data_5COX
# 
_entry.id   5COX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5COX         
WWPDB D_1000179684 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5COX 
_pdbx_database_status.recvd_initial_deposition_date   1996-12-18 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kurumbail, R.' 1 
'Stallings, W.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural basis for selective inhibition of cyclooxygenase-2 by anti-inflammatory agents.'         Nature 384 644 648 
1996 NATUAS UK 0028-0836 0006 ? 8967954 10.1038/384644a0 
1       'Erratum. Structural Basis for Selective Inhibition of Cyclooxygenase-2 by Anti-Inflammatory Agents' Nature 385 555 ?   
1997 NATUAS UK 0028-0836 0006 ? ?       ?                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kurumbail, R.G.' 1  ? 
primary 'Stevens, A.M.'   2  ? 
primary 'Gierse, J.K.'    3  ? 
primary 'McDonald, J.J.'  4  ? 
primary 'Stegeman, R.A.'  5  ? 
primary 'Pak, J.Y.'       6  ? 
primary 'Gildehaus, D.'   7  ? 
primary 'Miyashiro, J.M.' 8  ? 
primary 'Penning, T.D.'   9  ? 
primary 'Seibert, K.'     10 ? 
primary 'Isakson, P.C.'   11 ? 
primary 'Stallings, W.C.' 12 ? 
1       'Kurumbail, R.G.' 13 ? 
1       'Stevens, A.M.'   14 ? 
1       'Gierse, J.K.'    15 ? 
1       'Mcdonald, J.J.'  16 ? 
1       'Stegeman, R.A.'  17 ? 
1       'Pak, J.Y.'       18 ? 
1       'Gildehaus, D.'   19 ? 
1       'Miyashiro, J.M.' 20 ? 
1       'Penning, T.D.'   21 ? 
1       'Seibert, K.'     22 ? 
1       'Isakson, P.C.'   23 ? 
1       'Stallings, W.C.' 24 ? 
# 
_cell.entry_id           5COX 
_cell.length_a           180.460 
_cell.length_b           134.420 
_cell.length_c           119.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5COX 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man CYCLOOXYGENASE-2                         67318.719 4  1.14.99.1 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   12 ?         ? ? ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'        616.487   4  ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PROSTAGLANDIN SYNTHASE-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSL
IMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDP
QGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQV
EMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHQRVCDILKQEHPEWGDEQLFQTSKLILIGETIKIVIEDYVQH
LSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIA
GRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEK
PRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQDPQPTKTA
TINASASHSRLDDINPTVLIKRRSTEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSL
IMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDP
QGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQV
EMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHQRVCDILKQEHPEWGDEQLFQTSKLILIGETIKIVIEDYVQH
LSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIA
GRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEK
PRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQDPQPTKTA
TINASASHSRLDDINPTVLIKRRSTEL
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASN n 
1 3   PRO n 
1 4   CYS n 
1 5   CYS n 
1 6   SER n 
1 7   ASN n 
1 8   PRO n 
1 9   CYS n 
1 10  GLN n 
1 11  ASN n 
1 12  ARG n 
1 13  GLY n 
1 14  GLU n 
1 15  CYS n 
1 16  MET n 
1 17  SER n 
1 18  THR n 
1 19  GLY n 
1 20  PHE n 
1 21  ASP n 
1 22  GLN n 
1 23  TYR n 
1 24  LYS n 
1 25  CYS n 
1 26  ASP n 
1 27  CYS n 
1 28  THR n 
1 29  ARG n 
1 30  THR n 
1 31  GLY n 
1 32  PHE n 
1 33  TYR n 
1 34  GLY n 
1 35  GLU n 
1 36  ASN n 
1 37  CYS n 
1 38  THR n 
1 39  THR n 
1 40  PRO n 
1 41  GLU n 
1 42  PHE n 
1 43  LEU n 
1 44  THR n 
1 45  ARG n 
1 46  ILE n 
1 47  LYS n 
1 48  LEU n 
1 49  LEU n 
1 50  LEU n 
1 51  LYS n 
1 52  PRO n 
1 53  THR n 
1 54  PRO n 
1 55  ASN n 
1 56  THR n 
1 57  VAL n 
1 58  HIS n 
1 59  TYR n 
1 60  ILE n 
1 61  LEU n 
1 62  THR n 
1 63  HIS n 
1 64  PHE n 
1 65  LYS n 
1 66  GLY n 
1 67  VAL n 
1 68  TRP n 
1 69  ASN n 
1 70  ILE n 
1 71  VAL n 
1 72  ASN n 
1 73  ASN n 
1 74  ILE n 
1 75  PRO n 
1 76  PHE n 
1 77  LEU n 
1 78  ARG n 
1 79  SER n 
1 80  LEU n 
1 81  ILE n 
1 82  MET n 
1 83  LYS n 
1 84  TYR n 
1 85  VAL n 
1 86  LEU n 
1 87  THR n 
1 88  SER n 
1 89  ARG n 
1 90  SER n 
1 91  TYR n 
1 92  LEU n 
1 93  ILE n 
1 94  ASP n 
1 95  SER n 
1 96  PRO n 
1 97  PRO n 
1 98  THR n 
1 99  TYR n 
1 100 ASN n 
1 101 VAL n 
1 102 HIS n 
1 103 TYR n 
1 104 GLY n 
1 105 TYR n 
1 106 LYS n 
1 107 SER n 
1 108 TRP n 
1 109 GLU n 
1 110 ALA n 
1 111 PHE n 
1 112 SER n 
1 113 ASN n 
1 114 LEU n 
1 115 SER n 
1 116 TYR n 
1 117 TYR n 
1 118 THR n 
1 119 ARG n 
1 120 ALA n 
1 121 LEU n 
1 122 PRO n 
1 123 PRO n 
1 124 VAL n 
1 125 ALA n 
1 126 ASP n 
1 127 ASP n 
1 128 CYS n 
1 129 PRO n 
1 130 THR n 
1 131 PRO n 
1 132 MET n 
1 133 GLY n 
1 134 VAL n 
1 135 LYS n 
1 136 GLY n 
1 137 ASN n 
1 138 LYS n 
1 139 GLU n 
1 140 LEU n 
1 141 PRO n 
1 142 ASP n 
1 143 SER n 
1 144 LYS n 
1 145 GLU n 
1 146 VAL n 
1 147 LEU n 
1 148 GLU n 
1 149 LYS n 
1 150 VAL n 
1 151 LEU n 
1 152 LEU n 
1 153 ARG n 
1 154 ARG n 
1 155 GLU n 
1 156 PHE n 
1 157 ILE n 
1 158 PRO n 
1 159 ASP n 
1 160 PRO n 
1 161 GLN n 
1 162 GLY n 
1 163 SER n 
1 164 ASN n 
1 165 MET n 
1 166 MET n 
1 167 PHE n 
1 168 ALA n 
1 169 PHE n 
1 170 PHE n 
1 171 ALA n 
1 172 GLN n 
1 173 HIS n 
1 174 PHE n 
1 175 THR n 
1 176 HIS n 
1 177 GLN n 
1 178 PHE n 
1 179 PHE n 
1 180 LYS n 
1 181 THR n 
1 182 ASP n 
1 183 HIS n 
1 184 LYS n 
1 185 ARG n 
1 186 GLY n 
1 187 PRO n 
1 188 GLY n 
1 189 PHE n 
1 190 THR n 
1 191 ARG n 
1 192 GLY n 
1 193 LEU n 
1 194 GLY n 
1 195 HIS n 
1 196 GLY n 
1 197 VAL n 
1 198 ASP n 
1 199 LEU n 
1 200 ASN n 
1 201 HIS n 
1 202 ILE n 
1 203 TYR n 
1 204 GLY n 
1 205 GLU n 
1 206 THR n 
1 207 LEU n 
1 208 ASP n 
1 209 ARG n 
1 210 GLN n 
1 211 HIS n 
1 212 LYS n 
1 213 LEU n 
1 214 ARG n 
1 215 LEU n 
1 216 PHE n 
1 217 LYS n 
1 218 ASP n 
1 219 GLY n 
1 220 LYS n 
1 221 LEU n 
1 222 LYS n 
1 223 TYR n 
1 224 GLN n 
1 225 VAL n 
1 226 ILE n 
1 227 GLY n 
1 228 GLY n 
1 229 GLU n 
1 230 VAL n 
1 231 TYR n 
1 232 PRO n 
1 233 PRO n 
1 234 THR n 
1 235 VAL n 
1 236 LYS n 
1 237 ASP n 
1 238 THR n 
1 239 GLN n 
1 240 VAL n 
1 241 GLU n 
1 242 MET n 
1 243 ILE n 
1 244 TYR n 
1 245 PRO n 
1 246 PRO n 
1 247 HIS n 
1 248 ILE n 
1 249 PRO n 
1 250 GLU n 
1 251 ASN n 
1 252 LEU n 
1 253 GLN n 
1 254 PHE n 
1 255 ALA n 
1 256 VAL n 
1 257 GLY n 
1 258 GLN n 
1 259 GLU n 
1 260 VAL n 
1 261 PHE n 
1 262 GLY n 
1 263 LEU n 
1 264 VAL n 
1 265 PRO n 
1 266 GLY n 
1 267 LEU n 
1 268 MET n 
1 269 MET n 
1 270 TYR n 
1 271 ALA n 
1 272 THR n 
1 273 ILE n 
1 274 TRP n 
1 275 LEU n 
1 276 ARG n 
1 277 GLU n 
1 278 HIS n 
1 279 GLN n 
1 280 ARG n 
1 281 VAL n 
1 282 CYS n 
1 283 ASP n 
1 284 ILE n 
1 285 LEU n 
1 286 LYS n 
1 287 GLN n 
1 288 GLU n 
1 289 HIS n 
1 290 PRO n 
1 291 GLU n 
1 292 TRP n 
1 293 GLY n 
1 294 ASP n 
1 295 GLU n 
1 296 GLN n 
1 297 LEU n 
1 298 PHE n 
1 299 GLN n 
1 300 THR n 
1 301 SER n 
1 302 LYS n 
1 303 LEU n 
1 304 ILE n 
1 305 LEU n 
1 306 ILE n 
1 307 GLY n 
1 308 GLU n 
1 309 THR n 
1 310 ILE n 
1 311 LYS n 
1 312 ILE n 
1 313 VAL n 
1 314 ILE n 
1 315 GLU n 
1 316 ASP n 
1 317 TYR n 
1 318 VAL n 
1 319 GLN n 
1 320 HIS n 
1 321 LEU n 
1 322 SER n 
1 323 GLY n 
1 324 TYR n 
1 325 HIS n 
1 326 PHE n 
1 327 LYS n 
1 328 LEU n 
1 329 LYS n 
1 330 PHE n 
1 331 ASP n 
1 332 PRO n 
1 333 GLU n 
1 334 LEU n 
1 335 LEU n 
1 336 PHE n 
1 337 ASN n 
1 338 GLN n 
1 339 GLN n 
1 340 PHE n 
1 341 GLN n 
1 342 TYR n 
1 343 GLN n 
1 344 ASN n 
1 345 ARG n 
1 346 ILE n 
1 347 ALA n 
1 348 SER n 
1 349 GLU n 
1 350 PHE n 
1 351 ASN n 
1 352 THR n 
1 353 LEU n 
1 354 TYR n 
1 355 HIS n 
1 356 TRP n 
1 357 HIS n 
1 358 PRO n 
1 359 LEU n 
1 360 LEU n 
1 361 PRO n 
1 362 ASP n 
1 363 THR n 
1 364 PHE n 
1 365 ASN n 
1 366 ILE n 
1 367 GLU n 
1 368 ASP n 
1 369 GLN n 
1 370 GLU n 
1 371 TYR n 
1 372 SER n 
1 373 PHE n 
1 374 LYS n 
1 375 GLN n 
1 376 PHE n 
1 377 LEU n 
1 378 TYR n 
1 379 ASN n 
1 380 ASN n 
1 381 SER n 
1 382 ILE n 
1 383 LEU n 
1 384 LEU n 
1 385 GLU n 
1 386 HIS n 
1 387 GLY n 
1 388 LEU n 
1 389 THR n 
1 390 GLN n 
1 391 PHE n 
1 392 VAL n 
1 393 GLU n 
1 394 SER n 
1 395 PHE n 
1 396 THR n 
1 397 ARG n 
1 398 GLN n 
1 399 ILE n 
1 400 ALA n 
1 401 GLY n 
1 402 ARG n 
1 403 VAL n 
1 404 ALA n 
1 405 GLY n 
1 406 GLY n 
1 407 ARG n 
1 408 ASN n 
1 409 VAL n 
1 410 PRO n 
1 411 ILE n 
1 412 ALA n 
1 413 VAL n 
1 414 GLN n 
1 415 ALA n 
1 416 VAL n 
1 417 ALA n 
1 418 LYS n 
1 419 ALA n 
1 420 SER n 
1 421 ILE n 
1 422 ASP n 
1 423 GLN n 
1 424 SER n 
1 425 ARG n 
1 426 GLU n 
1 427 MET n 
1 428 LYS n 
1 429 TYR n 
1 430 GLN n 
1 431 SER n 
1 432 LEU n 
1 433 ASN n 
1 434 GLU n 
1 435 TYR n 
1 436 ARG n 
1 437 LYS n 
1 438 ARG n 
1 439 PHE n 
1 440 SER n 
1 441 LEU n 
1 442 LYS n 
1 443 PRO n 
1 444 TYR n 
1 445 THR n 
1 446 SER n 
1 447 PHE n 
1 448 GLU n 
1 449 GLU n 
1 450 LEU n 
1 451 THR n 
1 452 GLY n 
1 453 GLU n 
1 454 LYS n 
1 455 GLU n 
1 456 MET n 
1 457 ALA n 
1 458 ALA n 
1 459 GLU n 
1 460 LEU n 
1 461 LYS n 
1 462 ALA n 
1 463 LEU n 
1 464 TYR n 
1 465 SER n 
1 466 ASP n 
1 467 ILE n 
1 468 ASP n 
1 469 VAL n 
1 470 MET n 
1 471 GLU n 
1 472 LEU n 
1 473 TYR n 
1 474 PRO n 
1 475 ALA n 
1 476 LEU n 
1 477 LEU n 
1 478 VAL n 
1 479 GLU n 
1 480 LYS n 
1 481 PRO n 
1 482 ARG n 
1 483 PRO n 
1 484 ASP n 
1 485 ALA n 
1 486 ILE n 
1 487 PHE n 
1 488 GLY n 
1 489 GLU n 
1 490 THR n 
1 491 MET n 
1 492 VAL n 
1 493 GLU n 
1 494 LEU n 
1 495 GLY n 
1 496 ALA n 
1 497 PRO n 
1 498 PHE n 
1 499 SER n 
1 500 LEU n 
1 501 LYS n 
1 502 GLY n 
1 503 LEU n 
1 504 MET n 
1 505 GLY n 
1 506 ASN n 
1 507 PRO n 
1 508 ILE n 
1 509 CYS n 
1 510 SER n 
1 511 PRO n 
1 512 GLN n 
1 513 TYR n 
1 514 TRP n 
1 515 LYS n 
1 516 PRO n 
1 517 SER n 
1 518 THR n 
1 519 PHE n 
1 520 GLY n 
1 521 GLY n 
1 522 GLU n 
1 523 VAL n 
1 524 GLY n 
1 525 PHE n 
1 526 LYS n 
1 527 ILE n 
1 528 ILE n 
1 529 ASN n 
1 530 THR n 
1 531 ALA n 
1 532 SER n 
1 533 ILE n 
1 534 GLN n 
1 535 SER n 
1 536 LEU n 
1 537 ILE n 
1 538 CYS n 
1 539 ASN n 
1 540 ASN n 
1 541 VAL n 
1 542 LYS n 
1 543 GLY n 
1 544 CYS n 
1 545 PRO n 
1 546 PHE n 
1 547 THR n 
1 548 SER n 
1 549 PHE n 
1 550 ASN n 
1 551 VAL n 
1 552 GLN n 
1 553 ASP n 
1 554 PRO n 
1 555 GLN n 
1 556 PRO n 
1 557 THR n 
1 558 LYS n 
1 559 THR n 
1 560 ALA n 
1 561 THR n 
1 562 ILE n 
1 563 ASN n 
1 564 ALA n 
1 565 SER n 
1 566 ALA n 
1 567 SER n 
1 568 HIS n 
1 569 SER n 
1 570 ARG n 
1 571 LEU n 
1 572 ASP n 
1 573 ASP n 
1 574 ILE n 
1 575 ASN n 
1 576 PRO n 
1 577 THR n 
1 578 VAL n 
1 579 LEU n 
1 580 ILE n 
1 581 LYS n 
1 582 ARG n 
1 583 ARG n 
1 584 SER n 
1 585 THR n 
1 586 GLU n 
1 587 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    DERMAL 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 FIBROBLAST 
_entity_src_gen.pdbx_gene_src_cellular_location    'ENDOPLASMIC RETICULUM' 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               'OVARIAN TISSUE' 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'CULTURED SF21' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               PVL1393 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PGH2_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q05769 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MLFRAVLLCAALGLSQAANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTH
FKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDS
KEVLEKVLLRREFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY
QVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRL
ILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSIL
LEHGLTQFVESFTRQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKAL
YSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKG
CPFTSFNVQDPQPTKTATINASASHSRLDDINPTVLIKRRSTEL
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5COX A 1 ? 587 ? Q05769 18 ? 604 ? 33 618 
2 1 5COX B 1 ? 587 ? Q05769 18 ? 604 ? 33 618 
3 1 5COX C 1 ? 587 ? Q05769 18 ? 604 ? 33 618 
4 1 5COX D 1 ? 587 ? Q05769 18 ? 604 ? 33 618 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5COX GLN A 279 ? UNP Q05769 ASN 296 conflict 310 1 
1 5COX LYS A 302 ? UNP Q05769 ARG 319 conflict 333 2 
2 5COX GLN B 279 ? UNP Q05769 ASN 296 conflict 310 3 
2 5COX LYS B 302 ? UNP Q05769 ARG 319 conflict 333 4 
3 5COX GLN C 279 ? UNP Q05769 ASN 296 conflict 310 5 
3 5COX LYS C 302 ? UNP Q05769 ARG 319 conflict 333 6 
4 5COX GLN D 279 ? UNP Q05769 ASN 296 conflict 310 7 
4 5COX LYS D 302 ? UNP Q05769 ARG 319 conflict 333 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'          y ARGININE                                 ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'            y GLYCINE                                  ?    'C2 H5 N O2'       75.067  
HEM non-polymer                  . 'PROTOPORPHYRIN IX CONTAINING FE'        HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking'          y HISTIDINE                                ?    'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking'          y LYSINE                                   ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking'          y METHIONINE                               ?    'C5 H11 N O2 S'    149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ?    'C8 H15 N O6'      221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'          y PROLINE                                  ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking'          y SERINE                                   ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking'          y THREONINE                                ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'          y VALINE                                   ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          5COX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   52. 
_exptl_crystal.description           'PGHS-1 DIMER WAS USED AS THE SEARCH MODEL.' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;20 MM SODIUM PHOSPHATE, 100 MM NACL, 0.6% BETA-OCTYLGLUCOSIDE, 10 MG/ML PROTEIN MIXED WITH A RESERVOIR SOLUTION CONTAINING 20-34% MONOMETHYL PEG 550, 10-240 MGCL2, 50 MM EPPS PH 8.0 IN THE RATIO OF 1:1
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-03 
_diffrn_detector.details                'SUPPER MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     5COX 
_reflns.observed_criterion_sigma_I   -1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   52156 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89.2 
_reflns.pdbx_Rmerge_I_obs            0.097 
_reflns.pdbx_Rsym_value              0.097 
_reflns.pdbx_netI_over_sigmaI        7.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.6 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   76.8 
_reflns_shell.Rmerge_I_obs           0.289 
_reflns_shell.pdbx_Rsym_value        0.289 
_reflns_shell.meanI_over_sigI_obs    1.76 
_reflns_shell.pdbx_redundancy        1.95 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 5COX 
_refine.ls_number_reflns_obs                     41397 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               100000. 
_refine.pdbx_data_cutoff_low_absF                0.1 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    74.3 
_refine.ls_R_factor_obs                          0.321 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.321 
_refine.ls_R_factor_R_free                       0.308 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.47 
_refine.ls_number_reflns_R_free                  4161 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               11.3 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PROSTAGLANDIN SYNTHASE-1, PDB ENTRY 1PRH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        17892 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         340 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               18232 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.9   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.76  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            2.5   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_number 
1 RESTRAINED 300 ? 1.0 ? . . 1 'X-RAY DIFFRACTION' 1 ? 
2 ?          300 ? 1.0 ? . . 2 'X-RAY DIFFRACTION' 2 ? 
3 ?          300 ? 1.0 ? . . 3 'X-RAY DIFFRACTION' 3 ? 
4 ?          300 ? 1.0 ? . . 4 'X-RAY DIFFRACTION' 4 ? 
5 ?          300 ? 1.0 ? . . 5 'X-RAY DIFFRACTION' 5 ? 
6 ?          200 ? 2.0 ? . . 6 'X-RAY DIFFRACTION' 6 ? 
7 ?          50  ? 5.0 ? . . 7 'X-RAY DIFFRACTION' 7 ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.13 
_refine_ls_shell.number_reflns_R_work             2968 
_refine_ls_shell.R_factor_R_work                  0.269 
_refine_ls_shell.percent_reflns_obs               47.5 
_refine_ls_shell.R_factor_R_free                  0.368 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.3 
_refine_ls_shell.number_reflns_R_free             296 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM_ENGH.PRO    TOP_ENGH.PRO     'X-RAY DIFFRACTION' 
2 PARAM19X_MOD.HEME TOPH19X_MOD.HEME 'X-RAY DIFFRACTION' 
3 PARAM3_MOD.CHO    TOPH3.CHO        'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.999800 0.017200  -0.013700 0.013500  -0.011600 -0.999800 -0.017300 -0.999800 0.011300  94.84790  31.08800 32.21280 
2 given ? -0.998500 -0.047000 0.027900  0.048000  -0.998200 0.034600  0.026200  0.035900  0.999000  85.26010  65.02600 57.74280 
3 given ? 0.997400  -0.039900 0.060100  -0.061100 -0.023800 0.997900  -0.038400 -0.998900 -0.026200 -10.21210 39.60550 93.41290 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.details 
1 1 ? 
2 2 ? 
3 3 ? 
4 4 ? 
5 5 ? 
6 6 ? 
7 7 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
5 ? 
6 ? 
7 ? 
# 
_struct.entry_id                  5COX 
_struct.title                     'UNINHIBITED MOUSE CYCLOOXYGENASE-2 (PROSTAGLANDIN SYNTHASE-2)' 
_struct.pdbx_descriptor           'CYCLOOXYGENASE-2, PROTOPORPHYRIN IX CONTAINING FE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5COX 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;PEROXIDASE, DIOXYGENASE, CYCLOOXYGENASE, NONSTEROIDAL ANTIINFLAMMATORY DRUGS, INFLAMMATION, ARTHRITIS, PROSTAGLANDIN, PROSTAGLANDIN SYNTHASE, OXIDOREDUCTASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 3 ? 
M N N 2 ? 
N N N 2 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 2 ? 
R N N 2 ? 
S N N 2 ? 
T N N 3 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   PRO A 3   ? SER A 6   ? PRO A 35  SER A 38  5 ? 4  
HELX_P HELX_P2   2   PHE A 42  ? LEU A 50  ? PHE A 74  LEU A 82  1 ? 9  
HELX_P HELX_P3   3   PRO A 54  ? THR A 62  ? PRO A 86  THR A 94  1 ? 9  
HELX_P HELX_P4   4   LYS A 65  ? ASN A 73  ? LYS A 97  ASN A 105 1 ? 9  
HELX_P HELX_P5   5   PRO A 75  ? LEU A 92  ? PRO A 106 LEU A 123 1 ? 18 
HELX_P HELX_P6   6   TRP A 108 ? SER A 112 ? TRP A 139 SER A 143 1 ? 5  
HELX_P HELX_P7   7   SER A 143 ? VAL A 150 ? SER A 174 VAL A 181 1 ? 8  
HELX_P HELX_P8   8   MET A 165 ? PHE A 178 ? MET A 196 PHE A 209 1 ? 14 
HELX_P HELX_P9   9   ASN A 200 ? TYR A 203 ? ASN A 231 TYR A 234 1 ? 4  
HELX_P HELX_P10  10  LEU A 207 ? LEU A 213 ? LEU A 238 LEU A 244 1 ? 7  
HELX_P HELX_P11  11  VAL A 235 ? THR A 238 ? VAL A 266 THR A 269 1 ? 4  
HELX_P HELX_P12  12  GLU A 259 ? GLY A 262 ? GLU A 290 GLY A 293 5 ? 4  
HELX_P HELX_P13  13  PRO A 265 ? GLU A 288 ? PRO A 296 GLU A 319 1 ? 24 
HELX_P HELX_P14  14  ASP A 294 ? GLU A 315 ? ASP A 325 GLU A 346 1 ? 22 
HELX_P HELX_P15  15  TYR A 317 ? SER A 322 ? TYR A 348 SER A 353 1 ? 6  
HELX_P HELX_P16  16  PRO A 332 ? LEU A 335 ? PRO A 363 LEU A 366 5 ? 4  
HELX_P HELX_P17  17  SER A 348 ? LEU A 353 ? SER A 379 LEU A 384 1 ? 6  
HELX_P HELX_P18  18  HIS A 357 ? LEU A 359 ? HIS A 388 LEU A 390 5 ? 3  
HELX_P HELX_P19  19  PHE A 373 ? PHE A 376 ? PHE A 404 PHE A 407 1 ? 4  
HELX_P HELX_P20  20  ASN A 380 ? HIS A 386 ? ASN A 411 HIS A 417 1 ? 7  
HELX_P HELX_P21  21  THR A 389 ? THR A 396 ? THR A 420 THR A 427 1 ? 8  
HELX_P HELX_P22  22  GLN A 414 ? GLU A 426 ? GLN A 445 GLU A 457 1 ? 13 
HELX_P HELX_P23  23  LEU A 432 ? ARG A 438 ? LEU A 463 ARG A 469 1 ? 7  
HELX_P HELX_P24  24  PHE A 447 ? THR A 451 ? PHE A 478 THR A 482 1 ? 5  
HELX_P HELX_P25  25  GLU A 455 ? TYR A 464 ? GLU A 486 TYR A 495 1 ? 10 
HELX_P HELX_P26  26  ILE A 467 ? VAL A 469 ? ILE A 498 VAL A 500 5 ? 3  
HELX_P HELX_P27  27  TYR A 473 ? LEU A 477 ? TYR A 504 LEU A 508 1 ? 5  
HELX_P HELX_P28  28  GLU A 489 ? MET A 504 ? GLU A 520 MET A 535 1 ? 16 
HELX_P HELX_P29  29  PRO A 507 ? CYS A 509 ? PRO A 538 CYS A 540 5 ? 3  
HELX_P HELX_P30  30  PRO A 516 ? PHE A 519 ? PRO A 547 PHE A 550 5 ? 4  
HELX_P HELX_P31  31  VAL A 523 ? THR A 530 ? VAL A 554 THR A 561 1 ? 8  
HELX_P HELX_P32  32  ILE A 533 ? ASN A 540 ? ILE A 564 ASN A 571 1 ? 8  
HELX_P HELX_P33  33  PRO B 3   ? SER B 6   ? PRO B 35  SER B 38  5 ? 4  
HELX_P HELX_P34  34  PHE B 42  ? LEU B 50  ? PHE B 74  LEU B 82  1 ? 9  
HELX_P HELX_P35  35  PRO B 54  ? THR B 62  ? PRO B 86  THR B 94  1 ? 9  
HELX_P HELX_P36  36  LYS B 65  ? ASN B 73  ? LYS B 97  ASN B 105 1 ? 9  
HELX_P HELX_P37  37  PRO B 75  ? LEU B 92  ? PRO B 106 LEU B 123 1 ? 18 
HELX_P HELX_P38  38  TRP B 108 ? SER B 112 ? TRP B 139 SER B 143 1 ? 5  
HELX_P HELX_P39  39  SER B 143 ? VAL B 150 ? SER B 174 VAL B 181 1 ? 8  
HELX_P HELX_P40  40  MET B 165 ? PHE B 178 ? MET B 196 PHE B 209 1 ? 14 
HELX_P HELX_P41  41  ASN B 200 ? TYR B 203 ? ASN B 231 TYR B 234 1 ? 4  
HELX_P HELX_P42  42  LEU B 207 ? LEU B 213 ? LEU B 238 LEU B 244 1 ? 7  
HELX_P HELX_P43  43  VAL B 235 ? THR B 238 ? VAL B 266 THR B 269 1 ? 4  
HELX_P HELX_P44  44  GLU B 259 ? GLY B 262 ? GLU B 290 GLY B 293 5 ? 4  
HELX_P HELX_P45  45  PRO B 265 ? GLU B 288 ? PRO B 296 GLU B 319 1 ? 24 
HELX_P HELX_P46  46  ASP B 294 ? GLU B 315 ? ASP B 325 GLU B 346 1 ? 22 
HELX_P HELX_P47  47  TYR B 317 ? SER B 322 ? TYR B 348 SER B 353 1 ? 6  
HELX_P HELX_P48  48  PRO B 332 ? LEU B 335 ? PRO B 363 LEU B 366 5 ? 4  
HELX_P HELX_P49  49  SER B 348 ? LEU B 353 ? SER B 379 LEU B 384 1 ? 6  
HELX_P HELX_P50  50  HIS B 357 ? LEU B 359 ? HIS B 388 LEU B 390 5 ? 3  
HELX_P HELX_P51  51  PHE B 373 ? PHE B 376 ? PHE B 404 PHE B 407 1 ? 4  
HELX_P HELX_P52  52  ASN B 380 ? HIS B 386 ? ASN B 411 HIS B 417 1 ? 7  
HELX_P HELX_P53  53  THR B 389 ? THR B 396 ? THR B 420 THR B 427 1 ? 8  
HELX_P HELX_P54  54  GLN B 414 ? GLU B 426 ? GLN B 445 GLU B 457 1 ? 13 
HELX_P HELX_P55  55  LEU B 432 ? ARG B 438 ? LEU B 463 ARG B 469 1 ? 7  
HELX_P HELX_P56  56  PHE B 447 ? THR B 451 ? PHE B 478 THR B 482 1 ? 5  
HELX_P HELX_P57  57  GLU B 455 ? TYR B 464 ? GLU B 486 TYR B 495 1 ? 10 
HELX_P HELX_P58  58  ILE B 467 ? VAL B 469 ? ILE B 498 VAL B 500 5 ? 3  
HELX_P HELX_P59  59  TYR B 473 ? LEU B 477 ? TYR B 504 LEU B 508 1 ? 5  
HELX_P HELX_P60  60  GLU B 489 ? MET B 504 ? GLU B 520 MET B 535 1 ? 16 
HELX_P HELX_P61  61  PRO B 507 ? CYS B 509 ? PRO B 538 CYS B 540 5 ? 3  
HELX_P HELX_P62  62  PRO B 516 ? PHE B 519 ? PRO B 547 PHE B 550 5 ? 4  
HELX_P HELX_P63  63  VAL B 523 ? THR B 530 ? VAL B 554 THR B 561 1 ? 8  
HELX_P HELX_P64  64  ILE B 533 ? ASN B 540 ? ILE B 564 ASN B 571 1 ? 8  
HELX_P HELX_P65  65  PRO C 3   ? SER C 6   ? PRO C 35  SER C 38  5 ? 4  
HELX_P HELX_P66  66  PHE C 42  ? LEU C 50  ? PHE C 74  LEU C 82  1 ? 9  
HELX_P HELX_P67  67  PRO C 54  ? THR C 62  ? PRO C 86  THR C 94  1 ? 9  
HELX_P HELX_P68  68  LYS C 65  ? ASN C 73  ? LYS C 97  ASN C 105 1 ? 9  
HELX_P HELX_P69  69  PRO C 75  ? LEU C 92  ? PRO C 106 LEU C 123 1 ? 18 
HELX_P HELX_P70  70  TRP C 108 ? SER C 112 ? TRP C 139 SER C 143 1 ? 5  
HELX_P HELX_P71  71  SER C 143 ? VAL C 150 ? SER C 174 VAL C 181 1 ? 8  
HELX_P HELX_P72  72  MET C 165 ? PHE C 178 ? MET C 196 PHE C 209 1 ? 14 
HELX_P HELX_P73  73  ASN C 200 ? TYR C 203 ? ASN C 231 TYR C 234 1 ? 4  
HELX_P HELX_P74  74  LEU C 207 ? LEU C 213 ? LEU C 238 LEU C 244 1 ? 7  
HELX_P HELX_P75  75  VAL C 235 ? THR C 238 ? VAL C 266 THR C 269 1 ? 4  
HELX_P HELX_P76  76  GLU C 259 ? GLY C 262 ? GLU C 290 GLY C 293 5 ? 4  
HELX_P HELX_P77  77  PRO C 265 ? GLU C 288 ? PRO C 296 GLU C 319 1 ? 24 
HELX_P HELX_P78  78  ASP C 294 ? GLU C 315 ? ASP C 325 GLU C 346 1 ? 22 
HELX_P HELX_P79  79  TYR C 317 ? SER C 322 ? TYR C 348 SER C 353 1 ? 6  
HELX_P HELX_P80  80  PRO C 332 ? LEU C 335 ? PRO C 363 LEU C 366 5 ? 4  
HELX_P HELX_P81  81  SER C 348 ? LEU C 353 ? SER C 379 LEU C 384 1 ? 6  
HELX_P HELX_P82  82  HIS C 357 ? LEU C 359 ? HIS C 388 LEU C 390 5 ? 3  
HELX_P HELX_P83  83  PHE C 373 ? PHE C 376 ? PHE C 404 PHE C 407 1 ? 4  
HELX_P HELX_P84  84  ASN C 380 ? HIS C 386 ? ASN C 411 HIS C 417 1 ? 7  
HELX_P HELX_P85  85  THR C 389 ? THR C 396 ? THR C 420 THR C 427 1 ? 8  
HELX_P HELX_P86  86  GLN C 414 ? GLU C 426 ? GLN C 445 GLU C 457 1 ? 13 
HELX_P HELX_P87  87  LEU C 432 ? ARG C 438 ? LEU C 463 ARG C 469 1 ? 7  
HELX_P HELX_P88  88  PHE C 447 ? THR C 451 ? PHE C 478 THR C 482 1 ? 5  
HELX_P HELX_P89  89  GLU C 455 ? TYR C 464 ? GLU C 486 TYR C 495 1 ? 10 
HELX_P HELX_P90  90  ILE C 467 ? VAL C 469 ? ILE C 498 VAL C 500 5 ? 3  
HELX_P HELX_P91  91  TYR C 473 ? LEU C 477 ? TYR C 504 LEU C 508 1 ? 5  
HELX_P HELX_P92  92  GLU C 489 ? MET C 504 ? GLU C 520 MET C 535 1 ? 16 
HELX_P HELX_P93  93  PRO C 507 ? CYS C 509 ? PRO C 538 CYS C 540 5 ? 3  
HELX_P HELX_P94  94  PRO C 516 ? PHE C 519 ? PRO C 547 PHE C 550 5 ? 4  
HELX_P HELX_P95  95  VAL C 523 ? THR C 530 ? VAL C 554 THR C 561 1 ? 8  
HELX_P HELX_P96  96  ILE C 533 ? ASN C 540 ? ILE C 564 ASN C 571 1 ? 8  
HELX_P HELX_P97  97  PRO D 3   ? SER D 6   ? PRO D 35  SER D 38  5 ? 4  
HELX_P HELX_P98  98  PHE D 42  ? LEU D 50  ? PHE D 74  LEU D 82  1 ? 9  
HELX_P HELX_P99  99  PRO D 54  ? THR D 62  ? PRO D 86  THR D 94  1 ? 9  
HELX_P HELX_P100 100 LYS D 65  ? ASN D 73  ? LYS D 97  ASN D 105 1 ? 9  
HELX_P HELX_P101 101 PRO D 75  ? LEU D 92  ? PRO D 106 LEU D 123 1 ? 18 
HELX_P HELX_P102 102 TRP D 108 ? SER D 112 ? TRP D 139 SER D 143 1 ? 5  
HELX_P HELX_P103 103 SER D 143 ? VAL D 150 ? SER D 174 VAL D 181 1 ? 8  
HELX_P HELX_P104 104 MET D 165 ? PHE D 178 ? MET D 196 PHE D 209 1 ? 14 
HELX_P HELX_P105 105 ASN D 200 ? TYR D 203 ? ASN D 231 TYR D 234 1 ? 4  
HELX_P HELX_P106 106 LEU D 207 ? LEU D 213 ? LEU D 238 LEU D 244 1 ? 7  
HELX_P HELX_P107 107 VAL D 235 ? THR D 238 ? VAL D 266 THR D 269 1 ? 4  
HELX_P HELX_P108 108 GLU D 259 ? GLY D 262 ? GLU D 290 GLY D 293 5 ? 4  
HELX_P HELX_P109 109 PRO D 265 ? GLU D 288 ? PRO D 296 GLU D 319 1 ? 24 
HELX_P HELX_P110 110 ASP D 294 ? GLU D 315 ? ASP D 325 GLU D 346 1 ? 22 
HELX_P HELX_P111 111 TYR D 317 ? SER D 322 ? TYR D 348 SER D 353 1 ? 6  
HELX_P HELX_P112 112 PRO D 332 ? LEU D 335 ? PRO D 363 LEU D 366 5 ? 4  
HELX_P HELX_P113 113 SER D 348 ? LEU D 353 ? SER D 379 LEU D 384 1 ? 6  
HELX_P HELX_P114 114 HIS D 357 ? LEU D 359 ? HIS D 388 LEU D 390 5 ? 3  
HELX_P HELX_P115 115 PHE D 373 ? PHE D 376 ? PHE D 404 PHE D 407 1 ? 4  
HELX_P HELX_P116 116 ASN D 380 ? HIS D 386 ? ASN D 411 HIS D 417 1 ? 7  
HELX_P HELX_P117 117 THR D 389 ? THR D 396 ? THR D 420 THR D 427 1 ? 8  
HELX_P HELX_P118 118 ALA D 412 ? GLU D 426 ? ALA D 443 GLU D 457 5 ? 15 
HELX_P HELX_P119 119 LEU D 432 ? ARG D 438 ? LEU D 463 ARG D 469 1 ? 7  
HELX_P HELX_P120 120 PHE D 447 ? THR D 451 ? PHE D 478 THR D 482 1 ? 5  
HELX_P HELX_P121 121 GLU D 455 ? TYR D 464 ? GLU D 486 TYR D 495 1 ? 10 
HELX_P HELX_P122 122 ILE D 467 ? VAL D 469 ? ILE D 498 VAL D 500 5 ? 3  
HELX_P HELX_P123 123 TYR D 473 ? LEU D 477 ? TYR D 504 LEU D 508 1 ? 5  
HELX_P HELX_P124 124 GLU D 489 ? MET D 504 ? GLU D 520 MET D 535 1 ? 16 
HELX_P HELX_P125 125 PRO D 507 ? CYS D 509 ? PRO D 538 CYS D 540 5 ? 3  
HELX_P HELX_P126 126 PRO D 516 ? PHE D 519 ? PRO D 547 PHE D 550 5 ? 4  
HELX_P HELX_P127 127 VAL D 523 ? THR D 530 ? VAL D 554 THR D 561 1 ? 8  
HELX_P HELX_P128 128 ILE D 533 ? ASN D 540 ? ILE D 564 ASN D 571 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A CYS 4   SG  ? ? ? 1_555 A CYS 15  SG ? ? A CYS 36  A CYS 47  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf2  disulf ?   ? A CYS 5   SG  ? ? ? 1_555 A CYS 128 SG ? ? A CYS 37  A CYS 159 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf3  disulf ?   ? A CYS 9   SG  ? ? ? 1_555 A CYS 25  SG ? ? A CYS 41  A CYS 57  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf4  disulf ?   ? A CYS 27  SG  ? ? ? 1_555 A CYS 37  SG ? ? A CYS 59  A CYS 69  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf5  disulf ?   ? A CYS 538 SG  ? ? ? 1_555 A CYS 544 SG ? ? A CYS 569 A CYS 575 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf6  disulf ?   ? B CYS 4   SG  ? ? ? 1_555 B CYS 15  SG ? ? B CYS 36  B CYS 47  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf7  disulf ?   ? B CYS 5   SG  ? ? ? 1_555 B CYS 128 SG ? ? B CYS 37  B CYS 159 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf8  disulf ?   ? B CYS 9   SG  ? ? ? 1_555 B CYS 25  SG ? ? B CYS 41  B CYS 57  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf9  disulf ?   ? B CYS 27  SG  ? ? ? 1_555 B CYS 37  SG ? ? B CYS 59  B CYS 69  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf10 disulf ?   ? B CYS 538 SG  ? ? ? 1_555 B CYS 544 SG ? ? B CYS 569 B CYS 575 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf11 disulf ?   ? C CYS 4   SG  ? ? ? 1_555 C CYS 15  SG ? ? C CYS 36  C CYS 47  1_555 ? ? ? ? ? ? ? 2.020 ? ?               
disulf12 disulf ?   ? C CYS 5   SG  ? ? ? 1_555 C CYS 128 SG ? ? C CYS 37  C CYS 159 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf13 disulf ?   ? C CYS 9   SG  ? ? ? 1_555 C CYS 25  SG ? ? C CYS 41  C CYS 57  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf14 disulf ?   ? C CYS 27  SG  ? ? ? 1_555 C CYS 37  SG ? ? C CYS 59  C CYS 69  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf15 disulf ?   ? C CYS 538 SG  ? ? ? 1_555 C CYS 544 SG ? ? C CYS 569 C CYS 575 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf16 disulf ?   ? D CYS 4   SG  ? ? ? 1_555 D CYS 15  SG ? ? D CYS 36  D CYS 47  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf17 disulf ?   ? D CYS 5   SG  ? ? ? 1_555 D CYS 128 SG ? ? D CYS 37  D CYS 159 1_555 ? ? ? ? ? ? ? 2.019 ? ?               
disulf18 disulf ?   ? D CYS 9   SG  ? ? ? 1_555 D CYS 25  SG ? ? D CYS 41  D CYS 57  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf19 disulf ?   ? D CYS 27  SG  ? ? ? 1_555 D CYS 37  SG ? ? D CYS 59  D CYS 69  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf20 disulf ?   ? D CYS 538 SG  ? ? ? 1_555 D CYS 544 SG ? ? D CYS 569 D CYS 575 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
covale1  covale one ? A ASN 36  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 68  A NAG 661 1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation 
covale2  covale one ? A ASN 113 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 144 A NAG 671 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale3  covale one ? A ASN 379 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 410 A NAG 681 1_555 ? ? ? ? ? ? ? 1.471 ? N-Glycosylation 
covale4  covale one ? B ASN 36  ND2 ? ? ? 1_555 I NAG .   C1 ? ? B ASN 68  B NAG 661 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale5  covale one ? B ASN 113 ND2 ? ? ? 1_555 J NAG .   C1 ? ? B ASN 144 B NAG 671 1_555 ? ? ? ? ? ? ? 1.472 ? N-Glycosylation 
covale6  covale one ? B ASN 379 ND2 ? ? ? 1_555 K NAG .   C1 ? ? B ASN 410 B NAG 681 1_555 ? ? ? ? ? ? ? 1.429 ? N-Glycosylation 
covale7  covale one ? C ASN 36  ND2 ? ? ? 1_555 M NAG .   C1 ? ? C ASN 68  C NAG 661 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale8  covale one ? C ASN 113 ND2 ? ? ? 1_555 N NAG .   C1 ? ? C ASN 144 C NAG 671 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale9  covale one ? C ASN 379 ND2 ? ? ? 1_555 O NAG .   C1 ? ? C ASN 410 C NAG 681 1_555 ? ? ? ? ? ? ? 1.467 ? N-Glycosylation 
covale10 covale one ? D ASN 36  ND2 ? ? ? 1_555 Q NAG .   C1 ? ? D ASN 68  D NAG 661 1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation 
covale11 covale one ? D ASN 113 ND2 ? ? ? 1_555 R NAG .   C1 ? ? D ASN 144 D NAG 671 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale12 covale one ? D ASN 379 ND2 ? ? ? 1_555 S NAG .   C1 ? ? D ASN 410 D NAG 681 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
metalc1  metalc ?   ? A HIS 357 NE2 ? ? ? 1_555 H HEM .   FE ? ? A HIS 388 A HEM 682 1_555 ? ? ? ? ? ? ? 2.183 ? ?               
metalc2  metalc ?   ? B HIS 357 NE2 ? ? ? 1_555 L HEM .   FE ? ? B HIS 388 B HEM 682 1_555 ? ? ? ? ? ? ? 2.249 ? ?               
metalc3  metalc ?   ? C HIS 357 NE2 ? ? ? 1_555 P HEM .   FE ? ? C HIS 388 C HEM 682 1_555 ? ? ? ? ? ? ? 2.176 ? ?               
metalc4  metalc ?   ? D HIS 357 NE2 ? ? ? 1_555 T HEM .   FE ? ? D HIS 388 D HEM 682 1_555 ? ? ? ? ? ? ? 2.213 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 95 A . ? SER 126 A PRO 96 A ? PRO 127 A 1 0.10  
2 SER 95 B . ? SER 126 B PRO 96 B ? PRO 127 B 1 -0.14 
3 SER 95 C . ? SER 126 C PRO 96 C ? PRO 127 C 1 0.05  
4 SER 95 D . ? SER 126 D PRO 96 D ? PRO 127 D 1 0.09  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 15  ? SER A 17  ? CYS A 47  SER A 49  
A 2 TYR A 23  ? CYS A 25  ? TYR A 55  CYS A 57  
B 1 GLN A 224 ? ILE A 226 ? GLN A 255 ILE A 257 
B 2 GLU A 229 ? TYR A 231 ? GLU A 260 TYR A 262 
C 1 CYS B 15  ? SER B 17  ? CYS B 47  SER B 49  
C 2 TYR B 23  ? CYS B 25  ? TYR B 55  CYS B 57  
D 1 GLN B 224 ? ILE B 226 ? GLN B 255 ILE B 257 
D 2 GLU B 229 ? TYR B 231 ? GLU B 260 TYR B 262 
E 1 PHE B 364 ? ILE B 366 ? PHE B 395 ILE B 397 
E 2 GLN B 369 ? TYR B 371 ? GLN B 400 TYR B 402 
F 1 CYS C 15  ? SER C 17  ? CYS C 47  SER C 49  
F 2 TYR C 23  ? CYS C 25  ? TYR C 55  CYS C 57  
G 1 GLN C 224 ? ILE C 226 ? GLN C 255 ILE C 257 
G 2 GLU C 229 ? TYR C 231 ? GLU C 260 TYR C 262 
H 1 CYS D 15  ? SER D 17  ? CYS D 47  SER D 49  
H 2 TYR D 23  ? CYS D 25  ? TYR D 55  CYS D 57  
I 1 GLN D 224 ? ILE D 226 ? GLN D 255 ILE D 257 
I 2 GLU D 229 ? TYR D 231 ? GLU D 260 TYR D 262 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MET A 16  ? O MET A 48  N LYS A 24  ? N LYS A 56  
B 1 2 O GLN A 224 ? O GLN A 255 N TYR A 231 ? N TYR A 262 
C 1 2 O MET B 16  ? O MET B 48  N LYS B 24  ? N LYS B 56  
D 1 2 O GLN B 224 ? O GLN B 255 N TYR B 231 ? N TYR B 262 
E 1 2 O PHE B 364 ? O PHE B 395 N TYR B 371 ? N TYR B 402 
F 1 2 O MET C 16  ? O MET C 48  N LYS C 24  ? N LYS C 56  
G 1 2 O GLN C 224 ? O GLN C 255 N TYR C 231 ? N TYR C 262 
H 1 2 O MET D 16  ? O MET D 48  N LYS D 24  ? N LYS D 56  
I 1 2 O GLN D 224 ? O GLN D 255 N TYR D 231 ? N TYR D 262 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
CAT Unknown ? ? ? ? 1 
;TYR 385 IS BELIEVED TO BE THE AMINO ACID THAT ABSTRACTS A HYDROGEN ATOM FROM THE SUBSTRATE. IT IS LOCATED CLOSE TO THE HEME. A TYROSINE RADICAL IS FORMED DURING THE COURSE OF THE REACTION.
;
ACE Unknown ? ? ? ? 1 
;SER 530 IS ACETYLATED BY ASPIRIN (AN ACETYL GROUP IS COVALENTLY ATTACHED TO THE PROTEIN WHEN INHIBITED WITH ASPIRIN). THE ACETYLATED SER PREVENTS THE PROPER BINDING OF THE SUBSTRATE IN THE CYCLOOXYGENASE ACTIVE SITE. IT HAS BEEN RECENTLY SHOWN, HOWEVER, THAT ACETYLATION OF CYCLOOXYGENASE-2 RESULTS IN THE FORMATION OF A DIFFERENT PRODUCT (15-HETE).
;
HEM Unknown ? ? ? ? 1 'HIS 388 IS THE AXIAL LIGAND TO THE HEME.' 
SUB Unknown ? ? ? ? 1 'ARGININE 120 IS BELIEVED TO ANCHOR THE CARBOXYLATE OF THE SUBSTRATE BY FORMING AN ION-PAIR.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 1 TYR A 354 ? TYR A 385 . ? 1_555 ? 
2 ACE 1 SER A 499 ? SER A 530 . ? 1_555 ? 
3 HEM 1 HIS A 357 ? HIS A 388 . ? 1_555 ? 
4 SUB 1 ARG A 89  ? ARG A 120 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5COX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5COX 
_atom_sites.fract_transf_matrix[1][1]   0.005541 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007439 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008340 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ALA A 1 1   ? 29.852  7.372   -18.021 1.00 18.29 ? 33  ALA A N   1 
ATOM   2     C  CA  . ALA A 1 1   ? 30.345  6.109   -18.648 1.00 19.62 ? 33  ALA A CA  1 
ATOM   3     C  C   . ALA A 1 1   ? 31.330  5.523   -17.659 1.00 20.69 ? 33  ALA A C   1 
ATOM   4     O  O   . ALA A 1 1   ? 31.446  4.290   -17.533 1.00 22.76 ? 33  ALA A O   1 
ATOM   5     C  CB  . ALA A 1 1   ? 31.028  6.362   -20.009 1.00 17.14 ? 33  ALA A CB  1 
ATOM   6     N  N   . ASN A 1 2   ? 32.025  6.421   -16.956 1.00 17.69 ? 34  ASN A N   1 
ATOM   7     C  CA  . ASN A 1 2   ? 32.999  6.036   -15.945 1.00 16.34 ? 34  ASN A CA  1 
ATOM   8     C  C   . ASN A 1 2   ? 32.298  5.079   -14.974 1.00 16.17 ? 34  ASN A C   1 
ATOM   9     O  O   . ASN A 1 2   ? 31.237  5.405   -14.436 1.00 15.62 ? 34  ASN A O   1 
ATOM   10    C  CB  . ASN A 1 2   ? 33.533  7.308   -15.246 1.00 13.79 ? 34  ASN A CB  1 
ATOM   11    C  CG  . ASN A 1 2   ? 33.934  7.089   -13.782 1.00 14.18 ? 34  ASN A CG  1 
ATOM   12    O  OD1 . ASN A 1 2   ? 34.295  6.001   -13.359 1.00 14.01 ? 34  ASN A OD1 1 
ATOM   13    N  ND2 . ASN A 1 2   ? 33.873  8.147   -13.010 1.00 13.51 ? 34  ASN A ND2 1 
ATOM   14    N  N   . PRO A 1 3   ? 32.844  3.860   -14.810 1.00 15.13 ? 35  PRO A N   1 
ATOM   15    C  CA  . PRO A 1 3   ? 32.306  2.835   -13.925 1.00 16.11 ? 35  PRO A CA  1 
ATOM   16    C  C   . PRO A 1 3   ? 32.028  3.352   -12.531 1.00 16.45 ? 35  PRO A C   1 
ATOM   17    O  O   . PRO A 1 3   ? 31.118  2.864   -11.845 1.00 19.34 ? 35  PRO A O   1 
ATOM   18    C  CB  . PRO A 1 3   ? 33.406  1.762   -13.930 1.00 16.02 ? 35  PRO A CB  1 
ATOM   19    C  CG  . PRO A 1 3   ? 34.626  2.481   -14.383 1.00 14.07 ? 35  PRO A CG  1 
ATOM   20    C  CD  . PRO A 1 3   ? 34.063  3.362   -15.457 1.00 15.08 ? 35  PRO A CD  1 
ATOM   21    N  N   . CYS A 1 4   ? 32.820  4.313   -12.082 1.00 12.74 ? 36  CYS A N   1 
ATOM   22    C  CA  . CYS A 1 4   ? 32.569  4.860   -10.771 1.00 13.54 ? 36  CYS A CA  1 
ATOM   23    C  C   . CYS A 1 4   ? 31.270  5.657   -10.673 1.00 13.49 ? 36  CYS A C   1 
ATOM   24    O  O   . CYS A 1 4   ? 30.759  5.844   -9.561  1.00 13.53 ? 36  CYS A O   1 
ATOM   25    C  CB  . CYS A 1 4   ? 33.733  5.692   -10.312 1.00 13.24 ? 36  CYS A CB  1 
ATOM   26    S  SG  . CYS A 1 4   ? 35.093  4.617   -9.865  1.00 11.08 ? 36  CYS A SG  1 
ATOM   27    N  N   . CYS A 1 5   ? 30.740  6.091   -11.832 1.00 10.76 ? 37  CYS A N   1 
ATOM   28    C  CA  . CYS A 1 5   ? 29.501  6.866   -11.950 1.00 5.59  ? 37  CYS A CA  1 
ATOM   29    C  C   . CYS A 1 5   ? 28.434  6.454   -10.940 1.00 8.21  ? 37  CYS A C   1 
ATOM   30    O  O   . CYS A 1 5   ? 27.854  7.316   -10.277 1.00 9.23  ? 37  CYS A O   1 
ATOM   31    C  CB  . CYS A 1 5   ? 28.911  6.687   -13.333 1.00 3.90  ? 37  CYS A CB  1 
ATOM   32    S  SG  . CYS A 1 5   ? 29.532  7.791   -14.614 1.00 2.01  ? 37  CYS A SG  1 
ATOM   33    N  N   . SER A 1 6   ? 28.204  5.148   -10.782 1.00 4.91  ? 38  SER A N   1 
ATOM   34    C  CA  . SER A 1 6   ? 27.184  4.677   -9.874  1.00 2.00  ? 38  SER A CA  1 
ATOM   35    C  C   . SER A 1 6   ? 27.547  4.707   -8.409  1.00 2.02  ? 38  SER A C   1 
ATOM   36    O  O   . SER A 1 6   ? 26.902  4.064   -7.603  1.00 2.00  ? 38  SER A O   1 
ATOM   37    C  CB  . SER A 1 6   ? 26.788  3.292   -10.276 1.00 2.00  ? 38  SER A CB  1 
ATOM   38    O  OG  . SER A 1 6   ? 27.916  2.482   -10.285 1.00 2.67  ? 38  SER A OG  1 
ATOM   39    N  N   . ASN A 1 7   ? 28.608  5.416   -8.057  1.00 3.66  ? 39  ASN A N   1 
ATOM   40    C  CA  . ASN A 1 7   ? 29.044  5.521   -6.655  1.00 5.94  ? 39  ASN A CA  1 
ATOM   41    C  C   . ASN A 1 7   ? 29.085  4.167   -5.910  1.00 6.69  ? 39  ASN A C   1 
ATOM   42    O  O   . ASN A 1 7   ? 28.742  4.092   -4.720  1.00 9.12  ? 39  ASN A O   1 
ATOM   43    C  CB  . ASN A 1 7   ? 28.096  6.465   -5.919  1.00 5.62  ? 39  ASN A CB  1 
ATOM   44    C  CG  . ASN A 1 7   ? 28.177  7.885   -6.426  1.00 7.80  ? 39  ASN A CG  1 
ATOM   45    O  OD1 . ASN A 1 7   ? 28.260  8.805   -5.624  1.00 13.40 ? 39  ASN A OD1 1 
ATOM   46    N  ND2 . ASN A 1 7   ? 28.153  8.079   -7.749  1.00 3.28  ? 39  ASN A ND2 1 
ATOM   47    N  N   . PRO A 1 8   ? 29.632  3.116   -6.556  1.00 5.64  ? 40  PRO A N   1 
ATOM   48    C  CA  . PRO A 1 8   ? 29.708  1.773   -5.967  1.00 3.86  ? 40  PRO A CA  1 
ATOM   49    C  C   . PRO A 1 8   ? 30.366  1.621   -4.608  1.00 5.10  ? 40  PRO A C   1 
ATOM   50    O  O   . PRO A 1 8   ? 29.927  0.852   -3.765  1.00 2.00  ? 40  PRO A O   1 
ATOM   51    C  CB  . PRO A 1 8   ? 30.489  0.991   -7.008  1.00 2.00  ? 40  PRO A CB  1 
ATOM   52    C  CG  . PRO A 1 8   ? 30.350  1.774   -8.270  1.00 3.28  ? 40  PRO A CG  1 
ATOM   53    C  CD  . PRO A 1 8   ? 30.427  3.173   -7.797  1.00 4.84  ? 40  PRO A CD  1 
ATOM   54    N  N   . CYS A 1 9   ? 31.420  2.383   -4.391  1.00 9.56  ? 41  CYS A N   1 
ATOM   55    C  CA  . CYS A 1 9   ? 32.185  2.263   -3.159  1.00 11.07 ? 41  CYS A CA  1 
ATOM   56    C  C   . CYS A 1 9   ? 31.552  2.790   -1.890  1.00 11.41 ? 41  CYS A C   1 
ATOM   57    O  O   . CYS A 1 9   ? 31.514  3.973   -1.596  1.00 12.04 ? 41  CYS A O   1 
ATOM   58    C  CB  . CYS A 1 9   ? 33.606  2.765   -3.406  1.00 10.47 ? 41  CYS A CB  1 
ATOM   59    S  SG  . CYS A 1 9   ? 34.272  2.027   -4.968  1.00 4.03  ? 41  CYS A SG  1 
ATOM   60    N  N   . GLN A 1 10  ? 30.979  1.856   -1.167  1.00 14.26 ? 42  GLN A N   1 
ATOM   61    C  CA  . GLN A 1 10  ? 30.305  2.156   0.076   1.00 16.84 ? 42  GLN A CA  1 
ATOM   62    C  C   . GLN A 1 10  ? 31.280  2.397   1.208   1.00 12.36 ? 42  GLN A C   1 
ATOM   63    O  O   . GLN A 1 10  ? 32.475  2.422   1.005   1.00 9.25  ? 42  GLN A O   1 
ATOM   64    C  CB  . GLN A 1 10  ? 29.322  1.018   0.430   1.00 17.38 ? 42  GLN A CB  1 
ATOM   65    C  CG  . GLN A 1 10  ? 27.845  1.447   0.330   1.00 21.39 ? 42  GLN A CG  1 
ATOM   66    C  CD  . GLN A 1 10  ? 27.446  1.995   -1.055  1.00 21.33 ? 42  GLN A CD  1 
ATOM   67    O  OE1 . GLN A 1 10  ? 26.758  1.318   -1.817  1.00 24.97 ? 42  GLN A OE1 1 
ATOM   68    N  NE2 . GLN A 1 10  ? 27.832  3.235   -1.356  1.00 21.58 ? 42  GLN A NE2 1 
ATOM   69    N  N   . ASN A 1 11  ? 30.730  2.710   2.367   1.00 11.44 ? 43  ASN A N   1 
ATOM   70    C  CA  . ASN A 1 11  ? 31.502  2.923   3.567   1.00 11.84 ? 43  ASN A CA  1 
ATOM   71    C  C   . ASN A 1 11  ? 32.695  3.844   3.565   1.00 12.04 ? 43  ASN A C   1 
ATOM   72    O  O   . ASN A 1 11  ? 33.643  3.612   4.319   1.00 13.53 ? 43  ASN A O   1 
ATOM   73    C  CB  . ASN A 1 11  ? 31.919  1.588   4.148   1.00 14.97 ? 43  ASN A CB  1 
ATOM   74    C  CG  . ASN A 1 11  ? 30.870  1.022   5.068   1.00 17.26 ? 43  ASN A CG  1 
ATOM   75    O  OD1 . ASN A 1 11  ? 30.329  1.735   5.924   1.00 16.18 ? 43  ASN A OD1 1 
ATOM   76    N  ND2 . ASN A 1 11  ? 30.557  -0.259  4.897   1.00 18.78 ? 43  ASN A ND2 1 
ATOM   77    N  N   . ARG A 1 12  ? 32.637  4.905   2.763   1.00 9.54  ? 44  ARG A N   1 
ATOM   78    C  CA  . ARG A 1 12  ? 33.714  5.885   2.703   1.00 6.21  ? 44  ARG A CA  1 
ATOM   79    C  C   . ARG A 1 12  ? 34.981  5.411   1.949   1.00 5.34  ? 44  ARG A C   1 
ATOM   80    O  O   . ARG A 1 12  ? 36.032  6.022   2.052   1.00 5.23  ? 44  ARG A O   1 
ATOM   81    C  CB  . ARG A 1 12  ? 34.046  6.330   4.127   1.00 2.09  ? 44  ARG A CB  1 
ATOM   82    C  CG  . ARG A 1 12  ? 34.264  7.800   4.292   1.00 4.04  ? 44  ARG A CG  1 
ATOM   83    C  CD  . ARG A 1 12  ? 33.775  8.264   5.661   1.00 4.33  ? 44  ARG A CD  1 
ATOM   84    N  NE  . ARG A 1 12  ? 34.507  9.387   6.259   1.00 2.34  ? 44  ARG A NE  1 
ATOM   85    C  CZ  . ARG A 1 12  ? 35.058  10.403  5.599   1.00 4.66  ? 44  ARG A CZ  1 
ATOM   86    N  NH1 . ARG A 1 12  ? 34.993  10.501  4.268   1.00 3.67  ? 44  ARG A NH1 1 
ATOM   87    N  NH2 . ARG A 1 12  ? 35.679  11.339  6.295   1.00 3.76  ? 44  ARG A NH2 1 
ATOM   88    N  N   . GLY A 1 13  ? 34.870  4.332   1.183   1.00 5.86  ? 45  GLY A N   1 
ATOM   89    C  CA  . GLY A 1 13  ? 36.004  3.830   0.431   1.00 5.00  ? 45  GLY A CA  1 
ATOM   90    C  C   . GLY A 1 13  ? 36.124  4.674   -0.804  1.00 5.29  ? 45  GLY A C   1 
ATOM   91    O  O   . GLY A 1 13  ? 35.270  5.506   -1.012  1.00 3.82  ? 45  GLY A O   1 
ATOM   92    N  N   . GLU A 1 14  ? 37.150  4.465   -1.627  1.00 8.43  ? 46  GLU A N   1 
ATOM   93    C  CA  . GLU A 1 14  ? 37.347  5.282   -2.835  1.00 9.79  ? 46  GLU A CA  1 
ATOM   94    C  C   . GLU A 1 14  ? 37.296  4.536   -4.155  1.00 7.65  ? 46  GLU A C   1 
ATOM   95    O  O   . GLU A 1 14  ? 38.091  3.641   -4.438  1.00 4.28  ? 46  GLU A O   1 
ATOM   96    C  CB  . GLU A 1 14  ? 38.655  6.066   -2.751  1.00 14.32 ? 46  GLU A CB  1 
ATOM   97    C  CG  . GLU A 1 14  ? 38.819  6.834   -1.453  1.00 22.29 ? 46  GLU A CG  1 
ATOM   98    C  CD  . GLU A 1 14  ? 39.805  7.980   -1.557  1.00 28.52 ? 46  GLU A CD  1 
ATOM   99    O  OE1 . GLU A 1 14  ? 40.674  7.978   -2.462  1.00 31.36 ? 46  GLU A OE1 1 
ATOM   100   O  OE2 . GLU A 1 14  ? 39.698  8.911   -0.729  1.00 31.55 ? 46  GLU A OE2 1 
ATOM   101   N  N   . CYS A 1 15  ? 36.398  4.969   -5.010  1.00 9.14  ? 47  CYS A N   1 
ATOM   102   C  CA  . CYS A 1 15  ? 36.231  4.305   -6.286  1.00 11.62 ? 47  CYS A CA  1 
ATOM   103   C  C   . CYS A 1 15  ? 37.243  4.793   -7.289  1.00 12.78 ? 47  CYS A C   1 
ATOM   104   O  O   . CYS A 1 15  ? 37.441  5.991   -7.446  1.00 16.62 ? 47  CYS A O   1 
ATOM   105   C  CB  . CYS A 1 15  ? 34.816  4.552   -6.824  1.00 11.79 ? 47  CYS A CB  1 
ATOM   106   S  SG  . CYS A 1 15  ? 34.383  3.570   -8.275  1.00 11.75 ? 47  CYS A SG  1 
ATOM   107   N  N   . MET A 1 16  ? 37.896  3.874   -7.971  1.00 11.22 ? 48  MET A N   1 
ATOM   108   C  CA  . MET A 1 16  ? 38.837  4.265   -9.001  1.00 10.99 ? 48  MET A CA  1 
ATOM   109   C  C   . MET A 1 16  ? 38.523  3.437   -10.238 1.00 8.00  ? 48  MET A C   1 
ATOM   110   O  O   . MET A 1 16  ? 38.303  2.229   -10.150 1.00 3.58  ? 48  MET A O   1 
ATOM   111   C  CB  . MET A 1 16  ? 40.302  4.076   -8.541  1.00 17.15 ? 48  MET A CB  1 
ATOM   112   C  CG  . MET A 1 16  ? 40.937  2.680   -8.803  1.00 22.99 ? 48  MET A CG  1 
ATOM   113   S  SD  . MET A 1 16  ? 42.508  2.773   -9.713  1.00 21.09 ? 48  MET A SD  1 
ATOM   114   C  CE  . MET A 1 16  ? 43.335  3.962   -8.617  1.00 24.96 ? 48  MET A CE  1 
ATOM   115   N  N   . SER A 1 17  ? 38.419  4.106   -11.374 1.00 8.22  ? 49  SER A N   1 
ATOM   116   C  CA  . SER A 1 17  ? 38.142  3.415   -12.626 1.00 9.98  ? 49  SER A CA  1 
ATOM   117   C  C   . SER A 1 17  ? 39.348  2.522   -12.946 1.00 10.46 ? 49  SER A C   1 
ATOM   118   O  O   . SER A 1 17  ? 40.488  2.845   -12.603 1.00 13.32 ? 49  SER A O   1 
ATOM   119   C  CB  . SER A 1 17  ? 37.919  4.426   -13.759 1.00 9.94  ? 49  SER A CB  1 
ATOM   120   O  OG  . SER A 1 17  ? 38.873  5.471   -13.712 1.00 13.61 ? 49  SER A OG  1 
ATOM   121   N  N   . THR A 1 18  ? 39.117  1.373   -13.556 1.00 8.34  ? 50  THR A N   1 
ATOM   122   C  CA  . THR A 1 18  ? 40.229  0.528   -13.896 1.00 5.63  ? 50  THR A CA  1 
ATOM   123   C  C   . THR A 1 18  ? 40.072  -0.127  -15.262 1.00 3.66  ? 50  THR A C   1 
ATOM   124   O  O   . THR A 1 18  ? 40.280  -1.321  -15.414 1.00 2.00  ? 50  THR A O   1 
ATOM   125   C  CB  . THR A 1 18  ? 40.503  -0.514  -12.787 1.00 8.06  ? 50  THR A CB  1 
ATOM   126   O  OG1 . THR A 1 18  ? 39.409  -1.433  -12.688 1.00 9.86  ? 50  THR A OG1 1 
ATOM   127   C  CG2 . THR A 1 18  ? 40.706  0.170   -11.436 1.00 8.39  ? 50  THR A CG2 1 
ATOM   128   N  N   . GLY A 1 19  ? 39.637  0.643   -16.246 1.00 4.25  ? 51  GLY A N   1 
ATOM   129   C  CA  . GLY A 1 19  ? 39.513  0.088   -17.573 1.00 7.75  ? 51  GLY A CA  1 
ATOM   130   C  C   . GLY A 1 19  ? 38.201  0.279   -18.287 1.00 12.37 ? 51  GLY A C   1 
ATOM   131   O  O   . GLY A 1 19  ? 37.636  -0.682  -18.791 1.00 17.43 ? 51  GLY A O   1 
ATOM   132   N  N   . PHE A 1 20  ? 37.667  1.489   -18.287 1.00 13.77 ? 52  PHE A N   1 
ATOM   133   C  CA  . PHE A 1 20  ? 36.425  1.769   -18.995 1.00 16.45 ? 52  PHE A CA  1 
ATOM   134   C  C   . PHE A 1 20  ? 35.149  1.253   -18.329 1.00 20.58 ? 52  PHE A C   1 
ATOM   135   O  O   . PHE A 1 20  ? 34.224  2.044   -18.034 1.00 23.69 ? 52  PHE A O   1 
ATOM   136   C  CB  . PHE A 1 20  ? 36.467  1.198   -20.412 1.00 10.95 ? 52  PHE A CB  1 
ATOM   137   C  CG  . PHE A 1 20  ? 37.542  1.761   -21.265 1.00 7.68  ? 52  PHE A CG  1 
ATOM   138   C  CD1 . PHE A 1 20  ? 37.490  3.090   -21.681 1.00 8.24  ? 52  PHE A CD1 1 
ATOM   139   C  CD2 . PHE A 1 20  ? 38.542  0.936   -21.767 1.00 5.70  ? 52  PHE A CD2 1 
ATOM   140   C  CE1 . PHE A 1 20  ? 38.424  3.603   -22.614 1.00 8.34  ? 52  PHE A CE1 1 
ATOM   141   C  CE2 . PHE A 1 20  ? 39.471  1.416   -22.689 1.00 8.07  ? 52  PHE A CE2 1 
ATOM   142   C  CZ  . PHE A 1 20  ? 39.411  2.758   -23.121 1.00 9.54  ? 52  PHE A CZ  1 
ATOM   143   N  N   . ASP A 1 21  ? 35.056  -0.068  -18.176 1.00 19.76 ? 53  ASP A N   1 
ATOM   144   C  CA  . ASP A 1 21  ? 33.869  -0.657  -17.593 1.00 18.03 ? 53  ASP A CA  1 
ATOM   145   C  C   . ASP A 1 21  ? 34.055  -1.105  -16.167 1.00 16.16 ? 53  ASP A C   1 
ATOM   146   O  O   . ASP A 1 21  ? 33.109  -1.103  -15.397 1.00 18.43 ? 53  ASP A O   1 
ATOM   147   C  CB  . ASP A 1 21  ? 33.376  -1.801  -18.470 1.00 21.00 ? 53  ASP A CB  1 
ATOM   148   C  CG  . ASP A 1 21  ? 33.036  -1.340  -19.881 1.00 27.84 ? 53  ASP A CG  1 
ATOM   149   O  OD1 . ASP A 1 21  ? 32.483  -0.223  -20.010 1.00 31.24 ? 53  ASP A OD1 1 
ATOM   150   O  OD2 . ASP A 1 21  ? 33.315  -2.073  -20.864 1.00 30.95 ? 53  ASP A OD2 1 
ATOM   151   N  N   . GLN A 1 22  ? 35.270  -1.456  -15.777 1.00 12.83 ? 54  GLN A N   1 
ATOM   152   C  CA  . GLN A 1 22  ? 35.480  -1.907  -14.406 1.00 11.27 ? 54  GLN A CA  1 
ATOM   153   C  C   . GLN A 1 22  ? 35.934  -0.753  -13.526 1.00 9.50  ? 54  GLN A C   1 
ATOM   154   O  O   . GLN A 1 22  ? 36.433  0.253   -14.043 1.00 9.96  ? 54  GLN A O   1 
ATOM   155   C  CB  . GLN A 1 22  ? 36.504  -3.042  -14.352 1.00 15.17 ? 54  GLN A CB  1 
ATOM   156   C  CG  . GLN A 1 22  ? 36.232  -4.238  -15.289 1.00 23.73 ? 54  GLN A CG  1 
ATOM   157   C  CD  . GLN A 1 22  ? 36.579  -3.960  -16.768 1.00 30.34 ? 54  GLN A CD  1 
ATOM   158   O  OE1 . GLN A 1 22  ? 35.734  -3.508  -17.562 1.00 34.10 ? 54  GLN A OE1 1 
ATOM   159   N  NE2 . GLN A 1 22  ? 37.831  -4.233  -17.140 1.00 33.94 ? 54  GLN A NE2 1 
ATOM   160   N  N   . TYR A 1 23  ? 35.687  -0.874  -12.221 1.00 7.98  ? 55  TYR A N   1 
ATOM   161   C  CA  . TYR A 1 23  ? 36.074  0.131   -11.222 1.00 8.14  ? 55  TYR A CA  1 
ATOM   162   C  C   . TYR A 1 23  ? 36.706  -0.640  -10.045 1.00 7.27  ? 55  TYR A C   1 
ATOM   163   O  O   . TYR A 1 23  ? 36.605  -1.863  -10.024 1.00 7.20  ? 55  TYR A O   1 
ATOM   164   C  CB  . TYR A 1 23  ? 34.868  0.966   -10.752 1.00 8.65  ? 55  TYR A CB  1 
ATOM   165   C  CG  . TYR A 1 23  ? 33.912  0.226   -9.846  1.00 9.86  ? 55  TYR A CG  1 
ATOM   166   C  CD1 . TYR A 1 23  ? 32.895  -0.556  -10.378 1.00 10.23 ? 55  TYR A CD1 1 
ATOM   167   C  CD2 . TYR A 1 23  ? 34.094  0.222   -8.457  1.00 10.04 ? 55  TYR A CD2 1 
ATOM   168   C  CE1 . TYR A 1 23  ? 32.088  -1.339  -9.566  1.00 11.49 ? 55  TYR A CE1 1 
ATOM   169   C  CE2 . TYR A 1 23  ? 33.295  -0.561  -7.632  1.00 10.68 ? 55  TYR A CE2 1 
ATOM   170   C  CZ  . TYR A 1 23  ? 32.289  -1.347  -8.193  1.00 11.50 ? 55  TYR A CZ  1 
ATOM   171   O  OH  . TYR A 1 23  ? 31.489  -2.143  -7.395  1.00 6.88  ? 55  TYR A OH  1 
ATOM   172   N  N   . LYS A 1 24  ? 37.287  0.062   -9.060  1.00 4.10  ? 56  LYS A N   1 
ATOM   173   C  CA  . LYS A 1 24  ? 37.960  -0.555  -7.906  1.00 2.00  ? 56  LYS A CA  1 
ATOM   174   C  C   . LYS A 1 24  ? 37.799  0.317   -6.631  1.00 4.37  ? 56  LYS A C   1 
ATOM   175   O  O   . LYS A 1 24  ? 37.923  1.550   -6.691  1.00 8.04  ? 56  LYS A O   1 
ATOM   176   C  CB  . LYS A 1 24  ? 39.440  -0.679  -8.260  1.00 2.00  ? 56  LYS A CB  1 
ATOM   177   C  CG  . LYS A 1 24  ? 40.175  -1.923  -7.778  1.00 4.92  ? 56  LYS A CG  1 
ATOM   178   C  CD  . LYS A 1 24  ? 40.390  -1.937  -6.266  1.00 6.51  ? 56  LYS A CD  1 
ATOM   179   C  CE  . LYS A 1 24  ? 41.277  -3.098  -5.828  1.00 10.50 ? 56  LYS A CE  1 
ATOM   180   N  NZ  . LYS A 1 24  ? 40.821  -4.451  -6.338  1.00 18.80 ? 56  LYS A NZ  1 
ATOM   181   N  N   . CYS A 1 25  ? 37.567  -0.298  -5.469  1.00 5.51  ? 57  CYS A N   1 
ATOM   182   C  CA  . CYS A 1 25  ? 37.371  0.467   -4.206  1.00 6.20  ? 57  CYS A CA  1 
ATOM   183   C  C   . CYS A 1 25  ? 38.506  0.521   -3.178  1.00 4.42  ? 57  CYS A C   1 
ATOM   184   O  O   . CYS A 1 25  ? 38.927  -0.484  -2.642  1.00 6.57  ? 57  CYS A O   1 
ATOM   185   C  CB  . CYS A 1 25  ? 36.096  0.020   -3.453  1.00 4.97  ? 57  CYS A CB  1 
ATOM   186   S  SG  . CYS A 1 25  ? 34.542  0.086   -4.414  1.00 9.80  ? 57  CYS A SG  1 
ATOM   187   N  N   . ASP A 1 26  ? 38.931  1.705   -2.801  1.00 3.24  ? 58  ASP A N   1 
ATOM   188   C  CA  . ASP A 1 26  ? 39.977  1.811   -1.802  1.00 3.89  ? 58  ASP A CA  1 
ATOM   189   C  C   . ASP A 1 26  ? 39.388  1.756   -0.399  1.00 2.91  ? 58  ASP A C   1 
ATOM   190   O  O   . ASP A 1 26  ? 39.203  2.793   0.257   1.00 2.00  ? 58  ASP A O   1 
ATOM   191   C  CB  . ASP A 1 26  ? 40.739  3.116   -1.985  1.00 7.13  ? 58  ASP A CB  1 
ATOM   192   C  CG  . ASP A 1 26  ? 42.188  3.021   -1.540  1.00 2.82  ? 58  ASP A CG  1 
ATOM   193   O  OD1 . ASP A 1 26  ? 42.621  1.922   -1.194  1.00 2.00  ? 58  ASP A OD1 1 
ATOM   194   O  OD2 . ASP A 1 26  ? 42.901  4.041   -1.574  1.00 2.00  ? 58  ASP A OD2 1 
ATOM   195   N  N   . CYS A 1 27  ? 39.127  0.546   0.075   1.00 2.33  ? 59  CYS A N   1 
ATOM   196   C  CA  . CYS A 1 27  ? 38.531  0.365   1.402   1.00 8.05  ? 59  CYS A CA  1 
ATOM   197   C  C   . CYS A 1 27  ? 39.505  0.641   2.531   1.00 7.93  ? 59  CYS A C   1 
ATOM   198   O  O   . CYS A 1 27  ? 39.263  0.288   3.693   1.00 7.97  ? 59  CYS A O   1 
ATOM   199   C  CB  . CYS A 1 27  ? 37.962  -1.053  1.577   1.00 10.97 ? 59  CYS A CB  1 
ATOM   200   S  SG  . CYS A 1 27  ? 36.831  -1.648  0.280   1.00 15.37 ? 59  CYS A SG  1 
ATOM   201   N  N   . THR A 1 28  ? 40.568  1.351   2.208   1.00 9.38  ? 60  THR A N   1 
ATOM   202   C  CA  . THR A 1 28  ? 41.595  1.631   3.182   1.00 9.74  ? 60  THR A CA  1 
ATOM   203   C  C   . THR A 1 28  ? 41.122  2.342   4.436   1.00 10.63 ? 60  THR A C   1 
ATOM   204   O  O   . THR A 1 28  ? 40.456  3.384   4.380   1.00 9.89  ? 60  THR A O   1 
ATOM   205   C  CB  . THR A 1 28  ? 42.701  2.447   2.554   1.00 9.28  ? 60  THR A CB  1 
ATOM   206   O  OG1 . THR A 1 28  ? 42.849  2.064   1.186   1.00 2.10  ? 60  THR A OG1 1 
ATOM   207   C  CG2 . THR A 1 28  ? 44.006  2.261   3.337   1.00 9.86  ? 60  THR A CG2 1 
ATOM   208   N  N   . ARG A 1 29  ? 41.483  1.770   5.573   1.00 10.85 ? 61  ARG A N   1 
ATOM   209   C  CA  . ARG A 1 29  ? 41.147  2.352   6.865   1.00 12.35 ? 61  ARG A CA  1 
ATOM   210   C  C   . ARG A 1 29  ? 39.667  2.658   7.079   1.00 12.22 ? 61  ARG A C   1 
ATOM   211   O  O   . ARG A 1 29  ? 39.318  3.402   7.989   1.00 11.75 ? 61  ARG A O   1 
ATOM   212   C  CB  . ARG A 1 29  ? 42.017  3.597   7.124   1.00 12.27 ? 61  ARG A CB  1 
ATOM   213   C  CG  . ARG A 1 29  ? 43.259  3.306   7.987   1.00 13.96 ? 61  ARG A CG  1 
ATOM   214   C  CD  . ARG A 1 29  ? 44.393  4.310   7.809   1.00 10.87 ? 61  ARG A CD  1 
ATOM   215   N  NE  . ARG A 1 29  ? 45.123  4.068   6.563   1.00 11.84 ? 61  ARG A NE  1 
ATOM   216   C  CZ  . ARG A 1 29  ? 45.498  5.029   5.717   1.00 12.73 ? 61  ARG A CZ  1 
ATOM   217   N  NH1 . ARG A 1 29  ? 45.214  6.292   5.993   1.00 11.07 ? 61  ARG A NH1 1 
ATOM   218   N  NH2 . ARG A 1 29  ? 46.116  4.734   4.578   1.00 11.97 ? 61  ARG A NH2 1 
ATOM   219   N  N   . THR A 1 30  ? 38.801  2.020   6.294   1.00 12.14 ? 62  THR A N   1 
ATOM   220   C  CA  . THR A 1 30  ? 37.375  2.247   6.435   1.00 10.04 ? 62  THR A CA  1 
ATOM   221   C  C   . THR A 1 30  ? 36.831  1.424   7.581   1.00 11.57 ? 62  THR A C   1 
ATOM   222   O  O   . THR A 1 30  ? 36.045  1.917   8.398   1.00 14.21 ? 62  THR A O   1 
ATOM   223   C  CB  . THR A 1 30  ? 36.592  1.890   5.145   1.00 7.26  ? 62  THR A CB  1 
ATOM   224   O  OG1 . THR A 1 30  ? 36.641  0.488   4.914   1.00 8.95  ? 62  THR A OG1 1 
ATOM   225   C  CG2 . THR A 1 30  ? 37.201  2.543   3.956   1.00 9.74  ? 62  THR A CG2 1 
ATOM   226   N  N   . GLY A 1 31  ? 37.316  0.190   7.687   1.00 11.51 ? 63  GLY A N   1 
ATOM   227   C  CA  . GLY A 1 31  ? 36.804  -0.715  8.702   1.00 9.94  ? 63  GLY A CA  1 
ATOM   228   C  C   . GLY A 1 31  ? 35.824  -1.669  8.020   1.00 7.69  ? 63  GLY A C   1 
ATOM   229   O  O   . GLY A 1 31  ? 34.964  -2.268  8.672   1.00 3.65  ? 63  GLY A O   1 
ATOM   230   N  N   . PHE A 1 32  ? 35.940  -1.749  6.692   1.00 7.45  ? 64  PHE A N   1 
ATOM   231   C  CA  . PHE A 1 32  ? 35.127  -2.598  5.834   1.00 9.64  ? 64  PHE A CA  1 
ATOM   232   C  C   . PHE A 1 32  ? 35.934  -3.058  4.638   1.00 10.45 ? 64  PHE A C   1 
ATOM   233   O  O   . PHE A 1 32  ? 36.716  -2.281  4.085   1.00 11.14 ? 64  PHE A O   1 
ATOM   234   C  CB  . PHE A 1 32  ? 33.918  -1.836  5.301   1.00 8.14  ? 64  PHE A CB  1 
ATOM   235   C  CG  . PHE A 1 32  ? 32.956  -1.474  6.346   1.00 11.60 ? 64  PHE A CG  1 
ATOM   236   C  CD1 . PHE A 1 32  ? 33.181  -0.383  7.159   1.00 15.13 ? 64  PHE A CD1 1 
ATOM   237   C  CD2 . PHE A 1 32  ? 31.832  -2.233  6.562   1.00 11.69 ? 64  PHE A CD2 1 
ATOM   238   C  CE1 . PHE A 1 32  ? 32.283  -0.050  8.192   1.00 17.74 ? 64  PHE A CE1 1 
ATOM   239   C  CE2 . PHE A 1 32  ? 30.934  -1.904  7.587   1.00 14.66 ? 64  PHE A CE2 1 
ATOM   240   C  CZ  . PHE A 1 32  ? 31.163  -0.813  8.401   1.00 13.47 ? 64  PHE A CZ  1 
ATOM   241   N  N   . TYR A 1 33  ? 35.723  -4.309  4.226   1.00 10.52 ? 65  TYR A N   1 
ATOM   242   C  CA  . TYR A 1 33  ? 36.391  -4.863  3.047   1.00 8.79  ? 65  TYR A CA  1 
ATOM   243   C  C   . TYR A 1 33  ? 35.374  -5.390  2.038   1.00 6.96  ? 65  TYR A C   1 
ATOM   244   O  O   . TYR A 1 33  ? 34.179  -5.241  2.237   1.00 2.50  ? 65  TYR A O   1 
ATOM   245   C  CB  . TYR A 1 33  ? 37.425  -5.941  3.415   1.00 5.61  ? 65  TYR A CB  1 
ATOM   246   C  CG  . TYR A 1 33  ? 36.898  -7.084  4.209   1.00 2.06  ? 65  TYR A CG  1 
ATOM   247   C  CD1 . TYR A 1 33  ? 36.681  -6.956  5.577   1.00 6.82  ? 65  TYR A CD1 1 
ATOM   248   C  CD2 . TYR A 1 33  ? 36.643  -8.305  3.609   1.00 2.03  ? 65  TYR A CD2 1 
ATOM   249   C  CE1 . TYR A 1 33  ? 36.220  -8.026  6.344   1.00 6.94  ? 65  TYR A CE1 1 
ATOM   250   C  CE2 . TYR A 1 33  ? 36.180  -9.383  4.355   1.00 5.93  ? 65  TYR A CE2 1 
ATOM   251   C  CZ  . TYR A 1 33  ? 35.966  -9.240  5.730   1.00 7.13  ? 65  TYR A CZ  1 
ATOM   252   O  OH  . TYR A 1 33  ? 35.456  -10.300 6.461   1.00 10.35 ? 65  TYR A OH  1 
ATOM   253   N  N   . GLY A 1 34  ? 35.856  -5.990  0.955   1.00 10.12 ? 66  GLY A N   1 
ATOM   254   C  CA  . GLY A 1 34  ? 34.971  -6.518  -0.067  1.00 11.23 ? 66  GLY A CA  1 
ATOM   255   C  C   . GLY A 1 34  ? 34.793  -5.530  -1.195  1.00 12.13 ? 66  GLY A C   1 
ATOM   256   O  O   . GLY A 1 34  ? 35.024  -4.348  -1.010  1.00 14.62 ? 66  GLY A O   1 
ATOM   257   N  N   . GLU A 1 35  ? 34.324  -6.003  -2.344  1.00 12.55 ? 67  GLU A N   1 
ATOM   258   C  CA  . GLU A 1 35  ? 34.147  -5.168  -3.535  1.00 13.69 ? 67  GLU A CA  1 
ATOM   259   C  C   . GLU A 1 35  ? 33.641  -3.723  -3.324  1.00 13.97 ? 67  GLU A C   1 
ATOM   260   O  O   . GLU A 1 35  ? 34.078  -2.807  -4.007  1.00 15.36 ? 67  GLU A O   1 
ATOM   261   C  CB  . GLU A 1 35  ? 33.284  -5.896  -4.592  1.00 14.76 ? 67  GLU A CB  1 
ATOM   262   C  CG  . GLU A 1 35  ? 33.181  -5.139  -5.938  1.00 22.46 ? 67  GLU A CG  1 
ATOM   263   C  CD  . GLU A 1 35  ? 32.388  -5.874  -7.026  1.00 25.91 ? 67  GLU A CD  1 
ATOM   264   O  OE1 . GLU A 1 35  ? 31.859  -6.975  -6.750  1.00 29.58 ? 67  GLU A OE1 1 
ATOM   265   O  OE2 . GLU A 1 35  ? 32.287  -5.347  -8.164  1.00 25.58 ? 67  GLU A OE2 1 
ATOM   266   N  N   . ASN A 1 36  ? 32.769  -3.496  -2.355  1.00 12.15 ? 68  ASN A N   1 
ATOM   267   C  CA  . ASN A 1 36  ? 32.258  -2.160  -2.181  1.00 10.05 ? 68  ASN A CA  1 
ATOM   268   C  C   . ASN A 1 36  ? 32.515  -1.630  -0.787  1.00 8.84  ? 68  ASN A C   1 
ATOM   269   O  O   . ASN A 1 36  ? 31.830  -0.739  -0.316  1.00 11.25 ? 68  ASN A O   1 
ATOM   270   C  CB  . ASN A 1 36  ? 30.759  -2.132  -2.520  1.00 11.24 ? 68  ASN A CB  1 
ATOM   271   C  CG  . ASN A 1 36  ? 30.484  -2.469  -3.966  1.00 12.84 ? 68  ASN A CG  1 
ATOM   272   O  OD1 . ASN A 1 36  ? 31.229  -2.102  -4.854  1.00 8.50  ? 68  ASN A OD1 1 
ATOM   273   N  ND2 . ASN A 1 36  ? 29.395  -3.182  -4.202  1.00 20.23 ? 68  ASN A ND2 1 
ATOM   274   N  N   . CYS A 1 37  ? 33.501  -2.171  -0.110  1.00 8.03  ? 69  CYS A N   1 
ATOM   275   C  CA  . CYS A 1 37  ? 33.815  -1.723  1.248   1.00 12.94 ? 69  CYS A CA  1 
ATOM   276   C  C   . CYS A 1 37  ? 32.564  -1.866  2.082   1.00 14.33 ? 69  CYS A C   1 
ATOM   277   O  O   . CYS A 1 37  ? 32.273  -1.059  2.953   1.00 13.69 ? 69  CYS A O   1 
ATOM   278   C  CB  . CYS A 1 37  ? 34.334  -0.285  1.223   1.00 14.43 ? 69  CYS A CB  1 
ATOM   279   S  SG  . CYS A 1 37  ? 35.619  -0.062  -0.076  1.00 15.20 ? 69  CYS A SG  1 
ATOM   280   N  N   . THR A 1 38  ? 31.871  -2.971  1.795   1.00 19.09 ? 70  THR A N   1 
ATOM   281   C  CA  . THR A 1 38  ? 30.598  -3.388  2.388   1.00 17.87 ? 70  THR A CA  1 
ATOM   282   C  C   . THR A 1 38  ? 30.688  -4.244  3.649   1.00 17.20 ? 70  THR A C   1 
ATOM   283   O  O   . THR A 1 38  ? 30.058  -3.929  4.641   1.00 20.02 ? 70  THR A O   1 
ATOM   284   C  CB  . THR A 1 38  ? 29.712  -4.091  1.315   1.00 16.94 ? 70  THR A CB  1 
ATOM   285   O  OG1 . THR A 1 38  ? 30.535  -4.768  0.348   1.00 15.56 ? 70  THR A OG1 1 
ATOM   286   C  CG2 . THR A 1 38  ? 28.876  -3.060  0.575   1.00 20.18 ? 70  THR A CG2 1 
ATOM   287   N  N   . THR A 1 39  ? 31.474  -5.312  3.634   1.00 16.85 ? 71  THR A N   1 
ATOM   288   C  CA  . THR A 1 39  ? 31.595  -6.166  4.819   1.00 13.71 ? 71  THR A CA  1 
ATOM   289   C  C   . THR A 1 39  ? 32.525  -5.602  5.898   1.00 13.65 ? 71  THR A C   1 
ATOM   290   O  O   . THR A 1 39  ? 33.704  -5.359  5.661   1.00 12.47 ? 71  THR A O   1 
ATOM   291   C  CB  . THR A 1 39  ? 31.996  -7.645  4.473   1.00 11.97 ? 71  THR A CB  1 
ATOM   292   O  OG1 . THR A 1 39  ? 32.985  -8.114  5.400   1.00 6.42  ? 71  THR A OG1 1 
ATOM   293   C  CG2 . THR A 1 39  ? 32.485  -7.801  3.048   1.00 5.98  ? 71  THR A CG2 1 
ATOM   294   N  N   . PRO A 1 40  ? 32.003  -5.439  7.115   1.00 14.12 ? 72  PRO A N   1 
ATOM   295   C  CA  . PRO A 1 40  ? 32.762  -4.904  8.250   1.00 16.55 ? 72  PRO A CA  1 
ATOM   296   C  C   . PRO A 1 40  ? 33.835  -5.784  8.845   1.00 16.43 ? 72  PRO A C   1 
ATOM   297   O  O   . PRO A 1 40  ? 33.749  -7.002  8.827   1.00 16.65 ? 72  PRO A O   1 
ATOM   298   C  CB  . PRO A 1 40  ? 31.679  -4.650  9.302   1.00 18.53 ? 72  PRO A CB  1 
ATOM   299   C  CG  . PRO A 1 40  ? 30.723  -5.763  9.054   1.00 18.19 ? 72  PRO A CG  1 
ATOM   300   C  CD  . PRO A 1 40  ? 30.625  -5.772  7.517   1.00 14.62 ? 72  PRO A CD  1 
ATOM   301   N  N   . GLU A 1 41  ? 34.829  -5.126  9.416   1.00 17.31 ? 73  GLU A N   1 
ATOM   302   C  CA  . GLU A 1 41  ? 35.900  -5.806  10.087  1.00 19.94 ? 73  GLU A CA  1 
ATOM   303   C  C   . GLU A 1 41  ? 35.216  -6.166  11.385  1.00 19.89 ? 73  GLU A C   1 
ATOM   304   O  O   . GLU A 1 41  ? 34.390  -5.420  11.887  1.00 17.90 ? 73  GLU A O   1 
ATOM   305   C  CB  . GLU A 1 41  ? 37.071  -4.853  10.358  1.00 24.53 ? 73  GLU A CB  1 
ATOM   306   C  CG  . GLU A 1 41  ? 37.924  -4.512  9.138   1.00 30.96 ? 73  GLU A CG  1 
ATOM   307   C  CD  . GLU A 1 41  ? 38.810  -3.273  9.351   1.00 37.21 ? 73  GLU A CD  1 
ATOM   308   O  OE1 . GLU A 1 41  ? 38.888  -2.770  10.507  1.00 39.82 ? 73  GLU A OE1 1 
ATOM   309   O  OE2 . GLU A 1 41  ? 39.414  -2.781  8.353   1.00 40.34 ? 73  GLU A OE2 1 
ATOM   310   N  N   . PHE A 1 42  ? 35.548  -7.324  11.922  1.00 23.63 ? 74  PHE A N   1 
ATOM   311   C  CA  . PHE A 1 42  ? 34.943  -7.784  13.161  1.00 25.49 ? 74  PHE A CA  1 
ATOM   312   C  C   . PHE A 1 42  ? 34.777  -6.670  14.222  1.00 22.74 ? 74  PHE A C   1 
ATOM   313   O  O   . PHE A 1 42  ? 33.670  -6.419  14.706  1.00 21.19 ? 74  PHE A O   1 
ATOM   314   C  CB  . PHE A 1 42  ? 35.744  -8.974  13.727  1.00 28.27 ? 74  PHE A CB  1 
ATOM   315   C  CG  . PHE A 1 42  ? 34.986  -9.765  14.743  1.00 32.97 ? 74  PHE A CG  1 
ATOM   316   C  CD1 . PHE A 1 42  ? 34.982  -9.374  16.090  1.00 35.27 ? 74  PHE A CD1 1 
ATOM   317   C  CD2 . PHE A 1 42  ? 34.206  -10.852 14.346  1.00 34.83 ? 74  PHE A CD2 1 
ATOM   318   C  CE1 . PHE A 1 42  ? 34.200  -10.051 17.032  1.00 36.89 ? 74  PHE A CE1 1 
ATOM   319   C  CE2 . PHE A 1 42  ? 33.420  -11.544 15.270  1.00 38.39 ? 74  PHE A CE2 1 
ATOM   320   C  CZ  . PHE A 1 42  ? 33.413  -11.141 16.622  1.00 39.33 ? 74  PHE A CZ  1 
ATOM   321   N  N   . LEU A 1 43  ? 35.873  -6.018  14.580  1.00 20.80 ? 75  LEU A N   1 
ATOM   322   C  CA  . LEU A 1 43  ? 35.830  -4.961  15.577  1.00 20.93 ? 75  LEU A CA  1 
ATOM   323   C  C   . LEU A 1 43  ? 34.863  -3.861  15.143  1.00 21.14 ? 75  LEU A C   1 
ATOM   324   O  O   . LEU A 1 43  ? 34.234  -3.192  15.986  1.00 19.69 ? 75  LEU A O   1 
ATOM   325   C  CB  . LEU A 1 43  ? 37.230  -4.391  15.790  1.00 22.79 ? 75  LEU A CB  1 
ATOM   326   C  CG  . LEU A 1 43  ? 37.338  -3.098  16.596  1.00 23.75 ? 75  LEU A CG  1 
ATOM   327   C  CD1 . LEU A 1 43  ? 36.925  -3.322  18.060  1.00 24.59 ? 75  LEU A CD1 1 
ATOM   328   C  CD2 . LEU A 1 43  ? 38.773  -2.568  16.491  1.00 23.41 ? 75  LEU A CD2 1 
ATOM   329   N  N   . THR A 1 44  ? 34.758  -3.671  13.828  1.00 21.71 ? 76  THR A N   1 
ATOM   330   C  CA  . THR A 1 44  ? 33.839  -2.678  13.248  1.00 23.84 ? 76  THR A CA  1 
ATOM   331   C  C   . THR A 1 44  ? 32.416  -3.018  13.742  1.00 27.09 ? 76  THR A C   1 
ATOM   332   O  O   . THR A 1 44  ? 31.671  -2.141  14.200  1.00 26.93 ? 76  THR A O   1 
ATOM   333   C  CB  . THR A 1 44  ? 33.888  -2.710  11.683  1.00 20.96 ? 76  THR A CB  1 
ATOM   334   O  OG1 . THR A 1 44  ? 35.147  -2.213  11.229  1.00 16.88 ? 76  THR A OG1 1 
ATOM   335   C  CG2 . THR A 1 44  ? 32.776  -1.905  11.065  1.00 18.48 ? 76  THR A CG2 1 
ATOM   336   N  N   . ARG A 1 45  ? 32.080  -4.311  13.688  1.00 30.63 ? 77  ARG A N   1 
ATOM   337   C  CA  . ARG A 1 45  ? 30.790  -4.833  14.141  1.00 29.36 ? 77  ARG A CA  1 
ATOM   338   C  C   . ARG A 1 45  ? 30.513  -4.361  15.566  1.00 26.94 ? 77  ARG A C   1 
ATOM   339   O  O   . ARG A 1 45  ? 29.478  -3.753  15.845  1.00 25.18 ? 77  ARG A O   1 
ATOM   340   C  CB  . ARG A 1 45  ? 30.831  -6.363  14.136  1.00 33.36 ? 77  ARG A CB  1 
ATOM   341   C  CG  . ARG A 1 45  ? 31.123  -6.994  12.786  1.00 37.97 ? 77  ARG A CG  1 
ATOM   342   C  CD  . ARG A 1 45  ? 30.648  -8.442  12.784  1.00 42.61 ? 77  ARG A CD  1 
ATOM   343   N  NE  . ARG A 1 45  ? 30.748  -8.986  11.441  1.00 48.29 ? 77  ARG A NE  1 
ATOM   344   C  CZ  . ARG A 1 45  ? 31.647  -9.896  11.084  1.00 52.21 ? 77  ARG A CZ  1 
ATOM   345   N  NH1 . ARG A 1 45  ? 32.499  -10.372 11.990  1.00 53.42 ? 77  ARG A NH1 1 
ATOM   346   N  NH2 . ARG A 1 45  ? 31.767  -10.249 9.804   1.00 55.27 ? 77  ARG A NH2 1 
ATOM   347   N  N   . ILE A 1 46  ? 31.477  -4.626  16.444  1.00 25.45 ? 78  ILE A N   1 
ATOM   348   C  CA  . ILE A 1 46  ? 31.401  -4.256  17.848  1.00 26.67 ? 78  ILE A CA  1 
ATOM   349   C  C   . ILE A 1 46  ? 30.970  -2.804  18.010  1.00 29.82 ? 78  ILE A C   1 
ATOM   350   O  O   . ILE A 1 46  ? 30.032  -2.502  18.774  1.00 31.20 ? 78  ILE A O   1 
ATOM   351   C  CB  . ILE A 1 46  ? 32.772  -4.430  18.538  1.00 26.28 ? 78  ILE A CB  1 
ATOM   352   C  CG1 . ILE A 1 46  ? 33.357  -5.821  18.224  1.00 24.93 ? 78  ILE A CG1 1 
ATOM   353   C  CG2 . ILE A 1 46  ? 32.643  -4.163  20.047  1.00 24.98 ? 78  ILE A CG2 1 
ATOM   354   C  CD1 . ILE A 1 46  ? 32.377  -6.976  18.399  1.00 23.94 ? 78  ILE A CD1 1 
ATOM   355   N  N   . LYS A 1 47  ? 31.666  -1.910  17.299  1.00 30.39 ? 79  LYS A N   1 
ATOM   356   C  CA  . LYS A 1 47  ? 31.363  -0.479  17.348  1.00 27.86 ? 79  LYS A CA  1 
ATOM   357   C  C   . LYS A 1 47  ? 29.978  -0.224  16.744  1.00 24.75 ? 79  LYS A C   1 
ATOM   358   O  O   . LYS A 1 47  ? 29.130  0.396   17.384  1.00 24.44 ? 79  LYS A O   1 
ATOM   359   C  CB  . LYS A 1 47  ? 32.446  0.313   16.621  1.00 27.78 ? 79  LYS A CB  1 
ATOM   360   C  CG  . LYS A 1 47  ? 33.842  -0.027  17.100  1.00 31.64 ? 79  LYS A CG  1 
ATOM   361   C  CD  . LYS A 1 47  ? 34.934  0.640   16.268  1.00 32.17 ? 79  LYS A CD  1 
ATOM   362   C  CE  . LYS A 1 47  ? 36.313  0.103   16.656  1.00 34.02 ? 79  LYS A CE  1 
ATOM   363   N  NZ  . LYS A 1 47  ? 36.621  0.223   18.132  1.00 37.37 ? 79  LYS A NZ  1 
ATOM   364   N  N   . LEU A 1 48  ? 29.722  -0.782  15.569  1.00 23.41 ? 80  LEU A N   1 
ATOM   365   C  CA  . LEU A 1 48  ? 28.434  -0.618  14.932  1.00 24.57 ? 80  LEU A CA  1 
ATOM   366   C  C   . LEU A 1 48  ? 27.274  -0.923  15.898  1.00 26.81 ? 80  LEU A C   1 
ATOM   367   O  O   . LEU A 1 48  ? 26.277  -0.177  15.940  1.00 25.77 ? 80  LEU A O   1 
ATOM   368   C  CB  . LEU A 1 48  ? 28.322  -1.489  13.681  1.00 23.11 ? 80  LEU A CB  1 
ATOM   369   C  CG  . LEU A 1 48  ? 29.018  -0.958  12.431  1.00 23.29 ? 80  LEU A CG  1 
ATOM   370   C  CD1 . LEU A 1 48  ? 28.295  -1.471  11.195  1.00 25.52 ? 80  LEU A CD1 1 
ATOM   371   C  CD2 . LEU A 1 48  ? 29.015  0.559   12.413  1.00 24.91 ? 80  LEU A CD2 1 
ATOM   372   N  N   . LEU A 1 49  ? 27.412  -1.989  16.693  1.00 27.21 ? 81  LEU A N   1 
ATOM   373   C  CA  . LEU A 1 49  ? 26.366  -2.341  17.645  1.00 27.80 ? 81  LEU A CA  1 
ATOM   374   C  C   . LEU A 1 49  ? 26.162  -1.234  18.652  1.00 28.53 ? 81  LEU A C   1 
ATOM   375   O  O   . LEU A 1 49  ? 25.048  -0.742  18.844  1.00 31.55 ? 81  LEU A O   1 
ATOM   376   C  CB  . LEU A 1 49  ? 26.704  -3.596  18.428  1.00 27.43 ? 81  LEU A CB  1 
ATOM   377   C  CG  . LEU A 1 49  ? 26.615  -4.932  17.712  1.00 31.38 ? 81  LEU A CG  1 
ATOM   378   C  CD1 . LEU A 1 49  ? 26.610  -6.016  18.804  1.00 31.39 ? 81  LEU A CD1 1 
ATOM   379   C  CD2 . LEU A 1 49  ? 25.352  -5.030  16.828  1.00 31.70 ? 81  LEU A CD2 1 
ATOM   380   N  N   . LEU A 1 50  ? 27.240  -0.841  19.307  1.00 26.87 ? 82  LEU A N   1 
ATOM   381   C  CA  . LEU A 1 50  ? 27.137  0.187   20.314  1.00 27.25 ? 82  LEU A CA  1 
ATOM   382   C  C   . LEU A 1 50  ? 26.767  1.597   19.837  1.00 28.34 ? 82  LEU A C   1 
ATOM   383   O  O   . LEU A 1 50  ? 26.311  2.435   20.637  1.00 29.27 ? 82  LEU A O   1 
ATOM   384   C  CB  . LEU A 1 50  ? 28.393  0.196   21.150  1.00 28.31 ? 82  LEU A CB  1 
ATOM   385   C  CG  . LEU A 1 50  ? 28.242  -0.868  22.232  1.00 29.68 ? 82  LEU A CG  1 
ATOM   386   C  CD1 . LEU A 1 50  ? 28.144  -2.258  21.617  1.00 28.87 ? 82  LEU A CD1 1 
ATOM   387   C  CD2 . LEU A 1 50  ? 29.407  -0.762  23.215  1.00 32.30 ? 82  LEU A CD2 1 
ATOM   388   N  N   . LYS A 1 51  ? 26.932  1.849   18.543  1.00 26.99 ? 83  LYS A N   1 
ATOM   389   C  CA  . LYS A 1 51  ? 26.596  3.146   17.947  1.00 26.89 ? 83  LYS A CA  1 
ATOM   390   C  C   . LYS A 1 51  ? 25.154  3.663   18.268  1.00 26.67 ? 83  LYS A C   1 
ATOM   391   O  O   . LYS A 1 51  ? 24.162  3.210   17.670  1.00 30.12 ? 83  LYS A O   1 
ATOM   392   C  CB  . LYS A 1 51  ? 26.803  3.050   16.413  1.00 27.05 ? 83  LYS A CB  1 
ATOM   393   C  CG  . LYS A 1 51  ? 26.326  4.247   15.575  1.00 24.95 ? 83  LYS A CG  1 
ATOM   394   C  CD  . LYS A 1 51  ? 27.390  5.325   15.406  1.00 26.17 ? 83  LYS A CD  1 
ATOM   395   C  CE  . LYS A 1 51  ? 27.814  5.959   16.728  1.00 27.76 ? 83  LYS A CE  1 
ATOM   396   N  NZ  . LYS A 1 51  ? 28.826  5.145   17.503  1.00 25.63 ? 83  LYS A NZ  1 
ATOM   397   N  N   . PRO A 1 52  ? 25.015  4.600   19.224  1.00 23.17 ? 84  PRO A N   1 
ATOM   398   C  CA  . PRO A 1 52  ? 23.655  5.073   19.495  1.00 21.05 ? 84  PRO A CA  1 
ATOM   399   C  C   . PRO A 1 52  ? 23.240  6.018   18.365  1.00 21.27 ? 84  PRO A C   1 
ATOM   400   O  O   . PRO A 1 52  ? 24.084  6.788   17.867  1.00 23.11 ? 84  PRO A O   1 
ATOM   401   C  CB  . PRO A 1 52  ? 23.830  5.839   20.805  1.00 19.65 ? 84  PRO A CB  1 
ATOM   402   C  CG  . PRO A 1 52  ? 25.188  6.439   20.657  1.00 19.75 ? 84  PRO A CG  1 
ATOM   403   C  CD  . PRO A 1 52  ? 25.992  5.269   20.100  1.00 21.48 ? 84  PRO A CD  1 
ATOM   404   N  N   . THR A 1 53  ? 21.976  5.956   17.940  1.00 20.46 ? 85  THR A N   1 
ATOM   405   C  CA  . THR A 1 53  ? 21.505  6.864   16.889  1.00 21.33 ? 85  THR A CA  1 
ATOM   406   C  C   . THR A 1 53  ? 21.539  8.353   17.354  1.00 20.91 ? 85  THR A C   1 
ATOM   407   O  O   . THR A 1 53  ? 21.146  8.690   18.495  1.00 15.98 ? 85  THR A O   1 
ATOM   408   C  CB  . THR A 1 53  ? 20.087  6.510   16.361  1.00 20.29 ? 85  THR A CB  1 
ATOM   409   O  OG1 . THR A 1 53  ? 19.893  7.125   15.079  1.00 21.44 ? 85  THR A OG1 1 
ATOM   410   C  CG2 . THR A 1 53  ? 19.007  7.027   17.291  1.00 17.97 ? 85  THR A CG2 1 
ATOM   411   N  N   . PRO A 1 54  ? 21.973  9.259   16.442  1.00 20.52 ? 86  PRO A N   1 
ATOM   412   C  CA  . PRO A 1 54  ? 22.083  10.696  16.699  1.00 20.63 ? 86  PRO A CA  1 
ATOM   413   C  C   . PRO A 1 54  ? 20.849  11.228  17.431  1.00 21.72 ? 86  PRO A C   1 
ATOM   414   O  O   . PRO A 1 54  ? 20.944  12.053  18.351  1.00 21.17 ? 86  PRO A O   1 
ATOM   415   C  CB  . PRO A 1 54  ? 22.229  11.279  15.280  1.00 18.50 ? 86  PRO A CB  1 
ATOM   416   C  CG  . PRO A 1 54  ? 21.605  10.209  14.392  1.00 17.28 ? 86  PRO A CG  1 
ATOM   417   C  CD  . PRO A 1 54  ? 22.157  8.988   15.003  1.00 18.02 ? 86  PRO A CD  1 
ATOM   418   N  N   . ASN A 1 55  ? 19.701  10.685  17.057  1.00 19.39 ? 87  ASN A N   1 
ATOM   419   C  CA  . ASN A 1 55  ? 18.463  11.109  17.637  1.00 19.78 ? 87  ASN A CA  1 
ATOM   420   C  C   . ASN A 1 55  ? 18.363  10.651  19.070  1.00 18.41 ? 87  ASN A C   1 
ATOM   421   O  O   . ASN A 1 55  ? 17.821  11.386  19.905  1.00 16.24 ? 87  ASN A O   1 
ATOM   422   C  CB  . ASN A 1 55  ? 17.310  10.581  16.807  1.00 25.29 ? 87  ASN A CB  1 
ATOM   423   C  CG  . ASN A 1 55  ? 17.500  10.858  15.310  1.00 30.43 ? 87  ASN A CG  1 
ATOM   424   O  OD1 . ASN A 1 55  ? 16.944  11.820  14.769  1.00 33.56 ? 87  ASN A OD1 1 
ATOM   425   N  ND2 . ASN A 1 55  ? 18.297  10.016  14.637  1.00 30.61 ? 87  ASN A ND2 1 
ATOM   426   N  N   . THR A 1 56  ? 18.905  9.463   19.366  1.00 17.32 ? 88  THR A N   1 
ATOM   427   C  CA  . THR A 1 56  ? 18.877  8.922   20.747  1.00 17.63 ? 88  THR A CA  1 
ATOM   428   C  C   . THR A 1 56  ? 19.656  9.898   21.602  1.00 17.76 ? 88  THR A C   1 
ATOM   429   O  O   . THR A 1 56  ? 19.177  10.434  22.616  1.00 14.71 ? 88  THR A O   1 
ATOM   430   C  CB  . THR A 1 56  ? 19.612  7.552   20.902  1.00 16.98 ? 88  THR A CB  1 
ATOM   431   O  OG1 . THR A 1 56  ? 19.121  6.590   19.951  1.00 17.01 ? 88  THR A OG1 1 
ATOM   432   C  CG2 . THR A 1 56  ? 19.424  7.007   22.324  1.00 12.78 ? 88  THR A CG2 1 
ATOM   433   N  N   . VAL A 1 57  ? 20.867  10.148  21.123  1.00 20.92 ? 89  VAL A N   1 
ATOM   434   C  CA  . VAL A 1 57  ? 21.784  11.065  21.775  1.00 23.28 ? 89  VAL A CA  1 
ATOM   435   C  C   . VAL A 1 57  ? 21.078  12.409  21.876  1.00 23.01 ? 89  VAL A C   1 
ATOM   436   O  O   . VAL A 1 57  ? 21.060  13.046  22.943  1.00 23.25 ? 89  VAL A O   1 
ATOM   437   C  CB  . VAL A 1 57  ? 23.082  11.240  20.952  1.00 23.15 ? 89  VAL A CB  1 
ATOM   438   C  CG1 . VAL A 1 57  ? 24.160  11.852  21.842  1.00 23.13 ? 89  VAL A CG1 1 
ATOM   439   C  CG2 . VAL A 1 57  ? 23.542  9.883   20.365  1.00 24.76 ? 89  VAL A CG2 1 
ATOM   440   N  N   . HIS A 1 58  ? 20.425  12.785  20.779  1.00 21.37 ? 90  HIS A N   1 
ATOM   441   C  CA  . HIS A 1 58  ? 19.706  14.040  20.730  1.00 20.87 ? 90  HIS A CA  1 
ATOM   442   C  C   . HIS A 1 58  ? 18.706  14.092  21.864  1.00 19.40 ? 90  HIS A C   1 
ATOM   443   O  O   . HIS A 1 58  ? 18.613  15.092  22.578  1.00 17.84 ? 90  HIS A O   1 
ATOM   444   C  CB  . HIS A 1 58  ? 18.970  14.205  19.410  1.00 21.97 ? 90  HIS A CB  1 
ATOM   445   C  CG  . HIS A 1 58  ? 18.406  15.575  19.224  1.00 24.82 ? 90  HIS A CG  1 
ATOM   446   N  ND1 . HIS A 1 58  ? 17.702  16.226  20.213  1.00 24.99 ? 90  HIS A ND1 1 
ATOM   447   C  CD2 . HIS A 1 58  ? 18.530  16.459  18.205  1.00 27.61 ? 90  HIS A CD2 1 
ATOM   448   C  CE1 . HIS A 1 58  ? 17.423  17.455  19.817  1.00 28.55 ? 90  HIS A CE1 1 
ATOM   449   N  NE2 . HIS A 1 58  ? 17.915  17.622  18.601  1.00 28.99 ? 90  HIS A NE2 1 
ATOM   450   N  N   . TYR A 1 59  ? 17.959  13.007  22.024  1.00 19.13 ? 91  TYR A N   1 
ATOM   451   C  CA  . TYR A 1 59  ? 16.971  12.933  23.077  1.00 18.95 ? 91  TYR A CA  1 
ATOM   452   C  C   . TYR A 1 59  ? 17.683  13.104  24.414  1.00 16.65 ? 91  TYR A C   1 
ATOM   453   O  O   . TYR A 1 59  ? 17.455  14.070  25.142  1.00 17.34 ? 91  TYR A O   1 
ATOM   454   C  CB  . TYR A 1 59  ? 16.246  11.582  23.029  1.00 20.33 ? 91  TYR A CB  1 
ATOM   455   C  CG  . TYR A 1 59  ? 15.172  11.386  24.107  1.00 21.18 ? 91  TYR A CG  1 
ATOM   456   C  CD1 . TYR A 1 59  ? 15.517  10.954  25.404  1.00 20.75 ? 91  TYR A CD1 1 
ATOM   457   C  CD2 . TYR A 1 59  ? 13.820  11.651  23.835  1.00 18.53 ? 91  TYR A CD2 1 
ATOM   458   C  CE1 . TYR A 1 59  ? 14.551  10.800  26.390  1.00 19.55 ? 91  TYR A CE1 1 
ATOM   459   C  CE2 . TYR A 1 59  ? 12.849  11.495  24.813  1.00 17.11 ? 91  TYR A CE2 1 
ATOM   460   C  CZ  . TYR A 1 59  ? 13.221  11.073  26.086  1.00 18.19 ? 91  TYR A CZ  1 
ATOM   461   O  OH  . TYR A 1 59  ? 12.275  10.947  27.071  1.00 19.67 ? 91  TYR A OH  1 
ATOM   462   N  N   . ILE A 1 60  ? 18.586  12.187  24.689  1.00 13.33 ? 92  ILE A N   1 
ATOM   463   C  CA  . ILE A 1 60  ? 19.313  12.192  25.926  1.00 15.56 ? 92  ILE A CA  1 
ATOM   464   C  C   . ILE A 1 60  ? 19.978  13.521  26.240  1.00 17.60 ? 92  ILE A C   1 
ATOM   465   O  O   . ILE A 1 60  ? 20.111  13.907  27.413  1.00 16.80 ? 92  ILE A O   1 
ATOM   466   C  CB  . ILE A 1 60  ? 20.371  11.145  25.874  1.00 16.35 ? 92  ILE A CB  1 
ATOM   467   C  CG1 . ILE A 1 60  ? 19.767  9.837   25.354  1.00 14.42 ? 92  ILE A CG1 1 
ATOM   468   C  CG2 . ILE A 1 60  ? 20.966  10.964  27.267  1.00 19.21 ? 92  ILE A CG2 1 
ATOM   469   C  CD1 . ILE A 1 60  ? 20.776  8.871   24.790  1.00 15.42 ? 92  ILE A CD1 1 
ATOM   470   N  N   . LEU A 1 61  ? 20.383  14.221  25.188  1.00 18.72 ? 93  LEU A N   1 
ATOM   471   C  CA  . LEU A 1 61  ? 21.041  15.508  25.333  1.00 20.56 ? 93  LEU A CA  1 
ATOM   472   C  C   . LEU A 1 61  ? 20.009  16.584  25.713  1.00 20.29 ? 93  LEU A C   1 
ATOM   473   O  O   . LEU A 1 61  ? 20.174  17.293  26.709  1.00 21.03 ? 93  LEU A O   1 
ATOM   474   C  CB  . LEU A 1 61  ? 21.762  15.852  24.023  1.00 19.43 ? 93  LEU A CB  1 
ATOM   475   C  CG  . LEU A 1 61  ? 23.099  16.598  24.057  1.00 19.91 ? 93  LEU A CG  1 
ATOM   476   C  CD1 . LEU A 1 61  ? 23.811  16.516  25.416  1.00 16.11 ? 93  LEU A CD1 1 
ATOM   477   C  CD2 . LEU A 1 61  ? 23.956  16.028  22.948  1.00 18.28 ? 93  LEU A CD2 1 
ATOM   478   N  N   . THR A 1 62  ? 18.900  16.607  24.981  1.00 20.02 ? 94  THR A N   1 
ATOM   479   C  CA  . THR A 1 62  ? 17.822  17.571  25.188  1.00 20.18 ? 94  THR A CA  1 
ATOM   480   C  C   . THR A 1 62  ? 16.921  17.355  26.425  1.00 20.73 ? 94  THR A C   1 
ATOM   481   O  O   . THR A 1 62  ? 16.091  18.212  26.758  1.00 19.72 ? 94  THR A O   1 
ATOM   482   C  CB  . THR A 1 62  ? 16.935  17.600  23.944  1.00 19.39 ? 94  THR A CB  1 
ATOM   483   O  OG1 . THR A 1 62  ? 17.770  17.603  22.780  1.00 18.82 ? 94  THR A OG1 1 
ATOM   484   C  CG2 . THR A 1 62  ? 16.071  18.844  23.935  1.00 20.50 ? 94  THR A CG2 1 
ATOM   485   N  N   . HIS A 1 63  ? 17.080  16.227  27.113  1.00 20.58 ? 95  HIS A N   1 
ATOM   486   C  CA  . HIS A 1 63  ? 16.258  15.940  28.285  1.00 20.47 ? 95  HIS A CA  1 
ATOM   487   C  C   . HIS A 1 63  ? 17.042  15.938  29.571  1.00 19.44 ? 95  HIS A C   1 
ATOM   488   O  O   . HIS A 1 63  ? 18.058  16.604  29.652  1.00 22.82 ? 95  HIS A O   1 
ATOM   489   C  CB  . HIS A 1 63  ? 15.545  14.628  28.096  1.00 23.32 ? 95  HIS A CB  1 
ATOM   490   C  CG  . HIS A 1 63  ? 14.571  14.654  26.965  1.00 26.23 ? 95  HIS A CG  1 
ATOM   491   N  ND1 . HIS A 1 63  ? 13.211  14.534  27.152  1.00 25.25 ? 95  HIS A ND1 1 
ATOM   492   C  CD2 . HIS A 1 63  ? 14.763  14.792  25.630  1.00 25.96 ? 95  HIS A CD2 1 
ATOM   493   C  CE1 . HIS A 1 63  ? 12.607  14.590  25.978  1.00 28.50 ? 95  HIS A CE1 1 
ATOM   494   N  NE2 . HIS A 1 63  ? 13.527  14.744  25.039  1.00 28.54 ? 95  HIS A NE2 1 
ATOM   495   N  N   . PHE A 1 64  ? 16.479  15.339  30.615  1.00 18.52 ? 96  PHE A N   1 
ATOM   496   C  CA  . PHE A 1 64  ? 17.132  15.226  31.925  1.00 18.95 ? 96  PHE A CA  1 
ATOM   497   C  C   . PHE A 1 64  ? 17.740  16.509  32.510  1.00 19.86 ? 96  PHE A C   1 
ATOM   498   O  O   . PHE A 1 64  ? 18.682  16.446  33.320  1.00 17.66 ? 96  PHE A O   1 
ATOM   499   C  CB  . PHE A 1 64  ? 18.182  14.115  31.838  1.00 19.28 ? 96  PHE A CB  1 
ATOM   500   C  CG  . PHE A 1 64  ? 17.738  12.964  30.987  1.00 19.42 ? 96  PHE A CG  1 
ATOM   501   C  CD1 . PHE A 1 64  ? 16.505  12.364  31.221  1.00 19.07 ? 96  PHE A CD1 1 
ATOM   502   C  CD2 . PHE A 1 64  ? 18.485  12.557  29.880  1.00 22.10 ? 96  PHE A CD2 1 
ATOM   503   C  CE1 . PHE A 1 64  ? 15.999  11.377  30.365  1.00 20.57 ? 96  PHE A CE1 1 
ATOM   504   C  CE2 . PHE A 1 64  ? 17.990  11.568  29.007  1.00 22.20 ? 96  PHE A CE2 1 
ATOM   505   C  CZ  . PHE A 1 64  ? 16.738  10.978  29.252  1.00 21.11 ? 96  PHE A CZ  1 
ATOM   506   N  N   . LYS A 1 65  ? 17.121  17.650  32.181  1.00 20.85 ? 97  LYS A N   1 
ATOM   507   C  CA  . LYS A 1 65  ? 17.568  18.987  32.612  1.00 21.63 ? 97  LYS A CA  1 
ATOM   508   C  C   . LYS A 1 65  ? 18.215  19.112  34.010  1.00 22.30 ? 97  LYS A C   1 
ATOM   509   O  O   . LYS A 1 65  ? 19.058  19.984  34.251  1.00 23.07 ? 97  LYS A O   1 
ATOM   510   C  CB  . LYS A 1 65  ? 16.409  19.970  32.491  1.00 22.55 ? 97  LYS A CB  1 
ATOM   511   C  CG  . LYS A 1 65  ? 16.774  21.435  32.739  1.00 28.23 ? 97  LYS A CG  1 
ATOM   512   C  CD  . LYS A 1 65  ? 17.834  21.920  31.741  1.00 32.26 ? 97  LYS A CD  1 
ATOM   513   C  CE  . LYS A 1 65  ? 18.200  23.415  31.880  1.00 33.98 ? 97  LYS A CE  1 
ATOM   514   N  NZ  . LYS A 1 65  ? 19.249  23.876  30.887  1.00 30.23 ? 97  LYS A NZ  1 
ATOM   515   N  N   . GLY A 1 66  ? 17.810  18.252  34.930  1.00 23.63 ? 98  GLY A N   1 
ATOM   516   C  CA  . GLY A 1 66  ? 18.363  18.298  36.270  1.00 26.41 ? 98  GLY A CA  1 
ATOM   517   C  C   . GLY A 1 66  ? 19.630  17.476  36.345  1.00 27.62 ? 98  GLY A C   1 
ATOM   518   O  O   . GLY A 1 66  ? 20.601  17.856  37.034  1.00 28.91 ? 98  GLY A O   1 
ATOM   519   N  N   . VAL A 1 67  ? 19.605  16.319  35.684  1.00 25.80 ? 99  VAL A N   1 
ATOM   520   C  CA  . VAL A 1 67  ? 20.784  15.467  35.641  1.00 24.87 ? 99  VAL A CA  1 
ATOM   521   C  C   . VAL A 1 67  ? 21.814  16.385  34.994  1.00 25.73 ? 99  VAL A C   1 
ATOM   522   O  O   . VAL A 1 67  ? 22.876  16.662  35.564  1.00 27.16 ? 99  VAL A O   1 
ATOM   523   C  CB  . VAL A 1 67  ? 20.575  14.290  34.691  1.00 24.68 ? 99  VAL A CB  1 
ATOM   524   C  CG1 . VAL A 1 67  ? 21.782  13.395  34.715  1.00 19.98 ? 99  VAL A CG1 1 
ATOM   525   C  CG2 . VAL A 1 67  ? 19.288  13.538  35.046  1.00 25.18 ? 99  VAL A CG2 1 
ATOM   526   N  N   . TRP A 1 68  ? 21.420  16.956  33.856  1.00 24.52 ? 100 TRP A N   1 
ATOM   527   C  CA  . TRP A 1 68  ? 22.280  17.855  33.120  1.00 22.77 ? 100 TRP A CA  1 
ATOM   528   C  C   . TRP A 1 68  ? 22.790  18.979  33.952  1.00 21.25 ? 100 TRP A C   1 
ATOM   529   O  O   . TRP A 1 68  ? 23.918  19.395  33.784  1.00 22.11 ? 100 TRP A O   1 
ATOM   530   C  CB  . TRP A 1 68  ? 21.573  18.382  31.886  1.00 23.16 ? 100 TRP A CB  1 
ATOM   531   C  CG  . TRP A 1 68  ? 21.702  17.416  30.792  1.00 24.35 ? 100 TRP A CG  1 
ATOM   532   C  CD1 . TRP A 1 68  ? 20.701  16.774  30.134  1.00 23.98 ? 100 TRP A CD1 1 
ATOM   533   C  CD2 . TRP A 1 68  ? 22.922  16.924  30.254  1.00 26.19 ? 100 TRP A CD2 1 
ATOM   534   N  NE1 . TRP A 1 68  ? 21.220  15.902  29.212  1.00 23.57 ? 100 TRP A NE1 1 
ATOM   535   C  CE2 . TRP A 1 68  ? 22.586  15.971  29.265  1.00 25.31 ? 100 TRP A CE2 1 
ATOM   536   C  CE3 . TRP A 1 68  ? 24.276  17.188  30.521  1.00 26.70 ? 100 TRP A CE3 1 
ATOM   537   C  CZ2 . TRP A 1 68  ? 23.552  15.272  28.535  1.00 27.09 ? 100 TRP A CZ2 1 
ATOM   538   C  CZ3 . TRP A 1 68  ? 25.251  16.487  29.795  1.00 28.67 ? 100 TRP A CZ3 1 
ATOM   539   C  CH2 . TRP A 1 68  ? 24.878  15.537  28.810  1.00 27.97 ? 100 TRP A CH2 1 
ATOM   540   N  N   . ASN A 1 69  ? 21.978  19.433  34.888  1.00 22.49 ? 101 ASN A N   1 
ATOM   541   C  CA  . ASN A 1 69  ? 22.385  20.527  35.738  1.00 24.70 ? 101 ASN A CA  1 
ATOM   542   C  C   . ASN A 1 69  ? 23.530  20.136  36.679  1.00 23.94 ? 101 ASN A C   1 
ATOM   543   O  O   . ASN A 1 69  ? 24.442  20.927  36.945  1.00 25.00 ? 101 ASN A O   1 
ATOM   544   C  CB  . ASN A 1 69  ? 21.215  21.077  36.524  1.00 23.73 ? 101 ASN A CB  1 
ATOM   545   C  CG  . ASN A 1 69  ? 21.595  22.315  37.250  1.00 26.76 ? 101 ASN A CG  1 
ATOM   546   O  OD1 . ASN A 1 69  ? 21.713  23.390  36.641  1.00 31.40 ? 101 ASN A OD1 1 
ATOM   547   N  ND2 . ASN A 1 69  ? 21.906  22.176  38.535  1.00 25.19 ? 101 ASN A ND2 1 
ATOM   548   N  N   . ILE A 1 70  ? 23.493  18.912  37.170  1.00 22.64 ? 102 ILE A N   1 
ATOM   549   C  CA  . ILE A 1 70  ? 24.555  18.420  38.043  1.00 24.46 ? 102 ILE A CA  1 
ATOM   550   C  C   . ILE A 1 70  ? 25.876  18.472  37.258  1.00 24.38 ? 102 ILE A C   1 
ATOM   551   O  O   . ILE A 1 70  ? 26.902  18.982  37.740  1.00 23.48 ? 102 ILE A O   1 
ATOM   552   C  CB  . ILE A 1 70  ? 24.258  16.966  38.444  1.00 26.52 ? 102 ILE A CB  1 
ATOM   553   C  CG1 . ILE A 1 70  ? 23.033  16.933  39.359  1.00 28.21 ? 102 ILE A CG1 1 
ATOM   554   C  CG2 . ILE A 1 70  ? 25.485  16.295  39.065  1.00 25.00 ? 102 ILE A CG2 1 
ATOM   555   C  CD1 . ILE A 1 70  ? 22.381  15.561  39.443  1.00 30.74 ? 102 ILE A CD1 1 
ATOM   556   N  N   . VAL A 1 71  ? 25.819  17.940  36.038  1.00 23.77 ? 103 VAL A N   1 
ATOM   557   C  CA  . VAL A 1 71  ? 26.953  17.919  35.109  1.00 23.02 ? 103 VAL A CA  1 
ATOM   558   C  C   . VAL A 1 71  ? 27.525  19.337  34.932  1.00 23.17 ? 103 VAL A C   1 
ATOM   559   O  O   . VAL A 1 71  ? 28.688  19.565  35.231  1.00 25.13 ? 103 VAL A O   1 
ATOM   560   C  CB  . VAL A 1 71  ? 26.505  17.381  33.732  1.00 22.08 ? 103 VAL A CB  1 
ATOM   561   C  CG1 . VAL A 1 71  ? 27.657  17.421  32.725  1.00 21.38 ? 103 VAL A CG1 1 
ATOM   562   C  CG2 . VAL A 1 71  ? 25.936  15.968  33.888  1.00 20.74 ? 103 VAL A CG2 1 
ATOM   563   N  N   . ASN A 1 72  ? 26.680  20.295  34.543  1.00 22.82 ? 104 ASN A N   1 
ATOM   564   C  CA  . ASN A 1 72  ? 27.076  21.687  34.342  1.00 22.19 ? 104 ASN A CA  1 
ATOM   565   C  C   . ASN A 1 72  ? 27.714  22.318  35.572  1.00 23.94 ? 104 ASN A C   1 
ATOM   566   O  O   . ASN A 1 72  ? 28.165  23.468  35.518  1.00 24.70 ? 104 ASN A O   1 
ATOM   567   C  CB  . ASN A 1 72  ? 25.870  22.528  33.942  1.00 20.56 ? 104 ASN A CB  1 
ATOM   568   C  CG  . ASN A 1 72  ? 25.475  22.350  32.481  1.00 20.60 ? 104 ASN A CG  1 
ATOM   569   O  OD1 . ASN A 1 72  ? 26.195  21.772  31.668  1.00 20.23 ? 104 ASN A OD1 1 
ATOM   570   N  ND2 . ASN A 1 72  ? 24.326  22.884  32.142  1.00 24.50 ? 104 ASN A ND2 1 
ATOM   571   N  N   . ASN A 1 73  ? 27.739  21.580  36.679  1.00 24.15 ? 105 ASN A N   1 
ATOM   572   C  CA  . ASN A 1 73  ? 28.317  22.070  37.918  1.00 26.19 ? 105 ASN A CA  1 
ATOM   573   C  C   . ASN A 1 73  ? 29.518  21.282  38.409  1.00 27.83 ? 105 ASN A C   1 
ATOM   574   O  O   . ASN A 1 73  ? 30.121  21.639  39.429  1.00 32.02 ? 105 ASN A O   1 
ATOM   575   C  CB  . ASN A 1 73  ? 27.247  22.171  39.014  1.00 26.21 ? 105 ASN A CB  1 
ATOM   576   C  CG  . ASN A 1 73  ? 26.364  23.428  38.868  1.00 29.53 ? 105 ASN A CG  1 
ATOM   577   O  OD1 . ASN A 1 73  ? 25.505  23.502  37.986  1.00 25.34 ? 105 ASN A OD1 1 
ATOM   578   N  ND2 . ASN A 1 73  ? 26.589  24.425  39.733  1.00 30.40 ? 105 ASN A ND2 1 
ATOM   579   N  N   . ILE A 1 74  A 29.833  20.179  37.734  1.00 28.84 ? 105 ILE A N   1 
ATOM   580   C  CA  . ILE A 1 74  A 31.008  19.364  38.070  1.00 28.53 ? 105 ILE A CA  1 
ATOM   581   C  C   . ILE A 1 74  A 31.968  19.614  36.898  1.00 27.44 ? 105 ILE A C   1 
ATOM   582   O  O   . ILE A 1 74  A 31.940  18.895  35.882  1.00 27.14 ? 105 ILE A O   1 
ATOM   583   C  CB  . ILE A 1 74  A 30.663  17.851  38.171  1.00 29.81 ? 105 ILE A CB  1 
ATOM   584   C  CG1 . ILE A 1 74  A 29.779  17.595  39.394  1.00 31.67 ? 105 ILE A CG1 1 
ATOM   585   C  CG2 . ILE A 1 74  A 31.944  16.998  38.257  1.00 28.72 ? 105 ILE A CG2 1 
ATOM   586   C  CD1 . ILE A 1 74  A 29.589  16.104  39.718  1.00 33.63 ? 105 ILE A CD1 1 
ATOM   587   N  N   . PRO A 1 75  ? 32.840  20.633  37.032  1.00 24.98 ? 106 PRO A N   1 
ATOM   588   C  CA  . PRO A 1 75  ? 33.825  21.043  36.025  1.00 24.34 ? 106 PRO A CA  1 
ATOM   589   C  C   . PRO A 1 75  ? 34.466  19.888  35.270  1.00 23.95 ? 106 PRO A C   1 
ATOM   590   O  O   . PRO A 1 75  ? 34.361  19.785  34.034  1.00 22.76 ? 106 PRO A O   1 
ATOM   591   C  CB  . PRO A 1 75  ? 34.845  21.795  36.865  1.00 23.59 ? 106 PRO A CB  1 
ATOM   592   C  CG  . PRO A 1 75  ? 33.980  22.474  37.852  1.00 24.13 ? 106 PRO A CG  1 
ATOM   593   C  CD  . PRO A 1 75  ? 33.100  21.333  38.301  1.00 23.51 ? 106 PRO A CD  1 
ATOM   594   N  N   . PHE A 1 76  ? 35.059  18.996  36.058  1.00 23.27 ? 107 PHE A N   1 
ATOM   595   C  CA  . PHE A 1 76  ? 35.748  17.789  35.605  1.00 22.29 ? 107 PHE A CA  1 
ATOM   596   C  C   . PHE A 1 76  ? 34.823  17.013  34.673  1.00 20.72 ? 107 PHE A C   1 
ATOM   597   O  O   . PHE A 1 76  ? 35.237  16.522  33.621  1.00 20.64 ? 107 PHE A O   1 
ATOM   598   C  CB  . PHE A 1 76  ? 36.117  16.954  36.830  1.00 24.96 ? 107 PHE A CB  1 
ATOM   599   C  CG  . PHE A 1 76  ? 35.977  17.718  38.134  1.00 34.38 ? 107 PHE A CG  1 
ATOM   600   C  CD1 . PHE A 1 76  ? 36.607  18.971  38.306  1.00 36.69 ? 107 PHE A CD1 1 
ATOM   601   C  CD2 . PHE A 1 76  ? 35.135  17.246  39.155  1.00 37.96 ? 107 PHE A CD2 1 
ATOM   602   C  CE1 . PHE A 1 76  ? 36.392  19.746  39.466  1.00 38.65 ? 107 PHE A CE1 1 
ATOM   603   C  CE2 . PHE A 1 76  ? 34.911  18.015  40.328  1.00 39.59 ? 107 PHE A CE2 1 
ATOM   604   C  CZ  . PHE A 1 76  ? 35.543  19.272  40.478  1.00 39.27 ? 107 PHE A CZ  1 
ATOM   605   N  N   . LEU A 1 77  ? 33.544  17.001  35.015  1.00 17.80 ? 108 LEU A N   1 
ATOM   606   C  CA  . LEU A 1 77  ? 32.564  16.313  34.210  1.00 17.33 ? 108 LEU A CA  1 
ATOM   607   C  C   . LEU A 1 77  ? 32.248  17.029  32.921  1.00 15.30 ? 108 LEU A C   1 
ATOM   608   O  O   . LEU A 1 77  ? 32.307  16.434  31.844  1.00 13.31 ? 108 LEU A O   1 
ATOM   609   C  CB  . LEU A 1 77  ? 31.266  16.121  35.000  1.00 20.43 ? 108 LEU A CB  1 
ATOM   610   C  CG  . LEU A 1 77  ? 31.092  14.739  35.633  1.00 20.52 ? 108 LEU A CG  1 
ATOM   611   C  CD1 . LEU A 1 77  ? 29.853  14.728  36.501  1.00 17.68 ? 108 LEU A CD1 1 
ATOM   612   C  CD2 . LEU A 1 77  ? 31.031  13.683  34.526  1.00 17.97 ? 108 LEU A CD2 1 
ATOM   613   N  N   . ARG A 1 78  ? 31.884  18.300  33.046  1.00 14.00 ? 109 ARG A N   1 
ATOM   614   C  CA  . ARG A 1 78  ? 31.510  19.098  31.893  1.00 16.39 ? 109 ARG A CA  1 
ATOM   615   C  C   . ARG A 1 78  ? 32.571  19.073  30.807  1.00 18.02 ? 109 ARG A C   1 
ATOM   616   O  O   . ARG A 1 78  ? 32.294  18.739  29.649  1.00 17.52 ? 109 ARG A O   1 
ATOM   617   C  CB  . ARG A 1 78  ? 31.241  20.539  32.308  1.00 15.60 ? 109 ARG A CB  1 
ATOM   618   C  CG  . ARG A 1 78  ? 30.871  21.459  31.132  1.00 14.37 ? 109 ARG A CG  1 
ATOM   619   C  CD  . ARG A 1 78  ? 30.634  22.877  31.617  1.00 12.48 ? 109 ARG A CD  1 
ATOM   620   N  NE  . ARG A 1 78  ? 30.365  23.794  30.512  1.00 13.56 ? 109 ARG A NE  1 
ATOM   621   C  CZ  . ARG A 1 78  ? 30.358  25.122  30.632  1.00 14.23 ? 109 ARG A CZ  1 
ATOM   622   N  NH1 . ARG A 1 78  ? 30.616  25.676  31.811  1.00 13.33 ? 109 ARG A NH1 1 
ATOM   623   N  NH2 . ARG A 1 78  ? 30.060  25.893  29.587  1.00 11.13 ? 109 ARG A NH2 1 
ATOM   624   N  N   . SER A 1 79  ? 33.783  19.455  31.193  1.00 18.95 ? 110 SER A N   1 
ATOM   625   C  CA  . SER A 1 79  ? 34.919  19.497  30.287  1.00 17.00 ? 110 SER A CA  1 
ATOM   626   C  C   . SER A 1 79  ? 34.999  18.129  29.642  1.00 15.94 ? 110 SER A C   1 
ATOM   627   O  O   . SER A 1 79  ? 35.064  17.997  28.420  1.00 16.49 ? 110 SER A O   1 
ATOM   628   C  CB  . SER A 1 79  ? 36.153  19.764  31.105  1.00 15.71 ? 110 SER A CB  1 
ATOM   629   O  OG  . SER A 1 79  ? 36.157  18.848  32.178  1.00 12.97 ? 110 SER A OG  1 
ATOM   630   N  N   . LEU A 1 80  ? 34.923  17.114  30.488  1.00 14.25 ? 111 LEU A N   1 
ATOM   631   C  CA  . LEU A 1 80  ? 34.950  15.742  30.041  1.00 15.55 ? 111 LEU A CA  1 
ATOM   632   C  C   . LEU A 1 80  ? 33.941  15.556  28.889  1.00 15.39 ? 111 LEU A C   1 
ATOM   633   O  O   . LEU A 1 80  ? 34.289  15.077  27.800  1.00 13.52 ? 111 LEU A O   1 
ATOM   634   C  CB  . LEU A 1 80  ? 34.634  14.841  31.239  1.00 16.73 ? 111 LEU A CB  1 
ATOM   635   C  CG  . LEU A 1 80  ? 34.732  13.305  31.227  1.00 22.47 ? 111 LEU A CG  1 
ATOM   636   C  CD1 . LEU A 1 80  ? 33.398  12.645  30.797  1.00 23.89 ? 111 LEU A CD1 1 
ATOM   637   C  CD2 . LEU A 1 80  ? 35.915  12.823  30.378  1.00 21.09 ? 111 LEU A CD2 1 
ATOM   638   N  N   . ILE A 1 81  ? 32.716  16.034  29.097  1.00 17.05 ? 112 ILE A N   1 
ATOM   639   C  CA  . ILE A 1 81  ? 31.644  15.926  28.080  1.00 15.85 ? 112 ILE A CA  1 
ATOM   640   C  C   . ILE A 1 81  ? 32.025  16.733  26.813  1.00 14.71 ? 112 ILE A C   1 
ATOM   641   O  O   . ILE A 1 81  ? 32.023  16.209  25.675  1.00 11.92 ? 112 ILE A O   1 
ATOM   642   C  CB  . ILE A 1 81  ? 30.262  16.466  28.614  1.00 14.57 ? 112 ILE A CB  1 
ATOM   643   C  CG1 . ILE A 1 81  ? 30.010  16.071  30.081  1.00 10.21 ? 112 ILE A CG1 1 
ATOM   644   C  CG2 . ILE A 1 81  ? 29.136  15.960  27.721  1.00 15.02 ? 112 ILE A CG2 1 
ATOM   645   C  CD1 . ILE A 1 81  ? 29.900  14.599  30.318  1.00 8.74  ? 112 ILE A CD1 1 
ATOM   646   N  N   . MET A 1 82  ? 32.386  17.997  27.047  1.00 13.92 ? 113 MET A N   1 
ATOM   647   C  CA  . MET A 1 82  ? 32.778  18.942  25.999  1.00 13.31 ? 113 MET A CA  1 
ATOM   648   C  C   . MET A 1 82  ? 33.818  18.287  25.076  1.00 11.52 ? 113 MET A C   1 
ATOM   649   O  O   . MET A 1 82  ? 33.745  18.395  23.839  1.00 8.41  ? 113 MET A O   1 
ATOM   650   C  CB  . MET A 1 82  ? 33.325  20.241  26.640  1.00 10.74 ? 113 MET A CB  1 
ATOM   651   C  CG  . MET A 1 82  ? 32.956  21.552  25.928  1.00 5.00  ? 113 MET A CG  1 
ATOM   652   S  SD  . MET A 1 82  ? 32.047  21.220  24.446  1.00 2.00  ? 113 MET A SD  1 
ATOM   653   C  CE  . MET A 1 82  ? 32.841  22.279  23.204  1.00 5.45  ? 113 MET A CE  1 
ATOM   654   N  N   . LYS A 1 83  ? 34.711  17.515  25.684  1.00 12.38 ? 114 LYS A N   1 
ATOM   655   C  CA  . LYS A 1 83  ? 35.744  16.860  24.911  1.00 16.85 ? 114 LYS A CA  1 
ATOM   656   C  C   . LYS A 1 83  ? 35.129  15.892  23.929  1.00 19.11 ? 114 LYS A C   1 
ATOM   657   O  O   . LYS A 1 83  ? 35.309  16.048  22.714  1.00 19.24 ? 114 LYS A O   1 
ATOM   658   C  CB  . LYS A 1 83  ? 36.753  16.139  25.798  1.00 14.97 ? 114 LYS A CB  1 
ATOM   659   C  CG  . LYS A 1 83  ? 38.076  15.838  25.096  1.00 12.42 ? 114 LYS A CG  1 
ATOM   660   C  CD  . LYS A 1 83  ? 39.134  15.349  26.098  1.00 17.37 ? 114 LYS A CD  1 
ATOM   661   C  CE  . LYS A 1 83  ? 39.299  16.305  27.290  1.00 19.05 ? 114 LYS A CE  1 
ATOM   662   N  NZ  . LYS A 1 83  ? 40.538  16.055  28.092  1.00 21.60 ? 114 LYS A NZ  1 
ATOM   663   N  N   . TYR A 1 84  ? 34.344  14.946  24.445  1.00 21.34 ? 115 TYR A N   1 
ATOM   664   C  CA  . TYR A 1 84  ? 33.705  13.940  23.580  1.00 24.16 ? 115 TYR A CA  1 
ATOM   665   C  C   . TYR A 1 84  ? 33.002  14.531  22.356  1.00 22.08 ? 115 TYR A C   1 
ATOM   666   O  O   . TYR A 1 84  ? 33.217  14.078  21.219  1.00 18.71 ? 115 TYR A O   1 
ATOM   667   C  CB  . TYR A 1 84  ? 32.710  13.082  24.360  1.00 30.94 ? 115 TYR A CB  1 
ATOM   668   C  CG  . TYR A 1 84  ? 31.580  12.519  23.505  1.00 39.87 ? 115 TYR A CG  1 
ATOM   669   C  CD1 . TYR A 1 84  ? 31.773  11.383  22.690  1.00 42.90 ? 115 TYR A CD1 1 
ATOM   670   C  CD2 . TYR A 1 84  ? 30.309  13.144  23.491  1.00 44.28 ? 115 TYR A CD2 1 
ATOM   671   C  CE1 . TYR A 1 84  ? 30.713  10.876  21.875  1.00 44.81 ? 115 TYR A CE1 1 
ATOM   672   C  CE2 . TYR A 1 84  ? 29.241  12.658  22.680  1.00 44.31 ? 115 TYR A CE2 1 
ATOM   673   C  CZ  . TYR A 1 84  ? 29.449  11.526  21.878  1.00 45.35 ? 115 TYR A CZ  1 
ATOM   674   O  OH  . TYR A 1 84  ? 28.398  11.065  21.101  1.00 43.39 ? 115 TYR A OH  1 
ATOM   675   N  N   . VAL A 1 85  ? 32.127  15.501  22.603  1.00 19.87 ? 116 VAL A N   1 
ATOM   676   C  CA  . VAL A 1 85  ? 31.423  16.118  21.510  1.00 18.59 ? 116 VAL A CA  1 
ATOM   677   C  C   . VAL A 1 85  ? 32.461  16.663  20.572  1.00 17.43 ? 116 VAL A C   1 
ATOM   678   O  O   . VAL A 1 85  ? 32.474  16.300  19.391  1.00 19.56 ? 116 VAL A O   1 
ATOM   679   C  CB  . VAL A 1 85  ? 30.421  17.231  21.981  1.00 20.29 ? 116 VAL A CB  1 
ATOM   680   C  CG1 . VAL A 1 85  ? 30.932  17.950  23.199  1.00 18.98 ? 116 VAL A CG1 1 
ATOM   681   C  CG2 . VAL A 1 85  ? 30.103  18.218  20.835  1.00 17.36 ? 116 VAL A CG2 1 
ATOM   682   N  N   . LEU A 1 86  ? 33.440  17.356  21.146  1.00 15.18 ? 117 LEU A N   1 
ATOM   683   C  CA  . LEU A 1 86  ? 34.500  17.987  20.367  1.00 16.19 ? 117 LEU A CA  1 
ATOM   684   C  C   . LEU A 1 86  ? 35.267  17.097  19.366  1.00 19.10 ? 117 LEU A C   1 
ATOM   685   O  O   . LEU A 1 86  ? 35.482  17.482  18.194  1.00 16.62 ? 117 LEU A O   1 
ATOM   686   C  CB  . LEU A 1 86  ? 35.458  18.675  21.322  1.00 12.70 ? 117 LEU A CB  1 
ATOM   687   C  CG  . LEU A 1 86  ? 35.810  20.130  21.034  1.00 11.73 ? 117 LEU A CG  1 
ATOM   688   C  CD1 . LEU A 1 86  ? 34.619  20.911  20.453  1.00 9.31  ? 117 LEU A CD1 1 
ATOM   689   C  CD2 . LEU A 1 86  ? 36.317  20.723  22.366  1.00 12.31 ? 117 LEU A CD2 1 
ATOM   690   N  N   . THR A 1 87  ? 35.621  15.891  19.812  1.00 24.08 ? 118 THR A N   1 
ATOM   691   C  CA  . THR A 1 87  ? 36.387  14.926  19.004  1.00 25.63 ? 118 THR A CA  1 
ATOM   692   C  C   . THR A 1 87  ? 35.563  14.179  17.960  1.00 27.53 ? 118 THR A C   1 
ATOM   693   O  O   . THR A 1 87  ? 35.877  14.232  16.749  1.00 27.57 ? 118 THR A O   1 
ATOM   694   C  CB  . THR A 1 87  ? 37.020  13.880  19.898  1.00 25.29 ? 118 THR A CB  1 
ATOM   695   O  OG1 . THR A 1 87  ? 35.978  13.233  20.652  1.00 23.39 ? 118 THR A OG1 1 
ATOM   696   C  CG2 . THR A 1 87  ? 38.060  14.537  20.845  1.00 24.90 ? 118 THR A CG2 1 
ATOM   697   N  N   . SER A 1 88  ? 34.553  13.449  18.451  1.00 29.13 ? 119 SER A N   1 
ATOM   698   C  CA  . SER A 1 88  ? 33.634  12.653  17.614  1.00 31.13 ? 119 SER A CA  1 
ATOM   699   C  C   . SER A 1 88  ? 33.217  13.461  16.382  1.00 30.76 ? 119 SER A C   1 
ATOM   700   O  O   . SER A 1 88  ? 33.394  13.043  15.222  1.00 28.95 ? 119 SER A O   1 
ATOM   701   C  CB  . SER A 1 88  ? 32.394  12.252  18.439  1.00 31.93 ? 119 SER A CB  1 
ATOM   702   O  OG  . SER A 1 88  ? 31.882  13.362  19.175  1.00 31.72 ? 119 SER A OG  1 
ATOM   703   N  N   . ARG A 1 89  ? 32.749  14.668  16.664  1.00 31.34 ? 120 ARG A N   1 
ATOM   704   C  CA  . ARG A 1 89  ? 32.319  15.597  15.643  1.00 32.31 ? 120 ARG A CA  1 
ATOM   705   C  C   . ARG A 1 89  ? 33.349  15.682  14.510  1.00 30.91 ? 120 ARG A C   1 
ATOM   706   O  O   . ARG A 1 89  ? 33.011  15.613  13.321  1.00 30.04 ? 120 ARG A O   1 
ATOM   707   C  CB  . ARG A 1 89  ? 32.146  16.980  16.288  1.00 32.58 ? 120 ARG A CB  1 
ATOM   708   C  CG  . ARG A 1 89  ? 30.700  17.492  16.370  1.00 35.78 ? 120 ARG A CG  1 
ATOM   709   C  CD  . ARG A 1 89  ? 29.768  16.640  17.260  1.00 38.62 ? 120 ARG A CD  1 
ATOM   710   N  NE  . ARG A 1 89  ? 28.515  17.368  17.519  1.00 45.19 ? 120 ARG A NE  1 
ATOM   711   C  CZ  . ARG A 1 89  ? 27.593  17.058  18.443  1.00 45.48 ? 120 ARG A CZ  1 
ATOM   712   N  NH1 . ARG A 1 89  ? 27.722  15.996  19.239  1.00 45.23 ? 120 ARG A NH1 1 
ATOM   713   N  NH2 . ARG A 1 89  ? 26.570  17.886  18.641  1.00 45.74 ? 120 ARG A NH2 1 
ATOM   714   N  N   . SER A 1 90  ? 34.615  15.692  14.896  1.00 29.91 ? 121 SER A N   1 
ATOM   715   C  CA  . SER A 1 90  ? 35.681  15.857  13.932  1.00 29.58 ? 121 SER A CA  1 
ATOM   716   C  C   . SER A 1 90  ? 36.173  14.686  13.066  1.00 28.02 ? 121 SER A C   1 
ATOM   717   O  O   . SER A 1 90  ? 36.566  14.911  11.904  1.00 27.15 ? 121 SER A O   1 
ATOM   718   C  CB  . SER A 1 90  ? 36.834  16.628  14.594  1.00 29.96 ? 121 SER A CB  1 
ATOM   719   O  OG  . SER A 1 90  ? 36.356  17.881  15.098  1.00 32.95 ? 121 SER A OG  1 
ATOM   720   N  N   . TYR A 1 91  ? 36.110  13.447  13.548  1.00 24.67 ? 122 TYR A N   1 
ATOM   721   C  CA  . TYR A 1 91  ? 36.590  12.364  12.690  1.00 23.79 ? 122 TYR A CA  1 
ATOM   722   C  C   . TYR A 1 91  ? 35.864  12.369  11.329  1.00 20.66 ? 122 TYR A C   1 
ATOM   723   O  O   . TYR A 1 91  ? 36.234  11.623  10.422  1.00 19.80 ? 122 TYR A O   1 
ATOM   724   C  CB  . TYR A 1 91  ? 36.418  10.990  13.358  1.00 29.48 ? 122 TYR A CB  1 
ATOM   725   C  CG  . TYR A 1 91  ? 35.069  10.275  13.087  1.00 35.82 ? 122 TYR A CG  1 
ATOM   726   C  CD1 . TYR A 1 91  ? 34.798  9.655   11.848  1.00 35.86 ? 122 TYR A CD1 1 
ATOM   727   C  CD2 . TYR A 1 91  ? 34.062  10.250  14.062  1.00 36.42 ? 122 TYR A CD2 1 
ATOM   728   C  CE1 . TYR A 1 91  ? 33.561  9.048   11.594  1.00 36.62 ? 122 TYR A CE1 1 
ATOM   729   C  CE2 . TYR A 1 91  ? 32.832  9.646   13.817  1.00 37.25 ? 122 TYR A CE2 1 
ATOM   730   C  CZ  . TYR A 1 91  ? 32.579  9.051   12.584  1.00 37.83 ? 122 TYR A CZ  1 
ATOM   731   O  OH  . TYR A 1 91  ? 31.323  8.507   12.345  1.00 38.24 ? 122 TYR A OH  1 
ATOM   732   N  N   . LEU A 1 92  ? 34.799  13.159  11.215  1.00 17.92 ? 123 LEU A N   1 
ATOM   733   C  CA  . LEU A 1 92  ? 34.018  13.207  9.988   1.00 15.15 ? 123 LEU A CA  1 
ATOM   734   C  C   . LEU A 1 92  ? 34.538  14.040  8.856   1.00 14.61 ? 123 LEU A C   1 
ATOM   735   O  O   . LEU A 1 92  ? 34.263  13.699  7.718   1.00 10.76 ? 123 LEU A O   1 
ATOM   736   C  CB  . LEU A 1 92  ? 32.566  13.607  10.265  1.00 12.76 ? 123 LEU A CB  1 
ATOM   737   C  CG  . LEU A 1 92  ? 31.625  12.581  10.919  1.00 9.67  ? 123 LEU A CG  1 
ATOM   738   C  CD1 . LEU A 1 92  ? 31.533  11.293  10.078  1.00 6.87  ? 123 LEU A CD1 1 
ATOM   739   C  CD2 . LEU A 1 92  ? 32.086  12.288  12.342  1.00 5.30  ? 123 LEU A CD2 1 
ATOM   740   N  N   . ILE A 1 93  ? 35.237  15.140  9.150   1.00 16.06 ? 124 ILE A N   1 
ATOM   741   C  CA  . ILE A 1 93  ? 35.781  16.019  8.089   1.00 18.10 ? 124 ILE A CA  1 
ATOM   742   C  C   . ILE A 1 93  ? 37.237  15.784  7.635   1.00 18.12 ? 124 ILE A C   1 
ATOM   743   O  O   . ILE A 1 93  ? 38.112  15.409  8.427   1.00 19.82 ? 124 ILE A O   1 
ATOM   744   C  CB  . ILE A 1 93  ? 35.615  17.518  8.409   1.00 20.13 ? 124 ILE A CB  1 
ATOM   745   C  CG1 . ILE A 1 93  ? 35.375  17.749  9.917   1.00 25.40 ? 124 ILE A CG1 1 
ATOM   746   C  CG2 . ILE A 1 93  ? 34.513  18.098  7.568   1.00 21.26 ? 124 ILE A CG2 1 
ATOM   747   C  CD1 . ILE A 1 93  ? 36.601  17.488  10.836  1.00 24.43 ? 124 ILE A CD1 1 
ATOM   748   N  N   . ASP A 1 94  ? 37.481  16.019  6.348   1.00 16.52 ? 125 ASP A N   1 
ATOM   749   C  CA  . ASP A 1 94  ? 38.797  15.838  5.724   1.00 15.31 ? 125 ASP A CA  1 
ATOM   750   C  C   . ASP A 1 94  ? 39.866  16.924  5.918   1.00 15.48 ? 125 ASP A C   1 
ATOM   751   O  O   . ASP A 1 94  ? 39.834  17.987  5.287   1.00 16.22 ? 125 ASP A O   1 
ATOM   752   C  CB  . ASP A 1 94  ? 38.626  15.600  4.228   1.00 14.30 ? 125 ASP A CB  1 
ATOM   753   C  CG  . ASP A 1 94  ? 38.413  14.160  3.908   1.00 17.79 ? 125 ASP A CG  1 
ATOM   754   O  OD1 . ASP A 1 94  ? 38.590  13.327  4.839   1.00 20.19 ? 125 ASP A OD1 1 
ATOM   755   O  OD2 . ASP A 1 94  ? 38.083  13.859  2.730   1.00 20.22 ? 125 ASP A OD2 1 
ATOM   756   N  N   . SER A 1 95  ? 40.874  16.610  6.711   1.00 14.09 ? 126 SER A N   1 
ATOM   757   C  CA  . SER A 1 95  ? 41.939  17.553  6.951   1.00 12.87 ? 126 SER A CA  1 
ATOM   758   C  C   . SER A 1 95  ? 43.257  16.816  7.029   1.00 10.97 ? 126 SER A C   1 
ATOM   759   O  O   . SER A 1 95  ? 43.455  15.991  7.927   1.00 12.81 ? 126 SER A O   1 
ATOM   760   C  CB  . SER A 1 95  ? 41.679  18.299  8.256   1.00 14.97 ? 126 SER A CB  1 
ATOM   761   O  OG  . SER A 1 95  ? 41.718  19.704  8.045   1.00 18.48 ? 126 SER A OG  1 
ATOM   762   N  N   . PRO A 1 96  ? 44.185  17.119  6.115   1.00 7.70  ? 127 PRO A N   1 
ATOM   763   C  CA  . PRO A 1 96  ? 44.021  18.103  5.057   1.00 5.61  ? 127 PRO A CA  1 
ATOM   764   C  C   . PRO A 1 96  ? 42.976  17.771  4.008   1.00 3.60  ? 127 PRO A C   1 
ATOM   765   O  O   . PRO A 1 96  ? 42.656  16.619  3.793   1.00 2.00  ? 127 PRO A O   1 
ATOM   766   C  CB  . PRO A 1 96  ? 45.421  18.161  4.437   1.00 6.91  ? 127 PRO A CB  1 
ATOM   767   C  CG  . PRO A 1 96  ? 46.293  17.907  5.584   1.00 9.72  ? 127 PRO A CG  1 
ATOM   768   C  CD  . PRO A 1 96  ? 45.603  16.738  6.226   1.00 9.03  ? 127 PRO A CD  1 
ATOM   769   N  N   . PRO A 1 97  ? 42.469  18.807  3.325   1.00 3.44  ? 128 PRO A N   1 
ATOM   770   C  CA  . PRO A 1 97  ? 41.472  18.830  2.267   1.00 4.03  ? 128 PRO A CA  1 
ATOM   771   C  C   . PRO A 1 97  ? 41.713  17.922  1.095   1.00 4.12  ? 128 PRO A C   1 
ATOM   772   O  O   . PRO A 1 97  ? 42.853  17.619  0.762   1.00 3.48  ? 128 PRO A O   1 
ATOM   773   C  CB  . PRO A 1 97  ? 41.487  20.294  1.820   1.00 4.42  ? 128 PRO A CB  1 
ATOM   774   C  CG  . PRO A 1 97  ? 42.720  20.844  2.355   1.00 2.00  ? 128 PRO A CG  1 
ATOM   775   C  CD  . PRO A 1 97  ? 42.823  20.193  3.670   1.00 3.29  ? 128 PRO A CD  1 
ATOM   776   N  N   . THR A 1 98  ? 40.610  17.555  0.441   1.00 6.28  ? 129 THR A N   1 
ATOM   777   C  CA  . THR A 1 98  ? 40.648  16.664  -0.700  1.00 8.19  ? 129 THR A CA  1 
ATOM   778   C  C   . THR A 1 98  ? 40.038  17.230  -1.974  1.00 8.49  ? 129 THR A C   1 
ATOM   779   O  O   . THR A 1 98  ? 40.627  18.126  -2.569  1.00 12.54 ? 129 THR A O   1 
ATOM   780   C  CB  . THR A 1 98  ? 40.033  15.258  -0.370  1.00 10.03 ? 129 THR A CB  1 
ATOM   781   O  OG1 . THR A 1 98  ? 38.701  15.406  0.163   1.00 10.87 ? 129 THR A OG1 1 
ATOM   782   C  CG2 . THR A 1 98  ? 40.912  14.506  0.638   1.00 11.48 ? 129 THR A CG2 1 
ATOM   783   N  N   . TYR A 1 99  ? 38.825  16.789  -2.326  1.00 7.08  ? 130 TYR A N   1 
ATOM   784   C  CA  . TYR A 1 99  ? 38.144  17.175  -3.591  1.00 6.76  ? 130 TYR A CA  1 
ATOM   785   C  C   . TYR A 1 99  ? 37.532  18.578  -3.759  1.00 8.44  ? 130 TYR A C   1 
ATOM   786   O  O   . TYR A 1 99  ? 37.533  19.445  -2.850  1.00 10.45 ? 130 TYR A O   1 
ATOM   787   C  CB  . TYR A 1 99  ? 37.021  16.174  -3.926  1.00 3.86  ? 130 TYR A CB  1 
ATOM   788   C  CG  . TYR A 1 99  ? 37.308  14.751  -3.568  1.00 2.00  ? 130 TYR A CG  1 
ATOM   789   C  CD1 . TYR A 1 99  ? 37.258  14.332  -2.237  1.00 2.00  ? 130 TYR A CD1 1 
ATOM   790   C  CD2 . TYR A 1 99  ? 37.678  13.842  -4.542  1.00 2.00  ? 130 TYR A CD2 1 
ATOM   791   C  CE1 . TYR A 1 99  ? 37.581  13.039  -1.884  1.00 4.36  ? 130 TYR A CE1 1 
ATOM   792   C  CE2 . TYR A 1 99  ? 38.000  12.542  -4.213  1.00 2.00  ? 130 TYR A CE2 1 
ATOM   793   C  CZ  . TYR A 1 99  ? 37.952  12.136  -2.882  1.00 4.34  ? 130 TYR A CZ  1 
ATOM   794   O  OH  . TYR A 1 99  ? 38.236  10.827  -2.552  1.00 4.31  ? 130 TYR A OH  1 
ATOM   795   N  N   . ASN A 1 100 ? 36.959  18.776  -4.942  1.00 8.02  ? 131 ASN A N   1 
ATOM   796   C  CA  . ASN A 1 100 ? 36.276  20.016  -5.270  1.00 5.32  ? 131 ASN A CA  1 
ATOM   797   C  C   . ASN A 1 100 ? 35.605  20.023  -6.650  1.00 5.14  ? 131 ASN A C   1 
ATOM   798   O  O   . ASN A 1 100 ? 35.706  19.084  -7.446  1.00 5.90  ? 131 ASN A O   1 
ATOM   799   C  CB  . ASN A 1 100 ? 37.220  21.204  -5.152  1.00 4.54  ? 131 ASN A CB  1 
ATOM   800   C  CG  . ASN A 1 100 ? 38.264  21.270  -6.274  1.00 5.22  ? 131 ASN A CG  1 
ATOM   801   O  OD1 . ASN A 1 100 ? 38.009  21.031  -7.478  1.00 2.14  ? 131 ASN A OD1 1 
ATOM   802   N  ND2 . ASN A 1 100 ? 39.442  21.677  -5.878  1.00 10.06 ? 131 ASN A ND2 1 
ATOM   803   N  N   . VAL A 1 101 ? 34.941  21.133  -6.920  1.00 5.06  ? 132 VAL A N   1 
ATOM   804   C  CA  . VAL A 1 101 ? 34.245  21.382  -8.171  1.00 4.08  ? 132 VAL A CA  1 
ATOM   805   C  C   . VAL A 1 101 ? 34.856  20.670  -9.367  1.00 4.86  ? 132 VAL A C   1 
ATOM   806   O  O   . VAL A 1 101 ? 34.134  20.042  -10.142 1.00 7.03  ? 132 VAL A O   1 
ATOM   807   C  CB  . VAL A 1 101 ? 34.253  22.889  -8.512  1.00 2.00  ? 132 VAL A CB  1 
ATOM   808   C  CG1 . VAL A 1 101 ? 33.311  23.152  -9.657  1.00 2.61  ? 132 VAL A CG1 1 
ATOM   809   C  CG2 . VAL A 1 101 ? 33.907  23.726  -7.292  1.00 3.69  ? 132 VAL A CG2 1 
ATOM   810   N  N   . HIS A 1 102 ? 36.174  20.799  -9.519  1.00 4.22  ? 133 HIS A N   1 
ATOM   811   C  CA  . HIS A 1 102 ? 36.876  20.208  -10.644 1.00 4.50  ? 133 HIS A CA  1 
ATOM   812   C  C   . HIS A 1 102 ? 37.605  18.903  -10.393 1.00 5.30  ? 133 HIS A C   1 
ATOM   813   O  O   . HIS A 1 102 ? 37.922  18.154  -11.339 1.00 2.96  ? 133 HIS A O   1 
ATOM   814   C  CB  . HIS A 1 102 ? 37.898  21.171  -11.161 1.00 8.26  ? 133 HIS A CB  1 
ATOM   815   C  CG  . HIS A 1 102 ? 37.317  22.415  -11.727 1.00 12.50 ? 133 HIS A CG  1 
ATOM   816   N  ND1 . HIS A 1 102 ? 37.582  23.661  -11.199 1.00 14.61 ? 133 HIS A ND1 1 
ATOM   817   C  CD2 . HIS A 1 102 ? 36.520  22.618  -12.800 1.00 12.84 ? 133 HIS A CD2 1 
ATOM   818   C  CE1 . HIS A 1 102 ? 36.975  24.578  -11.927 1.00 16.41 ? 133 HIS A CE1 1 
ATOM   819   N  NE2 . HIS A 1 102 ? 36.324  23.970  -12.905 1.00 15.67 ? 133 HIS A NE2 1 
ATOM   820   N  N   . TYR A 1 103 ? 37.909  18.629  -9.136  1.00 2.01  ? 134 TYR A N   1 
ATOM   821   C  CA  . TYR A 1 103 ? 38.636  17.428  -8.864  1.00 2.03  ? 134 TYR A CA  1 
ATOM   822   C  C   . TYR A 1 103 ? 37.926  16.384  -8.063  1.00 2.00  ? 134 TYR A C   1 
ATOM   823   O  O   . TYR A 1 103 ? 37.728  16.500  -6.849  1.00 2.00  ? 134 TYR A O   1 
ATOM   824   C  CB  . TYR A 1 103 ? 40.034  17.756  -8.306  1.00 3.25  ? 134 TYR A CB  1 
ATOM   825   C  CG  . TYR A 1 103 ? 40.892  18.528  -9.306  1.00 3.57  ? 134 TYR A CG  1 
ATOM   826   C  CD1 . TYR A 1 103 ? 41.568  17.871  -10.332 1.00 2.00  ? 134 TYR A CD1 1 
ATOM   827   C  CD2 . TYR A 1 103 ? 40.928  19.929  -9.299  1.00 3.50  ? 134 TYR A CD2 1 
ATOM   828   C  CE1 . TYR A 1 103 ? 42.241  18.572  -11.322 1.00 2.00  ? 134 TYR A CE1 1 
ATOM   829   C  CE2 . TYR A 1 103 ? 41.600  20.631  -10.301 1.00 2.15  ? 134 TYR A CE2 1 
ATOM   830   C  CZ  . TYR A 1 103 ? 42.248  19.933  -11.303 1.00 2.00  ? 134 TYR A CZ  1 
ATOM   831   O  OH  . TYR A 1 103 ? 42.907  20.575  -12.300 1.00 2.00  ? 134 TYR A OH  1 
ATOM   832   N  N   . GLY A 1 104 ? 37.515  15.364  -8.801  1.00 2.37  ? 135 GLY A N   1 
ATOM   833   C  CA  . GLY A 1 104 ? 36.868  14.224  -8.198  1.00 4.45  ? 135 GLY A CA  1 
ATOM   834   C  C   . GLY A 1 104 ? 37.936  13.329  -7.610  1.00 5.31  ? 135 GLY A C   1 
ATOM   835   O  O   . GLY A 1 104 ? 37.637  12.369  -6.898  1.00 7.45  ? 135 GLY A O   1 
ATOM   836   N  N   . TYR A 1 105 ? 39.178  13.573  -8.022  1.00 5.08  ? 136 TYR A N   1 
ATOM   837   C  CA  . TYR A 1 105 ? 40.320  12.838  -7.520  1.00 3.66  ? 136 TYR A CA  1 
ATOM   838   C  C   . TYR A 1 105 ? 41.138  13.787  -6.691  1.00 3.29  ? 136 TYR A C   1 
ATOM   839   O  O   . TYR A 1 105 ? 40.990  14.980  -6.840  1.00 4.78  ? 136 TYR A O   1 
ATOM   840   C  CB  . TYR A 1 105 ? 41.149  12.232  -8.629  1.00 2.35  ? 136 TYR A CB  1 
ATOM   841   C  CG  . TYR A 1 105 ? 41.482  13.114  -9.783  1.00 2.00  ? 136 TYR A CG  1 
ATOM   842   C  CD1 . TYR A 1 105 ? 42.189  14.285  -9.615  1.00 4.54  ? 136 TYR A CD1 1 
ATOM   843   C  CD2 . TYR A 1 105 ? 41.130  12.739  -11.073 1.00 2.07  ? 136 TYR A CD2 1 
ATOM   844   C  CE1 . TYR A 1 105 ? 42.534  15.055  -10.718 1.00 4.46  ? 136 TYR A CE1 1 
ATOM   845   C  CE2 . TYR A 1 105 ? 41.460  13.497  -12.158 1.00 2.00  ? 136 TYR A CE2 1 
ATOM   846   C  CZ  . TYR A 1 105 ? 42.153  14.645  -11.981 1.00 2.05  ? 136 TYR A CZ  1 
ATOM   847   O  OH  . TYR A 1 105 ? 42.430  15.387  -13.085 1.00 4.31  ? 136 TYR A OH  1 
ATOM   848   N  N   . LYS A 1 106 ? 42.047  13.269  -5.875  1.00 4.74  ? 137 LYS A N   1 
ATOM   849   C  CA  . LYS A 1 106 ? 42.834  14.108  -4.984  1.00 5.07  ? 137 LYS A CA  1 
ATOM   850   C  C   . LYS A 1 106 ? 43.751  15.253  -5.465  1.00 5.22  ? 137 LYS A C   1 
ATOM   851   O  O   . LYS A 1 106 ? 43.824  16.281  -4.783  1.00 7.04  ? 137 LYS A O   1 
ATOM   852   C  CB  . LYS A 1 106 ? 43.521  13.256  -3.946  1.00 2.01  ? 137 LYS A CB  1 
ATOM   853   C  CG  . LYS A 1 106 ? 42.674  13.058  -2.740  1.00 2.00  ? 137 LYS A CG  1 
ATOM   854   C  CD  . LYS A 1 106 ? 42.543  11.616  -2.496  1.00 2.02  ? 137 LYS A CD  1 
ATOM   855   C  CE  . LYS A 1 106 ? 42.405  11.354  -1.041  1.00 2.00  ? 137 LYS A CE  1 
ATOM   856   N  NZ  . LYS A 1 106 ? 42.513  9.910   -0.863  1.00 2.00  ? 137 LYS A NZ  1 
ATOM   857   N  N   . SER A 1 107 ? 44.444  15.080  -6.585  1.00 2.00  ? 138 SER A N   1 
ATOM   858   C  CA  . SER A 1 107 ? 45.308  16.117  -7.149  1.00 2.00  ? 138 SER A CA  1 
ATOM   859   C  C   . SER A 1 107 ? 46.010  17.231  -6.298  1.00 2.52  ? 138 SER A C   1 
ATOM   860   O  O   . SER A 1 107 ? 45.464  17.728  -5.320  1.00 2.22  ? 138 SER A O   1 
ATOM   861   C  CB  . SER A 1 107 ? 44.577  16.724  -8.328  1.00 2.00  ? 138 SER A CB  1 
ATOM   862   O  OG  . SER A 1 107 ? 44.364  18.088  -8.136  1.00 2.00  ? 138 SER A OG  1 
ATOM   863   N  N   . TRP A 1 108 ? 47.220  17.650  -6.689  1.00 3.40  ? 139 TRP A N   1 
ATOM   864   C  CA  . TRP A 1 108 ? 47.907  18.720  -5.936  1.00 4.72  ? 139 TRP A CA  1 
ATOM   865   C  C   . TRP A 1 108 ? 47.118  20.047  -6.176  1.00 5.00  ? 139 TRP A C   1 
ATOM   866   O  O   . TRP A 1 108 ? 46.818  20.785  -5.228  1.00 2.00  ? 139 TRP A O   1 
ATOM   867   C  CB  . TRP A 1 108 ? 49.413  18.840  -6.344  1.00 4.90  ? 139 TRP A CB  1 
ATOM   868   C  CG  . TRP A 1 108 ? 50.242  19.790  -5.488  1.00 2.07  ? 139 TRP A CG  1 
ATOM   869   C  CD1 . TRP A 1 108 ? 50.519  21.089  -5.760  1.00 3.40  ? 139 TRP A CD1 1 
ATOM   870   C  CD2 . TRP A 1 108 ? 50.702  19.560  -4.164  1.00 2.00  ? 139 TRP A CD2 1 
ATOM   871   N  NE1 . TRP A 1 108 ? 51.080  21.693  -4.672  1.00 4.22  ? 139 TRP A NE1 1 
ATOM   872   C  CE2 . TRP A 1 108 ? 51.202  20.775  -3.673  1.00 2.00  ? 139 TRP A CE2 1 
ATOM   873   C  CE3 . TRP A 1 108 ? 50.723  18.450  -3.338  1.00 2.00  ? 139 TRP A CE3 1 
ATOM   874   C  CZ2 . TRP A 1 108 ? 51.704  20.918  -2.392  1.00 2.00  ? 139 TRP A CZ2 1 
ATOM   875   C  CZ3 . TRP A 1 108 ? 51.224  18.587  -2.058  1.00 2.00  ? 139 TRP A CZ3 1 
ATOM   876   C  CH2 . TRP A 1 108 ? 51.706  19.811  -1.597  1.00 2.07  ? 139 TRP A CH2 1 
ATOM   877   N  N   . GLU A 1 109 ? 46.703  20.268  -7.432  1.00 4.19  ? 140 GLU A N   1 
ATOM   878   C  CA  . GLU A 1 109 ? 45.933  21.439  -7.853  1.00 2.00  ? 140 GLU A CA  1 
ATOM   879   C  C   . GLU A 1 109 ? 44.776  21.709  -6.919  1.00 2.77  ? 140 GLU A C   1 
ATOM   880   O  O   . GLU A 1 109 ? 44.480  22.855  -6.582  1.00 5.66  ? 140 GLU A O   1 
ATOM   881   C  CB  . GLU A 1 109 ? 45.397  21.229  -9.257  1.00 2.00  ? 140 GLU A CB  1 
ATOM   882   C  CG  . GLU A 1 109 ? 44.408  22.251  -9.702  1.00 2.00  ? 140 GLU A CG  1 
ATOM   883   C  CD  . GLU A 1 109 ? 44.928  23.669  -9.627  1.00 5.38  ? 140 GLU A CD  1 
ATOM   884   O  OE1 . GLU A 1 109 ? 46.052  23.922  -10.105 1.00 10.36 ? 140 GLU A OE1 1 
ATOM   885   O  OE2 . GLU A 1 109 ? 44.210  24.541  -9.090  1.00 5.86  ? 140 GLU A OE2 1 
ATOM   886   N  N   . ALA A 1 110 ? 44.077  20.649  -6.566  1.00 2.00  ? 141 ALA A N   1 
ATOM   887   C  CA  . ALA A 1 110 ? 42.964  20.729  -5.655  1.00 2.00  ? 141 ALA A CA  1 
ATOM   888   C  C   . ALA A 1 110 ? 43.526  21.153  -4.314  1.00 2.00  ? 141 ALA A C   1 
ATOM   889   O  O   . ALA A 1 110 ? 43.269  22.268  -3.858  1.00 4.23  ? 141 ALA A O   1 
ATOM   890   C  CB  . ALA A 1 110 ? 42.279  19.372  -5.530  1.00 2.02  ? 141 ALA A CB  1 
ATOM   891   N  N   . PHE A 1 111 ? 44.363  20.306  -3.731  1.00 2.07  ? 142 PHE A N   1 
ATOM   892   C  CA  . PHE A 1 111 ? 44.944  20.594  -2.431  1.00 4.69  ? 142 PHE A CA  1 
ATOM   893   C  C   . PHE A 1 111 ? 45.553  21.985  -2.246  1.00 7.34  ? 142 PHE A C   1 
ATOM   894   O  O   . PHE A 1 111 ? 45.502  22.556  -1.145  1.00 4.81  ? 142 PHE A O   1 
ATOM   895   C  CB  . PHE A 1 111 ? 46.049  19.612  -2.071  1.00 4.29  ? 142 PHE A CB  1 
ATOM   896   C  CG  . PHE A 1 111 ? 46.842  20.067  -0.898  1.00 2.00  ? 142 PHE A CG  1 
ATOM   897   C  CD1 . PHE A 1 111 ? 46.292  20.024  0.379   1.00 3.01  ? 142 PHE A CD1 1 
ATOM   898   C  CD2 . PHE A 1 111 ? 48.046  20.694  -1.075  1.00 2.00  ? 142 PHE A CD2 1 
ATOM   899   C  CE1 . PHE A 1 111 ? 46.929  20.612  1.459   1.00 2.00  ? 142 PHE A CE1 1 
ATOM   900   C  CE2 . PHE A 1 111 ? 48.677  21.276  -0.005  1.00 5.22  ? 142 PHE A CE2 1 
ATOM   901   C  CZ  . PHE A 1 111 ? 48.116  21.236  1.267   1.00 2.00  ? 142 PHE A CZ  1 
ATOM   902   N  N   . SER A 1 112 ? 46.243  22.457  -3.281  1.00 7.43  ? 143 SER A N   1 
ATOM   903   C  CA  . SER A 1 112 ? 46.913  23.736  -3.238  1.00 6.17  ? 143 SER A CA  1 
ATOM   904   C  C   . SER A 1 112 ? 46.068  24.964  -3.525  1.00 7.70  ? 143 SER A C   1 
ATOM   905   O  O   . SER A 1 112 ? 46.208  25.960  -2.814  1.00 12.39 ? 143 SER A O   1 
ATOM   906   C  CB  . SER A 1 112 ? 48.115  23.718  -4.170  1.00 6.71  ? 143 SER A CB  1 
ATOM   907   O  OG  . SER A 1 112 ? 47.734  23.436  -5.499  1.00 4.50  ? 143 SER A OG  1 
ATOM   908   N  N   . ASN A 1 113 ? 45.203  24.925  -4.542  1.00 7.36  ? 144 ASN A N   1 
ATOM   909   C  CA  . ASN A 1 113 ? 44.385  26.104  -4.883  1.00 6.32  ? 144 ASN A CA  1 
ATOM   910   C  C   . ASN A 1 113 ? 43.428  26.655  -3.822  1.00 3.80  ? 144 ASN A C   1 
ATOM   911   O  O   . ASN A 1 113 ? 42.334  26.169  -3.691  1.00 6.28  ? 144 ASN A O   1 
ATOM   912   C  CB  . ASN A 1 113 ? 43.608  25.880  -6.163  1.00 3.43  ? 144 ASN A CB  1 
ATOM   913   C  CG  . ASN A 1 113 ? 43.283  27.182  -6.820  1.00 3.69  ? 144 ASN A CG  1 
ATOM   914   O  OD1 . ASN A 1 113 ? 42.881  28.142  -6.148  1.00 2.00  ? 144 ASN A OD1 1 
ATOM   915   N  ND2 . ASN A 1 113 ? 43.607  27.276  -8.096  1.00 3.66  ? 144 ASN A ND2 1 
ATOM   916   N  N   . LEU A 1 114 ? 43.814  27.700  -3.113  1.00 2.70  ? 145 LEU A N   1 
ATOM   917   C  CA  . LEU A 1 114 ? 42.963  28.214  -2.070  1.00 2.00  ? 145 LEU A CA  1 
ATOM   918   C  C   . LEU A 1 114 ? 41.733  28.967  -2.526  1.00 3.43  ? 145 LEU A C   1 
ATOM   919   O  O   . LEU A 1 114 ? 40.907  29.353  -1.682  1.00 6.15  ? 145 LEU A O   1 
ATOM   920   C  CB  . LEU A 1 114 ? 43.752  29.071  -1.108  1.00 3.10  ? 145 LEU A CB  1 
ATOM   921   C  CG  . LEU A 1 114 ? 44.736  28.390  -0.183  1.00 2.00  ? 145 LEU A CG  1 
ATOM   922   C  CD1 . LEU A 1 114 ? 45.321  29.409  0.764   1.00 3.16  ? 145 LEU A CD1 1 
ATOM   923   C  CD2 . LEU A 1 114 ? 44.013  27.381  0.595   1.00 2.00  ? 145 LEU A CD2 1 
ATOM   924   N  N   . SER A 1 115 ? 41.593  29.198  -3.822  1.00 2.00  ? 146 SER A N   1 
ATOM   925   C  CA  . SER A 1 115 ? 40.424  29.902  -4.285  1.00 2.55  ? 146 SER A CA  1 
ATOM   926   C  C   . SER A 1 115 ? 39.156  29.040  -4.341  1.00 2.90  ? 146 SER A C   1 
ATOM   927   O  O   . SER A 1 115 ? 38.047  29.542  -4.317  1.00 4.88  ? 146 SER A O   1 
ATOM   928   C  CB  . SER A 1 115 ? 40.716  30.505  -5.636  1.00 7.35  ? 146 SER A CB  1 
ATOM   929   O  OG  . SER A 1 115 ? 41.764  31.440  -5.515  1.00 12.96 ? 146 SER A OG  1 
ATOM   930   N  N   . TYR A 1 116 ? 39.329  27.742  -4.463  1.00 2.00  ? 147 TYR A N   1 
ATOM   931   C  CA  . TYR A 1 116 ? 38.232  26.804  -4.493  1.00 2.00  ? 147 TYR A CA  1 
ATOM   932   C  C   . TYR A 1 116 ? 37.606  26.638  -3.110  1.00 3.45  ? 147 TYR A C   1 
ATOM   933   O  O   . TYR A 1 116 ? 38.170  27.062  -2.101  1.00 6.91  ? 147 TYR A O   1 
ATOM   934   C  CB  . TYR A 1 116 ? 38.777  25.444  -4.870  1.00 2.45  ? 147 TYR A CB  1 
ATOM   935   C  CG  . TYR A 1 116 ? 39.112  25.242  -6.316  1.00 2.00  ? 147 TYR A CG  1 
ATOM   936   C  CD1 . TYR A 1 116 ? 38.427  25.888  -7.310  1.00 2.60  ? 147 TYR A CD1 1 
ATOM   937   C  CD2 . TYR A 1 116 ? 40.032  24.307  -6.683  1.00 2.00  ? 147 TYR A CD2 1 
ATOM   938   C  CE1 . TYR A 1 116 ? 38.644  25.582  -8.626  1.00 2.00  ? 147 TYR A CE1 1 
ATOM   939   C  CE2 . TYR A 1 116 ? 40.250  24.015  -7.991  1.00 2.24  ? 147 TYR A CE2 1 
ATOM   940   C  CZ  . TYR A 1 116 ? 39.556  24.650  -8.952  1.00 2.00  ? 147 TYR A CZ  1 
ATOM   941   O  OH  . TYR A 1 116 ? 39.796  24.331  -10.250 1.00 2.00  ? 147 TYR A OH  1 
ATOM   942   N  N   . TYR A 1 117 ? 36.431  26.022  -3.063  1.00 4.82  ? 148 TYR A N   1 
ATOM   943   C  CA  . TYR A 1 117 ? 35.757  25.742  -1.801  1.00 4.55  ? 148 TYR A CA  1 
ATOM   944   C  C   . TYR A 1 117 ? 36.040  24.276  -1.800  1.00 2.00  ? 148 TYR A C   1 
ATOM   945   O  O   . TYR A 1 117 ? 35.992  23.660  -2.861  1.00 2.00  ? 148 TYR A O   1 
ATOM   946   C  CB  . TYR A 1 117 ? 34.225  25.943  -1.912  1.00 6.29  ? 148 TYR A CB  1 
ATOM   947   C  CG  . TYR A 1 117 ? 33.676  27.323  -1.596  1.00 2.00  ? 148 TYR A CG  1 
ATOM   948   C  CD1 . TYR A 1 117 ? 33.557  27.758  -0.264  1.00 2.00  ? 148 TYR A CD1 1 
ATOM   949   C  CD2 . TYR A 1 117 ? 33.276  28.188  -2.625  1.00 2.00  ? 148 TYR A CD2 1 
ATOM   950   C  CE1 . TYR A 1 117 ? 33.061  29.029  0.036   1.00 2.00  ? 148 TYR A CE1 1 
ATOM   951   C  CE2 . TYR A 1 117 ? 32.775  29.451  -2.346  1.00 2.00  ? 148 TYR A CE2 1 
ATOM   952   C  CZ  . TYR A 1 117 ? 32.675  29.869  -1.006  1.00 3.60  ? 148 TYR A CZ  1 
ATOM   953   O  OH  . TYR A 1 117 ? 32.213  31.115  -0.687  1.00 2.00  ? 148 TYR A OH  1 
ATOM   954   N  N   . THR A 1 118 ? 36.350  23.701  -0.658  1.00 2.00  ? 149 THR A N   1 
ATOM   955   C  CA  . THR A 1 118 ? 36.612  22.278  -0.690  1.00 4.84  ? 149 THR A CA  1 
ATOM   956   C  C   . THR A 1 118 ? 35.301  21.538  -0.835  1.00 7.31  ? 149 THR A C   1 
ATOM   957   O  O   . THR A 1 118 ? 34.221  22.139  -0.689  1.00 9.31  ? 149 THR A O   1 
ATOM   958   C  CB  . THR A 1 118 ? 37.338  21.806  0.551   1.00 5.10  ? 149 THR A CB  1 
ATOM   959   O  OG1 . THR A 1 118 ? 37.695  20.428  0.384   1.00 7.77  ? 149 THR A OG1 1 
ATOM   960   C  CG2 . THR A 1 118 ? 36.477  21.989  1.778   1.00 4.36  ? 149 THR A CG2 1 
ATOM   961   N  N   . ARG A 1 119 ? 35.366  20.247  -1.136  1.00 7.23  ? 150 ARG A N   1 
ATOM   962   C  CA  . ARG A 1 119 ? 34.129  19.491  -1.270  1.00 6.83  ? 150 ARG A CA  1 
ATOM   963   C  C   . ARG A 1 119 ? 34.102  18.262  -0.371  1.00 7.26  ? 150 ARG A C   1 
ATOM   964   O  O   . ARG A 1 119 ? 35.060  17.496  -0.369  1.00 8.19  ? 150 ARG A O   1 
ATOM   965   C  CB  . ARG A 1 119 ? 33.940  19.076  -2.710  1.00 6.34  ? 150 ARG A CB  1 
ATOM   966   C  CG  . ARG A 1 119 ? 32.491  18.960  -3.059  1.00 3.59  ? 150 ARG A CG  1 
ATOM   967   C  CD  . ARG A 1 119 ? 31.957  20.255  -3.533  1.00 2.04  ? 150 ARG A CD  1 
ATOM   968   N  NE  . ARG A 1 119 ? 31.584  20.156  -4.930  1.00 2.63  ? 150 ARG A NE  1 
ATOM   969   C  CZ  . ARG A 1 119 ? 30.786  19.214  -5.410  1.00 2.63  ? 150 ARG A CZ  1 
ATOM   970   N  NH1 . ARG A 1 119 ? 30.271  18.293  -4.589  1.00 3.80  ? 150 ARG A NH1 1 
ATOM   971   N  NH2 . ARG A 1 119 ? 30.535  19.178  -6.711  1.00 2.00  ? 150 ARG A NH2 1 
ATOM   972   N  N   . ALA A 1 120 ? 33.015  18.075  0.385   1.00 6.67  ? 151 ALA A N   1 
ATOM   973   C  CA  . ALA A 1 120 ? 32.877  16.925  1.290   1.00 3.70  ? 151 ALA A CA  1 
ATOM   974   C  C   . ALA A 1 120 ? 32.573  15.642  0.529   1.00 2.00  ? 151 ALA A C   1 
ATOM   975   O  O   . ALA A 1 120 ? 32.710  14.552  1.056   1.00 2.04  ? 151 ALA A O   1 
ATOM   976   C  CB  . ALA A 1 120 ? 31.816  17.185  2.355   1.00 2.00  ? 151 ALA A CB  1 
ATOM   977   N  N   . LEU A 1 121 ? 32.196  15.767  -0.726  1.00 2.00  ? 152 LEU A N   1 
ATOM   978   C  CA  . LEU A 1 121 ? 31.899  14.602  -1.541  1.00 2.00  ? 152 LEU A CA  1 
ATOM   979   C  C   . LEU A 1 121 ? 32.261  15.043  -2.904  1.00 2.00  ? 152 LEU A C   1 
ATOM   980   O  O   . LEU A 1 121 ? 31.981  16.138  -3.296  1.00 2.00  ? 152 LEU A O   1 
ATOM   981   C  CB  . LEU A 1 121 ? 30.391  14.228  -1.509  1.00 8.02  ? 152 LEU A CB  1 
ATOM   982   C  CG  . LEU A 1 121 ? 29.764  13.012  -0.763  1.00 5.02  ? 152 LEU A CG  1 
ATOM   983   C  CD1 . LEU A 1 121 ? 29.523  11.887  -1.711  1.00 5.35  ? 152 LEU A CD1 1 
ATOM   984   C  CD2 . LEU A 1 121 ? 30.617  12.559  0.400   1.00 2.94  ? 152 LEU A CD2 1 
ATOM   985   N  N   . PRO A 1 122 ? 32.896  14.193  -3.651  1.00 2.00  ? 153 PRO A N   1 
ATOM   986   C  CA  . PRO A 1 122 ? 33.282  14.565  -4.993  1.00 2.00  ? 153 PRO A CA  1 
ATOM   987   C  C   . PRO A 1 122 ? 32.103  14.946  -5.833  1.00 2.00  ? 153 PRO A C   1 
ATOM   988   O  O   . PRO A 1 122 ? 30.959  14.706  -5.472  1.00 2.01  ? 153 PRO A O   1 
ATOM   989   C  CB  . PRO A 1 122 ? 33.862  13.268  -5.528  1.00 2.00  ? 153 PRO A CB  1 
ATOM   990   C  CG  . PRO A 1 122 ? 33.026  12.227  -4.865  1.00 2.00  ? 153 PRO A CG  1 
ATOM   991   C  CD  . PRO A 1 122 ? 33.050  12.751  -3.444  1.00 3.94  ? 153 PRO A CD  1 
ATOM   992   N  N   . PRO A 1 123 ? 32.354  15.685  -6.898  1.00 2.00  ? 154 PRO A N   1 
ATOM   993   C  CA  . PRO A 1 123 ? 31.222  16.028  -7.743  1.00 3.42  ? 154 PRO A CA  1 
ATOM   994   C  C   . PRO A 1 123 ? 30.955  14.765  -8.559  1.00 5.55  ? 154 PRO A C   1 
ATOM   995   O  O   . PRO A 1 123 ? 31.603  13.731  -8.363  1.00 6.78  ? 154 PRO A O   1 
ATOM   996   C  CB  . PRO A 1 123 ? 31.794  17.111  -8.650  1.00 5.05  ? 154 PRO A CB  1 
ATOM   997   C  CG  . PRO A 1 123 ? 33.260  16.800  -8.702  1.00 2.48  ? 154 PRO A CG  1 
ATOM   998   C  CD  . PRO A 1 123 ? 33.527  16.492  -7.245  1.00 3.07  ? 154 PRO A CD  1 
ATOM   999   N  N   . VAL A 1 124 ? 30.023  14.846  -9.492  1.00 6.14  ? 155 VAL A N   1 
ATOM   1000  C  CA  . VAL A 1 124 ? 29.698  13.710  -10.329 1.00 5.51  ? 155 VAL A CA  1 
ATOM   1001  C  C   . VAL A 1 124 ? 30.347  13.870  -11.685 1.00 6.21  ? 155 VAL A C   1 
ATOM   1002  O  O   . VAL A 1 124 ? 30.444  14.962  -12.221 1.00 6.88  ? 155 VAL A O   1 
ATOM   1003  C  CB  . VAL A 1 124 ? 28.172  13.533  -10.466 1.00 4.91  ? 155 VAL A CB  1 
ATOM   1004  C  CG1 . VAL A 1 124 ? 27.853  12.342  -11.339 1.00 4.78  ? 155 VAL A CG1 1 
ATOM   1005  C  CG2 . VAL A 1 124 ? 27.548  13.354  -9.083  1.00 2.01  ? 155 VAL A CG2 1 
ATOM   1006  N  N   . ALA A 1 125 ? 30.842  12.769  -12.216 1.00 8.63  ? 156 ALA A N   1 
ATOM   1007  C  CA  . ALA A 1 125 ? 31.504  12.788  -13.509 1.00 11.52 ? 156 ALA A CA  1 
ATOM   1008  C  C   . ALA A 1 125 ? 30.654  13.468  -14.562 1.00 10.29 ? 156 ALA A C   1 
ATOM   1009  O  O   . ALA A 1 125 ? 29.465  13.205  -14.689 1.00 9.52  ? 156 ALA A O   1 
ATOM   1010  C  CB  . ALA A 1 125 ? 31.859  11.354  -13.957 1.00 12.16 ? 156 ALA A CB  1 
ATOM   1011  N  N   . ASP A 1 126 ? 31.287  14.315  -15.348 1.00 12.95 ? 157 ASP A N   1 
ATOM   1012  C  CA  . ASP A 1 126 ? 30.563  14.995  -16.401 1.00 18.83 ? 157 ASP A CA  1 
ATOM   1013  C  C   . ASP A 1 126 ? 30.169  13.998  -17.485 1.00 18.99 ? 157 ASP A C   1 
ATOM   1014  O  O   . ASP A 1 126 ? 29.462  14.361  -18.414 1.00 22.10 ? 157 ASP A O   1 
ATOM   1015  C  CB  . ASP A 1 126 ? 31.405  16.106  -17.056 1.00 24.09 ? 157 ASP A CB  1 
ATOM   1016  C  CG  . ASP A 1 126 ? 32.072  17.032  -16.050 1.00 29.79 ? 157 ASP A CG  1 
ATOM   1017  O  OD1 . ASP A 1 126 ? 31.913  16.826  -14.820 1.00 34.90 ? 157 ASP A OD1 1 
ATOM   1018  O  OD2 . ASP A 1 126 ? 32.774  17.968  -16.503 1.00 32.52 ? 157 ASP A OD2 1 
ATOM   1019  N  N   . ASP A 1 127 ? 30.691  12.775  -17.435 1.00 19.44 ? 158 ASP A N   1 
ATOM   1020  C  CA  . ASP A 1 127 ? 30.326  11.802  -18.458 1.00 19.43 ? 158 ASP A CA  1 
ATOM   1021  C  C   . ASP A 1 127 ? 29.372  10.711  -17.960 1.00 18.73 ? 158 ASP A C   1 
ATOM   1022  O  O   . ASP A 1 127 ? 29.093  9.742   -18.670 1.00 20.69 ? 158 ASP A O   1 
ATOM   1023  C  CB  . ASP A 1 127 ? 31.565  11.262  -19.203 1.00 19.82 ? 158 ASP A CB  1 
ATOM   1024  C  CG  . ASP A 1 127 ? 32.061  9.905   -18.688 1.00 22.67 ? 158 ASP A CG  1 
ATOM   1025  O  OD1 . ASP A 1 127 ? 32.078  9.660   -17.454 1.00 24.64 ? 158 ASP A OD1 1 
ATOM   1026  O  OD2 . ASP A 1 127 ? 32.472  9.088   -19.549 1.00 20.69 ? 158 ASP A OD2 1 
ATOM   1027  N  N   . CYS A 1 128 ? 28.876  10.866  -16.738 1.00 15.47 ? 159 CYS A N   1 
ATOM   1028  C  CA  . CYS A 1 128 ? 27.921  9.918   -16.205 1.00 14.20 ? 159 CYS A CA  1 
ATOM   1029  C  C   . CYS A 1 128 ? 26.615  9.971   -17.046 1.00 17.63 ? 159 CYS A C   1 
ATOM   1030  O  O   . CYS A 1 128 ? 26.496  10.819  -17.957 1.00 15.90 ? 159 CYS A O   1 
ATOM   1031  C  CB  . CYS A 1 128 ? 27.678  10.211  -14.737 1.00 9.98  ? 159 CYS A CB  1 
ATOM   1032  S  SG  . CYS A 1 128 ? 29.086  9.600   -13.770 1.00 11.95 ? 159 CYS A SG  1 
ATOM   1033  N  N   . PRO A 1 129 ? 25.655  9.020   -16.812 1.00 18.23 ? 160 PRO A N   1 
ATOM   1034  C  CA  . PRO A 1 129 ? 24.419  9.035   -17.598 1.00 14.54 ? 160 PRO A CA  1 
ATOM   1035  C  C   . PRO A 1 129 ? 23.362  9.984   -17.044 1.00 13.52 ? 160 PRO A C   1 
ATOM   1036  O  O   . PRO A 1 129 ? 22.667  10.660  -17.799 1.00 12.09 ? 160 PRO A O   1 
ATOM   1037  C  CB  . PRO A 1 129 ? 23.987  7.581   -17.524 1.00 14.00 ? 160 PRO A CB  1 
ATOM   1038  C  CG  . PRO A 1 129 ? 24.323  7.234   -16.116 1.00 12.46 ? 160 PRO A CG  1 
ATOM   1039  C  CD  . PRO A 1 129 ? 25.694  7.812   -15.955 1.00 15.52 ? 160 PRO A CD  1 
ATOM   1040  N  N   . THR A 1 130 ? 23.234  10.028  -15.729 1.00 12.74 ? 161 THR A N   1 
ATOM   1041  C  CA  . THR A 1 130 ? 22.258  10.909  -15.128 1.00 14.36 ? 161 THR A CA  1 
ATOM   1042  C  C   . THR A 1 130 ? 22.941  11.828  -14.118 1.00 13.67 ? 161 THR A C   1 
ATOM   1043  O  O   . THR A 1 130 ? 23.892  11.441  -13.452 1.00 11.68 ? 161 THR A O   1 
ATOM   1044  C  CB  . THR A 1 130 ? 21.104  10.137  -14.420 1.00 15.34 ? 161 THR A CB  1 
ATOM   1045  O  OG1 . THR A 1 130 ? 21.458  9.852   -13.057 1.00 18.99 ? 161 THR A OG1 1 
ATOM   1046  C  CG2 . THR A 1 130 ? 20.801  8.859   -15.138 1.00 15.37 ? 161 THR A CG2 1 
ATOM   1047  N  N   . PRO A 1 131 ? 22.428  13.051  -13.971 1.00 13.16 ? 162 PRO A N   1 
ATOM   1048  C  CA  . PRO A 1 131 ? 22.976  14.041  -13.045 1.00 10.57 ? 162 PRO A CA  1 
ATOM   1049  C  C   . PRO A 1 131 ? 23.202  13.606  -11.599 1.00 7.09  ? 162 PRO A C   1 
ATOM   1050  O  O   . PRO A 1 131 ? 23.898  14.276  -10.854 1.00 6.99  ? 162 PRO A O   1 
ATOM   1051  C  CB  . PRO A 1 131 ? 21.993  15.224  -13.181 1.00 13.32 ? 162 PRO A CB  1 
ATOM   1052  C  CG  . PRO A 1 131 ? 20.744  14.618  -13.879 1.00 13.42 ? 162 PRO A CG  1 
ATOM   1053  C  CD  . PRO A 1 131 ? 21.361  13.636  -14.810 1.00 13.40 ? 162 PRO A CD  1 
ATOM   1054  N  N   . MET A 1 132 ? 22.621  12.504  -11.185 1.00 5.04  ? 163 MET A N   1 
ATOM   1055  C  CA  . MET A 1 132 ? 22.850  12.072  -9.817  1.00 6.52  ? 163 MET A CA  1 
ATOM   1056  C  C   . MET A 1 132 ? 23.707  10.817  -9.839  1.00 4.78  ? 163 MET A C   1 
ATOM   1057  O  O   . MET A 1 132 ? 23.948  10.151  -8.806  1.00 2.02  ? 163 MET A O   1 
ATOM   1058  C  CB  . MET A 1 132 ? 21.522  11.822  -9.115  1.00 11.27 ? 163 MET A CB  1 
ATOM   1059  C  CG  . MET A 1 132 ? 20.916  13.066  -8.536  1.00 13.36 ? 163 MET A CG  1 
ATOM   1060  S  SD  . MET A 1 132 ? 21.899  13.668  -7.149  1.00 14.77 ? 163 MET A SD  1 
ATOM   1061  C  CE  . MET A 1 132 ? 22.096  15.391  -7.718  1.00 12.51 ? 163 MET A CE  1 
ATOM   1062  N  N   . GLY A 1 133 ? 24.109  10.486  -11.057 1.00 2.00  ? 164 GLY A N   1 
ATOM   1063  C  CA  . GLY A 1 133 ? 24.935  9.332   -11.301 1.00 2.32  ? 164 GLY A CA  1 
ATOM   1064  C  C   . GLY A 1 133 ? 24.379  8.525   -12.443 1.00 4.42  ? 164 GLY A C   1 
ATOM   1065  O  O   . GLY A 1 133 ? 24.596  8.787   -13.635 1.00 2.00  ? 164 GLY A O   1 
ATOM   1066  N  N   . VAL A 1 134 ? 23.639  7.511   -12.048 1.00 8.78  ? 165 VAL A N   1 
ATOM   1067  C  CA  . VAL A 1 134 ? 23.017  6.621   -12.998 1.00 11.14 ? 165 VAL A CA  1 
ATOM   1068  C  C   . VAL A 1 134 ? 21.486  6.542   -12.734 1.00 12.24 ? 165 VAL A C   1 
ATOM   1069  O  O   . VAL A 1 134 ? 20.707  6.231   -13.637 1.00 10.85 ? 165 VAL A O   1 
ATOM   1070  C  CB  . VAL A 1 134 ? 23.724  5.264   -12.922 1.00 8.92  ? 165 VAL A CB  1 
ATOM   1071  C  CG1 . VAL A 1 134 ? 23.436  4.583   -11.581 1.00 11.47 ? 165 VAL A CG1 1 
ATOM   1072  C  CG2 . VAL A 1 134 ? 23.354  4.428   -14.106 1.00 13.14 ? 165 VAL A CG2 1 
ATOM   1073  N  N   . LYS A 1 135 ? 21.085  6.914   -11.513 1.00 12.54 ? 166 LYS A N   1 
ATOM   1074  C  CA  . LYS A 1 135 ? 19.697  6.924   -11.070 1.00 12.09 ? 166 LYS A CA  1 
ATOM   1075  C  C   . LYS A 1 135 ? 19.031  8.221   -11.444 1.00 12.75 ? 166 LYS A C   1 
ATOM   1076  O  O   . LYS A 1 135 ? 19.625  9.276   -11.231 1.00 12.80 ? 166 LYS A O   1 
ATOM   1077  C  CB  . LYS A 1 135 ? 19.629  6.827   -9.547  1.00 12.51 ? 166 LYS A CB  1 
ATOM   1078  C  CG  . LYS A 1 135 ? 19.943  5.468   -8.968  1.00 13.57 ? 166 LYS A CG  1 
ATOM   1079  C  CD  . LYS A 1 135 ? 19.663  5.466   -7.478  1.00 14.73 ? 166 LYS A CD  1 
ATOM   1080  C  CE  . LYS A 1 135 ? 19.902  4.111   -6.889  1.00 17.11 ? 166 LYS A CE  1 
ATOM   1081  N  NZ  . LYS A 1 135 ? 19.678  4.105   -5.423  1.00 21.12 ? 166 LYS A NZ  1 
ATOM   1082  N  N   . GLY A 1 136 ? 17.779  8.143   -11.911 1.00 13.79 ? 167 GLY A N   1 
ATOM   1083  C  CA  . GLY A 1 136 ? 17.019  9.335   -12.283 1.00 12.83 ? 167 GLY A CA  1 
ATOM   1084  C  C   . GLY A 1 136 ? 16.839  9.514   -13.781 1.00 11.48 ? 167 GLY A C   1 
ATOM   1085  O  O   . GLY A 1 136 ? 17.024  8.581   -14.543 1.00 9.52  ? 167 GLY A O   1 
ATOM   1086  N  N   . ASN A 1 137 ? 16.461  10.706  -14.217 1.00 13.52 ? 168 ASN A N   1 
ATOM   1087  C  CA  . ASN A 1 137 ? 16.270  10.936  -15.643 1.00 15.47 ? 168 ASN A CA  1 
ATOM   1088  C  C   . ASN A 1 137 ? 17.279  11.909  -16.186 1.00 12.77 ? 168 ASN A C   1 
ATOM   1089  O  O   . ASN A 1 137 ? 17.947  12.589  -15.411 1.00 14.40 ? 168 ASN A O   1 
ATOM   1090  C  CB  . ASN A 1 137 ? 14.878  11.483  -15.942 1.00 25.95 ? 168 ASN A CB  1 
ATOM   1091  C  CG  . ASN A 1 137 ? 14.765  12.021  -17.375 1.00 34.06 ? 168 ASN A CG  1 
ATOM   1092  O  OD1 . ASN A 1 137 ? 14.802  13.248  -17.610 1.00 37.30 ? 168 ASN A OD1 1 
ATOM   1093  N  ND2 . ASN A 1 137 ? 14.756  11.100  -18.350 1.00 36.41 ? 168 ASN A ND2 1 
ATOM   1094  N  N   . LYS A 1 138 ? 17.357  11.990  -17.518 1.00 10.74 ? 169 LYS A N   1 
ATOM   1095  C  CA  . LYS A 1 138 ? 18.266  12.890  -18.203 1.00 13.10 ? 169 LYS A CA  1 
ATOM   1096  C  C   . LYS A 1 138 ? 18.297  14.250  -17.488 1.00 16.54 ? 169 LYS A C   1 
ATOM   1097  O  O   . LYS A 1 138 ? 19.276  15.018  -17.607 1.00 18.65 ? 169 LYS A O   1 
ATOM   1098  C  CB  . LYS A 1 138 ? 17.860  13.051  -19.660 1.00 10.84 ? 169 LYS A CB  1 
ATOM   1099  C  CG  . LYS A 1 138 ? 18.951  12.673  -20.611 1.00 14.36 ? 169 LYS A CG  1 
ATOM   1100  C  CD  . LYS A 1 138 ? 19.325  11.211  -20.383 1.00 26.66 ? 169 LYS A CD  1 
ATOM   1101  C  CE  . LYS A 1 138 ? 20.120  10.580  -21.568 1.00 35.50 ? 169 LYS A CE  1 
ATOM   1102  N  NZ  . LYS A 1 138 ? 21.594  10.942  -21.679 1.00 38.10 ? 169 LYS A NZ  1 
ATOM   1103  N  N   . GLU A 1 139 ? 17.206  14.572  -16.790 1.00 15.14 ? 170 GLU A N   1 
ATOM   1104  C  CA  . GLU A 1 139 ? 17.153  15.793  -16.023 1.00 15.80 ? 170 GLU A CA  1 
ATOM   1105  C  C   . GLU A 1 139 ? 16.648  15.590  -14.613 1.00 15.27 ? 170 GLU A C   1 
ATOM   1106  O  O   . GLU A 1 139 ? 16.378  14.474  -14.158 1.00 15.99 ? 170 GLU A O   1 
ATOM   1107  C  CB  . GLU A 1 139 ? 16.320  16.843  -16.711 1.00 21.29 ? 170 GLU A CB  1 
ATOM   1108  C  CG  . GLU A 1 139 ? 16.940  17.336  -17.995 1.00 35.72 ? 170 GLU A CG  1 
ATOM   1109  C  CD  . GLU A 1 139 ? 16.828  16.306  -19.125 1.00 45.21 ? 170 GLU A CD  1 
ATOM   1110  O  OE1 . GLU A 1 139 ? 15.787  15.588  -19.192 1.00 48.19 ? 170 GLU A OE1 1 
ATOM   1111  O  OE2 . GLU A 1 139 ? 17.797  16.200  -19.932 1.00 52.09 ? 170 GLU A OE2 1 
ATOM   1112  N  N   . LEU A 1 140 ? 16.545  16.703  -13.916 1.00 14.42 ? 171 LEU A N   1 
ATOM   1113  C  CA  . LEU A 1 140 ? 16.105  16.728  -12.544 1.00 15.01 ? 171 LEU A CA  1 
ATOM   1114  C  C   . LEU A 1 140 ? 14.858  17.600  -12.522 1.00 16.48 ? 171 LEU A C   1 
ATOM   1115  O  O   . LEU A 1 140 ? 14.582  18.307  -13.515 1.00 16.84 ? 171 LEU A O   1 
ATOM   1116  C  CB  . LEU A 1 140 ? 17.226  17.321  -11.671 1.00 12.45 ? 171 LEU A CB  1 
ATOM   1117  C  CG  . LEU A 1 140 ? 17.932  16.389  -10.686 1.00 8.42  ? 171 LEU A CG  1 
ATOM   1118  C  CD1 . LEU A 1 140 ? 18.011  14.997  -11.256 1.00 11.76 ? 171 LEU A CD1 1 
ATOM   1119  C  CD2 . LEU A 1 140 ? 19.293  16.908  -10.404 1.00 6.23  ? 171 LEU A CD2 1 
ATOM   1120  N  N   . PRO A 1 141 ? 14.092  17.567  -11.397 1.00 16.43 ? 172 PRO A N   1 
ATOM   1121  C  CA  . PRO A 1 141 ? 12.865  18.355  -11.243 1.00 15.11 ? 172 PRO A CA  1 
ATOM   1122  C  C   . PRO A 1 141 ? 13.157  19.795  -11.579 1.00 15.14 ? 172 PRO A C   1 
ATOM   1123  O  O   . PRO A 1 141 ? 14.265  20.283  -11.351 1.00 18.52 ? 172 PRO A O   1 
ATOM   1124  C  CB  . PRO A 1 141 ? 12.569  18.224  -9.752  1.00 16.43 ? 172 PRO A CB  1 
ATOM   1125  C  CG  . PRO A 1 141 ? 13.066  16.884  -9.436  1.00 16.11 ? 172 PRO A CG  1 
ATOM   1126  C  CD  . PRO A 1 141 ? 14.399  16.872  -10.131 1.00 14.57 ? 172 PRO A CD  1 
ATOM   1127  N  N   . ASP A 1 142 ? 12.196  20.471  -12.174 1.00 14.06 ? 173 ASP A N   1 
ATOM   1128  C  CA  . ASP A 1 142 ? 12.410  21.863  -12.502 1.00 14.56 ? 173 ASP A CA  1 
ATOM   1129  C  C   . ASP A 1 142 ? 12.587  22.595  -11.192 1.00 13.57 ? 173 ASP A C   1 
ATOM   1130  O  O   . ASP A 1 142 ? 11.853  22.386  -10.225 1.00 11.42 ? 173 ASP A O   1 
ATOM   1131  C  CB  . ASP A 1 142 ? 11.226  22.434  -13.265 1.00 22.06 ? 173 ASP A CB  1 
ATOM   1132  C  CG  . ASP A 1 142 ? 11.389  23.911  -13.588 1.00 27.03 ? 173 ASP A CG  1 
ATOM   1133  O  OD1 . ASP A 1 142 ? 11.374  24.742  -12.647 1.00 27.25 ? 173 ASP A OD1 1 
ATOM   1134  O  OD2 . ASP A 1 142 ? 11.506  24.236  -14.797 1.00 32.85 ? 173 ASP A OD2 1 
ATOM   1135  N  N   . SER A 1 143 ? 13.600  23.445  -11.179 1.00 15.14 ? 174 SER A N   1 
ATOM   1136  C  CA  . SER A 1 143 ? 13.963  24.256  -10.019 1.00 14.00 ? 174 SER A CA  1 
ATOM   1137  C  C   . SER A 1 143 ? 12.800  25.165  -9.603  1.00 14.48 ? 174 SER A C   1 
ATOM   1138  O  O   . SER A 1 143 ? 12.256  25.064  -8.483  1.00 9.22  ? 174 SER A O   1 
ATOM   1139  C  CB  . SER A 1 143 ? 15.190  25.090  -10.396 1.00 7.52  ? 174 SER A CB  1 
ATOM   1140  O  OG  . SER A 1 143 ? 15.126  25.395  -11.785 1.00 2.03  ? 174 SER A OG  1 
ATOM   1141  N  N   . LYS A 1 144 ? 12.398  26.005  -10.558 1.00 14.19 ? 175 LYS A N   1 
ATOM   1142  C  CA  . LYS A 1 144 ? 11.341  26.964  -10.361 1.00 14.40 ? 175 LYS A CA  1 
ATOM   1143  C  C   . LYS A 1 144 ? 10.167  26.285  -9.677  1.00 14.13 ? 175 LYS A C   1 
ATOM   1144  O  O   . LYS A 1 144 ? 9.620   26.802  -8.684  1.00 12.59 ? 175 LYS A O   1 
ATOM   1145  C  CB  . LYS A 1 144 ? 10.966  27.561  -11.714 1.00 15.22 ? 175 LYS A CB  1 
ATOM   1146  C  CG  . LYS A 1 144 ? 9.886   28.634  -11.645 1.00 25.69 ? 175 LYS A CG  1 
ATOM   1147  C  CD  . LYS A 1 144 ? 10.105  29.635  -10.472 1.00 30.08 ? 175 LYS A CD  1 
ATOM   1148  C  CE  . LYS A 1 144 ? 11.059  30.797  -10.800 1.00 28.15 ? 175 LYS A CE  1 
ATOM   1149  N  NZ  . LYS A 1 144 ? 11.192  31.715  -9.622  1.00 28.09 ? 175 LYS A NZ  1 
ATOM   1150  N  N   . GLU A 1 145 ? 9.906   25.056  -10.126 1.00 15.20 ? 176 GLU A N   1 
ATOM   1151  C  CA  . GLU A 1 145 ? 8.813   24.236  -9.610  1.00 13.33 ? 176 GLU A CA  1 
ATOM   1152  C  C   . GLU A 1 145 ? 9.068   23.814  -8.167  1.00 9.23  ? 176 GLU A C   1 
ATOM   1153  O  O   . GLU A 1 145 ? 8.301   24.157  -7.280  1.00 6.58  ? 176 GLU A O   1 
ATOM   1154  C  CB  . GLU A 1 145 ? 8.592   23.019  -10.516 1.00 14.55 ? 176 GLU A CB  1 
ATOM   1155  C  CG  . GLU A 1 145 ? 7.124   22.640  -10.680 1.00 22.47 ? 176 GLU A CG  1 
ATOM   1156  C  CD  . GLU A 1 145 ? 6.792   21.991  -12.044 1.00 26.09 ? 176 GLU A CD  1 
ATOM   1157  O  OE1 . GLU A 1 145 ? 6.504   22.763  -12.998 1.00 24.85 ? 176 GLU A OE1 1 
ATOM   1158  O  OE2 . GLU A 1 145 ? 6.796   20.720  -12.151 1.00 27.29 ? 176 GLU A OE2 1 
ATOM   1159  N  N   . VAL A 1 146 ? 10.184  23.148  -7.922  1.00 7.02  ? 177 VAL A N   1 
ATOM   1160  C  CA  . VAL A 1 146 ? 10.496  22.689  -6.576  1.00 6.40  ? 177 VAL A CA  1 
ATOM   1161  C  C   . VAL A 1 146 ? 10.429  23.866  -5.604  1.00 6.03  ? 177 VAL A C   1 
ATOM   1162  O  O   . VAL A 1 146 ? 9.918   23.763  -4.473  1.00 3.88  ? 177 VAL A O   1 
ATOM   1163  C  CB  . VAL A 1 146 ? 11.922  22.060  -6.504  1.00 4.66  ? 177 VAL A CB  1 
ATOM   1164  C  CG1 . VAL A 1 146 ? 12.118  21.398  -5.151  1.00 2.00  ? 177 VAL A CG1 1 
ATOM   1165  C  CG2 . VAL A 1 146 ? 12.171  21.081  -7.677  1.00 2.00  ? 177 VAL A CG2 1 
ATOM   1166  N  N   . LEU A 1 147 ? 10.941  24.989  -6.091  1.00 7.55  ? 178 LEU A N   1 
ATOM   1167  C  CA  . LEU A 1 147 ? 11.016  26.249  -5.355  1.00 7.86  ? 178 LEU A CA  1 
ATOM   1168  C  C   . LEU A 1 147 ? 9.623   26.619  -4.818  1.00 9.80  ? 178 LEU A C   1 
ATOM   1169  O  O   . LEU A 1 147 ? 9.437   26.803  -3.605  1.00 5.18  ? 178 LEU A O   1 
ATOM   1170  C  CB  . LEU A 1 147 ? 11.542  27.307  -6.335  1.00 5.87  ? 178 LEU A CB  1 
ATOM   1171  C  CG  . LEU A 1 147 ? 11.889  28.740  -5.955  1.00 5.20  ? 178 LEU A CG  1 
ATOM   1172  C  CD1 . LEU A 1 147 ? 10.869  29.730  -6.554  1.00 2.26  ? 178 LEU A CD1 1 
ATOM   1173  C  CD2 . LEU A 1 147 ? 12.065  28.865  -4.452  1.00 2.01  ? 178 LEU A CD2 1 
ATOM   1174  N  N   . GLU A 1 148 ? 8.651   26.656  -5.741  1.00 12.71 ? 179 GLU A N   1 
ATOM   1175  C  CA  . GLU A 1 148 ? 7.242   26.983  -5.458  1.00 11.06 ? 179 GLU A CA  1 
ATOM   1176  C  C   . GLU A 1 148 ? 6.433   25.936  -4.682  1.00 8.89  ? 179 GLU A C   1 
ATOM   1177  O  O   . GLU A 1 148 ? 5.793   26.275  -3.685  1.00 8.65  ? 179 GLU A O   1 
ATOM   1178  C  CB  . GLU A 1 148 ? 6.526   27.305  -6.753  1.00 10.18 ? 179 GLU A CB  1 
ATOM   1179  C  CG  . GLU A 1 148 ? 7.036   28.578  -7.364  1.00 14.44 ? 179 GLU A CG  1 
ATOM   1180  C  CD  . GLU A 1 148 ? 6.544   28.777  -8.788  1.00 18.28 ? 179 GLU A CD  1 
ATOM   1181  O  OE1 . GLU A 1 148 ? 6.164   27.776  -9.438  1.00 19.66 ? 179 GLU A OE1 1 
ATOM   1182  O  OE2 . GLU A 1 148 ? 6.556   29.934  -9.261  1.00 18.51 ? 179 GLU A OE2 1 
ATOM   1183  N  N   . LYS A 1 149 ? 6.447   24.686  -5.134  1.00 3.88  ? 180 LYS A N   1 
ATOM   1184  C  CA  . LYS A 1 149 ? 5.718   23.652  -4.440  1.00 2.00  ? 180 LYS A CA  1 
ATOM   1185  C  C   . LYS A 1 149 ? 6.091   23.411  -2.964  1.00 2.06  ? 180 LYS A C   1 
ATOM   1186  O  O   . LYS A 1 149 ? 5.255   23.558  -2.084  1.00 3.21  ? 180 LYS A O   1 
ATOM   1187  C  CB  . LYS A 1 149 ? 5.781   22.355  -5.226  1.00 2.04  ? 180 LYS A CB  1 
ATOM   1188  C  CG  . LYS A 1 149 ? 5.103   22.420  -6.586  1.00 4.13  ? 180 LYS A CG  1 
ATOM   1189  C  CD  . LYS A 1 149 ? 5.314   21.123  -7.320  1.00 3.18  ? 180 LYS A CD  1 
ATOM   1190  C  CE  . LYS A 1 149 ? 4.633   21.111  -8.653  1.00 9.76  ? 180 LYS A CE  1 
ATOM   1191  N  NZ  . LYS A 1 149 ? 4.720   19.727  -9.239  1.00 16.29 ? 180 LYS A NZ  1 
ATOM   1192  N  N   . VAL A 1 150 ? 7.339   23.086  -2.660  1.00 4.44  ? 181 VAL A N   1 
ATOM   1193  C  CA  . VAL A 1 150 ? 7.695   22.800  -1.261  1.00 3.46  ? 181 VAL A CA  1 
ATOM   1194  C  C   . VAL A 1 150 ? 8.544   23.814  -0.537  1.00 3.60  ? 181 VAL A C   1 
ATOM   1195  O  O   . VAL A 1 150 ? 8.721   23.684  0.677   1.00 2.34  ? 181 VAL A O   1 
ATOM   1196  C  CB  . VAL A 1 150 ? 8.448   21.454  -1.115  1.00 4.66  ? 181 VAL A CB  1 
ATOM   1197  C  CG1 . VAL A 1 150 ? 7.496   20.257  -1.211  1.00 2.00  ? 181 VAL A CG1 1 
ATOM   1198  C  CG2 . VAL A 1 150 ? 9.555   21.377  -2.169  1.00 5.18  ? 181 VAL A CG2 1 
ATOM   1199  N  N   . LEU A 1 151 ? 9.066   24.815  -1.247  1.00 3.59  ? 182 LEU A N   1 
ATOM   1200  C  CA  . LEU A 1 151 ? 9.938   25.798  -0.593  1.00 5.97  ? 182 LEU A CA  1 
ATOM   1201  C  C   . LEU A 1 151 ? 9.371   27.131  -0.129  1.00 6.24  ? 182 LEU A C   1 
ATOM   1202  O  O   . LEU A 1 151 ? 9.472   27.448  1.060   1.00 4.24  ? 182 LEU A O   1 
ATOM   1203  C  CB  . LEU A 1 151 ? 11.217  26.050  -1.418  1.00 8.03  ? 182 LEU A CB  1 
ATOM   1204  C  CG  . LEU A 1 151 ? 12.310  24.977  -1.474  1.00 4.88  ? 182 LEU A CG  1 
ATOM   1205  C  CD1 . LEU A 1 151 ? 13.197  25.294  -2.616  1.00 2.67  ? 182 LEU A CD1 1 
ATOM   1206  C  CD2 . LEU A 1 151 ? 13.074  24.846  -0.170  1.00 2.00  ? 182 LEU A CD2 1 
ATOM   1207  N  N   . LEU A 1 152 ? 8.884   27.943  -1.073  1.00 6.66  ? 183 LEU A N   1 
ATOM   1208  C  CA  . LEU A 1 152 ? 8.326   29.264  -0.783  1.00 3.01  ? 183 LEU A CA  1 
ATOM   1209  C  C   . LEU A 1 152 ? 7.337   29.312  0.378   1.00 4.46  ? 183 LEU A C   1 
ATOM   1210  O  O   . LEU A 1 152 ? 6.578   28.380  0.612   1.00 4.43  ? 183 LEU A O   1 
ATOM   1211  C  CB  . LEU A 1 152 ? 7.684   29.823  -2.024  1.00 2.00  ? 183 LEU A CB  1 
ATOM   1212  C  CG  . LEU A 1 152 ? 8.677   30.343  -3.027  1.00 2.06  ? 183 LEU A CG  1 
ATOM   1213  C  CD1 . LEU A 1 152 ? 7.988   30.501  -4.339  1.00 2.01  ? 183 LEU A CD1 1 
ATOM   1214  C  CD2 . LEU A 1 152 ? 9.207   31.657  -2.552  1.00 6.15  ? 183 LEU A CD2 1 
ATOM   1215  N  N   . ARG A 1 153 ? 7.407   30.406  1.120   1.00 6.47  ? 184 ARG A N   1 
ATOM   1216  C  CA  . ARG A 1 153 ? 6.560   30.685  2.277   1.00 8.68  ? 184 ARG A CA  1 
ATOM   1217  C  C   . ARG A 1 153 ? 5.195   31.264  1.907   1.00 11.81 ? 184 ARG A C   1 
ATOM   1218  O  O   . ARG A 1 153 ? 5.075   32.213  1.115   1.00 11.29 ? 184 ARG A O   1 
ATOM   1219  C  CB  . ARG A 1 153 ? 7.259   31.670  3.211   1.00 9.38  ? 184 ARG A CB  1 
ATOM   1220  C  CG  . ARG A 1 153 ? 6.345   32.611  4.012   1.00 8.24  ? 184 ARG A CG  1 
ATOM   1221  C  CD  . ARG A 1 153 ? 7.180   33.694  4.721   1.00 7.98  ? 184 ARG A CD  1 
ATOM   1222  N  NE  . ARG A 1 153 ? 8.139   33.098  5.640   1.00 6.29  ? 184 ARG A NE  1 
ATOM   1223  C  CZ  . ARG A 1 153 ? 9.048   33.757  6.335   1.00 2.72  ? 184 ARG A CZ  1 
ATOM   1224  N  NH1 . ARG A 1 153 ? 9.150   35.061  6.221   1.00 2.00  ? 184 ARG A NH1 1 
ATOM   1225  N  NH2 . ARG A 1 153 ? 9.815   33.101  7.193   1.00 4.56  ? 184 ARG A NH2 1 
ATOM   1226  N  N   . ARG A 1 154 ? 4.167   30.700  2.530   1.00 14.66 ? 185 ARG A N   1 
ATOM   1227  C  CA  . ARG A 1 154 ? 2.796   31.130  2.314   1.00 12.29 ? 185 ARG A CA  1 
ATOM   1228  C  C   . ARG A 1 154 ? 2.532   31.991  3.511   1.00 10.49 ? 185 ARG A C   1 
ATOM   1229  O  O   . ARG A 1 154 ? 2.404   33.184  3.405   1.00 12.07 ? 185 ARG A O   1 
ATOM   1230  C  CB  . ARG A 1 154 ? 1.843   29.936  2.348   1.00 11.47 ? 185 ARG A CB  1 
ATOM   1231  C  CG  . ARG A 1 154 ? 2.384   28.671  1.737   1.00 6.91  ? 185 ARG A CG  1 
ATOM   1232  C  CD  . ARG A 1 154 ? 2.582   28.823  0.258   1.00 5.61  ? 185 ARG A CD  1 
ATOM   1233  N  NE  . ARG A 1 154 ? 2.973   27.529  -0.281  1.00 12.02 ? 185 ARG A NE  1 
ATOM   1234  C  CZ  . ARG A 1 154 ? 3.191   27.280  -1.571  1.00 15.98 ? 185 ARG A CZ  1 
ATOM   1235  N  NH1 . ARG A 1 154 ? 3.060   28.261  -2.480  1.00 18.62 ? 185 ARG A NH1 1 
ATOM   1236  N  NH2 . ARG A 1 154 ? 3.500   26.040  -1.953  1.00 14.70 ? 185 ARG A NH2 1 
ATOM   1237  N  N   . GLU A 1 155 ? 2.520   31.374  4.672   1.00 8.32  ? 186 GLU A N   1 
ATOM   1238  C  CA  . GLU A 1 155 ? 2.270   32.117  5.866   1.00 10.72 ? 186 GLU A CA  1 
ATOM   1239  C  C   . GLU A 1 155 ? 3.508   31.951  6.680   1.00 10.72 ? 186 GLU A C   1 
ATOM   1240  O  O   . GLU A 1 155 ? 4.040   30.841  6.791   1.00 11.50 ? 186 GLU A O   1 
ATOM   1241  C  CB  . GLU A 1 155 ? 1.080   31.525  6.604   1.00 16.94 ? 186 GLU A CB  1 
ATOM   1242  C  CG  . GLU A 1 155 ? 0.633   32.385  7.774   1.00 26.04 ? 186 GLU A CG  1 
ATOM   1243  C  CD  . GLU A 1 155 ? -0.498  31.777  8.596   1.00 30.43 ? 186 GLU A CD  1 
ATOM   1244  O  OE1 . GLU A 1 155 ? -1.244  30.896  8.072   1.00 34.48 ? 186 GLU A OE1 1 
ATOM   1245  O  OE2 . GLU A 1 155 ? -0.627  32.197  9.777   1.00 29.07 ? 186 GLU A OE2 1 
ATOM   1246  N  N   . PHE A 1 156 ? 3.995   33.056  7.218   1.00 10.90 ? 187 PHE A N   1 
ATOM   1247  C  CA  . PHE A 1 156 ? 5.192   33.016  8.047   1.00 11.56 ? 187 PHE A CA  1 
ATOM   1248  C  C   . PHE A 1 156 ? 5.070   32.042  9.230   1.00 9.39  ? 187 PHE A C   1 
ATOM   1249  O  O   . PHE A 1 156 ? 4.230   32.226  10.100  1.00 10.30 ? 187 PHE A O   1 
ATOM   1250  C  CB  . PHE A 1 156 ? 5.514   34.416  8.586   1.00 12.01 ? 187 PHE A CB  1 
ATOM   1251  C  CG  . PHE A 1 156 ? 6.569   34.428  9.662   1.00 12.72 ? 187 PHE A CG  1 
ATOM   1252  C  CD1 . PHE A 1 156 ? 6.223   34.193  10.997  1.00 13.21 ? 187 PHE A CD1 1 
ATOM   1253  C  CD2 . PHE A 1 156 ? 7.904   34.639  9.341   1.00 12.21 ? 187 PHE A CD2 1 
ATOM   1254  C  CE1 . PHE A 1 156 ? 7.186   34.163  11.994  1.00 12.57 ? 187 PHE A CE1 1 
ATOM   1255  C  CE2 . PHE A 1 156 ? 8.874   34.611  10.330  1.00 14.60 ? 187 PHE A CE2 1 
ATOM   1256  C  CZ  . PHE A 1 156 ? 8.513   34.372  11.661  1.00 13.54 ? 187 PHE A CZ  1 
ATOM   1257  N  N   . ILE A 1 157 ? 5.944   31.044  9.268   1.00 6.78  ? 188 ILE A N   1 
ATOM   1258  C  CA  . ILE A 1 157 ? 5.982   30.073  10.355  1.00 4.03  ? 188 ILE A CA  1 
ATOM   1259  C  C   . ILE A 1 157 ? 7.142   30.516  11.214  1.00 3.26  ? 188 ILE A C   1 
ATOM   1260  O  O   . ILE A 1 157 ? 8.261   30.664  10.704  1.00 4.56  ? 188 ILE A O   1 
ATOM   1261  C  CB  . ILE A 1 157 ? 6.335   28.659  9.839   1.00 4.87  ? 188 ILE A CB  1 
ATOM   1262  C  CG1 . ILE A 1 157 ? 5.483   28.306  8.613   1.00 4.55  ? 188 ILE A CG1 1 
ATOM   1263  C  CG2 . ILE A 1 157 ? 6.129   27.624  10.949  1.00 3.47  ? 188 ILE A CG2 1 
ATOM   1264  C  CD1 . ILE A 1 157 ? 5.975   27.116  7.884   1.00 2.00  ? 188 ILE A CD1 1 
ATOM   1265  N  N   . PRO A 1 158 ? 6.918   30.728  12.515  1.00 3.15  ? 189 PRO A N   1 
ATOM   1266  C  CA  . PRO A 1 158 ? 8.009   31.167  13.377  1.00 6.97  ? 189 PRO A CA  1 
ATOM   1267  C  C   . PRO A 1 158 ? 8.827   29.989  13.808  1.00 9.11  ? 189 PRO A C   1 
ATOM   1268  O  O   . PRO A 1 158 ? 8.390   28.842  13.660  1.00 11.60 ? 189 PRO A O   1 
ATOM   1269  C  CB  . PRO A 1 158 ? 7.269   31.741  14.565  1.00 5.80  ? 189 PRO A CB  1 
ATOM   1270  C  CG  . PRO A 1 158 ? 6.213   30.754  14.742  1.00 2.03  ? 189 PRO A CG  1 
ATOM   1271  C  CD  . PRO A 1 158 ? 5.690   30.612  13.301  1.00 4.81  ? 189 PRO A CD  1 
ATOM   1272  N  N   . ASP A 1 159 ? 10.019  30.266  14.324  1.00 8.61  ? 190 ASP A N   1 
ATOM   1273  C  CA  . ASP A 1 159 ? 10.889  29.209  14.813  1.00 8.43  ? 190 ASP A CA  1 
ATOM   1274  C  C   . ASP A 1 159 ? 10.424  28.773  16.215  1.00 5.82  ? 190 ASP A C   1 
ATOM   1275  O  O   . ASP A 1 159 ? 10.225  29.597  17.093  1.00 2.00  ? 190 ASP A O   1 
ATOM   1276  C  CB  . ASP A 1 159 ? 12.341  29.710  14.828  1.00 9.63  ? 190 ASP A CB  1 
ATOM   1277  C  CG  . ASP A 1 159 ? 13.233  28.916  15.773  1.00 10.29 ? 190 ASP A CG  1 
ATOM   1278  O  OD1 . ASP A 1 159 ? 13.265  27.672  15.695  1.00 8.75  ? 190 ASP A OD1 1 
ATOM   1279  O  OD2 . ASP A 1 159 ? 13.893  29.542  16.615  1.00 8.02  ? 190 ASP A OD2 1 
ATOM   1280  N  N   . PRO A 1 160 ? 10.183  27.469  16.416  1.00 5.57  ? 191 PRO A N   1 
ATOM   1281  C  CA  . PRO A 1 160 ? 9.745   26.993  17.736  1.00 6.87  ? 191 PRO A CA  1 
ATOM   1282  C  C   . PRO A 1 160 ? 10.863  27.073  18.765  1.00 8.74  ? 191 PRO A C   1 
ATOM   1283  O  O   . PRO A 1 160 ? 10.675  26.697  19.921  1.00 11.24 ? 191 PRO A O   1 
ATOM   1284  C  CB  . PRO A 1 160 ? 9.361   25.535  17.480  1.00 3.35  ? 191 PRO A CB  1 
ATOM   1285  C  CG  . PRO A 1 160 ? 10.253  25.163  16.393  1.00 5.53  ? 191 PRO A CG  1 
ATOM   1286  C  CD  . PRO A 1 160 ? 10.178  26.362  15.456  1.00 5.50  ? 191 PRO A CD  1 
ATOM   1287  N  N   . GLN A 1 161 ? 12.047  27.506  18.340  1.00 8.19  ? 192 GLN A N   1 
ATOM   1288  C  CA  . GLN A 1 161 ? 13.150  27.613  19.276  1.00 6.40  ? 192 GLN A CA  1 
ATOM   1289  C  C   . GLN A 1 161 ? 13.337  29.021  19.860  1.00 6.66  ? 192 GLN A C   1 
ATOM   1290  O  O   . GLN A 1 161 ? 14.027  29.178  20.865  1.00 9.63  ? 192 GLN A O   1 
ATOM   1291  C  CB  . GLN A 1 161 ? 14.446  27.076  18.662  1.00 6.85  ? 192 GLN A CB  1 
ATOM   1292  C  CG  . GLN A 1 161 ? 14.514  25.554  18.595  1.00 6.48  ? 192 GLN A CG  1 
ATOM   1293  C  CD  . GLN A 1 161 ? 15.961  25.010  18.534  1.00 4.86  ? 192 GLN A CD  1 
ATOM   1294  O  OE1 . GLN A 1 161 ? 16.407  24.490  17.509  1.00 2.02  ? 192 GLN A OE1 1 
ATOM   1295  N  NE2 . GLN A 1 161 ? 16.674  25.106  19.642  1.00 5.73  ? 192 GLN A NE2 1 
ATOM   1296  N  N   . GLY A 1 162 ? 12.770  30.044  19.226  1.00 3.50  ? 193 GLY A N   1 
ATOM   1297  C  CA  . GLY A 1 162 ? 12.884  31.378  19.786  1.00 2.12  ? 193 GLY A CA  1 
ATOM   1298  C  C   . GLY A 1 162 ? 13.914  32.275  19.159  1.00 4.40  ? 193 GLY A C   1 
ATOM   1299  O  O   . GLY A 1 162 ? 14.100  33.421  19.563  1.00 2.08  ? 193 GLY A O   1 
ATOM   1300  N  N   . SER A 1 163 ? 14.594  31.752  18.154  1.00 7.51  ? 194 SER A N   1 
ATOM   1301  C  CA  . SER A 1 163 ? 15.622  32.510  17.458  1.00 6.58  ? 194 SER A CA  1 
ATOM   1302  C  C   . SER A 1 163 ? 15.040  33.837  17.052  1.00 3.28  ? 194 SER A C   1 
ATOM   1303  O  O   . SER A 1 163 ? 14.059  33.876  16.311  1.00 2.00  ? 194 SER A O   1 
ATOM   1304  C  CB  . SER A 1 163 ? 16.096  31.733  16.230  1.00 8.72  ? 194 SER A CB  1 
ATOM   1305  O  OG  . SER A 1 163 ? 16.656  30.479  16.625  1.00 9.90  ? 194 SER A OG  1 
ATOM   1306  N  N   . ASN A 1 164 ? 15.579  34.907  17.628  1.00 2.38  ? 195 ASN A N   1 
ATOM   1307  C  CA  . ASN A 1 164 ? 15.109  36.258  17.307  1.00 3.70  ? 195 ASN A CA  1 
ATOM   1308  C  C   . ASN A 1 164 ? 15.831  36.934  16.141  1.00 2.00  ? 195 ASN A C   1 
ATOM   1309  O  O   . ASN A 1 164 ? 16.335  36.269  15.254  1.00 2.03  ? 195 ASN A O   1 
ATOM   1310  C  CB  . ASN A 1 164 ? 15.133  37.147  18.530  1.00 3.59  ? 195 ASN A CB  1 
ATOM   1311  C  CG  . ASN A 1 164 ? 16.458  37.196  19.156  1.00 5.72  ? 195 ASN A CG  1 
ATOM   1312  O  OD1 . ASN A 1 164 ? 17.452  36.807  18.546  1.00 8.04  ? 195 ASN A OD1 1 
ATOM   1313  N  ND2 . ASN A 1 164 ? 16.503  37.652  20.399  1.00 4.86  ? 195 ASN A ND2 1 
ATOM   1314  N  N   . MET A 1 165 ? 15.799  38.254  16.092  1.00 2.00  ? 196 MET A N   1 
ATOM   1315  C  CA  . MET A 1 165 ? 16.447  38.981  15.007  1.00 5.19  ? 196 MET A CA  1 
ATOM   1316  C  C   . MET A 1 165 ? 17.955  39.211  15.251  1.00 6.67  ? 196 MET A C   1 
ATOM   1317  O  O   . MET A 1 165 ? 18.774  39.285  14.304  1.00 4.75  ? 196 MET A O   1 
ATOM   1318  C  CB  . MET A 1 165 ? 15.704  40.285  14.731  1.00 2.00  ? 196 MET A CB  1 
ATOM   1319  C  CG  . MET A 1 165 ? 15.215  40.371  13.319  1.00 2.00  ? 196 MET A CG  1 
ATOM   1320  S  SD  . MET A 1 165 ? 14.807  38.737  12.669  1.00 3.93  ? 196 MET A SD  1 
ATOM   1321  C  CE  . MET A 1 165 ? 14.972  39.008  10.889  1.00 2.00  ? 196 MET A CE  1 
ATOM   1322  N  N   . MET A 1 166 ? 18.313  39.267  16.532  1.00 5.81  ? 197 MET A N   1 
ATOM   1323  C  CA  . MET A 1 166 ? 19.689  39.449  16.935  1.00 4.79  ? 197 MET A CA  1 
ATOM   1324  C  C   . MET A 1 166 ? 20.470  38.262  16.401  1.00 5.36  ? 197 MET A C   1 
ATOM   1325  O  O   . MET A 1 166 ? 21.532  38.420  15.800  1.00 7.68  ? 197 MET A O   1 
ATOM   1326  C  CB  . MET A 1 166 ? 19.799  39.514  18.458  1.00 2.60  ? 197 MET A CB  1 
ATOM   1327  C  CG  . MET A 1 166 ? 20.989  40.334  18.936  1.00 4.60  ? 197 MET A CG  1 
ATOM   1328  S  SD  . MET A 1 166 ? 20.760  42.148  19.003  1.00 4.11  ? 197 MET A SD  1 
ATOM   1329  C  CE  . MET A 1 166 ? 20.471  42.594  17.284  1.00 2.04  ? 197 MET A CE  1 
ATOM   1330  N  N   . PHE A 1 167 ? 19.906  37.074  16.578  1.00 5.39  ? 198 PHE A N   1 
ATOM   1331  C  CA  . PHE A 1 167 ? 20.508  35.836  16.117  1.00 2.04  ? 198 PHE A CA  1 
ATOM   1332  C  C   . PHE A 1 167 ? 20.586  35.795  14.604  1.00 2.00  ? 198 PHE A C   1 
ATOM   1333  O  O   . PHE A 1 167 ? 21.662  35.773  14.069  1.00 3.93  ? 198 PHE A O   1 
ATOM   1334  C  CB  . PHE A 1 167 ? 19.706  34.661  16.653  1.00 2.00  ? 198 PHE A CB  1 
ATOM   1335  C  CG  . PHE A 1 167 ? 20.017  33.340  16.006  1.00 3.59  ? 198 PHE A CG  1 
ATOM   1336  C  CD1 . PHE A 1 167 ? 19.648  33.072  14.674  1.00 3.73  ? 198 PHE A CD1 1 
ATOM   1337  C  CD2 . PHE A 1 167 ? 20.598  32.310  16.752  1.00 4.27  ? 198 PHE A CD2 1 
ATOM   1338  C  CE1 . PHE A 1 167 ? 19.846  31.805  14.102  1.00 2.00  ? 198 PHE A CE1 1 
ATOM   1339  C  CE2 . PHE A 1 167 ? 20.795  31.055  16.193  1.00 3.94  ? 198 PHE A CE2 1 
ATOM   1340  C  CZ  . PHE A 1 167 ? 20.414  30.805  14.860  1.00 3.18  ? 198 PHE A CZ  1 
ATOM   1341  N  N   . ALA A 1 168 ? 19.466  35.810  13.901  1.00 3.37  ? 199 ALA A N   1 
ATOM   1342  C  CA  . ALA A 1 168 ? 19.502  35.723  12.432  1.00 7.50  ? 199 ALA A CA  1 
ATOM   1343  C  C   . ALA A 1 168 ? 20.535  36.608  11.786  1.00 8.63  ? 199 ALA A C   1 
ATOM   1344  O  O   . ALA A 1 168 ? 21.234  36.183  10.865  1.00 10.74 ? 199 ALA A O   1 
ATOM   1345  C  CB  . ALA A 1 168 ? 18.130  36.001  11.809  1.00 8.89  ? 199 ALA A CB  1 
ATOM   1346  N  N   . PHE A 1 169 ? 20.624  37.850  12.248  1.00 10.52 ? 200 PHE A N   1 
ATOM   1347  C  CA  . PHE A 1 169 ? 21.603  38.777  11.685  1.00 8.80  ? 200 PHE A CA  1 
ATOM   1348  C  C   . PHE A 1 169 ? 23.049  38.428  12.085  1.00 7.62  ? 200 PHE A C   1 
ATOM   1349  O  O   . PHE A 1 169 ? 23.957  38.491  11.245  1.00 4.90  ? 200 PHE A O   1 
ATOM   1350  C  CB  . PHE A 1 169 ? 21.205  40.209  12.010  1.00 5.73  ? 200 PHE A CB  1 
ATOM   1351  C  CG  . PHE A 1 169 ? 20.181  40.766  11.065  1.00 2.95  ? 200 PHE A CG  1 
ATOM   1352  C  CD1 . PHE A 1 169 ? 20.323  40.586  9.689   1.00 2.04  ? 200 PHE A CD1 1 
ATOM   1353  C  CD2 . PHE A 1 169 ? 19.113  41.519  11.540  1.00 3.03  ? 200 PHE A CD2 1 
ATOM   1354  C  CE1 . PHE A 1 169 ? 19.422  41.155  8.799   1.00 2.32  ? 200 PHE A CE1 1 
ATOM   1355  C  CE2 . PHE A 1 169 ? 18.204  42.095  10.658  1.00 2.21  ? 200 PHE A CE2 1 
ATOM   1356  C  CZ  . PHE A 1 169 ? 18.360  41.914  9.282   1.00 2.02  ? 200 PHE A CZ  1 
ATOM   1357  N  N   . PHE A 1 170 ? 23.233  37.979  13.331  1.00 6.08  ? 201 PHE A N   1 
ATOM   1358  C  CA  . PHE A 1 170 ? 24.539  37.557  13.814  1.00 2.36  ? 201 PHE A CA  1 
ATOM   1359  C  C   . PHE A 1 170 ? 25.054  36.486  12.864  1.00 3.00  ? 201 PHE A C   1 
ATOM   1360  O  O   . PHE A 1 170 ? 26.110  36.628  12.284  1.00 2.54  ? 201 PHE A O   1 
ATOM   1361  C  CB  . PHE A 1 170 ? 24.429  36.993  15.202  1.00 2.00  ? 201 PHE A CB  1 
ATOM   1362  C  CG  . PHE A 1 170 ? 25.734  36.770  15.844  1.00 3.11  ? 201 PHE A CG  1 
ATOM   1363  C  CD1 . PHE A 1 170 ? 26.448  35.609  15.603  1.00 3.25  ? 201 PHE A CD1 1 
ATOM   1364  C  CD2 . PHE A 1 170 ? 26.262  37.721  16.709  1.00 2.77  ? 201 PHE A CD2 1 
ATOM   1365  C  CE1 . PHE A 1 170 ? 27.684  35.394  16.228  1.00 7.10  ? 201 PHE A CE1 1 
ATOM   1366  C  CE2 . PHE A 1 170 ? 27.498  37.521  17.340  1.00 4.78  ? 201 PHE A CE2 1 
ATOM   1367  C  CZ  . PHE A 1 170 ? 28.211  36.358  17.103  1.00 6.55  ? 201 PHE A CZ  1 
ATOM   1368  N  N   . ALA A 1 171 ? 24.263  35.452  12.642  1.00 2.59  ? 202 ALA A N   1 
ATOM   1369  C  CA  . ALA A 1 171 ? 24.640  34.401  11.723  1.00 2.00  ? 202 ALA A CA  1 
ATOM   1370  C  C   . ALA A 1 171 ? 24.909  34.920  10.307  1.00 2.00  ? 202 ALA A C   1 
ATOM   1371  O  O   . ALA A 1 171 ? 25.680  34.309  9.564   1.00 2.00  ? 202 ALA A O   1 
ATOM   1372  C  CB  . ALA A 1 171 ? 23.558  33.318  11.688  1.00 2.49  ? 202 ALA A CB  1 
ATOM   1373  N  N   . GLN A 1 172 ? 24.287  36.023  9.908   1.00 2.00  ? 203 GLN A N   1 
ATOM   1374  C  CA  . GLN A 1 172 ? 24.533  36.498  8.548   1.00 3.66  ? 203 GLN A CA  1 
ATOM   1375  C  C   . GLN A 1 172 ? 25.946  37.074  8.479   1.00 6.11  ? 203 GLN A C   1 
ATOM   1376  O  O   . GLN A 1 172 ? 26.783  36.716  7.624   1.00 2.00  ? 203 GLN A O   1 
ATOM   1377  C  CB  . GLN A 1 172 ? 23.518  37.551  8.113   1.00 2.00  ? 203 GLN A CB  1 
ATOM   1378  C  CG  . GLN A 1 172 ? 23.694  37.916  6.657   1.00 2.00  ? 203 GLN A CG  1 
ATOM   1379  C  CD  . GLN A 1 172 ? 22.662  38.892  6.131   1.00 4.42  ? 203 GLN A CD  1 
ATOM   1380  O  OE1 . GLN A 1 172 ? 22.630  39.179  4.932   1.00 5.01  ? 203 GLN A OE1 1 
ATOM   1381  N  NE2 . GLN A 1 172 ? 21.800  39.403  7.012   1.00 7.70  ? 203 GLN A NE2 1 
ATOM   1382  N  N   . HIS A 1 173 ? 26.175  37.972  9.427   1.00 6.80  ? 204 HIS A N   1 
ATOM   1383  C  CA  . HIS A 1 173 ? 27.409  38.691  9.616   1.00 4.63  ? 204 HIS A CA  1 
ATOM   1384  C  C   . HIS A 1 173 ? 28.500  37.646  9.766   1.00 6.08  ? 204 HIS A C   1 
ATOM   1385  O  O   . HIS A 1 173 ? 29.376  37.559  8.902   1.00 8.11  ? 204 HIS A O   1 
ATOM   1386  C  CB  . HIS A 1 173 ? 27.239  39.519  10.897  1.00 7.35  ? 204 HIS A CB  1 
ATOM   1387  C  CG  . HIS A 1 173 ? 28.403  40.394  11.261  1.00 6.16  ? 204 HIS A CG  1 
ATOM   1388  N  ND1 . HIS A 1 173 ? 28.884  41.383  10.426  1.00 4.29  ? 204 HIS A ND1 1 
ATOM   1389  C  CD2 . HIS A 1 173 ? 29.083  40.522  12.429  1.00 2.00  ? 204 HIS A CD2 1 
ATOM   1390  C  CE1 . HIS A 1 173 ? 29.800  42.087  11.068  1.00 3.86  ? 204 HIS A CE1 1 
ATOM   1391  N  NE2 . HIS A 1 173 ? 29.936  41.587  12.284  1.00 2.00  ? 204 HIS A NE2 1 
ATOM   1392  N  N   . PHE A 1 174 ? 28.412  36.827  10.824  1.00 4.02  ? 205 PHE A N   1 
ATOM   1393  C  CA  . PHE A 1 174 ? 29.398  35.772  11.127  1.00 2.06  ? 205 PHE A CA  1 
ATOM   1394  C  C   . PHE A 1 174 ? 29.799  34.917  9.943   1.00 2.00  ? 205 PHE A C   1 
ATOM   1395  O  O   . PHE A 1 174 ? 30.912  35.016  9.486   1.00 3.63  ? 205 PHE A O   1 
ATOM   1396  C  CB  . PHE A 1 174 ? 28.897  34.896  12.268  1.00 4.03  ? 205 PHE A CB  1 
ATOM   1397  C  CG  . PHE A 1 174 ? 29.801  33.759  12.615  1.00 6.74  ? 205 PHE A CG  1 
ATOM   1398  C  CD1 . PHE A 1 174 ? 30.993  33.977  13.302  1.00 9.62  ? 205 PHE A CD1 1 
ATOM   1399  C  CD2 . PHE A 1 174 ? 29.445  32.461  12.293  1.00 7.96  ? 205 PHE A CD2 1 
ATOM   1400  C  CE1 . PHE A 1 174 ? 31.820  32.907  13.667  1.00 8.92  ? 205 PHE A CE1 1 
ATOM   1401  C  CE2 . PHE A 1 174 ? 30.265  31.388  12.656  1.00 9.79  ? 205 PHE A CE2 1 
ATOM   1402  C  CZ  . PHE A 1 174 ? 31.453  31.616  13.344  1.00 9.24  ? 205 PHE A CZ  1 
ATOM   1403  N  N   . THR A 1 175 ? 28.894  34.123  9.404   1.00 2.00  ? 206 THR A N   1 
ATOM   1404  C  CA  . THR A 1 175 ? 29.239  33.298  8.254   1.00 3.61  ? 206 THR A CA  1 
ATOM   1405  C  C   . THR A 1 175 ? 29.691  34.083  7.032   1.00 3.31  ? 206 THR A C   1 
ATOM   1406  O  O   . THR A 1 175 ? 30.325  33.543  6.129   1.00 2.00  ? 206 THR A O   1 
ATOM   1407  C  CB  . THR A 1 175 ? 28.059  32.458  7.805   1.00 5.15  ? 206 THR A CB  1 
ATOM   1408  O  OG1 . THR A 1 175 ? 27.026  33.327  7.326   1.00 6.52  ? 206 THR A OG1 1 
ATOM   1409  C  CG2 . THR A 1 175 ? 27.565  31.608  8.950   1.00 3.31  ? 206 THR A CG2 1 
ATOM   1410  N  N   . HIS A 1 176 ? 29.364  35.361  6.990   1.00 6.58  ? 207 HIS A N   1 
ATOM   1411  C  CA  . HIS A 1 176 ? 29.731  36.155  5.820   1.00 9.72  ? 207 HIS A CA  1 
ATOM   1412  C  C   . HIS A 1 176 ? 31.162  36.623  5.652   1.00 9.65  ? 207 HIS A C   1 
ATOM   1413  O  O   . HIS A 1 176 ? 31.462  37.416  4.749   1.00 9.57  ? 207 HIS A O   1 
ATOM   1414  C  CB  . HIS A 1 176 ? 28.709  37.268  5.573   1.00 9.29  ? 207 HIS A CB  1 
ATOM   1415  C  CG  . HIS A 1 176 ? 27.491  36.776  4.864   1.00 4.39  ? 207 HIS A CG  1 
ATOM   1416  N  ND1 . HIS A 1 176 ? 26.786  35.681  5.302   1.00 2.00  ? 207 HIS A ND1 1 
ATOM   1417  C  CD2 . HIS A 1 176 ? 26.927  37.148  3.691   1.00 2.23  ? 207 HIS A CD2 1 
ATOM   1418  C  CE1 . HIS A 1 176 ? 25.843  35.396  4.423   1.00 4.21  ? 207 HIS A CE1 1 
ATOM   1419  N  NE2 . HIS A 1 176 ? 25.905  36.274  3.437   1.00 2.19  ? 207 HIS A NE2 1 
ATOM   1420  N  N   . GLN A 1 177 ? 32.027  36.173  6.567   1.00 10.09 ? 208 GLN A N   1 
ATOM   1421  C  CA  . GLN A 1 177 ? 33.453  36.456  6.486   1.00 4.72  ? 208 GLN A CA  1 
ATOM   1422  C  C   . GLN A 1 177 ? 34.000  35.255  5.776   1.00 3.92  ? 208 GLN A C   1 
ATOM   1423  O  O   . GLN A 1 177 ? 34.851  35.426  4.925   1.00 5.40  ? 208 GLN A O   1 
ATOM   1424  C  CB  . GLN A 1 177 ? 34.098  36.614  7.825   1.00 2.00  ? 208 GLN A CB  1 
ATOM   1425  C  CG  . GLN A 1 177 ? 34.111  35.428  8.646   1.00 2.00  ? 208 GLN A CG  1 
ATOM   1426  C  CD  . GLN A 1 177 ? 34.565  35.771  10.009  1.00 2.00  ? 208 GLN A CD  1 
ATOM   1427  O  OE1 . GLN A 1 177 ? 34.565  36.924  10.370  1.00 2.93  ? 208 GLN A OE1 1 
ATOM   1428  N  NE2 . GLN A 1 177 ? 35.006  34.810  10.760  1.00 3.92  ? 208 GLN A NE2 1 
ATOM   1429  N  N   . PHE A 1 178 ? 33.483  34.048  6.073   1.00 4.36  ? 209 PHE A N   1 
ATOM   1430  C  CA  . PHE A 1 178 ? 33.945  32.864  5.351   1.00 2.00  ? 209 PHE A CA  1 
ATOM   1431  C  C   . PHE A 1 178 ? 33.179  32.478  4.128   1.00 2.00  ? 209 PHE A C   1 
ATOM   1432  O  O   . PHE A 1 178 ? 33.716  31.815  3.275   1.00 2.44  ? 209 PHE A O   1 
ATOM   1433  C  CB  . PHE A 1 178 ? 34.224  31.623  6.193   1.00 2.00  ? 209 PHE A CB  1 
ATOM   1434  C  CG  . PHE A 1 178 ? 33.421  31.491  7.416   1.00 2.00  ? 209 PHE A CG  1 
ATOM   1435  C  CD1 . PHE A 1 178 ? 33.736  32.210  8.542   1.00 2.00  ? 209 PHE A CD1 1 
ATOM   1436  C  CD2 . PHE A 1 178 ? 32.448  30.527  7.504   1.00 3.66  ? 209 PHE A CD2 1 
ATOM   1437  C  CE1 . PHE A 1 178 ? 33.095  31.964  9.759   1.00 2.01  ? 209 PHE A CE1 1 
ATOM   1438  C  CE2 . PHE A 1 178 ? 31.802  30.273  8.715   1.00 3.96  ? 209 PHE A CE2 1 
ATOM   1439  C  CZ  . PHE A 1 178 ? 32.132  30.994  9.844   1.00 2.00  ? 209 PHE A CZ  1 
ATOM   1440  N  N   . PHE A 1 179 ? 31.921  32.839  4.027   1.00 2.00  ? 210 PHE A N   1 
ATOM   1441  C  CA  . PHE A 1 179 ? 31.206  32.483  2.809   1.00 5.28  ? 210 PHE A CA  1 
ATOM   1442  C  C   . PHE A 1 179 ? 31.298  33.771  2.021   1.00 4.77  ? 210 PHE A C   1 
ATOM   1443  O  O   . PHE A 1 179 ? 30.813  34.814  2.514   1.00 6.50  ? 210 PHE A O   1 
ATOM   1444  C  CB  . PHE A 1 179 ? 29.720  32.119  3.077   1.00 5.94  ? 210 PHE A CB  1 
ATOM   1445  C  CG  . PHE A 1 179 ? 29.522  30.869  3.913   1.00 6.83  ? 210 PHE A CG  1 
ATOM   1446  C  CD1 . PHE A 1 179 ? 30.261  29.719  3.663   1.00 7.56  ? 210 PHE A CD1 1 
ATOM   1447  C  CD2 . PHE A 1 179 ? 28.578  30.840  4.943   1.00 7.30  ? 210 PHE A CD2 1 
ATOM   1448  C  CE1 . PHE A 1 179 ? 30.059  28.557  4.429   1.00 8.87  ? 210 PHE A CE1 1 
ATOM   1449  C  CE2 . PHE A 1 179 ? 28.371  29.680  5.712   1.00 7.65  ? 210 PHE A CE2 1 
ATOM   1450  C  CZ  . PHE A 1 179 ? 29.108  28.544  5.455   1.00 7.03  ? 210 PHE A CZ  1 
ATOM   1451  N  N   . LYS A 1 180 ? 32.016  33.736  0.895   1.00 2.00  ? 211 LYS A N   1 
ATOM   1452  C  CA  . LYS A 1 180 ? 32.173  34.915  0.051   1.00 2.00  ? 211 LYS A CA  1 
ATOM   1453  C  C   . LYS A 1 180 ? 32.425  34.530  -1.388  1.00 2.00  ? 211 LYS A C   1 
ATOM   1454  O  O   . LYS A 1 180 ? 33.419  34.868  -1.932  1.00 2.07  ? 211 LYS A O   1 
ATOM   1455  C  CB  . LYS A 1 180 ? 33.339  35.792  0.526   1.00 2.00  ? 211 LYS A CB  1 
ATOM   1456  C  CG  . LYS A 1 180 ? 33.280  36.319  1.970   1.00 3.25  ? 211 LYS A CG  1 
ATOM   1457  C  CD  . LYS A 1 180 ? 34.610  36.825  2.472   1.00 2.00  ? 211 LYS A CD  1 
ATOM   1458  C  CE  . LYS A 1 180 ? 35.185  37.875  1.538   1.00 2.82  ? 211 LYS A CE  1 
ATOM   1459  N  NZ  . LYS A 1 180 ? 36.331  38.602  2.143   1.00 2.00  ? 211 LYS A NZ  1 
ATOM   1460  N  N   . THR A 1 181 ? 31.507  33.857  -2.039  1.00 2.66  ? 212 THR A N   1 
ATOM   1461  C  CA  . THR A 1 181 ? 31.715  33.440  -3.409  1.00 2.00  ? 212 THR A CA  1 
ATOM   1462  C  C   . THR A 1 181 ? 32.233  34.469  -4.387  1.00 2.00  ? 212 THR A C   1 
ATOM   1463  O  O   . THR A 1 181 ? 31.814  35.593  -4.396  1.00 4.93  ? 212 THR A O   1 
ATOM   1464  C  CB  . THR A 1 181 ? 30.463  32.804  -3.949  1.00 2.02  ? 212 THR A CB  1 
ATOM   1465  O  OG1 . THR A 1 181 ? 30.149  31.655  -3.144  1.00 2.00  ? 212 THR A OG1 1 
ATOM   1466  C  CG2 . THR A 1 181 ? 30.659  32.375  -5.407  1.00 2.00  ? 212 THR A CG2 1 
ATOM   1467  N  N   . ASP A 1 182 ? 33.140  34.029  -5.238  1.00 6.45  ? 213 ASP A N   1 
ATOM   1468  C  CA  . ASP A 1 182 ? 33.800  34.817  -6.269  1.00 7.95  ? 213 ASP A CA  1 
ATOM   1469  C  C   . ASP A 1 182 ? 32.993  34.518  -7.513  1.00 6.94  ? 213 ASP A C   1 
ATOM   1470  O  O   . ASP A 1 182 ? 33.400  33.743  -8.357  1.00 9.12  ? 213 ASP A O   1 
ATOM   1471  C  CB  . ASP A 1 182 ? 35.257  34.291  -6.407  1.00 12.36 ? 213 ASP A CB  1 
ATOM   1472  C  CG  . ASP A 1 182 ? 36.113  35.077  -7.410  1.00 17.30 ? 213 ASP A CG  1 
ATOM   1473  O  OD1 . ASP A 1 182 ? 35.568  35.954  -8.128  1.00 19.60 ? 213 ASP A OD1 1 
ATOM   1474  O  OD2 . ASP A 1 182 ? 37.348  34.802  -7.472  1.00 15.98 ? 213 ASP A OD2 1 
ATOM   1475  N  N   . HIS A 1 183 ? 31.829  35.120  -7.619  1.00 6.97  ? 214 HIS A N   1 
ATOM   1476  C  CA  . HIS A 1 183 ? 30.965  34.877  -8.769  1.00 10.85 ? 214 HIS A CA  1 
ATOM   1477  C  C   . HIS A 1 183 ? 31.621  35.041  -10.108 1.00 12.57 ? 214 HIS A C   1 
ATOM   1478  O  O   . HIS A 1 183 ? 31.226  34.375  -11.054 1.00 12.25 ? 214 HIS A O   1 
ATOM   1479  C  CB  . HIS A 1 183 ? 29.725  35.761  -8.722  1.00 10.83 ? 214 HIS A CB  1 
ATOM   1480  C  CG  . HIS A 1 183 ? 28.912  35.554  -7.495  1.00 10.14 ? 214 HIS A CG  1 
ATOM   1481  N  ND1 . HIS A 1 183 ? 28.868  36.469  -6.466  1.00 9.99  ? 214 HIS A ND1 1 
ATOM   1482  C  CD2 . HIS A 1 183 ? 28.191  34.485  -7.080  1.00 12.27 ? 214 HIS A CD2 1 
ATOM   1483  C  CE1 . HIS A 1 183 ? 28.160  35.969  -5.465  1.00 12.08 ? 214 HIS A CE1 1 
ATOM   1484  N  NE2 . HIS A 1 183 ? 27.737  34.766  -5.814  1.00 11.63 ? 214 HIS A NE2 1 
ATOM   1485  N  N   . LYS A 1 184 ? 32.599  35.941  -10.180 1.00 14.96 ? 215 LYS A N   1 
ATOM   1486  C  CA  . LYS A 1 184 ? 33.324  36.216  -11.422 1.00 18.52 ? 215 LYS A CA  1 
ATOM   1487  C  C   . LYS A 1 184 ? 34.054  34.938  -11.860 1.00 19.07 ? 215 LYS A C   1 
ATOM   1488  O  O   . LYS A 1 184 ? 34.294  34.716  -13.047 1.00 18.51 ? 215 LYS A O   1 
ATOM   1489  C  CB  . LYS A 1 184 ? 34.314  37.383  -11.234 1.00 21.22 ? 215 LYS A CB  1 
ATOM   1490  C  CG  . LYS A 1 184 ? 34.367  37.996  -9.806  1.00 26.02 ? 215 LYS A CG  1 
ATOM   1491  C  CD  . LYS A 1 184 ? 33.047  38.722  -9.388  1.00 29.28 ? 215 LYS A CD  1 
ATOM   1492  C  CE  . LYS A 1 184 ? 33.012  39.153  -7.895  1.00 23.85 ? 215 LYS A CE  1 
ATOM   1493  N  NZ  . LYS A 1 184 ? 32.405  38.144  -6.975  1.00 18.66 ? 215 LYS A NZ  1 
ATOM   1494  N  N   . ARG A 1 185 ? 34.396  34.106  -10.881 1.00 18.64 ? 216 ARG A N   1 
ATOM   1495  C  CA  . ARG A 1 185 ? 35.062  32.844  -11.138 1.00 18.89 ? 216 ARG A CA  1 
ATOM   1496  C  C   . ARG A 1 185 ? 33.993  31.756  -11.303 1.00 19.19 ? 216 ARG A C   1 
ATOM   1497  O  O   . ARG A 1 185 ? 34.068  30.921  -12.216 1.00 20.74 ? 216 ARG A O   1 
ATOM   1498  C  CB  . ARG A 1 185 ? 35.987  32.487  -9.982  1.00 20.56 ? 216 ARG A CB  1 
ATOM   1499  C  CG  . ARG A 1 185 ? 37.320  31.885  -10.427 1.00 25.05 ? 216 ARG A CG  1 
ATOM   1500  C  CD  . ARG A 1 185 ? 38.347  32.977  -10.780 1.00 28.32 ? 216 ARG A CD  1 
ATOM   1501  N  NE  . ARG A 1 185 ? 38.773  33.697  -9.585  1.00 26.77 ? 216 ARG A NE  1 
ATOM   1502  C  CZ  . ARG A 1 185 ? 39.992  33.617  -9.069  1.00 26.98 ? 216 ARG A CZ  1 
ATOM   1503  N  NH1 . ARG A 1 185 ? 40.924  32.863  -9.662  1.00 24.64 ? 216 ARG A NH1 1 
ATOM   1504  N  NH2 . ARG A 1 185 ? 40.243  34.222  -7.912  1.00 26.67 ? 216 ARG A NH2 1 
ATOM   1505  N  N   . GLY A 1 186 ? 32.998  31.771  -10.420 1.00 18.09 ? 217 GLY A N   1 
ATOM   1506  C  CA  . GLY A 1 186 ? 31.908  30.808  -10.483 1.00 15.64 ? 217 GLY A CA  1 
ATOM   1507  C  C   . GLY A 1 186 ? 31.562  30.306  -9.094  1.00 16.47 ? 217 GLY A C   1 
ATOM   1508  O  O   . GLY A 1 186 ? 32.225  30.717  -8.117  1.00 17.42 ? 217 GLY A O   1 
ATOM   1509  N  N   . PRO A 1 187 ? 30.435  29.577  -8.922  1.00 16.64 ? 218 PRO A N   1 
ATOM   1510  C  CA  . PRO A 1 187 ? 30.171  29.099  -7.557  1.00 15.92 ? 218 PRO A CA  1 
ATOM   1511  C  C   . PRO A 1 187 ? 31.246  28.026  -7.334  1.00 17.85 ? 218 PRO A C   1 
ATOM   1512  O  O   . PRO A 1 187 ? 31.812  27.445  -8.299  1.00 19.11 ? 218 PRO A O   1 
ATOM   1513  C  CB  . PRO A 1 187 ? 28.780  28.483  -7.663  1.00 14.55 ? 218 PRO A CB  1 
ATOM   1514  C  CG  . PRO A 1 187 ? 28.713  28.010  -9.096  1.00 14.26 ? 218 PRO A CG  1 
ATOM   1515  C  CD  . PRO A 1 187 ? 29.356  29.170  -9.845  1.00 15.74 ? 218 PRO A CD  1 
ATOM   1516  N  N   . GLY A 1 188 ? 31.577  27.785  -6.083  1.00 16.27 ? 219 GLY A N   1 
ATOM   1517  C  CA  . GLY A 1 188 ? 32.618  26.816  -5.847  1.00 14.01 ? 219 GLY A CA  1 
ATOM   1518  C  C   . GLY A 1 188 ? 33.897  27.544  -5.560  1.00 9.93  ? 219 GLY A C   1 
ATOM   1519  O  O   . GLY A 1 188 ? 34.786  26.967  -4.953  1.00 11.76 ? 219 GLY A O   1 
ATOM   1520  N  N   . PHE A 1 189 ? 33.950  28.819  -5.936  1.00 7.70  ? 220 PHE A N   1 
ATOM   1521  C  CA  . PHE A 1 189 ? 35.105  29.676  -5.707  1.00 5.28  ? 220 PHE A CA  1 
ATOM   1522  C  C   . PHE A 1 189 ? 34.809  30.687  -4.606  1.00 3.61  ? 220 PHE A C   1 
ATOM   1523  O  O   . PHE A 1 189 ? 33.774  31.332  -4.654  1.00 5.46  ? 220 PHE A O   1 
ATOM   1524  C  CB  . PHE A 1 189 ? 35.459  30.403  -6.981  1.00 3.30  ? 220 PHE A CB  1 
ATOM   1525  C  CG  . PHE A 1 189 ? 36.123  29.532  -8.011  1.00 7.16  ? 220 PHE A CG  1 
ATOM   1526  C  CD1 . PHE A 1 189 ? 37.507  29.333  -7.997  1.00 7.80  ? 220 PHE A CD1 1 
ATOM   1527  C  CD2 . PHE A 1 189 ? 35.393  28.997  -9.059  1.00 6.58  ? 220 PHE A CD2 1 
ATOM   1528  C  CE1 . PHE A 1 189 ? 38.126  28.626  -9.033  1.00 8.24  ? 220 PHE A CE1 1 
ATOM   1529  C  CE2 . PHE A 1 189 ? 36.021  28.289  -10.089 1.00 3.46  ? 220 PHE A CE2 1 
ATOM   1530  C  CZ  . PHE A 1 189 ? 37.369  28.107  -10.083 1.00 2.00  ? 220 PHE A CZ  1 
ATOM   1531  N  N   . THR A 1 190 ? 35.670  30.746  -3.584  1.00 2.67  ? 221 THR A N   1 
ATOM   1532  C  CA  . THR A 1 190 ? 35.553  31.666  -2.445  1.00 2.00  ? 221 THR A CA  1 
ATOM   1533  C  C   . THR A 1 190 ? 36.497  32.819  -2.712  1.00 2.52  ? 221 THR A C   1 
ATOM   1534  O  O   . THR A 1 190 ? 37.414  32.695  -3.508  1.00 4.96  ? 221 THR A O   1 
ATOM   1535  C  CB  . THR A 1 190 ? 35.959  30.971  -1.104  1.00 2.00  ? 221 THR A CB  1 
ATOM   1536  O  OG1 . THR A 1 190 ? 36.030  31.896  -0.016  1.00 2.00  ? 221 THR A OG1 1 
ATOM   1537  C  CG2 . THR A 1 190 ? 37.276  30.327  -1.257  1.00 3.08  ? 221 THR A CG2 1 
ATOM   1538  N  N   . ARG A 1 191 ? 36.214  33.972  -2.141  1.00 2.00  ? 222 ARG A N   1 
ATOM   1539  C  CA  . ARG A 1 191 ? 37.093  35.095  -2.299  1.00 3.02  ? 222 ARG A CA  1 
ATOM   1540  C  C   . ARG A 1 191 ? 37.684  35.267  -0.902  1.00 2.05  ? 222 ARG A C   1 
ATOM   1541  O  O   . ARG A 1 191 ? 38.581  36.073  -0.678  1.00 3.39  ? 222 ARG A O   1 
ATOM   1542  C  CB  . ARG A 1 191 ? 36.334  36.341  -2.807  1.00 9.55  ? 222 ARG A CB  1 
ATOM   1543  C  CG  . ARG A 1 191 ? 35.853  37.323  -1.702  1.00 19.45 ? 222 ARG A CG  1 
ATOM   1544  C  CD  . ARG A 1 191 ? 34.541  38.053  -2.030  1.00 26.46 ? 222 ARG A CD  1 
ATOM   1545  N  NE  . ARG A 1 191 ? 34.744  39.299  -2.740  1.00 30.24 ? 222 ARG A NE  1 
ATOM   1546  C  CZ  . ARG A 1 191 ? 34.972  39.401  -4.045  1.00 33.40 ? 222 ARG A CZ  1 
ATOM   1547  N  NH1 . ARG A 1 191 ? 35.030  38.316  -4.808  1.00 28.04 ? 222 ARG A NH1 1 
ATOM   1548  N  NH2 . ARG A 1 191 ? 35.129  40.612  -4.586  1.00 37.07 ? 222 ARG A NH2 1 
ATOM   1549  N  N   . GLY A 1 192 ? 37.216  34.465  0.040   1.00 2.00  ? 223 GLY A N   1 
ATOM   1550  C  CA  . GLY A 1 192 ? 37.744  34.534  1.393   1.00 3.55  ? 223 GLY A CA  1 
ATOM   1551  C  C   . GLY A 1 192 ? 38.835  33.481  1.580   1.00 3.55  ? 223 GLY A C   1 
ATOM   1552  O  O   . GLY A 1 192 ? 38.638  32.444  2.208   1.00 2.45  ? 223 GLY A O   1 
ATOM   1553  N  N   . LEU A 1 193 ? 40.011  33.757  1.053   1.00 2.00  ? 224 LEU A N   1 
ATOM   1554  C  CA  . LEU A 1 193 ? 41.102  32.822  1.131   1.00 2.00  ? 224 LEU A CA  1 
ATOM   1555  C  C   . LEU A 1 193 ? 41.528  32.477  2.545   1.00 2.30  ? 224 LEU A C   1 
ATOM   1556  O  O   . LEU A 1 193 ? 42.332  31.575  2.729   1.00 4.80  ? 224 LEU A O   1 
ATOM   1557  C  CB  . LEU A 1 193 ? 42.276  33.355  0.317   1.00 2.00  ? 224 LEU A CB  1 
ATOM   1558  C  CG  . LEU A 1 193 ? 41.882  33.616  -1.137  1.00 2.00  ? 224 LEU A CG  1 
ATOM   1559  C  CD1 . LEU A 1 193 ? 42.805  34.586  -1.809  1.00 2.00  ? 224 LEU A CD1 1 
ATOM   1560  C  CD2 . LEU A 1 193 ? 41.827  32.339  -1.904  1.00 3.98  ? 224 LEU A CD2 1 
ATOM   1561  N  N   . GLY A 1 194 ? 40.949  33.141  3.541   1.00 2.64  ? 225 GLY A N   1 
ATOM   1562  C  CA  . GLY A 1 194 ? 41.312  32.882  4.924   1.00 2.00  ? 225 GLY A CA  1 
ATOM   1563  C  C   . GLY A 1 194 ? 40.765  31.573  5.402   1.00 2.00  ? 225 GLY A C   1 
ATOM   1564  O  O   . GLY A 1 194 ? 41.235  31.017  6.381   1.00 2.00  ? 225 GLY A O   1 
ATOM   1565  N  N   . HIS A 1 195 ? 39.710  31.135  4.725   1.00 2.65  ? 226 HIS A N   1 
ATOM   1566  C  CA  . HIS A 1 195 ? 39.004  29.886  4.998   1.00 2.00  ? 226 HIS A CA  1 
ATOM   1567  C  C   . HIS A 1 195 ? 38.591  29.663  6.444   1.00 2.00  ? 226 HIS A C   1 
ATOM   1568  O  O   . HIS A 1 195 ? 38.480  28.531  6.876   1.00 3.18  ? 226 HIS A O   1 
ATOM   1569  C  CB  . HIS A 1 195 ? 39.783  28.691  4.448   1.00 2.00  ? 226 HIS A CB  1 
ATOM   1570  C  CG  . HIS A 1 195 ? 39.715  28.568  2.959   1.00 2.00  ? 226 HIS A CG  1 
ATOM   1571  N  ND1 . HIS A 1 195 ? 39.277  27.430  2.321   1.00 2.97  ? 226 HIS A ND1 1 
ATOM   1572  C  CD2 . HIS A 1 195 ? 40.017  29.448  1.973   1.00 3.75  ? 226 HIS A CD2 1 
ATOM   1573  C  CE1 . HIS A 1 195 ? 39.310  27.612  1.009   1.00 2.00  ? 226 HIS A CE1 1 
ATOM   1574  N  NE2 . HIS A 1 195 ? 39.759  28.828  0.772   1.00 2.00  ? 226 HIS A NE2 1 
ATOM   1575  N  N   . GLY A 1 196 ? 38.280  30.731  7.171   1.00 2.07  ? 227 GLY A N   1 
ATOM   1576  C  CA  . GLY A 1 196 ? 37.904  30.563  8.562   1.00 2.00  ? 227 GLY A CA  1 
ATOM   1577  C  C   . GLY A 1 196 ? 37.633  31.846  9.311   1.00 2.00  ? 227 GLY A C   1 
ATOM   1578  O  O   . GLY A 1 196 ? 37.571  32.919  8.735   1.00 2.00  ? 227 GLY A O   1 
ATOM   1579  N  N   . VAL A 1 197 ? 37.484  31.718  10.617  1.00 2.00  ? 228 VAL A N   1 
ATOM   1580  C  CA  . VAL A 1 197 ? 37.210  32.842  11.470  1.00 2.00  ? 228 VAL A CA  1 
ATOM   1581  C  C   . VAL A 1 197 ? 38.383  33.819  11.560  1.00 2.00  ? 228 VAL A C   1 
ATOM   1582  O  O   . VAL A 1 197 ? 39.087  33.872  12.572  1.00 2.00  ? 228 VAL A O   1 
ATOM   1583  C  CB  . VAL A 1 197 ? 36.875  32.359  12.850  1.00 2.00  ? 228 VAL A CB  1 
ATOM   1584  C  CG1 . VAL A 1 197 ? 36.221  33.455  13.620  1.00 4.18  ? 228 VAL A CG1 1 
ATOM   1585  C  CG2 . VAL A 1 197 ? 35.994  31.192  12.779  1.00 2.00  ? 228 VAL A CG2 1 
ATOM   1586  N  N   . ASP A 1 198 ? 38.578  34.624  10.529  1.00 2.00  ? 229 ASP A N   1 
ATOM   1587  C  CA  . ASP A 1 198 ? 39.694  35.553  10.549  1.00 2.00  ? 229 ASP A CA  1 
ATOM   1588  C  C   . ASP A 1 198 ? 39.275  36.993  10.754  1.00 3.18  ? 229 ASP A C   1 
ATOM   1589  O  O   . ASP A 1 198 ? 40.088  37.890  10.621  1.00 7.00  ? 229 ASP A O   1 
ATOM   1590  C  CB  . ASP A 1 198 ? 40.511  35.427  9.257   1.00 2.14  ? 229 ASP A CB  1 
ATOM   1591  C  CG  . ASP A 1 198 ? 39.692  35.711  8.010   1.00 7.29  ? 229 ASP A CG  1 
ATOM   1592  O  OD1 . ASP A 1 198 ? 38.595  36.275  8.139   1.00 10.60 ? 229 ASP A OD1 1 
ATOM   1593  O  OD2 . ASP A 1 198 ? 40.133  35.384  6.885   1.00 9.40  ? 229 ASP A OD2 1 
ATOM   1594  N  N   . LEU A 1 199 ? 37.998  37.215  11.043  1.00 4.23  ? 230 LEU A N   1 
ATOM   1595  C  CA  . LEU A 1 199 ? 37.431  38.560  11.237  1.00 2.00  ? 230 LEU A CA  1 
ATOM   1596  C  C   . LEU A 1 199 ? 37.823  39.483  10.100  1.00 2.00  ? 230 LEU A C   1 
ATOM   1597  O  O   . LEU A 1 199 ? 37.977  40.678  10.264  1.00 2.00  ? 230 LEU A O   1 
ATOM   1598  C  CB  . LEU A 1 199 ? 37.782  39.153  12.608  1.00 2.00  ? 230 LEU A CB  1 
ATOM   1599  C  CG  . LEU A 1 199 ? 37.405  38.314  13.843  1.00 2.00  ? 230 LEU A CG  1 
ATOM   1600  C  CD1 . LEU A 1 199 ? 36.973  39.164  14.978  1.00 2.00  ? 230 LEU A CD1 1 
ATOM   1601  C  CD2 . LEU A 1 199 ? 36.318  37.320  13.532  1.00 3.37  ? 230 LEU A CD2 1 
ATOM   1602  N  N   . ASN A 1 200 ? 37.902  38.905  8.916   1.00 2.00  ? 231 ASN A N   1 
ATOM   1603  C  CA  . ASN A 1 200 ? 38.249  39.658  7.744   1.00 2.00  ? 231 ASN A CA  1 
ATOM   1604  C  C   . ASN A 1 200 ? 37.169  40.677  7.434   1.00 2.00  ? 231 ASN A C   1 
ATOM   1605  O  O   . ASN A 1 200 ? 37.440  41.751  6.929   1.00 2.00  ? 231 ASN A O   1 
ATOM   1606  C  CB  . ASN A 1 200 ? 38.502  38.709  6.561   1.00 2.26  ? 231 ASN A CB  1 
ATOM   1607  C  CG  . ASN A 1 200 ? 37.396  38.721  5.498   1.00 2.00  ? 231 ASN A CG  1 
ATOM   1608  O  OD1 . ASN A 1 200 ? 36.989  39.755  4.977   1.00 2.00  ? 231 ASN A OD1 1 
ATOM   1609  N  ND2 . ASN A 1 200 ? 36.973  37.544  5.126   1.00 2.00  ? 231 ASN A ND2 1 
ATOM   1610  N  N   . HIS A 1 201 ? 35.939  40.320  7.769   1.00 6.17  ? 232 HIS A N   1 
ATOM   1611  C  CA  . HIS A 1 201 ? 34.783  41.152  7.517   1.00 4.87  ? 232 HIS A CA  1 
ATOM   1612  C  C   . HIS A 1 201 ? 34.853  42.468  8.301   1.00 8.10  ? 232 HIS A C   1 
ATOM   1613  O  O   . HIS A 1 201 ? 34.281  43.475  7.861   1.00 10.51 ? 232 HIS A O   1 
ATOM   1614  C  CB  . HIS A 1 201 ? 33.516  40.368  7.814   1.00 2.00  ? 232 HIS A CB  1 
ATOM   1615  C  CG  . HIS A 1 201 ? 33.448  39.831  9.210   1.00 2.00  ? 232 HIS A CG  1 
ATOM   1616  N  ND1 . HIS A 1 201 ? 32.426  39.016  9.643   1.00 2.52  ? 232 HIS A ND1 1 
ATOM   1617  C  CD2 . HIS A 1 201 ? 34.226  40.053  10.296  1.00 2.05  ? 232 HIS A CD2 1 
ATOM   1618  C  CE1 . HIS A 1 201 ? 32.568  38.769  10.934  1.00 2.00  ? 232 HIS A CE1 1 
ATOM   1619  N  NE2 . HIS A 1 201 ? 33.655  39.385  11.354  1.00 2.00  ? 232 HIS A NE2 1 
ATOM   1620  N  N   . ILE A 1 202 ? 35.562  42.466  9.437   1.00 6.19  ? 233 ILE A N   1 
ATOM   1621  C  CA  . ILE A 1 202 ? 35.717  43.677  10.231  1.00 4.63  ? 233 ILE A CA  1 
ATOM   1622  C  C   . ILE A 1 202 ? 36.907  44.456  9.687   1.00 6.45  ? 233 ILE A C   1 
ATOM   1623  O  O   . ILE A 1 202 ? 36.816  45.662  9.446   1.00 7.54  ? 233 ILE A O   1 
ATOM   1624  C  CB  . ILE A 1 202 ? 36.056  43.397  11.702  1.00 2.00  ? 233 ILE A CB  1 
ATOM   1625  C  CG1 . ILE A 1 202 ? 34.987  42.538  12.358  1.00 2.00  ? 233 ILE A CG1 1 
ATOM   1626  C  CG2 . ILE A 1 202 ? 36.254  44.710  12.438  1.00 2.00  ? 233 ILE A CG2 1 
ATOM   1627  C  CD1 . ILE A 1 202 ? 35.192  42.311  13.842  1.00 2.00  ? 233 ILE A CD1 1 
ATOM   1628  N  N   . TYR A 1 203 ? 37.994  43.721  9.432   1.00 7.16  ? 234 TYR A N   1 
ATOM   1629  C  CA  . TYR A 1 203 ? 39.270  44.286  9.002   1.00 2.86  ? 234 TYR A CA  1 
ATOM   1630  C  C   . TYR A 1 203 ? 39.631  44.452  7.559   1.00 2.00  ? 234 TYR A C   1 
ATOM   1631  O  O   . TYR A 1 203 ? 40.501  45.216  7.250   1.00 2.17  ? 234 TYR A O   1 
ATOM   1632  C  CB  . TYR A 1 203 ? 40.402  43.556  9.698   1.00 2.00  ? 234 TYR A CB  1 
ATOM   1633  C  CG  . TYR A 1 203 ? 40.314  43.618  11.189  1.00 2.00  ? 234 TYR A CG  1 
ATOM   1634  C  CD1 . TYR A 1 203 ? 40.596  44.788  11.865  1.00 2.00  ? 234 TYR A CD1 1 
ATOM   1635  C  CD2 . TYR A 1 203 ? 39.924  42.516  11.922  1.00 2.00  ? 234 TYR A CD2 1 
ATOM   1636  C  CE1 . TYR A 1 203 ? 40.494  44.859  13.223  1.00 2.00  ? 234 TYR A CE1 1 
ATOM   1637  C  CE2 . TYR A 1 203 ? 39.817  42.584  13.279  1.00 2.00  ? 234 TYR A CE2 1 
ATOM   1638  C  CZ  . TYR A 1 203 ? 40.100  43.758  13.915  1.00 2.00  ? 234 TYR A CZ  1 
ATOM   1639  O  OH  . TYR A 1 203 ? 39.975  43.824  15.252  1.00 2.00  ? 234 TYR A OH  1 
ATOM   1640  N  N   . GLY A 1 204 ? 38.958  43.796  6.652   1.00 2.00  ? 235 GLY A N   1 
ATOM   1641  C  CA  . GLY A 1 204 ? 39.324  43.966  5.264   1.00 2.23  ? 235 GLY A CA  1 
ATOM   1642  C  C   . GLY A 1 204 ? 39.982  42.697  4.812   1.00 5.45  ? 235 GLY A C   1 
ATOM   1643  O  O   . GLY A 1 204 ? 40.688  42.025  5.573   1.00 7.37  ? 235 GLY A O   1 
ATOM   1644  N  N   . GLU A 1 205 ? 39.734  42.357  3.563   1.00 7.90  ? 236 GLU A N   1 
ATOM   1645  C  CA  . GLU A 1 205 ? 40.282  41.157  2.962   1.00 12.81 ? 236 GLU A CA  1 
ATOM   1646  C  C   . GLU A 1 205 ? 41.813  41.252  2.778   1.00 14.65 ? 236 GLU A C   1 
ATOM   1647  O  O   . GLU A 1 205 ? 42.552  40.308  3.030   1.00 18.26 ? 236 GLU A O   1 
ATOM   1648  C  CB  . GLU A 1 205 ? 39.612  40.950  1.599   1.00 21.05 ? 236 GLU A CB  1 
ATOM   1649  C  CG  . GLU A 1 205 ? 38.046  40.702  1.592   1.00 31.52 ? 236 GLU A CG  1 
ATOM   1650  C  CD  . GLU A 1 205 ? 37.131  41.865  2.096   1.00 33.26 ? 236 GLU A CD  1 
ATOM   1651  O  OE1 . GLU A 1 205 ? 36.921  42.861  1.358   1.00 35.15 ? 236 GLU A OE1 1 
ATOM   1652  O  OE2 . GLU A 1 205 ? 36.574  41.742  3.213   1.00 30.29 ? 236 GLU A OE2 1 
ATOM   1653  N  N   . THR A 1 206 ? 42.295  42.412  2.355   1.00 13.12 ? 237 THR A N   1 
ATOM   1654  C  CA  . THR A 1 206 ? 43.704  42.603  2.115   1.00 7.29  ? 237 THR A CA  1 
ATOM   1655  C  C   . THR A 1 206 ? 44.314  43.684  3.020   1.00 8.23  ? 237 THR A C   1 
ATOM   1656  O  O   . THR A 1 206 ? 43.592  44.558  3.544   1.00 4.48  ? 237 THR A O   1 
ATOM   1657  C  CB  . THR A 1 206 ? 43.896  42.967  0.653   1.00 6.42  ? 237 THR A CB  1 
ATOM   1658  O  OG1 . THR A 1 206 ? 43.204  44.185  0.356   1.00 2.00  ? 237 THR A OG1 1 
ATOM   1659  C  CG2 . THR A 1 206 ? 43.320  41.893  -0.213  1.00 2.00  ? 237 THR A CG2 1 
ATOM   1660  N  N   . LEU A 1 207 ? 45.646  43.619  3.165   1.00 8.20  ? 238 LEU A N   1 
ATOM   1661  C  CA  . LEU A 1 207 ? 46.455  44.543  3.977   1.00 6.53  ? 238 LEU A CA  1 
ATOM   1662  C  C   . LEU A 1 207 ? 46.326  45.955  3.429   1.00 6.95  ? 238 LEU A C   1 
ATOM   1663  O  O   . LEU A 1 207 ? 46.422  46.949  4.167   1.00 4.87  ? 238 LEU A O   1 
ATOM   1664  C  CB  . LEU A 1 207 ? 47.917  44.088  3.941   1.00 7.63  ? 238 LEU A CB  1 
ATOM   1665  C  CG  . LEU A 1 207 ? 49.044  44.729  4.753   1.00 6.49  ? 238 LEU A CG  1 
ATOM   1666  C  CD1 . LEU A 1 207 ? 49.559  45.934  4.007   1.00 8.54  ? 238 LEU A CD1 1 
ATOM   1667  C  CD2 . LEU A 1 207 ? 48.587  45.060  6.200   1.00 8.74  ? 238 LEU A CD2 1 
ATOM   1668  N  N   . ASP A 1 208 ? 46.171  46.042  2.118   1.00 5.98  ? 239 ASP A N   1 
ATOM   1669  C  CA  . ASP A 1 208 ? 45.954  47.329  1.502   1.00 9.62  ? 239 ASP A CA  1 
ATOM   1670  C  C   . ASP A 1 208 ? 44.589  47.900  1.997   1.00 11.37 ? 239 ASP A C   1 
ATOM   1671  O  O   . ASP A 1 208 ? 44.500  49.071  2.336   1.00 14.75 ? 239 ASP A O   1 
ATOM   1672  C  CB  . ASP A 1 208 ? 45.984  47.165  -0.007  1.00 16.01 ? 239 ASP A CB  1 
ATOM   1673  C  CG  . ASP A 1 208 ? 45.554  48.406  -0.727  1.00 22.27 ? 239 ASP A CG  1 
ATOM   1674  O  OD1 . ASP A 1 208 ? 46.183  49.460  -0.496  1.00 29.68 ? 239 ASP A OD1 1 
ATOM   1675  O  OD2 . ASP A 1 208 ? 44.575  48.331  -1.507  1.00 25.76 ? 239 ASP A OD2 1 
ATOM   1676  N  N   . ARG A 1 209 ? 43.548  47.063  2.074   1.00 10.86 ? 240 ARG A N   1 
ATOM   1677  C  CA  . ARG A 1 209 ? 42.230  47.465  2.564   1.00 7.43  ? 240 ARG A CA  1 
ATOM   1678  C  C   . ARG A 1 209 ? 42.295  47.747  4.071   1.00 4.35  ? 240 ARG A C   1 
ATOM   1679  O  O   . ARG A 1 209 ? 41.904  48.803  4.539   1.00 2.00  ? 240 ARG A O   1 
ATOM   1680  C  CB  . ARG A 1 209 ? 41.220  46.339  2.289   1.00 11.20 ? 240 ARG A CB  1 
ATOM   1681  C  CG  . ARG A 1 209 ? 39.737  46.625  2.620   1.00 8.87  ? 240 ARG A CG  1 
ATOM   1682  C  CD  . ARG A 1 209 ? 38.821  45.543  1.998   1.00 10.54 ? 240 ARG A CD  1 
ATOM   1683  N  NE  . ARG A 1 209 ? 37.408  45.731  2.365   1.00 12.47 ? 240 ARG A NE  1 
ATOM   1684  C  CZ  . ARG A 1 209 ? 36.571  46.603  1.789   1.00 9.89  ? 240 ARG A CZ  1 
ATOM   1685  N  NH1 . ARG A 1 209 ? 36.976  47.372  0.780   1.00 8.06  ? 240 ARG A NH1 1 
ATOM   1686  N  NH2 . ARG A 1 209 ? 35.380  46.828  2.335   1.00 6.07  ? 240 ARG A NH2 1 
ATOM   1687  N  N   . GLN A 1 210 ? 42.849  46.821  4.828   1.00 2.00  ? 241 GLN A N   1 
ATOM   1688  C  CA  . GLN A 1 210 ? 42.913  47.011  6.255   1.00 2.00  ? 241 GLN A CA  1 
ATOM   1689  C  C   . GLN A 1 210 ? 43.580  48.322  6.578   1.00 4.31  ? 241 GLN A C   1 
ATOM   1690  O  O   . GLN A 1 210 ? 43.260  48.988  7.573   1.00 5.11  ? 241 GLN A O   1 
ATOM   1691  C  CB  . GLN A 1 210 ? 43.652  45.852  6.916   1.00 2.00  ? 241 GLN A CB  1 
ATOM   1692  C  CG  . GLN A 1 210 ? 45.038  46.163  7.368   1.00 3.02  ? 241 GLN A CG  1 
ATOM   1693  C  CD  . GLN A 1 210 ? 45.314  45.634  8.752   1.00 4.98  ? 241 GLN A CD  1 
ATOM   1694  O  OE1 . GLN A 1 210 ? 45.603  46.384  9.670   1.00 5.19  ? 241 GLN A OE1 1 
ATOM   1695  N  NE2 . GLN A 1 210 ? 45.259  44.333  8.901   1.00 10.42 ? 241 GLN A NE2 1 
ATOM   1696  N  N   . HIS A 1 211 ? 44.519  48.705  5.730   1.00 5.09  ? 242 HIS A N   1 
ATOM   1697  C  CA  . HIS A 1 211 ? 45.225  49.944  5.978   1.00 8.53  ? 242 HIS A CA  1 
ATOM   1698  C  C   . HIS A 1 211 ? 44.341  51.171  5.739   1.00 7.95  ? 242 HIS A C   1 
ATOM   1699  O  O   . HIS A 1 211 ? 44.424  52.150  6.483   1.00 8.18  ? 242 HIS A O   1 
ATOM   1700  C  CB  . HIS A 1 211 ? 46.568  49.989  5.218   1.00 10.90 ? 242 HIS A CB  1 
ATOM   1701  C  CG  . HIS A 1 211 ? 47.694  49.247  5.901   1.00 9.80  ? 242 HIS A CG  1 
ATOM   1702  N  ND1 . HIS A 1 211 ? 47.612  48.769  7.198   1.00 9.13  ? 242 HIS A ND1 1 
ATOM   1703  C  CD2 . HIS A 1 211 ? 48.927  48.908  5.458   1.00 5.36  ? 242 HIS A CD2 1 
ATOM   1704  C  CE1 . HIS A 1 211 ? 48.741  48.167  7.522   1.00 5.42  ? 242 HIS A CE1 1 
ATOM   1705  N  NE2 . HIS A 1 211 ? 49.553  48.238  6.481   1.00 6.20  ? 242 HIS A NE2 1 
ATOM   1706  N  N   . LYS A 1 212 ? 43.431  51.077  4.770   1.00 8.17  ? 243 LYS A N   1 
ATOM   1707  C  CA  . LYS A 1 212 ? 42.489  52.177  4.477   1.00 5.87  ? 243 LYS A CA  1 
ATOM   1708  C  C   . LYS A 1 212 ? 41.417  52.272  5.560   1.00 2.24  ? 243 LYS A C   1 
ATOM   1709  O  O   . LYS A 1 212 ? 40.672  53.231  5.603   1.00 2.00  ? 243 LYS A O   1 
ATOM   1710  C  CB  . LYS A 1 212 ? 41.766  51.989  3.134   1.00 2.00  ? 243 LYS A CB  1 
ATOM   1711  C  CG  . LYS A 1 212 ? 42.642  51.963  1.925   1.00 2.00  ? 243 LYS A CG  1 
ATOM   1712  C  CD  . LYS A 1 212 ? 41.811  52.147  0.684   1.00 2.00  ? 243 LYS A CD  1 
ATOM   1713  C  CE  . LYS A 1 212 ? 42.619  51.815  -0.574  1.00 2.02  ? 243 LYS A CE  1 
ATOM   1714  N  NZ  . LYS A 1 212 ? 41.771  51.696  -1.793  1.00 2.00  ? 243 LYS A NZ  1 
ATOM   1715  N  N   . LEU A 1 213 ? 41.344  51.265  6.414   1.00 2.00  ? 244 LEU A N   1 
ATOM   1716  C  CA  . LEU A 1 213 ? 40.343  51.224  7.449   1.00 2.89  ? 244 LEU A CA  1 
ATOM   1717  C  C   . LEU A 1 213 ? 40.898  51.575  8.791   1.00 3.06  ? 244 LEU A C   1 
ATOM   1718  O  O   . LEU A 1 213 ? 40.137  51.836  9.738   1.00 2.03  ? 244 LEU A O   1 
ATOM   1719  C  CB  . LEU A 1 213 ? 39.760  49.811  7.525   1.00 4.06  ? 244 LEU A CB  1 
ATOM   1720  C  CG  . LEU A 1 213 ? 39.081  49.350  6.242   1.00 5.65  ? 244 LEU A CG  1 
ATOM   1721  C  CD1 . LEU A 1 213 ? 38.823  47.860  6.244   1.00 4.08  ? 244 LEU A CD1 1 
ATOM   1722  C  CD2 . LEU A 1 213 ? 37.817  50.157  6.074   1.00 2.00  ? 244 LEU A CD2 1 
ATOM   1723  N  N   . ARG A 1 214 ? 42.220  51.552  8.900   1.00 5.06  ? 245 ARG A N   1 
ATOM   1724  C  CA  . ARG A 1 214 ? 42.836  51.822  10.198  1.00 8.35  ? 245 ARG A CA  1 
ATOM   1725  C  C   . ARG A 1 214 ? 43.220  53.273  10.458  1.00 4.97  ? 245 ARG A C   1 
ATOM   1726  O  O   . ARG A 1 214 ? 43.609  53.987  9.544   1.00 3.66  ? 245 ARG A O   1 
ATOM   1727  C  CB  . ARG A 1 214 ? 44.041  50.896  10.437  1.00 9.40  ? 245 ARG A CB  1 
ATOM   1728  C  CG  . ARG A 1 214 ? 44.290  50.685  11.930  1.00 11.40 ? 245 ARG A CG  1 
ATOM   1729  C  CD  . ARG A 1 214 ? 45.685  50.205  12.209  1.00 14.29 ? 245 ARG A CD  1 
ATOM   1730  N  NE  . ARG A 1 214 ? 46.106  49.132  11.304  1.00 11.25 ? 245 ARG A NE  1 
ATOM   1731  C  CZ  . ARG A 1 214 ? 47.329  48.611  11.303  1.00 10.15 ? 245 ARG A CZ  1 
ATOM   1732  N  NH1 . ARG A 1 214 ? 48.239  49.042  12.173  1.00 7.84  ? 245 ARG A NH1 1 
ATOM   1733  N  NH2 . ARG A 1 214 ? 47.691  47.791  10.327  1.00 11.09 ? 245 ARG A NH2 1 
ATOM   1734  N  N   . LEU A 1 215 ? 43.085  53.701  11.707  1.00 2.00  ? 246 LEU A N   1 
ATOM   1735  C  CA  . LEU A 1 215 ? 43.423  55.068  12.098  1.00 4.41  ? 246 LEU A CA  1 
ATOM   1736  C  C   . LEU A 1 215 ? 44.942  55.238  12.336  1.00 8.55  ? 246 LEU A C   1 
ATOM   1737  O  O   . LEU A 1 215 ? 45.479  56.343  12.285  1.00 11.50 ? 246 LEU A O   1 
ATOM   1738  C  CB  . LEU A 1 215 ? 42.696  55.391  13.391  1.00 3.18  ? 246 LEU A CB  1 
ATOM   1739  C  CG  . LEU A 1 215 ? 42.988  56.676  14.146  1.00 2.00  ? 246 LEU A CG  1 
ATOM   1740  C  CD1 . LEU A 1 215 ? 42.324  57.829  13.434  1.00 2.00  ? 246 LEU A CD1 1 
ATOM   1741  C  CD2 . LEU A 1 215 ? 42.468  56.539  15.570  1.00 2.00  ? 246 LEU A CD2 1 
ATOM   1742  N  N   . PHE A 1 216 ? 45.629  54.124  12.586  1.00 10.29 ? 247 PHE A N   1 
ATOM   1743  C  CA  . PHE A 1 216 ? 47.055  54.124  12.878  1.00 5.71  ? 247 PHE A CA  1 
ATOM   1744  C  C   . PHE A 1 216 ? 47.261  55.070  14.043  1.00 6.56  ? 247 PHE A C   1 
ATOM   1745  O  O   . PHE A 1 216 ? 47.855  56.102  13.875  1.00 11.08 ? 247 PHE A O   1 
ATOM   1746  C  CB  . PHE A 1 216 ? 47.849  54.582  11.672  1.00 2.00  ? 247 PHE A CB  1 
ATOM   1747  C  CG  . PHE A 1 216 ? 47.811  53.624  10.524  1.00 2.00  ? 247 PHE A CG  1 
ATOM   1748  C  CD1 . PHE A 1 216 ? 48.204  52.296  10.690  1.00 2.71  ? 247 PHE A CD1 1 
ATOM   1749  C  CD2 . PHE A 1 216 ? 47.428  54.052  9.260   1.00 2.00  ? 247 PHE A CD2 1 
ATOM   1750  C  CE1 . PHE A 1 216 ? 48.214  51.408  9.590   1.00 3.41  ? 247 PHE A CE1 1 
ATOM   1751  C  CE2 . PHE A 1 216 ? 47.434  53.186  8.173   1.00 2.00  ? 247 PHE A CE2 1 
ATOM   1752  C  CZ  . PHE A 1 216 ? 47.828  51.864  8.331   1.00 2.00  ? 247 PHE A CZ  1 
ATOM   1753  N  N   . LYS A 1 217 ? 46.736  54.718  15.214  1.00 5.33  ? 248 LYS A N   1 
ATOM   1754  C  CA  . LYS A 1 217 ? 46.833  55.548  16.407  1.00 3.97  ? 248 LYS A CA  1 
ATOM   1755  C  C   . LYS A 1 217 ? 46.134  54.791  17.507  1.00 5.54  ? 248 LYS A C   1 
ATOM   1756  O  O   . LYS A 1 217 ? 44.915  54.679  17.493  1.00 7.28  ? 248 LYS A O   1 
ATOM   1757  C  CB  . LYS A 1 217 ? 46.074  56.821  16.171  1.00 3.79  ? 248 LYS A CB  1 
ATOM   1758  C  CG  . LYS A 1 217 ? 46.278  57.870  17.210  1.00 9.35  ? 248 LYS A CG  1 
ATOM   1759  C  CD  . LYS A 1 217 ? 45.637  59.161  16.710  1.00 15.97 ? 248 LYS A CD  1 
ATOM   1760  C  CE  . LYS A 1 217 ? 46.075  59.417  15.268  1.00 20.08 ? 248 LYS A CE  1 
ATOM   1761  N  NZ  . LYS A 1 217 ? 45.252  60.440  14.608  1.00 28.11 ? 248 LYS A NZ  1 
ATOM   1762  N  N   . ASP A 1 218 ? 46.901  54.290  18.471  1.00 6.44  ? 249 ASP A N   1 
ATOM   1763  C  CA  . ASP A 1 218 ? 46.381  53.479  19.576  1.00 3.69  ? 249 ASP A CA  1 
ATOM   1764  C  C   . ASP A 1 218 ? 45.755  52.218  19.033  1.00 2.12  ? 249 ASP A C   1 
ATOM   1765  O  O   . ASP A 1 218 ? 44.988  51.582  19.720  1.00 2.00  ? 249 ASP A O   1 
ATOM   1766  C  CB  . ASP A 1 218 ? 45.392  54.241  20.427  1.00 6.17  ? 249 ASP A CB  1 
ATOM   1767  C  CG  . ASP A 1 218 ? 45.872  55.627  20.737  1.00 11.67 ? 249 ASP A CG  1 
ATOM   1768  O  OD1 . ASP A 1 218 ? 46.671  55.783  21.674  1.00 13.11 ? 249 ASP A OD1 1 
ATOM   1769  O  OD2 . ASP A 1 218 ? 45.479  56.563  20.017  1.00 15.86 ? 249 ASP A OD2 1 
ATOM   1770  N  N   . GLY A 1 219 ? 46.117  51.863  17.798  1.00 2.05  ? 250 GLY A N   1 
ATOM   1771  C  CA  . GLY A 1 219 ? 45.617  50.669  17.149  1.00 3.85  ? 250 GLY A CA  1 
ATOM   1772  C  C   . GLY A 1 219 ? 44.184  50.719  16.678  1.00 5.97  ? 250 GLY A C   1 
ATOM   1773  O  O   . GLY A 1 219 ? 43.720  49.797  16.011  1.00 7.35  ? 250 GLY A O   1 
ATOM   1774  N  N   . LYS A 1 220 ? 43.499  51.809  17.001  1.00 6.79  ? 251 LYS A N   1 
ATOM   1775  C  CA  . LYS A 1 220 ? 42.098  52.013  16.677  1.00 4.00  ? 251 LYS A CA  1 
ATOM   1776  C  C   . LYS A 1 220 ? 41.762  51.988  15.205  1.00 6.06  ? 251 LYS A C   1 
ATOM   1777  O  O   . LYS A 1 220 ? 42.592  52.346  14.347  1.00 4.79  ? 251 LYS A O   1 
ATOM   1778  C  CB  . LYS A 1 220 ? 41.640  53.330  17.272  1.00 3.27  ? 251 LYS A CB  1 
ATOM   1779  C  CG  . LYS A 1 220 ? 41.620  53.337  18.784  1.00 3.58  ? 251 LYS A CG  1 
ATOM   1780  C  CD  . LYS A 1 220 ? 41.496  54.754  19.316  1.00 5.47  ? 251 LYS A CD  1 
ATOM   1781  C  CE  . LYS A 1 220 ? 41.242  54.768  20.813  1.00 2.00  ? 251 LYS A CE  1 
ATOM   1782  N  NZ  . LYS A 1 220 ? 39.898  54.242  21.099  1.00 5.87  ? 251 LYS A NZ  1 
ATOM   1783  N  N   . LEU A 1 221 ? 40.552  51.495  14.927  1.00 6.57  ? 252 LEU A N   1 
ATOM   1784  C  CA  . LEU A 1 221 ? 40.018  51.436  13.569  1.00 7.27  ? 252 LEU A CA  1 
ATOM   1785  C  C   . LEU A 1 221 ? 39.473  52.842  13.320  1.00 7.21  ? 252 LEU A C   1 
ATOM   1786  O  O   . LEU A 1 221 ? 39.087  53.546  14.268  1.00 4.87  ? 252 LEU A O   1 
ATOM   1787  C  CB  . LEU A 1 221 ? 38.872  50.422  13.479  1.00 4.40  ? 252 LEU A CB  1 
ATOM   1788  C  CG  . LEU A 1 221 ? 39.013  49.138  12.642  1.00 3.87  ? 252 LEU A CG  1 
ATOM   1789  C  CD1 . LEU A 1 221 ? 39.938  49.350  11.452  1.00 3.32  ? 252 LEU A CD1 1 
ATOM   1790  C  CD2 . LEU A 1 221 ? 39.503  48.010  13.510  1.00 2.00  ? 252 LEU A CD2 1 
ATOM   1791  N  N   . LYS A 1 222 ? 39.452  53.269  12.064  1.00 8.67  ? 253 LYS A N   1 
ATOM   1792  C  CA  . LYS A 1 222 ? 38.953  54.607  11.764  1.00 9.33  ? 253 LYS A CA  1 
ATOM   1793  C  C   . LYS A 1 222 ? 37.461  54.573  12.027  1.00 11.35 ? 253 LYS A C   1 
ATOM   1794  O  O   . LYS A 1 222 ? 36.847  53.504  11.905  1.00 12.62 ? 253 LYS A O   1 
ATOM   1795  C  CB  . LYS A 1 222 ? 39.205  54.944  10.297  1.00 10.52 ? 253 LYS A CB  1 
ATOM   1796  C  CG  . LYS A 1 222 ? 39.308  56.415  10.002  1.00 15.84 ? 253 LYS A CG  1 
ATOM   1797  C  CD  . LYS A 1 222 ? 40.554  56.749  9.163   1.00 21.74 ? 253 LYS A CD  1 
ATOM   1798  C  CE  . LYS A 1 222 ? 40.536  56.166  7.746   1.00 21.08 ? 253 LYS A CE  1 
ATOM   1799  N  NZ  . LYS A 1 222 ? 40.533  54.693  7.710   1.00 21.43 ? 253 LYS A NZ  1 
ATOM   1800  N  N   . TYR A 1 223 ? 36.882  55.724  12.386  1.00 12.52 ? 254 TYR A N   1 
ATOM   1801  C  CA  . TYR A 1 223 ? 35.440  55.841  12.647  1.00 11.36 ? 254 TYR A CA  1 
ATOM   1802  C  C   . TYR A 1 223 ? 34.975  57.295  12.602  1.00 11.32 ? 254 TYR A C   1 
ATOM   1803  O  O   . TYR A 1 223 ? 35.787  58.196  12.399  1.00 15.44 ? 254 TYR A O   1 
ATOM   1804  C  CB  . TYR A 1 223 ? 35.132  55.294  14.030  1.00 11.18 ? 254 TYR A CB  1 
ATOM   1805  C  CG  . TYR A 1 223 ? 35.702  56.127  15.137  1.00 7.89  ? 254 TYR A CG  1 
ATOM   1806  C  CD1 . TYR A 1 223 ? 34.978  57.154  15.684  1.00 5.65  ? 254 TYR A CD1 1 
ATOM   1807  C  CD2 . TYR A 1 223 ? 36.959  55.860  15.646  1.00 8.68  ? 254 TYR A CD2 1 
ATOM   1808  C  CE1 . TYR A 1 223 ? 35.483  57.893  16.704  1.00 10.22 ? 254 TYR A CE1 1 
ATOM   1809  C  CE2 . TYR A 1 223 ? 37.472  56.587  16.672  1.00 10.57 ? 254 TYR A CE2 1 
ATOM   1810  C  CZ  . TYR A 1 223 ? 36.736  57.610  17.205  1.00 10.83 ? 254 TYR A CZ  1 
ATOM   1811  O  OH  . TYR A 1 223 ? 37.267  58.365  18.236  1.00 13.26 ? 254 TYR A OH  1 
ATOM   1812  N  N   . GLN A 1 224 ? 33.691  57.525  12.874  1.00 10.37 ? 255 GLN A N   1 
ATOM   1813  C  CA  . GLN A 1 224 ? 33.126  58.869  12.899  1.00 8.16  ? 255 GLN A CA  1 
ATOM   1814  C  C   . GLN A 1 224 ? 32.022  58.972  13.925  1.00 9.09  ? 255 GLN A C   1 
ATOM   1815  O  O   . GLN A 1 224 ? 31.392  57.968  14.265  1.00 9.62  ? 255 GLN A O   1 
ATOM   1816  C  CB  . GLN A 1 224 ? 32.572  59.258  11.543  1.00 7.29  ? 255 GLN A CB  1 
ATOM   1817  C  CG  . GLN A 1 224 ? 31.310  58.561  11.147  1.00 6.74  ? 255 GLN A CG  1 
ATOM   1818  C  CD  . GLN A 1 224 ? 30.840  58.990  9.766   1.00 8.41  ? 255 GLN A CD  1 
ATOM   1819  O  OE1 . GLN A 1 224 ? 30.396  60.113  9.577   1.00 8.04  ? 255 GLN A OE1 1 
ATOM   1820  N  NE2 . GLN A 1 224 ? 30.963  58.103  8.790   1.00 11.10 ? 255 GLN A NE2 1 
ATOM   1821  N  N   . VAL A 1 225 ? 31.822  60.180  14.451  1.00 9.33  ? 256 VAL A N   1 
ATOM   1822  C  CA  . VAL A 1 225 ? 30.785  60.410  15.440  1.00 8.40  ? 256 VAL A CA  1 
ATOM   1823  C  C   . VAL A 1 225 ? 29.627  61.168  14.823  1.00 9.85  ? 256 VAL A C   1 
ATOM   1824  O  O   . VAL A 1 225 ? 29.744  62.347  14.524  1.00 11.14 ? 256 VAL A O   1 
ATOM   1825  C  CB  . VAL A 1 225 ? 31.277  61.183  16.672  1.00 4.63  ? 256 VAL A CB  1 
ATOM   1826  C  CG1 . VAL A 1 225 ? 30.124  61.410  17.625  1.00 6.51  ? 256 VAL A CG1 1 
ATOM   1827  C  CG2 . VAL A 1 225 ? 32.318  60.410  17.391  1.00 7.04  ? 256 VAL A CG2 1 
ATOM   1828  N  N   . ILE A 1 226 ? 28.530  60.459  14.586  1.00 10.62 ? 257 ILE A N   1 
ATOM   1829  C  CA  . ILE A 1 226 ? 27.317  61.023  14.044  1.00 6.49  ? 257 ILE A CA  1 
ATOM   1830  C  C   . ILE A 1 226 ? 26.482  61.189  15.282  1.00 6.45  ? 257 ILE A C   1 
ATOM   1831  O  O   . ILE A 1 226 ? 26.467  60.336  16.162  1.00 5.40  ? 257 ILE A O   1 
ATOM   1832  C  CB  . ILE A 1 226 ? 26.634  60.051  13.079  1.00 6.94  ? 257 ILE A CB  1 
ATOM   1833  C  CG1 . ILE A 1 226 ? 27.311  60.101  11.713  1.00 8.47  ? 257 ILE A CG1 1 
ATOM   1834  C  CG2 . ILE A 1 226 ? 25.183  60.381  12.946  1.00 9.41  ? 257 ILE A CG2 1 
ATOM   1835  C  CD1 . ILE A 1 226 ? 26.835  59.029  10.737  1.00 12.16 ? 257 ILE A CD1 1 
ATOM   1836  N  N   . GLY A 1 227 ? 25.818  62.320  15.374  1.00 9.06  ? 258 GLY A N   1 
ATOM   1837  C  CA  . GLY A 1 227 ? 24.996  62.566  16.537  1.00 14.73 ? 258 GLY A CA  1 
ATOM   1838  C  C   . GLY A 1 227 ? 25.963  62.524  17.700  1.00 16.00 ? 258 GLY A C   1 
ATOM   1839  O  O   . GLY A 1 227 ? 26.883  63.330  17.786  1.00 18.58 ? 258 GLY A O   1 
ATOM   1840  N  N   . GLY A 1 228 ? 25.773  61.595  18.609  1.00 15.66 ? 259 GLY A N   1 
ATOM   1841  C  CA  . GLY A 1 228 ? 26.709  61.515  19.701  1.00 15.47 ? 259 GLY A CA  1 
ATOM   1842  C  C   . GLY A 1 228 ? 27.258  60.109  19.674  1.00 17.71 ? 259 GLY A C   1 
ATOM   1843  O  O   . GLY A 1 228 ? 27.987  59.711  20.586  1.00 18.97 ? 259 GLY A O   1 
ATOM   1844  N  N   . GLU A 1 229 ? 26.932  59.357  18.622  1.00 16.93 ? 260 GLU A N   1 
ATOM   1845  C  CA  . GLU A 1 229 ? 27.337  57.970  18.550  1.00 17.46 ? 260 GLU A CA  1 
ATOM   1846  C  C   . GLU A 1 229 ? 28.417  57.766  17.529  1.00 19.13 ? 260 GLU A C   1 
ATOM   1847  O  O   . GLU A 1 229 ? 28.563  58.586  16.642  1.00 19.20 ? 260 GLU A O   1 
ATOM   1848  C  CB  . GLU A 1 229 ? 26.131  57.083  18.215  1.00 17.83 ? 260 GLU A CB  1 
ATOM   1849  C  CG  . GLU A 1 229 ? 24.910  57.243  19.143  1.00 18.96 ? 260 GLU A CG  1 
ATOM   1850  C  CD  . GLU A 1 229 ? 25.222  57.013  20.622  1.00 20.67 ? 260 GLU A CD  1 
ATOM   1851  O  OE1 . GLU A 1 229 ? 25.358  55.840  21.048  1.00 25.45 ? 260 GLU A OE1 1 
ATOM   1852  O  OE2 . GLU A 1 229 ? 25.310  58.002  21.369  1.00 19.27 ? 260 GLU A OE2 1 
ATOM   1853  N  N   . VAL A 1 230 ? 29.173  56.670  17.682  1.00 21.09 ? 261 VAL A N   1 
ATOM   1854  C  CA  . VAL A 1 230 ? 30.276  56.270  16.786  1.00 17.17 ? 261 VAL A CA  1 
ATOM   1855  C  C   . VAL A 1 230 ? 29.719  55.394  15.662  1.00 15.37 ? 261 VAL A C   1 
ATOM   1856  O  O   . VAL A 1 230 ? 28.866  54.525  15.905  1.00 16.41 ? 261 VAL A O   1 
ATOM   1857  C  CB  . VAL A 1 230 ? 31.345  55.461  17.567  1.00 16.92 ? 261 VAL A CB  1 
ATOM   1858  C  CG1 . VAL A 1 230 ? 32.068  54.494  16.653  1.00 17.13 ? 261 VAL A CG1 1 
ATOM   1859  C  CG2 . VAL A 1 230 ? 32.335  56.400  18.229  1.00 14.91 ? 261 VAL A CG2 1 
ATOM   1860  N  N   . TYR A 1 231 ? 30.220  55.603  14.451  1.00 10.74 ? 262 TYR A N   1 
ATOM   1861  C  CA  . TYR A 1 231 ? 29.773  54.844  13.289  1.00 9.92  ? 262 TYR A CA  1 
ATOM   1862  C  C   . TYR A 1 231 ? 30.937  54.628  12.353  1.00 8.03  ? 262 TYR A C   1 
ATOM   1863  O  O   . TYR A 1 231 ? 31.915  55.325  12.432  1.00 9.64  ? 262 TYR A O   1 
ATOM   1864  C  CB  . TYR A 1 231 ? 28.670  55.608  12.516  1.00 10.38 ? 262 TYR A CB  1 
ATOM   1865  C  CG  . TYR A 1 231 ? 27.359  55.672  13.230  1.00 9.99  ? 262 TYR A CG  1 
ATOM   1866  C  CD1 . TYR A 1 231 ? 26.504  54.583  13.218  1.00 12.01 ? 262 TYR A CD1 1 
ATOM   1867  C  CD2 . TYR A 1 231 ? 27.031  56.760  14.028  1.00 7.92  ? 262 TYR A CD2 1 
ATOM   1868  C  CE1 . TYR A 1 231 ? 25.350  54.560  14.001  1.00 12.27 ? 262 TYR A CE1 1 
ATOM   1869  C  CE2 . TYR A 1 231 ? 25.900  56.749  14.808  1.00 10.71 ? 262 TYR A CE2 1 
ATOM   1870  C  CZ  . TYR A 1 231 ? 25.062  55.637  14.796  1.00 12.00 ? 262 TYR A CZ  1 
ATOM   1871  O  OH  . TYR A 1 231 ? 23.974  55.562  15.621  1.00 13.04 ? 262 TYR A OH  1 
ATOM   1872  N  N   . PRO A 1 232 ? 30.858  53.624  11.478  1.00 9.80  ? 263 PRO A N   1 
ATOM   1873  C  CA  . PRO A 1 232 ? 31.930  53.366  10.531  1.00 11.31 ? 263 PRO A CA  1 
ATOM   1874  C  C   . PRO A 1 232 ? 32.182  54.653  9.742   1.00 10.66 ? 263 PRO A C   1 
ATOM   1875  O  O   . PRO A 1 232 ? 31.287  55.466  9.577   1.00 4.84  ? 263 PRO A O   1 
ATOM   1876  C  CB  . PRO A 1 232 ? 31.315  52.294  9.613   1.00 12.02 ? 263 PRO A CB  1 
ATOM   1877  C  CG  . PRO A 1 232 ? 30.503  51.505  10.541  1.00 12.07 ? 263 PRO A CG  1 
ATOM   1878  C  CD  . PRO A 1 232 ? 29.827  52.570  11.379  1.00 14.24 ? 263 PRO A CD  1 
ATOM   1879  N  N   . PRO A 1 233 ? 33.412  54.832  9.234   1.00 12.75 ? 264 PRO A N   1 
ATOM   1880  C  CA  . PRO A 1 233 ? 33.801  56.003  8.461   1.00 11.09 ? 264 PRO A CA  1 
ATOM   1881  C  C   . PRO A 1 233 ? 33.266  55.929  7.047   1.00 9.28  ? 264 PRO A C   1 
ATOM   1882  O  O   . PRO A 1 233 ? 32.876  54.881  6.576   1.00 9.59  ? 264 PRO A O   1 
ATOM   1883  C  CB  . PRO A 1 233 ? 35.315  55.924  8.494   1.00 14.31 ? 264 PRO A CB  1 
ATOM   1884  C  CG  . PRO A 1 233 ? 35.563  54.467  8.395   1.00 15.53 ? 264 PRO A CG  1 
ATOM   1885  C  CD  . PRO A 1 233 ? 34.539  53.879  9.342   1.00 15.96 ? 264 PRO A CD  1 
ATOM   1886  N  N   . THR A 1 234 ? 33.316  57.047  6.356   1.00 9.07  ? 265 THR A N   1 
ATOM   1887  C  CA  . THR A 1 234 ? 32.798  57.144  5.011   1.00 9.75  ? 265 THR A CA  1 
ATOM   1888  C  C   . THR A 1 234 ? 33.654  56.533  3.956   1.00 2.19  ? 265 THR A C   1 
ATOM   1889  O  O   . THR A 1 234 ? 34.853  56.549  4.053   1.00 2.07  ? 265 THR A O   1 
ATOM   1890  C  CB  . THR A 1 234 ? 32.589  58.636  4.640   1.00 19.84 ? 265 THR A CB  1 
ATOM   1891  O  OG1 . THR A 1 234 ? 33.824  59.387  4.840   1.00 23.88 ? 265 THR A OG1 1 
ATOM   1892  C  CG2 . THR A 1 234 ? 31.453  59.246  5.517   1.00 24.96 ? 265 THR A CG2 1 
ATOM   1893  N  N   . VAL A 1 235 ? 33.020  56.012  2.927   1.00 2.00  ? 266 VAL A N   1 
ATOM   1894  C  CA  . VAL A 1 235 ? 33.732  55.433  1.796   1.00 3.16  ? 266 VAL A CA  1 
ATOM   1895  C  C   . VAL A 1 235 ? 34.473  56.567  1.181   1.00 3.68  ? 266 VAL A C   1 
ATOM   1896  O  O   . VAL A 1 235 ? 35.574  56.391  0.687   1.00 3.59  ? 266 VAL A O   1 
ATOM   1897  C  CB  . VAL A 1 235 ? 32.763  54.853  0.718   1.00 5.53  ? 266 VAL A CB  1 
ATOM   1898  C  CG1 . VAL A 1 235 ? 33.368  54.902  -0.679  1.00 2.00  ? 266 VAL A CG1 1 
ATOM   1899  C  CG2 . VAL A 1 235 ? 32.408  53.413  1.063   1.00 11.82 ? 266 VAL A CG2 1 
ATOM   1900  N  N   . LYS A 1 236 ? 33.859  57.745  1.232   1.00 7.12  ? 267 LYS A N   1 
ATOM   1901  C  CA  . LYS A 1 236 ? 34.453  58.973  0.676   1.00 8.72  ? 267 LYS A CA  1 
ATOM   1902  C  C   . LYS A 1 236 ? 35.827  59.259  1.324   1.00 8.69  ? 267 LYS A C   1 
ATOM   1903  O  O   . LYS A 1 236 ? 36.826  59.484  0.620   1.00 4.83  ? 267 LYS A O   1 
ATOM   1904  C  CB  . LYS A 1 236 ? 33.527  60.155  0.911   1.00 9.37  ? 267 LYS A CB  1 
ATOM   1905  C  CG  . LYS A 1 236 ? 33.861  61.396  0.111   1.00 13.99 ? 267 LYS A CG  1 
ATOM   1906  C  CD  . LYS A 1 236 ? 33.456  62.630  0.942   1.00 20.08 ? 267 LYS A CD  1 
ATOM   1907  C  CE  . LYS A 1 236 ? 33.804  63.971  0.265   1.00 23.31 ? 267 LYS A CE  1 
ATOM   1908  N  NZ  . LYS A 1 236 ? 33.657  65.158  1.202   1.00 18.36 ? 267 LYS A NZ  1 
ATOM   1909  N  N   . ASP A 1 237 ? 35.865  59.230  2.658   1.00 7.30  ? 268 ASP A N   1 
ATOM   1910  C  CA  . ASP A 1 237 ? 37.089  59.452  3.392   1.00 6.92  ? 268 ASP A CA  1 
ATOM   1911  C  C   . ASP A 1 237 ? 38.107  58.340  3.242   1.00 4.80  ? 268 ASP A C   1 
ATOM   1912  O  O   . ASP A 1 237 ? 39.172  58.553  2.679   1.00 6.13  ? 268 ASP A O   1 
ATOM   1913  C  CB  . ASP A 1 237 ? 36.822  59.632  4.875   1.00 15.60 ? 268 ASP A CB  1 
ATOM   1914  C  CG  . ASP A 1 237 ? 38.123  59.749  5.681   1.00 24.06 ? 268 ASP A CG  1 
ATOM   1915  O  OD1 . ASP A 1 237 ? 38.763  60.836  5.614   1.00 32.05 ? 268 ASP A OD1 1 
ATOM   1916  O  OD2 . ASP A 1 237 ? 38.523  58.758  6.343   1.00 16.60 ? 268 ASP A OD2 1 
ATOM   1917  N  N   . THR A 1 238 ? 37.797  57.166  3.785   1.00 3.07  ? 269 THR A N   1 
ATOM   1918  C  CA  . THR A 1 238 ? 38.712  56.029  3.729   1.00 2.45  ? 269 THR A CA  1 
ATOM   1919  C  C   . THR A 1 238 ? 38.995  55.561  2.311   1.00 2.00  ? 269 THR A C   1 
ATOM   1920  O  O   . THR A 1 238 ? 39.990  54.891  2.071   1.00 8.24  ? 269 THR A O   1 
ATOM   1921  C  CB  . THR A 1 238 ? 38.183  54.840  4.460   1.00 2.00  ? 269 THR A CB  1 
ATOM   1922  O  OG1 . THR A 1 238 ? 37.045  54.383  3.755   1.00 2.00  ? 269 THR A OG1 1 
ATOM   1923  C  CG2 . THR A 1 238 ? 37.788  55.180  5.860   1.00 2.00  ? 269 THR A CG2 1 
ATOM   1924  N  N   . GLN A 1 239 ? 38.083  55.806  1.394   1.00 2.00  ? 270 GLN A N   1 
ATOM   1925  C  CA  . GLN A 1 239 ? 38.309  55.413  0.024   1.00 2.10  ? 270 GLN A CA  1 
ATOM   1926  C  C   . GLN A 1 239 ? 38.164  53.916  -0.223  1.00 4.99  ? 270 GLN A C   1 
ATOM   1927  O  O   . GLN A 1 239 ? 38.380  53.445  -1.346  1.00 5.71  ? 270 GLN A O   1 
ATOM   1928  C  CB  . GLN A 1 239 ? 39.693  55.843  -0.415  1.00 2.04  ? 270 GLN A CB  1 
ATOM   1929  C  CG  . GLN A 1 239 ? 39.752  56.505  -1.772  1.00 9.54  ? 270 GLN A CG  1 
ATOM   1930  C  CD  . GLN A 1 239 ? 39.831  58.021  -1.679  1.00 12.85 ? 270 GLN A CD  1 
ATOM   1931  O  OE1 . GLN A 1 239 ? 40.923  58.599  -1.679  1.00 8.00  ? 270 GLN A OE1 1 
ATOM   1932  N  NE2 . GLN A 1 239 ? 38.670  58.674  -1.602  1.00 16.47 ? 270 GLN A NE2 1 
ATOM   1933  N  N   . VAL A 1 240 ? 37.787  53.151  0.796   1.00 4.11  ? 271 VAL A N   1 
ATOM   1934  C  CA  . VAL A 1 240 ? 37.632  51.728  0.604   1.00 2.93  ? 271 VAL A CA  1 
ATOM   1935  C  C   . VAL A 1 240 ? 36.406  51.463  -0.266  1.00 5.56  ? 271 VAL A C   1 
ATOM   1936  O  O   . VAL A 1 240 ? 35.364  52.053  -0.046  1.00 7.53  ? 271 VAL A O   1 
ATOM   1937  C  CB  . VAL A 1 240 ? 37.461  51.003  1.930   1.00 2.00  ? 271 VAL A CB  1 
ATOM   1938  C  CG1 . VAL A 1 240 ? 38.190  51.674  3.009   1.00 2.00  ? 271 VAL A CG1 1 
ATOM   1939  C  CG2 . VAL A 1 240 ? 36.036  50.865  2.280   1.00 3.55  ? 271 VAL A CG2 1 
ATOM   1940  N  N   . GLU A 1 241 ? 36.517  50.593  -1.264  1.00 10.00 ? 272 GLU A N   1 
ATOM   1941  C  CA  . GLU A 1 241 ? 35.359  50.284  -2.102  1.00 11.24 ? 272 GLU A CA  1 
ATOM   1942  C  C   . GLU A 1 241 ? 34.406  49.433  -1.314  1.00 10.48 ? 272 GLU A C   1 
ATOM   1943  O  O   . GLU A 1 241 ? 34.829  48.551  -0.567  1.00 9.98  ? 272 GLU A O   1 
ATOM   1944  C  CB  . GLU A 1 241 ? 35.741  49.549  -3.378  1.00 14.76 ? 272 GLU A CB  1 
ATOM   1945  C  CG  . GLU A 1 241 ? 36.568  50.404  -4.337  1.00 29.58 ? 272 GLU A CG  1 
ATOM   1946  C  CD  . GLU A 1 241 ? 36.900  49.714  -5.676  1.00 37.65 ? 272 GLU A CD  1 
ATOM   1947  O  OE1 . GLU A 1 241 ? 36.821  48.456  -5.771  1.00 41.65 ? 272 GLU A OE1 1 
ATOM   1948  O  OE2 . GLU A 1 241 ? 37.264  50.448  -6.638  1.00 41.43 ? 272 GLU A OE2 1 
ATOM   1949  N  N   . MET A 1 242 ? 33.126  49.780  -1.425  1.00 11.33 ? 273 MET A N   1 
ATOM   1950  C  CA  . MET A 1 242 ? 32.016  49.092  -0.762  1.00 7.09  ? 273 MET A CA  1 
ATOM   1951  C  C   . MET A 1 242 ? 30.913  49.013  -1.815  1.00 7.77  ? 273 MET A C   1 
ATOM   1952  O  O   . MET A 1 242 ? 30.935  49.748  -2.808  1.00 7.44  ? 273 MET A O   1 
ATOM   1953  C  CB  . MET A 1 242 ? 31.506  49.901  0.423   1.00 4.14  ? 273 MET A CB  1 
ATOM   1954  C  CG  . MET A 1 242 ? 32.310  49.808  1.667   1.00 2.00  ? 273 MET A CG  1 
ATOM   1955  S  SD  . MET A 1 242 ? 32.269  48.160  2.183   1.00 2.00  ? 273 MET A SD  1 
ATOM   1956  C  CE  . MET A 1 242 ? 30.845  48.128  3.113   1.00 5.21  ? 273 MET A CE  1 
ATOM   1957  N  N   . ILE A 1 243 ? 29.962  48.106  -1.618  1.00 11.52 ? 274 ILE A N   1 
ATOM   1958  C  CA  . ILE A 1 243 ? 28.849  47.932  -2.563  1.00 13.06 ? 274 ILE A CA  1 
ATOM   1959  C  C   . ILE A 1 243 ? 27.608  48.704  -2.099  1.00 11.76 ? 274 ILE A C   1 
ATOM   1960  O  O   . ILE A 1 243 ? 26.990  48.353  -1.086  1.00 9.25  ? 274 ILE A O   1 
ATOM   1961  C  CB  . ILE A 1 243 ? 28.472  46.447  -2.747  1.00 13.50 ? 274 ILE A CB  1 
ATOM   1962  C  CG1 . ILE A 1 243 ? 29.680  45.642  -3.209  1.00 13.91 ? 274 ILE A CG1 1 
ATOM   1963  C  CG2 . ILE A 1 243 ? 27.400  46.342  -3.801  1.00 14.87 ? 274 ILE A CG2 1 
ATOM   1964  C  CD1 . ILE A 1 243 ? 29.428  44.177  -3.214  1.00 20.76 ? 274 ILE A CD1 1 
ATOM   1965  N  N   . TYR A 1 244 ? 27.250  49.732  -2.867  1.00 10.30 ? 275 TYR A N   1 
ATOM   1966  C  CA  . TYR A 1 244 ? 26.118  50.597  -2.567  1.00 10.23 ? 275 TYR A CA  1 
ATOM   1967  C  C   . TYR A 1 244 ? 25.388  51.087  -3.833  1.00 13.37 ? 275 TYR A C   1 
ATOM   1968  O  O   . TYR A 1 244 ? 26.020  51.517  -4.797  1.00 15.30 ? 275 TYR A O   1 
ATOM   1969  C  CB  . TYR A 1 244 ? 26.606  51.812  -1.795  1.00 5.86  ? 275 TYR A CB  1 
ATOM   1970  C  CG  . TYR A 1 244 ? 26.886  51.573  -0.345  1.00 2.00  ? 275 TYR A CG  1 
ATOM   1971  C  CD1 . TYR A 1 244 ? 25.888  51.188  0.512   1.00 2.00  ? 275 TYR A CD1 1 
ATOM   1972  C  CD2 . TYR A 1 244 ? 28.129  51.832  0.188   1.00 3.20  ? 275 TYR A CD2 1 
ATOM   1973  C  CE1 . TYR A 1 244 ? 26.115  51.079  1.869   1.00 3.18  ? 275 TYR A CE1 1 
ATOM   1974  C  CE2 . TYR A 1 244 ? 28.363  51.723  1.555   1.00 2.41  ? 275 TYR A CE2 1 
ATOM   1975  C  CZ  . TYR A 1 244 ? 27.352  51.351  2.388   1.00 2.00  ? 275 TYR A CZ  1 
ATOM   1976  O  OH  . TYR A 1 244 ? 27.588  51.284  3.740   1.00 2.07  ? 275 TYR A OH  1 
ATOM   1977  N  N   . PRO A 1 245 ? 24.036  51.058  -3.827  1.00 14.68 ? 276 PRO A N   1 
ATOM   1978  C  CA  . PRO A 1 245 ? 23.205  51.492  -4.961  1.00 11.17 ? 276 PRO A CA  1 
ATOM   1979  C  C   . PRO A 1 245 ? 23.443  52.969  -5.224  1.00 11.04 ? 276 PRO A C   1 
ATOM   1980  O  O   . PRO A 1 245 ? 23.419  53.781  -4.297  1.00 7.78  ? 276 PRO A O   1 
ATOM   1981  C  CB  . PRO A 1 245 ? 21.794  51.259  -4.455  1.00 13.10 ? 276 PRO A CB  1 
ATOM   1982  C  CG  . PRO A 1 245 ? 21.963  50.149  -3.439  1.00 16.37 ? 276 PRO A CG  1 
ATOM   1983  C  CD  . PRO A 1 245 ? 23.194  50.577  -2.713  1.00 15.63 ? 276 PRO A CD  1 
ATOM   1984  N  N   . PRO A 1 246 ? 23.578  53.352  -6.506  1.00 11.22 ? 277 PRO A N   1 
ATOM   1985  C  CA  . PRO A 1 246 ? 23.825  54.732  -6.924  1.00 11.39 ? 277 PRO A CA  1 
ATOM   1986  C  C   . PRO A 1 246 ? 22.970  55.807  -6.291  1.00 11.08 ? 277 PRO A C   1 
ATOM   1987  O  O   . PRO A 1 246 ? 23.395  56.950  -6.165  1.00 12.58 ? 277 PRO A O   1 
ATOM   1988  C  CB  . PRO A 1 246 ? 23.692  54.672  -8.449  1.00 9.70  ? 277 PRO A CB  1 
ATOM   1989  C  CG  . PRO A 1 246 ? 22.914  53.468  -8.691  1.00 12.39 ? 277 PRO A CG  1 
ATOM   1990  C  CD  . PRO A 1 246 ? 23.423  52.495  -7.686  1.00 12.52 ? 277 PRO A CD  1 
ATOM   1991  N  N   . HIS A 1 247 ? 21.782  55.439  -5.850  1.00 12.36 ? 278 HIS A N   1 
ATOM   1992  C  CA  . HIS A 1 247 ? 20.896  56.412  -5.220  1.00 13.36 ? 278 HIS A CA  1 
ATOM   1993  C  C   . HIS A 1 247 ? 21.326  56.743  -3.809  1.00 12.96 ? 278 HIS A C   1 
ATOM   1994  O  O   . HIS A 1 247 ? 20.854  57.725  -3.256  1.00 18.24 ? 278 HIS A O   1 
ATOM   1995  C  CB  . HIS A 1 247 ? 19.421  55.957  -5.241  1.00 11.18 ? 278 HIS A CB  1 
ATOM   1996  C  CG  . HIS A 1 247 ? 19.183  54.609  -4.626  1.00 13.12 ? 278 HIS A CG  1 
ATOM   1997  N  ND1 . HIS A 1 247 ? 19.050  53.455  -5.376  1.00 10.56 ? 278 HIS A ND1 1 
ATOM   1998  C  CD2 . HIS A 1 247 ? 19.069  54.228  -3.326  1.00 13.80 ? 278 HIS A CD2 1 
ATOM   1999  C  CE1 . HIS A 1 247 ? 18.866  52.426  -4.563  1.00 14.07 ? 278 HIS A CE1 1 
ATOM   2000  N  NE2 . HIS A 1 247 ? 18.876  52.868  -3.316  1.00 13.12 ? 278 HIS A NE2 1 
ATOM   2001  N  N   . ILE A 1 248 ? 22.180  55.921  -3.207  1.00 10.25 ? 279 ILE A N   1 
ATOM   2002  C  CA  . ILE A 1 248 ? 22.622  56.211  -1.853  1.00 12.93 ? 279 ILE A CA  1 
ATOM   2003  C  C   . ILE A 1 248 ? 23.343  57.554  -1.957  1.00 12.74 ? 279 ILE A C   1 
ATOM   2004  O  O   . ILE A 1 248 ? 24.165  57.757  -2.848  1.00 10.71 ? 279 ILE A O   1 
ATOM   2005  C  CB  . ILE A 1 248 ? 23.573  55.150  -1.316  1.00 18.18 ? 279 ILE A CB  1 
ATOM   2006  C  CG1 . ILE A 1 248 ? 23.021  53.748  -1.591  1.00 17.96 ? 279 ILE A CG1 1 
ATOM   2007  C  CG2 . ILE A 1 248 ? 23.775  55.360  0.217   1.00 19.06 ? 279 ILE A CG2 1 
ATOM   2008  C  CD1 . ILE A 1 248 ? 21.890  53.339  -0.680  1.00 21.94 ? 279 ILE A CD1 1 
ATOM   2009  N  N   . PRO A 1 249 ? 23.085  58.468  -1.014  1.00 11.82 ? 280 PRO A N   1 
ATOM   2010  C  CA  . PRO A 1 249 ? 23.690  59.795  -1.018  1.00 14.79 ? 280 PRO A CA  1 
ATOM   2011  C  C   . PRO A 1 249 ? 25.199  59.935  -0.688  1.00 20.39 ? 280 PRO A C   1 
ATOM   2012  O  O   . PRO A 1 249 ? 25.702  61.083  -0.534  1.00 19.89 ? 280 PRO A O   1 
ATOM   2013  C  CB  . PRO A 1 249 ? 22.860  60.494  0.044   1.00 9.31  ? 280 PRO A CB  1 
ATOM   2014  C  CG  . PRO A 1 249 ? 22.753  59.459  1.054   1.00 2.15  ? 280 PRO A CG  1 
ATOM   2015  C  CD  . PRO A 1 249 ? 22.308  58.288  0.222   1.00 9.05  ? 280 PRO A CD  1 
ATOM   2016  N  N   . GLU A 1 250 ? 25.944  58.821  -0.638  1.00 20.28 ? 281 GLU A N   1 
ATOM   2017  C  CA  . GLU A 1 250 ? 27.348  58.922  -0.213  1.00 17.08 ? 281 GLU A CA  1 
ATOM   2018  C  C   . GLU A 1 250 ? 27.043  59.337  1.230   1.00 12.09 ? 281 GLU A C   1 
ATOM   2019  O  O   . GLU A 1 250 ? 25.982  59.000  1.731   1.00 13.07 ? 281 GLU A O   1 
ATOM   2020  C  CB  . GLU A 1 250 ? 28.027  60.049  -1.007  1.00 15.23 ? 281 GLU A CB  1 
ATOM   2021  C  CG  . GLU A 1 250 ? 29.486  60.291  -0.791  1.00 17.91 ? 281 GLU A CG  1 
ATOM   2022  C  CD  . GLU A 1 250 ? 29.959  61.500  -1.610  1.00 21.77 ? 281 GLU A CD  1 
ATOM   2023  O  OE1 . GLU A 1 250 ? 29.923  61.434  -2.872  1.00 20.05 ? 281 GLU A OE1 1 
ATOM   2024  O  OE2 . GLU A 1 250 ? 30.343  62.531  -0.993  1.00 22.50 ? 281 GLU A OE2 1 
ATOM   2025  N  N   . ASN A 1 251 ? 27.951  59.951  1.948   1.00 9.56  ? 282 ASN A N   1 
ATOM   2026  C  CA  . ASN A 1 251 ? 27.602  60.438  3.296   1.00 10.82 ? 282 ASN A CA  1 
ATOM   2027  C  C   . ASN A 1 251 ? 26.985  59.451  4.277   1.00 7.40  ? 282 ASN A C   1 
ATOM   2028  O  O   . ASN A 1 251 ? 26.843  59.757  5.468   1.00 2.00  ? 282 ASN A O   1 
ATOM   2029  C  CB  . ASN A 1 251 ? 26.643  61.626  3.159   1.00 15.91 ? 282 ASN A CB  1 
ATOM   2030  C  CG  . ASN A 1 251 ? 26.861  62.414  1.847   1.00 25.96 ? 282 ASN A CG  1 
ATOM   2031  O  OD1 . ASN A 1 251 ? 27.801  62.136  1.082   1.00 31.10 ? 282 ASN A OD1 1 
ATOM   2032  N  ND2 . ASN A 1 251 ? 25.988  63.380  1.579   1.00 24.39 ? 282 ASN A ND2 1 
ATOM   2033  N  N   . LEU A 1 252 ? 26.683  58.256  3.766   1.00 8.59  ? 283 LEU A N   1 
ATOM   2034  C  CA  . LEU A 1 252 ? 26.051  57.156  4.491   1.00 10.05 ? 283 LEU A CA  1 
ATOM   2035  C  C   . LEU A 1 252 ? 26.625  55.871  3.916   1.00 10.27 ? 283 LEU A C   1 
ATOM   2036  O  O   . LEU A 1 252 ? 26.163  54.773  4.258   1.00 13.06 ? 283 LEU A O   1 
ATOM   2037  C  CB  . LEU A 1 252 ? 24.536  57.127  4.249   1.00 8.98  ? 283 LEU A CB  1 
ATOM   2038  C  CG  . LEU A 1 252 ? 23.684  58.311  4.689   1.00 12.51 ? 283 LEU A CG  1 
ATOM   2039  C  CD1 . LEU A 1 252 ? 22.353  58.327  3.947   1.00 9.83  ? 283 LEU A CD1 1 
ATOM   2040  C  CD2 . LEU A 1 252 ? 23.524  58.344  6.218   1.00 10.23 ? 283 LEU A CD2 1 
ATOM   2041  N  N   . GLN A 1 253 ? 27.527  56.011  2.944   1.00 6.48  ? 284 GLN A N   1 
ATOM   2042  C  CA  . GLN A 1 253 ? 28.190  54.851  2.379   1.00 6.64  ? 284 GLN A CA  1 
ATOM   2043  C  C   . GLN A 1 253 ? 29.223  54.381  3.419   1.00 7.66  ? 284 GLN A C   1 
ATOM   2044  O  O   . GLN A 1 253 ? 30.392  54.714  3.328   1.00 8.50  ? 284 GLN A O   1 
ATOM   2045  C  CB  . GLN A 1 253 ? 28.885  55.210  1.075   1.00 2.00  ? 284 GLN A CB  1 
ATOM   2046  C  CG  . GLN A 1 253 ? 27.916  55.636  0.011   1.00 2.05  ? 284 GLN A CG  1 
ATOM   2047  C  CD  . GLN A 1 253 ? 28.457  55.453  -1.398  1.00 2.03  ? 284 GLN A CD  1 
ATOM   2048  O  OE1 . GLN A 1 253 ? 28.937  54.383  -1.751  1.00 4.61  ? 284 GLN A OE1 1 
ATOM   2049  N  NE2 . GLN A 1 253 ? 28.352  56.486  -2.215  1.00 2.07  ? 284 GLN A NE2 1 
ATOM   2050  N  N   . PHE A 1 254 ? 28.781  53.664  4.441   1.00 6.50  ? 285 PHE A N   1 
ATOM   2051  C  CA  . PHE A 1 254 ? 29.678  53.222  5.488   1.00 7.05  ? 285 PHE A CA  1 
ATOM   2052  C  C   . PHE A 1 254 ? 30.761  52.266  4.930   1.00 10.35 ? 285 PHE A C   1 
ATOM   2053  O  O   . PHE A 1 254 ? 30.492  51.469  4.028   1.00 12.91 ? 285 PHE A O   1 
ATOM   2054  C  CB  . PHE A 1 254 ? 28.837  52.606  6.616   1.00 8.07  ? 285 PHE A CB  1 
ATOM   2055  C  CG  . PHE A 1 254 ? 27.979  53.623  7.378   1.00 6.86  ? 285 PHE A CG  1 
ATOM   2056  C  CD1 . PHE A 1 254 ? 27.900  54.949  6.960   1.00 4.06  ? 285 PHE A CD1 1 
ATOM   2057  C  CD2 . PHE A 1 254 ? 27.344  53.272  8.572   1.00 5.84  ? 285 PHE A CD2 1 
ATOM   2058  C  CE1 . PHE A 1 254 ? 27.225  55.907  7.717   1.00 3.32  ? 285 PHE A CE1 1 
ATOM   2059  C  CE2 . PHE A 1 254 ? 26.664  54.231  9.340   1.00 5.57  ? 285 PHE A CE2 1 
ATOM   2060  C  CZ  . PHE A 1 254 ? 26.612  55.547  8.911   1.00 3.30  ? 285 PHE A CZ  1 
ATOM   2061  N  N   . ALA A 1 255 ? 31.994  52.382  5.434   1.00 10.38 ? 286 ALA A N   1 
ATOM   2062  C  CA  . ALA A 1 255 ? 33.144  51.567  4.996   1.00 2.00  ? 286 ALA A CA  1 
ATOM   2063  C  C   . ALA A 1 255 ? 33.212  50.141  5.544   1.00 3.19  ? 286 ALA A C   1 
ATOM   2064  O  O   . ALA A 1 255 ? 33.247  49.192  4.769   1.00 2.50  ? 286 ALA A O   1 
ATOM   2065  C  CB  . ALA A 1 255 ? 34.385  52.280  5.320   1.00 2.16  ? 286 ALA A CB  1 
ATOM   2066  N  N   . VAL A 1 256 ? 33.310  49.975  6.865   1.00 3.68  ? 287 VAL A N   1 
ATOM   2067  C  CA  . VAL A 1 256 ? 33.350  48.622  7.514   1.00 6.47  ? 287 VAL A CA  1 
ATOM   2068  C  C   . VAL A 1 256 ? 34.395  47.505  7.211   1.00 5.82  ? 287 VAL A C   1 
ATOM   2069  O  O   . VAL A 1 256 ? 34.961  46.924  8.149   1.00 2.82  ? 287 VAL A O   1 
ATOM   2070  C  CB  . VAL A 1 256 ? 31.956  47.915  7.529   1.00 7.49  ? 287 VAL A CB  1 
ATOM   2071  C  CG1 . VAL A 1 256 ? 30.897  48.865  8.035   1.00 10.06 ? 287 VAL A CG1 1 
ATOM   2072  C  CG2 . VAL A 1 256 ? 31.598  47.302  6.156   1.00 4.94  ? 287 VAL A CG2 1 
ATOM   2073  N  N   . GLY A 1 257 ? 34.597  47.137  5.948   1.00 3.33  ? 288 GLY A N   1 
ATOM   2074  C  CA  . GLY A 1 257 ? 35.567  46.095  5.710   1.00 3.15  ? 288 GLY A CA  1 
ATOM   2075  C  C   . GLY A 1 257 ? 35.091  44.843  5.008   1.00 5.47  ? 288 GLY A C   1 
ATOM   2076  O  O   . GLY A 1 257 ? 35.873  43.908  4.845   1.00 7.91  ? 288 GLY A O   1 
ATOM   2077  N  N   . GLN A 1 258 ? 33.829  44.813  4.580   1.00 6.35  ? 289 GLN A N   1 
ATOM   2078  C  CA  . GLN A 1 258 ? 33.264  43.672  3.848   1.00 4.64  ? 289 GLN A CA  1 
ATOM   2079  C  C   . GLN A 1 258 ? 32.324  44.357  2.884   1.00 4.44  ? 289 GLN A C   1 
ATOM   2080  O  O   . GLN A 1 258 ? 31.229  44.707  3.257   1.00 6.69  ? 289 GLN A O   1 
ATOM   2081  C  CB  . GLN A 1 258 ? 32.486  42.762  4.798   1.00 3.07  ? 289 GLN A CB  1 
ATOM   2082  C  CG  . GLN A 1 258 ? 32.553  41.255  4.470   1.00 3.89  ? 289 GLN A CG  1 
ATOM   2083  C  CD  . GLN A 1 258 ? 31.921  40.870  3.132   1.00 2.93  ? 289 GLN A CD  1 
ATOM   2084  O  OE1 . GLN A 1 258 ? 31.913  41.643  2.167   1.00 2.02  ? 289 GLN A OE1 1 
ATOM   2085  N  NE2 . GLN A 1 258 ? 31.439  39.649  3.060   1.00 2.76  ? 289 GLN A NE2 1 
ATOM   2086  N  N   . GLU A 1 259 ? 32.753  44.551  1.646   1.00 7.83  ? 290 GLU A N   1 
ATOM   2087  C  CA  . GLU A 1 259 ? 31.967  45.291  0.653   1.00 10.99 ? 290 GLU A CA  1 
ATOM   2088  C  C   . GLU A 1 259 ? 30.430  45.183  0.637   1.00 10.93 ? 290 GLU A C   1 
ATOM   2089  O  O   . GLU A 1 259 ? 29.691  46.168  0.469   1.00 11.83 ? 290 GLU A O   1 
ATOM   2090  C  CB  . GLU A 1 259 ? 32.541  45.039  -0.734  1.00 14.98 ? 290 GLU A CB  1 
ATOM   2091  C  CG  . GLU A 1 259 ? 32.871  43.599  -1.008  1.00 27.05 ? 290 GLU A CG  1 
ATOM   2092  C  CD  . GLU A 1 259 ? 33.685  43.419  -2.305  1.00 36.12 ? 290 GLU A CD  1 
ATOM   2093  O  OE1 . GLU A 1 259 ? 34.921  43.687  -2.262  1.00 40.22 ? 290 GLU A OE1 1 
ATOM   2094  O  OE2 . GLU A 1 259 ? 33.103  43.007  -3.356  1.00 36.11 ? 290 GLU A OE2 1 
ATOM   2095  N  N   . VAL A 1 260 ? 29.940  43.992  0.886   1.00 9.95  ? 291 VAL A N   1 
ATOM   2096  C  CA  . VAL A 1 260 ? 28.526  43.775  0.852   1.00 6.51  ? 291 VAL A CA  1 
ATOM   2097  C  C   . VAL A 1 260 ? 27.741  44.208  2.073   1.00 3.40  ? 291 VAL A C   1 
ATOM   2098  O  O   . VAL A 1 260 ? 26.568  44.467  1.956   1.00 5.82  ? 291 VAL A O   1 
ATOM   2099  C  CB  . VAL A 1 260 ? 28.231  42.326  0.537   1.00 5.27  ? 291 VAL A CB  1 
ATOM   2100  C  CG1 . VAL A 1 260 ? 28.278  41.482  1.787   1.00 3.55  ? 291 VAL A CG1 1 
ATOM   2101  C  CG2 . VAL A 1 260 ? 26.917  42.239  -0.142  1.00 10.64 ? 291 VAL A CG2 1 
ATOM   2102  N  N   . PHE A 1 261 ? 28.372  44.326  3.226   1.00 2.00  ? 292 PHE A N   1 
ATOM   2103  C  CA  . PHE A 1 261 ? 27.669  44.726  4.454   1.00 4.93  ? 292 PHE A CA  1 
ATOM   2104  C  C   . PHE A 1 261 ? 26.922  46.070  4.466   1.00 8.92  ? 292 PHE A C   1 
ATOM   2105  O  O   . PHE A 1 261 ? 26.410  46.510  5.530   1.00 5.38  ? 292 PHE A O   1 
ATOM   2106  C  CB  . PHE A 1 261 ? 28.593  44.664  5.668   1.00 3.36  ? 292 PHE A CB  1 
ATOM   2107  C  CG  . PHE A 1 261 ? 28.912  43.278  6.103   1.00 3.32  ? 292 PHE A CG  1 
ATOM   2108  C  CD1 . PHE A 1 261 ? 28.653  42.196  5.252   1.00 3.50  ? 292 PHE A CD1 1 
ATOM   2109  C  CD2 . PHE A 1 261 ? 29.459  43.043  7.359   1.00 2.00  ? 292 PHE A CD2 1 
ATOM   2110  C  CE1 . PHE A 1 261 ? 28.933  40.917  5.643   1.00 2.35  ? 292 PHE A CE1 1 
ATOM   2111  C  CE2 . PHE A 1 261 ? 29.743  41.774  7.762   1.00 2.00  ? 292 PHE A CE2 1 
ATOM   2112  C  CZ  . PHE A 1 261 ? 29.482  40.704  6.907   1.00 4.16  ? 292 PHE A CZ  1 
ATOM   2113  N  N   . GLY A 1 262 ? 26.874  46.720  3.297   1.00 11.48 ? 293 GLY A N   1 
ATOM   2114  C  CA  . GLY A 1 262 ? 26.150  47.968  3.173   1.00 15.10 ? 293 GLY A CA  1 
ATOM   2115  C  C   . GLY A 1 262 ? 24.739  47.802  2.584   1.00 17.76 ? 293 GLY A C   1 
ATOM   2116  O  O   . GLY A 1 262 ? 24.080  48.789  2.238   1.00 19.55 ? 293 GLY A O   1 
ATOM   2117  N  N   . LEU A 1 263 ? 24.222  46.573  2.536   1.00 17.61 ? 294 LEU A N   1 
ATOM   2118  C  CA  . LEU A 1 263 ? 22.902  46.322  1.952   1.00 11.94 ? 294 LEU A CA  1 
ATOM   2119  C  C   . LEU A 1 263 ? 21.842  45.754  2.887   1.00 8.30  ? 294 LEU A C   1 
ATOM   2120  O  O   . LEU A 1 263 ? 20.867  45.185  2.409   1.00 8.71  ? 294 LEU A O   1 
ATOM   2121  C  CB  . LEU A 1 263 ? 23.074  45.412  0.731   1.00 11.52 ? 294 LEU A CB  1 
ATOM   2122  C  CG  . LEU A 1 263 ? 24.099  45.998  -0.250  1.00 10.89 ? 294 LEU A CG  1 
ATOM   2123  C  CD1 . LEU A 1 263 ? 24.485  44.993  -1.338  1.00 11.74 ? 294 LEU A CD1 1 
ATOM   2124  C  CD2 . LEU A 1 263 ? 23.553  47.303  -0.857  1.00 9.58  ? 294 LEU A CD2 1 
ATOM   2125  N  N   . VAL A 1 264 ? 22.016  45.940  4.195   1.00 2.49  ? 295 VAL A N   1 
ATOM   2126  C  CA  . VAL A 1 264 ? 21.079  45.449  5.208   1.00 2.61  ? 295 VAL A CA  1 
ATOM   2127  C  C   . VAL A 1 264 ? 21.484  46.014  6.554   1.00 2.01  ? 295 VAL A C   1 
ATOM   2128  O  O   . VAL A 1 264 ? 22.481  45.624  7.102   1.00 5.77  ? 295 VAL A O   1 
ATOM   2129  C  CB  . VAL A 1 264 ? 21.076  43.886  5.301   1.00 3.55  ? 295 VAL A CB  1 
ATOM   2130  C  CG1 . VAL A 1 264 ? 20.729  43.395  6.707   1.00 2.00  ? 295 VAL A CG1 1 
ATOM   2131  C  CG2 . VAL A 1 264 ? 20.058  43.305  4.353   1.00 9.22  ? 295 VAL A CG2 1 
ATOM   2132  N  N   . PRO A 1 265 ? 20.717  46.943  7.114   1.00 3.10  ? 296 PRO A N   1 
ATOM   2133  C  CA  . PRO A 1 265 ? 21.080  47.509  8.417   1.00 2.09  ? 296 PRO A CA  1 
ATOM   2134  C  C   . PRO A 1 265 ? 21.305  46.506  9.535   1.00 2.00  ? 296 PRO A C   1 
ATOM   2135  O  O   . PRO A 1 265 ? 21.692  46.874  10.640  1.00 2.01  ? 296 PRO A O   1 
ATOM   2136  C  CB  . PRO A 1 265 ? 19.907  48.448  8.714   1.00 4.20  ? 296 PRO A CB  1 
ATOM   2137  C  CG  . PRO A 1 265 ? 19.585  48.992  7.348   1.00 3.49  ? 296 PRO A CG  1 
ATOM   2138  C  CD  . PRO A 1 265 ? 19.628  47.725  6.490   1.00 5.35  ? 296 PRO A CD  1 
ATOM   2139  N  N   . GLY A 1 266 ? 21.026  45.247  9.266   1.00 2.00  ? 297 GLY A N   1 
ATOM   2140  C  CA  . GLY A 1 266 ? 21.240  44.231  10.278  1.00 5.40  ? 297 GLY A CA  1 
ATOM   2141  C  C   . GLY A 1 266 ? 22.709  43.853  10.343  1.00 6.95  ? 297 GLY A C   1 
ATOM   2142  O  O   . GLY A 1 266 ? 23.224  43.446  11.391  1.00 8.29  ? 297 GLY A O   1 
ATOM   2143  N  N   . LEU A 1 267 ? 23.367  43.934  9.187   1.00 7.90  ? 298 LEU A N   1 
ATOM   2144  C  CA  . LEU A 1 267 ? 24.790  43.660  9.067   1.00 4.03  ? 298 LEU A CA  1 
ATOM   2145  C  C   . LEU A 1 267 ? 25.486  44.857  9.682   1.00 3.49  ? 298 LEU A C   1 
ATOM   2146  O  O   . LEU A 1 267 ? 26.070  44.757  10.769  1.00 2.00  ? 298 LEU A O   1 
ATOM   2147  C  CB  . LEU A 1 267 ? 25.177  43.498  7.596   1.00 3.31  ? 298 LEU A CB  1 
ATOM   2148  C  CG  . LEU A 1 267 ? 25.121  42.056  7.069   1.00 2.71  ? 298 LEU A CG  1 
ATOM   2149  C  CD1 . LEU A 1 267 ? 24.741  41.110  8.195   1.00 2.93  ? 298 LEU A CD1 1 
ATOM   2150  C  CD2 . LEU A 1 267 ? 24.179  41.933  5.907   1.00 2.00  ? 298 LEU A CD2 1 
ATOM   2151  N  N   . MET A 1 268 ? 25.312  46.015  9.056   1.00 2.00  ? 299 MET A N   1 
ATOM   2152  C  CA  . MET A 1 268 ? 25.930  47.235  9.559   1.00 2.22  ? 299 MET A CA  1 
ATOM   2153  C  C   . MET A 1 268 ? 25.738  47.494  11.063  1.00 2.00  ? 299 MET A C   1 
ATOM   2154  O  O   . MET A 1 268 ? 26.540  48.177  11.686  1.00 2.00  ? 299 MET A O   1 
ATOM   2155  C  CB  . MET A 1 268 ? 25.416  48.419  8.769   1.00 3.31  ? 299 MET A CB  1 
ATOM   2156  C  CG  . MET A 1 268 ? 26.112  49.718  9.053   1.00 3.64  ? 299 MET A CG  1 
ATOM   2157  S  SD  . MET A 1 268 ? 27.610  49.826  8.128   1.00 8.39  ? 299 MET A SD  1 
ATOM   2158  C  CE  . MET A 1 268 ? 27.182  49.186  6.456   1.00 2.00  ? 299 MET A CE  1 
ATOM   2159  N  N   . MET A 1 269 ? 24.678  46.963  11.649  1.00 2.07  ? 300 MET A N   1 
ATOM   2160  C  CA  . MET A 1 269 ? 24.434  47.193  13.067  1.00 5.25  ? 300 MET A CA  1 
ATOM   2161  C  C   . MET A 1 269 ? 25.553  46.535  13.842  1.00 5.16  ? 300 MET A C   1 
ATOM   2162  O  O   . MET A 1 269 ? 26.207  47.146  14.688  1.00 2.00  ? 300 MET A O   1 
ATOM   2163  C  CB  . MET A 1 269 ? 23.075  46.619  13.517  1.00 5.04  ? 300 MET A CB  1 
ATOM   2164  C  CG  . MET A 1 269 ? 22.816  46.811  15.020  1.00 5.93  ? 300 MET A CG  1 
ATOM   2165  S  SD  . MET A 1 269 ? 22.055  45.412  15.848  1.00 3.77  ? 300 MET A SD  1 
ATOM   2166  C  CE  . MET A 1 269 ? 21.931  44.255  14.436  1.00 5.84  ? 300 MET A CE  1 
ATOM   2167  N  N   . TYR A 1 270 ? 25.744  45.265  13.529  1.00 6.20  ? 301 TYR A N   1 
ATOM   2168  C  CA  . TYR A 1 270 ? 26.766  44.442  14.137  1.00 5.97  ? 301 TYR A CA  1 
ATOM   2169  C  C   . TYR A 1 270 ? 28.151  44.955  13.697  1.00 6.36  ? 301 TYR A C   1 
ATOM   2170  O  O   . TYR A 1 270 ? 29.081  45.072  14.508  1.00 3.26  ? 301 TYR A O   1 
ATOM   2171  C  CB  . TYR A 1 270 ? 26.559  43.001  13.683  1.00 4.21  ? 301 TYR A CB  1 
ATOM   2172  C  CG  . TYR A 1 270 ? 25.726  42.176  14.595  1.00 2.00  ? 301 TYR A CG  1 
ATOM   2173  C  CD1 . TYR A 1 270 ? 25.937  42.213  15.967  1.00 2.16  ? 301 TYR A CD1 1 
ATOM   2174  C  CD2 . TYR A 1 270 ? 24.800  41.280  14.081  1.00 2.00  ? 301 TYR A CD2 1 
ATOM   2175  C  CE1 . TYR A 1 270 ? 25.254  41.362  16.821  1.00 4.43  ? 301 TYR A CE1 1 
ATOM   2176  C  CE2 . TYR A 1 270 ? 24.102  40.417  14.913  1.00 3.48  ? 301 TYR A CE2 1 
ATOM   2177  C  CZ  . TYR A 1 270 ? 24.337  40.449  16.287  1.00 5.82  ? 301 TYR A CZ  1 
ATOM   2178  O  OH  . TYR A 1 270 ? 23.742  39.520  17.116  1.00 5.83  ? 301 TYR A OH  1 
ATOM   2179  N  N   . ALA A 1 271 ? 28.267  45.294  12.416  1.00 5.79  ? 302 ALA A N   1 
ATOM   2180  C  CA  . ALA A 1 271 ? 29.521  45.805  11.877  1.00 5.99  ? 302 ALA A CA  1 
ATOM   2181  C  C   . ALA A 1 271 ? 29.953  47.051  12.613  1.00 7.26  ? 302 ALA A C   1 
ATOM   2182  O  O   . ALA A 1 271 ? 31.120  47.413  12.525  1.00 10.77 ? 302 ALA A O   1 
ATOM   2183  C  CB  . ALA A 1 271 ? 29.404  46.105  10.388  1.00 5.57  ? 302 ALA A CB  1 
ATOM   2184  N  N   . THR A 1 272 ? 29.018  47.737  13.285  1.00 6.99  ? 303 THR A N   1 
ATOM   2185  C  CA  . THR A 1 272 ? 29.360  48.942  14.052  1.00 4.80  ? 303 THR A CA  1 
ATOM   2186  C  C   . THR A 1 272 ? 29.606  48.543  15.496  1.00 2.46  ? 303 THR A C   1 
ATOM   2187  O  O   . THR A 1 272 ? 30.431  49.136  16.168  1.00 2.00  ? 303 THR A O   1 
ATOM   2188  C  CB  . THR A 1 272 ? 28.279  50.056  13.948  1.00 3.71  ? 303 THR A CB  1 
ATOM   2189  O  OG1 . THR A 1 272 ? 27.984  50.308  12.566  1.00 2.52  ? 303 THR A OG1 1 
ATOM   2190  C  CG2 . THR A 1 272 ? 28.795  51.358  14.568  1.00 2.00  ? 303 THR A CG2 1 
ATOM   2191  N  N   . ILE A 1 273 ? 28.956  47.475  15.937  1.00 3.47  ? 304 ILE A N   1 
ATOM   2192  C  CA  . ILE A 1 273 ? 29.138  46.996  17.305  1.00 7.35  ? 304 ILE A CA  1 
ATOM   2193  C  C   . ILE A 1 273 ? 30.555  46.466  17.477  1.00 8.65  ? 304 ILE A C   1 
ATOM   2194  O  O   . ILE A 1 273 ? 31.210  46.751  18.487  1.00 10.07 ? 304 ILE A O   1 
ATOM   2195  C  CB  . ILE A 1 273 ? 28.094  45.915  17.705  1.00 8.80  ? 304 ILE A CB  1 
ATOM   2196  C  CG1 . ILE A 1 273 ? 26.670  46.529  17.680  1.00 9.01  ? 304 ILE A CG1 1 
ATOM   2197  C  CG2 . ILE A 1 273 ? 28.455  45.339  19.087  1.00 4.44  ? 304 ILE A CG2 1 
ATOM   2198  C  CD1 . ILE A 1 273 ? 25.529  45.567  17.900  1.00 8.63  ? 304 ILE A CD1 1 
ATOM   2199  N  N   . TRP A 1 274 ? 31.045  45.747  16.466  1.00 8.88  ? 305 TRP A N   1 
ATOM   2200  C  CA  . TRP A 1 274 ? 32.402  45.199  16.517  1.00 6.51  ? 305 TRP A CA  1 
ATOM   2201  C  C   . TRP A 1 274 ? 33.428  46.281  16.313  1.00 5.15  ? 305 TRP A C   1 
ATOM   2202  O  O   . TRP A 1 274 ? 34.479  46.235  16.961  1.00 7.56  ? 305 TRP A O   1 
ATOM   2203  C  CB  . TRP A 1 274 ? 32.618  44.038  15.530  1.00 5.18  ? 305 TRP A CB  1 
ATOM   2204  C  CG  . TRP A 1 274 ? 32.005  42.694  15.991  1.00 7.31  ? 305 TRP A CG  1 
ATOM   2205  C  CD1 . TRP A 1 274 ? 30.884  42.084  15.478  1.00 4.09  ? 305 TRP A CD1 1 
ATOM   2206  C  CD2 . TRP A 1 274 ? 32.524  41.790  16.996  1.00 6.24  ? 305 TRP A CD2 1 
ATOM   2207  N  NE1 . TRP A 1 274 ? 30.683  40.867  16.087  1.00 3.44  ? 305 TRP A NE1 1 
ATOM   2208  C  CE2 . TRP A 1 274 ? 31.671  40.659  17.018  1.00 6.06  ? 305 TRP A CE2 1 
ATOM   2209  C  CE3 . TRP A 1 274 ? 33.625  41.820  17.871  1.00 4.49  ? 305 TRP A CE3 1 
ATOM   2210  C  CZ2 . TRP A 1 274 ? 31.894  39.566  17.877  1.00 5.85  ? 305 TRP A CZ2 1 
ATOM   2211  C  CZ3 . TRP A 1 274 ? 33.842  40.726  18.729  1.00 2.04  ? 305 TRP A CZ3 1 
ATOM   2212  C  CH2 . TRP A 1 274 ? 32.979  39.617  18.718  1.00 2.85  ? 305 TRP A CH2 1 
ATOM   2213  N  N   . LEU A 1 275 ? 33.146  47.252  15.437  1.00 3.00  ? 306 LEU A N   1 
ATOM   2214  C  CA  . LEU A 1 275 ? 34.087  48.360  15.227  1.00 2.13  ? 306 LEU A CA  1 
ATOM   2215  C  C   . LEU A 1 275 ? 34.261  49.005  16.591  1.00 2.00  ? 306 LEU A C   1 
ATOM   2216  O  O   . LEU A 1 275 ? 35.345  49.277  17.035  1.00 2.00  ? 306 LEU A O   1 
ATOM   2217  C  CB  . LEU A 1 275 ? 33.527  49.393  14.246  1.00 2.04  ? 306 LEU A CB  1 
ATOM   2218  C  CG  . LEU A 1 275 ? 34.265  50.735  14.076  1.00 2.10  ? 306 LEU A CG  1 
ATOM   2219  C  CD1 . LEU A 1 275 ? 33.801  51.413  12.809  1.00 2.00  ? 306 LEU A CD1 1 
ATOM   2220  C  CD2 . LEU A 1 275 ? 34.065  51.660  15.255  1.00 2.00  ? 306 LEU A CD2 1 
ATOM   2221  N  N   . ARG A 1 276 ? 33.154  49.210  17.266  1.00 3.00  ? 307 ARG A N   1 
ATOM   2222  C  CA  . ARG A 1 276 ? 33.166  49.811  18.570  1.00 4.53  ? 307 ARG A CA  1 
ATOM   2223  C  C   . ARG A 1 276 ? 33.927  48.952  19.558  1.00 3.46  ? 307 ARG A C   1 
ATOM   2224  O  O   . ARG A 1 276 ? 34.585  49.477  20.457  1.00 2.56  ? 307 ARG A O   1 
ATOM   2225  C  CB  . ARG A 1 276 ? 31.720  50.022  19.031  1.00 7.72  ? 307 ARG A CB  1 
ATOM   2226  C  CG  . ARG A 1 276 ? 30.970  51.094  18.217  1.00 9.73  ? 307 ARG A CG  1 
ATOM   2227  C  CD  . ARG A 1 276 ? 29.452  50.935  18.270  1.00 11.35 ? 307 ARG A CD  1 
ATOM   2228  N  NE  . ARG A 1 276 ? 28.789  51.761  19.271  1.00 7.37  ? 307 ARG A NE  1 
ATOM   2229  C  CZ  . ARG A 1 276 ? 28.086  52.850  18.984  1.00 7.19  ? 307 ARG A CZ  1 
ATOM   2230  N  NH1 . ARG A 1 276 ? 27.956  53.253  17.724  1.00 2.00  ? 307 ARG A NH1 1 
ATOM   2231  N  NH2 . ARG A 1 276 ? 27.501  53.531  19.963  1.00 10.59 ? 307 ARG A NH2 1 
ATOM   2232  N  N   . GLU A 1 277 ? 33.821  47.630  19.395  1.00 5.02  ? 308 GLU A N   1 
ATOM   2233  C  CA  . GLU A 1 277 ? 34.498  46.676  20.284  1.00 5.30  ? 308 GLU A CA  1 
ATOM   2234  C  C   . GLU A 1 277 ? 35.990  46.626  20.047  1.00 5.83  ? 308 GLU A C   1 
ATOM   2235  O  O   . GLU A 1 277 ? 36.743  46.272  20.949  1.00 7.05  ? 308 GLU A O   1 
ATOM   2236  C  CB  . GLU A 1 277 ? 33.885  45.271  20.213  1.00 2.02  ? 308 GLU A CB  1 
ATOM   2237  C  CG  . GLU A 1 277 ? 34.600  44.206  21.052  1.00 2.01  ? 308 GLU A CG  1 
ATOM   2238  C  CD  . GLU A 1 277 ? 34.633  44.484  22.551  1.00 4.59  ? 308 GLU A CD  1 
ATOM   2239  O  OE1 . GLU A 1 277 ? 34.258  45.580  22.991  1.00 6.20  ? 308 GLU A OE1 1 
ATOM   2240  O  OE2 . GLU A 1 277 ? 35.054  43.597  23.318  1.00 5.22  ? 308 GLU A OE2 1 
ATOM   2241  N  N   . HIS A 1 278 ? 36.423  46.983  18.841  1.00 6.78  ? 309 HIS A N   1 
ATOM   2242  C  CA  . HIS A 1 278 ? 37.857  47.029  18.552  1.00 6.27  ? 309 HIS A CA  1 
ATOM   2243  C  C   . HIS A 1 278 ? 38.471  48.111  19.459  1.00 4.46  ? 309 HIS A C   1 
ATOM   2244  O  O   . HIS A 1 278 ? 39.092  47.797  20.489  1.00 3.04  ? 309 HIS A O   1 
ATOM   2245  C  CB  . HIS A 1 278 ? 38.138  47.356  17.080  1.00 4.74  ? 309 HIS A CB  1 
ATOM   2246  C  CG  . HIS A 1 278 ? 39.577  47.210  16.708  1.00 2.00  ? 309 HIS A CG  1 
ATOM   2247  N  ND1 . HIS A 1 278 ? 40.137  46.002  16.373  1.00 2.31  ? 309 HIS A ND1 1 
ATOM   2248  C  CD2 . HIS A 1 278 ? 40.587  48.103  16.692  1.00 3.40  ? 309 HIS A CD2 1 
ATOM   2249  C  CE1 . HIS A 1 278 ? 41.430  46.148  16.173  1.00 2.00  ? 309 HIS A CE1 1 
ATOM   2250  N  NE2 . HIS A 1 278 ? 41.730  47.415  16.363  1.00 2.84  ? 309 HIS A NE2 1 
ATOM   2251  N  N   . GLN A 1 279 ? 38.228  49.377  19.121  1.00 3.31  ? 310 GLN A N   1 
ATOM   2252  C  CA  . GLN A 1 279 ? 38.734  50.508  19.902  1.00 6.13  ? 310 GLN A CA  1 
ATOM   2253  C  C   . GLN A 1 279 ? 38.685  50.265  21.419  1.00 8.57  ? 310 GLN A C   1 
ATOM   2254  O  O   . GLN A 1 279 ? 39.547  50.739  22.162  1.00 10.80 ? 310 GLN A O   1 
ATOM   2255  C  CB  . GLN A 1 279 ? 37.912  51.759  19.611  1.00 3.36  ? 310 GLN A CB  1 
ATOM   2256  C  CG  . GLN A 1 279 ? 38.373  52.637  18.515  1.00 2.00  ? 310 GLN A CG  1 
ATOM   2257  C  CD  . GLN A 1 279 ? 38.362  51.976  17.194  1.00 2.00  ? 310 GLN A CD  1 
ATOM   2258  O  OE1 . GLN A 1 279 ? 38.789  50.847  17.049  1.00 3.33  ? 310 GLN A OE1 1 
ATOM   2259  N  NE2 . GLN A 1 279 ? 37.941  52.693  16.198  1.00 2.00  ? 310 GLN A NE2 1 
ATOM   2260  N  N   . ARG A 1 280 ? 37.671  49.537  21.870  1.00 10.03 ? 311 ARG A N   1 
ATOM   2261  C  CA  . ARG A 1 280 ? 37.499  49.273  23.284  1.00 10.96 ? 311 ARG A CA  1 
ATOM   2262  C  C   . ARG A 1 280 ? 38.659  48.477  23.831  1.00 9.97  ? 311 ARG A C   1 
ATOM   2263  O  O   . ARG A 1 280 ? 39.260  48.849  24.844  1.00 7.09  ? 311 ARG A O   1 
ATOM   2264  C  CB  . ARG A 1 280 ? 36.187  48.521  23.535  1.00 13.48 ? 311 ARG A CB  1 
ATOM   2265  C  CG  . ARG A 1 280 ? 35.834  48.470  25.016  1.00 13.17 ? 311 ARG A CG  1 
ATOM   2266  C  CD  . ARG A 1 280 ? 34.758  47.474  25.335  1.00 7.42  ? 311 ARG A CD  1 
ATOM   2267  N  NE  . ARG A 1 280 ? 35.111  46.830  26.588  1.00 4.79  ? 311 ARG A NE  1 
ATOM   2268  C  CZ  . ARG A 1 280 ? 35.286  45.524  26.711  1.00 6.71  ? 311 ARG A CZ  1 
ATOM   2269  N  NH1 . ARG A 1 280 ? 35.128  44.728  25.650  1.00 2.84  ? 311 ARG A NH1 1 
ATOM   2270  N  NH2 . ARG A 1 280 ? 35.655  45.022  27.886  1.00 5.68  ? 311 ARG A NH2 1 
ATOM   2271  N  N   . VAL A 1 281 ? 38.961  47.372  23.156  1.00 9.33  ? 312 VAL A N   1 
ATOM   2272  C  CA  . VAL A 1 281 ? 40.058  46.512  23.573  1.00 7.23  ? 312 VAL A CA  1 
ATOM   2273  C  C   . VAL A 1 281 ? 41.342  47.316  23.442  1.00 7.58  ? 312 VAL A C   1 
ATOM   2274  O  O   . VAL A 1 281 ? 42.196  47.233  24.330  1.00 9.03  ? 312 VAL A O   1 
ATOM   2275  C  CB  . VAL A 1 281 ? 40.112  45.189  22.756  1.00 4.87  ? 312 VAL A CB  1 
ATOM   2276  C  CG1 . VAL A 1 281 ? 41.525  44.636  22.727  1.00 4.55  ? 312 VAL A CG1 1 
ATOM   2277  C  CG2 . VAL A 1 281 ? 39.164  44.167  23.386  1.00 2.50  ? 312 VAL A CG2 1 
ATOM   2278  N  N   . CYS A 1 282 ? 41.444  48.148  22.397  1.00 4.87  ? 313 CYS A N   1 
ATOM   2279  C  CA  . CYS A 1 282 ? 42.639  48.965  22.203  1.00 2.00  ? 313 CYS A CA  1 
ATOM   2280  C  C   . CYS A 1 282 ? 42.855  49.749  23.455  1.00 2.00  ? 313 CYS A C   1 
ATOM   2281  O  O   . CYS A 1 282 ? 43.785  49.485  24.175  1.00 2.00  ? 313 CYS A O   1 
ATOM   2282  C  CB  . CYS A 1 282 ? 42.500  49.903  21.020  1.00 2.00  ? 313 CYS A CB  1 
ATOM   2283  S  SG  . CYS A 1 282 ? 42.746  49.139  19.413  1.00 2.00  ? 313 CYS A SG  1 
ATOM   2284  N  N   . ASP A 1 283 ? 41.905  50.607  23.796  1.00 4.05  ? 314 ASP A N   1 
ATOM   2285  C  CA  . ASP A 1 283 ? 42.021  51.433  24.999  1.00 6.17  ? 314 ASP A CA  1 
ATOM   2286  C  C   . ASP A 1 283 ? 42.357  50.656  26.263  1.00 5.14  ? 314 ASP A C   1 
ATOM   2287  O  O   . ASP A 1 283 ? 42.910  51.222  27.213  1.00 4.53  ? 314 ASP A O   1 
ATOM   2288  C  CB  . ASP A 1 283 ? 40.758  52.276  25.212  1.00 7.37  ? 314 ASP A CB  1 
ATOM   2289  C  CG  . ASP A 1 283 ? 40.619  53.377  24.181  1.00 8.46  ? 314 ASP A CG  1 
ATOM   2290  O  OD1 . ASP A 1 283 ? 41.644  53.756  23.561  1.00 7.93  ? 314 ASP A OD1 1 
ATOM   2291  O  OD2 . ASP A 1 283 ? 39.482  53.857  23.986  1.00 10.83 ? 314 ASP A OD2 1 
ATOM   2292  N  N   . ILE A 1 284 ? 42.026  49.370  26.276  1.00 4.06  ? 315 ILE A N   1 
ATOM   2293  C  CA  . ILE A 1 284 ? 42.314  48.534  27.433  1.00 5.26  ? 315 ILE A CA  1 
ATOM   2294  C  C   . ILE A 1 284 ? 43.782  48.127  27.386  1.00 5.10  ? 315 ILE A C   1 
ATOM   2295  O  O   . ILE A 1 284 ? 44.525  48.222  28.374  1.00 4.55  ? 315 ILE A O   1 
ATOM   2296  C  CB  . ILE A 1 284 ? 41.434  47.290  27.424  1.00 5.75  ? 315 ILE A CB  1 
ATOM   2297  C  CG1 . ILE A 1 284 ? 39.980  47.711  27.511  1.00 8.17  ? 315 ILE A CG1 1 
ATOM   2298  C  CG2 . ILE A 1 284 ? 41.787  46.379  28.579  1.00 3.84  ? 315 ILE A CG2 1 
ATOM   2299  C  CD1 . ILE A 1 284 ? 39.037  46.557  27.607  1.00 12.62 ? 315 ILE A CD1 1 
ATOM   2300  N  N   . LEU A 1 285 ? 44.192  47.688  26.210  1.00 5.44  ? 316 LEU A N   1 
ATOM   2301  C  CA  . LEU A 1 285 ? 45.549  47.265  25.999  1.00 5.60  ? 316 LEU A CA  1 
ATOM   2302  C  C   . LEU A 1 285 ? 46.454  48.462  26.181  1.00 7.46  ? 316 LEU A C   1 
ATOM   2303  O  O   . LEU A 1 285 ? 47.392  48.400  26.969  1.00 10.37 ? 316 LEU A O   1 
ATOM   2304  C  CB  . LEU A 1 285 ? 45.691  46.659  24.609  1.00 4.14  ? 316 LEU A CB  1 
ATOM   2305  C  CG  . LEU A 1 285 ? 45.798  45.129  24.552  1.00 3.72  ? 316 LEU A CG  1 
ATOM   2306  C  CD1 . LEU A 1 285 ? 45.080  44.429  25.714  1.00 2.00  ? 316 LEU A CD1 1 
ATOM   2307  C  CD2 . LEU A 1 285 ? 45.281  44.682  23.201  1.00 4.64  ? 316 LEU A CD2 1 
ATOM   2308  N  N   . LYS A 1 286 ? 46.127  49.571  25.518  1.00 9.29  ? 317 LYS A N   1 
ATOM   2309  C  CA  . LYS A 1 286 ? 46.913  50.797  25.623  1.00 7.32  ? 317 LYS A CA  1 
ATOM   2310  C  C   . LYS A 1 286 ? 47.010  51.280  27.068  1.00 5.58  ? 317 LYS A C   1 
ATOM   2311  O  O   . LYS A 1 286 ? 47.948  51.966  27.415  1.00 9.87  ? 317 LYS A O   1 
ATOM   2312  C  CB  . LYS A 1 286 ? 46.362  51.895  24.714  1.00 9.07  ? 317 LYS A CB  1 
ATOM   2313  C  CG  . LYS A 1 286 ? 47.147  53.214  24.774  1.00 12.16 ? 317 LYS A CG  1 
ATOM   2314  C  CD  . LYS A 1 286 ? 46.281  54.357  24.306  1.00 14.40 ? 317 LYS A CD  1 
ATOM   2315  C  CE  . LYS A 1 286 ? 46.824  55.689  24.763  1.00 15.97 ? 317 LYS A CE  1 
ATOM   2316  N  NZ  . LYS A 1 286 ? 45.846  56.792  24.415  1.00 20.47 ? 317 LYS A NZ  1 
ATOM   2317  N  N   . GLN A 1 287 ? 46.042  50.970  27.913  1.00 4.37  ? 318 GLN A N   1 
ATOM   2318  C  CA  . GLN A 1 287 ? 46.178  51.372  29.300  1.00 8.78  ? 318 GLN A CA  1 
ATOM   2319  C  C   . GLN A 1 287 ? 47.311  50.491  29.824  1.00 9.73  ? 318 GLN A C   1 
ATOM   2320  O  O   . GLN A 1 287 ? 48.356  50.991  30.226  1.00 7.25  ? 318 GLN A O   1 
ATOM   2321  C  CB  . GLN A 1 287 ? 44.906  51.082  30.096  1.00 14.56 ? 318 GLN A CB  1 
ATOM   2322  C  CG  . GLN A 1 287 ? 44.908  51.626  31.530  1.00 27.47 ? 318 GLN A CG  1 
ATOM   2323  C  CD  . GLN A 1 287 ? 46.268  51.482  32.245  1.00 36.42 ? 318 GLN A CD  1 
ATOM   2324  O  OE1 . GLN A 1 287 ? 46.704  50.375  32.594  1.00 41.27 ? 318 GLN A OE1 1 
ATOM   2325  N  NE2 . GLN A 1 287 ? 46.961  52.601  32.409  1.00 41.19 ? 318 GLN A NE2 1 
ATOM   2326  N  N   . GLU A 1 288 ? 47.053  49.181  29.853  1.00 11.54 ? 319 GLU A N   1 
ATOM   2327  C  CA  . GLU A 1 288 ? 47.999  48.164  30.306  1.00 9.39  ? 319 GLU A CA  1 
ATOM   2328  C  C   . GLU A 1 288 ? 49.401  48.230  29.721  1.00 6.48  ? 319 GLU A C   1 
ATOM   2329  O  O   . GLU A 1 288 ? 50.352  47.757  30.322  1.00 5.54  ? 319 GLU A O   1 
ATOM   2330  C  CB  . GLU A 1 288 ? 47.428  46.806  29.997  1.00 7.52  ? 319 GLU A CB  1 
ATOM   2331  C  CG  . GLU A 1 288 ? 46.439  46.412  31.015  1.00 16.45 ? 319 GLU A CG  1 
ATOM   2332  C  CD  . GLU A 1 288 ? 47.100  45.958  32.309  1.00 21.34 ? 319 GLU A CD  1 
ATOM   2333  O  OE1 . GLU A 1 288 ? 47.824  44.917  32.285  1.00 22.19 ? 319 GLU A OE1 1 
ATOM   2334  O  OE2 . GLU A 1 288 ? 46.873  46.633  33.348  1.00 24.14 ? 319 GLU A OE2 1 
ATOM   2335  N  N   . HIS A 1 289 ? 49.527  48.779  28.529  1.00 3.70  ? 320 HIS A N   1 
ATOM   2336  C  CA  . HIS A 1 289 ? 50.807  48.858  27.889  1.00 2.32  ? 320 HIS A CA  1 
ATOM   2337  C  C   . HIS A 1 289 ? 51.074  50.264  27.397  1.00 3.08  ? 320 HIS A C   1 
ATOM   2338  O  O   . HIS A 1 289 ? 51.029  50.532  26.186  1.00 2.33  ? 320 HIS A O   1 
ATOM   2339  C  CB  . HIS A 1 289 ? 50.890  47.838  26.742  1.00 3.08  ? 320 HIS A CB  1 
ATOM   2340  C  CG  . HIS A 1 289 ? 51.082  46.418  27.205  1.00 4.81  ? 320 HIS A CG  1 
ATOM   2341  N  ND1 . HIS A 1 289 ? 50.383  45.355  26.672  1.00 3.56  ? 320 HIS A ND1 1 
ATOM   2342  C  CD2 . HIS A 1 289 ? 51.869  45.896  28.177  1.00 4.68  ? 320 HIS A CD2 1 
ATOM   2343  C  CE1 . HIS A 1 289 ? 50.726  44.245  27.298  1.00 2.01  ? 320 HIS A CE1 1 
ATOM   2344  N  NE2 . HIS A 1 289 ? 51.626  44.545  28.216  1.00 2.36  ? 320 HIS A NE2 1 
ATOM   2345  N  N   . PRO A 1 290 ? 51.491  51.158  28.321  1.00 3.91  ? 321 PRO A N   1 
ATOM   2346  C  CA  . PRO A 1 290 ? 51.801  52.564  28.048  1.00 4.25  ? 321 PRO A CA  1 
ATOM   2347  C  C   . PRO A 1 290 ? 52.867  52.611  27.000  1.00 6.70  ? 321 PRO A C   1 
ATOM   2348  O  O   . PRO A 1 290 ? 52.996  53.573  26.240  1.00 8.37  ? 321 PRO A O   1 
ATOM   2349  C  CB  . PRO A 1 290 ? 52.401  53.049  29.361  1.00 2.09  ? 321 PRO A CB  1 
ATOM   2350  C  CG  . PRO A 1 290 ? 51.857  52.170  30.357  1.00 2.04  ? 321 PRO A CG  1 
ATOM   2351  C  CD  . PRO A 1 290 ? 51.876  50.828  29.698  1.00 4.40  ? 321 PRO A CD  1 
ATOM   2352  N  N   . GLU A 1 291 ? 53.626  51.530  26.977  1.00 6.31  ? 322 GLU A N   1 
ATOM   2353  C  CA  . GLU A 1 291 ? 54.750  51.377  26.101  1.00 8.20  ? 322 GLU A CA  1 
ATOM   2354  C  C   . GLU A 1 291 ? 54.517  50.694  24.768  1.00 10.14 ? 322 GLU A C   1 
ATOM   2355  O  O   . GLU A 1 291 ? 55.490  50.400  24.073  1.00 17.12 ? 322 GLU A O   1 
ATOM   2356  C  CB  . GLU A 1 291 ? 55.862  50.674  26.881  1.00 7.06  ? 322 GLU A CB  1 
ATOM   2357  C  CG  . GLU A 1 291 ? 55.352  49.820  28.021  1.00 12.68 ? 322 GLU A CG  1 
ATOM   2358  C  CD  . GLU A 1 291 ? 54.833  48.456  27.582  1.00 15.61 ? 322 GLU A CD  1 
ATOM   2359  O  OE1 . GLU A 1 291 ? 53.925  48.397  26.744  1.00 15.43 ? 322 GLU A OE1 1 
ATOM   2360  O  OE2 . GLU A 1 291 ? 55.320  47.426  28.074  1.00 15.20 ? 322 GLU A OE2 1 
ATOM   2361  N  N   . TRP A 1 292 ? 53.272  50.404  24.395  1.00 8.48  ? 323 TRP A N   1 
ATOM   2362  C  CA  . TRP A 1 292 ? 53.054  49.722  23.113  1.00 5.20  ? 323 TRP A CA  1 
ATOM   2363  C  C   . TRP A 1 292 ? 52.857  50.731  22.029  1.00 4.02  ? 323 TRP A C   1 
ATOM   2364  O  O   . TRP A 1 292 ? 52.580  51.890  22.310  1.00 6.46  ? 323 TRP A O   1 
ATOM   2365  C  CB  . TRP A 1 292 ? 51.858  48.777  23.155  1.00 6.74  ? 323 TRP A CB  1 
ATOM   2366  C  CG  . TRP A 1 292 ? 52.158  47.393  23.656  1.00 10.26 ? 323 TRP A CG  1 
ATOM   2367  C  CD1 . TRP A 1 292 ? 53.261  46.986  24.356  1.00 11.25 ? 323 TRP A CD1 1 
ATOM   2368  C  CD2 . TRP A 1 292 ? 51.317  46.241  23.532  1.00 11.16 ? 323 TRP A CD2 1 
ATOM   2369  N  NE1 . TRP A 1 292 ? 53.152  45.655  24.686  1.00 11.59 ? 323 TRP A NE1 1 
ATOM   2370  C  CE2 . TRP A 1 292 ? 51.971  45.173  24.193  1.00 10.65 ? 323 TRP A CE2 1 
ATOM   2371  C  CE3 . TRP A 1 292 ? 50.077  46.004  22.931  1.00 9.78  ? 323 TRP A CE3 1 
ATOM   2372  C  CZ2 . TRP A 1 292 ? 51.428  43.904  24.269  1.00 12.29 ? 323 TRP A CZ2 1 
ATOM   2373  C  CZ3 . TRP A 1 292 ? 49.537  44.744  23.007  1.00 10.26 ? 323 TRP A CZ3 1 
ATOM   2374  C  CH2 . TRP A 1 292 ? 50.212  43.704  23.674  1.00 13.13 ? 323 TRP A CH2 1 
ATOM   2375  N  N   . GLY A 1 293 ? 52.990  50.289  20.787  1.00 2.00  ? 324 GLY A N   1 
ATOM   2376  C  CA  . GLY A 1 293 ? 52.825  51.183  19.662  1.00 4.91  ? 324 GLY A CA  1 
ATOM   2377  C  C   . GLY A 1 293 ? 51.594  50.805  18.883  1.00 8.53  ? 324 GLY A C   1 
ATOM   2378  O  O   . GLY A 1 293 ? 51.093  49.703  19.048  1.00 12.15 ? 324 GLY A O   1 
ATOM   2379  N  N   . ASP A 1 294 ? 51.137  51.687  17.999  1.00 9.37  ? 325 ASP A N   1 
ATOM   2380  C  CA  . ASP A 1 294 ? 49.943  51.462  17.182  1.00 8.25  ? 325 ASP A CA  1 
ATOM   2381  C  C   . ASP A 1 294 ? 49.791  50.059  16.655  1.00 6.30  ? 325 ASP A C   1 
ATOM   2382  O  O   . ASP A 1 294 ? 48.879  49.358  17.079  1.00 7.86  ? 325 ASP A O   1 
ATOM   2383  C  CB  . ASP A 1 294 ? 49.886  52.450  16.022  1.00 14.66 ? 325 ASP A CB  1 
ATOM   2384  C  CG  . ASP A 1 294 ? 48.811  52.099  15.001  1.00 19.20 ? 325 ASP A CG  1 
ATOM   2385  O  OD1 . ASP A 1 294 ? 47.599  52.311  15.290  1.00 20.46 ? 325 ASP A OD1 1 
ATOM   2386  O  OD2 . ASP A 1 294 ? 49.197  51.614  13.906  1.00 22.77 ? 325 ASP A OD2 1 
ATOM   2387  N  N   . GLU A 1 295 ? 50.691  49.643  15.762  1.00 6.63  ? 326 GLU A N   1 
ATOM   2388  C  CA  . GLU A 1 295 ? 50.662  48.286  15.169  1.00 3.81  ? 326 GLU A CA  1 
ATOM   2389  C  C   . GLU A 1 295 ? 50.620  47.113  16.119  1.00 2.00  ? 326 GLU A C   1 
ATOM   2390  O  O   . GLU A 1 295 ? 50.103  46.073  15.775  1.00 2.00  ? 326 GLU A O   1 
ATOM   2391  C  CB  . GLU A 1 295 ? 51.792  48.079  14.182  1.00 2.88  ? 326 GLU A CB  1 
ATOM   2392  C  CG  . GLU A 1 295 ? 51.346  48.128  12.729  1.00 2.00  ? 326 GLU A CG  1 
ATOM   2393  C  CD  . GLU A 1 295 ? 50.870  46.782  12.231  1.00 2.02  ? 326 GLU A CD  1 
ATOM   2394  O  OE1 . GLU A 1 295 ? 50.911  45.803  13.004  1.00 2.00  ? 326 GLU A OE1 1 
ATOM   2395  O  OE2 . GLU A 1 295 ? 50.468  46.686  11.048  1.00 6.40  ? 326 GLU A OE2 1 
ATOM   2396  N  N   . GLN A 1 296 ? 51.139  47.260  17.318  1.00 2.00  ? 327 GLN A N   1 
ATOM   2397  C  CA  . GLN A 1 296 ? 51.065  46.148  18.227  1.00 2.22  ? 327 GLN A CA  1 
ATOM   2398  C  C   . GLN A 1 296 ? 49.709  46.140  18.859  1.00 2.14  ? 327 GLN A C   1 
ATOM   2399  O  O   . GLN A 1 296 ? 49.106  45.092  18.982  1.00 5.02  ? 327 GLN A O   1 
ATOM   2400  C  CB  . GLN A 1 296 ? 52.138  46.212  19.300  1.00 8.69  ? 327 GLN A CB  1 
ATOM   2401  C  CG  . GLN A 1 296 ? 52.130  44.979  20.189  1.00 12.12 ? 327 GLN A CG  1 
ATOM   2402  C  CD  . GLN A 1 296 ? 53.320  44.883  21.116  1.00 11.71 ? 327 GLN A CD  1 
ATOM   2403  O  OE1 . GLN A 1 296 ? 54.155  45.777  21.178  1.00 12.76 ? 327 GLN A OE1 1 
ATOM   2404  N  NE2 . GLN A 1 296 ? 53.400  43.785  21.847  1.00 12.83 ? 327 GLN A NE2 1 
ATOM   2405  N  N   . LEU A 1 297 ? 49.239  47.307  19.276  1.00 3.52  ? 328 LEU A N   1 
ATOM   2406  C  CA  . LEU A 1 297 ? 47.913  47.441  19.880  1.00 3.66  ? 328 LEU A CA  1 
ATOM   2407  C  C   . LEU A 1 297 ? 46.906  46.838  18.907  1.00 2.55  ? 328 LEU A C   1 
ATOM   2408  O  O   . LEU A 1 297 ? 46.122  45.956  19.261  1.00 2.33  ? 328 LEU A O   1 
ATOM   2409  C  CB  . LEU A 1 297 ? 47.594  48.907  20.147  1.00 2.00  ? 328 LEU A CB  1 
ATOM   2410  C  CG  . LEU A 1 297 ? 48.314  49.457  21.373  1.00 2.00  ? 328 LEU A CG  1 
ATOM   2411  C  CD1 . LEU A 1 297 ? 48.135  50.910  21.455  1.00 2.00  ? 328 LEU A CD1 1 
ATOM   2412  C  CD2 . LEU A 1 297 ? 47.813  48.820  22.626  1.00 2.00  ? 328 LEU A CD2 1 
ATOM   2413  N  N   . PHE A 1 298 ? 47.028  47.228  17.649  1.00 2.00  ? 329 PHE A N   1 
ATOM   2414  C  CA  . PHE A 1 298 ? 46.165  46.728  16.594  1.00 2.22  ? 329 PHE A CA  1 
ATOM   2415  C  C   . PHE A 1 298 ? 46.236  45.208  16.528  1.00 3.00  ? 329 PHE A C   1 
ATOM   2416  O  O   . PHE A 1 298 ? 45.283  44.513  16.871  1.00 5.73  ? 329 PHE A O   1 
ATOM   2417  C  CB  . PHE A 1 298 ? 46.569  47.331  15.247  1.00 2.00  ? 329 PHE A CB  1 
ATOM   2418  C  CG  . PHE A 1 298 ? 45.717  46.891  14.126  1.00 2.00  ? 329 PHE A CG  1 
ATOM   2419  C  CD1 . PHE A 1 298 ? 45.953  45.685  13.485  1.00 3.33  ? 329 PHE A CD1 1 
ATOM   2420  C  CD2 . PHE A 1 298 ? 44.634  47.642  13.735  1.00 3.44  ? 329 PHE A CD2 1 
ATOM   2421  C  CE1 . PHE A 1 298 ? 45.107  45.226  12.462  1.00 4.43  ? 329 PHE A CE1 1 
ATOM   2422  C  CE2 . PHE A 1 298 ? 43.771  47.189  12.702  1.00 6.95  ? 329 PHE A CE2 1 
ATOM   2423  C  CZ  . PHE A 1 298 ? 44.013  45.977  12.069  1.00 3.80  ? 329 PHE A CZ  1 
ATOM   2424  N  N   . GLN A 1 299 ? 47.377  44.681  16.117  1.00 3.30  ? 330 GLN A N   1 
ATOM   2425  C  CA  . GLN A 1 299 ? 47.545  43.237  16.010  1.00 2.93  ? 330 GLN A CA  1 
ATOM   2426  C  C   . GLN A 1 299 ? 47.073  42.389  17.183  1.00 2.35  ? 330 GLN A C   1 
ATOM   2427  O  O   . GLN A 1 299 ? 46.593  41.300  16.954  1.00 4.13  ? 330 GLN A O   1 
ATOM   2428  C  CB  . GLN A 1 299 ? 48.981  42.902  15.654  1.00 2.03  ? 330 GLN A CB  1 
ATOM   2429  C  CG  . GLN A 1 299 ? 49.313  43.327  14.270  1.00 2.00  ? 330 GLN A CG  1 
ATOM   2430  C  CD  . GLN A 1 299 ? 48.447  42.626  13.262  1.00 6.98  ? 330 GLN A CD  1 
ATOM   2431  O  OE1 . GLN A 1 299 ? 47.714  41.636  13.594  1.00 7.86  ? 330 GLN A OE1 1 
ATOM   2432  N  NE2 . GLN A 1 299 ? 48.519  43.099  12.002  1.00 5.21  ? 330 GLN A NE2 1 
ATOM   2433  N  N   . THR A 1 300 ? 47.196  42.877  18.414  1.00 2.00  ? 331 THR A N   1 
ATOM   2434  C  CA  . THR A 1 300 ? 46.748  42.129  19.585  1.00 4.06  ? 331 THR A CA  1 
ATOM   2435  C  C   . THR A 1 300 ? 45.222  42.144  19.704  1.00 6.95  ? 331 THR A C   1 
ATOM   2436  O  O   . THR A 1 300 ? 44.608  41.165  20.165  1.00 4.45  ? 331 THR A O   1 
ATOM   2437  C  CB  . THR A 1 300 ? 47.291  42.736  20.874  1.00 5.48  ? 331 THR A CB  1 
ATOM   2438  O  OG1 . THR A 1 300 ? 48.589  43.272  20.616  1.00 9.18  ? 331 THR A OG1 1 
ATOM   2439  C  CG2 . THR A 1 300 ? 47.379  41.677  21.972  1.00 2.90  ? 331 THR A CG2 1 
ATOM   2440  N  N   . SER A 1 301 ? 44.614  43.282  19.348  1.00 7.78  ? 332 SER A N   1 
ATOM   2441  C  CA  . SER A 1 301 ? 43.156  43.422  19.401  1.00 6.36  ? 332 SER A CA  1 
ATOM   2442  C  C   . SER A 1 301 ? 42.553  42.436  18.423  1.00 3.52  ? 332 SER A C   1 
ATOM   2443  O  O   . SER A 1 301 ? 41.829  41.559  18.852  1.00 4.17  ? 332 SER A O   1 
ATOM   2444  C  CB  . SER A 1 301 ? 42.704  44.861  19.114  1.00 8.06  ? 332 SER A CB  1 
ATOM   2445  O  OG  . SER A 1 301 ? 43.053  45.714  20.197  1.00 9.38  ? 332 SER A OG  1 
ATOM   2446  N  N   . LYS A 1 302 ? 42.905  42.513  17.141  1.00 2.00  ? 333 LYS A N   1 
ATOM   2447  C  CA  . LYS A 1 302 ? 42.396  41.530  16.158  1.00 2.54  ? 333 LYS A CA  1 
ATOM   2448  C  C   . LYS A 1 302 ? 42.489  40.067  16.667  1.00 2.00  ? 333 LYS A C   1 
ATOM   2449  O  O   . LYS A 1 302 ? 41.700  39.223  16.277  1.00 2.00  ? 333 LYS A O   1 
ATOM   2450  C  CB  . LYS A 1 302 ? 43.118  41.656  14.809  1.00 2.08  ? 333 LYS A CB  1 
ATOM   2451  C  CG  . LYS A 1 302 ? 42.748  40.596  13.768  1.00 2.00  ? 333 LYS A CG  1 
ATOM   2452  C  CD  . LYS A 1 302 ? 43.109  41.063  12.350  1.00 2.06  ? 333 LYS A CD  1 
ATOM   2453  C  CE  . LYS A 1 302 ? 42.730  40.077  11.250  1.00 2.11  ? 333 LYS A CE  1 
ATOM   2454  N  NZ  . LYS A 1 302 ? 42.827  40.691  9.892   1.00 2.00  ? 333 LYS A NZ  1 
ATOM   2455  N  N   . LEU A 1 303 ? 43.444  39.772  17.541  1.00 2.00  ? 334 LEU A N   1 
ATOM   2456  C  CA  . LEU A 1 303 ? 43.536  38.436  18.088  1.00 2.92  ? 334 LEU A CA  1 
ATOM   2457  C  C   . LEU A 1 303 ? 42.486  38.224  19.185  1.00 4.25  ? 334 LEU A C   1 
ATOM   2458  O  O   . LEU A 1 303 ? 41.742  37.247  19.148  1.00 5.17  ? 334 LEU A O   1 
ATOM   2459  C  CB  . LEU A 1 303 ? 44.936  38.125  18.614  1.00 4.72  ? 334 LEU A CB  1 
ATOM   2460  C  CG  . LEU A 1 303 ? 46.050  37.777  17.608  1.00 3.59  ? 334 LEU A CG  1 
ATOM   2461  C  CD1 . LEU A 1 303 ? 47.281  37.371  18.401  1.00 2.71  ? 334 LEU A CD1 1 
ATOM   2462  C  CD2 . LEU A 1 303 ? 45.661  36.672  16.649  1.00 2.00  ? 334 LEU A CD2 1 
ATOM   2463  N  N   . ILE A 1 304 ? 42.401  39.146  20.144  1.00 6.37  ? 335 ILE A N   1 
ATOM   2464  C  CA  . ILE A 1 304 ? 41.400  39.048  21.223  1.00 5.51  ? 335 ILE A CA  1 
ATOM   2465  C  C   . ILE A 1 304 ? 39.992  38.993  20.623  1.00 4.00  ? 335 ILE A C   1 
ATOM   2466  O  O   . ILE A 1 304 ? 39.209  38.138  20.985  1.00 3.48  ? 335 ILE A O   1 
ATOM   2467  C  CB  . ILE A 1 304 ? 41.485  40.231  22.212  1.00 4.44  ? 335 ILE A CB  1 
ATOM   2468  C  CG1 . ILE A 1 304 ? 42.906  40.351  22.745  1.00 3.62  ? 335 ILE A CG1 1 
ATOM   2469  C  CG2 . ILE A 1 304 ? 40.536  40.008  23.364  1.00 2.56  ? 335 ILE A CG2 1 
ATOM   2470  C  CD1 . ILE A 1 304 ? 43.071  41.334  23.845  1.00 2.57  ? 335 ILE A CD1 1 
ATOM   2471  N  N   . LEU A 1 305 ? 39.693  39.874  19.673  1.00 3.19  ? 336 LEU A N   1 
ATOM   2472  C  CA  . LEU A 1 305 ? 38.391  39.868  19.025  1.00 3.62  ? 336 LEU A CA  1 
ATOM   2473  C  C   . LEU A 1 305 ? 38.094  38.506  18.383  1.00 3.15  ? 336 LEU A C   1 
ATOM   2474  O  O   . LEU A 1 305 ? 36.963  38.036  18.437  1.00 2.19  ? 336 LEU A O   1 
ATOM   2475  C  CB  . LEU A 1 305 ? 38.262  41.021  18.022  1.00 2.00  ? 336 LEU A CB  1 
ATOM   2476  C  CG  . LEU A 1 305 ? 37.663  42.305  18.610  1.00 2.00  ? 336 LEU A CG  1 
ATOM   2477  C  CD1 . LEU A 1 305 ? 38.362  42.704  19.897  1.00 2.00  ? 336 LEU A CD1 1 
ATOM   2478  C  CD2 . LEU A 1 305 ? 37.691  43.435  17.589  1.00 2.00  ? 336 LEU A CD2 1 
ATOM   2479  N  N   . ILE A 1 306 ? 39.097  37.853  17.811  1.00 2.07  ? 337 ILE A N   1 
ATOM   2480  C  CA  . ILE A 1 306 ? 38.849  36.538  17.248  1.00 2.00  ? 337 ILE A CA  1 
ATOM   2481  C  C   . ILE A 1 306 ? 38.576  35.584  18.418  1.00 2.00  ? 337 ILE A C   1 
ATOM   2482  O  O   . ILE A 1 306 ? 37.747  34.686  18.359  1.00 2.00  ? 337 ILE A O   1 
ATOM   2483  C  CB  . ILE A 1 306 ? 40.030  36.029  16.437  1.00 2.00  ? 337 ILE A CB  1 
ATOM   2484  C  CG1 . ILE A 1 306 ? 40.259  36.930  15.238  1.00 2.00  ? 337 ILE A CG1 1 
ATOM   2485  C  CG2 . ILE A 1 306 ? 39.764  34.627  15.972  1.00 2.04  ? 337 ILE A CG2 1 
ATOM   2486  C  CD1 . ILE A 1 306 ? 40.217  36.244  13.909  1.00 2.00  ? 337 ILE A CD1 1 
ATOM   2487  N  N   . GLY A 1 307 ? 39.265  35.819  19.513  1.00 2.33  ? 338 GLY A N   1 
ATOM   2488  C  CA  . GLY A 1 307 ? 39.072  34.986  20.676  1.00 2.53  ? 338 GLY A CA  1 
ATOM   2489  C  C   . GLY A 1 307 ? 37.643  35.102  21.148  1.00 4.54  ? 338 GLY A C   1 
ATOM   2490  O  O   . GLY A 1 307 ? 37.027  34.109  21.450  1.00 5.79  ? 338 GLY A O   1 
ATOM   2491  N  N   . GLU A 1 308 ? 37.118  36.330  21.203  1.00 8.48  ? 339 GLU A N   1 
ATOM   2492  C  CA  . GLU A 1 308 ? 35.741  36.623  21.640  1.00 5.34  ? 339 GLU A CA  1 
ATOM   2493  C  C   . GLU A 1 308 ? 34.756  35.962  20.694  1.00 5.50  ? 339 GLU A C   1 
ATOM   2494  O  O   . GLU A 1 308 ? 33.884  35.212  21.114  1.00 4.51  ? 339 GLU A O   1 
ATOM   2495  C  CB  . GLU A 1 308 ? 35.485  38.128  21.648  1.00 2.93  ? 339 GLU A CB  1 
ATOM   2496  C  CG  . GLU A 1 308 ? 36.118  38.866  22.805  1.00 2.00  ? 339 GLU A CG  1 
ATOM   2497  C  CD  . GLU A 1 308 ? 35.532  40.259  22.987  1.00 8.06  ? 339 GLU A CD  1 
ATOM   2498  O  OE1 . GLU A 1 308 ? 34.508  40.385  23.711  1.00 9.41  ? 339 GLU A OE1 1 
ATOM   2499  O  OE2 . GLU A 1 308 ? 36.080  41.225  22.404  1.00 7.68  ? 339 GLU A OE2 1 
ATOM   2500  N  N   . THR A 1 309 ? 34.922  36.235  19.408  1.00 4.65  ? 340 THR A N   1 
ATOM   2501  C  CA  . THR A 1 309 ? 34.066  35.665  18.392  1.00 3.67  ? 340 THR A CA  1 
ATOM   2502  C  C   . THR A 1 309 ? 33.953  34.157  18.531  1.00 3.15  ? 340 THR A C   1 
ATOM   2503  O  O   . THR A 1 309 ? 32.850  33.631  18.484  1.00 5.30  ? 340 THR A O   1 
ATOM   2504  C  CB  . THR A 1 309 ? 34.548  36.037  16.974  1.00 5.30  ? 340 THR A CB  1 
ATOM   2505  O  OG1 . THR A 1 309 ? 34.274  37.431  16.708  1.00 2.27  ? 340 THR A OG1 1 
ATOM   2506  C  CG2 . THR A 1 309 ? 33.857  35.173  15.932  1.00 5.54  ? 340 THR A CG2 1 
ATOM   2507  N  N   . ILE A 1 310 ? 35.062  33.451  18.718  1.00 4.16  ? 341 ILE A N   1 
ATOM   2508  C  CA  . ILE A 1 310 ? 34.971  31.983  18.854  1.00 4.48  ? 341 ILE A CA  1 
ATOM   2509  C  C   . ILE A 1 310 ? 34.268  31.633  20.161  1.00 2.56  ? 341 ILE A C   1 
ATOM   2510  O  O   . ILE A 1 310 ? 33.448  30.723  20.187  1.00 3.41  ? 341 ILE A O   1 
ATOM   2511  C  CB  . ILE A 1 310 ? 36.363  31.280  18.738  1.00 4.35  ? 341 ILE A CB  1 
ATOM   2512  C  CG1 . ILE A 1 310 ? 36.960  31.541  17.356  1.00 2.86  ? 341 ILE A CG1 1 
ATOM   2513  C  CG2 . ILE A 1 310 ? 36.246  29.812  18.888  1.00 2.17  ? 341 ILE A CG2 1 
ATOM   2514  C  CD1 . ILE A 1 310 ? 38.368  31.018  17.207  1.00 3.91  ? 341 ILE A CD1 1 
ATOM   2515  N  N   . LYS A 1 311 ? 34.507  32.427  21.200  1.00 2.41  ? 342 LYS A N   1 
ATOM   2516  C  CA  . LYS A 1 311 ? 33.883  32.241  22.522  1.00 3.61  ? 342 LYS A CA  1 
ATOM   2517  C  C   . LYS A 1 311 ? 32.359  32.342  22.412  1.00 6.80  ? 342 LYS A C   1 
ATOM   2518  O  O   . LYS A 1 311 ? 31.635  31.422  22.805  1.00 10.86 ? 342 LYS A O   1 
ATOM   2519  C  CB  . LYS A 1 311 ? 34.392  33.307  23.488  1.00 2.00  ? 342 LYS A CB  1 
ATOM   2520  C  CG  . LYS A 1 311 ? 33.634  33.413  24.751  1.00 2.00  ? 342 LYS A CG  1 
ATOM   2521  C  CD  . LYS A 1 311 ? 33.923  32.272  25.687  1.00 2.20  ? 342 LYS A CD  1 
ATOM   2522  C  CE  . LYS A 1 311 ? 34.041  32.813  27.126  1.00 2.00  ? 342 LYS A CE  1 
ATOM   2523  N  NZ  . LYS A 1 311 ? 33.984  31.814  28.224  1.00 2.00  ? 342 LYS A NZ  1 
ATOM   2524  N  N   . ILE A 1 312 ? 31.886  33.458  21.856  1.00 5.39  ? 343 ILE A N   1 
ATOM   2525  C  CA  . ILE A 1 312 ? 30.471  33.714  21.657  1.00 2.35  ? 343 ILE A CA  1 
ATOM   2526  C  C   . ILE A 1 312 ? 29.841  32.704  20.704  1.00 2.79  ? 343 ILE A C   1 
ATOM   2527  O  O   . ILE A 1 312 ? 28.807  32.147  21.043  1.00 4.23  ? 343 ILE A O   1 
ATOM   2528  C  CB  . ILE A 1 312 ? 30.248  35.150  21.141  1.00 4.64  ? 343 ILE A CB  1 
ATOM   2529  C  CG1 . ILE A 1 312 ? 30.691  36.161  22.214  1.00 3.16  ? 343 ILE A CG1 1 
ATOM   2530  C  CG2 . ILE A 1 312 ? 28.804  35.358  20.690  1.00 4.56  ? 343 ILE A CG2 1 
ATOM   2531  C  CD1 . ILE A 1 312 ? 30.441  37.604  21.877  1.00 2.10  ? 343 ILE A CD1 1 
ATOM   2532  N  N   . VAL A 1 313 ? 30.446  32.439  19.544  1.00 2.53  ? 344 VAL A N   1 
ATOM   2533  C  CA  . VAL A 1 313 ? 29.875  31.462  18.600  1.00 2.76  ? 344 VAL A CA  1 
ATOM   2534  C  C   . VAL A 1 313 ? 29.700  30.039  19.156  1.00 3.67  ? 344 VAL A C   1 
ATOM   2535  O  O   . VAL A 1 313 ? 28.829  29.304  18.700  1.00 2.11  ? 344 VAL A O   1 
ATOM   2536  C  CB  . VAL A 1 313 ? 30.616  31.434  17.233  1.00 2.42  ? 344 VAL A CB  1 
ATOM   2537  C  CG1 . VAL A 1 313 ? 30.139  30.284  16.371  1.00 2.00  ? 344 VAL A CG1 1 
ATOM   2538  C  CG2 . VAL A 1 313 ? 30.378  32.735  16.494  1.00 2.03  ? 344 VAL A CG2 1 
ATOM   2539  N  N   . ILE A 1 314 ? 30.469  29.663  20.171  1.00 4.12  ? 345 ILE A N   1 
ATOM   2540  C  CA  . ILE A 1 314 ? 30.320  28.323  20.721  1.00 5.49  ? 345 ILE A CA  1 
ATOM   2541  C  C   . ILE A 1 314 ? 29.396  28.309  21.911  1.00 4.10  ? 345 ILE A C   1 
ATOM   2542  O  O   . ILE A 1 314 ? 28.476  27.506  21.960  1.00 7.85  ? 345 ILE A O   1 
ATOM   2543  C  CB  . ILE A 1 314 ? 31.716  27.649  21.078  1.00 8.09  ? 345 ILE A CB  1 
ATOM   2544  C  CG1 . ILE A 1 314 ? 32.316  26.987  19.841  1.00 6.81  ? 345 ILE A CG1 1 
ATOM   2545  C  CG2 . ILE A 1 314 ? 31.582  26.559  22.179  1.00 7.86  ? 345 ILE A CG2 1 
ATOM   2546  C  CD1 . ILE A 1 314 ? 33.662  26.447  20.090  1.00 8.61  ? 345 ILE A CD1 1 
ATOM   2547  N  N   . GLU A 1 315 ? 29.590  29.236  22.837  1.00 2.09  ? 346 GLU A N   1 
ATOM   2548  C  CA  . GLU A 1 315 ? 28.776  29.258  24.049  1.00 3.61  ? 346 GLU A CA  1 
ATOM   2549  C  C   . GLU A 1 315 ? 27.398  29.971  24.024  1.00 3.25  ? 346 GLU A C   1 
ATOM   2550  O  O   . GLU A 1 315 ? 26.623  29.865  24.978  1.00 4.21  ? 346 GLU A O   1 
ATOM   2551  C  CB  . GLU A 1 315 ? 29.626  29.715  25.239  1.00 5.68  ? 346 GLU A CB  1 
ATOM   2552  C  CG  . GLU A 1 315 ? 30.949  28.973  25.341  1.00 11.09 ? 346 GLU A CG  1 
ATOM   2553  C  CD  . GLU A 1 315 ? 31.551  28.903  26.751  1.00 14.17 ? 346 GLU A CD  1 
ATOM   2554  O  OE1 . GLU A 1 315 ? 30.795  29.023  27.751  1.00 16.71 ? 346 GLU A OE1 1 
ATOM   2555  O  OE2 . GLU A 1 315 ? 32.789  28.678  26.853  1.00 13.92 ? 346 GLU A OE2 1 
ATOM   2556  N  N   . ASP A 1 316 ? 27.083  30.670  22.938  1.00 2.02  ? 347 ASP A N   1 
ATOM   2557  C  CA  . ASP A 1 316 ? 25.803  31.336  22.820  1.00 2.31  ? 347 ASP A CA  1 
ATOM   2558  C  C   . ASP A 1 316 ? 25.111  30.889  21.544  1.00 2.72  ? 347 ASP A C   1 
ATOM   2559  O  O   . ASP A 1 316 ? 24.151  30.129  21.580  1.00 3.72  ? 347 ASP A O   1 
ATOM   2560  C  CB  . ASP A 1 316 ? 25.983  32.851  22.831  1.00 6.53  ? 347 ASP A CB  1 
ATOM   2561  C  CG  . ASP A 1 316 ? 26.452  33.379  24.187  1.00 7.81  ? 347 ASP A CG  1 
ATOM   2562  O  OD1 . ASP A 1 316 ? 25.983  32.909  25.243  1.00 5.11  ? 347 ASP A OD1 1 
ATOM   2563  O  OD2 . ASP A 1 316 ? 27.313  34.279  24.188  1.00 13.09 ? 347 ASP A OD2 1 
ATOM   2564  N  N   . TYR A 1 317 ? 25.620  31.344  20.415  1.00 2.00  ? 348 TYR A N   1 
ATOM   2565  C  CA  . TYR A 1 317 ? 25.055  31.006  19.120  1.00 2.90  ? 348 TYR A CA  1 
ATOM   2566  C  C   . TYR A 1 317 ? 24.844  29.504  18.941  1.00 5.59  ? 348 TYR A C   1 
ATOM   2567  O  O   . TYR A 1 317 ? 23.706  29.055  18.749  1.00 7.30  ? 348 TYR A O   1 
ATOM   2568  C  CB  . TYR A 1 317 ? 25.957  31.572  18.047  1.00 2.00  ? 348 TYR A CB  1 
ATOM   2569  C  CG  . TYR A 1 317 ? 25.598  31.307  16.634  1.00 2.00  ? 348 TYR A CG  1 
ATOM   2570  C  CD1 . TYR A 1 317 ? 25.808  30.083  16.066  1.00 2.00  ? 348 TYR A CD1 1 
ATOM   2571  C  CD2 . TYR A 1 317 ? 25.205  32.328  15.818  1.00 3.76  ? 348 TYR A CD2 1 
ATOM   2572  C  CE1 . TYR A 1 317 ? 25.654  29.885  14.711  1.00 2.00  ? 348 TYR A CE1 1 
ATOM   2573  C  CE2 . TYR A 1 317 ? 25.042  32.144  14.452  1.00 3.18  ? 348 TYR A CE2 1 
ATOM   2574  C  CZ  . TYR A 1 317 ? 25.273  30.916  13.913  1.00 2.00  ? 348 TYR A CZ  1 
ATOM   2575  O  OH  . TYR A 1 317 ? 25.119  30.717  12.578  1.00 2.00  ? 348 TYR A OH  1 
ATOM   2576  N  N   . VAL A 1 318 ? 25.913  28.714  19.011  1.00 6.64  ? 349 VAL A N   1 
ATOM   2577  C  CA  . VAL A 1 318 ? 25.757  27.264  18.844  1.00 5.15  ? 349 VAL A CA  1 
ATOM   2578  C  C   . VAL A 1 318 ? 25.001  26.657  19.998  1.00 4.61  ? 349 VAL A C   1 
ATOM   2579  O  O   . VAL A 1 318 ? 24.133  25.804  19.800  1.00 7.05  ? 349 VAL A O   1 
ATOM   2580  C  CB  . VAL A 1 318 ? 27.091  26.526  18.675  1.00 3.64  ? 349 VAL A CB  1 
ATOM   2581  C  CG1 . VAL A 1 318 ? 26.888  25.013  18.882  1.00 2.00  ? 349 VAL A CG1 1 
ATOM   2582  C  CG2 . VAL A 1 318 ? 27.639  26.789  17.271  1.00 2.19  ? 349 VAL A CG2 1 
ATOM   2583  N  N   . GLN A 1 319 ? 25.320  27.098  21.201  1.00 3.22  ? 350 GLN A N   1 
ATOM   2584  C  CA  . GLN A 1 319 ? 24.643  26.589  22.367  1.00 4.13  ? 350 GLN A CA  1 
ATOM   2585  C  C   . GLN A 1 319 ? 23.116  26.729  22.218  1.00 5.79  ? 350 GLN A C   1 
ATOM   2586  O  O   . GLN A 1 319 ? 22.377  25.777  22.434  1.00 8.15  ? 350 GLN A O   1 
ATOM   2587  C  CB  . GLN A 1 319 ? 25.132  27.329  23.576  1.00 2.82  ? 350 GLN A CB  1 
ATOM   2588  C  CG  . GLN A 1 319 ? 24.374  26.996  24.819  1.00 9.94  ? 350 GLN A CG  1 
ATOM   2589  C  CD  . GLN A 1 319 ? 25.054  25.933  25.649  1.00 14.09 ? 350 GLN A CD  1 
ATOM   2590  O  OE1 . GLN A 1 319 ? 24.848  24.732  25.434  1.00 16.03 ? 350 GLN A OE1 1 
ATOM   2591  N  NE2 . GLN A 1 319 ? 25.851  26.367  26.630  1.00 14.39 ? 350 GLN A NE2 1 
ATOM   2592  N  N   . HIS A 1 320 ? 22.649  27.890  21.772  1.00 6.39  ? 351 HIS A N   1 
ATOM   2593  C  CA  . HIS A 1 320 ? 21.214  28.152  21.590  1.00 5.84  ? 351 HIS A CA  1 
ATOM   2594  C  C   . HIS A 1 320 ? 20.715  27.268  20.475  1.00 4.71  ? 351 HIS A C   1 
ATOM   2595  O  O   . HIS A 1 320 ? 19.924  26.368  20.706  1.00 4.71  ? 351 HIS A O   1 
ATOM   2596  C  CB  . HIS A 1 320 ? 21.005  29.636  21.245  1.00 8.11  ? 351 HIS A CB  1 
ATOM   2597  C  CG  . HIS A 1 320 ? 19.662  29.965  20.666  1.00 6.12  ? 351 HIS A CG  1 
ATOM   2598  N  ND1 . HIS A 1 320 ? 19.373  29.821  19.321  1.00 8.92  ? 351 HIS A ND1 1 
ATOM   2599  C  CD2 . HIS A 1 320 ? 18.559  30.500  21.232  1.00 2.00  ? 351 HIS A CD2 1 
ATOM   2600  C  CE1 . HIS A 1 320 ? 18.148  30.258  19.086  1.00 3.52  ? 351 HIS A CE1 1 
ATOM   2601  N  NE2 . HIS A 1 320 ? 17.635  30.674  20.229  1.00 2.60  ? 351 HIS A NE2 1 
ATOM   2602  N  N   . LEU A 1 321 ? 21.220  27.517  19.274  1.00 3.42  ? 352 LEU A N   1 
ATOM   2603  C  CA  . LEU A 1 321 ? 20.875  26.757  18.088  1.00 2.50  ? 352 LEU A CA  1 
ATOM   2604  C  C   . LEU A 1 321 ? 20.829  25.239  18.361  1.00 2.47  ? 352 LEU A C   1 
ATOM   2605  O  O   . LEU A 1 321 ? 20.227  24.501  17.611  1.00 2.00  ? 352 LEU A O   1 
ATOM   2606  C  CB  . LEU A 1 321 ? 21.925  27.061  17.015  1.00 2.00  ? 352 LEU A CB  1 
ATOM   2607  C  CG  . LEU A 1 321 ? 21.560  26.895  15.551  1.00 5.20  ? 352 LEU A CG  1 
ATOM   2608  C  CD1 . LEU A 1 321 ? 20.130  27.314  15.326  1.00 7.38  ? 352 LEU A CD1 1 
ATOM   2609  C  CD2 . LEU A 1 321 ? 22.481  27.743  14.720  1.00 4.72  ? 352 LEU A CD2 1 
ATOM   2610  N  N   . SER A 1 322 ? 21.461  24.764  19.426  1.00 2.59  ? 353 SER A N   1 
ATOM   2611  C  CA  . SER A 1 322 ? 21.443  23.336  19.691  1.00 5.06  ? 353 SER A CA  1 
ATOM   2612  C  C   . SER A 1 322 ? 20.253  22.906  20.509  1.00 8.29  ? 353 SER A C   1 
ATOM   2613  O  O   . SER A 1 322 ? 19.608  21.909  20.216  1.00 10.34 ? 353 SER A O   1 
ATOM   2614  C  CB  . SER A 1 322 ? 22.712  22.910  20.418  1.00 3.27  ? 353 SER A CB  1 
ATOM   2615  O  OG  . SER A 1 322 ? 22.572  23.021  21.818  1.00 3.20  ? 353 SER A OG  1 
ATOM   2616  N  N   . GLY A 1 323 ? 19.997  23.666  21.563  1.00 13.23 ? 354 GLY A N   1 
ATOM   2617  C  CA  . GLY A 1 323 ? 18.913  23.370  22.476  1.00 15.35 ? 354 GLY A CA  1 
ATOM   2618  C  C   . GLY A 1 323 ? 19.426  22.188  23.250  1.00 15.02 ? 354 GLY A C   1 
ATOM   2619  O  O   . GLY A 1 323 ? 18.808  21.125  23.221  1.00 18.45 ? 354 GLY A O   1 
ATOM   2620  N  N   . TYR A 1 324 ? 20.502  22.384  24.005  1.00 13.98 ? 355 TYR A N   1 
ATOM   2621  C  CA  . TYR A 1 324 ? 21.087  21.253  24.682  1.00 15.21 ? 355 TYR A CA  1 
ATOM   2622  C  C   . TYR A 1 324 ? 20.996  20.938  26.138  1.00 15.19 ? 355 TYR A C   1 
ATOM   2623  O  O   . TYR A 1 324 ? 21.178  19.792  26.475  1.00 18.58 ? 355 TYR A O   1 
ATOM   2624  C  CB  . TYR A 1 324 ? 22.536  21.066  24.241  1.00 16.25 ? 355 TYR A CB  1 
ATOM   2625  C  CG  . TYR A 1 324 ? 22.684  20.272  22.954  1.00 16.72 ? 355 TYR A CG  1 
ATOM   2626  C  CD1 . TYR A 1 324 ? 21.603  20.104  22.095  1.00 18.59 ? 355 TYR A CD1 1 
ATOM   2627  C  CD2 . TYR A 1 324 ? 23.901  19.693  22.597  1.00 15.96 ? 355 TYR A CD2 1 
ATOM   2628  C  CE1 . TYR A 1 324 ? 21.714  19.388  20.923  1.00 19.92 ? 355 TYR A CE1 1 
ATOM   2629  C  CE2 . TYR A 1 324 ? 24.024  18.969  21.419  1.00 18.02 ? 355 TYR A CE2 1 
ATOM   2630  C  CZ  . TYR A 1 324 ? 22.917  18.819  20.588  1.00 20.59 ? 355 TYR A CZ  1 
ATOM   2631  O  OH  . TYR A 1 324 ? 22.968  18.066  19.437  1.00 21.83 ? 355 TYR A OH  1 
ATOM   2632  N  N   . HIS A 1 325 ? 20.734  21.891  27.013  1.00 16.31 ? 356 HIS A N   1 
ATOM   2633  C  CA  . HIS A 1 325 ? 20.694  21.593  28.464  1.00 20.56 ? 356 HIS A CA  1 
ATOM   2634  C  C   . HIS A 1 325 ? 22.088  21.443  29.018  1.00 23.16 ? 356 HIS A C   1 
ATOM   2635  O  O   . HIS A 1 325 ? 22.323  21.831  30.152  1.00 26.58 ? 356 HIS A O   1 
ATOM   2636  C  CB  . HIS A 1 325 ? 19.922  20.322  28.823  1.00 22.25 ? 356 HIS A CB  1 
ATOM   2637  C  CG  . HIS A 1 325 ? 18.435  20.503  28.882  1.00 24.10 ? 356 HIS A CG  1 
ATOM   2638  N  ND1 . HIS A 1 325 ? 17.575  19.481  29.227  1.00 20.74 ? 356 HIS A ND1 1 
ATOM   2639  C  CD2 . HIS A 1 325 ? 17.656  21.588  28.644  1.00 23.17 ? 356 HIS A CD2 1 
ATOM   2640  C  CE1 . HIS A 1 325 ? 16.334  19.929  29.199  1.00 22.22 ? 356 HIS A CE1 1 
ATOM   2641  N  NE2 . HIS A 1 325 ? 16.357  21.204  28.850  1.00 22.28 ? 356 HIS A NE2 1 
ATOM   2642  N  N   . PHE A 1 326 ? 22.970  20.762  28.282  1.00 24.39 ? 357 PHE A N   1 
ATOM   2643  C  CA  . PHE A 1 326 ? 24.377  20.633  28.676  1.00 21.94 ? 357 PHE A CA  1 
ATOM   2644  C  C   . PHE A 1 326 ? 25.050  21.914  28.149  1.00 21.98 ? 357 PHE A C   1 
ATOM   2645  O  O   . PHE A 1 326 ? 24.851  22.288  26.973  1.00 20.60 ? 357 PHE A O   1 
ATOM   2646  C  CB  . PHE A 1 326 ? 25.046  19.434  27.998  1.00 19.39 ? 357 PHE A CB  1 
ATOM   2647  C  CG  . PHE A 1 326 ? 26.546  19.455  28.097  1.00 17.44 ? 357 PHE A CG  1 
ATOM   2648  C  CD1 . PHE A 1 326 ? 27.163  19.545  29.348  1.00 18.79 ? 357 PHE A CD1 1 
ATOM   2649  C  CD2 . PHE A 1 326 ? 27.342  19.429  26.953  1.00 15.02 ? 357 PHE A CD2 1 
ATOM   2650  C  CE1 . PHE A 1 326 ? 28.545  19.612  29.468  1.00 13.82 ? 357 PHE A CE1 1 
ATOM   2651  C  CE2 . PHE A 1 326 ? 28.728  19.495  27.058  1.00 13.35 ? 357 PHE A CE2 1 
ATOM   2652  C  CZ  . PHE A 1 326 ? 29.328  19.588  28.323  1.00 14.57 ? 357 PHE A CZ  1 
ATOM   2653  N  N   . LYS A 1 327 ? 25.819  22.596  28.996  1.00 19.93 ? 358 LYS A N   1 
ATOM   2654  C  CA  . LYS A 1 327 ? 26.486  23.802  28.529  1.00 17.41 ? 358 LYS A CA  1 
ATOM   2655  C  C   . LYS A 1 327 ? 27.767  23.535  27.748  1.00 14.80 ? 358 LYS A C   1 
ATOM   2656  O  O   . LYS A 1 327 ? 28.720  22.963  28.280  1.00 13.37 ? 358 LYS A O   1 
ATOM   2657  C  CB  . LYS A 1 327 ? 26.797  24.745  29.673  1.00 17.81 ? 358 LYS A CB  1 
ATOM   2658  C  CG  . LYS A 1 327 ? 25.639  25.605  30.066  1.00 18.82 ? 358 LYS A CG  1 
ATOM   2659  C  CD  . LYS A 1 327 ? 25.964  26.378  31.345  1.00 21.10 ? 358 LYS A CD  1 
ATOM   2660  C  CE  . LYS A 1 327 ? 26.575  25.477  32.442  1.00 21.01 ? 358 LYS A CE  1 
ATOM   2661  N  NZ  . LYS A 1 327 ? 26.435  26.010  33.835  1.00 15.51 ? 358 LYS A NZ  1 
ATOM   2662  N  N   . LEU A 1 328 ? 27.732  23.867  26.459  1.00 12.30 ? 359 LEU A N   1 
ATOM   2663  C  CA  . LEU A 1 328 ? 28.890  23.750  25.602  1.00 11.07 ? 359 LEU A CA  1 
ATOM   2664  C  C   . LEU A 1 328 ? 29.885  24.779  26.186  1.00 14.36 ? 359 LEU A C   1 
ATOM   2665  O  O   . LEU A 1 328 ? 29.495  25.838  26.696  1.00 13.78 ? 359 LEU A O   1 
ATOM   2666  C  CB  . LEU A 1 328 ? 28.524  24.099  24.154  1.00 6.57  ? 359 LEU A CB  1 
ATOM   2667  C  CG  . LEU A 1 328 ? 27.604  23.137  23.396  1.00 2.05  ? 359 LEU A CG  1 
ATOM   2668  C  CD1 . LEU A 1 328 ? 27.274  23.665  22.040  1.00 2.04  ? 359 LEU A CD1 1 
ATOM   2669  C  CD2 . LEU A 1 328 ? 28.278  21.832  23.240  1.00 3.23  ? 359 LEU A CD2 1 
ATOM   2670  N  N   . LYS A 1 329 ? 31.169  24.452  26.106  1.00 16.60 ? 360 LYS A N   1 
ATOM   2671  C  CA  . LYS A 1 329 ? 32.234  25.280  26.653  1.00 14.40 ? 360 LYS A CA  1 
ATOM   2672  C  C   . LYS A 1 329 ? 33.295  25.454  25.587  1.00 13.73 ? 360 LYS A C   1 
ATOM   2673  O  O   . LYS A 1 329 ? 33.511  24.541  24.792  1.00 12.42 ? 360 LYS A O   1 
ATOM   2674  C  CB  . LYS A 1 329 ? 32.827  24.537  27.858  1.00 12.89 ? 360 LYS A CB  1 
ATOM   2675  C  CG  . LYS A 1 329 ? 34.012  25.169  28.520  1.00 11.52 ? 360 LYS A CG  1 
ATOM   2676  C  CD  . LYS A 1 329 ? 34.439  24.246  29.626  1.00 13.34 ? 360 LYS A CD  1 
ATOM   2677  C  CE  . LYS A 1 329 ? 35.727  24.699  30.288  1.00 16.66 ? 360 LYS A CE  1 
ATOM   2678  N  NZ  . LYS A 1 329 ? 36.255  23.591  31.133  1.00 17.91 ? 360 LYS A NZ  1 
ATOM   2679  N  N   . PHE A 1 330 ? 33.940  26.620  25.557  1.00 12.06 ? 361 PHE A N   1 
ATOM   2680  C  CA  . PHE A 1 330 ? 35.012  26.870  24.594  1.00 11.60 ? 361 PHE A CA  1 
ATOM   2681  C  C   . PHE A 1 330 ? 36.295  26.801  25.380  1.00 10.07 ? 361 PHE A C   1 
ATOM   2682  O  O   . PHE A 1 330 ? 36.664  27.741  26.071  1.00 11.65 ? 361 PHE A O   1 
ATOM   2683  C  CB  . PHE A 1 330 ? 34.889  28.242  23.932  1.00 12.04 ? 361 PHE A CB  1 
ATOM   2684  C  CG  . PHE A 1 330 ? 36.156  28.703  23.227  1.00 12.74 ? 361 PHE A CG  1 
ATOM   2685  C  CD1 . PHE A 1 330 ? 36.767  27.901  22.268  1.00 12.53 ? 361 PHE A CD1 1 
ATOM   2686  C  CD2 . PHE A 1 330 ? 36.701  29.974  23.496  1.00 12.84 ? 361 PHE A CD2 1 
ATOM   2687  C  CE1 . PHE A 1 330 ? 37.900  28.365  21.578  1.00 14.71 ? 361 PHE A CE1 1 
ATOM   2688  C  CE2 . PHE A 1 330 ? 37.829  30.448  22.819  1.00 11.12 ? 361 PHE A CE2 1 
ATOM   2689  C  CZ  . PHE A 1 330 ? 38.431  29.649  21.859  1.00 14.94 ? 361 PHE A CZ  1 
ATOM   2690  N  N   . ASP A 1 331 ? 36.942  25.655  25.327  1.00 9.86  ? 362 ASP A N   1 
ATOM   2691  C  CA  . ASP A 1 331 ? 38.191  25.484  26.048  1.00 10.15 ? 362 ASP A CA  1 
ATOM   2692  C  C   . ASP A 1 331 ? 39.200  24.729  25.184  1.00 8.76  ? 362 ASP A C   1 
ATOM   2693  O  O   . ASP A 1 331 ? 39.309  23.528  25.274  1.00 7.56  ? 362 ASP A O   1 
ATOM   2694  C  CB  . ASP A 1 331 ? 37.933  24.732  27.330  1.00 10.63 ? 362 ASP A CB  1 
ATOM   2695  C  CG  . ASP A 1 331 ? 39.145  24.638  28.172  1.00 14.88 ? 362 ASP A CG  1 
ATOM   2696  O  OD1 . ASP A 1 331 ? 40.027  25.524  28.023  1.00 18.66 ? 362 ASP A OD1 1 
ATOM   2697  O  OD2 . ASP A 1 331 ? 39.209  23.691  28.984  1.00 14.70 ? 362 ASP A OD2 1 
ATOM   2698  N  N   . PRO A 1 332 ? 40.018  25.458  24.407  1.00 7.71  ? 363 PRO A N   1 
ATOM   2699  C  CA  . PRO A 1 332 ? 41.033  24.927  23.495  1.00 6.93  ? 363 PRO A CA  1 
ATOM   2700  C  C   . PRO A 1 332 ? 41.829  23.740  24.001  1.00 8.18  ? 363 PRO A C   1 
ATOM   2701  O  O   . PRO A 1 332 ? 42.295  22.911  23.203  1.00 9.65  ? 363 PRO A O   1 
ATOM   2702  C  CB  . PRO A 1 332 ? 41.915  26.144  23.226  1.00 6.63  ? 363 PRO A CB  1 
ATOM   2703  C  CG  . PRO A 1 332 ? 40.925  27.268  23.277  1.00 6.27  ? 363 PRO A CG  1 
ATOM   2704  C  CD  . PRO A 1 332 ? 40.146  26.926  24.520  1.00 6.81  ? 363 PRO A CD  1 
ATOM   2705  N  N   . GLU A 1 333 ? 41.940  23.619  25.321  1.00 7.70  ? 364 GLU A N   1 
ATOM   2706  C  CA  . GLU A 1 333 ? 42.705  22.527  25.918  1.00 10.54 ? 364 GLU A CA  1 
ATOM   2707  C  C   . GLU A 1 333 ? 42.119  21.126  25.819  1.00 10.56 ? 364 GLU A C   1 
ATOM   2708  O  O   . GLU A 1 333 ? 42.850  20.149  25.837  1.00 13.39 ? 364 GLU A O   1 
ATOM   2709  C  CB  . GLU A 1 333 ? 43.003  22.813  27.369  1.00 11.03 ? 364 GLU A CB  1 
ATOM   2710  C  CG  . GLU A 1 333 ? 43.843  23.996  27.543  1.00 20.12 ? 364 GLU A CG  1 
ATOM   2711  C  CD  . GLU A 1 333 ? 44.127  24.238  28.986  1.00 28.29 ? 364 GLU A CD  1 
ATOM   2712  O  OE1 . GLU A 1 333 ? 44.329  23.241  29.723  1.00 28.20 ? 364 GLU A OE1 1 
ATOM   2713  O  OE2 . GLU A 1 333 ? 44.124  25.427  29.392  1.00 38.19 ? 364 GLU A OE2 1 
ATOM   2714  N  N   . LEU A 1 334 ? 40.809  21.015  25.708  1.00 9.43  ? 365 LEU A N   1 
ATOM   2715  C  CA  . LEU A 1 334 ? 40.180  19.712  25.627  1.00 7.80  ? 365 LEU A CA  1 
ATOM   2716  C  C   . LEU A 1 334 ? 40.797  18.937  24.482  1.00 8.12  ? 365 LEU A C   1 
ATOM   2717  O  O   . LEU A 1 334 ? 40.792  17.709  24.469  1.00 10.60 ? 365 LEU A O   1 
ATOM   2718  C  CB  . LEU A 1 334 ? 38.675  19.879  25.440  1.00 8.54  ? 365 LEU A CB  1 
ATOM   2719  C  CG  . LEU A 1 334 ? 38.073  20.793  26.511  1.00 9.93  ? 365 LEU A CG  1 
ATOM   2720  C  CD1 . LEU A 1 334 ? 36.748  21.266  26.047  1.00 9.32  ? 365 LEU A CD1 1 
ATOM   2721  C  CD2 . LEU A 1 334 ? 37.991  20.129  27.862  1.00 6.90  ? 365 LEU A CD2 1 
ATOM   2722  N  N   . LEU A 1 335 ? 41.371  19.661  23.536  1.00 6.45  ? 366 LEU A N   1 
ATOM   2723  C  CA  . LEU A 1 335 ? 42.017  19.021  22.410  1.00 8.66  ? 366 LEU A CA  1 
ATOM   2724  C  C   . LEU A 1 335 ? 43.542  18.859  22.561  1.00 8.99  ? 366 LEU A C   1 
ATOM   2725  O  O   . LEU A 1 335 ? 44.159  18.038  21.889  1.00 10.77 ? 366 LEU A O   1 
ATOM   2726  C  CB  . LEU A 1 335 ? 41.679  19.780  21.135  1.00 8.46  ? 366 LEU A CB  1 
ATOM   2727  C  CG  . LEU A 1 335 ? 40.228  19.635  20.700  1.00 5.91  ? 366 LEU A CG  1 
ATOM   2728  C  CD1 . LEU A 1 335 ? 40.062  20.315  19.356  1.00 3.67  ? 366 LEU A CD1 1 
ATOM   2729  C  CD2 . LEU A 1 335 ? 39.869  18.147  20.598  1.00 4.98  ? 366 LEU A CD2 1 
ATOM   2730  N  N   . PHE A 1 336 ? 44.141  19.616  23.467  1.00 8.47  ? 367 PHE A N   1 
ATOM   2731  C  CA  . PHE A 1 336 ? 45.583  19.561  23.689  1.00 8.87  ? 367 PHE A CA  1 
ATOM   2732  C  C   . PHE A 1 336 ? 46.164  18.145  23.790  1.00 9.83  ? 367 PHE A C   1 
ATOM   2733  O  O   . PHE A 1 336 ? 47.368  17.943  23.588  1.00 14.04 ? 367 PHE A O   1 
ATOM   2734  C  CB  . PHE A 1 336 ? 45.991  20.391  24.927  1.00 6.17  ? 367 PHE A CB  1 
ATOM   2735  C  CG  . PHE A 1 336 ? 46.028  21.892  24.693  1.00 3.59  ? 367 PHE A CG  1 
ATOM   2736  C  CD1 . PHE A 1 336 ? 45.666  22.449  23.458  1.00 3.46  ? 367 PHE A CD1 1 
ATOM   2737  C  CD2 . PHE A 1 336 ? 46.407  22.748  25.723  1.00 2.00  ? 367 PHE A CD2 1 
ATOM   2738  C  CE1 . PHE A 1 336 ? 45.685  23.830  23.266  1.00 2.03  ? 367 PHE A CE1 1 
ATOM   2739  C  CE2 . PHE A 1 336 ? 46.426  24.120  25.540  1.00 2.00  ? 367 PHE A CE2 1 
ATOM   2740  C  CZ  . PHE A 1 336 ? 46.065  24.663  24.309  1.00 2.00  ? 367 PHE A CZ  1 
ATOM   2741  N  N   . ASN A 1 337 ? 45.359  17.162  24.152  1.00 8.58  ? 368 ASN A N   1 
ATOM   2742  C  CA  . ASN A 1 337 ? 45.919  15.824  24.200  1.00 8.90  ? 368 ASN A CA  1 
ATOM   2743  C  C   . ASN A 1 337 ? 45.155  14.907  23.285  1.00 6.14  ? 368 ASN A C   1 
ATOM   2744  O  O   . ASN A 1 337 ? 44.839  13.786  23.642  1.00 4.50  ? 368 ASN A O   1 
ATOM   2745  C  CB  . ASN A 1 337 ? 46.019  15.284  25.622  1.00 9.76  ? 368 ASN A CB  1 
ATOM   2746  C  CG  . ASN A 1 337 ? 44.713  15.239  26.318  1.00 11.77 ? 368 ASN A CG  1 
ATOM   2747  O  OD1 . ASN A 1 337 ? 43.860  16.127  26.174  1.00 15.51 ? 368 ASN A OD1 1 
ATOM   2748  N  ND2 . ASN A 1 337 ? 44.546  14.215  27.124  1.00 14.77 ? 368 ASN A ND2 1 
ATOM   2749  N  N   . GLN A 1 338 ? 44.878  15.409  22.088  1.00 3.73  ? 369 GLN A N   1 
ATOM   2750  C  CA  . GLN A 1 338 ? 44.148  14.663  21.077  1.00 7.05  ? 369 GLN A CA  1 
ATOM   2751  C  C   . GLN A 1 338 ? 44.818  14.937  19.771  1.00 6.70  ? 369 GLN A C   1 
ATOM   2752  O  O   . GLN A 1 338 ? 45.539  15.917  19.645  1.00 6.40  ? 369 GLN A O   1 
ATOM   2753  C  CB  . GLN A 1 338 ? 42.701  15.149  20.931  1.00 9.96  ? 369 GLN A CB  1 
ATOM   2754  C  CG  . GLN A 1 338 ? 41.986  15.538  22.231  1.00 11.76 ? 369 GLN A CG  1 
ATOM   2755  C  CD  . GLN A 1 338 ? 41.710  14.363  23.140  1.00 11.98 ? 369 GLN A CD  1 
ATOM   2756  O  OE1 . GLN A 1 338 ? 41.427  13.252  22.668  1.00 12.93 ? 369 GLN A OE1 1 
ATOM   2757  N  NE2 . GLN A 1 338 ? 41.765  14.601  24.451  1.00 5.94  ? 369 GLN A NE2 1 
ATOM   2758  N  N   . GLN A 1 339 ? 44.591  14.064  18.799  1.00 8.81  ? 370 GLN A N   1 
ATOM   2759  C  CA  . GLN A 1 339 ? 45.167  14.255  17.481  1.00 13.06 ? 370 GLN A CA  1 
ATOM   2760  C  C   . GLN A 1 339 ? 44.176  15.236  16.908  1.00 12.74 ? 370 GLN A C   1 
ATOM   2761  O  O   . GLN A 1 339 ? 42.987  14.996  17.021  1.00 15.77 ? 370 GLN A O   1 
ATOM   2762  C  CB  . GLN A 1 339 ? 45.133  12.956  16.679  1.00 17.12 ? 370 GLN A CB  1 
ATOM   2763  C  CG  . GLN A 1 339 ? 45.755  11.730  17.385  1.00 26.81 ? 370 GLN A CG  1 
ATOM   2764  C  CD  . GLN A 1 339 ? 45.738  10.462  16.501  1.00 31.48 ? 370 GLN A CD  1 
ATOM   2765  O  OE1 . GLN A 1 339 ? 44.688  9.805   16.335  1.00 35.23 ? 370 GLN A OE1 1 
ATOM   2766  N  NE2 . GLN A 1 339 ? 46.895  10.132  15.915  1.00 33.29 ? 370 GLN A NE2 1 
ATOM   2767  N  N   . PHE A 1 340 ? 44.638  16.374  16.400  1.00 11.27 ? 371 PHE A N   1 
ATOM   2768  C  CA  . PHE A 1 340 ? 43.723  17.374  15.847  1.00 8.65  ? 371 PHE A CA  1 
ATOM   2769  C  C   . PHE A 1 340 ? 44.441  18.364  14.942  1.00 7.05  ? 371 PHE A C   1 
ATOM   2770  O  O   . PHE A 1 340 ? 45.321  19.079  15.380  1.00 10.08 ? 371 PHE A O   1 
ATOM   2771  C  CB  . PHE A 1 340 ? 43.004  18.130  16.979  1.00 6.76  ? 371 PHE A CB  1 
ATOM   2772  C  CG  . PHE A 1 340 ? 42.036  19.186  16.483  1.00 9.43  ? 371 PHE A CG  1 
ATOM   2773  C  CD1 . PHE A 1 340 ? 40.766  18.834  16.002  1.00 8.22  ? 371 PHE A CD1 1 
ATOM   2774  C  CD2 . PHE A 1 340 ? 42.389  20.529  16.476  1.00 7.78  ? 371 PHE A CD2 1 
ATOM   2775  C  CE1 . PHE A 1 340 ? 39.874  19.804  15.524  1.00 2.18  ? 371 PHE A CE1 1 
ATOM   2776  C  CE2 . PHE A 1 340 ? 41.491  21.494  16.000  1.00 6.16  ? 371 PHE A CE2 1 
ATOM   2777  C  CZ  . PHE A 1 340 ? 40.235  21.119  15.524  1.00 2.00  ? 371 PHE A CZ  1 
ATOM   2778  N  N   . GLN A 1 341 ? 44.045  18.416  13.685  1.00 5.25  ? 372 GLN A N   1 
ATOM   2779  C  CA  . GLN A 1 341 ? 44.658  19.320  12.726  1.00 5.19  ? 372 GLN A CA  1 
ATOM   2780  C  C   . GLN A 1 341 ? 44.171  20.751  12.875  1.00 3.41  ? 372 GLN A C   1 
ATOM   2781  O  O   . GLN A 1 341 ? 43.018  21.031  12.672  1.00 2.97  ? 372 GLN A O   1 
ATOM   2782  C  CB  . GLN A 1 341 ? 44.369  18.843  11.310  1.00 8.96  ? 372 GLN A CB  1 
ATOM   2783  C  CG  . GLN A 1 341 ? 44.858  17.444  11.049  1.00 10.76 ? 372 GLN A CG  1 
ATOM   2784  C  CD  . GLN A 1 341 ? 46.301  17.286  11.450  1.00 9.35  ? 372 GLN A CD  1 
ATOM   2785  O  OE1 . GLN A 1 341 ? 47.169  17.986  10.937  1.00 14.13 ? 372 GLN A OE1 1 
ATOM   2786  N  NE2 . GLN A 1 341 ? 46.568  16.387  12.389  1.00 10.54 ? 372 GLN A NE2 1 
ATOM   2787  N  N   . TYR A 1 342 ? 45.070  21.670  13.169  1.00 3.21  ? 373 TYR A N   1 
ATOM   2788  C  CA  . TYR A 1 342 ? 44.695  23.036  13.335  1.00 2.00  ? 373 TYR A CA  1 
ATOM   2789  C  C   . TYR A 1 342 ? 44.701  23.742  12.039  1.00 2.00  ? 373 TYR A C   1 
ATOM   2790  O  O   . TYR A 1 342 ? 45.346  24.763  11.912  1.00 2.95  ? 373 TYR A O   1 
ATOM   2791  C  CB  . TYR A 1 342 ? 45.624  23.719  14.287  1.00 2.00  ? 373 TYR A CB  1 
ATOM   2792  C  CG  . TYR A 1 342 ? 45.304  23.410  15.697  1.00 2.00  ? 373 TYR A CG  1 
ATOM   2793  C  CD1 . TYR A 1 342 ? 45.836  22.302  16.333  1.00 2.16  ? 373 TYR A CD1 1 
ATOM   2794  C  CD2 . TYR A 1 342 ? 44.509  24.257  16.423  1.00 3.98  ? 373 TYR A CD2 1 
ATOM   2795  C  CE1 . TYR A 1 342 ? 45.586  22.053  17.677  1.00 4.34  ? 373 TYR A CE1 1 
ATOM   2796  C  CE2 . TYR A 1 342 ? 44.247  24.029  17.761  1.00 8.36  ? 373 TYR A CE2 1 
ATOM   2797  C  CZ  . TYR A 1 342 ? 44.789  22.928  18.390  1.00 7.67  ? 373 TYR A CZ  1 
ATOM   2798  O  OH  . TYR A 1 342 ? 44.535  22.749  19.737  1.00 12.01 ? 373 TYR A OH  1 
ATOM   2799  N  N   . GLN A 1 343 ? 44.012  23.182  11.058  1.00 2.63  ? 374 GLN A N   1 
ATOM   2800  C  CA  . GLN A 1 343 ? 43.901  23.823  9.748   1.00 7.05  ? 374 GLN A CA  1 
ATOM   2801  C  C   . GLN A 1 343 ? 42.448  23.702  9.339   1.00 7.06  ? 374 GLN A C   1 
ATOM   2802  O  O   . GLN A 1 343 ? 41.719  22.953  9.965   1.00 9.94  ? 374 GLN A O   1 
ATOM   2803  C  CB  . GLN A 1 343 ? 44.842  23.180  8.715   1.00 8.16  ? 374 GLN A CB  1 
ATOM   2804  C  CG  . GLN A 1 343 ? 44.453  21.809  8.212   1.00 10.79 ? 374 GLN A CG  1 
ATOM   2805  C  CD  . GLN A 1 343 ? 45.630  21.081  7.624   1.00 13.46 ? 374 GLN A CD  1 
ATOM   2806  O  OE1 . GLN A 1 343 ? 45.927  21.194  6.428   1.00 13.04 ? 374 GLN A OE1 1 
ATOM   2807  N  NE2 . GLN A 1 343 ? 46.331  20.337  8.469   1.00 16.66 ? 374 GLN A NE2 1 
ATOM   2808  N  N   . ASN A 1 344 ? 42.018  24.432  8.316   1.00 7.04  ? 375 ASN A N   1 
ATOM   2809  C  CA  . ASN A 1 344 ? 40.621  24.385  7.866   1.00 8.25  ? 375 ASN A CA  1 
ATOM   2810  C  C   . ASN A 1 344 ? 40.417  24.962  6.442   1.00 7.17  ? 375 ASN A C   1 
ATOM   2811  O  O   . ASN A 1 344 ? 41.150  25.861  6.001   1.00 2.59  ? 375 ASN A O   1 
ATOM   2812  C  CB  . ASN A 1 344 ? 39.712  25.092  8.894   1.00 7.05  ? 375 ASN A CB  1 
ATOM   2813  C  CG  . ASN A 1 344 ? 38.267  24.930  8.583   1.00 5.34  ? 375 ASN A CG  1 
ATOM   2814  O  OD1 . ASN A 1 344 ? 37.722  23.859  8.712   1.00 7.73  ? 375 ASN A OD1 1 
ATOM   2815  N  ND2 . ASN A 1 344 ? 37.644  25.986  8.138   1.00 8.65  ? 375 ASN A ND2 1 
ATOM   2816  N  N   . ARG A 1 345 ? 39.412  24.451  5.735   1.00 6.02  ? 376 ARG A N   1 
ATOM   2817  C  CA  . ARG A 1 345 ? 39.134  24.883  4.374   1.00 6.82  ? 376 ARG A CA  1 
ATOM   2818  C  C   . ARG A 1 345 ? 37.616  24.824  4.270   1.00 10.81 ? 376 ARG A C   1 
ATOM   2819  O  O   . ARG A 1 345 ? 37.067  23.748  4.486   1.00 16.35 ? 376 ARG A O   1 
ATOM   2820  C  CB  . ARG A 1 345 ? 39.729  23.849  3.425   1.00 4.26  ? 376 ARG A CB  1 
ATOM   2821  C  CG  . ARG A 1 345 ? 39.940  24.260  2.005   1.00 2.00  ? 376 ARG A CG  1 
ATOM   2822  C  CD  . ARG A 1 345 ? 41.226  25.021  1.875   1.00 3.71  ? 376 ARG A CD  1 
ATOM   2823  N  NE  . ARG A 1 345 ? 41.937  24.639  0.657   1.00 7.07  ? 376 ARG A NE  1 
ATOM   2824  C  CZ  . ARG A 1 345 ? 43.196  24.193  0.637   1.00 3.09  ? 376 ARG A CZ  1 
ATOM   2825  N  NH1 . ARG A 1 345 ? 43.879  24.060  1.762   1.00 2.00  ? 376 ARG A NH1 1 
ATOM   2826  N  NH2 . ARG A 1 345 ? 43.792  23.937  -0.509  1.00 2.13  ? 376 ARG A NH2 1 
ATOM   2827  N  N   . ILE A 1 346 ? 36.925  25.942  3.980   1.00 10.14 ? 377 ILE A N   1 
ATOM   2828  C  CA  . ILE A 1 346 ? 35.447  25.931  3.865   1.00 6.16  ? 377 ILE A CA  1 
ATOM   2829  C  C   . ILE A 1 346 ? 34.992  25.188  2.626   1.00 4.25  ? 377 ILE A C   1 
ATOM   2830  O  O   . ILE A 1 346 ? 35.567  25.336  1.536   1.00 2.00  ? 377 ILE A O   1 
ATOM   2831  C  CB  . ILE A 1 346 ? 34.810  27.314  3.881   1.00 4.01  ? 377 ILE A CB  1 
ATOM   2832  C  CG1 . ILE A 1 346 ? 35.320  28.094  2.678   1.00 9.89  ? 377 ILE A CG1 1 
ATOM   2833  C  CG2 . ILE A 1 346 ? 35.048  27.985  5.234   1.00 2.00  ? 377 ILE A CG2 1 
ATOM   2834  C  CD1 . ILE A 1 346 ? 35.114  29.597  2.697   1.00 8.84  ? 377 ILE A CD1 1 
ATOM   2835  N  N   . ALA A 1 347 ? 34.019  24.305  2.862   1.00 5.79  ? 378 ALA A N   1 
ATOM   2836  C  CA  . ALA A 1 347 ? 33.428  23.421  1.846   1.00 6.79  ? 378 ALA A CA  1 
ATOM   2837  C  C   . ALA A 1 347 ? 32.192  24.035  1.221   1.00 4.97  ? 378 ALA A C   1 
ATOM   2838  O  O   . ALA A 1 347 ? 31.376  24.600  1.955   1.00 7.48  ? 378 ALA A O   1 
ATOM   2839  C  CB  . ALA A 1 347 ? 33.052  22.056  2.504   1.00 4.94  ? 378 ALA A CB  1 
ATOM   2840  N  N   . SER A 1 348 ? 31.994  23.894  -0.091  1.00 2.00  ? 379 SER A N   1 
ATOM   2841  C  CA  . SER A 1 348 ? 30.780  24.473  -0.656  1.00 3.12  ? 379 SER A CA  1 
ATOM   2842  C  C   . SER A 1 348 ? 29.548  23.924  0.067   1.00 3.07  ? 379 SER A C   1 
ATOM   2843  O  O   . SER A 1 348 ? 28.667  24.669  0.425   1.00 6.95  ? 379 SER A O   1 
ATOM   2844  C  CB  . SER A 1 348 ? 30.671  24.355  -2.186  1.00 2.74  ? 379 SER A CB  1 
ATOM   2845  O  OG  . SER A 1 348 ? 31.400  23.281  -2.723  1.00 7.18  ? 379 SER A OG  1 
ATOM   2846  N  N   . GLU A 1 349 ? 29.518  22.643  0.365   1.00 2.05  ? 380 GLU A N   1 
ATOM   2847  C  CA  . GLU A 1 349 ? 28.403  22.075  1.100   1.00 2.96  ? 380 GLU A CA  1 
ATOM   2848  C  C   . GLU A 1 349 ? 28.064  22.912  2.327   1.00 2.01  ? 380 GLU A C   1 
ATOM   2849  O  O   . GLU A 1 349 ? 26.908  23.199  2.546   1.00 5.84  ? 380 GLU A O   1 
ATOM   2850  C  CB  . GLU A 1 349 ? 28.697  20.634  1.535   1.00 2.01  ? 380 GLU A CB  1 
ATOM   2851  C  CG  . GLU A 1 349 ? 28.697  19.655  0.418   1.00 4.42  ? 380 GLU A CG  1 
ATOM   2852  C  CD  . GLU A 1 349 ? 30.061  19.409  -0.166  1.00 10.52 ? 380 GLU A CD  1 
ATOM   2853  O  OE1 . GLU A 1 349 ? 30.973  20.238  -0.013  1.00 15.51 ? 380 GLU A OE1 1 
ATOM   2854  O  OE2 . GLU A 1 349 ? 30.244  18.354  -0.791  1.00 15.81 ? 380 GLU A OE2 1 
ATOM   2855  N  N   . PHE A 1 350 ? 29.056  23.345  3.098   1.00 2.00  ? 381 PHE A N   1 
ATOM   2856  C  CA  . PHE A 1 350 ? 28.771  24.141  4.292   1.00 2.00  ? 381 PHE A CA  1 
ATOM   2857  C  C   . PHE A 1 350 ? 28.153  25.438  3.866   1.00 2.74  ? 381 PHE A C   1 
ATOM   2858  O  O   . PHE A 1 350 ? 27.222  25.920  4.480   1.00 4.31  ? 381 PHE A O   1 
ATOM   2859  C  CB  . PHE A 1 350 ? 30.022  24.443  5.084   1.00 2.05  ? 381 PHE A CB  1 
ATOM   2860  C  CG  . PHE A 1 350 ? 29.756  24.904  6.495   1.00 2.84  ? 381 PHE A CG  1 
ATOM   2861  C  CD1 . PHE A 1 350 ? 29.012  24.138  7.371   1.00 2.00  ? 381 PHE A CD1 1 
ATOM   2862  C  CD2 . PHE A 1 350 ? 30.361  26.051  6.987   1.00 5.86  ? 381 PHE A CD2 1 
ATOM   2863  C  CE1 . PHE A 1 350 ? 28.893  24.501  8.728   1.00 2.64  ? 381 PHE A CE1 1 
ATOM   2864  C  CE2 . PHE A 1 350 ? 30.244  26.418  8.341   1.00 4.25  ? 381 PHE A CE2 1 
ATOM   2865  C  CZ  . PHE A 1 350 ? 29.515  25.640  9.208   1.00 2.01  ? 381 PHE A CZ  1 
ATOM   2866  N  N   . ASN A 1 351 ? 28.690  26.023  2.812   1.00 2.90  ? 382 ASN A N   1 
ATOM   2867  C  CA  . ASN A 1 351 ? 28.146  27.263  2.294   1.00 3.22  ? 382 ASN A CA  1 
ATOM   2868  C  C   . ASN A 1 351 ? 26.655  27.081  1.937   1.00 5.18  ? 382 ASN A C   1 
ATOM   2869  O  O   . ASN A 1 351 ? 25.825  27.928  2.290   1.00 5.34  ? 382 ASN A O   1 
ATOM   2870  C  CB  . ASN A 1 351 ? 28.946  27.681  1.072   1.00 4.85  ? 382 ASN A CB  1 
ATOM   2871  C  CG  . ASN A 1 351 ? 28.523  29.008  0.536   1.00 9.81  ? 382 ASN A CG  1 
ATOM   2872  O  OD1 . ASN A 1 351 ? 28.281  29.160  -0.662  1.00 11.85 ? 382 ASN A OD1 1 
ATOM   2873  N  ND2 . ASN A 1 351 ? 28.393  29.981  1.422   1.00 11.10 ? 382 ASN A ND2 1 
ATOM   2874  N  N   . THR A 1 352 ? 26.330  25.963  1.271   1.00 3.53  ? 383 THR A N   1 
ATOM   2875  C  CA  . THR A 1 352 ? 24.978  25.604  0.855   1.00 2.13  ? 383 THR A CA  1 
ATOM   2876  C  C   . THR A 1 352 ? 24.005  25.384  2.010   1.00 2.00  ? 383 THR A C   1 
ATOM   2877  O  O   . THR A 1 352 ? 23.047  26.111  2.154   1.00 3.50  ? 383 THR A O   1 
ATOM   2878  C  CB  . THR A 1 352 ? 24.983  24.359  -0.068  1.00 2.70  ? 383 THR A CB  1 
ATOM   2879  O  OG1 . THR A 1 352 ? 25.139  24.777  -1.432  1.00 5.85  ? 383 THR A OG1 1 
ATOM   2880  C  CG2 . THR A 1 352 ? 23.686  23.574  0.052   1.00 2.56  ? 383 THR A CG2 1 
ATOM   2881  N  N   . LEU A 1 353 ? 24.270  24.420  2.866   1.00 2.00  ? 384 LEU A N   1 
ATOM   2882  C  CA  . LEU A 1 353 ? 23.382  24.143  3.970   1.00 2.00  ? 384 LEU A CA  1 
ATOM   2883  C  C   . LEU A 1 353 ? 23.183  25.342  4.874   1.00 3.07  ? 384 LEU A C   1 
ATOM   2884  O  O   . LEU A 1 353 ? 22.310  25.342  5.745   1.00 5.72  ? 384 LEU A O   1 
ATOM   2885  C  CB  . LEU A 1 353 ? 23.913  22.960  4.776   1.00 3.60  ? 384 LEU A CB  1 
ATOM   2886  C  CG  . LEU A 1 353 ? 25.158  23.002  5.675   1.00 2.00  ? 384 LEU A CG  1 
ATOM   2887  C  CD1 . LEU A 1 353 ? 24.881  23.670  7.023   1.00 2.05  ? 384 LEU A CD1 1 
ATOM   2888  C  CD2 . LEU A 1 353 ? 25.557  21.564  5.930   1.00 4.98  ? 384 LEU A CD2 1 
ATOM   2889  N  N   . TYR A 1 354 ? 23.995  26.367  4.691   1.00 2.02  ? 385 TYR A N   1 
ATOM   2890  C  CA  . TYR A 1 354 ? 23.859  27.531  5.533   1.00 4.57  ? 385 TYR A CA  1 
ATOM   2891  C  C   . TYR A 1 354 ? 22.987  28.576  4.898   1.00 8.70  ? 385 TYR A C   1 
ATOM   2892  O  O   . TYR A 1 354 ? 22.952  29.708  5.373   1.00 13.15 ? 385 TYR A O   1 
ATOM   2893  C  CB  . TYR A 1 354 ? 25.210  28.132  5.861   1.00 3.73  ? 385 TYR A CB  1 
ATOM   2894  C  CG  . TYR A 1 354 ? 25.451  28.280  7.326   1.00 2.05  ? 385 TYR A CG  1 
ATOM   2895  C  CD1 . TYR A 1 354 ? 24.977  29.364  8.019   1.00 2.76  ? 385 TYR A CD1 1 
ATOM   2896  C  CD2 . TYR A 1 354 ? 26.200  27.346  8.009   1.00 5.73  ? 385 TYR A CD2 1 
ATOM   2897  C  CE1 . TYR A 1 354 ? 25.252  29.520  9.372   1.00 6.02  ? 385 TYR A CE1 1 
ATOM   2898  C  CE2 . TYR A 1 354 ? 26.482  27.482  9.356   1.00 7.24  ? 385 TYR A CE2 1 
ATOM   2899  C  CZ  . TYR A 1 354 ? 26.011  28.572  10.036  1.00 7.08  ? 385 TYR A CZ  1 
ATOM   2900  O  OH  . TYR A 1 354 ? 26.339  28.711  11.373  1.00 9.80  ? 385 TYR A OH  1 
ATOM   2901  N  N   . HIS A 1 355 ? 22.297  28.232  3.816   1.00 9.42  ? 386 HIS A N   1 
ATOM   2902  C  CA  . HIS A 1 355 ? 21.415  29.201  3.182   1.00 10.20 ? 386 HIS A CA  1 
ATOM   2903  C  C   . HIS A 1 355 ? 20.076  29.239  3.924   1.00 10.32 ? 386 HIS A C   1 
ATOM   2904  O  O   . HIS A 1 355 ? 19.032  28.857  3.387   1.00 12.37 ? 386 HIS A O   1 
ATOM   2905  C  CB  . HIS A 1 355 ? 21.243  28.926  1.687   1.00 10.37 ? 386 HIS A CB  1 
ATOM   2906  C  CG  . HIS A 1 355 ? 22.422  29.344  0.860   1.00 11.31 ? 386 HIS A CG  1 
ATOM   2907  N  ND1 . HIS A 1 355 ? 23.518  28.539  0.657   1.00 13.11 ? 386 HIS A ND1 1 
ATOM   2908  C  CD2 . HIS A 1 355 ? 22.646  30.460  0.132   1.00 12.51 ? 386 HIS A CD2 1 
ATOM   2909  C  CE1 . HIS A 1 355 ? 24.359  29.132  -0.166  1.00 12.35 ? 386 HIS A CE1 1 
ATOM   2910  N  NE2 . HIS A 1 355 ? 23.852  30.301  -0.501  1.00 13.47 ? 386 HIS A NE2 1 
ATOM   2911  N  N   . TRP A 1 356 ? 20.154  29.763  5.148   1.00 6.02  ? 387 TRP A N   1 
ATOM   2912  C  CA  . TRP A 1 356 ? 19.056  29.942  6.079   1.00 2.57  ? 387 TRP A CA  1 
ATOM   2913  C  C   . TRP A 1 356 ? 18.214  31.193  5.902   1.00 2.00  ? 387 TRP A C   1 
ATOM   2914  O  O   . TRP A 1 356 ? 17.971  31.915  6.884   1.00 2.00  ? 387 TRP A O   1 
ATOM   2915  C  CB  . TRP A 1 356 ? 19.595  30.009  7.479   1.00 2.10  ? 387 TRP A CB  1 
ATOM   2916  C  CG  . TRP A 1 356 ? 20.304  28.819  7.885   1.00 3.19  ? 387 TRP A CG  1 
ATOM   2917  C  CD1 . TRP A 1 356 ? 20.479  27.670  7.169   1.00 2.64  ? 387 TRP A CD1 1 
ATOM   2918  C  CD2 . TRP A 1 356 ? 20.934  28.619  9.151   1.00 3.44  ? 387 TRP A CD2 1 
ATOM   2919  N  NE1 . TRP A 1 356 ? 21.184  26.758  7.926   1.00 4.60  ? 387 TRP A NE1 1 
ATOM   2920  C  CE2 . TRP A 1 356 ? 21.475  27.316  9.146   1.00 3.22  ? 387 TRP A CE2 1 
ATOM   2921  C  CE3 . TRP A 1 356 ? 21.092  29.424  10.294  1.00 4.33  ? 387 TRP A CE3 1 
ATOM   2922  C  CZ2 . TRP A 1 356 ? 22.169  26.793  10.241  1.00 2.91  ? 387 TRP A CZ2 1 
ATOM   2923  C  CZ3 . TRP A 1 356 ? 21.784  28.906  11.390  1.00 4.33  ? 387 TRP A CZ3 1 
ATOM   2924  C  CH2 . TRP A 1 356 ? 22.312  27.602  11.352  1.00 4.85  ? 387 TRP A CH2 1 
ATOM   2925  N  N   . HIS A 1 357 ? 17.748  31.425  4.677   1.00 2.00  ? 388 HIS A N   1 
ATOM   2926  C  CA  . HIS A 1 357 ? 16.878  32.561  4.369   1.00 4.66  ? 388 HIS A CA  1 
ATOM   2927  C  C   . HIS A 1 357 ? 15.508  32.569  5.168   1.00 5.83  ? 388 HIS A C   1 
ATOM   2928  O  O   . HIS A 1 357 ? 14.935  33.637  5.457   1.00 3.05  ? 388 HIS A O   1 
ATOM   2929  C  CB  . HIS A 1 357 ? 16.738  32.687  2.852   1.00 4.55  ? 388 HIS A CB  1 
ATOM   2930  C  CG  . HIS A 1 357 ? 18.105  33.138  2.309   1.00 8.45  ? 388 HIS A CG  1 
ATOM   2931  N  ND1 . HIS A 1 357 ? 18.740  32.590  1.178   1.00 9.14  ? 388 HIS A ND1 1 
ATOM   2932  C  CD2 . HIS A 1 357 ? 18.842  34.225  2.804   1.00 7.49  ? 388 HIS A CD2 1 
ATOM   2933  C  CE1 . HIS A 1 357 ? 19.834  33.375  1.004   1.00 5.23  ? 388 HIS A CE1 1 
ATOM   2934  N  NE2 . HIS A 1 357 ? 19.919  34.306  1.901   1.00 6.38  ? 388 HIS A NE2 1 
ATOM   2935  N  N   . PRO A 1 358 ? 14.962  31.374  5.514   1.00 6.59  ? 389 PRO A N   1 
ATOM   2936  C  CA  . PRO A 1 358 ? 13.718  31.226  6.280   1.00 5.13  ? 389 PRO A CA  1 
ATOM   2937  C  C   . PRO A 1 358 ? 13.733  32.007  7.606   1.00 5.24  ? 389 PRO A C   1 
ATOM   2938  O  O   . PRO A 1 358 ? 12.686  32.245  8.205   1.00 6.14  ? 389 PRO A O   1 
ATOM   2939  C  CB  . PRO A 1 358 ? 13.691  29.715  6.561   1.00 3.67  ? 389 PRO A CB  1 
ATOM   2940  C  CG  . PRO A 1 358 ? 14.127  29.145  5.279   1.00 2.87  ? 389 PRO A CG  1 
ATOM   2941  C  CD  . PRO A 1 358 ? 15.218  30.115  4.769   1.00 7.69  ? 389 PRO A CD  1 
ATOM   2942  N  N   . LEU A 1 359 ? 14.914  32.323  8.123   1.00 5.93  ? 390 LEU A N   1 
ATOM   2943  C  CA  . LEU A 1 359 ? 14.978  33.068  9.376   1.00 6.47  ? 390 LEU A CA  1 
ATOM   2944  C  C   . LEU A 1 359 ? 14.290  34.411  9.182   1.00 6.02  ? 390 LEU A C   1 
ATOM   2945  O  O   . LEU A 1 359 ? 13.681  34.937  10.106  1.00 2.11  ? 390 LEU A O   1 
ATOM   2946  C  CB  . LEU A 1 359 ? 16.438  33.295  9.804   1.00 6.86  ? 390 LEU A CB  1 
ATOM   2947  C  CG  . LEU A 1 359 ? 17.206  32.133  10.426  1.00 7.53  ? 390 LEU A CG  1 
ATOM   2948  C  CD1 . LEU A 1 359 ? 18.626  32.543  10.749  1.00 6.74  ? 390 LEU A CD1 1 
ATOM   2949  C  CD2 . LEU A 1 359 ? 16.489  31.704  11.688  1.00 7.22  ? 390 LEU A CD2 1 
ATOM   2950  N  N   . LEU A 1 360 ? 14.393  34.941  7.962   1.00 7.35  ? 391 LEU A N   1 
ATOM   2951  C  CA  . LEU A 1 360 ? 13.825  36.239  7.610   1.00 10.22 ? 391 LEU A CA  1 
ATOM   2952  C  C   . LEU A 1 360 ? 12.305  36.320  7.755   1.00 13.33 ? 391 LEU A C   1 
ATOM   2953  O  O   . LEU A 1 360 ? 11.599  35.361  7.458   1.00 18.16 ? 391 LEU A O   1 
ATOM   2954  C  CB  . LEU A 1 360 ? 14.177  36.588  6.170   1.00 6.36  ? 391 LEU A CB  1 
ATOM   2955  C  CG  . LEU A 1 360 ? 15.614  36.872  5.819   1.00 2.16  ? 391 LEU A CG  1 
ATOM   2956  C  CD1 . LEU A 1 360 ? 15.619  37.156  4.343   1.00 2.66  ? 391 LEU A CD1 1 
ATOM   2957  C  CD2 . LEU A 1 360 ? 16.146  38.032  6.599   1.00 2.00  ? 391 LEU A CD2 1 
ATOM   2958  N  N   . PRO A 1 361 ? 11.789  37.434  8.286   1.00 12.44 ? 392 PRO A N   1 
ATOM   2959  C  CA  . PRO A 1 361 ? 10.350  37.557  8.427   1.00 14.38 ? 392 PRO A CA  1 
ATOM   2960  C  C   . PRO A 1 361 ? 9.867   38.282  7.186   1.00 17.02 ? 392 PRO A C   1 
ATOM   2961  O  O   . PRO A 1 361 ? 10.483  38.176  6.114   1.00 17.01 ? 392 PRO A O   1 
ATOM   2962  C  CB  . PRO A 1 361 ? 10.221  38.411  9.675   1.00 16.61 ? 392 PRO A CB  1 
ATOM   2963  C  CG  . PRO A 1 361 ? 11.326  39.337  9.522   1.00 15.72 ? 392 PRO A CG  1 
ATOM   2964  C  CD  . PRO A 1 361 ? 12.466  38.444  9.101   1.00 14.04 ? 392 PRO A CD  1 
ATOM   2965  N  N   . ASP A 1 362 ? 8.808   39.070  7.333   1.00 18.81 ? 393 ASP A N   1 
ATOM   2966  C  CA  . ASP A 1 362 ? 8.270   39.795  6.191   1.00 19.53 ? 393 ASP A CA  1 
ATOM   2967  C  C   . ASP A 1 362 ? 8.409   41.306  6.328   1.00 15.95 ? 393 ASP A C   1 
ATOM   2968  O  O   . ASP A 1 362 ? 8.355   42.040  5.344   1.00 13.10 ? 393 ASP A O   1 
ATOM   2969  C  CB  . ASP A 1 362 ? 6.826   39.375  5.983   1.00 26.31 ? 393 ASP A CB  1 
ATOM   2970  C  CG  . ASP A 1 362 ? 6.678   37.867  5.876   1.00 29.38 ? 393 ASP A CG  1 
ATOM   2971  O  OD1 . ASP A 1 362 ? 7.151   37.294  4.861   1.00 28.99 ? 393 ASP A OD1 1 
ATOM   2972  O  OD2 . ASP A 1 362 ? 6.100   37.276  6.816   1.00 30.65 ? 393 ASP A OD2 1 
ATOM   2973  N  N   . THR A 1 363 ? 8.518   41.758  7.565   1.00 14.55 ? 394 THR A N   1 
ATOM   2974  C  CA  . THR A 1 363 ? 8.736   43.159  7.862   1.00 14.73 ? 394 THR A CA  1 
ATOM   2975  C  C   . THR A 1 363 ? 9.824   43.161  8.922   1.00 13.79 ? 394 THR A C   1 
ATOM   2976  O  O   . THR A 1 363 ? 9.967   42.194  9.708   1.00 11.70 ? 394 THR A O   1 
ATOM   2977  C  CB  . THR A 1 363 ? 7.507   43.884  8.473   1.00 16.26 ? 394 THR A CB  1 
ATOM   2978  O  OG1 . THR A 1 363 ? 6.787   42.999  9.338   1.00 18.95 ? 394 THR A OG1 1 
ATOM   2979  C  CG2 . THR A 1 363 ? 6.605   44.451  7.411   1.00 15.48 ? 394 THR A CG2 1 
ATOM   2980  N  N   . PHE A 1 364 ? 10.610  44.224  8.935   1.00 10.86 ? 395 PHE A N   1 
ATOM   2981  C  CA  . PHE A 1 364 ? 11.644  44.327  9.931   1.00 10.08 ? 395 PHE A CA  1 
ATOM   2982  C  C   . PHE A 1 364 ? 11.064  45.396  10.831  1.00 7.95  ? 395 PHE A C   1 
ATOM   2983  O  O   . PHE A 1 364 ? 10.693  46.475  10.390  1.00 4.26  ? 395 PHE A O   1 
ATOM   2984  C  CB  . PHE A 1 364 ? 12.989  44.669  9.273   1.00 10.13 ? 395 PHE A CB  1 
ATOM   2985  C  CG  . PHE A 1 364 ? 13.519  43.569  8.345   1.00 5.94  ? 395 PHE A CG  1 
ATOM   2986  C  CD1 . PHE A 1 364 ? 14.096  42.418  8.862   1.00 2.00  ? 395 PHE A CD1 1 
ATOM   2987  C  CD2 . PHE A 1 364 ? 13.438  43.706  6.959   1.00 3.77  ? 395 PHE A CD2 1 
ATOM   2988  C  CE1 . PHE A 1 364 ? 14.571  41.451  8.022   1.00 2.56  ? 395 PHE A CE1 1 
ATOM   2989  C  CE2 . PHE A 1 364 ? 13.919  42.729  6.120   1.00 2.00  ? 395 PHE A CE2 1 
ATOM   2990  C  CZ  . PHE A 1 364 ? 14.482  41.608  6.644   1.00 2.00  ? 395 PHE A CZ  1 
ATOM   2991  N  N   . ASN A 1 365 ? 10.793  45.006  12.059  1.00 8.46  ? 396 ASN A N   1 
ATOM   2992  C  CA  . ASN A 1 365 ? 10.174  45.919  12.977  1.00 10.66 ? 396 ASN A CA  1 
ATOM   2993  C  C   . ASN A 1 365 ? 11.152  46.451  13.988  1.00 14.15 ? 396 ASN A C   1 
ATOM   2994  O  O   . ASN A 1 365 ? 11.523  45.757  14.967  1.00 13.82 ? 396 ASN A O   1 
ATOM   2995  C  CB  . ASN A 1 365 ? 9.009   45.245  13.698  1.00 12.95 ? 396 ASN A CB  1 
ATOM   2996  C  CG  . ASN A 1 365 ? 8.193   44.324  12.785  1.00 17.40 ? 396 ASN A CG  1 
ATOM   2997  O  OD1 . ASN A 1 365 ? 7.566   43.357  13.251  1.00 18.78 ? 396 ASN A OD1 1 
ATOM   2998  N  ND2 . ASN A 1 365 ? 8.195   44.614  11.487  1.00 17.71 ? 396 ASN A ND2 1 
ATOM   2999  N  N   . ILE A 1 366 ? 11.625  47.666  13.705  1.00 15.64 ? 397 ILE A N   1 
ATOM   3000  C  CA  . ILE A 1 366 ? 12.536  48.364  14.609  1.00 16.50 ? 397 ILE A CA  1 
ATOM   3001  C  C   . ILE A 1 366 ? 11.634  49.296  15.431  1.00 17.54 ? 397 ILE A C   1 
ATOM   3002  O  O   . ILE A 1 366 ? 11.080  50.276  14.915  1.00 13.38 ? 397 ILE A O   1 
ATOM   3003  C  CB  . ILE A 1 366 ? 13.654  49.149  13.859  1.00 15.44 ? 397 ILE A CB  1 
ATOM   3004  C  CG1 . ILE A 1 366 ? 14.750  48.191  13.380  1.00 13.55 ? 397 ILE A CG1 1 
ATOM   3005  C  CG2 . ILE A 1 366 ? 14.293  50.166  14.796  1.00 14.67 ? 397 ILE A CG2 1 
ATOM   3006  C  CD1 . ILE A 1 366 ? 14.625  47.724  11.940  1.00 11.13 ? 397 ILE A CD1 1 
ATOM   3007  N  N   . GLU A 1 367 ? 11.383  48.838  16.655  1.00 22.70 ? 398 GLU A N   1 
ATOM   3008  C  CA  . GLU A 1 367 ? 10.546  49.467  17.676  1.00 28.75 ? 398 GLU A CA  1 
ATOM   3009  C  C   . GLU A 1 367 ? 9.760   50.686  17.205  1.00 30.74 ? 398 GLU A C   1 
ATOM   3010  O  O   . GLU A 1 367 ? 10.287  51.812  17.252  1.00 34.20 ? 398 GLU A O   1 
ATOM   3011  C  CB  . GLU A 1 367 ? 11.384  49.778  18.938  1.00 29.67 ? 398 GLU A CB  1 
ATOM   3012  C  CG  . GLU A 1 367 ? 10.600  49.719  20.270  1.00 37.29 ? 398 GLU A CG  1 
ATOM   3013  C  CD  . GLU A 1 367 ? 11.243  48.810  21.355  1.00 40.88 ? 398 GLU A CD  1 
ATOM   3014  O  OE1 . GLU A 1 367 ? 11.237  47.559  21.195  1.00 45.31 ? 398 GLU A OE1 1 
ATOM   3015  O  OE2 . GLU A 1 367 ? 11.714  49.343  22.394  1.00 39.54 ? 398 GLU A OE2 1 
ATOM   3016  N  N   . ASP A 1 368 ? 8.543   50.421  16.694  1.00 29.91 ? 399 ASP A N   1 
ATOM   3017  C  CA  . ASP A 1 368 ? 7.565   51.413  16.175  1.00 29.17 ? 399 ASP A CA  1 
ATOM   3018  C  C   . ASP A 1 368 ? 7.117   51.297  14.737  1.00 27.89 ? 399 ASP A C   1 
ATOM   3019  O  O   . ASP A 1 368 ? 5.988   51.639  14.426  1.00 30.03 ? 399 ASP A O   1 
ATOM   3020  C  CB  . ASP A 1 368 ? 7.924   52.881  16.459  1.00 28.33 ? 399 ASP A CB  1 
ATOM   3021  C  CG  . ASP A 1 368 ? 7.146   53.450  17.633  1.00 27.81 ? 399 ASP A CG  1 
ATOM   3022  O  OD1 . ASP A 1 368 ? 6.216   52.774  18.124  1.00 28.95 ? 399 ASP A OD1 1 
ATOM   3023  O  OD2 . ASP A 1 368 ? 7.457   54.572  18.075  1.00 31.09 ? 399 ASP A OD2 1 
ATOM   3024  N  N   . GLN A 1 369 ? 7.988   50.893  13.839  1.00 26.14 ? 400 GLN A N   1 
ATOM   3025  C  CA  . GLN A 1 369 ? 7.544   50.757  12.466  1.00 27.19 ? 400 GLN A CA  1 
ATOM   3026  C  C   . GLN A 1 369 ? 7.880   49.350  12.044  1.00 25.68 ? 400 GLN A C   1 
ATOM   3027  O  O   . GLN A 1 369 ? 8.516   48.591  12.792  1.00 26.39 ? 400 GLN A O   1 
ATOM   3028  C  CB  . GLN A 1 369 ? 8.250   51.756  11.567  1.00 34.48 ? 400 GLN A CB  1 
ATOM   3029  C  CG  . GLN A 1 369 ? 9.162   52.715  12.335  1.00 42.01 ? 400 GLN A CG  1 
ATOM   3030  C  CD  . GLN A 1 369 ? 8.540   54.083  12.470  1.00 46.31 ? 400 GLN A CD  1 
ATOM   3031  O  OE1 . GLN A 1 369 ? 8.675   54.922  11.569  1.00 49.99 ? 400 GLN A OE1 1 
ATOM   3032  N  NE2 . GLN A 1 369 ? 7.827   54.317  13.578  1.00 47.33 ? 400 GLN A NE2 1 
ATOM   3033  N  N   . GLU A 1 370 ? 7.411   48.985  10.865  1.00 23.67 ? 401 GLU A N   1 
ATOM   3034  C  CA  . GLU A 1 370 ? 7.686   47.663  10.305  1.00 22.42 ? 401 GLU A CA  1 
ATOM   3035  C  C   . GLU A 1 370 ? 8.186   48.061  8.910   1.00 17.85 ? 401 GLU A C   1 
ATOM   3036  O  O   . GLU A 1 370 ? 7.662   49.000  8.307   1.00 18.79 ? 401 GLU A O   1 
ATOM   3037  C  CB  . GLU A 1 370 ? 6.390   46.765  10.263  1.00 23.04 ? 401 GLU A CB  1 
ATOM   3038  C  CG  . GLU A 1 370 ? 5.786   46.394  11.677  1.00 22.25 ? 401 GLU A CG  1 
ATOM   3039  C  CD  . GLU A 1 370 ? 4.557   45.433  11.666  1.00 24.11 ? 401 GLU A CD  1 
ATOM   3040  O  OE1 . GLU A 1 370 ? 3.848   45.333  10.636  1.00 25.17 ? 401 GLU A OE1 1 
ATOM   3041  O  OE2 . GLU A 1 370 ? 4.274   44.798  12.720  1.00 19.56 ? 401 GLU A OE2 1 
ATOM   3042  N  N   . TYR A 1 371 ? 9.276   47.481  8.450   1.00 12.22 ? 402 TYR A N   1 
ATOM   3043  C  CA  . TYR A 1 371 ? 9.716   47.857  7.125   1.00 8.44  ? 402 TYR A CA  1 
ATOM   3044  C  C   . TYR A 1 371 ? 9.696   46.620  6.239   1.00 6.47  ? 402 TYR A C   1 
ATOM   3045  O  O   . TYR A 1 371 ? 9.781   45.489  6.721   1.00 4.63  ? 402 TYR A O   1 
ATOM   3046  C  CB  . TYR A 1 371 ? 11.119  48.488  7.138   1.00 7.11  ? 402 TYR A CB  1 
ATOM   3047  C  CG  . TYR A 1 371 ? 11.305  49.754  7.965   1.00 4.40  ? 402 TYR A CG  1 
ATOM   3048  C  CD1 . TYR A 1 371 ? 11.529  49.691  9.344   1.00 3.93  ? 402 TYR A CD1 1 
ATOM   3049  C  CD2 . TYR A 1 371 ? 11.347  51.006  7.355   1.00 3.24  ? 402 TYR A CD2 1 
ATOM   3050  C  CE1 . TYR A 1 371 ? 11.798  50.839  10.093  1.00 2.77  ? 402 TYR A CE1 1 
ATOM   3051  C  CE2 . TYR A 1 371 ? 11.612  52.166  8.097   1.00 2.37  ? 402 TYR A CE2 1 
ATOM   3052  C  CZ  . TYR A 1 371 ? 11.839  52.076  9.462   1.00 3.13  ? 402 TYR A CZ  1 
ATOM   3053  O  OH  . TYR A 1 371 ? 12.122  53.216  10.194  1.00 3.40  ? 402 TYR A OH  1 
ATOM   3054  N  N   . SER A 1 372 ? 9.523   46.848  4.951   1.00 3.62  ? 403 SER A N   1 
ATOM   3055  C  CA  . SER A 1 372 ? 9.509   45.785  3.984   1.00 6.21  ? 403 SER A CA  1 
ATOM   3056  C  C   . SER A 1 372 ? 10.937  45.578  3.561   1.00 8.67  ? 403 SER A C   1 
ATOM   3057  O  O   . SER A 1 372 ? 11.801  46.376  3.915   1.00 12.63 ? 403 SER A O   1 
ATOM   3058  C  CB  . SER A 1 372 ? 8.727   46.236  2.768   1.00 9.59  ? 403 SER A CB  1 
ATOM   3059  O  OG  . SER A 1 372 ? 9.303   47.403  2.204   1.00 6.44  ? 403 SER A OG  1 
ATOM   3060  N  N   . PHE A 1 373 ? 11.195  44.542  2.773   1.00 8.39  ? 404 PHE A N   1 
ATOM   3061  C  CA  . PHE A 1 373 ? 12.554  44.318  2.298   1.00 9.05  ? 404 PHE A CA  1 
ATOM   3062  C  C   . PHE A 1 373 ? 12.925  45.557  1.495   1.00 7.70  ? 404 PHE A C   1 
ATOM   3063  O  O   . PHE A 1 373 ? 13.904  46.244  1.771   1.00 9.30  ? 404 PHE A O   1 
ATOM   3064  C  CB  . PHE A 1 373 ? 12.636  43.061  1.420   1.00 7.66  ? 404 PHE A CB  1 
ATOM   3065  C  CG  . PHE A 1 373 ? 12.749  41.784  2.206   1.00 8.24  ? 404 PHE A CG  1 
ATOM   3066  C  CD1 . PHE A 1 373 ? 12.246  41.700  3.510   1.00 7.84  ? 404 PHE A CD1 1 
ATOM   3067  C  CD2 . PHE A 1 373 ? 13.366  40.671  1.654   1.00 8.08  ? 404 PHE A CD2 1 
ATOM   3068  C  CE1 . PHE A 1 373 ? 12.353  40.529  4.251   1.00 7.33  ? 404 PHE A CE1 1 
ATOM   3069  C  CE2 . PHE A 1 373 ? 13.481  39.493  2.388   1.00 9.28  ? 404 PHE A CE2 1 
ATOM   3070  C  CZ  . PHE A 1 373 ? 12.969  39.427  3.697   1.00 9.29  ? 404 PHE A CZ  1 
ATOM   3071  N  N   . LYS A 1 374 ? 12.014  45.929  0.631   1.00 6.55  ? 405 LYS A N   1 
ATOM   3072  C  CA  . LYS A 1 374 ? 12.178  47.082  -0.226  1.00 10.98 ? 405 LYS A CA  1 
ATOM   3073  C  C   . LYS A 1 374 ? 12.482  48.379  0.526   1.00 10.63 ? 405 LYS A C   1 
ATOM   3074  O  O   . LYS A 1 374 ? 12.837  49.377  -0.085  1.00 10.23 ? 405 LYS A O   1 
ATOM   3075  C  CB  . LYS A 1 374 ? 10.910  47.272  -1.073  1.00 17.79 ? 405 LYS A CB  1 
ATOM   3076  C  CG  . LYS A 1 374 ? 10.184  45.952  -1.463  1.00 23.50 ? 405 LYS A CG  1 
ATOM   3077  C  CD  . LYS A 1 374 ? 9.303   45.412  -0.323  1.00 19.24 ? 405 LYS A CD  1 
ATOM   3078  C  CE  . LYS A 1 374 ? 9.253   43.897  -0.326  1.00 16.43 ? 405 LYS A CE  1 
ATOM   3079  N  NZ  . LYS A 1 374 ? 8.807   43.420  1.014   1.00 13.76 ? 405 LYS A NZ  1 
ATOM   3080  N  N   . GLN A 1 375 ? 12.282  48.386  1.835   1.00 12.04 ? 406 GLN A N   1 
ATOM   3081  C  CA  . GLN A 1 375 ? 12.552  49.571  2.638   1.00 13.20 ? 406 GLN A CA  1 
ATOM   3082  C  C   . GLN A 1 375 ? 13.765  49.386  3.518   1.00 13.92 ? 406 GLN A C   1 
ATOM   3083  O  O   . GLN A 1 375 ? 14.356  50.362  3.972   1.00 12.91 ? 406 GLN A O   1 
ATOM   3084  C  CB  . GLN A 1 375 ? 11.384  49.865  3.541   1.00 17.26 ? 406 GLN A CB  1 
ATOM   3085  C  CG  . GLN A 1 375 ? 10.129  50.273  2.833   1.00 22.78 ? 406 GLN A CG  1 
ATOM   3086  C  CD  . GLN A 1 375 ? 9.056   50.626  3.842   1.00 27.55 ? 406 GLN A CD  1 
ATOM   3087  O  OE1 . GLN A 1 375 ? 8.281   49.764  4.276   1.00 28.42 ? 406 GLN A OE1 1 
ATOM   3088  N  NE2 . GLN A 1 375 ? 9.054   51.880  4.288   1.00 28.15 ? 406 GLN A NE2 1 
ATOM   3089  N  N   . PHE A 1 376 ? 14.072  48.129  3.826   1.00 14.01 ? 407 PHE A N   1 
ATOM   3090  C  CA  . PHE A 1 376 ? 15.207  47.788  4.656   1.00 12.58 ? 407 PHE A CA  1 
ATOM   3091  C  C   . PHE A 1 376 ? 16.505  47.756  3.825   1.00 14.92 ? 407 PHE A C   1 
ATOM   3092  O  O   . PHE A 1 376 ? 17.499  48.455  4.148   1.00 13.97 ? 407 PHE A O   1 
ATOM   3093  C  CB  . PHE A 1 376 ? 14.958  46.442  5.318   1.00 8.07  ? 407 PHE A CB  1 
ATOM   3094  C  CG  . PHE A 1 376 ? 15.558  46.331  6.683   1.00 8.88  ? 407 PHE A CG  1 
ATOM   3095  C  CD1 . PHE A 1 376 ? 15.303  47.304  7.639   1.00 9.47  ? 407 PHE A CD1 1 
ATOM   3096  C  CD2 . PHE A 1 376 ? 16.345  45.232  7.041   1.00 8.43  ? 407 PHE A CD2 1 
ATOM   3097  C  CE1 . PHE A 1 376 ? 15.816  47.187  8.944   1.00 10.58 ? 407 PHE A CE1 1 
ATOM   3098  C  CE2 . PHE A 1 376 ? 16.860  45.101  8.337   1.00 6.83  ? 407 PHE A CE2 1 
ATOM   3099  C  CZ  . PHE A 1 376 ? 16.594  46.081  9.297   1.00 8.61  ? 407 PHE A CZ  1 
ATOM   3100  N  N   . LEU A 1 377 ? 16.461  46.999  2.727   1.00 14.70 ? 408 LEU A N   1 
ATOM   3101  C  CA  . LEU A 1 377 ? 17.613  46.832  1.843   1.00 15.37 ? 408 LEU A CA  1 
ATOM   3102  C  C   . LEU A 1 377 ? 18.283  48.138  1.468   1.00 15.67 ? 408 LEU A C   1 
ATOM   3103  O  O   . LEU A 1 377 ? 17.609  49.072  1.044   1.00 14.42 ? 408 LEU A O   1 
ATOM   3104  C  CB  . LEU A 1 377 ? 17.235  46.032  0.602   1.00 12.65 ? 408 LEU A CB  1 
ATOM   3105  C  CG  . LEU A 1 377 ? 16.825  44.617  1.010   1.00 12.62 ? 408 LEU A CG  1 
ATOM   3106  C  CD1 . LEU A 1 377 ? 16.438  43.823  -0.232  1.00 14.14 ? 408 LEU A CD1 1 
ATOM   3107  C  CD2 . LEU A 1 377 ? 17.947  43.932  1.802   1.00 9.64  ? 408 LEU A CD2 1 
ATOM   3108  N  N   . TYR A 1 378 ? 19.612  48.172  1.637   1.00 17.44 ? 409 TYR A N   1 
ATOM   3109  C  CA  . TYR A 1 378 ? 20.445  49.340  1.372   1.00 19.50 ? 409 TYR A CA  1 
ATOM   3110  C  C   . TYR A 1 378 ? 19.889  50.647  1.933   1.00 18.43 ? 409 TYR A C   1 
ATOM   3111  O  O   . TYR A 1 378 ? 19.848  51.661  1.236   1.00 15.89 ? 409 TYR A O   1 
ATOM   3112  C  CB  . TYR A 1 378 ? 20.795  49.499  -0.126  1.00 24.70 ? 409 TYR A CB  1 
ATOM   3113  C  CG  . TYR A 1 378 ? 20.079  48.595  -1.110  1.00 29.11 ? 409 TYR A CG  1 
ATOM   3114  C  CD1 . TYR A 1 378 ? 20.416  47.244  -1.209  1.00 32.64 ? 409 TYR A CD1 1 
ATOM   3115  C  CD2 . TYR A 1 378 ? 19.113  49.110  -1.994  1.00 31.34 ? 409 TYR A CD2 1 
ATOM   3116  C  CE1 . TYR A 1 378 ? 19.818  46.401  -2.171  1.00 37.13 ? 409 TYR A CE1 1 
ATOM   3117  C  CE2 . TYR A 1 378 ? 18.498  48.288  -2.971  1.00 35.55 ? 409 TYR A CE2 1 
ATOM   3118  C  CZ  . TYR A 1 378 ? 18.860  46.919  -3.058  1.00 38.61 ? 409 TYR A CZ  1 
ATOM   3119  O  OH  . TYR A 1 378 ? 18.298  46.063  -4.013  1.00 37.50 ? 409 TYR A OH  1 
ATOM   3120  N  N   . ASN A 1 379 ? 19.501  50.637  3.202   1.00 19.28 ? 410 ASN A N   1 
ATOM   3121  C  CA  . ASN A 1 379 ? 18.964  51.848  3.801   1.00 23.73 ? 410 ASN A CA  1 
ATOM   3122  C  C   . ASN A 1 379 ? 19.522  52.097  5.193   1.00 24.70 ? 410 ASN A C   1 
ATOM   3123  O  O   . ASN A 1 379 ? 18.943  51.668  6.194   1.00 25.73 ? 410 ASN A O   1 
ATOM   3124  C  CB  . ASN A 1 379 ? 17.429  51.776  3.835   1.00 27.18 ? 410 ASN A CB  1 
ATOM   3125  C  CG  . ASN A 1 379 ? 16.792  53.069  4.330   1.00 26.44 ? 410 ASN A CG  1 
ATOM   3126  O  OD1 . ASN A 1 379 ? 17.517  54.011  4.661   1.00 25.43 ? 410 ASN A OD1 1 
ATOM   3127  N  ND2 . ASN A 1 379 ? 15.454  53.123  4.384   1.00 29.00 ? 410 ASN A ND2 1 
ATOM   3128  N  N   . ASN A 1 380 ? 20.623  52.836  5.263   1.00 25.31 ? 411 ASN A N   1 
ATOM   3129  C  CA  . ASN A 1 380 ? 21.272  53.111  6.555   1.00 27.75 ? 411 ASN A CA  1 
ATOM   3130  C  C   . ASN A 1 380 ? 20.425  54.003  7.474   1.00 23.84 ? 411 ASN A C   1 
ATOM   3131  O  O   . ASN A 1 380 ? 20.452  53.872  8.712   1.00 22.33 ? 411 ASN A O   1 
ATOM   3132  C  CB  . ASN A 1 380 ? 22.576  53.880  6.345   1.00 35.28 ? 411 ASN A CB  1 
ATOM   3133  C  CG  . ASN A 1 380 ? 22.353  55.409  6.462   1.00 42.28 ? 411 ASN A CG  1 
ATOM   3134  O  OD1 . ASN A 1 380 ? 22.557  56.012  7.534   1.00 42.68 ? 411 ASN A OD1 1 
ATOM   3135  N  ND2 . ASN A 1 380 ? 21.746  55.991  5.418   1.00 45.37 ? 411 ASN A ND2 1 
ATOM   3136  N  N   . SER A 1 381 ? 19.817  55.007  6.842   1.00 17.74 ? 412 SER A N   1 
ATOM   3137  C  CA  . SER A 1 381 ? 19.040  56.019  7.505   1.00 11.81 ? 412 SER A CA  1 
ATOM   3138  C  C   . SER A 1 381 ? 18.252  55.372  8.600   1.00 8.98  ? 412 SER A C   1 
ATOM   3139  O  O   . SER A 1 381 ? 18.245  55.870  9.713   1.00 6.50  ? 412 SER A O   1 
ATOM   3140  C  CB  . SER A 1 381 ? 18.155  56.707  6.489   1.00 11.77 ? 412 SER A CB  1 
ATOM   3141  O  OG  . SER A 1 381 ? 18.752  56.612  5.200   1.00 13.09 ? 412 SER A OG  1 
ATOM   3142  N  N   . ILE A 1 382 ? 17.686  54.205  8.308   1.00 5.42  ? 413 ILE A N   1 
ATOM   3143  C  CA  . ILE A 1 382 ? 16.918  53.483  9.314   1.00 8.07  ? 413 ILE A CA  1 
ATOM   3144  C  C   . ILE A 1 382 ? 17.753  53.382  10.624  1.00 9.22  ? 413 ILE A C   1 
ATOM   3145  O  O   . ILE A 1 382 ? 17.337  53.878  11.689  1.00 8.02  ? 413 ILE A O   1 
ATOM   3146  C  CB  . ILE A 1 382 ? 16.500  52.029  8.805   1.00 7.46  ? 413 ILE A CB  1 
ATOM   3147  C  CG1 . ILE A 1 382 ? 15.601  52.123  7.571   1.00 2.77  ? 413 ILE A CG1 1 
ATOM   3148  C  CG2 . ILE A 1 382 ? 15.828  51.186  9.942   1.00 3.62  ? 413 ILE A CG2 1 
ATOM   3149  C  CD1 . ILE A 1 382 ? 15.137  50.789  7.071   1.00 2.00  ? 413 ILE A CD1 1 
ATOM   3150  N  N   . LEU A 1 383 ? 18.964  52.828  10.495  1.00 11.37 ? 414 LEU A N   1 
ATOM   3151  C  CA  . LEU A 1 383 ? 19.888  52.599  11.607  1.00 7.86  ? 414 LEU A CA  1 
ATOM   3152  C  C   . LEU A 1 383 ? 20.245  53.888  12.260  1.00 6.30  ? 414 LEU A C   1 
ATOM   3153  O  O   . LEU A 1 383 ? 20.265  53.972  13.496  1.00 2.01  ? 414 LEU A O   1 
ATOM   3154  C  CB  . LEU A 1 383 ? 21.162  51.890  11.128  1.00 9.61  ? 414 LEU A CB  1 
ATOM   3155  C  CG  . LEU A 1 383 ? 22.249  51.750  12.202  1.00 13.15 ? 414 LEU A CG  1 
ATOM   3156  C  CD1 . LEU A 1 383 ? 21.853  50.763  13.277  1.00 15.21 ? 414 LEU A CD1 1 
ATOM   3157  C  CD2 . LEU A 1 383 ? 23.563  51.344  11.578  1.00 13.48 ? 414 LEU A CD2 1 
ATOM   3158  N  N   . LEU A 1 384 ? 20.538  54.882  11.423  1.00 5.56  ? 415 LEU A N   1 
ATOM   3159  C  CA  . LEU A 1 384 ? 20.899  56.207  11.911  1.00 7.44  ? 415 LEU A CA  1 
ATOM   3160  C  C   . LEU A 1 384 ? 19.716  56.918  12.541  1.00 8.68  ? 415 LEU A C   1 
ATOM   3161  O  O   . LEU A 1 384 ? 19.880  57.697  13.475  1.00 6.81  ? 415 LEU A O   1 
ATOM   3162  C  CB  . LEU A 1 384 ? 21.436  57.086  10.790  1.00 6.06  ? 415 LEU A CB  1 
ATOM   3163  C  CG  . LEU A 1 384 ? 22.905  57.055  10.389  1.00 2.00  ? 415 LEU A CG  1 
ATOM   3164  C  CD1 . LEU A 1 384 ? 23.172  58.344  9.622   1.00 2.00  ? 415 LEU A CD1 1 
ATOM   3165  C  CD2 . LEU A 1 384 ? 23.792  56.989  11.617  1.00 5.01  ? 415 LEU A CD2 1 
ATOM   3166  N  N   . GLU A 1 385 ? 18.519  56.600  12.055  1.00 10.22 ? 416 GLU A N   1 
ATOM   3167  C  CA  . GLU A 1 385 ? 17.287  57.206  12.548  1.00 9.45  ? 416 GLU A CA  1 
ATOM   3168  C  C   . GLU A 1 385 ? 16.809  56.528  13.810  1.00 8.56  ? 416 GLU A C   1 
ATOM   3169  O  O   . GLU A 1 385 ? 16.167  57.140  14.643  1.00 7.54  ? 416 GLU A O   1 
ATOM   3170  C  CB  . GLU A 1 385 ? 16.190  57.140  11.482  1.00 10.35 ? 416 GLU A CB  1 
ATOM   3171  C  CG  . GLU A 1 385 ? 15.185  58.314  11.519  1.00 13.32 ? 416 GLU A CG  1 
ATOM   3172  C  CD  . GLU A 1 385 ? 13.791  57.912  11.992  1.00 14.31 ? 416 GLU A CD  1 
ATOM   3173  O  OE1 . GLU A 1 385 ? 13.119  57.158  11.249  1.00 14.49 ? 416 GLU A OE1 1 
ATOM   3174  O  OE2 . GLU A 1 385 ? 13.369  58.343  13.097  1.00 15.60 ? 416 GLU A OE2 1 
ATOM   3175  N  N   . HIS A 1 386 ? 17.149  55.262  13.969  1.00 11.61 ? 417 HIS A N   1 
ATOM   3176  C  CA  . HIS A 1 386 ? 16.706  54.541  15.144  1.00 14.34 ? 417 HIS A CA  1 
ATOM   3177  C  C   . HIS A 1 386 ? 17.720  54.302  16.238  1.00 14.93 ? 417 HIS A C   1 
ATOM   3178  O  O   . HIS A 1 386 ? 17.344  54.057  17.386  1.00 16.32 ? 417 HIS A O   1 
ATOM   3179  C  CB  . HIS A 1 386 ? 16.050  53.231  14.735  1.00 18.56 ? 417 HIS A CB  1 
ATOM   3180  C  CG  . HIS A 1 386 ? 14.669  53.405  14.178  1.00 21.12 ? 417 HIS A CG  1 
ATOM   3181  N  ND1 . HIS A 1 386 ? 14.429  53.759  12.865  1.00 21.32 ? 417 HIS A ND1 1 
ATOM   3182  C  CD2 . HIS A 1 386 ? 13.457  53.265  14.759  1.00 18.99 ? 417 HIS A CD2 1 
ATOM   3183  C  CE1 . HIS A 1 386 ? 13.128  53.825  12.660  1.00 19.73 ? 417 HIS A CE1 1 
ATOM   3184  N  NE2 . HIS A 1 386 ? 12.516  53.527  13.793  1.00 21.93 ? 417 HIS A NE2 1 
ATOM   3185  N  N   . GLY A 1 387 ? 19.003  54.402  15.915  1.00 15.89 ? 418 GLY A N   1 
ATOM   3186  C  CA  . GLY A 1 387 ? 20.006  54.169  16.942  1.00 16.94 ? 418 GLY A CA  1 
ATOM   3187  C  C   . GLY A 1 387 ? 20.204  52.687  17.188  1.00 15.75 ? 418 GLY A C   1 
ATOM   3188  O  O   . GLY A 1 387 ? 19.348  51.871  16.866  1.00 17.80 ? 418 GLY A O   1 
ATOM   3189  N  N   . LEU A 1 388 ? 21.320  52.313  17.780  1.00 14.44 ? 419 LEU A N   1 
ATOM   3190  C  CA  . LEU A 1 388 ? 21.553  50.900  17.982  1.00 14.62 ? 419 LEU A CA  1 
ATOM   3191  C  C   . LEU A 1 388 ? 20.882  50.328  19.211  1.00 13.72 ? 419 LEU A C   1 
ATOM   3192  O  O   . LEU A 1 388 ? 20.575  49.151  19.242  1.00 16.63 ? 419 LEU A O   1 
ATOM   3193  C  CB  . LEU A 1 388 ? 23.064  50.566  17.944  1.00 16.09 ? 419 LEU A CB  1 
ATOM   3194  C  CG  . LEU A 1 388 ? 23.802  50.654  16.581  1.00 13.56 ? 419 LEU A CG  1 
ATOM   3195  C  CD1 . LEU A 1 388 ? 23.978  52.110  16.127  1.00 11.17 ? 419 LEU A CD1 1 
ATOM   3196  C  CD2 . LEU A 1 388 ? 25.156  49.993  16.691  1.00 9.43  ? 419 LEU A CD2 1 
ATOM   3197  N  N   . THR A 1 389 ? 20.620  51.147  20.217  1.00 13.88 ? 420 THR A N   1 
ATOM   3198  C  CA  . THR A 1 389 ? 19.974  50.648  21.437  1.00 13.43 ? 420 THR A CA  1 
ATOM   3199  C  C   . THR A 1 389 ? 18.567  50.201  21.049  1.00 13.98 ? 420 THR A C   1 
ATOM   3200  O  O   . THR A 1 389 ? 18.191  49.031  21.196  1.00 12.80 ? 420 THR A O   1 
ATOM   3201  C  CB  . THR A 1 389 ? 19.919  51.754  22.509  1.00 11.96 ? 420 THR A CB  1 
ATOM   3202  O  OG1 . THR A 1 389 ? 20.668  52.885  22.048  1.00 14.50 ? 420 THR A OG1 1 
ATOM   3203  C  CG2 . THR A 1 389 ? 20.544  51.291  23.804  1.00 7.39  ? 420 THR A CG2 1 
ATOM   3204  N  N   . GLN A 1 390 ? 17.840  51.123  20.434  1.00 14.69 ? 421 GLN A N   1 
ATOM   3205  C  CA  . GLN A 1 390 ? 16.495  50.842  19.971  1.00 15.20 ? 421 GLN A CA  1 
ATOM   3206  C  C   . GLN A 1 390 ? 16.631  50.192  18.594  1.00 12.25 ? 421 GLN A C   1 
ATOM   3207  O  O   . GLN A 1 390 ? 16.076  50.667  17.593  1.00 11.79 ? 421 GLN A O   1 
ATOM   3208  C  CB  . GLN A 1 390 ? 15.688  52.134  19.872  1.00 21.12 ? 421 GLN A CB  1 
ATOM   3209  C  CG  . GLN A 1 390 ? 14.200  51.912  19.760  1.00 25.40 ? 421 GLN A CG  1 
ATOM   3210  C  CD  . GLN A 1 390 ? 13.696  51.091  20.913  1.00 27.48 ? 421 GLN A CD  1 
ATOM   3211  O  OE1 . GLN A 1 390 ? 13.951  49.897  20.988  1.00 29.93 ? 421 GLN A OE1 1 
ATOM   3212  N  NE2 . GLN A 1 390 ? 12.993  51.728  21.835  1.00 31.07 ? 421 GLN A NE2 1 
ATOM   3213  N  N   . PHE A 1 391 ? 17.404  49.116  18.555  1.00 6.58  ? 422 PHE A N   1 
ATOM   3214  C  CA  . PHE A 1 391 ? 17.652  48.383  17.332  1.00 3.09  ? 422 PHE A CA  1 
ATOM   3215  C  C   . PHE A 1 391 ? 18.030  47.066  17.898  1.00 2.00  ? 422 PHE A C   1 
ATOM   3216  O  O   . PHE A 1 391 ? 17.737  46.034  17.332  1.00 4.28  ? 422 PHE A O   1 
ATOM   3217  C  CB  . PHE A 1 391 ? 18.835  48.959  16.572  1.00 2.00  ? 422 PHE A CB  1 
ATOM   3218  C  CG  . PHE A 1 391 ? 18.612  49.087  15.105  1.00 2.00  ? 422 PHE A CG  1 
ATOM   3219  C  CD1 . PHE A 1 391 ? 18.935  48.053  14.246  1.00 2.00  ? 422 PHE A CD1 1 
ATOM   3220  C  CD2 . PHE A 1 391 ? 18.124  50.263  14.565  1.00 2.06  ? 422 PHE A CD2 1 
ATOM   3221  C  CE1 . PHE A 1 391 ? 18.780  48.178  12.840  1.00 2.00  ? 422 PHE A CE1 1 
ATOM   3222  C  CE2 . PHE A 1 391 ? 17.962  50.402  13.171  1.00 4.02  ? 422 PHE A CE2 1 
ATOM   3223  C  CZ  . PHE A 1 391 ? 18.298  49.340  12.307  1.00 2.00  ? 422 PHE A CZ  1 
ATOM   3224  N  N   . VAL A 1 392 ? 18.678  47.102  19.048  1.00 2.01  ? 423 VAL A N   1 
ATOM   3225  C  CA  . VAL A 1 392 ? 19.078  45.877  19.707  1.00 5.01  ? 423 VAL A CA  1 
ATOM   3226  C  C   . VAL A 1 392 ? 17.851  45.428  20.450  1.00 6.32  ? 423 VAL A C   1 
ATOM   3227  O  O   . VAL A 1 392 ? 17.507  44.241  20.392  1.00 3.65  ? 423 VAL A O   1 
ATOM   3228  C  CB  . VAL A 1 392 ? 20.320  46.077  20.666  1.00 7.40  ? 423 VAL A CB  1 
ATOM   3229  C  CG1 . VAL A 1 392 ? 20.274  45.102  21.877  1.00 7.33  ? 423 VAL A CG1 1 
ATOM   3230  C  CG2 . VAL A 1 392 ? 21.629  45.854  19.880  1.00 4.25  ? 423 VAL A CG2 1 
ATOM   3231  N  N   . GLU A 1 393 ? 17.139  46.405  21.041  1.00 10.54 ? 424 GLU A N   1 
ATOM   3232  C  CA  . GLU A 1 393 ? 15.903  46.159  21.810  1.00 9.73  ? 424 GLU A CA  1 
ATOM   3233  C  C   . GLU A 1 393 ? 14.824  45.583  20.914  1.00 6.86  ? 424 GLU A C   1 
ATOM   3234  O  O   . GLU A 1 393 ? 14.216  44.571  21.234  1.00 6.77  ? 424 GLU A O   1 
ATOM   3235  C  CB  . GLU A 1 393 ? 15.394  47.443  22.463  1.00 13.45 ? 424 GLU A CB  1 
ATOM   3236  C  CG  . GLU A 1 393 ? 16.203  47.876  23.688  1.00 21.71 ? 424 GLU A CG  1 
ATOM   3237  C  CD  . GLU A 1 393 ? 15.920  49.322  24.159  1.00 28.43 ? 424 GLU A CD  1 
ATOM   3238  O  OE1 . GLU A 1 393 ? 15.560  50.194  23.308  1.00 27.91 ? 424 GLU A OE1 1 
ATOM   3239  O  OE2 . GLU A 1 393 ? 16.083  49.583  25.393  1.00 30.57 ? 424 GLU A OE2 1 
ATOM   3240  N  N   . SER A 1 394 ? 14.654  46.199  19.757  1.00 2.75  ? 425 SER A N   1 
ATOM   3241  C  CA  . SER A 1 394 ? 13.679  45.761  18.798  1.00 3.83  ? 425 SER A CA  1 
ATOM   3242  C  C   . SER A 1 394 ? 13.979  44.406  18.217  1.00 6.45  ? 425 SER A C   1 
ATOM   3243  O  O   . SER A 1 394 ? 13.050  43.666  17.927  1.00 10.59 ? 425 SER A O   1 
ATOM   3244  C  CB  . SER A 1 394 ? 13.585  46.768  17.678  1.00 5.22  ? 425 SER A CB  1 
ATOM   3245  O  OG  . SER A 1 394 ? 13.620  48.077  18.224  1.00 8.99  ? 425 SER A OG  1 
ATOM   3246  N  N   . PHE A 1 395 ? 15.257  44.081  18.013  1.00 7.51  ? 426 PHE A N   1 
ATOM   3247  C  CA  . PHE A 1 395 ? 15.616  42.767  17.454  1.00 8.89  ? 426 PHE A CA  1 
ATOM   3248  C  C   . PHE A 1 395 ? 15.590  41.641  18.481  1.00 8.04  ? 426 PHE A C   1 
ATOM   3249  O  O   . PHE A 1 395 ? 15.269  40.511  18.136  1.00 7.64  ? 426 PHE A O   1 
ATOM   3250  C  CB  . PHE A 1 395 ? 16.962  42.798  16.711  1.00 10.33 ? 426 PHE A CB  1 
ATOM   3251  C  CG  . PHE A 1 395 ? 16.902  43.451  15.334  1.00 11.76 ? 426 PHE A CG  1 
ATOM   3252  C  CD1 . PHE A 1 395 ? 15.707  43.940  14.822  1.00 9.57  ? 426 PHE A CD1 1 
ATOM   3253  C  CD2 . PHE A 1 395 ? 18.051  43.560  14.549  1.00 12.33 ? 426 PHE A CD2 1 
ATOM   3254  C  CE1 . PHE A 1 395 ? 15.654  44.520  13.556  1.00 11.22 ? 426 PHE A CE1 1 
ATOM   3255  C  CE2 . PHE A 1 395 ? 17.997  44.145  13.273  1.00 11.39 ? 426 PHE A CE2 1 
ATOM   3256  C  CZ  . PHE A 1 395 ? 16.793  44.626  12.778  1.00 10.40 ? 426 PHE A CZ  1 
ATOM   3257  N  N   . THR A 1 396 ? 15.918  41.949  19.735  1.00 8.03  ? 427 THR A N   1 
ATOM   3258  C  CA  . THR A 1 396 ? 15.899  40.962  20.807  1.00 8.45  ? 427 THR A CA  1 
ATOM   3259  C  C   . THR A 1 396 ? 14.519  40.344  20.916  1.00 11.24 ? 427 THR A C   1 
ATOM   3260  O  O   . THR A 1 396 ? 14.383  39.181  21.313  1.00 11.90 ? 427 THR A O   1 
ATOM   3261  C  CB  . THR A 1 396 ? 16.222  41.594  22.152  1.00 7.78  ? 427 THR A CB  1 
ATOM   3262  O  OG1 . THR A 1 396 ? 17.552  42.109  22.124  1.00 10.51 ? 427 THR A OG1 1 
ATOM   3263  C  CG2 . THR A 1 396 ? 16.106  40.572  23.267  1.00 8.85  ? 427 THR A CG2 1 
ATOM   3264  N  N   . ARG A 1 397 ? 13.511  41.145  20.566  1.00 13.72 ? 428 ARG A N   1 
ATOM   3265  C  CA  . ARG A 1 397 ? 12.102  40.766  20.605  1.00 13.85 ? 428 ARG A CA  1 
ATOM   3266  C  C   . ARG A 1 397 ? 11.573  40.782  19.181  1.00 11.48 ? 428 ARG A C   1 
ATOM   3267  O  O   . ARG A 1 397 ? 11.184  41.828  18.707  1.00 17.91 ? 428 ARG A O   1 
ATOM   3268  C  CB  . ARG A 1 397 ? 11.288  41.798  21.411  1.00 16.23 ? 428 ARG A CB  1 
ATOM   3269  C  CG  . ARG A 1 397 ? 11.656  41.979  22.876  1.00 27.27 ? 428 ARG A CG  1 
ATOM   3270  C  CD  . ARG A 1 397 ? 12.888  42.861  23.079  1.00 33.65 ? 428 ARG A CD  1 
ATOM   3271  N  NE  . ARG A 1 397 ? 13.382  42.890  24.464  1.00 37.15 ? 428 ARG A NE  1 
ATOM   3272  C  CZ  . ARG A 1 397 ? 14.499  43.519  24.848  1.00 37.96 ? 428 ARG A CZ  1 
ATOM   3273  N  NH1 . ARG A 1 397 ? 15.233  44.167  23.945  1.00 36.61 ? 428 ARG A NH1 1 
ATOM   3274  N  NH2 . ARG A 1 397 ? 14.883  43.519  26.132  1.00 35.03 ? 428 ARG A NH2 1 
ATOM   3275  N  N   . GLN A 1 398 ? 11.650  39.674  18.468  1.00 5.10  ? 429 GLN A N   1 
ATOM   3276  C  CA  . GLN A 1 398 ? 11.113  39.575  17.112  1.00 3.77  ? 429 GLN A CA  1 
ATOM   3277  C  C   . GLN A 1 398 ? 11.502  38.244  16.523  1.00 5.71  ? 429 GLN A C   1 
ATOM   3278  O  O   . GLN A 1 398 ? 12.414  38.149  15.727  1.00 6.60  ? 429 GLN A O   1 
ATOM   3279  C  CB  . GLN A 1 398 ? 11.531  40.696  16.140  1.00 2.00  ? 429 GLN A CB  1 
ATOM   3280  C  CG  . GLN A 1 398 ? 10.864  40.494  14.750  1.00 2.14  ? 429 GLN A CG  1 
ATOM   3281  C  CD  . GLN A 1 398 ? 11.109  41.598  13.698  1.00 2.93  ? 429 GLN A CD  1 
ATOM   3282  O  OE1 . GLN A 1 398 ? 11.672  42.680  13.986  1.00 2.00  ? 429 GLN A OE1 1 
ATOM   3283  N  NE2 . GLN A 1 398 ? 10.667  41.325  12.458  1.00 2.00  ? 429 GLN A NE2 1 
ATOM   3284  N  N   . ILE A 1 399 ? 10.809  37.203  16.941  1.00 6.35  ? 430 ILE A N   1 
ATOM   3285  C  CA  . ILE A 1 399 ? 11.063  35.869  16.446  1.00 5.95  ? 430 ILE A CA  1 
ATOM   3286  C  C   . ILE A 1 399 ? 11.384  35.815  14.931  1.00 4.46  ? 430 ILE A C   1 
ATOM   3287  O  O   . ILE A 1 399 ? 10.907  36.632  14.133  1.00 2.00  ? 430 ILE A O   1 
ATOM   3288  C  CB  . ILE A 1 399 ? 9.836   34.941  16.773  1.00 6.96  ? 430 ILE A CB  1 
ATOM   3289  C  CG1 . ILE A 1 399 ? 10.295  33.488  16.889  1.00 8.07  ? 430 ILE A CG1 1 
ATOM   3290  C  CG2 . ILE A 1 399 ? 8.756   35.046  15.690  1.00 3.54  ? 430 ILE A CG2 1 
ATOM   3291  C  CD1 . ILE A 1 399 ? 9.197   32.534  17.257  1.00 9.60  ? 430 ILE A CD1 1 
ATOM   3292  N  N   . ALA A 1 400 ? 12.203  34.836  14.566  1.00 4.03  ? 431 ALA A N   1 
ATOM   3293  C  CA  . ALA A 1 400 ? 12.588  34.601  13.189  1.00 5.53  ? 431 ALA A CA  1 
ATOM   3294  C  C   . ALA A 1 400 ? 11.984  33.264  12.745  1.00 5.17  ? 431 ALA A C   1 
ATOM   3295  O  O   . ALA A 1 400 ? 11.654  32.405  13.585  1.00 3.02  ? 431 ALA A O   1 
ATOM   3296  C  CB  . ALA A 1 400 ? 14.100  34.575  13.067  1.00 8.97  ? 431 ALA A CB  1 
ATOM   3297  N  N   . GLY A 1 401 ? 11.858  33.075  11.432  1.00 6.33  ? 432 GLY A N   1 
ATOM   3298  C  CA  . GLY A 1 401 ? 11.248  31.860  10.916  1.00 8.75  ? 432 GLY A CA  1 
ATOM   3299  C  C   . GLY A 1 401 ? 11.964  30.534  11.135  1.00 10.82 ? 432 GLY A C   1 
ATOM   3300  O  O   . GLY A 1 401 ? 13.179  30.491  11.283  1.00 14.50 ? 432 GLY A O   1 
ATOM   3301  N  N   . ARG A 1 402 ? 11.202  29.443  11.187  1.00 10.47 ? 433 ARG A N   1 
ATOM   3302  C  CA  . ARG A 1 402 ? 11.766  28.103  11.319  1.00 6.22  ? 433 ARG A CA  1 
ATOM   3303  C  C   . ARG A 1 402 ? 12.464  27.871  9.955   1.00 5.58  ? 433 ARG A C   1 
ATOM   3304  O  O   . ARG A 1 402 ? 11.982  28.334  8.913   1.00 2.00  ? 433 ARG A O   1 
ATOM   3305  C  CB  . ARG A 1 402 ? 10.633  27.092  11.507  1.00 3.30  ? 433 ARG A CB  1 
ATOM   3306  C  CG  . ARG A 1 402 ? 10.974  25.897  12.372  1.00 3.07  ? 433 ARG A CG  1 
ATOM   3307  C  CD  . ARG A 1 402 ? 9.982   24.760  12.189  1.00 4.02  ? 433 ARG A CD  1 
ATOM   3308  N  NE  . ARG A 1 402 ? 10.334  23.647  13.048  1.00 7.94  ? 433 ARG A NE  1 
ATOM   3309  C  CZ  . ARG A 1 402 ? 9.606   23.212  14.082  1.00 15.27 ? 433 ARG A CZ  1 
ATOM   3310  N  NH1 . ARG A 1 402 ? 8.451   23.793  14.395  1.00 17.75 ? 433 ARG A NH1 1 
ATOM   3311  N  NH2 . ARG A 1 402 ? 10.060  22.216  14.859  1.00 18.22 ? 433 ARG A NH2 1 
ATOM   3312  N  N   . VAL A 1 403 ? 13.602  27.179  9.954   1.00 7.07  ? 434 VAL A N   1 
ATOM   3313  C  CA  . VAL A 1 403 ? 14.315  26.968  8.698   1.00 7.71  ? 434 VAL A CA  1 
ATOM   3314  C  C   . VAL A 1 403 ? 13.877  25.676  8.037   1.00 6.35  ? 434 VAL A C   1 
ATOM   3315  O  O   . VAL A 1 403 ? 13.445  25.660  6.856   1.00 4.18  ? 434 VAL A O   1 
ATOM   3316  C  CB  . VAL A 1 403 ? 15.875  26.992  8.873   1.00 10.14 ? 434 VAL A CB  1 
ATOM   3317  C  CG1 . VAL A 1 403 ? 16.541  26.887  7.497   1.00 9.17  ? 434 VAL A CG1 1 
ATOM   3318  C  CG2 . VAL A 1 403 ? 16.351  28.297  9.551   1.00 6.79  ? 434 VAL A CG2 1 
ATOM   3319  N  N   . ALA A 1 404 ? 14.001  24.595  8.799   1.00 5.27  ? 435 ALA A N   1 
ATOM   3320  C  CA  . ALA A 1 404 ? 13.588  23.282  8.309   1.00 10.25 ? 435 ALA A CA  1 
ATOM   3321  C  C   . ALA A 1 404 ? 12.065  23.189  8.418   1.00 14.30 ? 435 ALA A C   1 
ATOM   3322  O  O   . ALA A 1 404 ? 11.392  24.126  8.885   1.00 18.56 ? 435 ALA A O   1 
ATOM   3323  C  CB  . ALA A 1 404 ? 14.234  22.195  9.140   1.00 6.19  ? 435 ALA A CB  1 
ATOM   3324  N  N   . GLY A 1 405 ? 11.493  22.076  7.996   1.00 15.93 ? 436 GLY A N   1 
ATOM   3325  C  CA  . GLY A 1 405 ? 10.055  21.955  8.136   1.00 18.64 ? 436 GLY A CA  1 
ATOM   3326  C  C   . GLY A 1 405 ? 9.262   22.044  6.858   1.00 19.51 ? 436 GLY A C   1 
ATOM   3327  O  O   . GLY A 1 405 ? 8.592   21.064  6.504   1.00 23.46 ? 436 GLY A O   1 
ATOM   3328  N  N   . GLY A 1 406 ? 9.247   23.219  6.223   1.00 16.68 ? 437 GLY A N   1 
ATOM   3329  C  CA  . GLY A 1 406 ? 8.518   23.368  4.973   1.00 11.61 ? 437 GLY A CA  1 
ATOM   3330  C  C   . GLY A 1 406 ? 8.195   24.786  4.574   1.00 10.97 ? 437 GLY A C   1 
ATOM   3331  O  O   . GLY A 1 406 ? 8.277   25.730  5.388   1.00 9.32  ? 437 GLY A O   1 
ATOM   3332  N  N   . ARG A 1 407 ? 7.909   24.940  3.287   1.00 12.19 ? 438 ARG A N   1 
ATOM   3333  C  CA  . ARG A 1 407 ? 7.520   26.228  2.671   1.00 12.85 ? 438 ARG A CA  1 
ATOM   3334  C  C   . ARG A 1 407 ? 7.675   27.542  3.469   1.00 9.86  ? 438 ARG A C   1 
ATOM   3335  O  O   . ARG A 1 407 ? 6.690   28.231  3.681   1.00 10.84 ? 438 ARG A O   1 
ATOM   3336  C  CB  . ARG A 1 407 ? 6.063   26.138  2.211   1.00 14.76 ? 438 ARG A CB  1 
ATOM   3337  C  CG  . ARG A 1 407 ? 5.778   25.071  1.181   1.00 18.36 ? 438 ARG A CG  1 
ATOM   3338  C  CD  . ARG A 1 407 ? 4.392   24.528  1.397   1.00 19.42 ? 438 ARG A CD  1 
ATOM   3339  N  NE  . ARG A 1 407 ? 3.967   23.725  0.268   1.00 17.07 ? 438 ARG A NE  1 
ATOM   3340  C  CZ  . ARG A 1 407 ? 3.097   22.734  0.373   1.00 16.36 ? 438 ARG A CZ  1 
ATOM   3341  N  NH1 . ARG A 1 407 ? 2.574   22.455  1.564   1.00 13.67 ? 438 ARG A NH1 1 
ATOM   3342  N  NH2 . ARG A 1 407 ? 2.778   22.011  -0.700  1.00 14.23 ? 438 ARG A NH2 1 
ATOM   3343  N  N   . ASN A 1 408 ? 8.879   27.923  3.878   1.00 5.18  ? 439 ASN A N   1 
ATOM   3344  C  CA  . ASN A 1 408 ? 8.997   29.157  4.633   1.00 2.19  ? 439 ASN A CA  1 
ATOM   3345  C  C   . ASN A 1 408 ? 9.991   30.155  4.035   1.00 2.00  ? 439 ASN A C   1 
ATOM   3346  O  O   . ASN A 1 408 ? 10.477  31.049  4.720   1.00 2.00  ? 439 ASN A O   1 
ATOM   3347  C  CB  . ASN A 1 408 ? 9.304   28.855  6.109   1.00 2.08  ? 439 ASN A CB  1 
ATOM   3348  C  CG  . ASN A 1 408 ? 8.814   29.966  7.059   1.00 2.01  ? 439 ASN A CG  1 
ATOM   3349  O  OD1 . ASN A 1 408 ? 7.834   30.653  6.778   1.00 3.68  ? 439 ASN A OD1 1 
ATOM   3350  N  ND2 . ASN A 1 408 ? 9.477   30.125  8.191   1.00 2.05  ? 439 ASN A ND2 1 
ATOM   3351  N  N   . VAL A 1 409 ? 10.241  30.032  2.734   1.00 2.18  ? 440 VAL A N   1 
ATOM   3352  C  CA  . VAL A 1 409 ? 11.185  30.912  2.015   1.00 3.44  ? 440 VAL A CA  1 
ATOM   3353  C  C   . VAL A 1 409 ? 10.519  32.210  1.496   1.00 5.44  ? 440 VAL A C   1 
ATOM   3354  O  O   . VAL A 1 409 ? 9.651   32.180  0.619   1.00 6.48  ? 440 VAL A O   1 
ATOM   3355  C  CB  . VAL A 1 409 ? 11.861  30.175  0.800   1.00 4.00  ? 440 VAL A CB  1 
ATOM   3356  C  CG1 . VAL A 1 409 ? 12.765  31.127  0.023   1.00 3.33  ? 440 VAL A CG1 1 
ATOM   3357  C  CG2 . VAL A 1 409 ? 12.656  28.954  1.276   1.00 3.31  ? 440 VAL A CG2 1 
ATOM   3358  N  N   . PRO A 1 410 ? 10.894  33.371  2.060   1.00 7.31  ? 441 PRO A N   1 
ATOM   3359  C  CA  . PRO A 1 410 ? 10.323  34.649  1.635   1.00 6.14  ? 441 PRO A CA  1 
ATOM   3360  C  C   . PRO A 1 410 ? 10.404  34.855  0.134   1.00 6.96  ? 441 PRO A C   1 
ATOM   3361  O  O   . PRO A 1 410 ? 11.479  34.822  -0.445  1.00 6.74  ? 441 PRO A O   1 
ATOM   3362  C  CB  . PRO A 1 410 ? 11.195  35.654  2.368   1.00 4.88  ? 441 PRO A CB  1 
ATOM   3363  C  CG  . PRO A 1 410 ? 11.398  35.002  3.676   1.00 5.63  ? 441 PRO A CG  1 
ATOM   3364  C  CD  . PRO A 1 410 ? 11.762  33.575  3.237   1.00 10.24 ? 441 PRO A CD  1 
ATOM   3365  N  N   . ILE A 1 411 ? 9.250   35.117  -0.464  1.00 9.46  ? 442 ILE A N   1 
ATOM   3366  C  CA  . ILE A 1 411 ? 9.086   35.353  -1.898  1.00 10.82 ? 442 ILE A CA  1 
ATOM   3367  C  C   . ILE A 1 411 ? 10.032  36.422  -2.440  1.00 9.56  ? 442 ILE A C   1 
ATOM   3368  O  O   . ILE A 1 411 ? 10.203  36.570  -3.659  1.00 7.31  ? 442 ILE A O   1 
ATOM   3369  C  CB  . ILE A 1 411 ? 7.577   35.679  -2.242  1.00 12.95 ? 442 ILE A CB  1 
ATOM   3370  C  CG1 . ILE A 1 411 ? 6.771   34.387  -2.431  1.00 12.81 ? 442 ILE A CG1 1 
ATOM   3371  C  CG2 . ILE A 1 411 ? 7.438   36.534  -3.497  1.00 14.60 ? 442 ILE A CG2 1 
ATOM   3372  C  CD1 . ILE A 1 411 ? 6.381   33.729  -1.135  1.00 13.97 ? 442 ILE A CD1 1 
ATOM   3373  N  N   . ALA A 1 412 ? 10.629  37.191  -1.541  1.00 10.56 ? 443 ALA A N   1 
ATOM   3374  C  CA  . ALA A 1 412 ? 11.614  38.195  -1.969  1.00 13.02 ? 443 ALA A CA  1 
ATOM   3375  C  C   . ALA A 1 412 ? 12.952  37.466  -2.307  1.00 12.42 ? 443 ALA A C   1 
ATOM   3376  O  O   . ALA A 1 412 ? 13.429  37.405  -3.454  1.00 10.27 ? 443 ALA A O   1 
ATOM   3377  C  CB  . ALA A 1 412 ? 11.830  39.201  -0.836  1.00 12.85 ? 443 ALA A CB  1 
ATOM   3378  N  N   . VAL A 1 413 ? 13.460  36.790  -1.286  1.00 12.90 ? 444 VAL A N   1 
ATOM   3379  C  CA  . VAL A 1 413 ? 14.679  36.025  -1.341  1.00 10.39 ? 444 VAL A CA  1 
ATOM   3380  C  C   . VAL A 1 413 ? 14.350  34.734  -2.070  1.00 10.59 ? 444 VAL A C   1 
ATOM   3381  O  O   . VAL A 1 413 ? 14.945  33.690  -1.799  1.00 8.68  ? 444 VAL A O   1 
ATOM   3382  C  CB  . VAL A 1 413 ? 15.113  35.720  0.105   1.00 10.27 ? 444 VAL A CB  1 
ATOM   3383  C  CG1 . VAL A 1 413 ? 16.436  35.017  0.136   1.00 11.72 ? 444 VAL A CG1 1 
ATOM   3384  C  CG2 . VAL A 1 413 ? 15.186  37.016  0.908   1.00 10.08 ? 444 VAL A CG2 1 
ATOM   3385  N  N   . GLN A 1 414 ? 13.392  34.801  -2.995  1.00 12.66 ? 445 GLN A N   1 
ATOM   3386  C  CA  . GLN A 1 414 ? 12.971  33.618  -3.743  1.00 16.08 ? 445 GLN A CA  1 
ATOM   3387  C  C   . GLN A 1 414 ? 13.952  33.428  -4.873  1.00 14.97 ? 445 GLN A C   1 
ATOM   3388  O  O   . GLN A 1 414 ? 14.334  32.301  -5.199  1.00 16.82 ? 445 GLN A O   1 
ATOM   3389  C  CB  . GLN A 1 414 ? 11.544  33.748  -4.305  1.00 18.41 ? 445 GLN A CB  1 
ATOM   3390  C  CG  . GLN A 1 414 ? 11.443  34.676  -5.498  1.00 23.40 ? 445 GLN A CG  1 
ATOM   3391  C  CD  . GLN A 1 414 ? 10.295  34.355  -6.422  1.00 23.59 ? 445 GLN A CD  1 
ATOM   3392  O  OE1 . GLN A 1 414 ? 9.855   33.200  -6.525  1.00 24.38 ? 445 GLN A OE1 1 
ATOM   3393  N  NE2 . GLN A 1 414 ? 9.834   35.370  -7.144  1.00 23.56 ? 445 GLN A NE2 1 
ATOM   3394  N  N   . ALA A 1 415 ? 14.380  34.546  -5.444  1.00 13.62 ? 446 ALA A N   1 
ATOM   3395  C  CA  . ALA A 1 415 ? 15.351  34.538  -6.535  1.00 12.96 ? 446 ALA A CA  1 
ATOM   3396  C  C   . ALA A 1 415 ? 16.583  33.735  -6.090  1.00 9.59  ? 446 ALA A C   1 
ATOM   3397  O  O   . ALA A 1 415 ? 17.187  32.976  -6.869  1.00 7.24  ? 446 ALA A O   1 
ATOM   3398  C  CB  . ALA A 1 415 ? 15.746  35.979  -6.855  1.00 14.30 ? 446 ALA A CB  1 
ATOM   3399  N  N   . VAL A 1 416 ? 16.879  33.896  -4.805  1.00 4.06  ? 447 VAL A N   1 
ATOM   3400  C  CA  . VAL A 1 416 ? 17.971  33.261  -4.145  1.00 3.39  ? 447 VAL A CA  1 
ATOM   3401  C  C   . VAL A 1 416 ? 17.806  31.730  -4.119  1.00 6.17  ? 447 VAL A C   1 
ATOM   3402  O  O   . VAL A 1 416 ? 18.489  31.021  -4.854  1.00 9.26  ? 447 VAL A O   1 
ATOM   3403  C  CB  . VAL A 1 416 ? 18.101  33.825  -2.733  1.00 2.51  ? 447 VAL A CB  1 
ATOM   3404  C  CG1 . VAL A 1 416 ? 19.167  33.110  -1.968  1.00 4.30  ? 447 VAL A CG1 1 
ATOM   3405  C  CG2 . VAL A 1 416 ? 18.407  35.277  -2.795  1.00 2.00  ? 447 VAL A CG2 1 
ATOM   3406  N  N   . ALA A 1 417 ? 16.895  31.209  -3.306  1.00 5.93  ? 448 ALA A N   1 
ATOM   3407  C  CA  . ALA A 1 417 ? 16.694  29.762  -3.215  1.00 5.06  ? 448 ALA A CA  1 
ATOM   3408  C  C   . ALA A 1 417 ? 16.591  29.038  -4.561  1.00 3.10  ? 448 ALA A C   1 
ATOM   3409  O  O   . ALA A 1 417 ? 16.811  27.823  -4.650  1.00 2.00  ? 448 ALA A O   1 
ATOM   3410  C  CB  . ALA A 1 417 ? 15.480  29.467  -2.374  1.00 5.15  ? 448 ALA A CB  1 
ATOM   3411  N  N   . LYS A 1 418 ? 16.197  29.771  -5.591  1.00 2.00  ? 449 LYS A N   1 
ATOM   3412  C  CA  . LYS A 1 418 ? 16.089  29.200  -6.920  1.00 2.00  ? 449 LYS A CA  1 
ATOM   3413  C  C   . LYS A 1 418 ? 17.514  28.998  -7.350  1.00 2.36  ? 449 LYS A C   1 
ATOM   3414  O  O   . LYS A 1 418 ? 17.914  27.904  -7.755  1.00 2.00  ? 449 LYS A O   1 
ATOM   3415  C  CB  . LYS A 1 418 ? 15.406  30.170  -7.869  1.00 2.00  ? 449 LYS A CB  1 
ATOM   3416  C  CG  . LYS A 1 418 ? 14.636  29.508  -8.995  1.00 2.00  ? 449 LYS A CG  1 
ATOM   3417  C  CD  . LYS A 1 418 ? 15.359  29.507  -10.328 1.00 2.00  ? 449 LYS A CD  1 
ATOM   3418  C  CE  . LYS A 1 418 ? 14.473  28.880  -11.376 1.00 2.00  ? 449 LYS A CE  1 
ATOM   3419  N  NZ  . LYS A 1 418 ? 15.083  28.630  -12.708 1.00 2.82  ? 449 LYS A NZ  1 
ATOM   3420  N  N   . ALA A 1 419 ? 18.278  30.081  -7.262  1.00 4.16  ? 450 ALA A N   1 
ATOM   3421  C  CA  . ALA A 1 419 ? 19.682  30.053  -7.595  1.00 4.34  ? 450 ALA A CA  1 
ATOM   3422  C  C   . ALA A 1 419 ? 20.330  28.904  -6.810  1.00 4.13  ? 450 ALA A C   1 
ATOM   3423  O  O   . ALA A 1 419 ? 20.862  27.976  -7.399  1.00 4.82  ? 450 ALA A O   1 
ATOM   3424  C  CB  . ALA A 1 419 ? 20.308  31.350  -7.235  1.00 4.98  ? 450 ALA A CB  1 
ATOM   3425  N  N   . SER A 1 420 ? 20.214  28.908  -5.493  1.00 2.00  ? 451 SER A N   1 
ATOM   3426  C  CA  . SER A 1 420 ? 20.793  27.836  -4.706  1.00 3.41  ? 451 SER A CA  1 
ATOM   3427  C  C   . SER A 1 420 ? 20.508  26.485  -5.304  1.00 5.70  ? 451 SER A C   1 
ATOM   3428  O  O   . SER A 1 420 ? 21.377  25.626  -5.323  1.00 9.78  ? 451 SER A O   1 
ATOM   3429  C  CB  . SER A 1 420 ? 20.256  27.841  -3.295  1.00 3.17  ? 451 SER A CB  1 
ATOM   3430  O  OG  . SER A 1 420 ? 20.715  28.977  -2.615  1.00 12.18 ? 451 SER A OG  1 
ATOM   3431  N  N   . ILE A 1 421 ? 19.308  26.302  -5.827  1.00 7.68  ? 452 ILE A N   1 
ATOM   3432  C  CA  . ILE A 1 421 ? 18.956  25.035  -6.420  1.00 7.96  ? 452 ILE A CA  1 
ATOM   3433  C  C   . ILE A 1 421 ? 19.746  24.848  -7.686  1.00 6.78  ? 452 ILE A C   1 
ATOM   3434  O  O   . ILE A 1 421 ? 20.408  23.850  -7.829  1.00 8.80  ? 452 ILE A O   1 
ATOM   3435  C  CB  . ILE A 1 421 ? 17.432  24.937  -6.687  1.00 12.70 ? 452 ILE A CB  1 
ATOM   3436  C  CG1 . ILE A 1 421 ? 16.697  24.749  -5.349  1.00 13.48 ? 452 ILE A CG1 1 
ATOM   3437  C  CG2 . ILE A 1 421 ? 17.117  23.811  -7.683  1.00 11.23 ? 452 ILE A CG2 1 
ATOM   3438  C  CD1 . ILE A 1 421 ? 15.219  24.681  -5.469  1.00 15.58 ? 452 ILE A CD1 1 
ATOM   3439  N  N   . ASP A 1 422 ? 19.771  25.860  -8.537  1.00 5.49  ? 453 ASP A N   1 
ATOM   3440  C  CA  . ASP A 1 422 ? 20.484  25.801  -9.809  1.00 6.12  ? 453 ASP A CA  1 
ATOM   3441  C  C   . ASP A 1 422 ? 21.975  25.676  -9.753  1.00 3.87  ? 453 ASP A C   1 
ATOM   3442  O  O   . ASP A 1 422 ? 22.573  25.204  -10.707 1.00 2.05  ? 453 ASP A O   1 
ATOM   3443  C  CB  . ASP A 1 422 ? 20.219  27.053  -10.626 1.00 13.14 ? 453 ASP A CB  1 
ATOM   3444  C  CG  . ASP A 1 422 ? 18.786  27.211  -11.002 1.00 12.42 ? 453 ASP A CG  1 
ATOM   3445  O  OD1 . ASP A 1 422 ? 18.193  26.215  -11.459 1.00 16.50 ? 453 ASP A OD1 1 
ATOM   3446  O  OD2 . ASP A 1 422 ? 18.271  28.333  -10.857 1.00 10.98 ? 453 ASP A OD2 1 
ATOM   3447  N  N   . GLN A 1 423 ? 22.575  26.258  -8.722  1.00 5.19  ? 454 GLN A N   1 
ATOM   3448  C  CA  . GLN A 1 423 ? 24.021  26.220  -8.561  1.00 4.75  ? 454 GLN A CA  1 
ATOM   3449  C  C   . GLN A 1 423 ? 24.479  24.857  -8.100  1.00 4.22  ? 454 GLN A C   1 
ATOM   3450  O  O   . GLN A 1 423 ? 25.281  24.238  -8.799  1.00 4.71  ? 454 GLN A O   1 
ATOM   3451  C  CB  . GLN A 1 423 ? 24.511  27.334  -7.647  1.00 5.15  ? 454 GLN A CB  1 
ATOM   3452  C  CG  . GLN A 1 423 ? 24.389  28.694  -8.303  1.00 3.08  ? 454 GLN A CG  1 
ATOM   3453  C  CD  . GLN A 1 423 ? 24.849  29.805  -7.402  1.00 6.19  ? 454 GLN A CD  1 
ATOM   3454  O  OE1 . GLN A 1 423 ? 25.157  30.905  -7.875  1.00 7.54  ? 454 GLN A OE1 1 
ATOM   3455  N  NE2 . GLN A 1 423 ? 24.928  29.528  -6.090  1.00 4.19  ? 454 GLN A NE2 1 
ATOM   3456  N  N   . SER A 1 424 ? 23.936  24.347  -6.993  1.00 2.00  ? 455 SER A N   1 
ATOM   3457  C  CA  . SER A 1 424 ? 24.314  23.007  -6.554  1.00 3.04  ? 455 SER A CA  1 
ATOM   3458  C  C   . SER A 1 424 ? 24.192  22.029  -7.725  1.00 3.27  ? 455 SER A C   1 
ATOM   3459  O  O   . SER A 1 424 ? 24.892  21.022  -7.793  1.00 2.00  ? 455 SER A O   1 
ATOM   3460  C  CB  . SER A 1 424 ? 23.436  22.548  -5.406  1.00 5.53  ? 455 SER A CB  1 
ATOM   3461  O  OG  . SER A 1 424 ? 23.749  23.253  -4.209  1.00 11.76 ? 455 SER A OG  1 
ATOM   3462  N  N   . ARG A 1 425 ? 23.304  22.368  -8.655  1.00 6.94  ? 456 ARG A N   1 
ATOM   3463  C  CA  . ARG A 1 425 ? 23.056  21.611  -9.886  1.00 8.23  ? 456 ARG A CA  1 
ATOM   3464  C  C   . ARG A 1 425 ? 24.298  21.682  -10.738 1.00 7.73  ? 456 ARG A C   1 
ATOM   3465  O  O   . ARG A 1 425 ? 24.783  20.652  -11.160 1.00 11.50 ? 456 ARG A O   1 
ATOM   3466  C  CB  . ARG A 1 425 ? 21.924  22.235  -10.734 1.00 11.12 ? 456 ARG A CB  1 
ATOM   3467  C  CG  . ARG A 1 425 ? 20.495  22.140  -10.198 1.00 15.88 ? 456 ARG A CG  1 
ATOM   3468  C  CD  . ARG A 1 425 ? 19.781  20.848  -10.577 1.00 14.11 ? 456 ARG A CD  1 
ATOM   3469  N  NE  . ARG A 1 425 ? 18.520  20.715  -9.849  1.00 11.54 ? 456 ARG A NE  1 
ATOM   3470  C  CZ  . ARG A 1 425 ? 17.320  20.983  -10.350 1.00 9.31  ? 456 ARG A CZ  1 
ATOM   3471  N  NH1 . ARG A 1 425 ? 17.184  21.415  -11.595 1.00 9.02  ? 456 ARG A NH1 1 
ATOM   3472  N  NH2 . ARG A 1 425 ? 16.246  20.781  -9.608  1.00 6.29  ? 456 ARG A NH2 1 
ATOM   3473  N  N   . GLU A 1 426 ? 24.779  22.897  -11.022 1.00 7.22  ? 457 GLU A N   1 
ATOM   3474  C  CA  . GLU A 1 426 ? 25.956  23.091  -11.869 1.00 9.96  ? 457 GLU A CA  1 
ATOM   3475  C  C   . GLU A 1 426 ? 27.256  22.645  -11.216 1.00 7.87  ? 457 GLU A C   1 
ATOM   3476  O  O   . GLU A 1 426 ? 28.159  22.124  -11.863 1.00 4.57  ? 457 GLU A O   1 
ATOM   3477  C  CB  . GLU A 1 426 ? 26.039  24.525  -12.389 1.00 14.73 ? 457 GLU A CB  1 
ATOM   3478  C  CG  . GLU A 1 426 ? 25.929  25.613  -11.341 1.00 28.08 ? 457 GLU A CG  1 
ATOM   3479  C  CD  . GLU A 1 426 ? 25.848  27.023  -11.950 1.00 37.42 ? 457 GLU A CD  1 
ATOM   3480  O  OE1 . GLU A 1 426 ? 26.377  27.242  -13.077 1.00 40.73 ? 457 GLU A OE1 1 
ATOM   3481  O  OE2 . GLU A 1 426 ? 25.253  27.916  -11.291 1.00 42.66 ? 457 GLU A OE2 1 
ATOM   3482  N  N   . MET A 1 427 ? 27.293  22.733  -9.905  1.00 5.72  ? 458 MET A N   1 
ATOM   3483  C  CA  . MET A 1 427 ? 28.453  22.299  -9.178  1.00 5.73  ? 458 MET A CA  1 
ATOM   3484  C  C   . MET A 1 427 ? 28.411  20.774  -9.087  1.00 6.11  ? 458 MET A C   1 
ATOM   3485  O  O   . MET A 1 427 ? 29.079  20.186  -8.227  1.00 6.71  ? 458 MET A O   1 
ATOM   3486  C  CB  . MET A 1 427 ? 28.431  22.907  -7.774  1.00 5.37  ? 458 MET A CB  1 
ATOM   3487  C  CG  . MET A 1 427 ? 28.280  24.397  -7.805  1.00 4.15  ? 458 MET A CG  1 
ATOM   3488  S  SD  . MET A 1 427 ? 29.322  25.212  -6.654  1.00 8.87  ? 458 MET A SD  1 
ATOM   3489  C  CE  . MET A 1 427 ? 28.674  24.577  -5.100  1.00 9.32  ? 458 MET A CE  1 
ATOM   3490  N  N   . LYS A 1 428 ? 27.611  20.153  -9.960  1.00 3.99  ? 459 LYS A N   1 
ATOM   3491  C  CA  . LYS A 1 428 ? 27.404  18.705  -10.031 1.00 2.11  ? 459 LYS A CA  1 
ATOM   3492  C  C   . LYS A 1 428 ? 27.378  17.920  -8.734  1.00 2.82  ? 459 LYS A C   1 
ATOM   3493  O  O   . LYS A 1 428 ? 27.963  16.859  -8.662  1.00 4.51  ? 459 LYS A O   1 
ATOM   3494  C  CB  . LYS A 1 428 ? 28.354  18.084  -11.024 1.00 2.00  ? 459 LYS A CB  1 
ATOM   3495  C  CG  . LYS A 1 428 ? 28.196  18.733  -12.365 1.00 5.99  ? 459 LYS A CG  1 
ATOM   3496  C  CD  . LYS A 1 428 ? 28.483  17.788  -13.544 1.00 14.26 ? 459 LYS A CD  1 
ATOM   3497  C  CE  . LYS A 1 428 ? 27.404  16.692  -13.737 1.00 16.05 ? 459 LYS A CE  1 
ATOM   3498  N  NZ  . LYS A 1 428 ? 27.470  15.536  -12.758 1.00 18.47 ? 459 LYS A NZ  1 
ATOM   3499  N  N   . TYR A 1 429 ? 26.688  18.457  -7.722  1.00 5.10  ? 460 TYR A N   1 
ATOM   3500  C  CA  . TYR A 1 429 ? 26.515  17.851  -6.380  1.00 5.37  ? 460 TYR A CA  1 
ATOM   3501  C  C   . TYR A 1 429 ? 25.961  16.408  -6.435  1.00 7.71  ? 460 TYR A C   1 
ATOM   3502  O  O   . TYR A 1 429 ? 25.563  15.904  -7.504  1.00 6.53  ? 460 TYR A O   1 
ATOM   3503  C  CB  . TYR A 1 429 ? 25.494  18.689  -5.586  1.00 6.76  ? 460 TYR A CB  1 
ATOM   3504  C  CG  . TYR A 1 429 ? 26.053  19.733  -4.658  1.00 4.42  ? 460 TYR A CG  1 
ATOM   3505  C  CD1 . TYR A 1 429 ? 26.917  20.720  -5.121  1.00 6.15  ? 460 TYR A CD1 1 
ATOM   3506  C  CD2 . TYR A 1 429 ? 25.760  19.696  -3.292  1.00 3.00  ? 460 TYR A CD2 1 
ATOM   3507  C  CE1 . TYR A 1 429 ? 27.487  21.633  -4.236  1.00 5.62  ? 460 TYR A CE1 1 
ATOM   3508  C  CE2 . TYR A 1 429 ? 26.319  20.599  -2.407  1.00 2.04  ? 460 TYR A CE2 1 
ATOM   3509  C  CZ  . TYR A 1 429 ? 27.187  21.555  -2.878  1.00 3.62  ? 460 TYR A CZ  1 
ATOM   3510  O  OH  . TYR A 1 429 ? 27.825  22.366  -1.978  1.00 2.02  ? 460 TYR A OH  1 
ATOM   3511  N  N   . GLN A 1 430 ? 25.829  15.785  -5.266  1.00 8.91  ? 461 GLN A N   1 
ATOM   3512  C  CA  . GLN A 1 430 ? 25.298  14.416  -5.201  1.00 11.30 ? 461 GLN A CA  1 
ATOM   3513  C  C   . GLN A 1 430 ? 23.978  14.241  -4.453  1.00 12.50 ? 461 GLN A C   1 
ATOM   3514  O  O   . GLN A 1 430 ? 23.448  15.175  -3.857  1.00 15.07 ? 461 GLN A O   1 
ATOM   3515  C  CB  . GLN A 1 430 ? 26.335  13.462  -4.604  1.00 12.58 ? 461 GLN A CB  1 
ATOM   3516  C  CG  . GLN A 1 430 ? 27.068  12.623  -5.636  1.00 11.80 ? 461 GLN A CG  1 
ATOM   3517  C  CD  . GLN A 1 430 ? 28.343  12.061  -5.078  1.00 13.15 ? 461 GLN A CD  1 
ATOM   3518  O  OE1 . GLN A 1 430 ? 28.345  11.057  -4.362  1.00 13.16 ? 461 GLN A OE1 1 
ATOM   3519  N  NE2 . GLN A 1 430 ? 29.445  12.738  -5.361  1.00 15.69 ? 461 GLN A NE2 1 
ATOM   3520  N  N   . SER A 1 431 ? 23.454  13.024  -4.503  1.00 11.54 ? 462 SER A N   1 
ATOM   3521  C  CA  . SER A 1 431 ? 22.213  12.664  -3.839  1.00 10.78 ? 462 SER A CA  1 
ATOM   3522  C  C   . SER A 1 431 ? 22.203  13.007  -2.348  1.00 9.10  ? 462 SER A C   1 
ATOM   3523  O  O   . SER A 1 431 ? 23.211  12.862  -1.665  1.00 11.20 ? 462 SER A O   1 
ATOM   3524  C  CB  . SER A 1 431 ? 21.996  11.151  -4.016  1.00 13.19 ? 462 SER A CB  1 
ATOM   3525  O  OG  . SER A 1 431 ? 21.183  10.583  -2.994  1.00 13.50 ? 462 SER A OG  1 
ATOM   3526  N  N   . LEU A 1 432 ? 21.056  13.434  -1.837  1.00 7.51  ? 463 LEU A N   1 
ATOM   3527  C  CA  . LEU A 1 432 ? 20.933  13.734  -0.411  1.00 6.67  ? 463 LEU A CA  1 
ATOM   3528  C  C   . LEU A 1 432 ? 21.228  12.470  0.400   1.00 7.43  ? 463 LEU A C   1 
ATOM   3529  O  O   . LEU A 1 432 ? 21.714  12.538  1.525   1.00 3.85  ? 463 LEU A O   1 
ATOM   3530  C  CB  . LEU A 1 432 ? 19.511  14.201  -0.063  1.00 6.48  ? 463 LEU A CB  1 
ATOM   3531  C  CG  . LEU A 1 432 ? 19.064  13.970  1.400   1.00 5.73  ? 463 LEU A CG  1 
ATOM   3532  C  CD1 . LEU A 1 432 ? 19.658  15.022  2.335   1.00 4.99  ? 463 LEU A CD1 1 
ATOM   3533  C  CD2 . LEU A 1 432 ? 17.535  13.930  1.514   1.00 3.71  ? 463 LEU A CD2 1 
ATOM   3534  N  N   . ASN A 1 433 ? 20.885  11.312  -0.162  1.00 9.95  ? 464 ASN A N   1 
ATOM   3535  C  CA  . ASN A 1 433 ? 21.090  10.048  0.528   1.00 9.36  ? 464 ASN A CA  1 
ATOM   3536  C  C   . ASN A 1 433 ? 22.554  9.818   0.643   1.00 8.80  ? 464 ASN A C   1 
ATOM   3537  O  O   . ASN A 1 433 ? 23.026  9.421   1.703   1.00 9.07  ? 464 ASN A O   1 
ATOM   3538  C  CB  . ASN A 1 433 ? 20.424  8.885   -0.202  1.00 15.24 ? 464 ASN A CB  1 
ATOM   3539  C  CG  . ASN A 1 433 ? 18.907  8.782   0.083   1.00 19.80 ? 464 ASN A CG  1 
ATOM   3540  O  OD1 . ASN A 1 433 ? 18.091  8.606   -0.836  1.00 20.37 ? 464 ASN A OD1 1 
ATOM   3541  N  ND2 . ASN A 1 433 ? 18.536  8.887   1.351   1.00 18.21 ? 464 ASN A ND2 1 
ATOM   3542  N  N   . GLU A 1 434 ? 23.287  10.114  -0.432  1.00 10.22 ? 465 GLU A N   1 
ATOM   3543  C  CA  . GLU A 1 434 ? 24.745  9.956   -0.434  1.00 8.49  ? 465 GLU A CA  1 
ATOM   3544  C  C   . GLU A 1 434 ? 25.341  10.765  0.709   1.00 4.88  ? 465 GLU A C   1 
ATOM   3545  O  O   . GLU A 1 434 ? 26.029  10.226  1.574   1.00 3.10  ? 465 GLU A O   1 
ATOM   3546  C  CB  . GLU A 1 434 ? 25.340  10.359  -1.781  1.00 10.38 ? 465 GLU A CB  1 
ATOM   3547  C  CG  . GLU A 1 434 ? 24.959  9.407   -2.941  1.00 19.27 ? 465 GLU A CG  1 
ATOM   3548  C  CD  . GLU A 1 434 ? 25.346  7.915   -2.715  1.00 26.35 ? 465 GLU A CD  1 
ATOM   3549  O  OE1 . GLU A 1 434 ? 26.128  7.582   -1.789  1.00 31.04 ? 465 GLU A OE1 1 
ATOM   3550  O  OE2 . GLU A 1 434 ? 24.870  7.058   -3.494  1.00 30.13 ? 465 GLU A OE2 1 
ATOM   3551  N  N   . TYR A 1 435 ? 24.974  12.029  0.790   1.00 2.00  ? 466 TYR A N   1 
ATOM   3552  C  CA  . TYR A 1 435 ? 25.476  12.845  1.874   1.00 3.53  ? 466 TYR A CA  1 
ATOM   3553  C  C   . TYR A 1 435 ? 25.110  12.301  3.246   1.00 5.61  ? 466 TYR A C   1 
ATOM   3554  O  O   . TYR A 1 435 ? 25.880  12.454  4.204   1.00 5.49  ? 466 TYR A O   1 
ATOM   3555  C  CB  . TYR A 1 435 ? 25.002  14.295  1.753   1.00 2.44  ? 466 TYR A CB  1 
ATOM   3556  C  CG  . TYR A 1 435 ? 25.773  15.060  0.734   1.00 3.94  ? 466 TYR A CG  1 
ATOM   3557  C  CD1 . TYR A 1 435 ? 26.957  15.727  1.071   1.00 2.14  ? 466 TYR A CD1 1 
ATOM   3558  C  CD2 . TYR A 1 435 ? 25.353  15.073  -0.590  1.00 4.65  ? 466 TYR A CD2 1 
ATOM   3559  C  CE1 . TYR A 1 435 ? 27.702  16.387  0.093   1.00 5.72  ? 466 TYR A CE1 1 
ATOM   3560  C  CE2 . TYR A 1 435 ? 26.079  15.724  -1.574  1.00 6.23  ? 466 TYR A CE2 1 
ATOM   3561  C  CZ  . TYR A 1 435 ? 27.248  16.379  -1.244  1.00 8.45  ? 466 TYR A CZ  1 
ATOM   3562  O  OH  . TYR A 1 435 ? 27.935  17.002  -2.278  1.00 10.09 ? 466 TYR A OH  1 
ATOM   3563  N  N   . ARG A 1 436 ? 23.932  11.687  3.351   1.00 8.84  ? 467 ARG A N   1 
ATOM   3564  C  CA  . ARG A 1 436 ? 23.478  11.154  4.634   1.00 8.87  ? 467 ARG A CA  1 
ATOM   3565  C  C   . ARG A 1 436 ? 24.379  9.999   5.012   1.00 7.90  ? 467 ARG A C   1 
ATOM   3566  O  O   . ARG A 1 436 ? 24.904  9.959   6.124   1.00 7.43  ? 467 ARG A O   1 
ATOM   3567  C  CB  . ARG A 1 436 ? 21.997  10.740  4.590   1.00 11.49 ? 467 ARG A CB  1 
ATOM   3568  C  CG  . ARG A 1 436 ? 20.990  11.905  4.634   1.00 10.63 ? 467 ARG A CG  1 
ATOM   3569  C  CD  . ARG A 1 436 ? 19.532  11.422  4.652   1.00 11.27 ? 467 ARG A CD  1 
ATOM   3570  N  NE  . ARG A 1 436 ? 19.210  10.570  5.805   1.00 8.09  ? 467 ARG A NE  1 
ATOM   3571  C  CZ  . ARG A 1 436 ? 19.087  11.006  7.063   1.00 7.04  ? 467 ARG A CZ  1 
ATOM   3572  N  NH1 . ARG A 1 436 ? 19.247  12.283  7.355   1.00 5.09  ? 467 ARG A NH1 1 
ATOM   3573  N  NH2 . ARG A 1 436 ? 18.840  10.159  8.049   1.00 3.17  ? 467 ARG A NH2 1 
ATOM   3574  N  N   . LYS A 1 437 ? 24.642  9.124   4.045   1.00 6.40  ? 468 LYS A N   1 
ATOM   3575  C  CA  . LYS A 1 437 ? 25.508  7.976   4.265   1.00 6.26  ? 468 LYS A CA  1 
ATOM   3576  C  C   . LYS A 1 437 ? 26.893  8.499   4.674   1.00 7.04  ? 468 LYS A C   1 
ATOM   3577  O  O   . LYS A 1 437 ? 27.504  8.031   5.646   1.00 5.09  ? 468 LYS A O   1 
ATOM   3578  C  CB  . LYS A 1 437 ? 25.622  7.175   2.975   1.00 2.97  ? 468 LYS A CB  1 
ATOM   3579  C  CG  . LYS A 1 437 ? 24.316  6.838   2.341   1.00 2.02  ? 468 LYS A CG  1 
ATOM   3580  C  CD  . LYS A 1 437 ? 24.477  6.539   0.861   1.00 2.00  ? 468 LYS A CD  1 
ATOM   3581  C  CE  . LYS A 1 437 ? 24.815  5.081   0.584   1.00 3.76  ? 468 LYS A CE  1 
ATOM   3582  N  NZ  . LYS A 1 437 ? 24.933  4.844   -0.879  1.00 2.78  ? 468 LYS A NZ  1 
ATOM   3583  N  N   . ARG A 1 438 ? 27.342  9.527   3.954   1.00 7.59  ? 469 ARG A N   1 
ATOM   3584  C  CA  . ARG A 1 438 ? 28.631  10.151  4.195   1.00 4.50  ? 469 ARG A CA  1 
ATOM   3585  C  C   . ARG A 1 438 ? 28.775  10.562  5.634   1.00 2.00  ? 469 ARG A C   1 
ATOM   3586  O  O   . ARG A 1 438 ? 29.783  10.282  6.260   1.00 2.15  ? 469 ARG A O   1 
ATOM   3587  C  CB  . ARG A 1 438 ? 28.818  11.331  3.253   1.00 4.48  ? 469 ARG A CB  1 
ATOM   3588  C  CG  . ARG A 1 438 ? 30.030  12.172  3.505   1.00 5.15  ? 469 ARG A CG  1 
ATOM   3589  C  CD  . ARG A 1 438 ? 31.326  11.382  3.552   1.00 6.55  ? 469 ARG A CD  1 
ATOM   3590  N  NE  . ARG A 1 438 ? 32.162  11.915  4.622   1.00 4.00  ? 469 ARG A NE  1 
ATOM   3591  C  CZ  . ARG A 1 438 ? 32.873  13.031  4.525   1.00 2.31  ? 469 ARG A CZ  1 
ATOM   3592  N  NH1 . ARG A 1 438 ? 32.883  13.724  3.397   1.00 2.00  ? 469 ARG A NH1 1 
ATOM   3593  N  NH2 . ARG A 1 438 ? 33.462  13.521  5.598   1.00 2.00  ? 469 ARG A NH2 1 
ATOM   3594  N  N   . PHE A 1 439 ? 27.741  11.172  6.183   1.00 2.00  ? 470 PHE A N   1 
ATOM   3595  C  CA  . PHE A 1 439 ? 27.819  11.590  7.576   1.00 3.90  ? 470 PHE A CA  1 
ATOM   3596  C  C   . PHE A 1 439 ? 27.336  10.575  8.577   1.00 3.09  ? 470 PHE A C   1 
ATOM   3597  O  O   . PHE A 1 439 ? 27.025  10.889  9.726   1.00 2.00  ? 470 PHE A O   1 
ATOM   3598  C  CB  . PHE A 1 439 ? 27.217  12.982  7.787   1.00 2.04  ? 470 PHE A CB  1 
ATOM   3599  C  CG  . PHE A 1 439 ? 28.061  14.079  7.199   1.00 2.14  ? 470 PHE A CG  1 
ATOM   3600  C  CD1 . PHE A 1 439 ? 28.207  14.188  5.810   1.00 2.13  ? 470 PHE A CD1 1 
ATOM   3601  C  CD2 . PHE A 1 439 ? 28.774  14.948  8.021   1.00 2.06  ? 470 PHE A CD2 1 
ATOM   3602  C  CE1 . PHE A 1 439 ? 29.062  15.147  5.248   1.00 2.99  ? 470 PHE A CE1 1 
ATOM   3603  C  CE2 . PHE A 1 439 ? 29.642  15.921  7.471   1.00 2.15  ? 470 PHE A CE2 1 
ATOM   3604  C  CZ  . PHE A 1 439 ? 29.787  16.019  6.079   1.00 2.00  ? 470 PHE A CZ  1 
ATOM   3605  N  N   . SER A 1 440 ? 27.406  9.326   8.144   1.00 7.49  ? 471 SER A N   1 
ATOM   3606  C  CA  . SER A 1 440 ? 26.997  8.197   8.957   1.00 12.22 ? 471 SER A CA  1 
ATOM   3607  C  C   . SER A 1 440 ? 25.499  8.244   9.325   1.00 14.27 ? 471 SER A C   1 
ATOM   3608  O  O   . SER A 1 440 ? 25.102  7.895   10.451  1.00 15.12 ? 471 SER A O   1 
ATOM   3609  C  CB  . SER A 1 440 ? 27.851  8.150   10.223  1.00 12.43 ? 471 SER A CB  1 
ATOM   3610  O  OG  . SER A 1 440 ? 29.213  8.230   9.900   1.00 11.79 ? 471 SER A OG  1 
ATOM   3611  N  N   . LEU A 1 441 ? 24.666  8.651   8.375   1.00 13.20 ? 472 LEU A N   1 
ATOM   3612  C  CA  . LEU A 1 441 ? 23.232  8.751   8.631   1.00 13.70 ? 472 LEU A CA  1 
ATOM   3613  C  C   . LEU A 1 441 ? 22.522  7.716   7.762   1.00 16.69 ? 472 LEU A C   1 
ATOM   3614  O  O   . LEU A 1 441 ? 23.047  7.345   6.702   1.00 19.37 ? 472 LEU A O   1 
ATOM   3615  C  CB  . LEU A 1 441 ? 22.727  10.167  8.305   1.00 7.75  ? 472 LEU A CB  1 
ATOM   3616  C  CG  . LEU A 1 441 ? 23.395  11.334  9.037   1.00 5.07  ? 472 LEU A CG  1 
ATOM   3617  C  CD1 . LEU A 1 441 ? 22.694  12.623  8.676   1.00 2.00  ? 472 LEU A CD1 1 
ATOM   3618  C  CD2 . LEU A 1 441 ? 23.376  11.109  10.565  1.00 2.02  ? 472 LEU A CD2 1 
ATOM   3619  N  N   . LYS A 1 442 ? 21.386  7.187   8.222   1.00 16.56 ? 473 LYS A N   1 
ATOM   3620  C  CA  . LYS A 1 442 ? 20.676  6.213   7.414   1.00 15.84 ? 473 LYS A CA  1 
ATOM   3621  C  C   . LYS A 1 442 ? 19.838  6.946   6.391   1.00 14.37 ? 473 LYS A C   1 
ATOM   3622  O  O   . LYS A 1 442 ? 19.169  7.918   6.711   1.00 13.95 ? 473 LYS A O   1 
ATOM   3623  C  CB  . LYS A 1 442 ? 19.819  5.301   8.275   1.00 21.44 ? 473 LYS A CB  1 
ATOM   3624  C  CG  . LYS A 1 442 ? 20.616  4.120   8.845   1.00 28.85 ? 473 LYS A CG  1 
ATOM   3625  C  CD  . LYS A 1 442 ? 19.720  3.039   9.519   1.00 33.41 ? 473 LYS A CD  1 
ATOM   3626  C  CE  . LYS A 1 442 ? 20.509  1.759   9.940   1.00 29.65 ? 473 LYS A CE  1 
ATOM   3627  N  NZ  . LYS A 1 442 ? 21.115  1.063   8.762   1.00 30.45 ? 473 LYS A NZ  1 
ATOM   3628  N  N   . PRO A 1 443 ? 19.949  6.558   5.120   1.00 13.32 ? 474 PRO A N   1 
ATOM   3629  C  CA  . PRO A 1 443 ? 19.170  7.218   4.066   1.00 14.66 ? 474 PRO A CA  1 
ATOM   3630  C  C   . PRO A 1 443 ? 17.621  7.104   4.152   1.00 15.87 ? 474 PRO A C   1 
ATOM   3631  O  O   . PRO A 1 443 ? 17.055  6.126   4.665   1.00 15.50 ? 474 PRO A O   1 
ATOM   3632  C  CB  . PRO A 1 443 ? 19.749  6.610   2.774   1.00 11.03 ? 474 PRO A CB  1 
ATOM   3633  C  CG  . PRO A 1 443 ? 20.326  5.318   3.206   1.00 10.48 ? 474 PRO A CG  1 
ATOM   3634  C  CD  . PRO A 1 443 ? 20.933  5.628   4.549   1.00 10.99 ? 474 PRO A CD  1 
ATOM   3635  N  N   . TYR A 1 444 ? 16.952  8.160   3.694   1.00 14.76 ? 475 TYR A N   1 
ATOM   3636  C  CA  . TYR A 1 444 ? 15.498  8.215   3.662   1.00 8.97  ? 475 TYR A CA  1 
ATOM   3637  C  C   . TYR A 1 444 ? 14.956  7.245   2.656   1.00 7.71  ? 475 TYR A C   1 
ATOM   3638  O  O   . TYR A 1 444 ? 15.320  7.274   1.478   1.00 3.08  ? 475 TYR A O   1 
ATOM   3639  C  CB  . TYR A 1 444 ? 15.024  9.611   3.299   1.00 4.93  ? 475 TYR A CB  1 
ATOM   3640  C  CG  . TYR A 1 444 ? 15.268  10.573  4.400   1.00 2.00  ? 475 TYR A CG  1 
ATOM   3641  C  CD1 . TYR A 1 444 ? 15.193  10.156  5.716   1.00 2.00  ? 475 TYR A CD1 1 
ATOM   3642  C  CD2 . TYR A 1 444 ? 15.564  11.897  4.141   1.00 2.31  ? 475 TYR A CD2 1 
ATOM   3643  C  CE1 . TYR A 1 444 ? 15.400  11.028  6.762   1.00 2.02  ? 475 TYR A CE1 1 
ATOM   3644  C  CE2 . TYR A 1 444 ? 15.780  12.792  5.185   1.00 3.21  ? 475 TYR A CE2 1 
ATOM   3645  C  CZ  . TYR A 1 444 ? 15.690  12.343  6.498   1.00 2.31  ? 475 TYR A CZ  1 
ATOM   3646  O  OH  . TYR A 1 444 ? 15.866  13.199  7.558   1.00 3.91  ? 475 TYR A OH  1 
ATOM   3647  N  N   . THR A 1 445 ? 14.059  6.399   3.142   1.00 10.85 ? 476 THR A N   1 
ATOM   3648  C  CA  . THR A 1 445 ? 13.402  5.371   2.329   1.00 11.52 ? 476 THR A CA  1 
ATOM   3649  C  C   . THR A 1 445 ? 12.252  5.875   1.424   1.00 12.30 ? 476 THR A C   1 
ATOM   3650  O  O   . THR A 1 445 ? 11.876  5.202   0.465   1.00 11.41 ? 476 THR A O   1 
ATOM   3651  C  CB  . THR A 1 445 ? 12.878  4.220   3.242   1.00 8.07  ? 476 THR A CB  1 
ATOM   3652  O  OG1 . THR A 1 445 ? 12.537  4.742   4.532   1.00 7.28  ? 476 THR A OG1 1 
ATOM   3653  C  CG2 . THR A 1 445 ? 13.921  3.153   3.425   1.00 5.26  ? 476 THR A CG2 1 
ATOM   3654  N  N   . SER A 1 446 ? 11.749  7.081   1.698   1.00 13.52 ? 477 SER A N   1 
ATOM   3655  C  CA  . SER A 1 446 ? 10.631  7.666   0.961   1.00 9.71  ? 477 SER A CA  1 
ATOM   3656  C  C   . SER A 1 446 ? 10.586  9.179   1.180   1.00 9.37  ? 477 SER A C   1 
ATOM   3657  O  O   . SER A 1 446 ? 10.884  9.657   2.284   1.00 6.82  ? 477 SER A O   1 
ATOM   3658  C  CB  . SER A 1 446 ? 9.361   7.077   1.542   1.00 12.48 ? 477 SER A CB  1 
ATOM   3659  O  OG  . SER A 1 446 ? 9.404   7.126   2.974   1.00 14.01 ? 477 SER A OG  1 
ATOM   3660  N  N   . PHE A 1 447 ? 10.139  9.926   0.168   1.00 8.55  ? 478 PHE A N   1 
ATOM   3661  C  CA  . PHE A 1 447 ? 10.042  11.390  0.285   1.00 8.29  ? 478 PHE A CA  1 
ATOM   3662  C  C   . PHE A 1 447 ? 9.201   11.680  1.488   1.00 11.06 ? 478 PHE A C   1 
ATOM   3663  O  O   . PHE A 1 447 ? 9.286   12.730  2.107   1.00 14.78 ? 478 PHE A O   1 
ATOM   3664  C  CB  . PHE A 1 447 ? 9.318   11.977  -0.894  1.00 4.57  ? 478 PHE A CB  1 
ATOM   3665  C  CG  . PHE A 1 447 ? 9.970   11.704  -2.170  1.00 4.87  ? 478 PHE A CG  1 
ATOM   3666  C  CD1 . PHE A 1 447 ? 10.020  10.421  -2.669  1.00 3.63  ? 478 PHE A CD1 1 
ATOM   3667  C  CD2 . PHE A 1 447 ? 10.535  12.743  -2.897  1.00 7.56  ? 478 PHE A CD2 1 
ATOM   3668  C  CE1 . PHE A 1 447 ? 10.624  10.169  -3.886  1.00 8.67  ? 478 PHE A CE1 1 
ATOM   3669  C  CE2 . PHE A 1 447 ? 11.147  12.512  -4.118  1.00 6.99  ? 478 PHE A CE2 1 
ATOM   3670  C  CZ  . PHE A 1 447 ? 11.194  11.218  -4.622  1.00 9.87  ? 478 PHE A CZ  1 
ATOM   3671  N  N   . GLU A 1 448 ? 8.363   10.708  1.777   1.00 14.24 ? 479 GLU A N   1 
ATOM   3672  C  CA  . GLU A 1 448 ? 7.437   10.719  2.868   1.00 17.73 ? 479 GLU A CA  1 
ATOM   3673  C  C   . GLU A 1 448 ? 8.208   10.627  4.191   1.00 18.93 ? 479 GLU A C   1 
ATOM   3674  O  O   . GLU A 1 448 ? 7.880   11.325  5.157   1.00 21.67 ? 479 GLU A O   1 
ATOM   3675  C  CB  . GLU A 1 448 ? 6.489   9.542   2.637   1.00 18.13 ? 479 GLU A CB  1 
ATOM   3676  C  CG  . GLU A 1 448 ? 5.694   9.624   1.276   1.00 22.20 ? 479 GLU A CG  1 
ATOM   3677  C  CD  . GLU A 1 448 ? 6.501   9.384   -0.049  1.00 23.95 ? 479 GLU A CD  1 
ATOM   3678  O  OE1 . GLU A 1 448 ? 7.388   8.509   -0.090  1.00 25.82 ? 479 GLU A OE1 1 
ATOM   3679  O  OE2 . GLU A 1 448 ? 6.212   10.038  -1.089  1.00 21.61 ? 479 GLU A OE2 1 
ATOM   3680  N  N   . GLU A 1 449 ? 9.263   9.809   4.210   1.00 18.52 ? 480 GLU A N   1 
ATOM   3681  C  CA  . GLU A 1 449 ? 10.099  9.645   5.398   1.00 17.62 ? 480 GLU A CA  1 
ATOM   3682  C  C   . GLU A 1 449 ? 10.858  10.930  5.695   1.00 14.21 ? 480 GLU A C   1 
ATOM   3683  O  O   . GLU A 1 449 ? 11.038  11.297  6.862   1.00 13.54 ? 480 GLU A O   1 
ATOM   3684  C  CB  . GLU A 1 449 ? 11.094  8.489   5.222   1.00 20.94 ? 480 GLU A CB  1 
ATOM   3685  C  CG  . GLU A 1 449 ? 12.212  8.552   6.265   1.00 29.76 ? 480 GLU A CG  1 
ATOM   3686  C  CD  . GLU A 1 449 ? 12.986  7.248   6.481   1.00 33.65 ? 480 GLU A CD  1 
ATOM   3687  O  OE1 . GLU A 1 449 ? 12.465  6.392   7.239   1.00 35.64 ? 480 GLU A OE1 1 
ATOM   3688  O  OE2 . GLU A 1 449 ? 14.134  7.110   5.961   1.00 32.53 ? 480 GLU A OE2 1 
ATOM   3689  N  N   . LEU A 1 450 ? 11.294  11.591  4.622   1.00 11.79 ? 481 LEU A N   1 
ATOM   3690  C  CA  . LEU A 1 450 ? 12.041  12.847  4.681   1.00 8.56  ? 481 LEU A CA  1 
ATOM   3691  C  C   . LEU A 1 450 ? 11.233  13.960  5.288   1.00 9.28  ? 481 LEU A C   1 
ATOM   3692  O  O   . LEU A 1 450 ? 11.691  14.607  6.225   1.00 9.29  ? 481 LEU A O   1 
ATOM   3693  C  CB  . LEU A 1 450 ? 12.500  13.260  3.282   1.00 4.57  ? 481 LEU A CB  1 
ATOM   3694  C  CG  . LEU A 1 450 ? 12.904  14.694  2.976   1.00 2.00  ? 481 LEU A CG  1 
ATOM   3695  C  CD1 . LEU A 1 450 ? 14.198  15.082  3.626   1.00 2.00  ? 481 LEU A CD1 1 
ATOM   3696  C  CD2 . LEU A 1 450 ? 13.028  14.832  1.476   1.00 4.22  ? 481 LEU A CD2 1 
ATOM   3697  N  N   . THR A 1 451 ? 10.016  14.152  4.786   1.00 10.20 ? 482 THR A N   1 
ATOM   3698  C  CA  . THR A 1 451 ? 9.145   15.229  5.267   1.00 12.51 ? 482 THR A CA  1 
ATOM   3699  C  C   . THR A 1 451 ? 8.453   15.018  6.615   1.00 13.07 ? 482 THR A C   1 
ATOM   3700  O  O   . THR A 1 451 ? 8.314   15.965  7.408   1.00 11.10 ? 482 THR A O   1 
ATOM   3701  C  CB  . THR A 1 451 ? 8.063   15.568  4.239   1.00 14.26 ? 482 THR A CB  1 
ATOM   3702  O  OG1 . THR A 1 451 ? 7.275   14.397  3.983   1.00 18.14 ? 482 THR A OG1 1 
ATOM   3703  C  CG2 . THR A 1 451 ? 8.685   16.077  2.931   1.00 14.23 ? 482 THR A CG2 1 
ATOM   3704  N  N   . GLY A 1 452 ? 7.992   13.790  6.855   1.00 14.02 ? 483 GLY A N   1 
ATOM   3705  C  CA  . GLY A 1 452 ? 7.283   13.477  8.091   1.00 14.83 ? 483 GLY A CA  1 
ATOM   3706  C  C   . GLY A 1 452 ? 5.799   13.778  7.914   1.00 14.42 ? 483 GLY A C   1 
ATOM   3707  O  O   . GLY A 1 452 ? 4.966   13.361  8.712   1.00 14.26 ? 483 GLY A O   1 
ATOM   3708  N  N   . GLU A 1 453 ? 5.483   14.557  6.885   1.00 11.71 ? 484 GLU A N   1 
ATOM   3709  C  CA  . GLU A 1 453 ? 4.125   14.911  6.574   1.00 10.14 ? 484 GLU A CA  1 
ATOM   3710  C  C   . GLU A 1 453 ? 3.834   14.200  5.268   1.00 11.40 ? 484 GLU A C   1 
ATOM   3711  O  O   . GLU A 1 453 ? 4.611   13.330  4.869   1.00 12.92 ? 484 GLU A O   1 
ATOM   3712  C  CB  . GLU A 1 453 ? 3.994   16.423  6.438   1.00 9.49  ? 484 GLU A CB  1 
ATOM   3713  C  CG  . GLU A 1 453 ? 4.886   17.054  5.404   1.00 11.61 ? 484 GLU A CG  1 
ATOM   3714  C  CD  . GLU A 1 453 ? 4.278   17.090  3.999   1.00 11.60 ? 484 GLU A CD  1 
ATOM   3715  O  OE1 . GLU A 1 453 ? 3.360   17.918  3.752   1.00 9.58  ? 484 GLU A OE1 1 
ATOM   3716  O  OE2 . GLU A 1 453 ? 4.745   16.299  3.151   1.00 5.72  ? 484 GLU A OE2 1 
ATOM   3717  N  N   . LYS A 1 454 ? 2.751   14.558  4.576   1.00 10.78 ? 485 LYS A N   1 
ATOM   3718  C  CA  . LYS A 1 454 ? 2.460   13.855  3.336   1.00 9.21  ? 485 LYS A CA  1 
ATOM   3719  C  C   . LYS A 1 454 ? 2.062   14.644  2.121   1.00 6.57  ? 485 LYS A C   1 
ATOM   3720  O  O   . LYS A 1 454 ? 2.092   14.110  1.006   1.00 3.41  ? 485 LYS A O   1 
ATOM   3721  C  CB  . LYS A 1 454 ? 1.447   12.733  3.570   1.00 15.29 ? 485 LYS A CB  1 
ATOM   3722  C  CG  . LYS A 1 454 ? 2.038   11.308  3.583   1.00 13.60 ? 485 LYS A CG  1 
ATOM   3723  C  CD  . LYS A 1 454 ? 2.679   10.922  2.256   1.00 10.31 ? 485 LYS A CD  1 
ATOM   3724  C  CE  . LYS A 1 454 ? 2.743   9.422   2.136   1.00 11.05 ? 485 LYS A CE  1 
ATOM   3725  N  NZ  . LYS A 1 454 ? 3.460   8.790   3.271   1.00 14.36 ? 485 LYS A NZ  1 
ATOM   3726  N  N   . GLU A 1 455 ? 1.662   15.891  2.313   1.00 7.60  ? 486 GLU A N   1 
ATOM   3727  C  CA  . GLU A 1 455 ? 1.293   16.697  1.165   1.00 11.69 ? 486 GLU A CA  1 
ATOM   3728  C  C   . GLU A 1 455 ? 2.532   16.959  0.307   1.00 14.69 ? 486 GLU A C   1 
ATOM   3729  O  O   . GLU A 1 455 ? 2.561   16.598  -0.877  1.00 16.26 ? 486 GLU A O   1 
ATOM   3730  C  CB  . GLU A 1 455 ? 0.685   18.011  1.605   1.00 14.08 ? 486 GLU A CB  1 
ATOM   3731  C  CG  . GLU A 1 455 ? 0.108   18.812  0.436   1.00 20.83 ? 486 GLU A CG  1 
ATOM   3732  C  CD  . GLU A 1 455 ? -0.674  20.042  0.893   1.00 24.35 ? 486 GLU A CD  1 
ATOM   3733  O  OE1 . GLU A 1 455 ? -1.629  19.876  1.702   1.00 27.69 ? 486 GLU A OE1 1 
ATOM   3734  O  OE2 . GLU A 1 455 ? -0.335  21.170  0.452   1.00 24.97 ? 486 GLU A OE2 1 
ATOM   3735  N  N   . MET A 1 456 ? 3.553   17.570  0.920   1.00 14.61 ? 487 MET A N   1 
ATOM   3736  C  CA  . MET A 1 456 ? 4.825   17.877  0.256   1.00 11.70 ? 487 MET A CA  1 
ATOM   3737  C  C   . MET A 1 456 ? 5.500   16.610  -0.210  1.00 8.71  ? 487 MET A C   1 
ATOM   3738  O  O   . MET A 1 456 ? 5.896   16.500  -1.352  1.00 2.40  ? 487 MET A O   1 
ATOM   3739  C  CB  . MET A 1 456 ? 5.761   18.603  1.209   1.00 11.86 ? 487 MET A CB  1 
ATOM   3740  C  CG  . MET A 1 456 ? 5.207   19.896  1.700   1.00 14.79 ? 487 MET A CG  1 
ATOM   3741  S  SD  . MET A 1 456 ? 6.387   20.804  2.664   1.00 18.35 ? 487 MET A SD  1 
ATOM   3742  C  CE  . MET A 1 456 ? 6.580   19.797  4.087   1.00 10.24 ? 487 MET A CE  1 
ATOM   3743  N  N   . ALA A 1 457 ? 5.631   15.664  0.706   1.00 8.06  ? 488 ALA A N   1 
ATOM   3744  C  CA  . ALA A 1 457 ? 6.235   14.380  0.425   1.00 10.07 ? 488 ALA A CA  1 
ATOM   3745  C  C   . ALA A 1 457 ? 5.746   13.870  -0.930  1.00 11.07 ? 488 ALA A C   1 
ATOM   3746  O  O   . ALA A 1 457 ? 6.523   13.759  -1.881  1.00 11.54 ? 488 ALA A O   1 
ATOM   3747  C  CB  . ALA A 1 457 ? 5.888   13.386  1.539   1.00 5.15  ? 488 ALA A CB  1 
ATOM   3748  N  N   . ALA A 1 458 ? 4.440   13.652  -1.037  1.00 13.62 ? 489 ALA A N   1 
ATOM   3749  C  CA  . ALA A 1 458 ? 3.841   13.151  -2.264  1.00 15.31 ? 489 ALA A CA  1 
ATOM   3750  C  C   . ALA A 1 458 ? 4.017   14.154  -3.400  1.00 14.55 ? 489 ALA A C   1 
ATOM   3751  O  O   . ALA A 1 458 ? 4.126   13.801  -4.582  1.00 8.53  ? 489 ALA A O   1 
ATOM   3752  C  CB  . ALA A 1 458 ? 2.377   12.851  -2.021  1.00 17.90 ? 489 ALA A CB  1 
ATOM   3753  N  N   . GLU A 1 459 ? 4.088   15.417  -3.010  1.00 17.71 ? 490 GLU A N   1 
ATOM   3754  C  CA  . GLU A 1 459 ? 4.267   16.509  -3.955  1.00 18.07 ? 490 GLU A CA  1 
ATOM   3755  C  C   . GLU A 1 459 ? 5.682   16.446  -4.541  1.00 16.64 ? 490 GLU A C   1 
ATOM   3756  O  O   . GLU A 1 459 ? 5.863   16.663  -5.742  1.00 17.13 ? 490 GLU A O   1 
ATOM   3757  C  CB  . GLU A 1 459 ? 3.987   17.857  -3.271  1.00 18.34 ? 490 GLU A CB  1 
ATOM   3758  C  CG  . GLU A 1 459 ? 4.247   19.039  -4.138  1.00 21.68 ? 490 GLU A CG  1 
ATOM   3759  C  CD  . GLU A 1 459 ? 3.504   18.974  -5.463  1.00 26.32 ? 490 GLU A CD  1 
ATOM   3760  O  OE1 . GLU A 1 459 ? 3.953   18.269  -6.412  1.00 21.39 ? 490 GLU A OE1 1 
ATOM   3761  O  OE2 . GLU A 1 459 ? 2.471   19.669  -5.559  1.00 31.10 ? 490 GLU A OE2 1 
ATOM   3762  N  N   . LEU A 1 460 ? 6.656   16.060  -3.708  1.00 14.75 ? 491 LEU A N   1 
ATOM   3763  C  CA  . LEU A 1 460 ? 8.053   15.922  -4.117  1.00 10.80 ? 491 LEU A CA  1 
ATOM   3764  C  C   . LEU A 1 460 ? 8.138   14.681  -4.976  1.00 9.55  ? 491 LEU A C   1 
ATOM   3765  O  O   . LEU A 1 460 ? 8.599   14.733  -6.121  1.00 8.61  ? 491 LEU A O   1 
ATOM   3766  C  CB  . LEU A 1 460 ? 8.957   15.725  -2.901  1.00 10.31 ? 491 LEU A CB  1 
ATOM   3767  C  CG  . LEU A 1 460 ? 9.294   16.844  -1.894  1.00 12.64 ? 491 LEU A CG  1 
ATOM   3768  C  CD1 . LEU A 1 460 ? 9.707   16.208  -0.562  1.00 13.00 ? 491 LEU A CD1 1 
ATOM   3769  C  CD2 . LEU A 1 460 ? 10.397  17.793  -2.411  1.00 5.97  ? 491 LEU A CD2 1 
ATOM   3770  N  N   . LYS A 1 461 ? 7.673   13.566  -4.411  1.00 8.79  ? 492 LYS A N   1 
ATOM   3771  C  CA  . LYS A 1 461 ? 7.652   12.265  -5.098  1.00 9.62  ? 492 LYS A CA  1 
ATOM   3772  C  C   . LYS A 1 461 ? 7.182   12.459  -6.538  1.00 9.77  ? 492 LYS A C   1 
ATOM   3773  O  O   . LYS A 1 461 ? 7.694   11.827  -7.457  1.00 9.62  ? 492 LYS A O   1 
ATOM   3774  C  CB  . LYS A 1 461 ? 6.768   11.252  -4.330  1.00 8.12  ? 492 LYS A CB  1 
ATOM   3775  C  CG  . LYS A 1 461 ? 6.222   10.052  -5.135  1.00 8.89  ? 492 LYS A CG  1 
ATOM   3776  C  CD  . LYS A 1 461 ? 7.270   8.967   -5.498  1.00 13.06 ? 492 LYS A CD  1 
ATOM   3777  C  CE  . LYS A 1 461 ? 7.392   7.771   -4.484  1.00 14.16 ? 492 LYS A CE  1 
ATOM   3778  N  NZ  . LYS A 1 461 ? 7.916   8.099   -3.097  1.00 14.11 ? 492 LYS A NZ  1 
ATOM   3779  N  N   . ALA A 1 462 ? 6.292   13.423  -6.734  1.00 10.82 ? 493 ALA A N   1 
ATOM   3780  C  CA  . ALA A 1 462 ? 5.767   13.724  -8.054  1.00 12.59 ? 493 ALA A CA  1 
ATOM   3781  C  C   . ALA A 1 462 ? 6.880   14.038  -9.041  1.00 12.77 ? 493 ALA A C   1 
ATOM   3782  O  O   . ALA A 1 462 ? 6.850   13.597  -10.193 1.00 14.00 ? 493 ALA A O   1 
ATOM   3783  C  CB  . ALA A 1 462 ? 4.821   14.897  -7.970  1.00 14.62 ? 493 ALA A CB  1 
ATOM   3784  N  N   . LEU A 1 463 ? 7.848   14.824  -8.592  1.00 11.89 ? 494 LEU A N   1 
ATOM   3785  C  CA  . LEU A 1 463 ? 8.948   15.213  -9.462  1.00 11.26 ? 494 LEU A CA  1 
ATOM   3786  C  C   . LEU A 1 463 ? 10.232  14.352  -9.340  1.00 10.73 ? 494 LEU A C   1 
ATOM   3787  O  O   . LEU A 1 463 ? 10.777  13.872  -10.355 1.00 7.06  ? 494 LEU A O   1 
ATOM   3788  C  CB  . LEU A 1 463 ? 9.252   16.708  -9.262  1.00 8.64  ? 494 LEU A CB  1 
ATOM   3789  C  CG  . LEU A 1 463 ? 8.120   17.639  -8.804  1.00 5.08  ? 494 LEU A CG  1 
ATOM   3790  C  CD1 . LEU A 1 463 ? 8.047   17.595  -7.286  1.00 2.04  ? 494 LEU A CD1 1 
ATOM   3791  C  CD2 . LEU A 1 463 ? 8.366   19.082  -9.274  1.00 2.95  ? 494 LEU A CD2 1 
ATOM   3792  N  N   . TYR A 1 464 ? 10.699  14.129  -8.116  1.00 9.43  ? 495 TYR A N   1 
ATOM   3793  C  CA  . TYR A 1 464 ? 11.911  13.349  -7.941  1.00 12.98 ? 495 TYR A CA  1 
ATOM   3794  C  C   . TYR A 1 464 ? 11.769  11.837  -8.149  1.00 16.15 ? 495 TYR A C   1 
ATOM   3795  O  O   . TYR A 1 464 ? 12.731  11.179  -8.539  1.00 17.22 ? 495 TYR A O   1 
ATOM   3796  C  CB  . TYR A 1 464 ? 12.568  13.665  -6.602  1.00 13.95 ? 495 TYR A CB  1 
ATOM   3797  C  CG  . TYR A 1 464 ? 13.138  15.069  -6.524  1.00 13.73 ? 495 TYR A CG  1 
ATOM   3798  C  CD1 . TYR A 1 464 ? 14.430  15.337  -6.928  1.00 12.59 ? 495 TYR A CD1 1 
ATOM   3799  C  CD2 . TYR A 1 464 ? 12.375  16.124  -6.054  1.00 13.50 ? 495 TYR A CD2 1 
ATOM   3800  C  CE1 . TYR A 1 464 ? 14.934  16.605  -6.866  1.00 12.60 ? 495 TYR A CE1 1 
ATOM   3801  C  CE2 . TYR A 1 464 ? 12.877  17.397  -5.988  1.00 10.81 ? 495 TYR A CE2 1 
ATOM   3802  C  CZ  . TYR A 1 464 ? 14.155  17.631  -6.397  1.00 9.67  ? 495 TYR A CZ  1 
ATOM   3803  O  OH  . TYR A 1 464 ? 14.668  18.896  -6.358  1.00 8.08  ? 495 TYR A OH  1 
ATOM   3804  N  N   . SER A 1 465 ? 10.580  11.285  -7.914  1.00 17.98 ? 496 SER A N   1 
ATOM   3805  C  CA  . SER A 1 465 ? 10.339  9.849   -8.116  1.00 19.26 ? 496 SER A CA  1 
ATOM   3806  C  C   . SER A 1 465 ? 11.136  8.941   -7.198  1.00 18.79 ? 496 SER A C   1 
ATOM   3807  O  O   . SER A 1 465 ? 10.549  8.157   -6.453  1.00 21.42 ? 496 SER A O   1 
ATOM   3808  C  CB  . SER A 1 465 ? 10.578  9.439   -9.578  1.00 20.71 ? 496 SER A CB  1 
ATOM   3809  O  OG  . SER A 1 465 ? 9.761   10.193  -10.457 1.00 24.46 ? 496 SER A OG  1 
ATOM   3810  N  N   . ASP A 1 466 ? 12.460  8.978   -7.289  1.00 15.90 ? 497 ASP A N   1 
ATOM   3811  C  CA  . ASP A 1 466 ? 13.268  8.131   -6.430  1.00 14.44 ? 497 ASP A CA  1 
ATOM   3812  C  C   . ASP A 1 466 ? 13.794  9.033   -5.348  1.00 11.58 ? 497 ASP A C   1 
ATOM   3813  O  O   . ASP A 1 466 ? 14.151  10.175  -5.626  1.00 10.18 ? 497 ASP A O   1 
ATOM   3814  C  CB  . ASP A 1 466 ? 14.442  7.498   -7.215  1.00 18.39 ? 497 ASP A CB  1 
ATOM   3815  C  CG  . ASP A 1 466 ? 15.111  6.295   -6.472  1.00 22.58 ? 497 ASP A CG  1 
ATOM   3816  O  OD1 . ASP A 1 466 ? 14.755  5.985   -5.298  1.00 27.47 ? 497 ASP A OD1 1 
ATOM   3817  O  OD2 . ASP A 1 466 ? 15.991  5.640   -7.085  1.00 21.43 ? 497 ASP A OD2 1 
ATOM   3818  N  N   . ILE A 1 467 ? 13.733  8.560   -4.106  1.00 8.22  ? 498 ILE A N   1 
ATOM   3819  C  CA  . ILE A 1 467 ? 14.258  9.311   -2.975  1.00 6.57  ? 498 ILE A CA  1 
ATOM   3820  C  C   . ILE A 1 467 ? 15.798  9.346   -3.227  1.00 7.74  ? 498 ILE A C   1 
ATOM   3821  O  O   . ILE A 1 467 ? 16.487  10.355  -3.003  1.00 10.30 ? 498 ILE A O   1 
ATOM   3822  C  CB  . ILE A 1 467 ? 13.861  8.604   -1.633  1.00 6.91  ? 498 ILE A CB  1 
ATOM   3823  C  CG1 . ILE A 1 467 ? 14.289  9.423   -0.413  1.00 8.40  ? 498 ILE A CG1 1 
ATOM   3824  C  CG2 . ILE A 1 467 ? 14.448  7.182   -1.567  1.00 6.87  ? 498 ILE A CG2 1 
ATOM   3825  C  CD1 . ILE A 1 467 ? 13.706  10.810  -0.358  1.00 6.22  ? 498 ILE A CD1 1 
ATOM   3826  N  N   . ASP A 1 468 ? 16.307  8.288   -3.842  1.00 5.41  ? 499 ASP A N   1 
ATOM   3827  C  CA  . ASP A 1 468 ? 17.710  8.228   -4.155  1.00 6.34  ? 499 ASP A CA  1 
ATOM   3828  C  C   . ASP A 1 468 ? 17.973  9.127   -5.359  1.00 6.52  ? 499 ASP A C   1 
ATOM   3829  O  O   . ASP A 1 468 ? 18.725  8.742   -6.251  1.00 10.56 ? 499 ASP A O   1 
ATOM   3830  C  CB  . ASP A 1 468 ? 18.160  6.800   -4.523  1.00 10.05 ? 499 ASP A CB  1 
ATOM   3831  C  CG  . ASP A 1 468 ? 17.857  5.770   -3.453  1.00 13.58 ? 499 ASP A CG  1 
ATOM   3832  O  OD1 . ASP A 1 468 ? 18.107  6.009   -2.245  1.00 15.16 ? 499 ASP A OD1 1 
ATOM   3833  O  OD2 . ASP A 1 468 ? 17.392  4.679   -3.846  1.00 17.28 ? 499 ASP A OD2 1 
ATOM   3834  N  N   . VAL A 1 469 ? 17.283  10.256  -5.467  1.00 3.57  ? 500 VAL A N   1 
ATOM   3835  C  CA  . VAL A 1 469 ? 17.514  11.210  -6.557  1.00 2.51  ? 500 VAL A CA  1 
ATOM   3836  C  C   . VAL A 1 469 ? 17.103  12.593  -6.056  1.00 2.05  ? 500 VAL A C   1 
ATOM   3837  O  O   . VAL A 1 469 ? 17.135  13.585  -6.786  1.00 2.00  ? 500 VAL A O   1 
ATOM   3838  C  CB  . VAL A 1 469 ? 16.729  10.867  -7.852  1.00 2.00  ? 500 VAL A CB  1 
ATOM   3839  C  CG1 . VAL A 1 469 ? 17.036  11.876  -8.934  1.00 2.00  ? 500 VAL A CG1 1 
ATOM   3840  C  CG2 . VAL A 1 469 ? 17.077  9.480   -8.349  1.00 2.00  ? 500 VAL A CG2 1 
ATOM   3841  N  N   . MET A 1 470 ? 16.731  12.652  -4.788  1.00 2.00  ? 501 MET A N   1 
ATOM   3842  C  CA  . MET A 1 470 ? 16.305  13.888  -4.190  1.00 2.00  ? 501 MET A CA  1 
ATOM   3843  C  C   . MET A 1 470 ? 17.590  14.628  -3.888  1.00 6.24  ? 501 MET A C   1 
ATOM   3844  O  O   . MET A 1 470 ? 18.565  14.013  -3.441  1.00 9.27  ? 501 MET A O   1 
ATOM   3845  C  CB  . MET A 1 470 ? 15.533  13.600  -2.898  1.00 2.06  ? 501 MET A CB  1 
ATOM   3846  C  CG  . MET A 1 470 ? 15.042  14.825  -2.095  1.00 2.00  ? 501 MET A CG  1 
ATOM   3847  S  SD  . MET A 1 470 ? 14.284  16.122  -3.126  1.00 4.80  ? 501 MET A SD  1 
ATOM   3848  C  CE  . MET A 1 470 ? 14.058  17.365  -1.874  1.00 2.04  ? 501 MET A CE  1 
ATOM   3849  N  N   . GLU A 1 471 ? 17.599  15.933  -4.166  1.00 5.91  ? 502 GLU A N   1 
ATOM   3850  C  CA  . GLU A 1 471 ? 18.724  16.839  -3.933  1.00 3.56  ? 502 GLU A CA  1 
ATOM   3851  C  C   . GLU A 1 471 ? 19.035  17.201  -2.442  1.00 6.13  ? 502 GLU A C   1 
ATOM   3852  O  O   . GLU A 1 471 ? 18.320  16.793  -1.528  1.00 5.38  ? 502 GLU A O   1 
ATOM   3853  C  CB  . GLU A 1 471 ? 18.474  18.088  -4.774  1.00 2.00  ? 502 GLU A CB  1 
ATOM   3854  C  CG  . GLU A 1 471 ? 18.359  17.737  -6.250  1.00 3.96  ? 502 GLU A CG  1 
ATOM   3855  C  CD  . GLU A 1 471 ? 18.155  18.933  -7.180  1.00 5.65  ? 502 GLU A CD  1 
ATOM   3856  O  OE1 . GLU A 1 471 ? 18.376  20.090  -6.797  1.00 7.18  ? 502 GLU A OE1 1 
ATOM   3857  O  OE2 . GLU A 1 471 ? 17.781  18.702  -8.336  1.00 8.11  ? 502 GLU A OE2 1 
ATOM   3858  N  N   . LEU A 1 472 ? 20.129  17.931  -2.193  1.00 10.12 ? 503 LEU A N   1 
ATOM   3859  C  CA  . LEU A 1 472 ? 20.505  18.322  -0.824  1.00 8.51  ? 503 LEU A CA  1 
ATOM   3860  C  C   . LEU A 1 472 ? 19.814  19.609  -0.300  1.00 9.22  ? 503 LEU A C   1 
ATOM   3861  O  O   . LEU A 1 472 ? 19.157  19.604  0.741   1.00 6.42  ? 503 LEU A O   1 
ATOM   3862  C  CB  . LEU A 1 472 ? 22.038  18.444  -0.670  1.00 2.00  ? 503 LEU A CB  1 
ATOM   3863  C  CG  . LEU A 1 472 ? 22.493  18.873  0.754   1.00 2.00  ? 503 LEU A CG  1 
ATOM   3864  C  CD1 . LEU A 1 472 ? 22.458  17.736  1.760   1.00 2.00  ? 503 LEU A CD1 1 
ATOM   3865  C  CD2 . LEU A 1 472 ? 23.886  19.437  0.746   1.00 2.00  ? 503 LEU A CD2 1 
ATOM   3866  N  N   . TYR A 1 473 ? 19.970  20.708  -1.021  1.00 9.84  ? 504 TYR A N   1 
ATOM   3867  C  CA  . TYR A 1 473 ? 19.381  21.973  -0.594  1.00 10.30 ? 504 TYR A CA  1 
ATOM   3868  C  C   . TYR A 1 473 ? 17.883  21.921  -0.266  1.00 10.28 ? 504 TYR A C   1 
ATOM   3869  O  O   . TYR A 1 473 ? 17.490  22.332  0.836   1.00 9.94  ? 504 TYR A O   1 
ATOM   3870  C  CB  . TYR A 1 473 ? 19.649  23.075  -1.636  1.00 14.81 ? 504 TYR A CB  1 
ATOM   3871  C  CG  . TYR A 1 473 ? 19.030  24.416  -1.282  1.00 15.47 ? 504 TYR A CG  1 
ATOM   3872  C  CD1 . TYR A 1 473 ? 19.410  25.070  -0.104  1.00 17.09 ? 504 TYR A CD1 1 
ATOM   3873  C  CD2 . TYR A 1 473 ? 18.067  25.030  -2.125  1.00 13.56 ? 504 TYR A CD2 1 
ATOM   3874  C  CE1 . TYR A 1 473 ? 18.867  26.306  0.234   1.00 21.22 ? 504 TYR A CE1 1 
ATOM   3875  C  CE2 . TYR A 1 473 ? 17.496  26.268  -1.799  1.00 12.73 ? 504 TYR A CE2 1 
ATOM   3876  C  CZ  . TYR A 1 473 ? 17.915  26.911  -0.612  1.00 20.48 ? 504 TYR A CZ  1 
ATOM   3877  O  OH  . TYR A 1 473 ? 17.487  28.186  -0.259  1.00 22.10 ? 504 TYR A OH  1 
ATOM   3878  N  N   . PRO A 1 474 ? 17.023  21.521  -1.244  1.00 7.90  ? 505 PRO A N   1 
ATOM   3879  C  CA  . PRO A 1 474 ? 15.578  21.451  -0.986  1.00 3.88  ? 505 PRO A CA  1 
ATOM   3880  C  C   . PRO A 1 474 ? 15.281  20.661  0.268   1.00 2.65  ? 505 PRO A C   1 
ATOM   3881  O  O   . PRO A 1 474 ? 14.967  21.233  1.291   1.00 2.00  ? 505 PRO A O   1 
ATOM   3882  C  CB  . PRO A 1 474 ? 15.054  20.756  -2.222  1.00 2.00  ? 505 PRO A CB  1 
ATOM   3883  C  CG  . PRO A 1 474 ? 15.945  21.359  -3.299  1.00 6.09  ? 505 PRO A CG  1 
ATOM   3884  C  CD  . PRO A 1 474 ? 17.307  21.226  -2.665  1.00 7.22  ? 505 PRO A CD  1 
ATOM   3885  N  N   . ALA A 1 475 ? 15.505  19.359  0.219   1.00 4.18  ? 506 ALA A N   1 
ATOM   3886  C  CA  . ALA A 1 475 ? 15.267  18.465  1.359   1.00 4.96  ? 506 ALA A CA  1 
ATOM   3887  C  C   . ALA A 1 475 ? 15.767  18.950  2.722   1.00 4.88  ? 506 ALA A C   1 
ATOM   3888  O  O   . ALA A 1 475 ? 15.365  18.421  3.772   1.00 2.09  ? 506 ALA A O   1 
ATOM   3889  C  CB  . ALA A 1 475 ? 15.846  17.071  1.058   1.00 6.48  ? 506 ALA A CB  1 
ATOM   3890  N  N   . LEU A 1 476 ? 16.687  19.912  2.710   1.00 7.79  ? 507 LEU A N   1 
ATOM   3891  C  CA  . LEU A 1 476 ? 17.224  20.454  3.963   1.00 8.53  ? 507 LEU A CA  1 
ATOM   3892  C  C   . LEU A 1 476 ? 16.142  21.318  4.607   1.00 7.25  ? 507 LEU A C   1 
ATOM   3893  O  O   . LEU A 1 476 ? 15.955  21.295  5.830   1.00 4.58  ? 507 LEU A O   1 
ATOM   3894  C  CB  . LEU A 1 476 ? 18.524  21.249  3.727   1.00 7.27  ? 507 LEU A CB  1 
ATOM   3895  C  CG  . LEU A 1 476 ? 19.824  20.451  3.701   1.00 5.60  ? 507 LEU A CG  1 
ATOM   3896  C  CD1 . LEU A 1 476 ? 20.901  21.277  3.068   1.00 6.75  ? 507 LEU A CD1 1 
ATOM   3897  C  CD2 . LEU A 1 476 ? 20.218  20.011  5.120   1.00 5.69  ? 507 LEU A CD2 1 
ATOM   3898  N  N   . LEU A 1 477 ? 15.411  22.030  3.751   1.00 6.66  ? 508 LEU A N   1 
ATOM   3899  C  CA  . LEU A 1 477 ? 14.317  22.904  4.161   1.00 8.54  ? 508 LEU A CA  1 
ATOM   3900  C  C   . LEU A 1 477 ? 12.978  22.110  4.313   1.00 9.98  ? 508 LEU A C   1 
ATOM   3901  O  O   . LEU A 1 477 ? 12.280  22.188  5.347   1.00 9.96  ? 508 LEU A O   1 
ATOM   3902  C  CB  . LEU A 1 477 ? 14.212  24.058  3.144   1.00 6.76  ? 508 LEU A CB  1 
ATOM   3903  C  CG  . LEU A 1 477 ? 15.540  24.829  2.949   1.00 4.42  ? 508 LEU A CG  1 
ATOM   3904  C  CD1 . LEU A 1 477 ? 15.369  26.138  2.200   1.00 2.00  ? 508 LEU A CD1 1 
ATOM   3905  C  CD2 . LEU A 1 477 ? 16.126  25.117  4.324   1.00 2.00  ? 508 LEU A CD2 1 
ATOM   3906  N  N   . VAL A 1 478 ? 12.684  21.300  3.297   1.00 7.90  ? 509 VAL A N   1 
ATOM   3907  C  CA  . VAL A 1 478 ? 11.511  20.431  3.202   1.00 3.73  ? 509 VAL A CA  1 
ATOM   3908  C  C   . VAL A 1 478 ? 11.783  19.222  4.087   1.00 2.23  ? 509 VAL A C   1 
ATOM   3909  O  O   . VAL A 1 478 ? 11.666  18.105  3.633   1.00 4.87  ? 509 VAL A O   1 
ATOM   3910  C  CB  . VAL A 1 478 ? 11.409  19.944  1.720   1.00 3.26  ? 509 VAL A CB  1 
ATOM   3911  C  CG1 . VAL A 1 478 ? 10.334  18.924  1.502   1.00 2.19  ? 509 VAL A CG1 1 
ATOM   3912  C  CG2 . VAL A 1 478 ? 11.199  21.125  0.823   1.00 5.82  ? 509 VAL A CG2 1 
ATOM   3913  N  N   . GLU A 1 479 ? 12.132  19.413  5.345   1.00 2.00  ? 510 GLU A N   1 
ATOM   3914  C  CA  . GLU A 1 479 ? 12.458  18.248  6.158   1.00 2.00  ? 510 GLU A CA  1 
ATOM   3915  C  C   . GLU A 1 479 ? 11.832  18.316  7.518   1.00 2.45  ? 510 GLU A C   1 
ATOM   3916  O  O   . GLU A 1 479 ? 11.500  19.386  7.999   1.00 5.57  ? 510 GLU A O   1 
ATOM   3917  C  CB  . GLU A 1 479 ? 13.967  18.110  6.282   1.00 4.05  ? 510 GLU A CB  1 
ATOM   3918  C  CG  . GLU A 1 479 ? 14.423  16.827  6.919   1.00 9.23  ? 510 GLU A CG  1 
ATOM   3919  C  CD  . GLU A 1 479 ? 15.853  16.888  7.452   1.00 13.88 ? 510 GLU A CD  1 
ATOM   3920  O  OE1 . GLU A 1 479 ? 16.318  17.996  7.799   1.00 19.63 ? 510 GLU A OE1 1 
ATOM   3921  O  OE2 . GLU A 1 479 ? 16.518  15.831  7.561   1.00 14.40 ? 510 GLU A OE2 1 
ATOM   3922  N  N   . LYS A 1 480 ? 11.725  17.173  8.160   1.00 2.01  ? 511 LYS A N   1 
ATOM   3923  C  CA  . LYS A 1 480 ? 11.090  17.077  9.458   1.00 3.83  ? 511 LYS A CA  1 
ATOM   3924  C  C   . LYS A 1 480 ? 11.863  17.594  10.650  1.00 2.74  ? 511 LYS A C   1 
ATOM   3925  O  O   . LYS A 1 480 ? 12.839  16.995  11.090  1.00 5.67  ? 511 LYS A O   1 
ATOM   3926  C  CB  . LYS A 1 480 ? 10.680  15.631  9.712   1.00 8.20  ? 511 LYS A CB  1 
ATOM   3927  C  CG  . LYS A 1 480 ? 10.241  15.342  11.147  1.00 10.22 ? 511 LYS A CG  1 
ATOM   3928  C  CD  . LYS A 1 480 ? 10.192  13.840  11.397  1.00 14.64 ? 511 LYS A CD  1 
ATOM   3929  C  CE  . LYS A 1 480 ? 10.190  13.516  12.877  1.00 14.10 ? 511 LYS A CE  1 
ATOM   3930  N  NZ  . LYS A 1 480 ? 10.305  12.034  13.085  1.00 19.03 ? 511 LYS A NZ  1 
ATOM   3931  N  N   . PRO A 1 481 ? 11.433  18.722  11.198  1.00 4.03  ? 512 PRO A N   1 
ATOM   3932  C  CA  . PRO A 1 481 ? 12.105  19.302  12.363  1.00 4.75  ? 512 PRO A CA  1 
ATOM   3933  C  C   . PRO A 1 481 ? 12.067  18.344  13.511  1.00 5.68  ? 512 PRO A C   1 
ATOM   3934  O  O   . PRO A 1 481 ? 11.061  17.704  13.767  1.00 8.45  ? 512 PRO A O   1 
ATOM   3935  C  CB  . PRO A 1 481 ? 11.245  20.511  12.684  1.00 3.41  ? 512 PRO A CB  1 
ATOM   3936  C  CG  . PRO A 1 481 ? 10.820  20.982  11.299  1.00 5.12  ? 512 PRO A CG  1 
ATOM   3937  C  CD  . PRO A 1 481 ? 10.452  19.663  10.625  1.00 5.27  ? 512 PRO A CD  1 
ATOM   3938  N  N   . ARG A 1 482 ? 13.206  18.159  14.140  1.00 8.71  ? 513 ARG A N   1 
ATOM   3939  C  CA  . ARG A 1 482 ? 13.274  17.293  15.299  1.00 10.43 ? 513 ARG A CA  1 
ATOM   3940  C  C   . ARG A 1 482 ? 12.468  18.103  16.284  1.00 7.98  ? 513 ARG A C   1 
ATOM   3941  O  O   . ARG A 1 482 ? 12.551  19.324  16.257  1.00 10.14 ? 513 ARG A O   1 
ATOM   3942  C  CB  . ARG A 1 482 ? 14.742  17.165  15.754  1.00 14.80 ? 513 ARG A CB  1 
ATOM   3943  C  CG  . ARG A 1 482 ? 15.664  16.574  14.656  1.00 18.39 ? 513 ARG A CG  1 
ATOM   3944  C  CD  . ARG A 1 482 ? 17.118  16.543  15.059  1.00 18.77 ? 513 ARG A CD  1 
ATOM   3945  N  NE  . ARG A 1 482 ? 17.683  15.211  14.911  1.00 20.05 ? 513 ARG A NE  1 
ATOM   3946  C  CZ  . ARG A 1 482 ? 18.951  14.897  15.164  1.00 22.77 ? 513 ARG A CZ  1 
ATOM   3947  N  NH1 . ARG A 1 482 ? 19.807  15.826  15.568  1.00 26.54 ? 513 ARG A NH1 1 
ATOM   3948  N  NH2 . ARG A 1 482 ? 19.352  13.637  15.081  1.00 19.29 ? 513 ARG A NH2 1 
ATOM   3949  N  N   . PRO A 1 483 ? 11.685  17.458  17.153  1.00 6.08  ? 514 PRO A N   1 
ATOM   3950  C  CA  . PRO A 1 483 ? 10.878  18.182  18.129  1.00 7.96  ? 514 PRO A CA  1 
ATOM   3951  C  C   . PRO A 1 483 ? 10.581  19.675  17.920  1.00 11.35 ? 514 PRO A C   1 
ATOM   3952  O  O   . PRO A 1 483 ? 10.305  20.118  16.793  1.00 16.23 ? 514 PRO A O   1 
ATOM   3953  C  CB  . PRO A 1 483 ? 11.583  17.837  19.419  1.00 6.59  ? 514 PRO A CB  1 
ATOM   3954  C  CG  . PRO A 1 483 ? 11.714  16.261  19.185  1.00 6.47  ? 514 PRO A CG  1 
ATOM   3955  C  CD  . PRO A 1 483 ? 11.900  16.090  17.645  1.00 4.84  ? 514 PRO A CD  1 
ATOM   3956  N  N   . ASP A 1 484 ? 10.581  20.469  18.965  1.00 10.12 ? 515 ASP A N   1 
ATOM   3957  C  CA  . ASP A 1 484 ? 10.258  21.828  18.698  1.00 14.42 ? 515 ASP A CA  1 
ATOM   3958  C  C   . ASP A 1 484 ? 11.529  22.577  18.317  1.00 15.36 ? 515 ASP A C   1 
ATOM   3959  O  O   . ASP A 1 484 ? 11.886  23.570  18.944  1.00 21.70 ? 515 ASP A O   1 
ATOM   3960  C  CB  . ASP A 1 484 ? 9.476   22.382  19.890  1.00 21.34 ? 515 ASP A CB  1 
ATOM   3961  C  CG  . ASP A 1 484 ? 8.045   21.721  20.030  1.00 24.97 ? 515 ASP A CG  1 
ATOM   3962  O  OD1 . ASP A 1 484 ? 7.192   21.834  19.092  1.00 23.95 ? 515 ASP A OD1 1 
ATOM   3963  O  OD2 . ASP A 1 484 ? 7.774   21.083  21.085  1.00 24.30 ? 515 ASP A OD2 1 
ATOM   3964  N  N   . ALA A 1 485 ? 12.186  22.109  17.252  1.00 12.64 ? 516 ALA A N   1 
ATOM   3965  C  CA  . ALA A 1 485 ? 13.434  22.694  16.790  1.00 9.55  ? 516 ALA A CA  1 
ATOM   3966  C  C   . ALA A 1 485 ? 13.410  23.257  15.396  1.00 7.61  ? 516 ALA A C   1 
ATOM   3967  O  O   . ALA A 1 485 ? 12.575  22.900  14.606  1.00 9.40  ? 516 ALA A O   1 
ATOM   3968  C  CB  . ALA A 1 485 ? 14.526  21.717  16.913  1.00 14.28 ? 516 ALA A CB  1 
ATOM   3969  N  N   . ILE A 1 486 ? 14.434  24.029  15.061  1.00 6.29  ? 517 ILE A N   1 
ATOM   3970  C  CA  . ILE A 1 486 ? 14.505  24.727  13.786  1.00 4.24  ? 517 ILE A CA  1 
ATOM   3971  C  C   . ILE A 1 486 ? 15.013  23.957  12.587  1.00 3.02  ? 517 ILE A C   1 
ATOM   3972  O  O   . ILE A 1 486 ? 14.701  24.296  11.426  1.00 2.00  ? 517 ILE A O   1 
ATOM   3973  C  CB  . ILE A 1 486 ? 15.278  26.087  13.979  1.00 3.60  ? 517 ILE A CB  1 
ATOM   3974  C  CG1 . ILE A 1 486 ? 15.438  26.851  12.670  1.00 3.21  ? 517 ILE A CG1 1 
ATOM   3975  C  CG2 . ILE A 1 486 ? 16.575  25.875  14.694  1.00 2.00  ? 517 ILE A CG2 1 
ATOM   3976  C  CD1 . ILE A 1 486 ? 15.864  28.279  12.891  1.00 2.87  ? 517 ILE A CD1 1 
ATOM   3977  N  N   . PHE A 1 487 ? 15.807  22.931  12.863  1.00 3.89  ? 518 PHE A N   1 
ATOM   3978  C  CA  . PHE A 1 487 ? 16.383  22.122  11.793  1.00 5.33  ? 518 PHE A CA  1 
ATOM   3979  C  C   . PHE A 1 487 ? 16.050  20.654  11.984  1.00 5.15  ? 518 PHE A C   1 
ATOM   3980  O  O   . PHE A 1 487 ? 15.654  20.219  13.070  1.00 3.61  ? 518 PHE A O   1 
ATOM   3981  C  CB  . PHE A 1 487 ? 17.933  22.202  11.759  1.00 7.94  ? 518 PHE A CB  1 
ATOM   3982  C  CG  . PHE A 1 487 ? 18.512  23.587  11.866  1.00 5.41  ? 518 PHE A CG  1 
ATOM   3983  C  CD1 . PHE A 1 487 ? 18.247  24.547  10.902  1.00 3.05  ? 518 PHE A CD1 1 
ATOM   3984  C  CD2 . PHE A 1 487 ? 19.327  23.922  12.949  1.00 3.97  ? 518 PHE A CD2 1 
ATOM   3985  C  CE1 . PHE A 1 487 ? 18.777  25.813  11.025  1.00 2.00  ? 518 PHE A CE1 1 
ATOM   3986  C  CE2 . PHE A 1 487 ? 19.854  25.181  13.071  1.00 2.00  ? 518 PHE A CE2 1 
ATOM   3987  C  CZ  . PHE A 1 487 ? 19.581  26.126  12.116  1.00 2.00  ? 518 PHE A CZ  1 
ATOM   3988  N  N   . GLY A 1 488 ? 16.321  19.884  10.936  1.00 6.13  ? 519 GLY A N   1 
ATOM   3989  C  CA  . GLY A 1 488 ? 16.112  18.449  10.989  1.00 9.54  ? 519 GLY A CA  1 
ATOM   3990  C  C   . GLY A 1 488 ? 17.484  17.804  11.097  1.00 10.16 ? 519 GLY A C   1 
ATOM   3991  O  O   . GLY A 1 488 ? 18.490  18.481  10.844  1.00 10.86 ? 519 GLY A O   1 
ATOM   3992  N  N   . GLU A 1 489 ? 17.531  16.532  11.495  1.00 9.17  ? 520 GLU A N   1 
ATOM   3993  C  CA  . GLU A 1 489 ? 18.787  15.794  11.626  1.00 8.00  ? 520 GLU A CA  1 
ATOM   3994  C  C   . GLU A 1 489 ? 19.824  16.045  10.513  1.00 6.42  ? 520 GLU A C   1 
ATOM   3995  O  O   . GLU A 1 489 ? 20.964  16.400  10.832  1.00 6.42  ? 520 GLU A O   1 
ATOM   3996  C  CB  . GLU A 1 489 ? 18.492  14.299  11.715  1.00 12.26 ? 520 GLU A CB  1 
ATOM   3997  C  CG  . GLU A 1 489 ? 19.706  13.389  11.660  1.00 8.62  ? 520 GLU A CG  1 
ATOM   3998  C  CD  . GLU A 1 489 ? 19.322  11.998  11.217  1.00 6.08  ? 520 GLU A CD  1 
ATOM   3999  O  OE1 . GLU A 1 489 ? 18.924  11.837  10.044  1.00 2.00  ? 520 GLU A OE1 1 
ATOM   4000  O  OE2 . GLU A 1 489 ? 19.400  11.080  12.050  1.00 7.52  ? 520 GLU A OE2 1 
ATOM   4001  N  N   . THR A 1 490 ? 19.450  15.875  9.237   1.00 2.00  ? 521 THR A N   1 
ATOM   4002  C  CA  . THR A 1 490 ? 20.401  16.109  8.136   1.00 4.45  ? 521 THR A CA  1 
ATOM   4003  C  C   . THR A 1 490 ? 21.217  17.405  8.279   1.00 5.83  ? 521 THR A C   1 
ATOM   4004  O  O   . THR A 1 490 ? 22.441  17.378  8.198   1.00 6.14  ? 521 THR A O   1 
ATOM   4005  C  CB  . THR A 1 490 ? 19.725  16.099  6.746   1.00 2.00  ? 521 THR A CB  1 
ATOM   4006  O  OG1 . THR A 1 490 ? 19.345  14.772  6.397   1.00 5.65  ? 521 THR A OG1 1 
ATOM   4007  C  CG2 . THR A 1 490 ? 20.658  16.589  5.696   1.00 2.00  ? 521 THR A CG2 1 
ATOM   4008  N  N   . MET A 1 491 ? 20.532  18.532  8.489   1.00 8.21  ? 522 MET A N   1 
ATOM   4009  C  CA  . MET A 1 491 ? 21.183  19.835  8.676   1.00 5.08  ? 522 MET A CA  1 
ATOM   4010  C  C   . MET A 1 491 ? 22.010  19.862  9.938   1.00 4.80  ? 522 MET A C   1 
ATOM   4011  O  O   . MET A 1 491 ? 23.042  20.484  9.938   1.00 9.61  ? 522 MET A O   1 
ATOM   4012  C  CB  . MET A 1 491 ? 20.180  20.977  8.730   1.00 2.86  ? 522 MET A CB  1 
ATOM   4013  C  CG  . MET A 1 491 ? 20.752  22.251  9.297   1.00 2.00  ? 522 MET A CG  1 
ATOM   4014  S  SD  . MET A 1 491 ? 20.812  23.597  8.112   1.00 2.00  ? 522 MET A SD  1 
ATOM   4015  C  CE  . MET A 1 491 ? 20.733  22.799  6.618   1.00 2.00  ? 522 MET A CE  1 
ATOM   4016  N  N   . VAL A 1 492 ? 21.584  19.222  11.015  1.00 4.38  ? 523 VAL A N   1 
ATOM   4017  C  CA  . VAL A 1 492 ? 22.418  19.245  12.204  1.00 8.34  ? 523 VAL A CA  1 
ATOM   4018  C  C   . VAL A 1 492 ? 23.651  18.351  12.104  1.00 10.70 ? 523 VAL A C   1 
ATOM   4019  O  O   . VAL A 1 492 ? 24.717  18.712  12.602  1.00 11.26 ? 523 VAL A O   1 
ATOM   4020  C  CB  . VAL A 1 492 ? 21.625  18.944  13.481  1.00 10.49 ? 523 VAL A CB  1 
ATOM   4021  C  CG1 . VAL A 1 492 ? 22.526  18.417  14.607  1.00 7.56  ? 523 VAL A CG1 1 
ATOM   4022  C  CG2 . VAL A 1 492 ? 20.951  20.214  13.932  1.00 13.56 ? 523 VAL A CG2 1 
ATOM   4023  N  N   . GLU A 1 493 ? 23.546  17.232  11.397  1.00 11.32 ? 524 GLU A N   1 
ATOM   4024  C  CA  . GLU A 1 493 ? 24.689  16.323  11.288  1.00 11.27 ? 524 GLU A CA  1 
ATOM   4025  C  C   . GLU A 1 493 ? 25.771  16.712  10.271  1.00 8.00  ? 524 GLU A C   1 
ATOM   4026  O  O   . GLU A 1 493 ? 26.921  16.369  10.449  1.00 9.12  ? 524 GLU A O   1 
ATOM   4027  C  CB  . GLU A 1 493 ? 24.208  14.875  11.081  1.00 15.75 ? 524 GLU A CB  1 
ATOM   4028  C  CG  . GLU A 1 493 ? 23.434  14.277  12.271  1.00 17.74 ? 524 GLU A CG  1 
ATOM   4029  C  CD  . GLU A 1 493 ? 24.230  14.292  13.561  1.00 20.03 ? 524 GLU A CD  1 
ATOM   4030  O  OE1 . GLU A 1 493 ? 24.171  15.321  14.273  1.00 21.51 ? 524 GLU A OE1 1 
ATOM   4031  O  OE2 . GLU A 1 493 ? 24.899  13.277  13.865  1.00 20.91 ? 524 GLU A OE2 1 
ATOM   4032  N  N   . LEU A 1 494 ? 25.409  17.387  9.192   1.00 6.28  ? 525 LEU A N   1 
ATOM   4033  C  CA  . LEU A 1 494 ? 26.400  17.813  8.209   1.00 3.11  ? 525 LEU A CA  1 
ATOM   4034  C  C   . LEU A 1 494 ? 27.096  19.106  8.648   1.00 3.87  ? 525 LEU A C   1 
ATOM   4035  O  O   . LEU A 1 494 ? 28.255  19.334  8.369   1.00 4.53  ? 525 LEU A O   1 
ATOM   4036  C  CB  . LEU A 1 494 ? 25.751  18.071  6.855   1.00 2.00  ? 525 LEU A CB  1 
ATOM   4037  C  CG  . LEU A 1 494 ? 25.063  16.938  6.155   1.00 2.00  ? 525 LEU A CG  1 
ATOM   4038  C  CD1 . LEU A 1 494 ? 25.534  16.880  4.728   1.00 3.17  ? 525 LEU A CD1 1 
ATOM   4039  C  CD2 . LEU A 1 494 ? 25.398  15.691  6.874   1.00 2.00  ? 525 LEU A CD2 1 
ATOM   4040  N  N   . GLY A 1 495 ? 26.369  19.977  9.314   1.00 3.16  ? 526 GLY A N   1 
ATOM   4041  C  CA  . GLY A 1 495 ? 26.950  21.226  9.731   1.00 2.00  ? 526 GLY A CA  1 
ATOM   4042  C  C   . GLY A 1 495 ? 27.839  21.180  10.942  1.00 2.00  ? 526 GLY A C   1 
ATOM   4043  O  O   . GLY A 1 495 ? 28.866  21.797  10.910  1.00 4.23  ? 526 GLY A O   1 
ATOM   4044  N  N   . ALA A 1 496 ? 27.458  20.492  12.012  1.00 3.67  ? 527 ALA A N   1 
ATOM   4045  C  CA  . ALA A 1 496 ? 28.284  20.439  13.232  1.00 5.27  ? 527 ALA A CA  1 
ATOM   4046  C  C   . ALA A 1 496 ? 29.713  20.000  13.025  1.00 5.92  ? 527 ALA A C   1 
ATOM   4047  O  O   . ALA A 1 496 ? 30.583  20.455  13.754  1.00 7.09  ? 527 ALA A O   1 
ATOM   4048  C  CB  . ALA A 1 496 ? 27.643  19.591  14.324  1.00 5.91  ? 527 ALA A CB  1 
ATOM   4049  N  N   . PRO A 1 497 ? 29.966  19.031  12.129  1.00 5.81  ? 528 PRO A N   1 
ATOM   4050  C  CA  . PRO A 1 497 ? 31.362  18.648  11.945  1.00 8.90  ? 528 PRO A CA  1 
ATOM   4051  C  C   . PRO A 1 497 ? 32.033  19.854  11.297  1.00 9.61  ? 528 PRO A C   1 
ATOM   4052  O  O   . PRO A 1 497 ? 32.996  20.408  11.828  1.00 11.77 ? 528 PRO A O   1 
ATOM   4053  C  CB  . PRO A 1 497 ? 31.258  17.468  10.974  1.00 9.17  ? 528 PRO A CB  1 
ATOM   4054  C  CG  . PRO A 1 497 ? 29.990  16.847  11.381  1.00 9.95  ? 528 PRO A CG  1 
ATOM   4055  C  CD  . PRO A 1 497 ? 29.100  18.065  11.445  1.00 8.67  ? 528 PRO A CD  1 
ATOM   4056  N  N   . PHE A 1 498 ? 31.434  20.321  10.207  1.00 7.94  ? 529 PHE A N   1 
ATOM   4057  C  CA  . PHE A 1 498 ? 31.923  21.486  9.488   1.00 5.83  ? 529 PHE A CA  1 
ATOM   4058  C  C   . PHE A 1 498 ? 32.161  22.701  10.416  1.00 5.50  ? 529 PHE A C   1 
ATOM   4059  O  O   . PHE A 1 498 ? 33.122  23.427  10.251  1.00 9.91  ? 529 PHE A O   1 
ATOM   4060  C  CB  . PHE A 1 498 ? 30.889  21.937  8.460   1.00 4.94  ? 529 PHE A CB  1 
ATOM   4061  C  CG  . PHE A 1 498 ? 30.772  21.073  7.235   1.00 2.62  ? 529 PHE A CG  1 
ATOM   4062  C  CD1 . PHE A 1 498 ? 31.810  20.248  6.811   1.00 2.00  ? 529 PHE A CD1 1 
ATOM   4063  C  CD2 . PHE A 1 498 ? 29.627  21.177  6.439   1.00 2.40  ? 529 PHE A CD2 1 
ATOM   4064  C  CE1 . PHE A 1 498 ? 31.715  19.547  5.601   1.00 2.67  ? 529 PHE A CE1 1 
ATOM   4065  C  CE2 . PHE A 1 498 ? 29.524  20.481  5.232   1.00 3.29  ? 529 PHE A CE2 1 
ATOM   4066  C  CZ  . PHE A 1 498 ? 30.582  19.664  4.815   1.00 3.70  ? 529 PHE A CZ  1 
ATOM   4067  N  N   . SER A 1 499 ? 31.291  22.920  11.382  1.00 4.55  ? 530 SER A N   1 
ATOM   4068  C  CA  . SER A 1 499 ? 31.411  24.075  12.245  1.00 8.63  ? 530 SER A CA  1 
ATOM   4069  C  C   . SER A 1 499 ? 32.491  24.048  13.316  1.00 9.04  ? 530 SER A C   1 
ATOM   4070  O  O   . SER A 1 499 ? 33.143  25.071  13.570  1.00 8.47  ? 530 SER A O   1 
ATOM   4071  C  CB  . SER A 1 499 ? 30.047  24.392  12.893  1.00 11.32 ? 530 SER A CB  1 
ATOM   4072  O  OG  . SER A 1 499 ? 29.795  25.793  13.003  1.00 19.19 ? 530 SER A OG  1 
ATOM   4073  N  N   . LEU A 1 500 ? 32.684  22.904  13.960  1.00 9.69  ? 531 LEU A N   1 
ATOM   4074  C  CA  . LEU A 1 500 ? 33.659  22.852  15.043  1.00 10.87 ? 531 LEU A CA  1 
ATOM   4075  C  C   . LEU A 1 500 ? 35.117  22.757  14.592  1.00 10.72 ? 531 LEU A C   1 
ATOM   4076  O  O   . LEU A 1 500 ? 36.044  23.004  15.380  1.00 9.81  ? 531 LEU A O   1 
ATOM   4077  C  CB  . LEU A 1 500 ? 33.256  21.803  16.083  1.00 10.06 ? 531 LEU A CB  1 
ATOM   4078  C  CG  . LEU A 1 500 ? 31.910  22.213  16.723  1.00 10.73 ? 531 LEU A CG  1 
ATOM   4079  C  CD1 . LEU A 1 500 ? 31.211  21.041  17.384  1.00 14.51 ? 531 LEU A CD1 1 
ATOM   4080  C  CD2 . LEU A 1 500 ? 32.077  23.354  17.715  1.00 9.02  ? 531 LEU A CD2 1 
ATOM   4081  N  N   . LYS A 1 501 ? 35.301  22.520  13.292  1.00 8.24  ? 532 LYS A N   1 
ATOM   4082  C  CA  . LYS A 1 501 ? 36.630  22.433  12.706  1.00 6.18  ? 532 LYS A CA  1 
ATOM   4083  C  C   . LYS A 1 501 ? 37.076  23.862  12.548  1.00 4.15  ? 532 LYS A C   1 
ATOM   4084  O  O   . LYS A 1 501 ? 37.846  24.362  13.356  1.00 3.89  ? 532 LYS A O   1 
ATOM   4085  C  CB  . LYS A 1 501 ? 36.588  21.720  11.349  1.00 6.79  ? 532 LYS A CB  1 
ATOM   4086  C  CG  . LYS A 1 501 ? 37.603  20.583  11.214  1.00 8.17  ? 532 LYS A CG  1 
ATOM   4087  C  CD  . LYS A 1 501 ? 39.040  21.064  11.263  1.00 6.21  ? 532 LYS A CD  1 
ATOM   4088  C  CE  . LYS A 1 501 ? 39.974  19.921  10.970  1.00 9.86  ? 532 LYS A CE  1 
ATOM   4089  N  NZ  . LYS A 1 501 ? 41.347  20.363  10.595  1.00 10.58 ? 532 LYS A NZ  1 
ATOM   4090  N  N   . GLY A 1 502 ? 36.505  24.552  11.570  1.00 3.70  ? 533 GLY A N   1 
ATOM   4091  C  CA  . GLY A 1 502 ? 36.843  25.943  11.374  1.00 2.66  ? 533 GLY A CA  1 
ATOM   4092  C  C   . GLY A 1 502 ? 36.791  26.756  12.669  1.00 2.74  ? 533 GLY A C   1 
ATOM   4093  O  O   . GLY A 1 502 ? 37.288  27.853  12.704  1.00 4.59  ? 533 GLY A O   1 
ATOM   4094  N  N   . LEU A 1 503 ? 36.221  26.232  13.741  1.00 2.00  ? 534 LEU A N   1 
ATOM   4095  C  CA  . LEU A 1 503 ? 36.150  26.980  14.974  1.00 4.98  ? 534 LEU A CA  1 
ATOM   4096  C  C   . LEU A 1 503 ? 37.301  26.600  15.868  1.00 7.73  ? 534 LEU A C   1 
ATOM   4097  O  O   . LEU A 1 503 ? 38.017  27.459  16.380  1.00 9.78  ? 534 LEU A O   1 
ATOM   4098  C  CB  . LEU A 1 503 ? 34.831  26.686  15.689  1.00 9.37  ? 534 LEU A CB  1 
ATOM   4099  C  CG  . LEU A 1 503 ? 33.850  27.837  15.979  1.00 9.68  ? 534 LEU A CG  1 
ATOM   4100  C  CD1 . LEU A 1 503 ? 33.679  28.722  14.743  1.00 8.75  ? 534 LEU A CD1 1 
ATOM   4101  C  CD2 . LEU A 1 503 ? 32.516  27.274  16.419  1.00 7.96  ? 534 LEU A CD2 1 
ATOM   4102  N  N   . MET A 1 504 ? 37.480  25.301  16.066  1.00 9.11  ? 535 MET A N   1 
ATOM   4103  C  CA  . MET A 1 504 ? 38.563  24.824  16.917  1.00 8.31  ? 535 MET A CA  1 
ATOM   4104  C  C   . MET A 1 504 ? 39.907  24.800  16.215  1.00 7.72  ? 535 MET A C   1 
ATOM   4105  O  O   . MET A 1 504 ? 40.914  25.194  16.792  1.00 9.53  ? 535 MET A O   1 
ATOM   4106  C  CB  . MET A 1 504 ? 38.213  23.474  17.508  1.00 7.48  ? 535 MET A CB  1 
ATOM   4107  C  CG  . MET A 1 504 ? 37.072  23.604  18.524  1.00 7.75  ? 535 MET A CG  1 
ATOM   4108  S  SD  . MET A 1 504 ? 37.370  24.976  19.645  1.00 3.06  ? 535 MET A SD  1 
ATOM   4109  C  CE  . MET A 1 504 ? 37.610  24.077  21.136  1.00 4.35  ? 535 MET A CE  1 
ATOM   4110  N  N   . GLY A 1 505 ? 39.914  24.396  14.952  1.00 7.35  ? 536 GLY A N   1 
ATOM   4111  C  CA  . GLY A 1 505 ? 41.144  24.364  14.178  1.00 7.61  ? 536 GLY A CA  1 
ATOM   4112  C  C   . GLY A 1 505 ? 41.571  25.734  13.686  1.00 7.62  ? 536 GLY A C   1 
ATOM   4113  O  O   . GLY A 1 505 ? 41.659  25.974  12.484  1.00 10.06 ? 536 GLY A O   1 
ATOM   4114  N  N   . ASN A 1 506 ? 41.874  26.625  14.622  1.00 8.30  ? 537 ASN A N   1 
ATOM   4115  C  CA  . ASN A 1 506 ? 42.289  27.996  14.325  1.00 7.45  ? 537 ASN A CA  1 
ATOM   4116  C  C   . ASN A 1 506 ? 43.613  28.216  15.045  1.00 6.81  ? 537 ASN A C   1 
ATOM   4117  O  O   . ASN A 1 506 ? 43.757  27.815  16.204  1.00 7.24  ? 537 ASN A O   1 
ATOM   4118  C  CB  . ASN A 1 506 ? 41.233  28.961  14.895  1.00 9.83  ? 537 ASN A CB  1 
ATOM   4119  C  CG  . ASN A 1 506 ? 41.544  30.427  14.611  1.00 9.90  ? 537 ASN A CG  1 
ATOM   4120  O  OD1 . ASN A 1 506 ? 42.461  31.020  15.208  1.00 8.20  ? 537 ASN A OD1 1 
ATOM   4121  N  ND2 . ASN A 1 506 ? 40.759  31.027  13.723  1.00 7.45  ? 537 ASN A ND2 1 
ATOM   4122  N  N   . PRO A 1 507 ? 44.589  28.862  14.389  1.00 5.42  ? 538 PRO A N   1 
ATOM   4123  C  CA  . PRO A 1 507 ? 45.863  29.085  15.053  1.00 3.11  ? 538 PRO A CA  1 
ATOM   4124  C  C   . PRO A 1 507 ? 45.773  29.597  16.481  1.00 3.00  ? 538 PRO A C   1 
ATOM   4125  O  O   . PRO A 1 507 ? 46.425  29.058  17.338  1.00 4.79  ? 538 PRO A O   1 
ATOM   4126  C  CB  . PRO A 1 507 ? 46.564  30.077  14.124  1.00 2.53  ? 538 PRO A CB  1 
ATOM   4127  C  CG  . PRO A 1 507 ? 45.487  30.756  13.440  1.00 3.60  ? 538 PRO A CG  1 
ATOM   4128  C  CD  . PRO A 1 507 ? 44.581  29.581  13.114  1.00 6.51  ? 538 PRO A CD  1 
ATOM   4129  N  N   . ILE A 1 508 ? 44.920  30.564  16.781  1.00 2.31  ? 539 ILE A N   1 
ATOM   4130  C  CA  . ILE A 1 508 ? 44.878  31.052  18.158  1.00 2.76  ? 539 ILE A CA  1 
ATOM   4131  C  C   . ILE A 1 508 ? 44.413  29.984  19.142  1.00 3.14  ? 539 ILE A C   1 
ATOM   4132  O  O   . ILE A 1 508 ? 44.460  30.165  20.358  1.00 2.00  ? 539 ILE A O   1 
ATOM   4133  C  CB  . ILE A 1 508 ? 44.029  32.318  18.306  1.00 2.06  ? 539 ILE A CB  1 
ATOM   4134  C  CG1 . ILE A 1 508 ? 42.559  31.972  18.304  1.00 2.39  ? 539 ILE A CG1 1 
ATOM   4135  C  CG2 . ILE A 1 508 ? 44.316  33.280  17.173  1.00 2.00  ? 539 ILE A CG2 1 
ATOM   4136  C  CD1 . ILE A 1 508 ? 41.813  32.715  19.368  1.00 4.18  ? 539 ILE A CD1 1 
ATOM   4137  N  N   . CYS A 1 509 ? 43.947  28.866  18.597  1.00 5.63  ? 540 CYS A N   1 
ATOM   4138  C  CA  . CYS A 1 509 ? 43.483  27.731  19.408  1.00 9.63  ? 540 CYS A CA  1 
ATOM   4139  C  C   . CYS A 1 509 ? 44.617  26.730  19.652  1.00 10.79 ? 540 CYS A C   1 
ATOM   4140  O  O   . CYS A 1 509 ? 44.507  25.857  20.539  1.00 13.28 ? 540 CYS A O   1 
ATOM   4141  C  CB  . CYS A 1 509 ? 42.318  26.997  18.724  1.00 10.07 ? 540 CYS A CB  1 
ATOM   4142  S  SG  . CYS A 1 509 ? 40.630  27.521  19.181  1.00 10.74 ? 540 CYS A SG  1 
ATOM   4143  N  N   . SER A 1 510 ? 45.677  26.828  18.840  1.00 8.11  ? 541 SER A N   1 
ATOM   4144  C  CA  . SER A 1 510 ? 46.824  25.945  18.960  1.00 5.39  ? 541 SER A CA  1 
ATOM   4145  C  C   . SER A 1 510 ? 47.714  26.282  20.160  1.00 7.70  ? 541 SER A C   1 
ATOM   4146  O  O   . SER A 1 510 ? 48.053  27.440  20.395  1.00 7.45  ? 541 SER A O   1 
ATOM   4147  C  CB  . SER A 1 510 ? 47.611  25.921  17.665  1.00 2.65  ? 541 SER A CB  1 
ATOM   4148  O  OG  . SER A 1 510 ? 48.194  27.160  17.380  1.00 5.50  ? 541 SER A OG  1 
ATOM   4149  N  N   . PRO A 1 511 ? 48.156  25.249  20.906  1.00 8.09  ? 542 PRO A N   1 
ATOM   4150  C  CA  . PRO A 1 511 ? 49.003  25.384  22.099  1.00 8.57  ? 542 PRO A CA  1 
ATOM   4151  C  C   . PRO A 1 511 ? 50.012  26.516  22.112  1.00 6.89  ? 542 PRO A C   1 
ATOM   4152  O  O   . PRO A 1 511 ? 50.154  27.211  23.118  1.00 2.00  ? 542 PRO A O   1 
ATOM   4153  C  CB  . PRO A 1 511 ? 49.658  23.999  22.221  1.00 3.19  ? 542 PRO A CB  1 
ATOM   4154  C  CG  . PRO A 1 511 ? 49.336  23.302  20.908  1.00 3.09  ? 542 PRO A CG  1 
ATOM   4155  C  CD  . PRO A 1 511 ? 48.004  23.823  20.560  1.00 9.28  ? 542 PRO A CD  1 
ATOM   4156  N  N   . GLN A 1 512 ? 50.643  26.762  20.972  1.00 9.92  ? 543 GLN A N   1 
ATOM   4157  C  CA  . GLN A 1 512 ? 51.652  27.809  20.937  1.00 14.67 ? 543 GLN A CA  1 
ATOM   4158  C  C   . GLN A 1 512 ? 50.999  29.185  21.091  1.00 12.38 ? 543 GLN A C   1 
ATOM   4159  O  O   . GLN A 1 512 ? 51.570  30.103  21.682  1.00 10.51 ? 543 GLN A O   1 
ATOM   4160  C  CB  . GLN A 1 512 ? 52.508  27.734  19.661  1.00 20.98 ? 543 GLN A CB  1 
ATOM   4161  C  CG  . GLN A 1 512 ? 52.635  26.339  19.020  1.00 20.82 ? 543 GLN A CG  1 
ATOM   4162  C  CD  . GLN A 1 512 ? 51.479  26.040  18.047  1.00 19.93 ? 543 GLN A CD  1 
ATOM   4163  O  OE1 . GLN A 1 512 ? 50.805  25.000  18.187  1.00 17.00 ? 543 GLN A OE1 1 
ATOM   4164  N  NE2 . GLN A 1 512 ? 51.251  26.947  17.055  1.00 2.39  ? 543 GLN A NE2 1 
ATOM   4165  N  N   . TYR A 1 513 ? 49.801  29.322  20.547  1.00 8.75  ? 544 TYR A N   1 
ATOM   4166  C  CA  . TYR A 1 513 ? 49.067  30.570  20.660  1.00 5.74  ? 544 TYR A CA  1 
ATOM   4167  C  C   . TYR A 1 513 ? 48.227  30.693  21.953  1.00 4.34  ? 544 TYR A C   1 
ATOM   4168  O  O   . TYR A 1 513 ? 48.137  31.763  22.527  1.00 4.50  ? 544 TYR A O   1 
ATOM   4169  C  CB  . TYR A 1 513 ? 48.153  30.737  19.466  1.00 2.00  ? 544 TYR A CB  1 
ATOM   4170  C  CG  . TYR A 1 513 ? 48.820  31.239  18.223  1.00 2.00  ? 544 TYR A CG  1 
ATOM   4171  C  CD1 . TYR A 1 513 ? 49.469  30.381  17.361  1.00 2.11  ? 544 TYR A CD1 1 
ATOM   4172  C  CD2 . TYR A 1 513 ? 48.713  32.564  17.862  1.00 2.49  ? 544 TYR A CD2 1 
ATOM   4173  C  CE1 . TYR A 1 513 ? 49.987  30.826  16.155  1.00 2.00  ? 544 TYR A CE1 1 
ATOM   4174  C  CE2 . TYR A 1 513 ? 49.225  33.018  16.669  1.00 2.00  ? 544 TYR A CE2 1 
ATOM   4175  C  CZ  . TYR A 1 513 ? 49.859  32.142  15.812  1.00 2.00  ? 544 TYR A CZ  1 
ATOM   4176  O  OH  . TYR A 1 513 ? 50.330  32.612  14.605  1.00 2.00  ? 544 TYR A OH  1 
ATOM   4177  N  N   . TRP A 1 514 ? 47.642  29.606  22.435  1.00 3.89  ? 545 TRP A N   1 
ATOM   4178  C  CA  . TRP A 1 514 ? 46.795  29.672  23.626  1.00 4.29  ? 545 TRP A CA  1 
ATOM   4179  C  C   . TRP A 1 514 ? 47.397  30.016  24.990  1.00 2.00  ? 545 TRP A C   1 
ATOM   4180  O  O   . TRP A 1 514 ? 47.410  29.190  25.903  1.00 2.00  ? 545 TRP A O   1 
ATOM   4181  C  CB  . TRP A 1 514 ? 45.930  28.404  23.738  1.00 8.05  ? 545 TRP A CB  1 
ATOM   4182  C  CG  . TRP A 1 514 ? 44.655  28.611  24.601  1.00 9.65  ? 545 TRP A CG  1 
ATOM   4183  C  CD1 . TRP A 1 514 ? 44.303  27.920  25.732  1.00 8.60  ? 545 TRP A CD1 1 
ATOM   4184  C  CD2 . TRP A 1 514 ? 43.614  29.600  24.402  1.00 8.74  ? 545 TRP A CD2 1 
ATOM   4185  N  NE1 . TRP A 1 514 ? 43.121  28.420  26.249  1.00 7.66  ? 545 TRP A NE1 1 
ATOM   4186  C  CE2 . TRP A 1 514 ? 42.681  29.447  25.456  1.00 7.45  ? 545 TRP A CE2 1 
ATOM   4187  C  CE3 . TRP A 1 514 ? 43.387  30.587  23.438  1.00 5.76  ? 545 TRP A CE3 1 
ATOM   4188  C  CZ2 . TRP A 1 514 ? 41.542  30.251  25.571  1.00 3.09  ? 545 TRP A CZ2 1 
ATOM   4189  C  CZ3 . TRP A 1 514 ? 42.260  31.371  23.556  1.00 7.19  ? 545 TRP A CZ3 1 
ATOM   4190  C  CH2 . TRP A 1 514 ? 41.348  31.200  24.617  1.00 3.15  ? 545 TRP A CH2 1 
ATOM   4191  N  N   . LYS A 1 515 ? 47.828  31.256  25.148  1.00 2.00  ? 546 LYS A N   1 
ATOM   4192  C  CA  . LYS A 1 515 ? 48.400  31.705  26.407  1.00 2.85  ? 546 LYS A CA  1 
ATOM   4193  C  C   . LYS A 1 515 ? 48.460  33.233  26.486  1.00 3.14  ? 546 LYS A C   1 
ATOM   4194  O  O   . LYS A 1 515 ? 48.683  33.926  25.472  1.00 2.00  ? 546 LYS A O   1 
ATOM   4195  C  CB  . LYS A 1 515 ? 49.772  31.079  26.655  1.00 7.06  ? 546 LYS A CB  1 
ATOM   4196  C  CG  . LYS A 1 515 ? 50.793  31.257  25.553  1.00 13.20 ? 546 LYS A CG  1 
ATOM   4197  C  CD  . LYS A 1 515 ? 52.041  30.478  25.931  1.00 18.15 ? 546 LYS A CD  1 
ATOM   4198  C  CE  . LYS A 1 515 ? 53.203  30.697  24.955  1.00 24.82 ? 546 LYS A CE  1 
ATOM   4199  N  NZ  . LYS A 1 515 ? 54.455  29.976  25.409  1.00 24.61 ? 546 LYS A NZ  1 
ATOM   4200  N  N   . PRO A 1 516 ? 48.307  33.770  27.711  1.00 2.00  ? 547 PRO A N   1 
ATOM   4201  C  CA  . PRO A 1 516 ? 48.303  35.174  28.072  1.00 2.00  ? 547 PRO A CA  1 
ATOM   4202  C  C   . PRO A 1 516 ? 49.085  36.115  27.180  1.00 2.00  ? 547 PRO A C   1 
ATOM   4203  O  O   . PRO A 1 516 ? 48.569  37.108  26.662  1.00 3.42  ? 547 PRO A O   1 
ATOM   4204  C  CB  . PRO A 1 516 ? 48.848  35.133  29.478  1.00 2.00  ? 547 PRO A CB  1 
ATOM   4205  C  CG  . PRO A 1 516 ? 48.233  33.977  30.016  1.00 2.00  ? 547 PRO A CG  1 
ATOM   4206  C  CD  . PRO A 1 516 ? 48.411  32.961  28.934  1.00 2.00  ? 547 PRO A CD  1 
ATOM   4207  N  N   . SER A 1 517 ? 50.340  35.797  26.986  1.00 2.00  ? 548 SER A N   1 
ATOM   4208  C  CA  . SER A 1 517 ? 51.176  36.629  26.172  1.00 2.69  ? 548 SER A CA  1 
ATOM   4209  C  C   . SER A 1 517 ? 50.621  36.903  24.794  1.00 2.03  ? 548 SER A C   1 
ATOM   4210  O  O   . SER A 1 517 ? 50.618  38.044  24.364  1.00 3.74  ? 548 SER A O   1 
ATOM   4211  C  CB  . SER A 1 517 ? 52.563  36.010  26.090  1.00 4.04  ? 548 SER A CB  1 
ATOM   4212  O  OG  . SER A 1 517 ? 53.072  35.864  27.403  1.00 3.94  ? 548 SER A OG  1 
ATOM   4213  N  N   . THR A 1 518 ? 50.074  35.886  24.142  1.00 2.00  ? 549 THR A N   1 
ATOM   4214  C  CA  . THR A 1 518 ? 49.563  36.054  22.799  1.00 2.00  ? 549 THR A CA  1 
ATOM   4215  C  C   . THR A 1 518 ? 48.600  37.204  22.732  1.00 4.61  ? 549 THR A C   1 
ATOM   4216  O  O   . THR A 1 518 ? 48.636  38.000  21.776  1.00 6.79  ? 549 THR A O   1 
ATOM   4217  C  CB  . THR A 1 518 ? 48.847  34.801  22.326  1.00 2.00  ? 549 THR A CB  1 
ATOM   4218  O  OG1 . THR A 1 518 ? 49.637  33.678  22.682  1.00 6.00  ? 549 THR A OG1 1 
ATOM   4219  C  CG2 . THR A 1 518 ? 48.657  34.790  20.811  1.00 2.00  ? 549 THR A CG2 1 
ATOM   4220  N  N   . PHE A 1 519 ? 47.829  37.358  23.810  1.00 5.65  ? 550 PHE A N   1 
ATOM   4221  C  CA  . PHE A 1 519 ? 46.784  38.387  23.879  1.00 6.33  ? 550 PHE A CA  1 
ATOM   4222  C  C   . PHE A 1 519 ? 47.092  39.706  24.595  1.00 4.81  ? 550 PHE A C   1 
ATOM   4223  O  O   . PHE A 1 519 ? 46.206  40.534  24.806  1.00 7.04  ? 550 PHE A O   1 
ATOM   4224  C  CB  . PHE A 1 519 ? 45.471  37.750  24.386  1.00 3.00  ? 550 PHE A CB  1 
ATOM   4225  C  CG  . PHE A 1 519 ? 45.138  36.469  23.700  1.00 2.00  ? 550 PHE A CG  1 
ATOM   4226  C  CD1 . PHE A 1 519 ? 44.870  36.449  22.331  1.00 2.00  ? 550 PHE A CD1 1 
ATOM   4227  C  CD2 . PHE A 1 519 ? 45.186  35.270  24.398  1.00 2.00  ? 550 PHE A CD2 1 
ATOM   4228  C  CE1 . PHE A 1 519 ? 44.662  35.237  21.669  1.00 4.45  ? 550 PHE A CE1 1 
ATOM   4229  C  CE2 . PHE A 1 519 ? 44.981  34.056  23.755  1.00 2.00  ? 550 PHE A CE2 1 
ATOM   4230  C  CZ  . PHE A 1 519 ? 44.720  34.029  22.391  1.00 2.00  ? 550 PHE A CZ  1 
ATOM   4231  N  N   . GLY A 1 520 ? 48.349  39.926  24.923  1.00 3.85  ? 551 GLY A N   1 
ATOM   4232  C  CA  . GLY A 1 520 ? 48.704  41.167  25.569  1.00 4.04  ? 551 GLY A CA  1 
ATOM   4233  C  C   . GLY A 1 520 ? 48.753  41.126  27.073  1.00 4.20  ? 551 GLY A C   1 
ATOM   4234  O  O   . GLY A 1 520 ? 49.023  42.158  27.679  1.00 3.30  ? 551 GLY A O   1 
ATOM   4235  N  N   . GLY A 1 521 ? 48.505  39.966  27.680  1.00 5.16  ? 552 GLY A N   1 
ATOM   4236  C  CA  . GLY A 1 521 ? 48.564  39.873  29.131  1.00 7.36  ? 552 GLY A CA  1 
ATOM   4237  C  C   . GLY A 1 521 ? 47.579  38.868  29.694  1.00 10.19 ? 552 GLY A C   1 
ATOM   4238  O  O   . GLY A 1 521 ? 47.189  37.941  28.999  1.00 10.02 ? 552 GLY A O   1 
ATOM   4239  N  N   . GLU A 1 522 ? 47.241  38.996  30.975  1.00 12.19 ? 553 GLU A N   1 
ATOM   4240  C  CA  . GLU A 1 522 ? 46.260  38.101  31.597  1.00 13.66 ? 553 GLU A CA  1 
ATOM   4241  C  C   . GLU A 1 522 ? 44.856  38.789  31.458  1.00 12.92 ? 553 GLU A C   1 
ATOM   4242  O  O   . GLU A 1 522 ? 43.788  38.127  31.508  1.00 9.27  ? 553 GLU A O   1 
ATOM   4243  C  CB  . GLU A 1 522 ? 46.632  37.833  33.064  1.00 14.94 ? 553 GLU A CB  1 
ATOM   4244  C  CG  . GLU A 1 522 ? 46.095  36.508  33.633  1.00 21.26 ? 553 GLU A CG  1 
ATOM   4245  C  CD  . GLU A 1 522 ? 46.816  35.278  33.064  1.00 25.03 ? 553 GLU A CD  1 
ATOM   4246  O  OE1 . GLU A 1 522 ? 48.037  35.370  32.836  1.00 27.61 ? 553 GLU A OE1 1 
ATOM   4247  O  OE2 . GLU A 1 522 ? 46.174  34.218  32.850  1.00 26.63 ? 553 GLU A OE2 1 
ATOM   4248  N  N   . VAL A 1 523 ? 44.901  40.117  31.259  1.00 9.33  ? 554 VAL A N   1 
ATOM   4249  C  CA  . VAL A 1 523 ? 43.721  40.945  31.021  1.00 7.16  ? 554 VAL A CA  1 
ATOM   4250  C  C   . VAL A 1 523 ? 43.143  40.518  29.663  1.00 5.16  ? 554 VAL A C   1 
ATOM   4251  O  O   . VAL A 1 523 ? 42.184  39.765  29.607  1.00 7.36  ? 554 VAL A O   1 
ATOM   4252  C  CB  . VAL A 1 523 ? 44.105  42.434  30.947  1.00 7.98  ? 554 VAL A CB  1 
ATOM   4253  C  CG1 . VAL A 1 523 ? 43.056  43.230  30.170  1.00 6.56  ? 554 VAL A CG1 1 
ATOM   4254  C  CG2 . VAL A 1 523 ? 44.256  42.986  32.344  1.00 5.65  ? 554 VAL A CG2 1 
ATOM   4255  N  N   . GLY A 1 524 ? 43.772  40.945  28.576  1.00 3.09  ? 555 GLY A N   1 
ATOM   4256  C  CA  . GLY A 1 524 ? 43.300  40.561  27.267  1.00 2.49  ? 555 GLY A CA  1 
ATOM   4257  C  C   . GLY A 1 524 ? 42.985  39.072  27.149  1.00 2.43  ? 555 GLY A C   1 
ATOM   4258  O  O   . GLY A 1 524 ? 42.222  38.696  26.277  1.00 5.75  ? 555 GLY A O   1 
ATOM   4259  N  N   . PHE A 1 525 ? 43.547  38.220  28.002  1.00 2.35  ? 556 PHE A N   1 
ATOM   4260  C  CA  . PHE A 1 525 ? 43.259  36.788  27.923  1.00 4.22  ? 556 PHE A CA  1 
ATOM   4261  C  C   . PHE A 1 525 ? 41.885  36.520  28.473  1.00 6.99  ? 556 PHE A C   1 
ATOM   4262  O  O   . PHE A 1 525 ? 41.179  35.657  27.970  1.00 8.24  ? 556 PHE A O   1 
ATOM   4263  C  CB  . PHE A 1 525 ? 44.235  35.947  28.719  1.00 3.75  ? 556 PHE A CB  1 
ATOM   4264  C  CG  . PHE A 1 525 ? 44.149  34.486  28.409  1.00 2.00  ? 556 PHE A CG  1 
ATOM   4265  C  CD1 . PHE A 1 525 ? 43.962  34.056  27.117  1.00 2.00  ? 556 PHE A CD1 1 
ATOM   4266  C  CD2 . PHE A 1 525 ? 44.314  33.545  29.411  1.00 2.00  ? 556 PHE A CD2 1 
ATOM   4267  C  CE1 . PHE A 1 525 ? 43.942  32.717  26.823  1.00 2.02  ? 556 PHE A CE1 1 
ATOM   4268  C  CE2 . PHE A 1 525 ? 44.297  32.198  29.135  1.00 2.00  ? 556 PHE A CE2 1 
ATOM   4269  C  CZ  . PHE A 1 525 ? 44.111  31.780  27.834  1.00 3.46  ? 556 PHE A CZ  1 
ATOM   4270  N  N   . LYS A 1 526 ? 41.529  37.198  29.555  1.00 7.09  ? 557 LYS A N   1 
ATOM   4271  C  CA  . LYS A 1 526 ? 40.208  37.017  30.094  1.00 6.79  ? 557 LYS A CA  1 
ATOM   4272  C  C   . LYS A 1 526 ? 39.143  37.723  29.272  1.00 3.37  ? 557 LYS A C   1 
ATOM   4273  O  O   . LYS A 1 526 ? 37.983  37.334  29.293  1.00 4.66  ? 557 LYS A O   1 
ATOM   4274  C  CB  . LYS A 1 526 ? 40.164  37.378  31.562  1.00 13.70 ? 557 LYS A CB  1 
ATOM   4275  C  CG  . LYS A 1 526 ? 40.100  36.102  32.457  1.00 27.72 ? 557 LYS A CG  1 
ATOM   4276  C  CD  . LYS A 1 526 ? 41.188  35.031  32.119  1.00 31.65 ? 557 LYS A CD  1 
ATOM   4277  C  CE  . LYS A 1 526 ? 42.612  35.501  32.497  1.00 35.60 ? 557 LYS A CE  1 
ATOM   4278  N  NZ  . LYS A 1 526 ? 42.758  35.832  33.966  1.00 34.04 ? 557 LYS A NZ  1 
ATOM   4279  N  N   . ILE A 1 527 ? 39.530  38.733  28.511  1.00 4.02  ? 558 ILE A N   1 
ATOM   4280  C  CA  . ILE A 1 527 ? 38.576  39.399  27.644  1.00 5.15  ? 558 ILE A CA  1 
ATOM   4281  C  C   . ILE A 1 527 ? 38.009  38.271  26.787  1.00 5.79  ? 558 ILE A C   1 
ATOM   4282  O  O   . ILE A 1 527 ? 36.779  38.106  26.705  1.00 8.13  ? 558 ILE A O   1 
ATOM   4283  C  CB  . ILE A 1 527 ? 39.227  40.502  26.757  1.00 5.31  ? 558 ILE A CB  1 
ATOM   4284  C  CG1 . ILE A 1 527 ? 39.631  41.690  27.630  1.00 8.93  ? 558 ILE A CG1 1 
ATOM   4285  C  CG2 . ILE A 1 527 ? 38.246  41.019  25.709  1.00 8.29  ? 558 ILE A CG2 1 
ATOM   4286  C  CD1 . ILE A 1 527 ? 39.911  42.974  26.827  1.00 10.06 ? 558 ILE A CD1 1 
ATOM   4287  N  N   . ILE A 1 528 ? 38.890  37.455  26.209  1.00 2.38  ? 559 ILE A N   1 
ATOM   4288  C  CA  . ILE A 1 528 ? 38.414  36.319  25.428  1.00 4.85  ? 559 ILE A CA  1 
ATOM   4289  C  C   . ILE A 1 528 ? 37.622  35.348  26.346  1.00 7.26  ? 559 ILE A C   1 
ATOM   4290  O  O   . ILE A 1 528 ? 36.483  34.963  26.053  1.00 9.11  ? 559 ILE A O   1 
ATOM   4291  C  CB  . ILE A 1 528 ? 39.561  35.507  24.821  1.00 3.23  ? 559 ILE A CB  1 
ATOM   4292  C  CG1 . ILE A 1 528 ? 40.335  36.345  23.824  1.00 2.33  ? 559 ILE A CG1 1 
ATOM   4293  C  CG2 . ILE A 1 528 ? 39.013  34.239  24.142  1.00 2.45  ? 559 ILE A CG2 1 
ATOM   4294  C  CD1 . ILE A 1 528 ? 41.471  35.582  23.203  1.00 2.00  ? 559 ILE A CD1 1 
ATOM   4295  N  N   . ASN A 1 529 ? 38.198  35.017  27.492  1.00 6.17  ? 560 ASN A N   1 
ATOM   4296  C  CA  . ASN A 1 529 ? 37.570  34.074  28.392  1.00 6.90  ? 560 ASN A CA  1 
ATOM   4297  C  C   . ASN A 1 529 ? 36.275  34.465  29.049  1.00 7.26  ? 560 ASN A C   1 
ATOM   4298  O  O   . ASN A 1 529 ? 35.715  33.658  29.783  1.00 9.62  ? 560 ASN A O   1 
ATOM   4299  C  CB  . ASN A 1 529 ? 38.557  33.589  29.453  1.00 12.03 ? 560 ASN A CB  1 
ATOM   4300  C  CG  . ASN A 1 529 ? 39.791  32.910  28.849  1.00 17.56 ? 560 ASN A CG  1 
ATOM   4301  O  OD1 . ASN A 1 529 ? 39.685  32.054  27.943  1.00 13.09 ? 560 ASN A OD1 1 
ATOM   4302  N  ND2 . ASN A 1 529 ? 40.978  33.306  29.341  1.00 17.39 ? 560 ASN A ND2 1 
ATOM   4303  N  N   . THR A 1 530 ? 35.793  35.685  28.834  1.00 8.41  ? 561 THR A N   1 
ATOM   4304  C  CA  . THR A 1 530 ? 34.519  36.091  29.442  1.00 7.55  ? 561 THR A CA  1 
ATOM   4305  C  C   . THR A 1 530 ? 33.552  36.674  28.429  1.00 7.94  ? 561 THR A C   1 
ATOM   4306  O  O   . THR A 1 530 ? 32.495  37.174  28.792  1.00 9.38  ? 561 THR A O   1 
ATOM   4307  C  CB  . THR A 1 530 ? 34.699  37.089  30.590  1.00 4.67  ? 561 THR A CB  1 
ATOM   4308  O  OG1 . THR A 1 530 ? 35.406  38.235  30.118  1.00 3.49  ? 561 THR A OG1 1 
ATOM   4309  C  CG2 . THR A 1 530 ? 35.477  36.465  31.712  1.00 5.43  ? 561 THR A CG2 1 
ATOM   4310  N  N   . ALA A 1 531 ? 33.896  36.567  27.153  1.00 8.29  ? 562 ALA A N   1 
ATOM   4311  C  CA  . ALA A 1 531 ? 33.050  37.090  26.089  1.00 9.63  ? 562 ALA A CA  1 
ATOM   4312  C  C   . ALA A 1 531 ? 31.627  36.508  26.108  1.00 10.58 ? 562 ALA A C   1 
ATOM   4313  O  O   . ALA A 1 531 ? 31.419  35.339  26.464  1.00 11.73 ? 562 ALA A O   1 
ATOM   4314  C  CB  . ALA A 1 531 ? 33.706  36.835  24.736  1.00 10.75 ? 562 ALA A CB  1 
ATOM   4315  N  N   . SER A 1 532 ? 30.652  37.333  25.717  1.00 9.34  ? 563 SER A N   1 
ATOM   4316  C  CA  . SER A 1 532 ? 29.248  36.940  25.654  1.00 4.66  ? 563 SER A CA  1 
ATOM   4317  C  C   . SER A 1 532 ? 28.520  37.900  24.767  1.00 2.97  ? 563 SER A C   1 
ATOM   4318  O  O   . SER A 1 532 ? 28.903  39.046  24.669  1.00 3.38  ? 563 SER A O   1 
ATOM   4319  C  CB  . SER A 1 532 ? 28.620  36.958  27.044  1.00 6.72  ? 563 SER A CB  1 
ATOM   4320  O  OG  . SER A 1 532 ? 28.820  38.187  27.707  1.00 4.10  ? 563 SER A OG  1 
ATOM   4321  N  N   . ILE A 1 533 ? 27.453  37.446  24.131  1.00 4.89  ? 564 ILE A N   1 
ATOM   4322  C  CA  . ILE A 1 533 ? 26.657  38.313  23.257  1.00 4.31  ? 564 ILE A CA  1 
ATOM   4323  C  C   . ILE A 1 533 ? 26.030  39.421  24.092  1.00 4.08  ? 564 ILE A C   1 
ATOM   4324  O  O   . ILE A 1 533 ? 25.839  40.535  23.587  1.00 2.00  ? 564 ILE A O   1 
ATOM   4325  C  CB  . ILE A 1 533 ? 25.600  37.518  22.432  1.00 2.29  ? 564 ILE A CB  1 
ATOM   4326  C  CG1 . ILE A 1 533 ? 24.905  38.426  21.444  1.00 2.00  ? 564 ILE A CG1 1 
ATOM   4327  C  CG2 . ILE A 1 533 ? 24.616  36.814  23.332  1.00 2.00  ? 564 ILE A CG2 1 
ATOM   4328  C  CD1 . ILE A 1 533 ? 25.825  38.993  20.435  1.00 2.00  ? 564 ILE A CD1 1 
ATOM   4329  N  N   . GLN A 1 534 ? 25.808  39.146  25.385  1.00 5.81  ? 565 GLN A N   1 
ATOM   4330  C  CA  . GLN A 1 534 ? 25.258  40.160  26.300  1.00 10.58 ? 565 GLN A CA  1 
ATOM   4331  C  C   . GLN A 1 534 ? 26.298  41.233  26.576  1.00 6.93  ? 565 GLN A C   1 
ATOM   4332  O  O   . GLN A 1 534 ? 25.999  42.427  26.584  1.00 5.74  ? 565 GLN A O   1 
ATOM   4333  C  CB  . GLN A 1 534 ? 24.764  39.554  27.625  1.00 16.73 ? 565 GLN A CB  1 
ATOM   4334  C  CG  . GLN A 1 534 ? 24.207  40.601  28.653  1.00 25.07 ? 565 GLN A CG  1 
ATOM   4335  C  CD  . GLN A 1 534 ? 23.073  41.522  28.104  1.00 28.49 ? 565 GLN A CD  1 
ATOM   4336  O  OE1 . GLN A 1 534 ? 21.917  41.111  27.956  1.00 30.26 ? 565 GLN A OE1 1 
ATOM   4337  N  NE2 . GLN A 1 534 ? 23.420  42.775  27.821  1.00 31.61 ? 565 GLN A NE2 1 
ATOM   4338  N  N   . SER A 1 535 ? 27.532  40.807  26.776  1.00 7.18  ? 566 SER A N   1 
ATOM   4339  C  CA  . SER A 1 535 ? 28.595  41.759  27.014  1.00 7.63  ? 566 SER A CA  1 
ATOM   4340  C  C   . SER A 1 535 ? 28.996  42.521  25.786  1.00 3.21  ? 566 SER A C   1 
ATOM   4341  O  O   . SER A 1 535 ? 29.314  43.703  25.887  1.00 2.34  ? 566 SER A O   1 
ATOM   4342  C  CB  . SER A 1 535 ? 29.803  41.109  27.651  1.00 9.89  ? 566 SER A CB  1 
ATOM   4343  O  OG  . SER A 1 535 ? 29.795  41.383  29.053  1.00 18.96 ? 566 SER A OG  1 
ATOM   4344  N  N   . LEU A 1 536 ? 28.922  41.887  24.621  1.00 2.00  ? 567 LEU A N   1 
ATOM   4345  C  CA  . LEU A 1 536 ? 29.295  42.572  23.381  1.00 2.00  ? 567 LEU A CA  1 
ATOM   4346  C  C   . LEU A 1 536 ? 28.438  43.820  23.235  1.00 2.00  ? 567 LEU A C   1 
ATOM   4347  O  O   . LEU A 1 536 ? 28.939  44.902  23.005  1.00 2.02  ? 567 LEU A O   1 
ATOM   4348  C  CB  . LEU A 1 536 ? 29.106  41.688  22.154  1.00 2.00  ? 567 LEU A CB  1 
ATOM   4349  C  CG  . LEU A 1 536 ? 29.949  42.161  20.975  1.00 2.00  ? 567 LEU A CG  1 
ATOM   4350  C  CD1 . LEU A 1 536 ? 31.355  41.644  21.204  1.00 5.70  ? 567 LEU A CD1 1 
ATOM   4351  C  CD2 . LEU A 1 536 ? 29.447  41.674  19.636  1.00 2.03  ? 567 LEU A CD2 1 
ATOM   4352  N  N   . ILE A 1 537 ? 27.146  43.664  23.464  1.00 2.38  ? 568 ILE A N   1 
ATOM   4353  C  CA  . ILE A 1 537 ? 26.216  44.761  23.363  1.00 2.00  ? 568 ILE A CA  1 
ATOM   4354  C  C   . ILE A 1 537 ? 26.264  45.690  24.574  1.00 3.76  ? 568 ILE A C   1 
ATOM   4355  O  O   . ILE A 1 537 ? 26.131  46.906  24.439  1.00 2.90  ? 568 ILE A O   1 
ATOM   4356  C  CB  . ILE A 1 537 ? 24.814  44.227  23.136  1.00 2.00  ? 568 ILE A CB  1 
ATOM   4357  C  CG1 . ILE A 1 537 ? 24.519  44.216  21.638  1.00 3.42  ? 568 ILE A CG1 1 
ATOM   4358  C  CG2 . ILE A 1 537 ? 23.790  45.048  23.864  1.00 2.94  ? 568 ILE A CG2 1 
ATOM   4359  C  CD1 . ILE A 1 537 ? 25.261  43.147  20.852  1.00 6.19  ? 568 ILE A CD1 1 
ATOM   4360  N  N   . CYS A 1 538 ? 26.465  45.122  25.754  1.00 4.78  ? 569 CYS A N   1 
ATOM   4361  C  CA  . CYS A 1 538 ? 26.527  45.902  26.980  1.00 6.10  ? 569 CYS A CA  1 
ATOM   4362  C  C   . CYS A 1 538 ? 27.578  46.993  26.883  1.00 4.91  ? 569 CYS A C   1 
ATOM   4363  O  O   . CYS A 1 538 ? 27.291  48.168  26.982  1.00 5.13  ? 569 CYS A O   1 
ATOM   4364  C  CB  . CYS A 1 538 ? 26.887  44.979  28.125  1.00 8.82  ? 569 CYS A CB  1 
ATOM   4365  S  SG  . CYS A 1 538 ? 25.871  45.207  29.598  1.00 16.45 ? 569 CYS A SG  1 
ATOM   4366  N  N   . ASN A 1 539 ? 28.793  46.564  26.597  1.00 6.85  ? 570 ASN A N   1 
ATOM   4367  C  CA  . ASN A 1 539 ? 29.949  47.428  26.489  1.00 4.82  ? 570 ASN A CA  1 
ATOM   4368  C  C   . ASN A 1 539 ? 29.916  48.360  25.308  1.00 4.68  ? 570 ASN A C   1 
ATOM   4369  O  O   . ASN A 1 539 ? 30.546  49.407  25.344  1.00 7.48  ? 570 ASN A O   1 
ATOM   4370  C  CB  . ASN A 1 539 ? 31.214  46.569  26.366  1.00 2.00  ? 570 ASN A CB  1 
ATOM   4371  C  CG  . ASN A 1 539 ? 31.456  45.705  27.584  1.00 2.99  ? 570 ASN A CG  1 
ATOM   4372  O  OD1 . ASN A 1 539 ? 31.427  46.167  28.726  1.00 4.76  ? 570 ASN A OD1 1 
ATOM   4373  N  ND2 . ASN A 1 539 ? 31.685  44.439  27.349  1.00 3.17  ? 570 ASN A ND2 1 
ATOM   4374  N  N   . ASN A 1 540 ? 29.222  47.980  24.247  1.00 2.56  ? 571 ASN A N   1 
ATOM   4375  C  CA  . ASN A 1 540 ? 29.220  48.802  23.053  1.00 3.43  ? 571 ASN A CA  1 
ATOM   4376  C  C   . ASN A 1 540 ? 27.930  49.467  22.679  1.00 4.14  ? 571 ASN A C   1 
ATOM   4377  O  O   . ASN A 1 540 ? 27.907  50.361  21.842  1.00 6.05  ? 571 ASN A O   1 
ATOM   4378  C  CB  . ASN A 1 540 ? 29.766  48.004  21.879  1.00 4.33  ? 571 ASN A CB  1 
ATOM   4379  C  CG  . ASN A 1 540 ? 31.156  47.501  22.143  1.00 7.73  ? 571 ASN A CG  1 
ATOM   4380  O  OD1 . ASN A 1 540 ? 32.086  48.291  22.305  1.00 9.12  ? 571 ASN A OD1 1 
ATOM   4381  N  ND2 . ASN A 1 540 ? 31.301  46.190  22.289  1.00 9.23  ? 571 ASN A ND2 1 
ATOM   4382  N  N   . VAL A 1 541 ? 26.845  49.075  23.311  1.00 6.01  ? 572 VAL A N   1 
ATOM   4383  C  CA  . VAL A 1 541 ? 25.586  49.706  22.989  1.00 8.63  ? 572 VAL A CA  1 
ATOM   4384  C  C   . VAL A 1 541 ? 25.144  50.661  24.099  1.00 9.10  ? 572 VAL A C   1 
ATOM   4385  O  O   . VAL A 1 541 ? 25.222  50.360  25.296  1.00 6.84  ? 572 VAL A O   1 
ATOM   4386  C  CB  . VAL A 1 541 ? 24.504  48.688  22.641  1.00 9.88  ? 572 VAL A CB  1 
ATOM   4387  C  CG1 . VAL A 1 541 ? 23.316  49.398  21.998  1.00 9.27  ? 572 VAL A CG1 1 
ATOM   4388  C  CG2 . VAL A 1 541 ? 25.082  47.653  21.672  1.00 12.84 ? 572 VAL A CG2 1 
ATOM   4389  N  N   . LYS A 1 542 ? 24.660  51.812  23.663  1.00 10.23 ? 573 LYS A N   1 
ATOM   4390  C  CA  . LYS A 1 542 ? 24.221  52.890  24.526  1.00 12.98 ? 573 LYS A CA  1 
ATOM   4391  C  C   . LYS A 1 542 ? 23.736  52.702  25.966  1.00 12.43 ? 573 LYS A C   1 
ATOM   4392  O  O   . LYS A 1 542 ? 23.966  53.597  26.783  1.00 15.80 ? 573 LYS A O   1 
ATOM   4393  C  CB  . LYS A 1 542 ? 23.248  53.785  23.769  1.00 19.12 ? 573 LYS A CB  1 
ATOM   4394  C  CG  . LYS A 1 542 ? 22.934  55.094  24.484  1.00 22.50 ? 573 LYS A CG  1 
ATOM   4395  C  CD  . LYS A 1 542 ? 24.208  55.815  24.883  1.00 20.99 ? 573 LYS A CD  1 
ATOM   4396  C  CE  . LYS A 1 542 ? 23.888  57.241  25.304  1.00 26.68 ? 573 LYS A CE  1 
ATOM   4397  N  NZ  . LYS A 1 542 ? 23.307  58.069  24.165  1.00 30.94 ? 573 LYS A NZ  1 
ATOM   4398  N  N   . GLY A 1 543 ? 23.038  51.625  26.303  1.00 10.19 ? 574 GLY A N   1 
ATOM   4399  C  CA  . GLY A 1 543 ? 22.611  51.493  27.690  1.00 10.30 ? 574 GLY A CA  1 
ATOM   4400  C  C   . GLY A 1 543 ? 22.479  50.057  28.143  1.00 12.93 ? 574 GLY A C   1 
ATOM   4401  O  O   . GLY A 1 543 ? 21.430  49.658  28.662  1.00 17.70 ? 574 GLY A O   1 
ATOM   4402  N  N   . CYS A 1 544 ? 23.531  49.266  27.948  1.00 10.84 ? 575 CYS A N   1 
ATOM   4403  C  CA  . CYS A 1 544 ? 23.504  47.846  28.305  1.00 9.40  ? 575 CYS A CA  1 
ATOM   4404  C  C   . CYS A 1 544 ? 22.152  47.142  28.089  1.00 7.77  ? 575 CYS A C   1 
ATOM   4405  O  O   . CYS A 1 544 ? 21.609  46.484  28.991  1.00 8.37  ? 575 CYS A O   1 
ATOM   4406  C  CB  . CYS A 1 544 ? 24.019  47.597  29.720  1.00 11.11 ? 575 CYS A CB  1 
ATOM   4407  S  SG  . CYS A 1 544 ? 25.802  47.223  29.786  1.00 20.01 ? 575 CYS A SG  1 
ATOM   4408  N  N   . PRO A 1 545 ? 21.564  47.335  26.899  1.00 3.02  ? 576 PRO A N   1 
ATOM   4409  C  CA  . PRO A 1 545 ? 20.307  46.727  26.540  1.00 2.66  ? 576 PRO A CA  1 
ATOM   4410  C  C   . PRO A 1 545 ? 20.428  45.220  26.756  1.00 4.65  ? 576 PRO A C   1 
ATOM   4411  O  O   . PRO A 1 545 ? 21.456  44.630  26.399  1.00 6.78  ? 576 PRO A O   1 
ATOM   4412  C  CB  . PRO A 1 545 ? 20.269  46.980  25.039  1.00 2.00  ? 576 PRO A CB  1 
ATOM   4413  C  CG  . PRO A 1 545 ? 20.904  48.244  24.914  1.00 2.00  ? 576 PRO A CG  1 
ATOM   4414  C  CD  . PRO A 1 545 ? 22.093  48.086  25.749  1.00 2.24  ? 576 PRO A CD  1 
ATOM   4415  N  N   . PHE A 1 546 ? 19.419  44.592  27.350  1.00 4.88  ? 577 PHE A N   1 
ATOM   4416  C  CA  . PHE A 1 546 ? 19.469  43.152  27.501  1.00 4.89  ? 577 PHE A CA  1 
ATOM   4417  C  C   . PHE A 1 546 ? 19.330  42.535  26.101  1.00 3.57  ? 577 PHE A C   1 
ATOM   4418  O  O   . PHE A 1 546 ? 18.662  43.087  25.237  1.00 2.04  ? 577 PHE A O   1 
ATOM   4419  C  CB  . PHE A 1 546 ? 18.342  42.667  28.386  1.00 9.34  ? 577 PHE A CB  1 
ATOM   4420  C  CG  . PHE A 1 546 ? 17.930  41.260  28.096  1.00 13.47 ? 577 PHE A CG  1 
ATOM   4421  C  CD1 . PHE A 1 546 ? 18.655  40.199  28.614  1.00 16.41 ? 577 PHE A CD1 1 
ATOM   4422  C  CD2 . PHE A 1 546 ? 16.870  40.998  27.233  1.00 15.78 ? 577 PHE A CD2 1 
ATOM   4423  C  CE1 . PHE A 1 546 ? 18.343  38.901  28.276  1.00 16.95 ? 577 PHE A CE1 1 
ATOM   4424  C  CE2 . PHE A 1 546 ? 16.541  39.698  26.886  1.00 18.46 ? 577 PHE A CE2 1 
ATOM   4425  C  CZ  . PHE A 1 546 ? 17.283  38.646  27.407  1.00 19.92 ? 577 PHE A CZ  1 
ATOM   4426  N  N   . THR A 1 547 ? 19.987  41.408  25.867  1.00 4.66  ? 578 THR A N   1 
ATOM   4427  C  CA  . THR A 1 547 ? 19.909  40.764  24.562  1.00 3.54  ? 578 THR A CA  1 
ATOM   4428  C  C   . THR A 1 547 ? 19.982  39.279  24.729  1.00 2.99  ? 578 THR A C   1 
ATOM   4429  O  O   . THR A 1 547 ? 20.110  38.760  25.831  1.00 2.00  ? 578 THR A O   1 
ATOM   4430  C  CB  . THR A 1 547 ? 21.114  41.116  23.678  1.00 2.00  ? 578 THR A CB  1 
ATOM   4431  O  OG1 . THR A 1 547 ? 21.961  42.035  24.368  1.00 2.10  ? 578 THR A OG1 1 
ATOM   4432  C  CG2 . THR A 1 547 ? 20.660  41.695  22.366  1.00 2.04  ? 578 THR A CG2 1 
ATOM   4433  N  N   . SER A 1 548 ? 19.881  38.607  23.605  1.00 2.00  ? 579 SER A N   1 
ATOM   4434  C  CA  . SER A 1 548 ? 20.003  37.180  23.548  1.00 4.81  ? 579 SER A CA  1 
ATOM   4435  C  C   . SER A 1 548 ? 19.623  36.755  22.171  1.00 8.44  ? 579 SER A C   1 
ATOM   4436  O  O   . SER A 1 548 ? 19.144  37.572  21.380  1.00 7.08  ? 579 SER A O   1 
ATOM   4437  C  CB  . SER A 1 548 ? 19.129  36.462  24.540  1.00 3.68  ? 579 SER A CB  1 
ATOM   4438  O  OG  . SER A 1 548 ? 19.440  35.079  24.425  1.00 7.36  ? 579 SER A OG  1 
ATOM   4439  N  N   . PHE A 1 549 ? 19.870  35.488  21.865  1.00 11.71 ? 580 PHE A N   1 
ATOM   4440  C  CA  . PHE A 1 549 ? 19.531  34.989  20.547  1.00 16.32 ? 580 PHE A CA  1 
ATOM   4441  C  C   . PHE A 1 549 ? 18.148  34.358  20.612  1.00 17.36 ? 580 PHE A C   1 
ATOM   4442  O  O   . PHE A 1 549 ? 17.710  33.625  19.703  1.00 16.78 ? 580 PHE A O   1 
ATOM   4443  C  CB  . PHE A 1 549 ? 20.616  34.028  20.046  1.00 18.01 ? 580 PHE A CB  1 
ATOM   4444  C  CG  . PHE A 1 549 ? 21.968  34.682  19.870  1.00 17.38 ? 580 PHE A CG  1 
ATOM   4445  C  CD1 . PHE A 1 549 ? 22.092  35.878  19.164  1.00 14.39 ? 580 PHE A CD1 1 
ATOM   4446  C  CD2 . PHE A 1 549 ? 23.111  34.112  20.434  1.00 16.66 ? 580 PHE A CD2 1 
ATOM   4447  C  CE1 . PHE A 1 549 ? 23.326  36.493  19.025  1.00 15.65 ? 580 PHE A CE1 1 
ATOM   4448  C  CE2 . PHE A 1 549 ? 24.359  34.719  20.298  1.00 16.51 ? 580 PHE A CE2 1 
ATOM   4449  C  CZ  . PHE A 1 549 ? 24.467  35.912  19.592  1.00 17.15 ? 580 PHE A CZ  1 
ATOM   4450  N  N   . ASN A 1 550 ? 17.451  34.699  21.694  1.00 19.94 ? 581 ASN A N   1 
ATOM   4451  C  CA  . ASN A 1 550 ? 16.113  34.208  21.940  1.00 20.99 ? 581 ASN A CA  1 
ATOM   4452  C  C   . ASN A 1 550 ? 15.072  35.302  22.227  1.00 20.54 ? 581 ASN A C   1 
ATOM   4453  O  O   . ASN A 1 550 ? 15.294  36.181  23.089  1.00 20.76 ? 581 ASN A O   1 
ATOM   4454  C  CB  . ASN A 1 550 ? 16.123  33.219  23.096  1.00 20.80 ? 581 ASN A CB  1 
ATOM   4455  C  CG  . ASN A 1 550 ? 14.827  32.463  23.176  1.00 28.64 ? 581 ASN A CG  1 
ATOM   4456  O  OD1 . ASN A 1 550 ? 14.410  31.799  22.194  1.00 27.96 ? 581 ASN A OD1 1 
ATOM   4457  N  ND2 . ASN A 1 550 ? 14.118  32.626  24.291  1.00 31.30 ? 581 ASN A ND2 1 
ATOM   4458  N  N   . VAL A 1 551 ? 13.956  35.254  21.487  1.00 17.78 ? 582 VAL A N   1 
ATOM   4459  C  CA  . VAL A 1 551 ? 12.856  36.180  21.678  1.00 12.77 ? 582 VAL A CA  1 
ATOM   4460  C  C   . VAL A 1 551 ? 12.222  35.634  22.931  1.00 11.23 ? 582 VAL A C   1 
ATOM   4461  O  O   . VAL A 1 551 ? 11.491  34.668  22.901  1.00 7.03  ? 582 VAL A O   1 
ATOM   4462  C  CB  . VAL A 1 551 ? 11.887  36.198  20.487  1.00 11.88 ? 582 VAL A CB  1 
ATOM   4463  C  CG1 . VAL A 1 551 ? 11.273  34.842  20.252  1.00 10.81 ? 582 VAL A CG1 1 
ATOM   4464  C  CG2 . VAL A 1 551 ? 10.848  37.270  20.683  1.00 12.61 ? 582 VAL A CG2 1 
ATOM   4465  N  N   . GLN A 1 552 ? 12.808  36.100  24.024  1.00 15.69 ? 583 GLN A N   1 
ATOM   4466  C  CA  . GLN A 1 552 ? 12.463  35.780  25.390  1.00 20.71 ? 583 GLN A CA  1 
ATOM   4467  C  C   . GLN A 1 552 ? 11.356  34.751  25.540  1.00 21.27 ? 583 GLN A C   1 
ATOM   4468  O  O   . GLN A 1 552 ? 10.169  35.141  25.515  1.00 22.21 ? 583 GLN A O   1 
ATOM   4469  C  CB  . GLN A 1 552 ? 12.168  37.071  26.170  1.00 25.85 ? 583 GLN A CB  1 
ATOM   4470  C  CG  . GLN A 1 552 ? 11.316  38.114  25.388  1.00 32.58 ? 583 GLN A CG  1 
ATOM   4471  C  CD  . GLN A 1 552 ? 12.103  38.911  24.297  1.00 36.13 ? 583 GLN A CD  1 
ATOM   4472  O  OE1 . GLN A 1 552 ? 11.663  39.004  23.132  1.00 30.20 ? 583 GLN A OE1 1 
ATOM   4473  N  NE2 . GLN A 1 552 ? 13.249  39.506  24.688  1.00 36.48 ? 583 GLN A NE2 1 
ATOM   4474  N  N   . ALA B 1 1   ? 65.313  49.491  24.054  1.00 18.17 ? 33  ALA B N   1 
ATOM   4475  C  CA  . ALA B 1 1   ? 64.819  50.112  25.318  1.00 20.18 ? 33  ALA B CA  1 
ATOM   4476  C  C   . ALA B 1 1   ? 63.828  49.136  25.916  1.00 20.42 ? 33  ALA B C   1 
ATOM   4477  O  O   . ALA B 1 1   ? 63.719  49.015  27.139  1.00 24.00 ? 33  ALA B O   1 
ATOM   4478  C  CB  . ALA B 1 1   ? 64.147  51.471  25.053  1.00 17.45 ? 33  ALA B CB  1 
ATOM   4479  N  N   . ASN B 1 2   ? 63.136  48.420  25.037  1.00 17.02 ? 34  ASN B N   1 
ATOM   4480  C  CA  . ASN B 1 2   ? 62.156  47.422  25.439  1.00 16.20 ? 34  ASN B CA  1 
ATOM   4481  C  C   . ASN B 1 2   ? 62.837  46.460  26.419  1.00 15.15 ? 34  ASN B C   1 
ATOM   4482  O  O   . ASN B 1 2   ? 63.895  45.918  26.112  1.00 17.38 ? 34  ASN B O   1 
ATOM   4483  C  CB  . ASN B 1 2   ? 61.649  46.717  24.165  1.00 16.70 ? 34  ASN B CB  1 
ATOM   4484  C  CG  . ASN B 1 2   ? 61.219  45.281  24.400  1.00 17.87 ? 34  ASN B CG  1 
ATOM   4485  O  OD1 . ASN B 1 2   ? 60.799  44.904  25.504  1.00 14.24 ? 34  ASN B OD1 1 
ATOM   4486  N  ND2 . ASN B 1 2   ? 61.325  44.464  23.351  1.00 17.97 ? 34  ASN B ND2 1 
ATOM   4487  N  N   . PRO B 1 3   ? 62.288  46.305  27.632  1.00 13.72 ? 35  PRO B N   1 
ATOM   4488  C  CA  . PRO B 1 3   ? 62.813  45.425  28.690  1.00 15.87 ? 35  PRO B CA  1 
ATOM   4489  C  C   . PRO B 1 3   ? 63.082  43.976  28.222  1.00 16.86 ? 35  PRO B C   1 
ATOM   4490  O  O   . PRO B 1 3   ? 63.946  43.256  28.741  1.00 15.18 ? 35  PRO B O   1 
ATOM   4491  C  CB  . PRO B 1 3   ? 61.718  45.494  29.763  1.00 15.69 ? 35  PRO B CB  1 
ATOM   4492  C  CG  . PRO B 1 3   ? 60.498  45.927  28.997  1.00 15.87 ? 35  PRO B CG  1 
ATOM   4493  C  CD  . PRO B 1 3   ? 61.053  46.952  28.074  1.00 14.01 ? 35  PRO B CD  1 
ATOM   4494  N  N   . CYS B 1 4   ? 62.341  43.551  27.216  1.00 16.09 ? 36  CYS B N   1 
ATOM   4495  C  CA  . CYS B 1 4   ? 62.548  42.225  26.703  1.00 15.63 ? 36  CYS B CA  1 
ATOM   4496  C  C   . CYS B 1 4   ? 63.842  42.132  25.922  1.00 14.69 ? 36  CYS B C   1 
ATOM   4497  O  O   . CYS B 1 4   ? 64.346  41.036  25.761  1.00 17.74 ? 36  CYS B O   1 
ATOM   4498  C  CB  . CYS B 1 4   ? 61.333  41.755  25.889  1.00 18.18 ? 36  CYS B CB  1 
ATOM   4499  S  SG  . CYS B 1 4   ? 59.880  41.351  26.961  1.00 18.80 ? 36  CYS B SG  1 
ATOM   4500  N  N   . CYS B 1 5   ? 64.404  43.275  25.504  1.00 12.98 ? 37  CYS B N   1 
ATOM   4501  C  CA  . CYS B 1 5   ? 65.674  43.360  24.752  1.00 8.32  ? 37  CYS B CA  1 
ATOM   4502  C  C   . CYS B 1 5   ? 66.704  42.346  25.196  1.00 8.57  ? 37  CYS B C   1 
ATOM   4503  O  O   . CYS B 1 5   ? 67.308  41.664  24.368  1.00 8.73  ? 37  CYS B O   1 
ATOM   4504  C  CB  . CYS B 1 5   ? 66.317  44.718  24.920  1.00 2.00  ? 37  CYS B CB  1 
ATOM   4505  S  SG  . CYS B 1 5   ? 65.720  45.904  23.723  1.00 6.15  ? 37  CYS B SG  1 
ATOM   4506  N  N   . SER B 1 6   ? 66.886  42.222  26.506  1.00 7.30  ? 38  SER B N   1 
ATOM   4507  C  CA  . SER B 1 6   ? 67.861  41.285  27.035  1.00 5.67  ? 38  SER B CA  1 
ATOM   4508  C  C   . SER B 1 6   ? 67.467  39.818  26.994  1.00 6.26  ? 38  SER B C   1 
ATOM   4509  O  O   . SER B 1 6   ? 68.076  39.038  27.700  1.00 9.30  ? 38  SER B O   1 
ATOM   4510  C  CB  . SER B 1 6   ? 68.230  41.651  28.481  1.00 6.98  ? 38  SER B CB  1 
ATOM   4511  O  OG  . SER B 1 6   ? 67.490  40.930  29.451  1.00 2.00  ? 38  SER B OG  1 
ATOM   4512  N  N   . ASN B 1 7   ? 66.427  39.449  26.245  1.00 5.81  ? 39  ASN B N   1 
ATOM   4513  C  CA  . ASN B 1 7   ? 65.957  38.055  26.135  1.00 3.48  ? 39  ASN B CA  1 
ATOM   4514  C  C   . ASN B 1 7   ? 65.894  37.340  27.482  1.00 2.86  ? 39  ASN B C   1 
ATOM   4515  O  O   . ASN B 1 7   ? 66.199  36.169  27.590  1.00 3.12  ? 39  ASN B O   1 
ATOM   4516  C  CB  . ASN B 1 7   ? 66.887  37.300  25.213  1.00 4.77  ? 39  ASN B CB  1 
ATOM   4517  C  CG  . ASN B 1 7   ? 66.827  37.803  23.788  1.00 10.02 ? 39  ASN B CG  1 
ATOM   4518  O  OD1 . ASN B 1 7   ? 66.740  37.003  22.846  1.00 17.13 ? 39  ASN B OD1 1 
ATOM   4519  N  ND2 . ASN B 1 7   ? 66.897  39.125  23.604  1.00 7.94  ? 39  ASN B ND2 1 
ATOM   4520  N  N   . PRO B 1 8   ? 65.387  38.007  28.501  1.00 2.00  ? 40  PRO B N   1 
ATOM   4521  C  CA  . PRO B 1 8   ? 65.295  37.440  29.839  1.00 3.85  ? 40  PRO B CA  1 
ATOM   4522  C  C   . PRO B 1 8   ? 64.623  36.093  29.981  1.00 7.90  ? 40  PRO B C   1 
ATOM   4523  O  O   . PRO B 1 8   ? 65.041  35.261  30.785  1.00 7.49  ? 40  PRO B O   1 
ATOM   4524  C  CB  . PRO B 1 8   ? 64.510  38.491  30.604  1.00 2.03  ? 40  PRO B CB  1 
ATOM   4525  C  CG  . PRO B 1 8   ? 64.711  39.709  29.820  1.00 6.01  ? 40  PRO B CG  1 
ATOM   4526  C  CD  . PRO B 1 8   ? 64.626  39.247  28.425  1.00 2.34  ? 40  PRO B CD  1 
ATOM   4527  N  N   . CYS B 1 9   ? 63.555  35.889  29.221  1.00 11.50 ? 41  CYS B N   1 
ATOM   4528  C  CA  . CYS B 1 9   ? 62.787  34.660  29.333  1.00 12.25 ? 41  CYS B CA  1 
ATOM   4529  C  C   . CYS B 1 9   ? 63.434  33.366  28.844  1.00 12.84 ? 41  CYS B C   1 
ATOM   4530  O  O   . CYS B 1 9   ? 63.450  33.013  27.661  1.00 13.02 ? 41  CYS B O   1 
ATOM   4531  C  CB  . CYS B 1 9   ? 61.386  34.886  28.793  1.00 9.09  ? 41  CYS B CB  1 
ATOM   4532  S  SG  . CYS B 1 9   ? 60.723  36.382  29.555  1.00 5.40  ? 41  CYS B SG  1 
ATOM   4533  N  N   . GLN B 1 10  ? 63.981  32.661  29.810  1.00 13.95 ? 42  GLN B N   1 
ATOM   4534  C  CA  . GLN B 1 10  ? 64.655  31.417  29.550  1.00 17.38 ? 42  GLN B CA  1 
ATOM   4535  C  C   . GLN B 1 10  ? 63.632  30.300  29.352  1.00 15.91 ? 42  GLN B C   1 
ATOM   4536  O  O   . GLN B 1 10  ? 62.426  30.534  29.412  1.00 16.35 ? 42  GLN B O   1 
ATOM   4537  C  CB  . GLN B 1 10  ? 65.608  31.107  30.731  1.00 19.66 ? 42  GLN B CB  1 
ATOM   4538  C  CG  . GLN B 1 10  ? 67.097  30.934  30.359  1.00 23.50 ? 42  GLN B CG  1 
ATOM   4539  C  CD  . GLN B 1 10  ? 67.759  32.186  29.797  1.00 26.10 ? 42  GLN B CD  1 
ATOM   4540  O  OE1 . GLN B 1 10  ? 68.451  32.902  30.519  1.00 31.15 ? 42  GLN B OE1 1 
ATOM   4541  N  NE2 . GLN B 1 10  ? 67.583  32.432  28.500  1.00 26.34 ? 42  GLN B NE2 1 
ATOM   4542  N  N   . ASN B 1 11  ? 64.139  29.117  29.005  1.00 14.08 ? 43  ASN B N   1 
ATOM   4543  C  CA  . ASN B 1 11  ? 63.339  27.914  28.815  1.00 12.29 ? 43  ASN B CA  1 
ATOM   4544  C  C   . ASN B 1 11  ? 62.157  27.934  27.867  1.00 12.07 ? 43  ASN B C   1 
ATOM   4545  O  O   . ASN B 1 11  ? 61.170  27.231  28.090  1.00 12.74 ? 43  ASN B O   1 
ATOM   4546  C  CB  . ASN B 1 11  ? 62.897  27.362  30.162  1.00 11.88 ? 43  ASN B CB  1 
ATOM   4547  C  CG  . ASN B 1 11  ? 63.929  26.438  30.765  1.00 13.19 ? 43  ASN B CG  1 
ATOM   4548  O  OD1 . ASN B 1 11  ? 64.514  25.589  30.073  1.00 14.96 ? 43  ASN B OD1 1 
ATOM   4549  N  ND2 . ASN B 1 11  ? 64.183  26.602  32.050  1.00 13.20 ? 43  ASN B ND2 1 
ATOM   4550  N  N   . ARG B 1 12  ? 62.265  28.708  26.792  1.00 11.21 ? 44  ARG B N   1 
ATOM   4551  C  CA  . ARG B 1 12  ? 61.195  28.785  25.801  1.00 9.08  ? 44  ARG B CA  1 
ATOM   4552  C  C   . ARG B 1 12  ? 59.941  29.564  26.259  1.00 7.11  ? 44  ARG B C   1 
ATOM   4553  O  O   . ARG B 1 12  ? 58.911  29.499  25.585  1.00 7.07  ? 44  ARG B O   1 
ATOM   4554  C  CB  . ARG B 1 12  ? 60.844  27.363  25.325  1.00 7.80  ? 44  ARG B CB  1 
ATOM   4555  C  CG  . ARG B 1 12  ? 60.666  27.198  23.824  1.00 4.88  ? 44  ARG B CG  1 
ATOM   4556  C  CD  . ARG B 1 12  ? 61.186  25.846  23.386  1.00 5.74  ? 44  ARG B CD  1 
ATOM   4557  N  NE  . ARG B 1 12  ? 60.466  25.234  22.270  1.00 6.96  ? 44  ARG B NE  1 
ATOM   4558  C  CZ  . ARG B 1 12  ? 59.936  25.879  21.230  1.00 9.12  ? 44  ARG B CZ  1 
ATOM   4559  N  NH1 . ARG B 1 12  ? 60.027  27.200  21.132  1.00 6.28  ? 44  ARG B NH1 1 
ATOM   4560  N  NH2 . ARG B 1 12  ? 59.332  25.191  20.253  1.00 6.11  ? 44  ARG B NH2 1 
ATOM   4561  N  N   . GLY B 1 13  ? 60.046  30.296  27.379  1.00 5.53  ? 45  GLY B N   1 
ATOM   4562  C  CA  . GLY B 1 13  ? 58.953  31.113  27.889  1.00 5.01  ? 45  GLY B CA  1 
ATOM   4563  C  C   . GLY B 1 13  ? 58.829  32.319  26.966  1.00 10.09 ? 45  GLY B C   1 
ATOM   4564  O  O   . GLY B 1 13  ? 59.659  32.465  26.063  1.00 12.24 ? 45  GLY B O   1 
ATOM   4565  N  N   . GLU B 1 14  ? 57.812  33.173  27.131  1.00 12.20 ? 46  GLU B N   1 
ATOM   4566  C  CA  . GLU B 1 14  ? 57.663  34.356  26.252  1.00 12.11 ? 46  GLU B CA  1 
ATOM   4567  C  C   . GLU B 1 14  ? 57.752  35.680  27.002  1.00 10.07 ? 46  GLU B C   1 
ATOM   4568  O  O   . GLU B 1 14  ? 57.044  35.924  27.978  1.00 5.88  ? 46  GLU B O   1 
ATOM   4569  C  CB  . GLU B 1 14  ? 56.358  34.305  25.453  1.00 17.87 ? 46  GLU B CB  1 
ATOM   4570  C  CG  . GLU B 1 14  ? 56.191  33.014  24.678  1.00 26.79 ? 46  GLU B CG  1 
ATOM   4571  C  CD  . GLU B 1 14  ? 55.212  33.117  23.526  1.00 30.74 ? 46  GLU B CD  1 
ATOM   4572  O  OE1 . GLU B 1 14  ? 54.323  34.018  23.556  1.00 29.72 ? 46  GLU B OE1 1 
ATOM   4573  O  OE2 . GLU B 1 14  ? 55.354  32.276  22.594  1.00 31.05 ? 46  GLU B OE2 1 
ATOM   4574  N  N   . CYS B 1 15  ? 58.632  36.547  26.529  1.00 11.18 ? 47  CYS B N   1 
ATOM   4575  C  CA  . CYS B 1 15  ? 58.800  37.825  27.182  1.00 14.07 ? 47  CYS B CA  1 
ATOM   4576  C  C   . CYS B 1 15  ? 57.835  38.845  26.628  1.00 16.79 ? 47  CYS B C   1 
ATOM   4577  O  O   . CYS B 1 15  ? 57.684  38.966  25.413  1.00 18.12 ? 47  CYS B O   1 
ATOM   4578  C  CB  . CYS B 1 15  ? 60.222  38.364  27.012  1.00 14.97 ? 47  CYS B CB  1 
ATOM   4579  S  SG  . CYS B 1 15  ? 60.564  39.812  28.095  1.00 15.49 ? 47  CYS B SG  1 
ATOM   4580  N  N   . MET B 1 16  ? 57.187  39.584  27.523  1.00 19.37 ? 48  MET B N   1 
ATOM   4581  C  CA  . MET B 1 16  ? 56.282  40.636  27.117  1.00 16.61 ? 48  MET B CA  1 
ATOM   4582  C  C   . MET B 1 16  ? 56.597  41.818  27.996  1.00 13.65 ? 48  MET B C   1 
ATOM   4583  O  O   . MET B 1 16  ? 56.800  41.703  29.224  1.00 6.84  ? 48  MET B O   1 
ATOM   4584  C  CB  . MET B 1 16  ? 54.815  40.245  27.275  1.00 24.60 ? 48  MET B CB  1 
ATOM   4585  C  CG  . MET B 1 16  ? 54.225  40.425  28.690  1.00 29.36 ? 48  MET B CG  1 
ATOM   4586  S  SD  . MET B 1 16  ? 52.642  41.290  28.621  1.00 30.81 ? 48  MET B SD  1 
ATOM   4587  C  CE  . MET B 1 16  ? 51.816  40.345  27.323  1.00 24.73 ? 48  MET B CE  1 
ATOM   4588  N  N   . SER B 1 17  ? 56.687  42.953  27.327  1.00 12.85 ? 49  SER B N   1 
ATOM   4589  C  CA  . SER B 1 17  ? 56.972  44.214  27.980  1.00 11.68 ? 49  SER B CA  1 
ATOM   4590  C  C   . SER B 1 17  ? 55.778  44.566  28.830  1.00 8.74  ? 49  SER B C   1 
ATOM   4591  O  O   . SER B 1 17  ? 54.651  44.298  28.427  1.00 12.06 ? 49  SER B O   1 
ATOM   4592  C  CB  . SER B 1 17  ? 57.190  45.292  26.916  1.00 13.08 ? 49  SER B CB  1 
ATOM   4593  O  OG  . SER B 1 17  ? 56.244  45.180  25.845  1.00 12.68 ? 49  SER B OG  1 
ATOM   4594  N  N   . THR B 1 18  ? 56.003  45.106  30.015  1.00 5.77  ? 50  THR B N   1 
ATOM   4595  C  CA  . THR B 1 18  ? 54.877  45.490  30.849  1.00 7.82  ? 50  THR B CA  1 
ATOM   4596  C  C   . THR B 1 18  ? 55.023  46.874  31.495  1.00 9.10  ? 50  THR B C   1 
ATOM   4597  O  O   . THR B 1 18  ? 54.799  47.035  32.710  1.00 7.05  ? 50  THR B O   1 
ATOM   4598  C  CB  . THR B 1 18  ? 54.549  44.422  31.923  1.00 8.95  ? 50  THR B CB  1 
ATOM   4599  O  OG1 . THR B 1 18  ? 55.620  44.323  32.860  1.00 6.60  ? 50  THR B OG1 1 
ATOM   4600  C  CG2 . THR B 1 18  ? 54.290  43.063  31.279  1.00 12.74 ? 50  THR B CG2 1 
ATOM   4601  N  N   . GLY B 1 19  ? 55.467  47.852  30.702  1.00 9.30  ? 51  GLY B N   1 
ATOM   4602  C  CA  . GLY B 1 19  ? 55.609  49.190  31.229  1.00 11.89 ? 51  GLY B CA  1 
ATOM   4603  C  C   . GLY B 1 19  ? 56.958  49.872  31.085  1.00 13.63 ? 51  GLY B C   1 
ATOM   4604  O  O   . GLY B 1 19  ? 57.530  50.360  32.070  1.00 15.18 ? 51  GLY B O   1 
ATOM   4605  N  N   . PHE B 1 20  ? 57.494  49.864  29.873  1.00 14.47 ? 52  PHE B N   1 
ATOM   4606  C  CA  . PHE B 1 20  ? 58.741  50.559  29.580  1.00 16.89 ? 52  PHE B CA  1 
ATOM   4607  C  C   . PHE B 1 20  ? 60.014  49.913  30.108  1.00 20.02 ? 52  PHE B C   1 
ATOM   4608  O  O   . PHE B 1 20  ? 60.937  49.625  29.335  1.00 18.98 ? 52  PHE B O   1 
ATOM   4609  C  CB  . PHE B 1 20  ? 58.684  51.976  30.137  1.00 13.36 ? 52  PHE B CB  1 
ATOM   4610  C  CG  . PHE B 1 20  ? 57.614  52.832  29.540  1.00 8.05  ? 52  PHE B CG  1 
ATOM   4611  C  CD1 . PHE B 1 20  ? 57.687  53.228  28.211  1.00 5.84  ? 52  PHE B CD1 1 
ATOM   4612  C  CD2 . PHE B 1 20  ? 56.612  53.348  30.337  1.00 4.82  ? 52  PHE B CD2 1 
ATOM   4613  C  CE1 . PHE B 1 20  ? 56.786  54.137  27.684  1.00 3.72  ? 52  PHE B CE1 1 
ATOM   4614  C  CE2 . PHE B 1 20  ? 55.717  54.248  29.822  1.00 6.66  ? 52  PHE B CE2 1 
ATOM   4615  C  CZ  . PHE B 1 20  ? 55.805  54.649  28.483  1.00 3.40  ? 52  PHE B CZ  1 
ATOM   4616  N  N   . ASP B 1 21  ? 60.100  49.780  31.430  1.00 22.43 ? 53  ASP B N   1 
ATOM   4617  C  CA  . ASP B 1 21  ? 61.280  49.188  32.051  1.00 23.25 ? 53  ASP B CA  1 
ATOM   4618  C  C   . ASP B 1 21  ? 61.078  47.745  32.485  1.00 20.62 ? 53  ASP B C   1 
ATOM   4619  O  O   . ASP B 1 21  ? 62.017  46.962  32.475  1.00 21.40 ? 53  ASP B O   1 
ATOM   4620  C  CB  . ASP B 1 21  ? 61.750  50.029  33.261  1.00 30.66 ? 53  ASP B CB  1 
ATOM   4621  C  CG  . ASP B 1 21  ? 62.206  51.475  32.878  1.00 36.88 ? 53  ASP B CG  1 
ATOM   4622  O  OD1 . ASP B 1 21  ? 62.656  51.727  31.720  1.00 36.60 ? 53  ASP B OD1 1 
ATOM   4623  O  OD2 . ASP B 1 21  ? 62.131  52.361  33.775  1.00 38.30 ? 53  ASP B OD2 1 
ATOM   4624  N  N   . GLN B 1 22  ? 59.855  47.382  32.845  1.00 19.50 ? 54  GLN B N   1 
ATOM   4625  C  CA  . GLN B 1 22  ? 59.602  46.026  33.297  1.00 19.14 ? 54  GLN B CA  1 
ATOM   4626  C  C   . GLN B 1 22  ? 59.128  45.133  32.154  1.00 17.33 ? 54  GLN B C   1 
ATOM   4627  O  O   . GLN B 1 22  ? 58.630  45.662  31.142  1.00 16.74 ? 54  GLN B O   1 
ATOM   4628  C  CB  . GLN B 1 22  ? 58.608  46.027  34.450  1.00 25.29 ? 54  GLN B CB  1 
ATOM   4629  C  CG  . GLN B 1 22  ? 59.000  46.954  35.608  1.00 35.29 ? 54  GLN B CG  1 
ATOM   4630  C  CD  . GLN B 1 22  ? 58.663  48.433  35.329  1.00 43.06 ? 54  GLN B CD  1 
ATOM   4631  O  OE1 . GLN B 1 22  ? 59.553  49.246  35.032  1.00 44.73 ? 54  GLN B OE1 1 
ATOM   4632  N  NE2 . GLN B 1 22  ? 57.370  48.779  35.416  1.00 44.52 ? 54  GLN B NE2 1 
ATOM   4633  N  N   . TYR B 1 23  ? 59.332  43.809  32.299  1.00 12.43 ? 55  TYR B N   1 
ATOM   4634  C  CA  . TYR B 1 23  ? 58.931  42.808  31.296  1.00 10.23 ? 55  TYR B CA  1 
ATOM   4635  C  C   . TYR B 1 23  ? 58.318  41.655  32.063  1.00 7.91  ? 55  TYR B C   1 
ATOM   4636  O  O   . TYR B 1 23  ? 58.493  41.601  33.284  1.00 6.30  ? 55  TYR B O   1 
ATOM   4637  C  CB  . TYR B 1 23  ? 60.139  42.303  30.471  1.00 12.09 ? 55  TYR B CB  1 
ATOM   4638  C  CG  . TYR B 1 23  ? 61.076  41.386  31.240  1.00 14.78 ? 55  TYR B CG  1 
ATOM   4639  C  CD1 . TYR B 1 23  ? 62.094  41.919  32.047  1.00 15.53 ? 55  TYR B CD1 1 
ATOM   4640  C  CD2 . TYR B 1 23  ? 60.876  39.993  31.258  1.00 12.75 ? 55  TYR B CD2 1 
ATOM   4641  C  CE1 . TYR B 1 23  ? 62.875  41.091  32.869  1.00 15.97 ? 55  TYR B CE1 1 
ATOM   4642  C  CE2 . TYR B 1 23  ? 61.653  39.158  32.080  1.00 13.32 ? 55  TYR B CE2 1 
ATOM   4643  C  CZ  . TYR B 1 23  ? 62.648  39.711  32.888  1.00 14.98 ? 55  TYR B CZ  1 
ATOM   4644  O  OH  . TYR B 1 23  ? 63.385  38.906  33.735  1.00 12.93 ? 55  TYR B OH  1 
ATOM   4645  N  N   . LYS B 1 24  ? 57.711  40.705  31.339  1.00 6.88  ? 56  LYS B N   1 
ATOM   4646  C  CA  . LYS B 1 24  ? 57.048  39.546  31.937  1.00 8.74  ? 56  LYS B CA  1 
ATOM   4647  C  C   . LYS B 1 24  ? 57.236  38.262  31.115  1.00 8.97  ? 56  LYS B C   1 
ATOM   4648  O  O   . LYS B 1 24  ? 57.171  38.306  29.883  1.00 6.69  ? 56  LYS B O   1 
ATOM   4649  C  CB  . LYS B 1 24  ? 55.564  39.842  32.026  1.00 13.32 ? 56  LYS B CB  1 
ATOM   4650  C  CG  . LYS B 1 24  ? 54.909  39.409  33.342  1.00 21.46 ? 56  LYS B CG  1 
ATOM   4651  C  CD  . LYS B 1 24  ? 54.907  37.885  33.574  1.00 22.01 ? 56  LYS B CD  1 
ATOM   4652  C  CE  . LYS B 1 24  ? 53.947  37.491  34.719  1.00 23.10 ? 56  LYS B CE  1 
ATOM   4653  N  NZ  . LYS B 1 24  ? 54.144  38.259  36.009  1.00 23.40 ? 56  LYS B NZ  1 
ATOM   4654  N  N   . CYS B 1 25  ? 57.365  37.109  31.786  1.00 9.01  ? 57  CYS B N   1 
ATOM   4655  C  CA  . CYS B 1 25  ? 57.574  35.821  31.071  1.00 8.91  ? 57  CYS B CA  1 
ATOM   4656  C  C   . CYS B 1 25  ? 56.397  34.809  31.019  1.00 6.26  ? 57  CYS B C   1 
ATOM   4657  O  O   . CYS B 1 25  ? 55.896  34.335  32.052  1.00 5.16  ? 57  CYS B O   1 
ATOM   4658  C  CB  . CYS B 1 25  ? 58.842  35.070  31.612  1.00 9.55  ? 57  CYS B CB  1 
ATOM   4659  S  SG  . CYS B 1 25  ? 60.500  35.869  31.524  1.00 7.78  ? 57  CYS B SG  1 
ATOM   4660  N  N   . ASP B 1 26  ? 56.031  34.388  29.816  1.00 4.74  ? 58  ASP B N   1 
ATOM   4661  C  CA  . ASP B 1 26  ? 54.961  33.408  29.681  1.00 5.76  ? 58  ASP B CA  1 
ATOM   4662  C  C   . ASP B 1 26  ? 55.537  31.976  29.745  1.00 5.40  ? 58  ASP B C   1 
ATOM   4663  O  O   . ASP B 1 26  ? 55.728  31.293  28.713  1.00 2.00  ? 58  ASP B O   1 
ATOM   4664  C  CB  . ASP B 1 26  ? 54.198  33.617  28.373  1.00 7.59  ? 58  ASP B CB  1 
ATOM   4665  C  CG  . ASP B 1 26  ? 52.710  33.231  28.484  1.00 6.62  ? 58  ASP B CG  1 
ATOM   4666  O  OD1 . ASP B 1 26  ? 52.224  32.947  29.621  1.00 2.11  ? 58  ASP B OD1 1 
ATOM   4667  O  OD2 . ASP B 1 26  ? 52.038  33.224  27.420  1.00 5.26  ? 58  ASP B OD2 1 
ATOM   4668  N  N   . CYS B 1 27  ? 55.781  31.525  30.973  1.00 5.86  ? 59  CYS B N   1 
ATOM   4669  C  CA  . CYS B 1 27  ? 56.343  30.203  31.212  1.00 8.63  ? 59  CYS B CA  1 
ATOM   4670  C  C   . CYS B 1 27  ? 55.338  29.093  30.939  1.00 9.61  ? 59  CYS B C   1 
ATOM   4671  O  O   . CYS B 1 27  ? 55.558  27.954  31.325  1.00 10.86 ? 59  CYS B O   1 
ATOM   4672  C  CB  . CYS B 1 27  ? 56.825  30.084  32.665  1.00 10.29 ? 59  CYS B CB  1 
ATOM   4673  S  SG  . CYS B 1 27  ? 58.045  31.323  33.230  1.00 14.54 ? 59  CYS B SG  1 
ATOM   4674  N  N   . THR B 1 28  ? 54.280  29.402  30.209  1.00 11.44 ? 60  THR B N   1 
ATOM   4675  C  CA  . THR B 1 28  ? 53.224  28.440  29.936  1.00 12.19 ? 60  THR B CA  1 
ATOM   4676  C  C   . THR B 1 28  ? 53.662  27.186  29.231  1.00 11.86 ? 60  THR B C   1 
ATOM   4677  O  O   . THR B 1 28  ? 54.285  27.246  28.163  1.00 12.73 ? 60  THR B O   1 
ATOM   4678  C  CB  . THR B 1 28  ? 52.119  29.071  29.089  1.00 14.82 ? 60  THR B CB  1 
ATOM   4679  O  OG1 . THR B 1 28  ? 51.927  30.439  29.496  1.00 13.58 ? 60  THR B OG1 1 
ATOM   4680  C  CG2 . THR B 1 28  ? 50.808  28.285  29.270  1.00 13.82 ? 60  THR B CG2 1 
ATOM   4681  N  N   . ARG B 1 29  ? 53.306  26.051  29.823  1.00 9.77  ? 61  ARG B N   1 
ATOM   4682  C  CA  . ARG B 1 29  ? 53.639  24.752  29.244  1.00 12.92 ? 61  ARG B CA  1 
ATOM   4683  C  C   . ARG B 1 29  ? 55.142  24.499  28.954  1.00 13.00 ? 61  ARG B C   1 
ATOM   4684  O  O   . ARG B 1 29  ? 55.508  23.613  28.175  1.00 12.19 ? 61  ARG B O   1 
ATOM   4685  C  CB  . ARG B 1 29  ? 52.772  24.516  27.992  1.00 12.39 ? 61  ARG B CB  1 
ATOM   4686  C  CG  . ARG B 1 29  ? 51.505  23.698  28.292  1.00 13.56 ? 61  ARG B CG  1 
ATOM   4687  C  CD  . ARG B 1 29  ? 50.405  23.846  27.234  1.00 10.12 ? 61  ARG B CD  1 
ATOM   4688  N  NE  . ARG B 1 29  ? 49.670  25.085  27.424  1.00 7.98  ? 61  ARG B NE  1 
ATOM   4689  C  CZ  . ARG B 1 29  ? 49.351  25.922  26.448  1.00 7.22  ? 61  ARG B CZ  1 
ATOM   4690  N  NH1 . ARG B 1 29  ? 49.689  25.650  25.197  1.00 5.06  ? 61  ARG B NH1 1 
ATOM   4691  N  NH2 . ARG B 1 29  ? 48.750  27.063  26.741  1.00 7.13  ? 61  ARG B NH2 1 
ATOM   4692  N  N   . THR B 1 30  ? 56.003  25.260  29.621  1.00 13.39 ? 62  THR B N   1 
ATOM   4693  C  CA  . THR B 1 30  ? 57.444  25.119  29.438  1.00 12.29 ? 62  THR B CA  1 
ATOM   4694  C  C   . THR B 1 30  ? 57.968  23.978  30.305  1.00 12.22 ? 62  THR B C   1 
ATOM   4695  O  O   . THR B 1 30  ? 58.758  23.143  29.862  1.00 13.00 ? 62  THR B O   1 
ATOM   4696  C  CB  . THR B 1 30  ? 58.219  26.439  29.815  1.00 11.26 ? 62  THR B CB  1 
ATOM   4697  O  OG1 . THR B 1 30  ? 58.150  26.671  31.230  1.00 4.60  ? 62  THR B OG1 1 
ATOM   4698  C  CG2 . THR B 1 30  ? 57.641  27.636  29.064  1.00 8.45  ? 62  THR B CG2 1 
ATOM   4699  N  N   . GLY B 1 31  ? 57.456  23.901  31.523  1.00 8.97  ? 63  GLY B N   1 
ATOM   4700  C  CA  . GLY B 1 31  ? 57.931  22.881  32.417  1.00 6.39  ? 63  GLY B CA  1 
ATOM   4701  C  C   . GLY B 1 31  ? 58.828  23.580  33.397  1.00 5.61  ? 63  GLY B C   1 
ATOM   4702  O  O   . GLY B 1 31  ? 59.544  22.956  34.152  1.00 2.07  ? 63  GLY B O   1 
ATOM   4703  N  N   . PHE B 1 32  ? 58.753  24.902  33.408  1.00 8.27  ? 64  PHE B N   1 
ATOM   4704  C  CA  . PHE B 1 32  ? 59.561  25.718  34.303  1.00 10.96 ? 64  PHE B CA  1 
ATOM   4705  C  C   . PHE B 1 32  ? 58.773  26.928  34.711  1.00 11.10 ? 64  PHE B C   1 
ATOM   4706  O  O   . PHE B 1 32  ? 58.028  27.470  33.897  1.00 11.62 ? 64  PHE B O   1 
ATOM   4707  C  CB  . PHE B 1 32  ? 60.815  26.241  33.575  1.00 14.61 ? 64  PHE B CB  1 
ATOM   4708  C  CG  . PHE B 1 32  ? 61.795  25.179  33.200  1.00 13.50 ? 64  PHE B CG  1 
ATOM   4709  C  CD1 . PHE B 1 32  ? 61.591  24.393  32.072  1.00 12.36 ? 64  PHE B CD1 1 
ATOM   4710  C  CD2 . PHE B 1 32  ? 62.901  24.952  33.992  1.00 13.83 ? 64  PHE B CD2 1 
ATOM   4711  C  CE1 . PHE B 1 32  ? 62.470  23.394  31.746  1.00 14.99 ? 64  PHE B CE1 1 
ATOM   4712  C  CE2 . PHE B 1 32  ? 63.791  23.957  33.679  1.00 17.57 ? 64  PHE B CE2 1 
ATOM   4713  C  CZ  . PHE B 1 32  ? 63.576  23.169  32.549  1.00 17.96 ? 64  PHE B CZ  1 
ATOM   4714  N  N   . TYR B 1 33  ? 58.971  27.373  35.947  1.00 13.09 ? 65  TYR B N   1 
ATOM   4715  C  CA  . TYR B 1 33  ? 58.320  28.582  36.456  1.00 15.85 ? 65  TYR B CA  1 
ATOM   4716  C  C   . TYR B 1 33  ? 59.327  29.603  36.986  1.00 16.67 ? 65  TYR B C   1 
ATOM   4717  O  O   . TYR B 1 33  ? 60.542  29.411  36.845  1.00 19.71 ? 65  TYR B O   1 
ATOM   4718  C  CB  . TYR B 1 33  ? 57.345  28.238  37.551  1.00 16.12 ? 65  TYR B CB  1 
ATOM   4719  C  CG  . TYR B 1 33  ? 57.949  27.477  38.670  1.00 13.41 ? 65  TYR B CG  1 
ATOM   4720  C  CD1 . TYR B 1 33  ? 58.127  26.102  38.568  1.00 11.81 ? 65  TYR B CD1 1 
ATOM   4721  C  CD2 . TYR B 1 33  ? 58.246  28.112  39.873  1.00 13.94 ? 65  TYR B CD2 1 
ATOM   4722  C  CE1 . TYR B 1 33  ? 58.577  25.364  39.640  1.00 16.78 ? 65  TYR B CE1 1 
ATOM   4723  C  CE2 . TYR B 1 33  ? 58.696  27.383  40.967  1.00 18.09 ? 65  TYR B CE2 1 
ATOM   4724  C  CZ  . TYR B 1 33  ? 58.861  26.009  40.846  1.00 18.74 ? 65  TYR B CZ  1 
ATOM   4725  O  OH  . TYR B 1 33  ? 59.325  25.300  41.928  1.00 21.20 ? 65  TYR B OH  1 
ATOM   4726  N  N   . GLY B 1 34  ? 58.827  30.669  37.615  1.00 17.44 ? 66  GLY B N   1 
ATOM   4727  C  CA  . GLY B 1 34  ? 59.698  31.725  38.139  1.00 17.20 ? 66  GLY B CA  1 
ATOM   4728  C  C   . GLY B 1 34  ? 59.910  32.858  37.128  1.00 15.07 ? 66  GLY B C   1 
ATOM   4729  O  O   . GLY B 1 34  ? 59.643  32.694  35.926  1.00 13.66 ? 66  GLY B O   1 
ATOM   4730  N  N   . GLU B 1 35  ? 60.447  33.979  37.605  1.00 13.92 ? 67  GLU B N   1 
ATOM   4731  C  CA  . GLU B 1 35  ? 60.671  35.156  36.763  1.00 15.23 ? 67  GLU B CA  1 
ATOM   4732  C  C   . GLU B 1 35  ? 61.194  34.934  35.348  1.00 16.04 ? 67  GLU B C   1 
ATOM   4733  O  O   . GLU B 1 35  ? 60.764  35.645  34.418  1.00 15.66 ? 67  GLU B O   1 
ATOM   4734  C  CB  . GLU B 1 35  ? 61.536  36.199  37.475  1.00 17.99 ? 67  GLU B CB  1 
ATOM   4735  C  CG  . GLU B 1 35  ? 61.746  37.481  36.647  1.00 23.97 ? 67  GLU B CG  1 
ATOM   4736  C  CD  . GLU B 1 35  ? 62.517  38.583  37.378  1.00 29.14 ? 67  GLU B CD  1 
ATOM   4737  O  OE1 . GLU B 1 35  ? 62.964  38.361  38.539  1.00 31.95 ? 67  GLU B OE1 1 
ATOM   4738  O  OE2 . GLU B 1 35  ? 62.669  39.682  36.775  1.00 30.67 ? 67  GLU B OE2 1 
ATOM   4739  N  N   . ASN B 1 36  ? 62.103  33.966  35.162  1.00 16.30 ? 68  ASN B N   1 
ATOM   4740  C  CA  . ASN B 1 36  ? 62.639  33.714  33.804  1.00 14.61 ? 68  ASN B CA  1 
ATOM   4741  C  C   . ASN B 1 36  ? 62.379  32.317  33.241  1.00 10.57 ? 68  ASN B C   1 
ATOM   4742  O  O   . ASN B 1 36  ? 63.051  31.877  32.319  1.00 5.88  ? 68  ASN B O   1 
ATOM   4743  C  CB  . ASN B 1 36  ? 64.135  34.043  33.736  1.00 15.48 ? 68  ASN B CB  1 
ATOM   4744  C  CG  . ASN B 1 36  ? 64.443  35.488  34.108  1.00 16.82 ? 68  ASN B CG  1 
ATOM   4745  O  OD1 . ASN B 1 36  ? 63.761  36.410  33.653  1.00 16.58 ? 68  ASN B OD1 1 
ATOM   4746  N  ND2 . ASN B 1 36  ? 65.464  35.655  34.958  1.00 19.73 ? 68  ASN B ND2 1 
ATOM   4747  N  N   . CYS B 1 37  ? 61.360  31.651  33.771  1.00 12.01 ? 69  CYS B N   1 
ATOM   4748  C  CA  . CYS B 1 37  ? 61.007  30.301  33.345  1.00 13.75 ? 69  CYS B CA  1 
ATOM   4749  C  C   . CYS B 1 37  ? 62.261  29.481  33.541  1.00 14.58 ? 69  CYS B C   1 
ATOM   4750  O  O   . CYS B 1 37  ? 62.628  28.640  32.729  1.00 12.80 ? 69  CYS B O   1 
ATOM   4751  C  CB  . CYS B 1 37  ? 60.550  30.320  31.889  1.00 14.58 ? 69  CYS B CB  1 
ATOM   4752  S  SG  . CYS B 1 37  ? 59.251  31.568  31.607  1.00 13.54 ? 69  CYS B SG  1 
ATOM   4753  N  N   . THR B 1 38  ? 62.895  29.765  34.672  1.00 17.59 ? 70  THR B N   1 
ATOM   4754  C  CA  . THR B 1 38  ? 64.153  29.167  35.095  1.00 19.30 ? 70  THR B CA  1 
ATOM   4755  C  C   . THR B 1 38  ? 64.040  27.894  35.955  1.00 19.47 ? 70  THR B C   1 
ATOM   4756  O  O   . THR B 1 38  ? 64.687  26.877  35.646  1.00 21.06 ? 70  THR B O   1 
ATOM   4757  C  CB  . THR B 1 38  ? 65.018  30.250  35.813  1.00 18.86 ? 70  THR B CB  1 
ATOM   4758  O  OG1 . THR B 1 38  ? 64.159  31.238  36.427  1.00 17.64 ? 70  THR B OG1 1 
ATOM   4759  C  CG2 . THR B 1 38  ? 65.932  30.948  34.807  1.00 20.92 ? 70  THR B CG2 1 
ATOM   4760  N  N   . THR B 1 39  ? 63.241  27.937  37.023  1.00 16.11 ? 71  THR B N   1 
ATOM   4761  C  CA  . THR B 1 39  ? 63.093  26.756  37.870  1.00 13.26 ? 71  THR B CA  1 
ATOM   4762  C  C   . THR B 1 39  ? 62.152  25.689  37.283  1.00 14.21 ? 71  THR B C   1 
ATOM   4763  O  O   . THR B 1 39  ? 60.981  25.939  36.989  1.00 13.76 ? 71  THR B O   1 
ATOM   4764  C  CB  . THR B 1 39  ? 62.722  27.100  39.339  1.00 12.52 ? 71  THR B CB  1 
ATOM   4765  O  OG1 . THR B 1 39  ? 61.707  26.191  39.827  1.00 9.14  ? 71  THR B OG1 1 
ATOM   4766  C  CG2 . THR B 1 39  ? 62.302  28.550  39.479  1.00 10.89 ? 71  THR B CG2 1 
ATOM   4767  N  N   . PRO B 1 40  ? 62.660  24.467  37.129  1.00 16.05 ? 72  PRO B N   1 
ATOM   4768  C  CA  . PRO B 1 40  ? 61.895  23.352  36.578  1.00 17.04 ? 72  PRO B CA  1 
ATOM   4769  C  C   . PRO B 1 40  ? 60.824  22.774  37.482  1.00 19.80 ? 72  PRO B C   1 
ATOM   4770  O  O   . PRO B 1 40  ? 60.943  22.795  38.733  1.00 19.50 ? 72  PRO B O   1 
ATOM   4771  C  CB  . PRO B 1 40  ? 62.968  22.306  36.334  1.00 16.85 ? 72  PRO B CB  1 
ATOM   4772  C  CG  . PRO B 1 40  ? 63.888  22.541  37.494  1.00 18.72 ? 72  PRO B CG  1 
ATOM   4773  C  CD  . PRO B 1 40  ? 64.022  24.038  37.483  1.00 17.44 ? 72  PRO B CD  1 
ATOM   4774  N  N   . GLU B 1 41  ? 59.795  22.238  36.825  1.00 20.57 ? 73  GLU B N   1 
ATOM   4775  C  CA  . GLU B 1 41  ? 58.709  21.564  37.506  1.00 22.54 ? 73  GLU B CA  1 
ATOM   4776  C  C   . GLU B 1 41  ? 59.356  20.234  37.891  1.00 22.38 ? 73  GLU B C   1 
ATOM   4777  O  O   . GLU B 1 41  ? 60.163  19.675  37.122  1.00 17.66 ? 73  GLU B O   1 
ATOM   4778  C  CB  . GLU B 1 41  ? 57.556  21.303  36.538  1.00 27.12 ? 73  GLU B CB  1 
ATOM   4779  C  CG  . GLU B 1 41  ? 56.727  22.541  36.169  1.00 33.76 ? 73  GLU B CG  1 
ATOM   4780  C  CD  . GLU B 1 41  ? 55.844  22.342  34.912  1.00 38.83 ? 73  GLU B CD  1 
ATOM   4781  O  OE1 . GLU B 1 41  ? 55.746  21.181  34.405  1.00 42.63 ? 73  GLU B OE1 1 
ATOM   4782  O  OE2 . GLU B 1 41  ? 55.265  23.357  34.419  1.00 40.24 ? 73  GLU B OE2 1 
ATOM   4783  N  N   . PHE B 1 42  ? 59.022  19.738  39.079  1.00 23.65 ? 74  PHE B N   1 
ATOM   4784  C  CA  . PHE B 1 42  ? 59.591  18.485  39.561  1.00 24.61 ? 74  PHE B CA  1 
ATOM   4785  C  C   . PHE B 1 42  ? 59.754  17.397  38.484  1.00 24.13 ? 74  PHE B C   1 
ATOM   4786  O  O   . PHE B 1 42  ? 60.864  16.890  38.267  1.00 25.57 ? 74  PHE B O   1 
ATOM   4787  C  CB  . PHE B 1 42  ? 58.784  17.955  40.731  1.00 26.38 ? 74  PHE B CB  1 
ATOM   4788  C  CG  . PHE B 1 42  ? 59.517  16.940  41.533  1.00 31.84 ? 74  PHE B CG  1 
ATOM   4789  C  CD1 . PHE B 1 42  ? 59.564  15.605  41.120  1.00 34.61 ? 74  PHE B CD1 1 
ATOM   4790  C  CD2 . PHE B 1 42  ? 60.223  17.324  42.670  1.00 35.78 ? 74  PHE B CD2 1 
ATOM   4791  C  CE1 . PHE B 1 42  ? 60.312  14.657  41.824  1.00 36.01 ? 74  PHE B CE1 1 
ATOM   4792  C  CE2 . PHE B 1 42  ? 60.981  16.385  43.392  1.00 39.23 ? 74  PHE B CE2 1 
ATOM   4793  C  CZ  . PHE B 1 42  ? 61.026  15.046  42.964  1.00 38.48 ? 74  PHE B CZ  1 
ATOM   4794  N  N   . LEU B 1 43  ? 58.662  17.037  37.820  1.00 21.74 ? 75  LEU B N   1 
ATOM   4795  C  CA  . LEU B 1 43  ? 58.723  16.029  36.766  1.00 21.44 ? 75  LEU B CA  1 
ATOM   4796  C  C   . LEU B 1 43  ? 59.729  16.461  35.681  1.00 21.87 ? 75  LEU B C   1 
ATOM   4797  O  O   . LEU B 1 43  ? 60.375  15.621  35.033  1.00 19.77 ? 75  LEU B O   1 
ATOM   4798  C  CB  . LEU B 1 43  ? 57.329  15.829  36.155  1.00 23.22 ? 75  LEU B CB  1 
ATOM   4799  C  CG  . LEU B 1 43  ? 57.207  15.026  34.849  1.00 23.70 ? 75  LEU B CG  1 
ATOM   4800  C  CD1 . LEU B 1 43  ? 57.578  13.545  35.071  1.00 24.24 ? 75  LEU B CD1 1 
ATOM   4801  C  CD2 . LEU B 1 43  ? 55.788  15.171  34.285  1.00 20.66 ? 75  LEU B CD2 1 
ATOM   4802  N  N   . THR B 1 44  ? 59.856  17.775  35.491  1.00 22.86 ? 76  THR B N   1 
ATOM   4803  C  CA  . THR B 1 44  ? 60.790  18.317  34.506  1.00 24.93 ? 76  THR B CA  1 
ATOM   4804  C  C   . THR B 1 44  ? 62.185  17.823  34.854  1.00 26.51 ? 76  THR B C   1 
ATOM   4805  O  O   . THR B 1 44  ? 62.933  17.346  33.979  1.00 25.36 ? 76  THR B O   1 
ATOM   4806  C  CB  . THR B 1 44  ? 60.762  19.841  34.513  1.00 23.38 ? 76  THR B CB  1 
ATOM   4807  O  OG1 . THR B 1 44  ? 59.481  20.285  34.027  1.00 20.70 ? 76  THR B OG1 1 
ATOM   4808  C  CG2 . THR B 1 44  ? 61.927  20.410  33.679  1.00 22.21 ? 76  THR B CG2 1 
ATOM   4809  N  N   . ARG B 1 45  ? 62.492  17.905  36.149  1.00 27.19 ? 77  ARG B N   1 
ATOM   4810  C  CA  . ARG B 1 45  ? 63.763  17.442  36.679  1.00 28.28 ? 77  ARG B CA  1 
ATOM   4811  C  C   . ARG B 1 45  ? 64.017  16.007  36.194  1.00 27.19 ? 77  ARG B C   1 
ATOM   4812  O  O   . ARG B 1 45  ? 65.060  15.709  35.574  1.00 25.37 ? 77  ARG B O   1 
ATOM   4813  C  CB  . ARG B 1 45  ? 63.727  17.445  38.212  1.00 29.61 ? 77  ARG B CB  1 
ATOM   4814  C  CG  . ARG B 1 45  ? 63.710  18.815  38.834  1.00 33.57 ? 77  ARG B CG  1 
ATOM   4815  C  CD  . ARG B 1 45  ? 64.033  18.778  40.339  1.00 35.96 ? 77  ARG B CD  1 
ATOM   4816  N  NE  . ARG B 1 45  ? 64.034  20.125  40.919  1.00 38.82 ? 77  ARG B NE  1 
ATOM   4817  C  CZ  . ARG B 1 45  ? 63.235  20.528  41.911  1.00 40.29 ? 77  ARG B CZ  1 
ATOM   4818  N  NH1 . ARG B 1 45  ? 62.360  19.693  42.473  1.00 40.05 ? 77  ARG B NH1 1 
ATOM   4819  N  NH2 . ARG B 1 45  ? 63.281  21.792  42.315  1.00 41.69 ? 77  ARG B NH2 1 
ATOM   4820  N  N   . ILE B 1 46  ? 63.041  15.141  36.463  1.00 26.15 ? 78  ILE B N   1 
ATOM   4821  C  CA  . ILE B 1 46  ? 63.105  13.722  36.098  1.00 28.33 ? 78  ILE B CA  1 
ATOM   4822  C  C   . ILE B 1 46  ? 63.557  13.518  34.651  1.00 29.66 ? 78  ILE B C   1 
ATOM   4823  O  O   . ILE B 1 46  ? 64.461  12.700  34.359  1.00 30.48 ? 78  ILE B O   1 
ATOM   4824  C  CB  . ILE B 1 46  ? 61.726  13.024  36.289  1.00 27.06 ? 78  ILE B CB  1 
ATOM   4825  C  CG1 . ILE B 1 46  ? 61.139  13.366  37.671  1.00 25.25 ? 78  ILE B CG1 1 
ATOM   4826  C  CG2 . ILE B 1 46  ? 61.849  11.519  36.049  1.00 23.43 ? 78  ILE B CG2 1 
ATOM   4827  C  CD1 . ILE B 1 46  ? 62.116  13.244  38.837  1.00 23.01 ? 78  ILE B CD1 1 
ATOM   4828  N  N   . LYS B 1 47  ? 62.926  14.270  33.754  1.00 30.37 ? 79  LYS B N   1 
ATOM   4829  C  CA  . LYS B 1 47  ? 63.255  14.206  32.329  1.00 31.86 ? 79  LYS B CA  1 
ATOM   4830  C  C   . LYS B 1 47  ? 64.664  14.779  32.090  1.00 31.76 ? 79  LYS B C   1 
ATOM   4831  O  O   . LYS B 1 47  ? 65.516  14.160  31.420  1.00 30.55 ? 79  LYS B O   1 
ATOM   4832  C  CB  . LYS B 1 47  ? 62.214  14.985  31.528  1.00 32.23 ? 79  LYS B CB  1 
ATOM   4833  C  CG  . LYS B 1 47  ? 60.813  14.659  32.000  1.00 34.23 ? 79  LYS B CG  1 
ATOM   4834  C  CD  . LYS B 1 47  ? 59.735  15.264  31.136  1.00 34.16 ? 79  LYS B CD  1 
ATOM   4835  C  CE  . LYS B 1 47  ? 58.357  14.853  31.639  1.00 33.60 ? 79  LYS B CE  1 
ATOM   4836  N  NZ  . LYS B 1 47  ? 58.134  13.375  31.621  1.00 31.65 ? 79  LYS B NZ  1 
ATOM   4837  N  N   . LEU B 1 48  ? 64.927  15.932  32.698  1.00 29.77 ? 80  LEU B N   1 
ATOM   4838  C  CA  . LEU B 1 48  ? 66.230  16.560  32.554  1.00 28.51 ? 80  LEU B CA  1 
ATOM   4839  C  C   . LEU B 1 48  ? 67.369  15.599  32.890  1.00 28.29 ? 80  LEU B C   1 
ATOM   4840  O  O   . LEU B 1 48  ? 68.381  15.567  32.178  1.00 27.97 ? 80  LEU B O   1 
ATOM   4841  C  CB  . LEU B 1 48  ? 66.337  17.846  33.387  1.00 26.46 ? 80  LEU B CB  1 
ATOM   4842  C  CG  . LEU B 1 48  ? 65.668  19.107  32.806  1.00 24.77 ? 80  LEU B CG  1 
ATOM   4843  C  CD1 . LEU B 1 48  ? 66.413  20.349  33.311  1.00 22.25 ? 80  LEU B CD1 1 
ATOM   4844  C  CD2 . LEU B 1 48  ? 65.679  19.093  31.258  1.00 24.88 ? 80  LEU B CD2 1 
ATOM   4845  N  N   . LEU B 1 49  ? 67.199  14.803  33.944  1.00 27.94 ? 81  LEU B N   1 
ATOM   4846  C  CA  . LEU B 1 49  ? 68.232  13.835  34.308  1.00 28.72 ? 81  LEU B CA  1 
ATOM   4847  C  C   . LEU B 1 49  ? 68.435  12.799  33.213  1.00 27.84 ? 81  LEU B C   1 
ATOM   4848  O  O   . LEU B 1 49  ? 69.558  12.567  32.746  1.00 27.84 ? 81  LEU B O   1 
ATOM   4849  C  CB  . LEU B 1 49  ? 67.872  13.076  35.576  1.00 29.41 ? 81  LEU B CB  1 
ATOM   4850  C  CG  . LEU B 1 49  ? 67.928  13.799  36.917  1.00 31.38 ? 81  LEU B CG  1 
ATOM   4851  C  CD1 . LEU B 1 49  ? 67.890  12.723  38.022  1.00 30.25 ? 81  LEU B CD1 1 
ATOM   4852  C  CD2 . LEU B 1 49  ? 69.192  14.656  37.026  1.00 29.94 ? 81  LEU B CD2 1 
ATOM   4853  N  N   . LEU B 1 50  ? 67.344  12.174  32.801  1.00 24.78 ? 82  LEU B N   1 
ATOM   4854  C  CA  . LEU B 1 50  ? 67.460  11.157  31.792  1.00 25.97 ? 82  LEU B CA  1 
ATOM   4855  C  C   . LEU B 1 50  ? 67.893  11.619  30.411  1.00 27.25 ? 82  LEU B C   1 
ATOM   4856  O  O   . LEU B 1 50  ? 68.436  10.835  29.634  1.00 28.29 ? 82  LEU B O   1 
ATOM   4857  C  CB  . LEU B 1 50  ? 66.187  10.343  31.737  1.00 28.18 ? 82  LEU B CB  1 
ATOM   4858  C  CG  . LEU B 1 50  ? 66.274  9.270   32.828  1.00 32.68 ? 82  LEU B CG  1 
ATOM   4859  C  CD1 . LEU B 1 50  ? 66.340  9.910   34.241  1.00 31.13 ? 82  LEU B CD1 1 
ATOM   4860  C  CD2 . LEU B 1 50  ? 65.085  8.285   32.700  1.00 35.49 ? 82  LEU B CD2 1 
ATOM   4861  N  N   . LYS B 1 51  ? 67.702  12.900  30.121  1.00 28.52 ? 83  LYS B N   1 
ATOM   4862  C  CA  . LYS B 1 51  ? 68.060  13.462  28.821  1.00 28.73 ? 83  LYS B CA  1 
ATOM   4863  C  C   . LYS B 1 51  ? 69.502  13.136  28.335  1.00 27.20 ? 83  LYS B C   1 
ATOM   4864  O  O   . LYS B 1 51  ? 70.477  13.712  28.821  1.00 32.05 ? 83  LYS B O   1 
ATOM   4865  C  CB  . LYS B 1 51  ? 67.816  14.987  28.867  1.00 31.16 ? 83  LYS B CB  1 
ATOM   4866  C  CG  . LYS B 1 51  ? 68.396  15.811  27.688  1.00 36.76 ? 83  LYS B CG  1 
ATOM   4867  C  CD  . LYS B 1 51  ? 67.434  15.938  26.467  1.00 38.36 ? 83  LYS B CD  1 
ATOM   4868  C  CE  . LYS B 1 51  ? 67.149  14.608  25.702  1.00 36.63 ? 83  LYS B CE  1 
ATOM   4869  N  NZ  . LYS B 1 51  ? 66.138  13.680  26.308  1.00 30.93 ? 83  LYS B NZ  1 
ATOM   4870  N  N   . PRO B 1 52  ? 69.661  12.180  27.405  1.00 22.80 ? 84  PRO B N   1 
ATOM   4871  C  CA  . PRO B 1 52  ? 71.018  11.887  26.939  1.00 20.79 ? 84  PRO B CA  1 
ATOM   4872  C  C   . PRO B 1 52  ? 71.452  12.987  25.962  1.00 19.55 ? 84  PRO B C   1 
ATOM   4873  O  O   . PRO B 1 52  ? 70.649  13.486  25.165  1.00 17.87 ? 84  PRO B O   1 
ATOM   4874  C  CB  . PRO B 1 52  ? 70.846  10.561  26.219  1.00 20.73 ? 84  PRO B CB  1 
ATOM   4875  C  CG  . PRO B 1 52  ? 69.504  10.714  25.602  1.00 23.04 ? 84  PRO B CG  1 
ATOM   4876  C  CD  . PRO B 1 52  ? 68.686  11.303  26.743  1.00 23.63 ? 84  PRO B CD  1 
ATOM   4877  N  N   . THR B 1 53  ? 72.717  13.375  26.029  1.00 19.14 ? 85  THR B N   1 
ATOM   4878  C  CA  . THR B 1 53  ? 73.203  14.406  25.135  1.00 18.89 ? 85  THR B CA  1 
ATOM   4879  C  C   . THR B 1 53  ? 73.182  13.922  23.681  1.00 18.19 ? 85  THR B C   1 
ATOM   4880  O  O   . THR B 1 53  ? 73.520  12.772  23.381  1.00 16.17 ? 85  THR B O   1 
ATOM   4881  C  CB  . THR B 1 53  ? 74.608  14.896  25.531  1.00 17.76 ? 85  THR B CB  1 
ATOM   4882  O  OG1 . THR B 1 53  ? 74.845  16.170  24.934  1.00 20.72 ? 85  THR B OG1 1 
ATOM   4883  C  CG2 . THR B 1 53  ? 75.659  13.971  25.029  1.00 19.53 ? 85  THR B CG2 1 
ATOM   4884  N  N   . PRO B 1 54  ? 72.813  14.818  22.754  1.00 19.36 ? 86  PRO B N   1 
ATOM   4885  C  CA  . PRO B 1 54  ? 72.724  14.555  21.310  1.00 19.62 ? 86  PRO B CA  1 
ATOM   4886  C  C   . PRO B 1 54  ? 73.931  13.821  20.805  1.00 19.94 ? 86  PRO B C   1 
ATOM   4887  O  O   . PRO B 1 54  ? 73.830  12.945  19.952  1.00 21.19 ? 86  PRO B O   1 
ATOM   4888  C  CB  . PRO B 1 54  ? 72.670  15.965  20.698  1.00 19.76 ? 86  PRO B CB  1 
ATOM   4889  C  CG  . PRO B 1 54  ? 73.266  16.865  21.784  1.00 20.05 ? 86  PRO B CG  1 
ATOM   4890  C  CD  . PRO B 1 54  ? 72.656  16.259  23.023  1.00 19.96 ? 86  PRO B CD  1 
ATOM   4891  N  N   . ASN B 1 55  ? 75.081  14.202  21.340  1.00 19.92 ? 87  ASN B N   1 
ATOM   4892  C  CA  . ASN B 1 55  ? 76.331  13.587  20.960  1.00 20.02 ? 87  ASN B CA  1 
ATOM   4893  C  C   . ASN B 1 55  ? 76.377  12.143  21.457  1.00 18.24 ? 87  ASN B C   1 
ATOM   4894  O  O   . ASN B 1 55  ? 76.862  11.278  20.736  1.00 17.27 ? 87  ASN B O   1 
ATOM   4895  C  CB  . ASN B 1 55  ? 77.505  14.398  21.510  1.00 24.49 ? 87  ASN B CB  1 
ATOM   4896  C  CG  . ASN B 1 55  ? 77.372  15.871  21.213  1.00 29.13 ? 87  ASN B CG  1 
ATOM   4897  O  OD1 . ASN B 1 55  ? 77.955  16.379  20.240  1.00 31.03 ? 87  ASN B OD1 1 
ATOM   4898  N  ND2 . ASN B 1 55  ? 76.586  16.574  22.042  1.00 29.99 ? 87  ASN B ND2 1 
ATOM   4899  N  N   . THR B 1 56  ? 75.860  11.875  22.659  1.00 15.76 ? 88  THR B N   1 
ATOM   4900  C  CA  . THR B 1 56  ? 75.853  10.515  23.189  1.00 17.39 ? 88  THR B CA  1 
ATOM   4901  C  C   . THR B 1 56  ? 75.055  9.678   22.200  1.00 18.52 ? 88  THR B C   1 
ATOM   4902  O  O   . THR B 1 56  ? 75.510  8.652   21.665  1.00 19.00 ? 88  THR B O   1 
ATOM   4903  C  CB  . THR B 1 56  ? 75.094  10.406  24.523  1.00 18.10 ? 88  THR B CB  1 
ATOM   4904  O  OG1 . THR B 1 56  ? 75.621  11.344  25.472  1.00 18.67 ? 88  THR B OG1 1 
ATOM   4905  C  CG2 . THR B 1 56  ? 75.210  8.974   25.087  1.00 17.52 ? 88  THR B CG2 1 
ATOM   4906  N  N   . VAL B 1 57  ? 73.854  10.158  21.946  1.00 18.92 ? 89  VAL B N   1 
ATOM   4907  C  CA  . VAL B 1 57  ? 72.969  9.484   21.028  1.00 21.78 ? 89  VAL B CA  1 
ATOM   4908  C  C   . VAL B 1 57  ? 73.709  9.352   19.700  1.00 21.09 ? 89  VAL B C   1 
ATOM   4909  O  O   . VAL B 1 57  ? 73.754  8.276   19.086  1.00 19.96 ? 89  VAL B O   1 
ATOM   4910  C  CB  . VAL B 1 57  ? 71.670  10.291  20.837  1.00 22.20 ? 89  VAL B CB  1 
ATOM   4911  C  CG1 . VAL B 1 57  ? 70.615  9.429   20.177  1.00 20.22 ? 89  VAL B CG1 1 
ATOM   4912  C  CG2 . VAL B 1 57  ? 71.179  10.834  22.199  1.00 24.06 ? 89  VAL B CG2 1 
ATOM   4913  N  N   . HIS B 1 58  ? 74.381  10.431  19.330  1.00 20.33 ? 90  HIS B N   1 
ATOM   4914  C  CA  . HIS B 1 58  ? 75.109  10.455  18.088  1.00 20.05 ? 90  HIS B CA  1 
ATOM   4915  C  C   . HIS B 1 58  ? 76.098  9.321   18.054  1.00 18.65 ? 90  HIS B C   1 
ATOM   4916  O  O   . HIS B 1 58  ? 76.235  8.638   17.047  1.00 17.87 ? 90  HIS B O   1 
ATOM   4917  C  CB  . HIS B 1 58  ? 75.836  11.774  17.894  1.00 19.92 ? 90  HIS B CB  1 
ATOM   4918  C  CG  . HIS B 1 58  ? 76.399  11.924  16.523  1.00 24.92 ? 90  HIS B CG  1 
ATOM   4919  N  ND1 . HIS B 1 58  ? 77.153  10.939  15.919  1.00 26.35 ? 90  HIS B ND1 1 
ATOM   4920  C  CD2 . HIS B 1 58  ? 76.246  12.902  15.594  1.00 28.41 ? 90  HIS B CD2 1 
ATOM   4921  C  CE1 . HIS B 1 58  ? 77.437  11.300  14.676  1.00 29.67 ? 90  HIS B CE1 1 
ATOM   4922  N  NE2 . HIS B 1 58  ? 76.896  12.485  14.452  1.00 30.45 ? 90  HIS B NE2 1 
ATOM   4923  N  N   . TYR B 1 59  ? 76.787  9.118   19.164  1.00 18.98 ? 91  TYR B N   1 
ATOM   4924  C  CA  . TYR B 1 59  ? 77.787  8.061   19.250  1.00 18.42 ? 91  TYR B CA  1 
ATOM   4925  C  C   . TYR B 1 59  ? 77.062  6.751   19.053  1.00 17.11 ? 91  TYR B C   1 
ATOM   4926  O  O   . TYR B 1 59  ? 77.308  6.017   18.082  1.00 16.25 ? 91  TYR B O   1 
ATOM   4927  C  CB  . TYR B 1 59  ? 78.481  8.060   20.632  1.00 20.66 ? 91  TYR B CB  1 
ATOM   4928  C  CG  . TYR B 1 59  ? 79.558  6.986   20.802  1.00 24.92 ? 91  TYR B CG  1 
ATOM   4929  C  CD1 . TYR B 1 59  ? 79.212  5.672   21.153  1.00 25.32 ? 91  TYR B CD1 1 
ATOM   4930  C  CD2 . TYR B 1 59  ? 80.921  7.273   20.562  1.00 24.99 ? 91  TYR B CD2 1 
ATOM   4931  C  CE1 . TYR B 1 59  ? 80.171  4.674   21.244  1.00 24.12 ? 91  TYR B CE1 1 
ATOM   4932  C  CE2 . TYR B 1 59  ? 81.895  6.285   20.668  1.00 23.01 ? 91  TYR B CE2 1 
ATOM   4933  C  CZ  . TYR B 1 59  ? 81.508  4.986   21.003  1.00 25.67 ? 91  TYR B CZ  1 
ATOM   4934  O  OH  . TYR B 1 59  ? 82.445  3.982   21.071  1.00 26.41 ? 91  TYR B OH  1 
ATOM   4935  N  N   . ILE B 1 60  ? 76.126  6.503   19.960  1.00 14.93 ? 92  ILE B N   1 
ATOM   4936  C  CA  . ILE B 1 60  ? 75.349  5.287   19.967  1.00 14.51 ? 92  ILE B CA  1 
ATOM   4937  C  C   . ILE B 1 60  ? 74.718  4.985   18.622  1.00 16.60 ? 92  ILE B C   1 
ATOM   4938  O  O   . ILE B 1 60  ? 74.614  3.836   18.217  1.00 17.77 ? 92  ILE B O   1 
ATOM   4939  C  CB  . ILE B 1 60  ? 74.277  5.381   20.990  1.00 12.23 ? 92  ILE B CB  1 
ATOM   4940  C  CG1 . ILE B 1 60  ? 74.875  5.886   22.298  1.00 14.09 ? 92  ILE B CG1 1 
ATOM   4941  C  CG2 . ILE B 1 60  ? 73.694  4.045   21.193  1.00 14.64 ? 92  ILE B CG2 1 
ATOM   4942  C  CD1 . ILE B 1 60  ? 73.867  6.475   23.254  1.00 16.29 ? 92  ILE B CD1 1 
ATOM   4943  N  N   . LEU B 1 61  ? 74.336  6.023   17.906  1.00 16.75 ? 93  LEU B N   1 
ATOM   4944  C  CA  . LEU B 1 61  ? 73.716  5.849   16.613  1.00 18.09 ? 93  LEU B CA  1 
ATOM   4945  C  C   . LEU B 1 61  ? 74.746  5.443   15.569  1.00 18.39 ? 93  LEU B C   1 
ATOM   4946  O  O   . LEU B 1 61  ? 74.547  4.489   14.830  1.00 17.55 ? 93  LEU B O   1 
ATOM   4947  C  CB  . LEU B 1 61  ? 73.034  7.163   16.218  1.00 20.36 ? 93  LEU B CB  1 
ATOM   4948  C  CG  . LEU B 1 61  ? 71.710  7.164   15.430  1.00 21.15 ? 93  LEU B CG  1 
ATOM   4949  C  CD1 . LEU B 1 61  ? 70.958  5.828   15.503  1.00 17.20 ? 93  LEU B CD1 1 
ATOM   4950  C  CD2 . LEU B 1 61  ? 70.855  8.299   15.990  1.00 20.16 ? 93  LEU B CD2 1 
ATOM   4951  N  N   . THR B 1 62  ? 75.881  6.139   15.581  1.00 21.18 ? 94  THR B N   1 
ATOM   4952  C  CA  . THR B 1 62  ? 76.986  5.927   14.634  1.00 20.84 ? 94  THR B CA  1 
ATOM   4953  C  C   . THR B 1 62  ? 77.883  4.696   14.873  1.00 20.58 ? 94  THR B C   1 
ATOM   4954  O  O   . THR B 1 62  ? 78.711  4.333   14.028  1.00 17.68 ? 94  THR B O   1 
ATOM   4955  C  CB  . THR B 1 62  ? 77.874  7.176   14.587  1.00 18.62 ? 94  THR B CB  1 
ATOM   4956  O  OG1 . THR B 1 62  ? 77.041  8.339   14.554  1.00 17.06 ? 94  THR B OG1 1 
ATOM   4957  C  CG2 . THR B 1 62  ? 78.728  7.161   13.337  1.00 19.76 ? 94  THR B CG2 1 
ATOM   4958  N  N   . HIS B 1 63  ? 77.704  4.046   16.012  1.00 21.28 ? 95  HIS B N   1 
ATOM   4959  C  CA  . HIS B 1 63  ? 78.511  2.887   16.352  1.00 23.21 ? 95  HIS B CA  1 
ATOM   4960  C  C   . HIS B 1 63  ? 77.692  1.577   16.300  1.00 21.59 ? 95  HIS B C   1 
ATOM   4961  O  O   . HIS B 1 63  ? 76.727  1.481   15.549  1.00 20.20 ? 95  HIS B O   1 
ATOM   4962  C  CB  . HIS B 1 63  ? 79.182  3.140   17.733  1.00 25.70 ? 95  HIS B CB  1 
ATOM   4963  C  CG  . HIS B 1 63  ? 80.190  4.263   17.720  1.00 30.18 ? 95  HIS B CG  1 
ATOM   4964  N  ND1 . HIS B 1 63  ? 81.541  4.063   17.930  1.00 29.36 ? 95  HIS B ND1 1 
ATOM   4965  C  CD2 . HIS B 1 63  ? 80.051  5.586   17.436  1.00 32.22 ? 95  HIS B CD2 1 
ATOM   4966  C  CE1 . HIS B 1 63  ? 82.187  5.206   17.764  1.00 30.14 ? 95  HIS B CE1 1 
ATOM   4967  N  NE2 . HIS B 1 63  ? 81.307  6.146   17.466  1.00 30.99 ? 95  HIS B NE2 1 
ATOM   4968  N  N   . PHE B 1 64  ? 78.195  0.534   16.955  1.00 20.18 ? 96  PHE B N   1 
ATOM   4969  C  CA  . PHE B 1 64  ? 77.525  -0.753  17.041  1.00 18.02 ? 96  PHE B CA  1 
ATOM   4970  C  C   . PHE B 1 64  ? 76.953  -1.342  15.739  1.00 17.28 ? 96  PHE B C   1 
ATOM   4971  O  O   . PHE B 1 64  ? 76.020  -2.142  15.770  1.00 17.66 ? 96  PHE B O   1 
ATOM   4972  C  CB  . PHE B 1 64  ? 76.463  -0.625  18.116  1.00 17.29 ? 96  PHE B CB  1 
ATOM   4973  C  CG  . PHE B 1 64  ? 76.911  0.187   19.271  1.00 17.33 ? 96  PHE B CG  1 
ATOM   4974  C  CD1 . PHE B 1 64  ? 78.127  -0.075  19.888  1.00 17.07 ? 96  PHE B CD1 1 
ATOM   4975  C  CD2 . PHE B 1 64  ? 76.163  1.269   19.695  1.00 20.87 ? 96  PHE B CD2 1 
ATOM   4976  C  CE1 . PHE B 1 64  ? 78.601  0.741   20.918  1.00 21.14 ? 96  PHE B CE1 1 
ATOM   4977  C  CE2 . PHE B 1 64  ? 76.624  2.100   20.727  1.00 22.82 ? 96  PHE B CE2 1 
ATOM   4978  C  CZ  . PHE B 1 64  ? 77.854  1.833   21.341  1.00 21.77 ? 96  PHE B CZ  1 
ATOM   4979  N  N   . LYS B 1 65  ? 77.597  -1.038  14.616  1.00 15.70 ? 97  LYS B N   1 
ATOM   4980  C  CA  . LYS B 1 65  ? 77.178  -1.492  13.281  1.00 18.03 ? 97  LYS B CA  1 
ATOM   4981  C  C   . LYS B 1 65  ? 76.494  -2.875  13.175  1.00 21.26 ? 97  LYS B C   1 
ATOM   4982  O  O   . LYS B 1 65  ? 75.642  -3.105  12.304  1.00 24.38 ? 97  LYS B O   1 
ATOM   4983  C  CB  . LYS B 1 65  ? 78.377  -1.438  12.329  1.00 16.12 ? 97  LYS B CB  1 
ATOM   4984  C  CG  . LYS B 1 65  ? 78.091  -1.740  10.868  1.00 15.29 ? 97  LYS B CG  1 
ATOM   4985  C  CD  . LYS B 1 65  ? 77.193  -0.697  10.257  1.00 15.05 ? 97  LYS B CD  1 
ATOM   4986  C  CE  . LYS B 1 65  ? 77.051  -0.865  8.746   1.00 14.50 ? 97  LYS B CE  1 
ATOM   4987  N  NZ  . LYS B 1 65  ? 76.117  0.152   8.169   1.00 19.83 ? 97  LYS B NZ  1 
ATOM   4988  N  N   . GLY B 1 66  ? 76.867  -3.797  14.051  1.00 22.83 ? 98  GLY B N   1 
ATOM   4989  C  CA  . GLY B 1 66  ? 76.283  -5.132  14.019  1.00 25.12 ? 98  GLY B CA  1 
ATOM   4990  C  C   . GLY B 1 66  ? 75.001  -5.191  14.810  1.00 23.85 ? 98  GLY B C   1 
ATOM   4991  O  O   . GLY B 1 66  ? 74.039  -5.849  14.413  1.00 25.25 ? 98  GLY B O   1 
ATOM   4992  N  N   . VAL B 1 67  ? 75.015  -4.537  15.959  1.00 22.44 ? 99  VAL B N   1 
ATOM   4993  C  CA  . VAL B 1 67  ? 73.834  -4.454  16.794  1.00 22.44 ? 99  VAL B CA  1 
ATOM   4994  C  C   . VAL B 1 67  ? 72.851  -3.797  15.847  1.00 23.84 ? 99  VAL B C   1 
ATOM   4995  O  O   . VAL B 1 67  ? 71.772  -4.342  15.585  1.00 26.15 ? 99  VAL B O   1 
ATOM   4996  C  CB  . VAL B 1 67  ? 74.055  -3.493  17.981  1.00 22.46 ? 99  VAL B CB  1 
ATOM   4997  C  CG1 . VAL B 1 67  ? 72.861  -3.481  18.883  1.00 18.04 ? 99  VAL B CG1 1 
ATOM   4998  C  CG2 . VAL B 1 67  ? 75.331  -3.871  18.742  1.00 23.20 ? 99  VAL B CG2 1 
ATOM   4999  N  N   . TRP B 1 68  ? 73.292  -2.688  15.243  1.00 23.03 ? 100 TRP B N   1 
ATOM   5000  C  CA  . TRP B 1 68  ? 72.465  -1.936  14.312  1.00 23.17 ? 100 TRP B CA  1 
ATOM   5001  C  C   . TRP B 1 68  ? 71.920  -2.776  13.190  1.00 23.48 ? 100 TRP B C   1 
ATOM   5002  O  O   . TRP B 1 68  ? 70.756  -2.614  12.794  1.00 23.15 ? 100 TRP B O   1 
ATOM   5003  C  CB  . TRP B 1 68  ? 73.190  -0.699  13.772  1.00 21.79 ? 100 TRP B CB  1 
ATOM   5004  C  CG  . TRP B 1 68  ? 73.042  0.417   14.707  1.00 22.91 ? 100 TRP B CG  1 
ATOM   5005  C  CD1 . TRP B 1 68  ? 74.032  1.040   15.385  1.00 24.54 ? 100 TRP B CD1 1 
ATOM   5006  C  CD2 . TRP B 1 68  ? 71.805  0.959   15.209  1.00 26.05 ? 100 TRP B CD2 1 
ATOM   5007  N  NE1 . TRP B 1 68  ? 73.507  1.925   16.299  1.00 26.39 ? 100 TRP B NE1 1 
ATOM   5008  C  CE2 . TRP B 1 68  ? 72.138  1.898   16.212  1.00 27.52 ? 100 TRP B CE2 1 
ATOM   5009  C  CE3 . TRP B 1 68  ? 70.448  0.735   14.913  1.00 25.13 ? 100 TRP B CE3 1 
ATOM   5010  C  CZ2 . TRP B 1 68  ? 71.155  2.623   16.930  1.00 27.76 ? 100 TRP B CZ2 1 
ATOM   5011  C  CZ3 . TRP B 1 68  ? 69.478  1.452   15.623  1.00 26.22 ? 100 TRP B CZ3 1 
ATOM   5012  C  CH2 . TRP B 1 68  ? 69.840  2.385   16.619  1.00 26.70 ? 100 TRP B CH2 1 
ATOM   5013  N  N   . ASN B 1 69  ? 72.732  -3.720  12.727  1.00 25.78 ? 101 ASN B N   1 
ATOM   5014  C  CA  . ASN B 1 69  ? 72.307  -4.590  11.638  1.00 27.62 ? 101 ASN B CA  1 
ATOM   5015  C  C   . ASN B 1 69  ? 71.150  -5.512  12.021  1.00 24.66 ? 101 ASN B C   1 
ATOM   5016  O  O   . ASN B 1 69  ? 70.279  -5.800  11.202  1.00 20.08 ? 101 ASN B O   1 
ATOM   5017  C  CB  . ASN B 1 69  ? 73.476  -5.391  11.076  1.00 34.02 ? 101 ASN B CB  1 
ATOM   5018  C  CG  . ASN B 1 69  ? 73.129  -6.030  9.744   1.00 40.04 ? 101 ASN B CG  1 
ATOM   5019  O  OD1 . ASN B 1 69  ? 73.172  -5.379  8.696   1.00 43.35 ? 101 ASN B OD1 1 
ATOM   5020  N  ND2 . ASN B 1 69  ? 72.731  -7.297  9.781   1.00 46.69 ? 101 ASN B ND2 1 
ATOM   5021  N  N   . ILE B 1 70  ? 71.154  -5.971  13.265  1.00 23.87 ? 102 ILE B N   1 
ATOM   5022  C  CA  . ILE B 1 70  ? 70.085  -6.824  13.778  1.00 25.03 ? 102 ILE B CA  1 
ATOM   5023  C  C   . ILE B 1 70  ? 68.792  -6.012  13.676  1.00 25.02 ? 102 ILE B C   1 
ATOM   5024  O  O   . ILE B 1 70  ? 67.784  -6.470  13.088  1.00 24.32 ? 102 ILE B O   1 
ATOM   5025  C  CB  . ILE B 1 70  ? 70.354  -7.200  15.264  1.00 26.26 ? 102 ILE B CB  1 
ATOM   5026  C  CG1 . ILE B 1 70  ? 71.565  -8.136  15.332  1.00 26.65 ? 102 ILE B CG1 1 
ATOM   5027  C  CG2 . ILE B 1 70  ? 69.102  -7.794  15.937  1.00 24.94 ? 102 ILE B CG2 1 
ATOM   5028  C  CD1 . ILE B 1 70  ? 72.164  -8.237  16.722  1.00 30.43 ? 102 ILE B CD1 1 
ATOM   5029  N  N   . VAL B 1 71  ? 68.856  -4.797  14.225  1.00 24.25 ? 103 VAL B N   1 
ATOM   5030  C  CA  . VAL B 1 71  ? 67.740  -3.848  14.216  1.00 23.42 ? 103 VAL B CA  1 
ATOM   5031  C  C   . VAL B 1 71  ? 67.190  -3.685  12.791  1.00 22.19 ? 103 VAL B C   1 
ATOM   5032  O  O   . VAL B 1 71  ? 66.015  -3.975  12.547  1.00 22.57 ? 103 VAL B O   1 
ATOM   5033  C  CB  . VAL B 1 71  ? 68.200  -2.477  14.755  1.00 23.04 ? 103 VAL B CB  1 
ATOM   5034  C  CG1 . VAL B 1 71  ? 67.057  -1.462  14.700  1.00 21.63 ? 103 VAL B CG1 1 
ATOM   5035  C  CG2 . VAL B 1 71  ? 68.715  -2.637  16.194  1.00 22.00 ? 103 VAL B CG2 1 
ATOM   5036  N  N   . ASN B 1 72  ? 68.055  -3.293  11.854  1.00 21.31 ? 104 ASN B N   1 
ATOM   5037  C  CA  . ASN B 1 72  ? 67.681  -3.113  10.441  1.00 22.24 ? 104 ASN B CA  1 
ATOM   5038  C  C   . ASN B 1 72  ? 67.016  -4.332  9.807   1.00 24.78 ? 104 ASN B C   1 
ATOM   5039  O  O   . ASN B 1 72  ? 66.631  -4.287  8.636   1.00 23.35 ? 104 ASN B O   1 
ATOM   5040  C  CB  . ASN B 1 72  ? 68.910  -2.769  9.598   1.00 21.20 ? 104 ASN B CB  1 
ATOM   5041  C  CG  . ASN B 1 72  ? 69.352  -1.336  9.777   1.00 25.05 ? 104 ASN B CG  1 
ATOM   5042  O  OD1 . ASN B 1 72  ? 68.649  -0.522  10.402  1.00 29.11 ? 104 ASN B OD1 1 
ATOM   5043  N  ND2 . ASN B 1 72  ? 70.509  -0.997  9.214   1.00 24.59 ? 104 ASN B ND2 1 
ATOM   5044  N  N   . ASN B 1 73  ? 66.942  -5.433  10.555  1.00 28.18 ? 105 ASN B N   1 
ATOM   5045  C  CA  . ASN B 1 73  ? 66.342  -6.652  10.053  1.00 31.29 ? 105 ASN B CA  1 
ATOM   5046  C  C   . ASN B 1 73  ? 65.126  -7.150  10.855  1.00 32.13 ? 105 ASN B C   1 
ATOM   5047  O  O   . ASN B 1 73  ? 64.466  -8.128  10.476  1.00 34.11 ? 105 ASN B O   1 
ATOM   5048  C  CB  . ASN B 1 73  ? 67.420  -7.716  9.850   1.00 35.89 ? 105 ASN B CB  1 
ATOM   5049  C  CG  . ASN B 1 73  ? 68.220  -7.505  8.536   1.00 41.92 ? 105 ASN B CG  1 
ATOM   5050  O  OD1 . ASN B 1 73  ? 69.194  -6.730  8.480   1.00 43.43 ? 105 ASN B OD1 1 
ATOM   5051  N  ND2 . ASN B 1 73  ? 67.807  -8.206  7.477   1.00 44.40 ? 105 ASN B ND2 1 
ATOM   5052  N  N   . ILE B 1 74  A 64.824  -6.471  11.958  1.00 31.05 ? 105 ILE B N   1 
ATOM   5053  C  CA  . ILE B 1 74  A 63.641  -6.789  12.760  1.00 29.38 ? 105 ILE B CA  1 
ATOM   5054  C  C   . ILE B 1 74  A 62.707  -5.609  12.475  1.00 29.18 ? 105 ILE B C   1 
ATOM   5055  O  O   . ILE B 1 74  A 62.750  -4.576  13.167  1.00 29.82 ? 105 ILE B O   1 
ATOM   5056  C  CB  . ILE B 1 74  A 63.965  -6.859  14.259  1.00 29.26 ? 105 ILE B CB  1 
ATOM   5057  C  CG1 . ILE B 1 74  A 64.850  -8.077  14.527  1.00 31.16 ? 105 ILE B CG1 1 
ATOM   5058  C  CG2 . ILE B 1 74  A 62.683  -6.908  15.089  1.00 27.03 ? 105 ILE B CG2 1 
ATOM   5059  C  CD1 . ILE B 1 74  A 65.023  -8.411  16.026  1.00 36.38 ? 105 ILE B CD1 1 
ATOM   5060  N  N   . PRO B 1 75  ? 61.867  -5.736  11.428  1.00 27.14 ? 106 PRO B N   1 
ATOM   5061  C  CA  . PRO B 1 75  ? 60.914  -4.708  10.997  1.00 24.51 ? 106 PRO B CA  1 
ATOM   5062  C  C   . PRO B 1 75  ? 60.263  -3.966  12.148  1.00 23.09 ? 106 PRO B C   1 
ATOM   5063  O  O   . PRO B 1 75  ? 60.391  -2.748  12.278  1.00 23.19 ? 106 PRO B O   1 
ATOM   5064  C  CB  . PRO B 1 75  ? 59.906  -5.513  10.184  1.00 23.13 ? 106 PRO B CB  1 
ATOM   5065  C  CG  . PRO B 1 75  ? 60.793  -6.497  9.498   1.00 24.47 ? 106 PRO B CG  1 
ATOM   5066  C  CD  . PRO B 1 75  ? 61.662  -6.975  10.657  1.00 26.76 ? 106 PRO B CD  1 
ATOM   5067  N  N   . PHE B 1 76  ? 59.657  -4.741  13.028  1.00 22.16 ? 107 PHE B N   1 
ATOM   5068  C  CA  . PHE B 1 76  ? 58.946  -4.247  14.208  1.00 23.67 ? 107 PHE B CA  1 
ATOM   5069  C  C   . PHE B 1 76  ? 59.854  -3.319  14.998  1.00 22.45 ? 107 PHE B C   1 
ATOM   5070  O  O   . PHE B 1 76  ? 59.415  -2.277  15.498  1.00 25.30 ? 107 PHE B O   1 
ATOM   5071  C  CB  . PHE B 1 76  ? 58.518  -5.446  15.046  1.00 26.58 ? 107 PHE B CB  1 
ATOM   5072  C  CG  . PHE B 1 76  ? 58.668  -6.756  14.302  1.00 35.38 ? 107 PHE B CG  1 
ATOM   5073  C  CD1 . PHE B 1 76  ? 58.051  -6.933  13.047  1.00 38.07 ? 107 PHE B CD1 1 
ATOM   5074  C  CD2 . PHE B 1 76  ? 59.511  -7.768  14.785  1.00 37.57 ? 107 PHE B CD2 1 
ATOM   5075  C  CE1 . PHE B 1 76  ? 58.284  -8.093  12.283  1.00 40.19 ? 107 PHE B CE1 1 
ATOM   5076  C  CE2 . PHE B 1 76  ? 59.749  -8.932  14.032  1.00 39.67 ? 107 PHE B CE2 1 
ATOM   5077  C  CZ  . PHE B 1 76  ? 59.135  -9.092  12.777  1.00 40.13 ? 107 PHE B CZ  1 
ATOM   5078  N  N   . LEU B 1 77  ? 61.141  -3.650  15.022  1.00 19.54 ? 108 LEU B N   1 
ATOM   5079  C  CA  . LEU B 1 77  ? 62.127  -2.845  15.729  1.00 17.40 ? 108 LEU B CA  1 
ATOM   5080  C  C   . LEU B 1 77  ? 62.485  -1.569  15.007  1.00 15.30 ? 108 LEU B C   1 
ATOM   5081  O  O   . LEU B 1 77  ? 62.407  -0.477  15.588  1.00 11.83 ? 108 LEU B O   1 
ATOM   5082  C  CB  . LEU B 1 77  ? 63.393  -3.643  15.950  1.00 19.41 ? 108 LEU B CB  1 
ATOM   5083  C  CG  . LEU B 1 77  ? 63.476  -4.260  17.341  1.00 19.91 ? 108 LEU B CG  1 
ATOM   5084  C  CD1 . LEU B 1 77  ? 64.715  -5.145  17.375  1.00 23.21 ? 108 LEU B CD1 1 
ATOM   5085  C  CD2 . LEU B 1 77  ? 63.521  -3.142  18.406  1.00 16.95 ? 108 LEU B CD2 1 
ATOM   5086  N  N   . ARG B 1 78  ? 62.909  -1.718  13.751  1.00 13.65 ? 109 ARG B N   1 
ATOM   5087  C  CA  . ARG B 1 78  ? 63.288  -0.575  12.920  1.00 14.74 ? 109 ARG B CA  1 
ATOM   5088  C  C   . ARG B 1 78  ? 62.226  0.520   12.931  1.00 17.92 ? 109 ARG B C   1 
ATOM   5089  O  O   . ARG B 1 78  ? 62.503  1.658   13.320  1.00 16.37 ? 109 ARG B O   1 
ATOM   5090  C  CB  . ARG B 1 78  ? 63.522  -1.009  11.480  1.00 12.36 ? 109 ARG B CB  1 
ATOM   5091  C  CG  . ARG B 1 78  ? 63.880  0.153   10.576  1.00 9.02  ? 109 ARG B CG  1 
ATOM   5092  C  CD  . ARG B 1 78  ? 64.121  -0.324  9.196   1.00 5.98  ? 109 ARG B CD  1 
ATOM   5093  N  NE  . ARG B 1 78  ? 64.447  0.737   8.273   1.00 2.34  ? 109 ARG B NE  1 
ATOM   5094  C  CZ  . ARG B 1 78  ? 64.416  0.579   6.961   1.00 6.92  ? 109 ARG B CZ  1 
ATOM   5095  N  NH1 . ARG B 1 78  ? 64.063  -0.584  6.446   1.00 8.66  ? 109 ARG B NH1 1 
ATOM   5096  N  NH2 . ARG B 1 78  ? 64.790  1.558   6.157   1.00 12.51 ? 109 ARG B NH2 1 
ATOM   5097  N  N   . SER B 1 79  ? 61.014  0.158   12.487  1.00 20.56 ? 110 SER B N   1 
ATOM   5098  C  CA  . SER B 1 79  ? 59.864  1.062   12.431  1.00 17.99 ? 110 SER B CA  1 
ATOM   5099  C  C   . SER B 1 79  ? 59.774  1.710   13.797  1.00 17.76 ? 110 SER B C   1 
ATOM   5100  O  O   . SER B 1 79  ? 59.762  2.936   13.900  1.00 18.96 ? 110 SER B O   1 
ATOM   5101  C  CB  . SER B 1 79  ? 58.607  0.262   12.151  1.00 15.82 ? 110 SER B CB  1 
ATOM   5102  O  OG  . SER B 1 79  ? 58.533  -0.784  13.097  1.00 14.86 ? 110 SER B OG  1 
ATOM   5103  N  N   . LEU B 1 80  ? 59.787  0.871   14.831  1.00 15.83 ? 111 LEU B N   1 
ATOM   5104  C  CA  . LEU B 1 80  ? 59.753  1.326   16.211  1.00 16.88 ? 111 LEU B CA  1 
ATOM   5105  C  C   . LEU B 1 80  ? 60.802  2.466   16.406  1.00 17.02 ? 111 LEU B C   1 
ATOM   5106  O  O   . LEU B 1 80  ? 60.483  3.556   16.934  1.00 15.31 ? 111 LEU B O   1 
ATOM   5107  C  CB  . LEU B 1 80  ? 60.023  0.123   17.135  1.00 16.28 ? 111 LEU B CB  1 
ATOM   5108  C  CG  . LEU B 1 80  ? 59.938  0.148   18.665  1.00 18.54 ? 111 LEU B CG  1 
ATOM   5109  C  CD1 . LEU B 1 80  ? 61.277  0.555   19.316  1.00 21.38 ? 111 LEU B CD1 1 
ATOM   5110  C  CD2 . LEU B 1 80  ? 58.791  1.047   19.118  1.00 23.33 ? 111 LEU B CD2 1 
ATOM   5111  N  N   . ILE B 1 81  ? 62.012  2.251   15.892  1.00 15.10 ? 112 ILE B N   1 
ATOM   5112  C  CA  . ILE B 1 81  ? 63.080  3.244   16.018  1.00 15.03 ? 112 ILE B CA  1 
ATOM   5113  C  C   . ILE B 1 81  ? 62.718  4.497   15.200  1.00 13.49 ? 112 ILE B C   1 
ATOM   5114  O  O   . ILE B 1 81  ? 62.736  5.642   15.716  1.00 13.96 ? 112 ILE B O   1 
ATOM   5115  C  CB  . ILE B 1 81  ? 64.493  2.681   15.507  1.00 16.66 ? 112 ILE B CB  1 
ATOM   5116  C  CG1 . ILE B 1 81  ? 64.733  1.226   15.947  1.00 14.17 ? 112 ILE B CG1 1 
ATOM   5117  C  CG2 . ILE B 1 81  ? 65.677  3.564   16.013  1.00 14.54 ? 112 ILE B CG2 1 
ATOM   5118  C  CD1 . ILE B 1 81  ? 64.867  1.012   17.446  1.00 11.93 ? 112 ILE B CD1 1 
ATOM   5119  N  N   . MET B 1 82  ? 62.377  4.261   13.931  1.00 11.19 ? 113 MET B N   1 
ATOM   5120  C  CA  . MET B 1 82  ? 62.021  5.307   12.973  1.00 10.88 ? 113 MET B CA  1 
ATOM   5121  C  C   . MET B 1 82  ? 61.032  6.268   13.591  1.00 12.21 ? 113 MET B C   1 
ATOM   5122  O  O   . MET B 1 82  ? 61.178  7.471   13.520  1.00 12.15 ? 113 MET B O   1 
ATOM   5123  C  CB  . MET B 1 82  ? 61.422  4.685   11.713  1.00 7.15  ? 113 MET B CB  1 
ATOM   5124  C  CG  . MET B 1 82  ? 61.817  5.410   10.419  1.00 7.78  ? 113 MET B CG  1 
ATOM   5125  S  SD  . MET B 1 82  ? 62.797  6.959   10.667  1.00 6.16  ? 113 MET B SD  1 
ATOM   5126  C  CE  . MET B 1 82  ? 62.114  8.055   9.564   1.00 6.25  ? 113 MET B CE  1 
ATOM   5127  N  N   . LYS B 1 83  ? 60.071  5.709   14.292  1.00 16.14 ? 114 LYS B N   1 
ATOM   5128  C  CA  . LYS B 1 83  ? 59.053  6.486   14.958  1.00 18.53 ? 114 LYS B CA  1 
ATOM   5129  C  C   . LYS B 1 83  ? 59.692  7.472   15.935  1.00 19.55 ? 114 LYS B C   1 
ATOM   5130  O  O   . LYS B 1 83  ? 59.543  8.682   15.775  1.00 21.07 ? 114 LYS B O   1 
ATOM   5131  C  CB  . LYS B 1 83  ? 58.080  5.534   15.674  1.00 18.77 ? 114 LYS B CB  1 
ATOM   5132  C  CG  . LYS B 1 83  ? 56.807  6.175   16.173  1.00 18.64 ? 114 LYS B CG  1 
ATOM   5133  C  CD  . LYS B 1 83  ? 55.798  5.137   16.550  1.00 17.16 ? 114 LYS B CD  1 
ATOM   5134  C  CE  . LYS B 1 83  ? 55.444  4.261   15.357  1.00 22.16 ? 114 LYS B CE  1 
ATOM   5135  N  NZ  . LYS B 1 83  ? 54.227  3.410   15.648  1.00 22.75 ? 114 LYS B NZ  1 
ATOM   5136  N  N   . TYR B 1 84  ? 60.448  6.957   16.900  1.00 23.49 ? 115 TYR B N   1 
ATOM   5137  C  CA  . TYR B 1 84  ? 61.107  7.797   17.921  1.00 27.52 ? 115 TYR B CA  1 
ATOM   5138  C  C   . TYR B 1 84  ? 61.789  9.020   17.334  1.00 25.86 ? 115 TYR B C   1 
ATOM   5139  O  O   . TYR B 1 84  ? 61.546  10.169  17.753  1.00 22.98 ? 115 TYR B O   1 
ATOM   5140  C  CB  . TYR B 1 84  ? 62.163  6.994   18.693  1.00 32.93 ? 115 TYR B CB  1 
ATOM   5141  C  CG  . TYR B 1 84  ? 63.292  7.836   19.240  1.00 39.91 ? 115 TYR B CG  1 
ATOM   5142  C  CD1 . TYR B 1 84  ? 63.156  8.511   20.454  1.00 44.14 ? 115 TYR B CD1 1 
ATOM   5143  C  CD2 . TYR B 1 84  ? 64.521  7.947   18.539  1.00 44.48 ? 115 TYR B CD2 1 
ATOM   5144  C  CE1 . TYR B 1 84  ? 64.221  9.285   20.979  1.00 49.74 ? 115 TYR B CE1 1 
ATOM   5145  C  CE2 . TYR B 1 84  ? 65.601  8.713   19.046  1.00 47.12 ? 115 TYR B CE2 1 
ATOM   5146  C  CZ  . TYR B 1 84  ? 65.443  9.378   20.271  1.00 51.09 ? 115 TYR B CZ  1 
ATOM   5147  O  OH  . TYR B 1 84  ? 66.496  10.109  20.801  1.00 52.57 ? 115 TYR B OH  1 
ATOM   5148  N  N   . VAL B 1 85  ? 62.712  8.745   16.420  1.00 22.86 ? 116 VAL B N   1 
ATOM   5149  C  CA  . VAL B 1 85  ? 63.433  9.822   15.786  1.00 20.98 ? 116 VAL B CA  1 
ATOM   5150  C  C   . VAL B 1 85  ? 62.395  10.767  15.196  1.00 17.95 ? 116 VAL B C   1 
ATOM   5151  O  O   . VAL B 1 85  ? 62.366  11.931  15.555  1.00 21.54 ? 116 VAL B O   1 
ATOM   5152  C  CB  . VAL B 1 85  ? 64.472  9.305   14.736  1.00 20.24 ? 116 VAL B CB  1 
ATOM   5153  C  CG1 . VAL B 1 85  ? 63.955  8.077   14.006  1.00 19.91 ? 116 VAL B CG1 1 
ATOM   5154  C  CG2 . VAL B 1 85  ? 64.829  10.406  13.753  1.00 18.83 ? 116 VAL B CG2 1 
ATOM   5155  N  N   . LEU B 1 86  ? 61.436  10.217  14.473  1.00 14.37 ? 117 LEU B N   1 
ATOM   5156  C  CA  . LEU B 1 86  ? 60.392  10.998  13.845  1.00 15.13 ? 117 LEU B CA  1 
ATOM   5157  C  C   . LEU B 1 86  ? 59.619  11.985  14.749  1.00 17.54 ? 117 LEU B C   1 
ATOM   5158  O  O   . LEU B 1 86  ? 59.355  13.139  14.356  1.00 16.31 ? 117 LEU B O   1 
ATOM   5159  C  CB  . LEU B 1 86  ? 59.415  10.044  13.148  1.00 13.25 ? 117 LEU B CB  1 
ATOM   5160  C  CG  . LEU B 1 86  ? 59.113  10.306  11.670  1.00 11.69 ? 117 LEU B CG  1 
ATOM   5161  C  CD1 . LEU B 1 86  ? 60.340  10.788  10.936  1.00 10.25 ? 117 LEU B CD1 1 
ATOM   5162  C  CD2 . LEU B 1 86  ? 58.596  9.056   11.042  1.00 12.21 ? 117 LEU B CD2 1 
ATOM   5163  N  N   . THR B 1 87  ? 59.295  11.557  15.963  1.00 20.44 ? 118 THR B N   1 
ATOM   5164  C  CA  . THR B 1 87  ? 58.516  12.382  16.888  1.00 25.25 ? 118 THR B CA  1 
ATOM   5165  C  C   . THR B 1 87  ? 59.327  13.437  17.635  1.00 26.42 ? 118 THR B C   1 
ATOM   5166  O  O   . THR B 1 87  ? 59.021  14.642  17.579  1.00 27.62 ? 118 THR B O   1 
ATOM   5167  C  CB  . THR B 1 87  ? 57.799  11.500  17.938  1.00 26.69 ? 118 THR B CB  1 
ATOM   5168  O  OG1 . THR B 1 87  ? 58.778  10.715  18.636  1.00 24.92 ? 118 THR B OG1 1 
ATOM   5169  C  CG2 . THR B 1 87  ? 56.772  10.567  17.270  1.00 27.11 ? 118 THR B CG2 1 
ATOM   5170  N  N   . SER B 1 88  ? 60.291  12.952  18.415  1.00 28.49 ? 119 SER B N   1 
ATOM   5171  C  CA  . SER B 1 88  ? 61.194  13.791  19.217  1.00 30.40 ? 119 SER B CA  1 
ATOM   5172  C  C   . SER B 1 88  ? 61.627  15.007  18.394  1.00 31.61 ? 119 SER B C   1 
ATOM   5173  O  O   . SER B 1 88  ? 61.432  16.173  18.800  1.00 31.24 ? 119 SER B O   1 
ATOM   5174  C  CB  . SER B 1 88  ? 62.430  12.967  19.620  1.00 32.17 ? 119 SER B CB  1 
ATOM   5175  O  OG  . SER B 1 88  ? 62.968  12.194  18.530  1.00 30.17 ? 119 SER B OG  1 
ATOM   5176  N  N   . ARG B 1 89  ? 62.136  14.707  17.198  1.00 31.82 ? 120 ARG B N   1 
ATOM   5177  C  CA  . ARG B 1 89  ? 62.582  15.702  16.235  1.00 31.52 ? 120 ARG B CA  1 
ATOM   5178  C  C   . ARG B 1 89  ? 61.579  16.852  16.121  1.00 30.48 ? 120 ARG B C   1 
ATOM   5179  O  O   . ARG B 1 89  ? 61.951  18.028  16.206  1.00 29.97 ? 120 ARG B O   1 
ATOM   5180  C  CB  . ARG B 1 89  ? 62.752  15.040  14.857  1.00 30.38 ? 120 ARG B CB  1 
ATOM   5181  C  CG  . ARG B 1 89  ? 64.194  14.930  14.356  1.00 35.29 ? 120 ARG B CG  1 
ATOM   5182  C  CD  . ARG B 1 89  ? 65.140  14.052  15.220  1.00 39.38 ? 120 ARG B CD  1 
ATOM   5183  N  NE  . ARG B 1 89  ? 66.411  13.780  14.509  1.00 44.10 ? 120 ARG B NE  1 
ATOM   5184  C  CZ  . ARG B 1 89  ? 67.321  12.858  14.847  1.00 44.25 ? 120 ARG B CZ  1 
ATOM   5185  N  NH1 . ARG B 1 89  ? 67.157  12.078  15.921  1.00 46.29 ? 120 ARG B NH1 1 
ATOM   5186  N  NH2 . ARG B 1 89  ? 68.355  12.644  14.039  1.00 43.42 ? 120 ARG B NH2 1 
ATOM   5187  N  N   . SER B 1 90  ? 60.300  16.501  16.073  1.00 29.58 ? 121 SER B N   1 
ATOM   5188  C  CA  . SER B 1 90  ? 59.247  17.488  15.891  1.00 27.44 ? 121 SER B CA  1 
ATOM   5189  C  C   . SER B 1 90  ? 58.722  18.341  17.043  1.00 24.48 ? 121 SER B C   1 
ATOM   5190  O  O   . SER B 1 90  ? 58.298  19.471  16.812  1.00 22.02 ? 121 SER B O   1 
ATOM   5191  C  CB  . SER B 1 90  ? 58.117  16.857  15.090  1.00 29.09 ? 121 SER B CB  1 
ATOM   5192  O  OG  . SER B 1 90  ? 58.647  16.291  13.890  1.00 31.18 ? 121 SER B OG  1 
ATOM   5193  N  N   . TYR B 1 91  ? 58.792  17.878  18.281  1.00 21.99 ? 122 TYR B N   1 
ATOM   5194  C  CA  . TYR B 1 91  ? 58.298  18.747  19.346  1.00 23.50 ? 122 TYR B CA  1 
ATOM   5195  C  C   . TYR B 1 91  ? 59.028  20.105  19.333  1.00 21.88 ? 122 TYR B C   1 
ATOM   5196  O  O   . TYR B 1 91  ? 58.629  21.036  20.037  1.00 21.01 ? 122 TYR B O   1 
ATOM   5197  C  CB  . TYR B 1 91  ? 58.461  18.100  20.732  1.00 28.81 ? 122 TYR B CB  1 
ATOM   5198  C  CG  . TYR B 1 91  ? 59.795  18.362  21.445  1.00 35.88 ? 122 TYR B CG  1 
ATOM   5199  C  CD1 . TYR B 1 91  ? 60.072  19.605  22.073  1.00 38.16 ? 122 TYR B CD1 1 
ATOM   5200  C  CD2 . TYR B 1 91  ? 60.792  17.377  21.490  1.00 38.66 ? 122 TYR B CD2 1 
ATOM   5201  C  CE1 . TYR B 1 91  ? 61.313  19.849  22.711  1.00 37.00 ? 122 TYR B CE1 1 
ATOM   5202  C  CE2 . TYR B 1 91  ? 62.035  17.615  22.140  1.00 38.08 ? 122 TYR B CE2 1 
ATOM   5203  C  CZ  . TYR B 1 91  ? 62.285  18.849  22.736  1.00 36.33 ? 122 TYR B CZ  1 
ATOM   5204  O  OH  . TYR B 1 91  ? 63.515  19.070  23.316  1.00 35.55 ? 122 TYR B OH  1 
ATOM   5205  N  N   . LEU B 1 92  ? 60.141  20.182  18.600  1.00 19.85 ? 123 LEU B N   1 
ATOM   5206  C  CA  . LEU B 1 92  ? 60.944  21.396  18.537  1.00 15.95 ? 123 LEU B CA  1 
ATOM   5207  C  C   . LEU B 1 92  ? 60.447  22.514  17.656  1.00 17.77 ? 123 LEU B C   1 
ATOM   5208  O  O   . LEU B 1 92  ? 60.690  23.664  17.996  1.00 18.99 ? 123 LEU B O   1 
ATOM   5209  C  CB  . LEU B 1 92  ? 62.396  21.096  18.177  1.00 13.14 ? 123 LEU B CB  1 
ATOM   5210  C  CG  . LEU B 1 92  ? 63.305  20.460  19.242  1.00 8.25  ? 123 LEU B CG  1 
ATOM   5211  C  CD1 . LEU B 1 92  ? 63.386  21.280  20.523  1.00 2.32  ? 123 LEU B CD1 1 
ATOM   5212  C  CD2 . LEU B 1 92  ? 62.806  19.064  19.509  1.00 6.22  ? 123 LEU B CD2 1 
ATOM   5213  N  N   . ILE B 1 93  ? 59.774  22.213  16.541  1.00 18.54 ? 124 ILE B N   1 
ATOM   5214  C  CA  . ILE B 1 93  ? 59.243  23.275  15.654  1.00 20.05 ? 124 ILE B CA  1 
ATOM   5215  C  C   . ILE B 1 93  ? 57.791  23.736  15.889  1.00 18.82 ? 124 ILE B C   1 
ATOM   5216  O  O   . ILE B 1 93  ? 56.932  22.940  16.300  1.00 17.25 ? 124 ILE B O   1 
ATOM   5217  C  CB  . ILE B 1 93  ? 59.425  22.950  14.176  1.00 22.13 ? 124 ILE B CB  1 
ATOM   5218  C  CG1 . ILE B 1 93  ? 59.629  21.438  13.976  1.00 26.44 ? 124 ILE B CG1 1 
ATOM   5219  C  CG2 . ILE B 1 93  ? 60.591  23.737  13.631  1.00 24.42 ? 124 ILE B CG2 1 
ATOM   5220  C  CD1 . ILE B 1 93  ? 58.357  20.563  14.212  1.00 25.35 ? 124 ILE B CD1 1 
ATOM   5221  N  N   . ASP B 1 94  ? 57.546  25.025  15.603  1.00 18.57 ? 125 ASP B N   1 
ATOM   5222  C  CA  . ASP B 1 94  ? 56.237  25.691  15.784  1.00 15.72 ? 125 ASP B CA  1 
ATOM   5223  C  C   . ASP B 1 94  ? 55.197  25.509  14.679  1.00 15.99 ? 125 ASP B C   1 
ATOM   5224  O  O   . ASP B 1 94  ? 55.310  26.049  13.569  1.00 16.55 ? 125 ASP B O   1 
ATOM   5225  C  CB  . ASP B 1 94  ? 56.434  27.178  16.027  1.00 15.16 ? 125 ASP B CB  1 
ATOM   5226  C  CG  . ASP B 1 94  ? 56.593  27.504  17.479  1.00 17.83 ? 125 ASP B CG  1 
ATOM   5227  O  OD1 . ASP B 1 94  ? 56.311  26.611  18.300  1.00 16.97 ? 125 ASP B OD1 1 
ATOM   5228  O  OD2 . ASP B 1 94  ? 56.985  28.657  17.804  1.00 22.92 ? 125 ASP B OD2 1 
ATOM   5229  N  N   . SER B 1 95  ? 54.150  24.769  15.003  1.00 14.75 ? 126 SER B N   1 
ATOM   5230  C  CA  . SER B 1 95  ? 53.093  24.521  14.042  1.00 13.73 ? 126 SER B CA  1 
ATOM   5231  C  C   . SER B 1 95  ? 51.741  24.466  14.788  1.00 12.92 ? 126 SER B C   1 
ATOM   5232  O  O   . SER B 1 95  ? 51.509  23.612  15.671  1.00 11.78 ? 126 SER B O   1 
ATOM   5233  C  CB  . SER B 1 95  ? 53.360  23.234  13.236  1.00 13.62 ? 126 SER B CB  1 
ATOM   5234  O  OG  . SER B 1 95  ? 53.452  23.488  11.836  1.00 10.09 ? 126 SER B OG  1 
ATOM   5235  N  N   . PRO B 1 96  ? 50.835  25.391  14.437  1.00 9.58  ? 127 PRO B N   1 
ATOM   5236  C  CA  . PRO B 1 96  ? 51.048  26.427  13.415  1.00 7.27  ? 127 PRO B CA  1 
ATOM   5237  C  C   . PRO B 1 96  ? 52.093  27.472  13.759  1.00 3.58  ? 127 PRO B C   1 
ATOM   5238  O  O   . PRO B 1 96  ? 52.377  27.711  14.937  1.00 2.00  ? 127 PRO B O   1 
ATOM   5239  C  CB  . PRO B 1 96  ? 49.674  27.055  13.288  1.00 7.84  ? 127 PRO B CB  1 
ATOM   5240  C  CG  . PRO B 1 96  ? 48.794  25.906  13.557  1.00 10.32 ? 127 PRO B CG  1 
ATOM   5241  C  CD  . PRO B 1 96  ? 49.416  25.300  14.776  1.00 7.95  ? 127 PRO B CD  1 
ATOM   5242  N  N   . PRO B 1 97  ? 52.647  28.119  12.721  1.00 2.00  ? 128 PRO B N   1 
ATOM   5243  C  CA  . PRO B 1 97  ? 53.666  29.164  12.702  1.00 3.68  ? 128 PRO B CA  1 
ATOM   5244  C  C   . PRO B 1 97  ? 53.439  30.371  13.603  1.00 4.88  ? 128 PRO B C   1 
ATOM   5245  O  O   . PRO B 1 97  ? 52.323  30.743  13.883  1.00 7.58  ? 128 PRO B O   1 
ATOM   5246  C  CB  . PRO B 1 97  ? 53.714  29.565  11.224  1.00 3.80  ? 128 PRO B CB  1 
ATOM   5247  C  CG  . PRO B 1 97  ? 52.441  29.084  10.656  1.00 2.11  ? 128 PRO B CG  1 
ATOM   5248  C  CD  . PRO B 1 97  ? 52.259  27.788  11.344  1.00 2.69  ? 128 PRO B CD  1 
ATOM   5249  N  N   . THR B 1 98  ? 54.525  30.999  14.025  1.00 7.95  ? 129 THR B N   1 
ATOM   5250  C  CA  . THR B 1 98  ? 54.453  32.158  14.896  1.00 7.89  ? 129 THR B CA  1 
ATOM   5251  C  C   . THR B 1 98  ? 55.109  33.423  14.313  1.00 8.40  ? 129 THR B C   1 
ATOM   5252  O  O   . THR B 1 98  ? 54.560  33.992  13.372  1.00 11.81 ? 129 THR B O   1 
ATOM   5253  C  CB  . THR B 1 98  ? 55.020  31.833  16.291  1.00 7.84  ? 129 THR B CB  1 
ATOM   5254  O  OG1 . THR B 1 98  ? 56.326  31.271  16.155  1.00 9.23  ? 129 THR B OG1 1 
ATOM   5255  C  CG2 . THR B 1 98  ? 54.161  30.820  16.990  1.00 9.12  ? 129 THR B CG2 1 
ATOM   5256  N  N   . TYR B 1 99  ? 56.325  33.761  14.763  1.00 6.07  ? 130 TYR B N   1 
ATOM   5257  C  CA  . TYR B 1 99  ? 57.051  34.986  14.367  1.00 4.48  ? 130 TYR B CA  1 
ATOM   5258  C  C   . TYR B 1 99  ? 57.649  35.143  12.976  1.00 5.14  ? 130 TYR B C   1 
ATOM   5259  O  O   . TYR B 1 99  ? 57.587  34.240  12.132  1.00 7.18  ? 130 TYR B O   1 
ATOM   5260  C  CB  . TYR B 1 99  ? 58.183  35.257  15.354  1.00 2.00  ? 130 TYR B CB  1 
ATOM   5261  C  CG  . TYR B 1 99  ? 57.847  34.942  16.767  1.00 2.00  ? 130 TYR B CG  1 
ATOM   5262  C  CD1 . TYR B 1 99  ? 57.866  33.648  17.218  1.00 2.00  ? 130 TYR B CD1 1 
ATOM   5263  C  CD2 . TYR B 1 99  ? 57.472  35.939  17.650  1.00 2.00  ? 130 TYR B CD2 1 
ATOM   5264  C  CE1 . TYR B 1 99  ? 57.516  33.342  18.510  1.00 2.00  ? 130 TYR B CE1 1 
ATOM   5265  C  CE2 . TYR B 1 99  ? 57.121  35.646  18.957  1.00 2.00  ? 130 TYR B CE2 1 
ATOM   5266  C  CZ  . TYR B 1 99  ? 57.148  34.347  19.384  1.00 2.00  ? 130 TYR B CZ  1 
ATOM   5267  O  OH  . TYR B 1 99  ? 56.862  34.065  20.703  1.00 2.00  ? 130 TYR B OH  1 
ATOM   5268  N  N   . ASN B 1 100 ? 58.222  36.327  12.754  1.00 3.90  ? 131 ASN B N   1 
ATOM   5269  C  CA  . ASN B 1 100 ? 58.932  36.643  11.519  1.00 5.26  ? 131 ASN B CA  1 
ATOM   5270  C  C   . ASN B 1 100 ? 59.638  37.997  11.526  1.00 6.16  ? 131 ASN B C   1 
ATOM   5271  O  O   . ASN B 1 100 ? 59.545  38.777  12.503  1.00 6.12  ? 131 ASN B O   1 
ATOM   5272  C  CB  . ASN B 1 100 ? 58.057  36.508  10.281  1.00 5.15  ? 131 ASN B CB  1 
ATOM   5273  C  CG  . ASN B 1 100 ? 57.025  37.626  10.154  1.00 12.24 ? 131 ASN B CG  1 
ATOM   5274  O  OD1 . ASN B 1 100 ? 57.314  38.822  10.345  1.00 13.63 ? 131 ASN B OD1 1 
ATOM   5275  N  ND2 . ASN B 1 100 ? 55.811  37.243  9.780   1.00 14.39 ? 131 ASN B ND2 1 
ATOM   5276  N  N   . VAL B 1 101 ? 60.299  38.265  10.397  1.00 5.57  ? 132 VAL B N   1 
ATOM   5277  C  CA  . VAL B 1 101 ? 61.069  39.483  10.129  1.00 4.12  ? 132 VAL B CA  1 
ATOM   5278  C  C   . VAL B 1 101 ? 60.525  40.691  10.830  1.00 5.07  ? 132 VAL B C   1 
ATOM   5279  O  O   . VAL B 1 101 ? 61.288  41.428  11.467  1.00 6.28  ? 132 VAL B O   1 
ATOM   5280  C  CB  . VAL B 1 101 ? 61.079  39.835  8.618   1.00 2.00  ? 132 VAL B CB  1 
ATOM   5281  C  CG1 . VAL B 1 101 ? 62.040  40.966  8.348   1.00 2.01  ? 132 VAL B CG1 1 
ATOM   5282  C  CG2 . VAL B 1 101 ? 61.426  38.617  7.776   1.00 7.54  ? 132 VAL B CG2 1 
ATOM   5283  N  N   . HIS B 1 102 ? 59.210  40.887  10.680  1.00 4.71  ? 133 HIS B N   1 
ATOM   5284  C  CA  . HIS B 1 102 ? 58.496  42.025  11.237  1.00 2.01  ? 133 HIS B CA  1 
ATOM   5285  C  C   . HIS B 1 102 ? 57.759  41.795  12.535  1.00 2.00  ? 133 HIS B C   1 
ATOM   5286  O  O   . HIS B 1 102 ? 57.536  42.746  13.297  1.00 2.00  ? 133 HIS B O   1 
ATOM   5287  C  CB  . HIS B 1 102 ? 57.526  42.535  10.219  1.00 2.00  ? 133 HIS B CB  1 
ATOM   5288  C  CG  . HIS B 1 102 ? 58.170  42.997  8.959   1.00 2.15  ? 133 HIS B CG  1 
ATOM   5289  N  ND1 . HIS B 1 102 ? 57.811  42.514  7.721   1.00 5.32  ? 133 HIS B ND1 1 
ATOM   5290  C  CD2 . HIS B 1 102 ? 59.112  43.936  8.731   1.00 2.09  ? 133 HIS B CD2 1 
ATOM   5291  C  CE1 . HIS B 1 102 ? 58.492  43.138  6.779   1.00 2.01  ? 133 HIS B CE1 1 
ATOM   5292  N  NE2 . HIS B 1 102 ? 59.293  44.006  7.365   1.00 2.66  ? 133 HIS B NE2 1 
ATOM   5293  N  N   . TYR B 1 103 ? 57.411  40.546  12.814  1.00 2.00  ? 134 TYR B N   1 
ATOM   5294  C  CA  . TYR B 1 103 ? 56.656  40.282  14.022  1.00 3.03  ? 134 TYR B CA  1 
ATOM   5295  C  C   . TYR B 1 103 ? 57.354  39.490  15.089  1.00 2.00  ? 134 TYR B C   1 
ATOM   5296  O  O   . TYR B 1 103 ? 57.655  38.317  14.954  1.00 2.00  ? 134 TYR B O   1 
ATOM   5297  C  CB  . TYR B 1 103 ? 55.236  39.749  13.696  1.00 2.45  ? 134 TYR B CB  1 
ATOM   5298  C  CG  . TYR B 1 103 ? 54.414  40.747  12.869  1.00 2.02  ? 134 TYR B CG  1 
ATOM   5299  C  CD1 . TYR B 1 103 ? 53.701  41.772  13.493  1.00 2.07  ? 134 TYR B CD1 1 
ATOM   5300  C  CD2 . TYR B 1 103 ? 54.460  40.743  11.458  1.00 2.00  ? 134 TYR B CD2 1 
ATOM   5301  C  CE1 . TYR B 1 103 ? 53.069  42.774  12.757  1.00 2.00  ? 134 TYR B CE1 1 
ATOM   5302  C  CE2 . TYR B 1 103 ? 53.822  41.739  10.709  1.00 2.00  ? 134 TYR B CE2 1 
ATOM   5303  C  CZ  . TYR B 1 103 ? 53.133  42.752  11.368  1.00 2.00  ? 134 TYR B CZ  1 
ATOM   5304  O  OH  . TYR B 1 103 ? 52.516  43.734  10.629  1.00 2.00  ? 134 TYR B OH  1 
ATOM   5305  N  N   . GLY B 1 104 ? 57.698  40.209  16.131  1.00 2.00  ? 135 GLY B N   1 
ATOM   5306  C  CA  . GLY B 1 104 ? 58.344  39.591  17.261  1.00 4.75  ? 135 GLY B CA  1 
ATOM   5307  C  C   . GLY B 1 104 ? 57.259  39.066  18.171  1.00 5.82  ? 135 GLY B C   1 
ATOM   5308  O  O   . GLY B 1 104 ? 57.528  38.412  19.180  1.00 6.88  ? 135 GLY B O   1 
ATOM   5309  N  N   . TYR B 1 105 ? 56.028  39.448  17.866  1.00 5.89  ? 136 TYR B N   1 
ATOM   5310  C  CA  . TYR B 1 105 ? 54.887  38.974  18.622  1.00 5.32  ? 136 TYR B CA  1 
ATOM   5311  C  C   . TYR B 1 105 ? 54.088  38.125  17.653  1.00 4.32  ? 136 TYR B C   1 
ATOM   5312  O  O   . TYR B 1 105 ? 54.318  38.214  16.425  1.00 2.00  ? 136 TYR B O   1 
ATOM   5313  C  CB  . TYR B 1 105 ? 54.046  40.133  19.206  1.00 6.41  ? 136 TYR B CB  1 
ATOM   5314  C  CG  . TYR B 1 105 ? 53.697  41.300  18.300  1.00 2.49  ? 136 TYR B CG  1 
ATOM   5315  C  CD1 . TYR B 1 105 ? 53.053  41.121  17.086  1.00 4.30  ? 136 TYR B CD1 1 
ATOM   5316  C  CD2 . TYR B 1 105 ? 54.024  42.582  18.666  1.00 2.76  ? 136 TYR B CD2 1 
ATOM   5317  C  CE1 . TYR B 1 105 ? 52.758  42.197  16.266  1.00 3.25  ? 136 TYR B CE1 1 
ATOM   5318  C  CE2 . TYR B 1 105 ? 53.728  43.656  17.844  1.00 3.06  ? 136 TYR B CE2 1 
ATOM   5319  C  CZ  . TYR B 1 105 ? 53.101  43.450  16.643  1.00 2.00  ? 136 TYR B CZ  1 
ATOM   5320  O  OH  . TYR B 1 105 ? 52.878  44.484  15.787  1.00 2.00  ? 136 TYR B OH  1 
ATOM   5321  N  N   . LYS B 1 106 ? 53.101  37.389  18.178  1.00 4.42  ? 137 LYS B N   1 
ATOM   5322  C  CA  . LYS B 1 106 ? 52.306  36.498  17.324  1.00 5.18  ? 137 LYS B CA  1 
ATOM   5323  C  C   . LYS B 1 106 ? 51.428  36.979  16.165  1.00 4.87  ? 137 LYS B C   1 
ATOM   5324  O  O   . LYS B 1 106 ? 51.383  36.271  15.152  1.00 6.35  ? 137 LYS B O   1 
ATOM   5325  C  CB  . LYS B 1 106 ? 51.594  35.446  18.130  1.00 3.13  ? 137 LYS B CB  1 
ATOM   5326  C  CG  . LYS B 1 106 ? 52.438  34.246  18.360  1.00 2.00  ? 137 LYS B CG  1 
ATOM   5327  C  CD  . LYS B 1 106 ? 52.618  34.078  19.822  1.00 2.00  ? 137 LYS B CD  1 
ATOM   5328  C  CE  . LYS B 1 106 ? 52.720  32.636  20.137  1.00 2.00  ? 137 LYS B CE  1 
ATOM   5329  N  NZ  . LYS B 1 106 ? 52.530  32.476  21.588  1.00 4.95  ? 137 LYS B NZ  1 
ATOM   5330  N  N   . SER B 1 107 ? 50.705  38.096  16.316  1.00 2.00  ? 138 SER B N   1 
ATOM   5331  C  CA  . SER B 1 107 ? 49.893  38.669  15.228  1.00 2.00  ? 138 SER B CA  1 
ATOM   5332  C  C   . SER B 1 107 ? 49.229  37.813  14.088  1.00 5.89  ? 138 SER B C   1 
ATOM   5333  O  O   . SER B 1 107 ? 49.833  36.894  13.509  1.00 6.63  ? 138 SER B O   1 
ATOM   5334  C  CB  . SER B 1 107 ? 50.695  39.775  14.559  1.00 2.00  ? 138 SER B CB  1 
ATOM   5335  O  OG  . SER B 1 107 ? 50.844  39.529  13.162  1.00 2.00  ? 138 SER B OG  1 
ATOM   5336  N  N   . TRP B 1 108 ? 48.022  38.196  13.673  1.00 5.56  ? 139 TRP B N   1 
ATOM   5337  C  CA  . TRP B 1 108 ? 47.360  37.456  12.601  1.00 4.67  ? 139 TRP B CA  1 
ATOM   5338  C  C   . TRP B 1 108 ? 48.150  37.679  11.314  1.00 2.77  ? 139 TRP B C   1 
ATOM   5339  O  O   . TRP B 1 108 ? 48.362  36.733  10.570  1.00 2.00  ? 139 TRP B O   1 
ATOM   5340  C  CB  . TRP B 1 108 ? 45.874  37.896  12.417  1.00 5.98  ? 139 TRP B CB  1 
ATOM   5341  C  CG  . TRP B 1 108 ? 45.060  37.029  11.430  1.00 2.15  ? 139 TRP B CG  1 
ATOM   5342  C  CD1 . TRP B 1 108 ? 44.839  37.268  10.090  1.00 2.00  ? 139 TRP B CD1 1 
ATOM   5343  C  CD2 . TRP B 1 108 ? 44.540  35.727  11.685  1.00 2.00  ? 139 TRP B CD2 1 
ATOM   5344  N  NE1 . TRP B 1 108 ? 44.246  36.179  9.500   1.00 2.00  ? 139 TRP B NE1 1 
ATOM   5345  C  CE2 . TRP B 1 108 ? 44.059  35.221  10.457  1.00 2.00  ? 139 TRP B CE2 1 
ATOM   5346  C  CE3 . TRP B 1 108 ? 44.464  34.925  12.828  1.00 2.00  ? 139 TRP B CE3 1 
ATOM   5347  C  CZ2 . TRP B 1 108 ? 43.526  33.961  10.350  1.00 2.02  ? 139 TRP B CZ2 1 
ATOM   5348  C  CZ3 . TRP B 1 108 ? 43.938  33.673  12.718  1.00 2.00  ? 139 TRP B CZ3 1 
ATOM   5349  C  CH2 . TRP B 1 108 ? 43.474  33.198  11.488  1.00 2.02  ? 139 TRP B CH2 1 
ATOM   5350  N  N   . GLU B 1 109 ? 48.639  38.911  11.120  1.00 2.62  ? 140 GLU B N   1 
ATOM   5351  C  CA  . GLU B 1 109 ? 49.398  39.315  9.933   1.00 2.48  ? 140 GLU B CA  1 
ATOM   5352  C  C   . GLU B 1 109 ? 50.553  38.380  9.674   1.00 2.56  ? 140 GLU B C   1 
ATOM   5353  O  O   . GLU B 1 109 ? 50.852  38.007  8.531   1.00 2.00  ? 140 GLU B O   1 
ATOM   5354  C  CB  . GLU B 1 109 ? 49.916  40.725  10.089  1.00 2.00  ? 140 GLU B CB  1 
ATOM   5355  C  CG  . GLU B 1 109 ? 50.968  41.079  9.062   1.00 2.86  ? 140 GLU B CG  1 
ATOM   5356  C  CD  . GLU B 1 109 ? 50.479  41.047  7.639   1.00 2.00  ? 140 GLU B CD  1 
ATOM   5357  O  OE1 . GLU B 1 109 ? 49.357  41.497  7.401   1.00 8.27  ? 140 GLU B OE1 1 
ATOM   5358  O  OE2 . GLU B 1 109 ? 51.222  40.611  6.747   1.00 2.00  ? 140 GLU B OE2 1 
ATOM   5359  N  N   . ALA B 1 110 ? 51.212  38.016  10.763  1.00 4.27  ? 141 ALA B N   1 
ATOM   5360  C  CA  . ALA B 1 110 ? 52.323  37.075  10.699  1.00 3.75  ? 141 ALA B CA  1 
ATOM   5361  C  C   . ALA B 1 110 ? 51.737  35.737  10.249  1.00 2.98  ? 141 ALA B C   1 
ATOM   5362  O  O   . ALA B 1 110 ? 51.965  35.301  9.117   1.00 2.00  ? 141 ALA B O   1 
ATOM   5363  C  CB  . ALA B 1 110 ? 52.982  36.926  12.078  1.00 2.00  ? 141 ALA B CB  1 
ATOM   5364  N  N   . PHE B 1 111 ? 50.882  35.170  11.104  1.00 3.79  ? 142 PHE B N   1 
ATOM   5365  C  CA  . PHE B 1 111 ? 50.270  33.892  10.824  1.00 2.46  ? 142 PHE B CA  1 
ATOM   5366  C  C   . PHE B 1 111 ? 49.677  33.698  9.443   1.00 2.00  ? 142 PHE B C   1 
ATOM   5367  O  O   . PHE B 1 111 ? 49.692  32.609  8.917   1.00 2.00  ? 142 PHE B O   1 
ATOM   5368  C  CB  . PHE B 1 111 ? 49.192  33.545  11.823  1.00 2.00  ? 142 PHE B CB  1 
ATOM   5369  C  CG  . PHE B 1 111 ? 48.381  32.371  11.376  1.00 4.80  ? 142 PHE B CG  1 
ATOM   5370  C  CD1 . PHE B 1 111 ? 48.913  31.103  11.413  1.00 4.93  ? 142 PHE B CD1 1 
ATOM   5371  C  CD2 . PHE B 1 111 ? 47.163  32.543  10.732  1.00 8.00  ? 142 PHE B CD2 1 
ATOM   5372  C  CE1 . PHE B 1 111 ? 48.250  30.030  10.800  1.00 5.92  ? 142 PHE B CE1 1 
ATOM   5373  C  CE2 . PHE B 1 111 ? 46.505  31.472  10.121  1.00 6.24  ? 142 PHE B CE2 1 
ATOM   5374  C  CZ  . PHE B 1 111 ? 47.055  30.228  10.156  1.00 4.01  ? 142 PHE B CZ  1 
ATOM   5375  N  N   . SER B 1 112 ? 49.057  34.728  8.912   1.00 2.29  ? 143 SER B N   1 
ATOM   5376  C  CA  . SER B 1 112 ? 48.421  34.638  7.617   1.00 2.57  ? 143 SER B CA  1 
ATOM   5377  C  C   . SER B 1 112 ? 49.288  34.870  6.396   1.00 5.03  ? 143 SER B C   1 
ATOM   5378  O  O   . SER B 1 112 ? 49.160  34.135  5.424   1.00 5.24  ? 143 SER B O   1 
ATOM   5379  C  CB  . SER B 1 112 ? 47.247  35.599  7.567   1.00 3.89  ? 143 SER B CB  1 
ATOM   5380  O  OG  . SER B 1 112 ? 47.636  36.906  7.949   1.00 5.62  ? 143 SER B OG  1 
ATOM   5381  N  N   . ASN B 1 113 ? 50.169  35.880  6.440   1.00 7.89  ? 144 ASN B N   1 
ATOM   5382  C  CA  . ASN B 1 113 ? 51.009  36.246  5.285   1.00 4.84  ? 144 ASN B CA  1 
ATOM   5383  C  C   . ASN B 1 113 ? 51.954  35.184  4.788   1.00 5.61  ? 144 ASN B C   1 
ATOM   5384  O  O   . ASN B 1 113 ? 53.065  35.062  5.291   1.00 6.70  ? 144 ASN B O   1 
ATOM   5385  C  CB  . ASN B 1 113 ? 51.801  37.530  5.532   1.00 2.11  ? 144 ASN B CB  1 
ATOM   5386  C  CG  . ASN B 1 113 ? 52.151  38.235  4.237   1.00 3.93  ? 144 ASN B CG  1 
ATOM   5387  O  OD1 . ASN B 1 113 ? 52.611  37.574  3.294   1.00 5.11  ? 144 ASN B OD1 1 
ATOM   5388  N  ND2 . ASN B 1 113 ? 51.804  39.530  4.137   1.00 6.52  ? 144 ASN B ND2 1 
ATOM   5389  N  N   . LEU B 1 114 ? 51.558  34.473  3.736   1.00 5.80  ? 145 LEU B N   1 
ATOM   5390  C  CA  . LEU B 1 114 ? 52.412  33.404  3.193   1.00 5.10  ? 145 LEU B CA  1 
ATOM   5391  C  C   . LEU B 1 114 ? 53.666  33.845  2.455   1.00 2.69  ? 145 LEU B C   1 
ATOM   5392  O  O   . LEU B 1 114 ? 54.422  32.997  2.024   1.00 3.10  ? 145 LEU B O   1 
ATOM   5393  C  CB  . LEU B 1 114 ? 51.611  32.470  2.280   1.00 2.41  ? 145 LEU B CB  1 
ATOM   5394  C  CG  . LEU B 1 114 ? 50.617  31.569  2.978   1.00 2.00  ? 145 LEU B CG  1 
ATOM   5395  C  CD1 . LEU B 1 114 ? 50.052  30.613  1.956   1.00 2.00  ? 145 LEU B CD1 1 
ATOM   5396  C  CD2 . LEU B 1 114 ? 51.296  30.841  4.118   1.00 2.00  ? 145 LEU B CD2 1 
ATOM   5397  N  N   . SER B 1 115 ? 53.849  35.145  2.240   1.00 2.00  ? 146 SER B N   1 
ATOM   5398  C  CA  . SER B 1 115 ? 55.029  35.631  1.548   1.00 2.39  ? 146 SER B CA  1 
ATOM   5399  C  C   . SER B 1 115 ? 56.269  35.675  2.425   1.00 2.00  ? 146 SER B C   1 
ATOM   5400  O  O   . SER B 1 115 ? 57.373  35.598  1.926   1.00 2.00  ? 146 SER B O   1 
ATOM   5401  C  CB  . SER B 1 115 ? 54.755  36.980  0.944   1.00 2.00  ? 146 SER B CB  1 
ATOM   5402  O  OG  . SER B 1 115 ? 53.713  36.861  0.017   1.00 4.87  ? 146 SER B OG  1 
ATOM   5403  N  N   . TYR B 1 116 ? 56.069  35.785  3.730   1.00 2.09  ? 147 TYR B N   1 
ATOM   5404  C  CA  . TYR B 1 116 ? 57.152  35.779  4.702   1.00 2.00  ? 147 TYR B CA  1 
ATOM   5405  C  C   . TYR B 1 116 ? 57.769  34.369  4.883   1.00 4.72  ? 147 TYR B C   1 
ATOM   5406  O  O   . TYR B 1 116 ? 57.211  33.369  4.433   1.00 8.50  ? 147 TYR B O   1 
ATOM   5407  C  CB  . TYR B 1 116 ? 56.596  36.168  6.061   1.00 2.92  ? 147 TYR B CB  1 
ATOM   5408  C  CG  . TYR B 1 116 ? 56.321  37.625  6.276   1.00 3.25  ? 147 TYR B CG  1 
ATOM   5409  C  CD1 . TYR B 1 116 ? 56.987  38.607  5.560   1.00 2.79  ? 147 TYR B CD1 1 
ATOM   5410  C  CD2 . TYR B 1 116 ? 55.423  38.019  7.240   1.00 2.48  ? 147 TYR B CD2 1 
ATOM   5411  C  CE1 . TYR B 1 116 ? 56.753  39.935  5.814   1.00 2.43  ? 147 TYR B CE1 1 
ATOM   5412  C  CE2 . TYR B 1 116 ? 55.191  39.330  7.498   1.00 2.86  ? 147 TYR B CE2 1 
ATOM   5413  C  CZ  . TYR B 1 116 ? 55.850  40.280  6.785   1.00 3.00  ? 147 TYR B CZ  1 
ATOM   5414  O  OH  . TYR B 1 116 ? 55.571  41.583  7.051   1.00 5.27  ? 147 TYR B OH  1 
ATOM   5415  N  N   . TYR B 1 117 ? 58.935  34.297  5.528   1.00 5.48  ? 148 TYR B N   1 
ATOM   5416  C  CA  . TYR B 1 117 ? 59.605  33.035  5.859   1.00 2.21  ? 148 TYR B CA  1 
ATOM   5417  C  C   . TYR B 1 117 ? 59.296  33.070  7.334   1.00 2.00  ? 148 TYR B C   1 
ATOM   5418  O  O   . TYR B 1 117 ? 59.334  34.119  7.957   1.00 2.20  ? 148 TYR B O   1 
ATOM   5419  C  CB  . TYR B 1 117 ? 61.134  33.107  5.694   1.00 2.14  ? 148 TYR B CB  1 
ATOM   5420  C  CG  . TYR B 1 117 ? 61.700  32.798  4.317   1.00 2.24  ? 148 TYR B CG  1 
ATOM   5421  C  CD1 . TYR B 1 117 ? 61.744  31.497  3.841   1.00 5.31  ? 148 TYR B CD1 1 
ATOM   5422  C  CD2 . TYR B 1 117 ? 62.191  33.800  3.491   1.00 2.00  ? 148 TYR B CD2 1 
ATOM   5423  C  CE1 . TYR B 1 117 ? 62.262  31.201  2.556   1.00 3.17  ? 148 TYR B CE1 1 
ATOM   5424  C  CE2 . TYR B 1 117 ? 62.710  33.516  2.218   1.00 2.00  ? 148 TYR B CE2 1 
ATOM   5425  C  CZ  . TYR B 1 117 ? 62.736  32.219  1.752   1.00 2.00  ? 148 TYR B CZ  1 
ATOM   5426  O  OH  . TYR B 1 117 ? 63.181  31.957  0.472   1.00 2.00  ? 148 TYR B OH  1 
ATOM   5427  N  N   . THR B 1 118 ? 58.940  31.956  7.912   1.00 2.00  ? 149 THR B N   1 
ATOM   5428  C  CA  . THR B 1 118 ? 58.642  32.020  9.315   1.00 3.78  ? 149 THR B CA  1 
ATOM   5429  C  C   . THR B 1 118 ? 59.937  32.175  10.085  1.00 4.08  ? 149 THR B C   1 
ATOM   5430  O  O   . THR B 1 118 ? 61.021  32.051  9.517   1.00 9.06  ? 149 THR B O   1 
ATOM   5431  C  CB  . THR B 1 118 ? 57.877  30.782  9.770   1.00 5.71  ? 149 THR B CB  1 
ATOM   5432  O  OG1 . THR B 1 118 ? 57.504  30.927  11.160  1.00 10.71 ? 149 THR B OG1 1 
ATOM   5433  C  CG2 . THR B 1 118 ? 58.715  29.528  9.547   1.00 4.09  ? 149 THR B CG2 1 
ATOM   5434  N  N   . ARG B 1 119 ? 59.853  32.429  11.379  1.00 2.04  ? 150 ARG B N   1 
ATOM   5435  C  CA  . ARG B 1 119 ? 61.068  32.578  12.143  1.00 4.11  ? 150 ARG B CA  1 
ATOM   5436  C  C   . ARG B 1 119 ? 61.063  31.706  13.387  1.00 6.24  ? 150 ARG B C   1 
ATOM   5437  O  O   . ARG B 1 119 ? 60.125  31.776  14.174  1.00 7.77  ? 150 ARG B O   1 
ATOM   5438  C  CB  . ARG B 1 119 ? 61.255  34.035  12.540  1.00 5.49  ? 150 ARG B CB  1 
ATOM   5439  C  CG  . ARG B 1 119 ? 62.691  34.447  12.644  1.00 3.58  ? 150 ARG B CG  1 
ATOM   5440  C  CD  . ARG B 1 119 ? 63.263  34.849  11.302  1.00 2.00  ? 150 ARG B CD  1 
ATOM   5441  N  NE  . ARG B 1 119 ? 63.732  36.213  11.401  1.00 3.43  ? 150 ARG B NE  1 
ATOM   5442  C  CZ  . ARG B 1 119 ? 64.529  36.667  12.378  1.00 6.97  ? 150 ARG B CZ  1 
ATOM   5443  N  NH1 . ARG B 1 119 ? 64.994  35.878  13.359  1.00 2.85  ? 150 ARG B NH1 1 
ATOM   5444  N  NH2 . ARG B 1 119 ? 64.766  37.963  12.453  1.00 6.95  ? 150 ARG B NH2 1 
ATOM   5445  N  N   . ALA B 1 120 ? 62.140  30.944  13.599  1.00 4.93  ? 151 ALA B N   1 
ATOM   5446  C  CA  . ALA B 1 120 ? 62.248  30.053  14.748  1.00 2.00  ? 151 ALA B CA  1 
ATOM   5447  C  C   . ALA B 1 120 ? 62.515  30.809  16.016  1.00 2.00  ? 151 ALA B C   1 
ATOM   5448  O  O   . ALA B 1 120 ? 62.370  30.297  17.096  1.00 2.00  ? 151 ALA B O   1 
ATOM   5449  C  CB  . ALA B 1 120 ? 63.337  29.023  14.518  1.00 3.12  ? 151 ALA B CB  1 
ATOM   5450  N  N   . LEU B 1 121 ? 62.987  32.023  15.880  1.00 2.00  ? 152 LEU B N   1 
ATOM   5451  C  CA  . LEU B 1 121 ? 63.268  32.859  17.035  1.00 2.34  ? 152 LEU B CA  1 
ATOM   5452  C  C   . LEU B 1 121 ? 62.909  34.249  16.557  1.00 3.55  ? 152 LEU B C   1 
ATOM   5453  O  O   . LEU B 1 121 ? 63.213  34.638  15.406  1.00 2.00  ? 152 LEU B O   1 
ATOM   5454  C  CB  . LEU B 1 121 ? 64.754  32.834  17.410  1.00 6.01  ? 152 LEU B CB  1 
ATOM   5455  C  CG  . LEU B 1 121 ? 65.296  32.122  18.657  1.00 6.62  ? 152 LEU B CG  1 
ATOM   5456  C  CD1 . LEU B 1 121 ? 65.535  33.072  19.808  1.00 7.82  ? 152 LEU B CD1 1 
ATOM   5457  C  CD2 . LEU B 1 121 ? 64.330  31.030  19.058  1.00 9.72  ? 152 LEU B CD2 1 
ATOM   5458  N  N   . PRO B 1 122 ? 62.275  35.027  17.433  1.00 2.47  ? 153 PRO B N   1 
ATOM   5459  C  CA  . PRO B 1 122 ? 61.884  36.376  17.055  1.00 2.35  ? 153 PRO B CA  1 
ATOM   5460  C  C   . PRO B 1 122 ? 63.062  37.217  16.682  1.00 3.34  ? 153 PRO B C   1 
ATOM   5461  O  O   . PRO B 1 122 ? 64.204  36.850  16.969  1.00 7.41  ? 153 PRO B O   1 
ATOM   5462  C  CB  . PRO B 1 122 ? 61.291  36.906  18.342  1.00 2.58  ? 153 PRO B CB  1 
ATOM   5463  C  CG  . PRO B 1 122 ? 62.137  36.196  19.386  1.00 2.72  ? 153 PRO B CG  1 
ATOM   5464  C  CD  . PRO B 1 122 ? 62.090  34.811  18.875  1.00 2.09  ? 153 PRO B CD  1 
ATOM   5465  N  N   . PRO B 1 123 ? 62.828  38.256  15.887  1.00 2.53  ? 154 PRO B N   1 
ATOM   5466  C  CA  . PRO B 1 123 ? 63.972  39.082  15.564  1.00 4.43  ? 154 PRO B CA  1 
ATOM   5467  C  C   . PRO B 1 123 ? 64.178  39.928  16.819  1.00 6.03  ? 154 PRO B C   1 
ATOM   5468  O  O   . PRO B 1 123 ? 63.451  39.779  17.839  1.00 2.00  ? 154 PRO B O   1 
ATOM   5469  C  CB  . PRO B 1 123 ? 63.471  39.927  14.399  1.00 3.43  ? 154 PRO B CB  1 
ATOM   5470  C  CG  . PRO B 1 123 ? 62.022  39.965  14.599  1.00 4.10  ? 154 PRO B CG  1 
ATOM   5471  C  CD  . PRO B 1 123 ? 61.727  38.545  14.968  1.00 3.63  ? 154 PRO B CD  1 
ATOM   5472  N  N   . VAL B 1 124 ? 65.195  40.785  16.757  1.00 9.46  ? 155 VAL B N   1 
ATOM   5473  C  CA  . VAL B 1 124 ? 65.514  41.650  17.879  1.00 9.59  ? 155 VAL B CA  1 
ATOM   5474  C  C   . VAL B 1 124 ? 64.868  43.022  17.683  1.00 10.98 ? 155 VAL B C   1 
ATOM   5475  O  O   . VAL B 1 124 ? 64.807  43.548  16.550  1.00 11.30 ? 155 VAL B O   1 
ATOM   5476  C  CB  . VAL B 1 124 ? 67.023  41.781  18.056  1.00 7.11  ? 155 VAL B CB  1 
ATOM   5477  C  CG1 . VAL B 1 124 ? 67.310  42.603  19.290  1.00 6.76  ? 155 VAL B CG1 1 
ATOM   5478  C  CG2 . VAL B 1 124 ? 67.638  40.403  18.176  1.00 6.02  ? 155 VAL B CG2 1 
ATOM   5479  N  N   . ALA B 1 125 ? 64.342  43.564  18.779  1.00 8.69  ? 156 ALA B N   1 
ATOM   5480  C  CA  . ALA B 1 125 ? 63.703  44.862  18.752  1.00 9.56  ? 156 ALA B CA  1 
ATOM   5481  C  C   . ALA B 1 125 ? 64.586  45.910  18.087  1.00 10.39 ? 156 ALA B C   1 
ATOM   5482  O  O   . ALA B 1 125 ? 65.754  46.032  18.421  1.00 11.54 ? 156 ALA B O   1 
ATOM   5483  C  CB  . ALA B 1 125 ? 63.394  45.281  20.161  1.00 12.84 ? 156 ALA B CB  1 
ATOM   5484  N  N   . ASP B 1 126 ? 64.023  46.689  17.179  1.00 12.63 ? 157 ASP B N   1 
ATOM   5485  C  CA  . ASP B 1 126 ? 64.802  47.728  16.519  1.00 18.48 ? 157 ASP B CA  1 
ATOM   5486  C  C   . ASP B 1 126 ? 65.208  48.814  17.504  1.00 19.86 ? 157 ASP B C   1 
ATOM   5487  O  O   . ASP B 1 126 ? 65.978  49.701  17.143  1.00 22.56 ? 157 ASP B O   1 
ATOM   5488  C  CB  . ASP B 1 126 ? 64.009  48.401  15.395  1.00 23.40 ? 157 ASP B CB  1 
ATOM   5489  C  CG  . ASP B 1 126 ? 63.499  47.419  14.386  1.00 27.54 ? 157 ASP B CG  1 
ATOM   5490  O  OD1 . ASP B 1 126 ? 63.719  46.208  14.627  1.00 32.50 ? 157 ASP B OD1 1 
ATOM   5491  O  OD2 . ASP B 1 126 ? 62.889  47.847  13.364  1.00 28.28 ? 157 ASP B OD2 1 
ATOM   5492  N  N   . ASP B 1 127 ? 64.636  48.810  18.710  1.00 19.52 ? 158 ASP B N   1 
ATOM   5493  C  CA  . ASP B 1 127 ? 65.005  49.833  19.694  1.00 19.28 ? 158 ASP B CA  1 
ATOM   5494  C  C   . ASP B 1 127 ? 65.918  49.316  20.823  1.00 19.18 ? 158 ASP B C   1 
ATOM   5495  O  O   . ASP B 1 127 ? 66.108  49.980  21.844  1.00 19.07 ? 158 ASP B O   1 
ATOM   5496  C  CB  . ASP B 1 127 ? 63.771  50.594  20.216  1.00 20.10 ? 158 ASP B CB  1 
ATOM   5497  C  CG  . ASP B 1 127 ? 63.268  50.108  21.587  1.00 23.10 ? 158 ASP B CG  1 
ATOM   5498  O  OD1 . ASP B 1 127 ? 63.190  48.880  21.844  1.00 25.69 ? 158 ASP B OD1 1 
ATOM   5499  O  OD2 . ASP B 1 127 ? 62.916  50.990  22.405  1.00 20.96 ? 158 ASP B OD2 1 
ATOM   5500  N  N   . CYS B 1 128 ? 66.448  48.108  20.658  1.00 17.11 ? 159 CYS B N   1 
ATOM   5501  C  CA  . CYS B 1 128 ? 67.361  47.548  21.636  1.00 13.73 ? 159 CYS B CA  1 
ATOM   5502  C  C   . CYS B 1 128 ? 68.676  48.354  21.587  1.00 16.23 ? 159 CYS B C   1 
ATOM   5503  O  O   . CYS B 1 128 ? 68.862  49.179  20.680  1.00 15.62 ? 159 CYS B O   1 
ATOM   5504  C  CB  . CYS B 1 128 ? 67.579  46.070  21.352  1.00 9.65  ? 159 CYS B CB  1 
ATOM   5505  S  SG  . CYS B 1 128 ? 66.179  45.084  21.922  1.00 2.88  ? 159 CYS B SG  1 
ATOM   5506  N  N   . PRO B 1 129 ? 69.588  48.155  22.579  1.00 17.08 ? 160 PRO B N   1 
ATOM   5507  C  CA  . PRO B 1 129 ? 70.836  48.912  22.574  1.00 14.29 ? 160 PRO B CA  1 
ATOM   5508  C  C   . PRO B 1 129 ? 71.880  48.329  21.654  1.00 13.35 ? 160 PRO B C   1 
ATOM   5509  O  O   . PRO B 1 129 ? 72.581  49.072  20.984  1.00 12.65 ? 160 PRO B O   1 
ATOM   5510  C  CB  . PRO B 1 129 ? 71.258  48.849  24.041  1.00 12.96 ? 160 PRO B CB  1 
ATOM   5511  C  CG  . PRO B 1 129 ? 70.898  47.465  24.407  1.00 11.76 ? 160 PRO B CG  1 
ATOM   5512  C  CD  . PRO B 1 129 ? 69.520  47.310  23.795  1.00 16.02 ? 160 PRO B CD  1 
ATOM   5513  N  N   . THR B 1 130 ? 72.007  47.005  21.626  1.00 14.12 ? 161 THR B N   1 
ATOM   5514  C  CA  . THR B 1 130 ? 73.006  46.378  20.754  1.00 14.36 ? 161 THR B CA  1 
ATOM   5515  C  C   . THR B 1 130 ? 72.332  45.380  19.841  1.00 12.98 ? 161 THR B C   1 
ATOM   5516  O  O   . THR B 1 130 ? 71.335  44.762  20.218  1.00 10.63 ? 161 THR B O   1 
ATOM   5517  C  CB  . THR B 1 130 ? 74.114  45.653  21.532  1.00 14.16 ? 161 THR B CB  1 
ATOM   5518  O  OG1 . THR B 1 130 ? 73.691  44.327  21.838  1.00 18.73 ? 161 THR B OG1 1 
ATOM   5519  C  CG2 . THR B 1 130 ? 74.403  46.356  22.827  1.00 16.10 ? 161 THR B CG2 1 
ATOM   5520  N  N   . PRO B 1 131 ? 72.870  45.206  18.628  1.00 11.78 ? 162 PRO B N   1 
ATOM   5521  C  CA  . PRO B 1 131 ? 72.325  44.277  17.632  1.00 12.51 ? 162 PRO B CA  1 
ATOM   5522  C  C   . PRO B 1 131 ? 72.048  42.813  18.074  1.00 10.51 ? 162 PRO B C   1 
ATOM   5523  O  O   . PRO B 1 131 ? 71.306  42.088  17.411  1.00 8.71  ? 162 PRO B O   1 
ATOM   5524  C  CB  . PRO B 1 131 ? 73.311  44.404  16.451  1.00 11.93 ? 162 PRO B CB  1 
ATOM   5525  C  CG  . PRO B 1 131 ? 74.505  45.102  17.039  1.00 11.53 ? 162 PRO B CG  1 
ATOM   5526  C  CD  . PRO B 1 131 ? 73.935  46.027  18.044  1.00 10.42 ? 162 PRO B CD  1 
ATOM   5527  N  N   . MET B 1 132 ? 72.605  42.384  19.195  1.00 8.11  ? 163 MET B N   1 
ATOM   5528  C  CA  . MET B 1 132 ? 72.351  41.024  19.655  1.00 6.82  ? 163 MET B CA  1 
ATOM   5529  C  C   . MET B 1 132 ? 71.524  41.102  20.902  1.00 4.95  ? 163 MET B C   1 
ATOM   5530  O  O   . MET B 1 132 ? 71.328  40.118  21.622  1.00 3.22  ? 163 MET B O   1 
ATOM   5531  C  CB  . MET B 1 132 ? 73.662  40.319  19.943  1.00 10.59 ? 163 MET B CB  1 
ATOM   5532  C  CG  . MET B 1 132 ? 74.323  39.772  18.705  1.00 11.68 ? 163 MET B CG  1 
ATOM   5533  S  SD  . MET B 1 132 ? 73.349  38.449  18.062  1.00 12.03 ? 163 MET B SD  1 
ATOM   5534  C  CE  . MET B 1 132 ? 73.164  38.938  16.343  1.00 6.58  ? 163 MET B CE  1 
ATOM   5535  N  N   . GLY B 1 133 ? 71.123  42.326  21.185  1.00 2.34  ? 164 GLY B N   1 
ATOM   5536  C  CA  . GLY B 1 133 ? 70.307  42.597  22.329  1.00 4.32  ? 164 GLY B CA  1 
ATOM   5537  C  C   . GLY B 1 133 ? 70.868  43.738  23.125  1.00 5.37  ? 164 GLY B C   1 
ATOM   5538  O  O   . GLY B 1 133 ? 70.694  44.942  22.840  1.00 2.00  ? 164 GLY B O   1 
ATOM   5539  N  N   . VAL B 1 134 ? 71.550  43.334  24.171  1.00 7.24  ? 165 VAL B N   1 
ATOM   5540  C  CA  . VAL B 1 134 ? 72.140  44.300  25.045  1.00 11.48 ? 165 VAL B CA  1 
ATOM   5541  C  C   . VAL B 1 134 ? 73.643  44.028  25.152  1.00 13.79 ? 165 VAL B C   1 
ATOM   5542  O  O   . VAL B 1 134 ? 74.408  44.930  25.468  1.00 14.00 ? 165 VAL B O   1 
ATOM   5543  C  CB  . VAL B 1 134 ? 71.431  44.255  26.386  1.00 10.26 ? 165 VAL B CB  1 
ATOM   5544  C  CG1 . VAL B 1 134 ? 71.738  42.948  27.098  1.00 11.25 ? 165 VAL B CG1 1 
ATOM   5545  C  CG2 . VAL B 1 134 ? 71.800  45.471  27.215  1.00 13.68 ? 165 VAL B CG2 1 
ATOM   5546  N  N   . LYS B 1 135 ? 74.049  42.798  24.813  1.00 15.83 ? 166 LYS B N   1 
ATOM   5547  C  CA  . LYS B 1 135 ? 75.460  42.349  24.825  1.00 13.80 ? 166 LYS B CA  1 
ATOM   5548  C  C   . LYS B 1 135 ? 76.159  42.661  23.506  1.00 12.50 ? 166 LYS B C   1 
ATOM   5549  O  O   . LYS B 1 135 ? 75.623  42.393  22.434  1.00 10.71 ? 166 LYS B O   1 
ATOM   5550  C  CB  . LYS B 1 135 ? 75.555  40.836  24.996  1.00 15.78 ? 166 LYS B CB  1 
ATOM   5551  C  CG  . LYS B 1 135 ? 75.156  40.288  26.332  1.00 15.95 ? 166 LYS B CG  1 
ATOM   5552  C  CD  . LYS B 1 135 ? 75.404  38.786  26.326  1.00 17.78 ? 166 LYS B CD  1 
ATOM   5553  C  CE  . LYS B 1 135 ? 75.171  38.183  27.700  1.00 22.47 ? 166 LYS B CE  1 
ATOM   5554  N  NZ  . LYS B 1 135 ? 75.311  36.692  27.753  1.00 21.41 ? 166 LYS B NZ  1 
ATOM   5555  N  N   . GLY B 1 136 ? 77.400  43.130  23.587  1.00 14.20 ? 167 GLY B N   1 
ATOM   5556  C  CA  . GLY B 1 136 ? 78.148  43.457  22.380  1.00 13.20 ? 167 GLY B CA  1 
ATOM   5557  C  C   . GLY B 1 136 ? 78.405  44.941  22.212  1.00 11.44 ? 167 GLY B C   1 
ATOM   5558  O  O   . GLY B 1 136 ? 78.264  45.717  23.163  1.00 10.64 ? 167 GLY B O   1 
ATOM   5559  N  N   . ASN B 1 137 ? 78.751  45.346  20.998  1.00 10.03 ? 168 ASN B N   1 
ATOM   5560  C  CA  . ASN B 1 137 ? 79.039  46.743  20.733  1.00 13.39 ? 168 ASN B CA  1 
ATOM   5561  C  C   . ASN B 1 137 ? 78.010  47.330  19.800  1.00 13.00 ? 168 ASN B C   1 
ATOM   5562  O  O   . ASN B 1 137 ? 77.293  46.582  19.160  1.00 15.04 ? 168 ASN B O   1 
ATOM   5563  C  CB  . ASN B 1 137 ? 80.426  46.863  20.099  1.00 17.01 ? 168 ASN B CB  1 
ATOM   5564  C  CG  . ASN B 1 137 ? 80.785  48.297  19.763  1.00 24.64 ? 168 ASN B CG  1 
ATOM   5565  O  OD1 . ASN B 1 137 ? 80.824  48.680  18.590  1.00 26.73 ? 168 ASN B OD1 1 
ATOM   5566  N  ND2 . ASN B 1 137 ? 80.991  49.121  20.799  1.00 27.03 ? 168 ASN B ND2 1 
ATOM   5567  N  N   . LYS B 1 138 ? 77.940  48.662  19.719  1.00 13.41 ? 169 LYS B N   1 
ATOM   5568  C  CA  . LYS B 1 138 ? 77.021  49.365  18.812  1.00 13.28 ? 169 LYS B CA  1 
ATOM   5569  C  C   . LYS B 1 138 ? 77.015  48.679  17.449  1.00 14.97 ? 169 LYS B C   1 
ATOM   5570  O  O   . LYS B 1 138 ? 76.122  48.929  16.635  1.00 16.21 ? 169 LYS B O   1 
ATOM   5571  C  CB  . LYS B 1 138 ? 77.443  50.822  18.623  1.00 13.99 ? 169 LYS B CB  1 
ATOM   5572  C  CG  . LYS B 1 138 ? 76.477  51.841  19.150  1.00 18.15 ? 169 LYS B CG  1 
ATOM   5573  C  CD  . LYS B 1 138 ? 76.250  51.636  20.658  1.00 23.12 ? 169 LYS B CD  1 
ATOM   5574  C  CE  . LYS B 1 138 ? 75.457  52.784  21.308  1.00 23.85 ? 169 LYS B CE  1 
ATOM   5575  N  NZ  . LYS B 1 138 ? 74.041  52.917  20.826  1.00 23.85 ? 169 LYS B NZ  1 
ATOM   5576  N  N   . GLU B 1 139 ? 78.079  47.926  17.155  1.00 16.13 ? 170 GLU B N   1 
ATOM   5577  C  CA  . GLU B 1 139 ? 78.157  47.169  15.917  1.00 17.85 ? 170 GLU B CA  1 
ATOM   5578  C  C   . GLU B 1 139 ? 78.698  45.777  16.143  1.00 16.12 ? 170 GLU B C   1 
ATOM   5579  O  O   . GLU B 1 139 ? 79.019  45.384  17.266  1.00 14.54 ? 170 GLU B O   1 
ATOM   5580  C  CB  . GLU B 1 139 ? 78.975  47.876  14.847  1.00 24.53 ? 170 GLU B CB  1 
ATOM   5581  C  CG  . GLU B 1 139 ? 78.302  49.114  14.271  1.00 30.48 ? 170 GLU B CG  1 
ATOM   5582  C  CD  . GLU B 1 139 ? 78.486  50.335  15.163  1.00 38.25 ? 170 GLU B CD  1 
ATOM   5583  O  OE1 . GLU B 1 139 ? 79.619  50.548  15.703  1.00 40.17 ? 170 GLU B OE1 1 
ATOM   5584  O  OE2 . GLU B 1 139 ? 77.485  51.081  15.330  1.00 43.10 ? 170 GLU B OE2 1 
ATOM   5585  N  N   . LEU B 1 140 ? 78.736  45.025  15.052  1.00 15.58 ? 171 LEU B N   1 
ATOM   5586  C  CA  . LEU B 1 140 ? 79.203  43.646  15.040  1.00 16.23 ? 171 LEU B CA  1 
ATOM   5587  C  C   . LEU B 1 140 ? 80.468  43.601  14.186  1.00 17.63 ? 171 LEU B C   1 
ATOM   5588  O  O   . LEU B 1 140 ? 80.771  44.571  13.468  1.00 19.03 ? 171 LEU B O   1 
ATOM   5589  C  CB  . LEU B 1 140 ? 78.128  42.739  14.427  1.00 9.82  ? 171 LEU B CB  1 
ATOM   5590  C  CG  . LEU B 1 140 ? 77.382  41.817  15.372  1.00 5.90  ? 171 LEU B CG  1 
ATOM   5591  C  CD1 . LEU B 1 140 ? 77.298  42.399  16.770  1.00 7.61  ? 171 LEU B CD1 1 
ATOM   5592  C  CD2 . LEU B 1 140 ? 76.008  41.583  14.800  1.00 7.85  ? 171 LEU B CD2 1 
ATOM   5593  N  N   . PRO B 1 141 ? 81.235  42.494  14.278  1.00 16.07 ? 172 PRO B N   1 
ATOM   5594  C  CA  . PRO B 1 141 ? 82.463  42.314  13.516  1.00 14.18 ? 172 PRO B CA  1 
ATOM   5595  C  C   . PRO B 1 141 ? 82.193  42.638  12.059  1.00 14.18 ? 172 PRO B C   1 
ATOM   5596  O  O   . PRO B 1 141 ? 81.088  42.410  11.559  1.00 17.12 ? 172 PRO B O   1 
ATOM   5597  C  CB  . PRO B 1 141 ? 82.718  40.824  13.665  1.00 16.79 ? 172 PRO B CB  1 
ATOM   5598  C  CG  . PRO B 1 141 ? 82.238  40.558  15.034  1.00 17.33 ? 172 PRO B CG  1 
ATOM   5599  C  CD  . PRO B 1 141 ? 80.927  41.270  15.039  1.00 17.10 ? 172 PRO B CD  1 
ATOM   5600  N  N   . ASP B 1 142 ? 83.180  43.214  11.385  1.00 11.22 ? 173 ASP B N   1 
ATOM   5601  C  CA  . ASP B 1 142 ? 83.018  43.540  9.997   1.00 7.70  ? 173 ASP B CA  1 
ATOM   5602  C  C   . ASP B 1 142 ? 82.853  42.220  9.270   1.00 9.18  ? 173 ASP B C   1 
ATOM   5603  O  O   . ASP B 1 142 ? 83.579  41.255  9.505   1.00 7.37  ? 173 ASP B O   1 
ATOM   5604  C  CB  . ASP B 1 142 ? 84.218  44.313  9.482   1.00 5.76  ? 173 ASP B CB  1 
ATOM   5605  C  CG  . ASP B 1 142 ? 84.069  44.720  8.020   1.00 12.18 ? 173 ASP B CG  1 
ATOM   5606  O  OD1 . ASP B 1 142 ? 83.915  43.826  7.142   1.00 12.32 ? 173 ASP B OD1 1 
ATOM   5607  O  OD2 . ASP B 1 142 ? 84.111  45.949  7.746   1.00 14.00 ? 173 ASP B OD2 1 
ATOM   5608  N  N   . SER B 1 143 ? 81.835  42.193  8.430   1.00 11.33 ? 174 SER B N   1 
ATOM   5609  C  CA  . SER B 1 143 ? 81.469  41.049  7.622   1.00 13.41 ? 174 SER B CA  1 
ATOM   5610  C  C   . SER B 1 143 ? 82.622  40.601  6.732   1.00 15.31 ? 174 SER B C   1 
ATOM   5611  O  O   . SER B 1 143 ? 83.105  39.464  6.843   1.00 15.93 ? 174 SER B O   1 
ATOM   5612  C  CB  . SER B 1 143 ? 80.325  41.488  6.751   1.00 14.31 ? 174 SER B CB  1 
ATOM   5613  O  OG  . SER B 1 143 ? 80.611  42.811  6.321   1.00 19.66 ? 174 SER B OG  1 
ATOM   5614  N  N   . LYS B 1 144 ? 83.051  41.508  5.850   1.00 15.51 ? 175 LYS B N   1 
ATOM   5615  C  CA  . LYS B 1 144 ? 84.150  41.258  4.919   1.00 12.89 ? 175 LYS B CA  1 
ATOM   5616  C  C   . LYS B 1 144 ? 85.304  40.602  5.670   1.00 12.54 ? 175 LYS B C   1 
ATOM   5617  O  O   . LYS B 1 144 ? 85.888  39.629  5.204   1.00 11.95 ? 175 LYS B O   1 
ATOM   5618  C  CB  . LYS B 1 144 ? 84.590  42.575  4.270   1.00 11.93 ? 175 LYS B CB  1 
ATOM   5619  C  CG  . LYS B 1 144 ? 85.762  42.445  3.328   1.00 9.89  ? 175 LYS B CG  1 
ATOM   5620  C  CD  . LYS B 1 144 ? 85.535  41.324  2.332   1.00 13.91 ? 175 LYS B CD  1 
ATOM   5621  C  CE  . LYS B 1 144 ? 84.553  41.689  1.227   1.00 17.28 ? 175 LYS B CE  1 
ATOM   5622  N  NZ  . LYS B 1 144 ? 84.323  40.527  0.316   1.00 17.26 ? 175 LYS B NZ  1 
ATOM   5623  N  N   . GLU B 1 145 ? 85.545  41.084  6.886   1.00 13.97 ? 176 GLU B N   1 
ATOM   5624  C  CA  . GLU B 1 145 ? 86.605  40.561  7.735   1.00 15.81 ? 176 GLU B CA  1 
ATOM   5625  C  C   . GLU B 1 145 ? 86.314  39.123  8.154   1.00 15.00 ? 176 GLU B C   1 
ATOM   5626  O  O   . GLU B 1 145 ? 87.101  38.231  7.821   1.00 17.64 ? 176 GLU B O   1 
ATOM   5627  C  CB  . GLU B 1 145 ? 86.796  41.444  8.971   1.00 18.77 ? 176 GLU B CB  1 
ATOM   5628  C  CG  . GLU B 1 145 ? 88.235  41.495  9.507   1.00 23.89 ? 176 GLU B CG  1 
ATOM   5629  C  CD  . GLU B 1 145 ? 88.628  42.883  10.031  1.00 28.35 ? 176 GLU B CD  1 
ATOM   5630  O  OE1 . GLU B 1 145 ? 88.884  43.768  9.170   1.00 27.83 ? 176 GLU B OE1 1 
ATOM   5631  O  OE2 . GLU B 1 145 ? 88.668  43.089  11.286  1.00 28.05 ? 176 GLU B OE2 1 
ATOM   5632  N  N   . VAL B 1 146 ? 85.185  38.889  8.831   1.00 9.72  ? 177 VAL B N   1 
ATOM   5633  C  CA  . VAL B 1 146 ? 84.818  37.538  9.279   1.00 6.97  ? 177 VAL B CA  1 
ATOM   5634  C  C   . VAL B 1 146 ? 84.887  36.550  8.098   1.00 4.80  ? 177 VAL B C   1 
ATOM   5635  O  O   . VAL B 1 146 ? 85.390  35.414  8.222   1.00 3.01  ? 177 VAL B O   1 
ATOM   5636  C  CB  . VAL B 1 146 ? 83.379  37.485  9.888   1.00 4.32  ? 177 VAL B CB  1 
ATOM   5637  C  CG1 . VAL B 1 146 ? 83.189  36.192  10.618  1.00 3.62  ? 177 VAL B CG1 1 
ATOM   5638  C  CG2 . VAL B 1 146 ? 83.137  38.635  10.847  1.00 3.60  ? 177 VAL B CG2 1 
ATOM   5639  N  N   . LEU B 1 147 ? 84.425  37.040  6.953   1.00 2.15  ? 178 LEU B N   1 
ATOM   5640  C  CA  . LEU B 1 147 ? 84.379  36.310  5.700   1.00 3.81  ? 178 LEU B CA  1 
ATOM   5641  C  C   . LEU B 1 147 ? 85.760  35.777  5.355   1.00 7.50  ? 178 LEU B C   1 
ATOM   5642  O  O   . LEU B 1 147 ? 85.962  34.574  5.128   1.00 8.65  ? 178 LEU B O   1 
ATOM   5643  C  CB  . LEU B 1 147 ? 83.886  37.256  4.619   1.00 2.00  ? 178 LEU B CB  1 
ATOM   5644  C  CG  . LEU B 1 147 ? 83.506  36.863  3.206   1.00 2.00  ? 178 LEU B CG  1 
ATOM   5645  C  CD1 . LEU B 1 147 ? 84.528  37.356  2.230   1.00 2.00  ? 178 LEU B CD1 1 
ATOM   5646  C  CD2 . LEU B 1 147 ? 83.256  35.403  3.081   1.00 2.06  ? 178 LEU B CD2 1 
ATOM   5647  N  N   . GLU B 1 148 ? 86.734  36.675  5.375   1.00 12.12 ? 179 GLU B N   1 
ATOM   5648  C  CA  . GLU B 1 148 ? 88.128  36.338  5.060   1.00 11.10 ? 179 GLU B CA  1 
ATOM   5649  C  C   . GLU B 1 148 ? 88.891  35.555  6.142   1.00 9.20  ? 179 GLU B C   1 
ATOM   5650  O  O   . GLU B 1 148 ? 89.443  34.483  5.874   1.00 8.82  ? 179 GLU B O   1 
ATOM   5651  C  CB  . GLU B 1 148 ? 88.869  37.606  4.710   1.00 9.00  ? 179 GLU B CB  1 
ATOM   5652  C  CG  . GLU B 1 148 ? 88.409  38.180  3.424   1.00 10.79 ? 179 GLU B CG  1 
ATOM   5653  C  CD  . GLU B 1 148 ? 88.941  39.553  3.223   1.00 16.90 ? 179 GLU B CD  1 
ATOM   5654  O  OE1 . GLU B 1 148 ? 89.260  40.225  4.240   1.00 21.12 ? 179 GLU B OE1 1 
ATOM   5655  O  OE2 . GLU B 1 148 ? 89.045  39.960  2.048   1.00 20.10 ? 179 GLU B OE2 1 
ATOM   5656  N  N   . LYS B 1 149 ? 88.909  36.065  7.361   1.00 5.83  ? 180 LYS B N   1 
ATOM   5657  C  CA  . LYS B 1 149 ? 89.622  35.366  8.394   1.00 6.71  ? 180 LYS B CA  1 
ATOM   5658  C  C   . LYS B 1 149 ? 89.211  33.915  8.661   1.00 6.79  ? 180 LYS B C   1 
ATOM   5659  O  O   . LYS B 1 149 ? 90.071  33.047  8.555   1.00 7.52  ? 180 LYS B O   1 
ATOM   5660  C  CB  . LYS B 1 149 ? 89.659  36.177  9.675   1.00 10.03 ? 180 LYS B CB  1 
ATOM   5661  C  CG  . LYS B 1 149 ? 90.455  37.462  9.559   1.00 13.97 ? 180 LYS B CG  1 
ATOM   5662  C  CD  . LYS B 1 149 ? 90.382  38.190  10.908  1.00 20.58 ? 180 LYS B CD  1 
ATOM   5663  C  CE  . LYS B 1 149 ? 91.130  39.534  10.966  1.00 20.34 ? 180 LYS B CE  1 
ATOM   5664  N  NZ  . LYS B 1 149 ? 90.896  40.149  12.325  1.00 20.13 ? 180 LYS B NZ  1 
ATOM   5665  N  N   . VAL B 1 150 ? 87.937  33.629  8.968   1.00 6.34  ? 181 VAL B N   1 
ATOM   5666  C  CA  . VAL B 1 150 ? 87.534  32.234  9.259   1.00 5.16  ? 181 VAL B CA  1 
ATOM   5667  C  C   . VAL B 1 150 ? 86.702  31.502  8.214   1.00 4.36  ? 181 VAL B C   1 
ATOM   5668  O  O   . VAL B 1 150 ? 86.517  30.284  8.316   1.00 4.56  ? 181 VAL B O   1 
ATOM   5669  C  CB  . VAL B 1 150 ? 86.762  32.099  10.588  1.00 4.01  ? 181 VAL B CB  1 
ATOM   5670  C  CG1 . VAL B 1 150 ? 87.697  32.193  11.769  1.00 4.78  ? 181 VAL B CG1 1 
ATOM   5671  C  CG2 . VAL B 1 150 ? 85.649  33.156  10.657  1.00 5.04  ? 181 VAL B CG2 1 
ATOM   5672  N  N   . LEU B 1 151 ? 86.246  32.195  7.183   1.00 2.00  ? 182 LEU B N   1 
ATOM   5673  C  CA  . LEU B 1 151 ? 85.389  31.517  6.232   1.00 5.34  ? 182 LEU B CA  1 
ATOM   5674  C  C   . LEU B 1 151 ? 85.962  31.056  4.928   1.00 5.13  ? 182 LEU B C   1 
ATOM   5675  O  O   . LEU B 1 151 ? 85.831  29.876  4.584   1.00 6.45  ? 182 LEU B O   1 
ATOM   5676  C  CB  . LEU B 1 151 ? 84.107  32.321  5.960   1.00 9.06  ? 182 LEU B CB  1 
ATOM   5677  C  CG  . LEU B 1 151 ? 83.014  32.421  7.029   1.00 7.28  ? 182 LEU B CG  1 
ATOM   5678  C  CD1 . LEU B 1 151 ? 82.064  33.547  6.657   1.00 6.47  ? 182 LEU B CD1 1 
ATOM   5679  C  CD2 . LEU B 1 151 ? 82.289  31.087  7.165   1.00 5.34  ? 182 LEU B CD2 1 
ATOM   5680  N  N   . LEU B 1 152 ? 86.451  31.993  4.131   1.00 4.03  ? 183 LEU B N   1 
ATOM   5681  C  CA  . LEU B 1 152 ? 87.023  31.660  2.829   1.00 6.89  ? 183 LEU B CA  1 
ATOM   5682  C  C   . LEU B 1 152 ? 88.012  30.455  2.780   1.00 9.34  ? 183 LEU B C   1 
ATOM   5683  O  O   . LEU B 1 152 ? 88.825  30.241  3.698   1.00 8.16  ? 183 LEU B O   1 
ATOM   5684  C  CB  . LEU B 1 152 ? 87.697  32.888  2.249   1.00 4.91  ? 183 LEU B CB  1 
ATOM   5685  C  CG  . LEU B 1 152 ? 86.737  33.881  1.656   1.00 4.80  ? 183 LEU B CG  1 
ATOM   5686  C  CD1 . LEU B 1 152 ? 87.423  35.217  1.559   1.00 4.50  ? 183 LEU B CD1 1 
ATOM   5687  C  CD2 . LEU B 1 152 ? 86.273  33.376  0.288   1.00 4.84  ? 183 LEU B CD2 1 
ATOM   5688  N  N   . ARG B 1 153 ? 87.936  29.700  1.685   1.00 9.06  ? 184 ARG B N   1 
ATOM   5689  C  CA  . ARG B 1 153 ? 88.757  28.530  1.443   1.00 9.10  ? 184 ARG B CA  1 
ATOM   5690  C  C   . ARG B 1 153 ? 90.142  28.886  0.906   1.00 13.60 ? 184 ARG B C   1 
ATOM   5691  O  O   . ARG B 1 153 ? 90.275  29.693  -0.043  1.00 15.02 ? 184 ARG B O   1 
ATOM   5692  C  CB  . ARG B 1 153 ? 88.044  27.637  0.435   1.00 8.24  ? 184 ARG B CB  1 
ATOM   5693  C  CG  . ARG B 1 153 ? 88.940  26.827  -0.488  1.00 9.64  ? 184 ARG B CG  1 
ATOM   5694  C  CD  . ARG B 1 153 ? 88.134  26.081  -1.544  1.00 6.91  ? 184 ARG B CD  1 
ATOM   5695  N  NE  . ARG B 1 153 ? 87.154  25.200  -0.909  1.00 6.77  ? 184 ARG B NE  1 
ATOM   5696  C  CZ  . ARG B 1 153 ? 86.246  24.478  -1.560  1.00 4.58  ? 184 ARG B CZ  1 
ATOM   5697  N  NH1 . ARG B 1 153 ? 86.164  24.514  -2.888  1.00 5.31  ? 184 ARG B NH1 1 
ATOM   5698  N  NH2 . ARG B 1 153 ? 85.434  23.694  -0.877  1.00 2.00  ? 184 ARG B NH2 1 
ATOM   5699  N  N   . ARG B 1 154 ? 91.164  28.273  1.514   1.00 14.13 ? 185 ARG B N   1 
ATOM   5700  C  CA  . ARG B 1 154 ? 92.540  28.463  1.097   1.00 11.32 ? 185 ARG B CA  1 
ATOM   5701  C  C   . ARG B 1 154 ? 92.788  27.240  0.235   1.00 11.84 ? 185 ARG B C   1 
ATOM   5702  O  O   . ARG B 1 154 ? 92.858  27.323  -0.989  1.00 11.96 ? 185 ARG B O   1 
ATOM   5703  C  CB  . ARG B 1 154 ? 93.476  28.413  2.290   1.00 9.43  ? 185 ARG B CB  1 
ATOM   5704  C  CG  . ARG B 1 154 ? 92.934  29.019  3.553   1.00 6.91  ? 185 ARG B CG  1 
ATOM   5705  C  CD  . ARG B 1 154 ? 92.762  30.485  3.406   1.00 7.00  ? 185 ARG B CD  1 
ATOM   5706  N  NE  . ARG B 1 154 ? 92.410  31.059  4.689   1.00 9.57  ? 185 ARG B NE  1 
ATOM   5707  C  CZ  . ARG B 1 154 ? 92.211  32.357  4.894   1.00 14.75 ? 185 ARG B CZ  1 
ATOM   5708  N  NH1 . ARG B 1 154 ? 92.337  33.230  3.882   1.00 19.18 ? 185 ARG B NH1 1 
ATOM   5709  N  NH2 . ARG B 1 154 ? 91.875  32.780  6.114   1.00 15.95 ? 185 ARG B NH2 1 
ATOM   5710  N  N   . GLU B 1 155 ? 92.872  26.086  0.880   1.00 12.03 ? 186 GLU B N   1 
ATOM   5711  C  CA  . GLU B 1 155 ? 93.105  24.864  0.135   1.00 16.19 ? 186 GLU B CA  1 
ATOM   5712  C  C   . GLU B 1 155 ? 91.847  24.025  0.282   1.00 16.72 ? 186 GLU B C   1 
ATOM   5713  O  O   . GLU B 1 155 ? 91.336  23.862  1.401   1.00 20.94 ? 186 GLU B O   1 
ATOM   5714  C  CB  . GLU B 1 155 ? 94.308  24.122  0.704   1.00 22.42 ? 186 GLU B CB  1 
ATOM   5715  C  CG  . GLU B 1 155 ? 94.997  23.178  -0.309  1.00 33.39 ? 186 GLU B CG  1 
ATOM   5716  C  CD  . GLU B 1 155 ? 96.169  22.352  0.295   1.00 39.57 ? 186 GLU B CD  1 
ATOM   5717  O  OE1 . GLU B 1 155 ? 96.717  22.765  1.358   1.00 43.12 ? 186 GLU B OE1 1 
ATOM   5718  O  OE2 . GLU B 1 155 ? 96.528  21.285  -0.289  1.00 36.91 ? 186 GLU B OE2 1 
ATOM   5719  N  N   . PHE B 1 156 ? 91.308  23.544  -0.832  1.00 13.12 ? 187 PHE B N   1 
ATOM   5720  C  CA  . PHE B 1 156 ? 90.090  22.742  -0.780  1.00 11.24 ? 187 PHE B CA  1 
ATOM   5721  C  C   . PHE B 1 156 ? 90.167  21.576  0.199   1.00 8.54  ? 187 PHE B C   1 
ATOM   5722  O  O   . PHE B 1 156 ? 90.995  20.698  0.055   1.00 10.90 ? 187 PHE B O   1 
ATOM   5723  C  CB  . PHE B 1 156 ? 89.761  22.203  -2.172  1.00 14.55 ? 187 PHE B CB  1 
ATOM   5724  C  CG  . PHE B 1 156 ? 88.706  21.138  -2.179  1.00 11.40 ? 187 PHE B CG  1 
ATOM   5725  C  CD1 . PHE B 1 156 ? 89.023  19.828  -1.890  1.00 14.15 ? 187 PHE B CD1 1 
ATOM   5726  C  CD2 . PHE B 1 156 ? 87.411  21.454  -2.467  1.00 13.66 ? 187 PHE B CD2 1 
ATOM   5727  C  CE1 . PHE B 1 156 ? 88.067  18.847  -1.885  1.00 16.00 ? 187 PHE B CE1 1 
ATOM   5728  C  CE2 . PHE B 1 156 ? 86.448  20.489  -2.467  1.00 17.76 ? 187 PHE B CE2 1 
ATOM   5729  C  CZ  . PHE B 1 156 ? 86.779  19.170  -2.174  1.00 18.77 ? 187 PHE B CZ  1 
ATOM   5730  N  N   . ILE B 1 157 ? 89.296  21.569  1.188   1.00 6.33  ? 188 ILE B N   1 
ATOM   5731  C  CA  . ILE B 1 157 ? 89.246  20.488  2.151   1.00 4.44  ? 188 ILE B CA  1 
ATOM   5732  C  C   . ILE B 1 157 ? 88.079  19.622  1.658   1.00 7.72  ? 188 ILE B C   1 
ATOM   5733  O  O   . ILE B 1 157 ? 86.997  20.139  1.360   1.00 6.96  ? 188 ILE B O   1 
ATOM   5734  C  CB  . ILE B 1 157 ? 88.881  21.000  3.518   1.00 2.00  ? 188 ILE B CB  1 
ATOM   5735  C  CG1 . ILE B 1 157 ? 89.687  22.246  3.823   1.00 2.00  ? 188 ILE B CG1 1 
ATOM   5736  C  CG2 . ILE B 1 157 ? 89.069  19.925  4.551   1.00 2.00  ? 188 ILE B CG2 1 
ATOM   5737  C  CD1 . ILE B 1 157 ? 89.199  22.984  5.041   1.00 5.42  ? 188 ILE B CD1 1 
ATOM   5738  N  N   . PRO B 1 158 ? 88.297  18.306  1.488   1.00 8.76  ? 189 PRO B N   1 
ATOM   5739  C  CA  . PRO B 1 158 ? 87.203  17.461  1.026   1.00 7.94  ? 189 PRO B CA  1 
ATOM   5740  C  C   . PRO B 1 158 ? 86.366  17.036  2.240   1.00 10.15 ? 189 PRO B C   1 
ATOM   5741  O  O   . PRO B 1 158 ? 86.797  17.184  3.400   1.00 9.29  ? 189 PRO B O   1 
ATOM   5742  C  CB  . PRO B 1 158 ? 87.948  16.278  0.430   1.00 6.54  ? 189 PRO B CB  1 
ATOM   5743  C  CG  . PRO B 1 158 ? 89.016  16.091  1.411   1.00 6.66  ? 189 PRO B CG  1 
ATOM   5744  C  CD  . PRO B 1 158 ? 89.530  17.507  1.622   1.00 8.61  ? 189 PRO B CD  1 
ATOM   5745  N  N   . ASP B 1 159 ? 85.167  16.524  1.962   1.00 10.44 ? 190 ASP B N   1 
ATOM   5746  C  CA  . ASP B 1 159 ? 84.267  16.069  2.999   1.00 7.40  ? 190 ASP B CA  1 
ATOM   5747  C  C   . ASP B 1 159 ? 84.710  14.683  3.440   1.00 5.09  ? 190 ASP B C   1 
ATOM   5748  O  O   . ASP B 1 159 ? 84.950  13.812  2.614   1.00 2.72  ? 190 ASP B O   1 
ATOM   5749  C  CB  . ASP B 1 159 ? 82.825  16.070  2.453   1.00 9.06  ? 190 ASP B CB  1 
ATOM   5750  C  CG  . ASP B 1 159 ? 81.859  15.209  3.275   1.00 10.50 ? 190 ASP B CG  1 
ATOM   5751  O  OD1 . ASP B 1 159 ? 81.786  15.365  4.510   1.00 8.27  ? 190 ASP B OD1 1 
ATOM   5752  O  OD2 . ASP B 1 159 ? 81.167  14.367  2.667   1.00 10.43 ? 190 ASP B OD2 1 
ATOM   5753  N  N   . PRO B 1 160 ? 84.928  14.492  4.745   1.00 4.51  ? 191 PRO B N   1 
ATOM   5754  C  CA  . PRO B 1 160 ? 85.341  13.181  5.237   1.00 5.22  ? 191 PRO B CA  1 
ATOM   5755  C  C   . PRO B 1 160 ? 84.209  12.163  5.160   1.00 6.40  ? 191 PRO B C   1 
ATOM   5756  O  O   . PRO B 1 160 ? 84.396  11.028  5.567   1.00 10.52 ? 191 PRO B O   1 
ATOM   5757  C  CB  . PRO B 1 160 ? 85.705  13.461  6.691   1.00 4.19  ? 191 PRO B CB  1 
ATOM   5758  C  CG  . PRO B 1 160 ? 84.813  14.559  7.042   1.00 6.46  ? 191 PRO B CG  1 
ATOM   5759  C  CD  . PRO B 1 160 ? 84.949  15.467  5.841   1.00 4.49  ? 191 PRO B CD  1 
ATOM   5760  N  N   . GLN B 1 161 ? 83.025  12.577  4.701   1.00 5.22  ? 192 GLN B N   1 
ATOM   5761  C  CA  . GLN B 1 161 ? 81.905  11.659  4.589   1.00 2.01  ? 192 GLN B CA  1 
ATOM   5762  C  C   . GLN B 1 161 ? 81.719  11.082  3.195   1.00 2.00  ? 192 GLN B C   1 
ATOM   5763  O  O   . GLN B 1 161 ? 81.018  10.106  3.021   1.00 2.00  ? 192 GLN B O   1 
ATOM   5764  C  CB  . GLN B 1 161 ? 80.627  12.281  5.109   1.00 3.47  ? 192 GLN B CB  1 
ATOM   5765  C  CG  . GLN B 1 161 ? 80.588  12.372  6.619   1.00 5.31  ? 192 GLN B CG  1 
ATOM   5766  C  CD  . GLN B 1 161 ? 79.175  12.445  7.186   1.00 6.19  ? 192 GLN B CD  1 
ATOM   5767  O  OE1 . GLN B 1 161 ? 78.754  13.477  7.719   1.00 5.82  ? 192 GLN B OE1 1 
ATOM   5768  N  NE2 . GLN B 1 161 ? 78.444  11.334  7.092   1.00 9.69  ? 192 GLN B NE2 1 
ATOM   5769  N  N   . GLY B 1 162 ? 82.351  11.684  2.206   1.00 2.00  ? 193 GLY B N   1 
ATOM   5770  C  CA  . GLY B 1 162 ? 82.272  11.151  0.870   1.00 2.00  ? 193 GLY B CA  1 
ATOM   5771  C  C   . GLY B 1 162 ? 81.266  11.772  -0.033  1.00 2.52  ? 193 GLY B C   1 
ATOM   5772  O  O   . GLY B 1 162 ? 81.142  11.351  -1.176  1.00 6.37  ? 193 GLY B O   1 
ATOM   5773  N  N   . SER B 1 163 ? 80.545  12.766  0.459   1.00 2.02  ? 194 SER B N   1 
ATOM   5774  C  CA  . SER B 1 163 ? 79.541  13.443  -0.344  1.00 3.20  ? 194 SER B CA  1 
ATOM   5775  C  C   . SER B 1 163 ? 80.124  13.841  -1.692  1.00 2.00  ? 194 SER B C   1 
ATOM   5776  O  O   . SER B 1 163 ? 81.058  14.616  -1.750  1.00 4.68  ? 194 SER B O   1 
ATOM   5777  C  CB  . SER B 1 163 ? 79.062  14.676  0.405   1.00 8.61  ? 194 SER B CB  1 
ATOM   5778  O  OG  . SER B 1 163 ? 78.576  14.329  1.692   1.00 8.84  ? 194 SER B OG  1 
ATOM   5779  N  N   . ASN B 1 164 ? 79.611  13.271  -2.770  1.00 2.09  ? 195 ASN B N   1 
ATOM   5780  C  CA  . ASN B 1 164 ? 80.137  13.587  -4.089  1.00 2.22  ? 195 ASN B CA  1 
ATOM   5781  C  C   . ASN B 1 164 ? 79.430  14.758  -4.765  1.00 2.00  ? 195 ASN B C   1 
ATOM   5782  O  O   . ASN B 1 164 ? 78.931  15.653  -4.090  1.00 2.10  ? 195 ASN B O   1 
ATOM   5783  C  CB  . ASN B 1 164 ? 80.112  12.356  -4.980  1.00 4.61  ? 195 ASN B CB  1 
ATOM   5784  C  CG  . ASN B 1 164 ? 78.759  11.734  -5.044  1.00 7.35  ? 195 ASN B CG  1 
ATOM   5785  O  OD1 . ASN B 1 164 ? 77.766  12.338  -4.630  1.00 8.25  ? 195 ASN B OD1 1 
ATOM   5786  N  ND2 . ASN B 1 164 ? 78.698  10.513  -5.543  1.00 7.97  ? 195 ASN B ND2 1 
ATOM   5787  N  N   . MET B 1 165 ? 79.441  14.782  -6.096  1.00 2.44  ? 196 MET B N   1 
ATOM   5788  C  CA  . MET B 1 165 ? 78.828  15.872  -6.848  1.00 3.76  ? 196 MET B CA  1 
ATOM   5789  C  C   . MET B 1 165 ? 77.358  15.641  -7.079  1.00 6.34  ? 196 MET B C   1 
ATOM   5790  O  O   . MET B 1 165 ? 76.580  16.592  -7.091  1.00 8.91  ? 196 MET B O   1 
ATOM   5791  C  CB  . MET B 1 165 ? 79.556  16.132  -8.173  1.00 2.00  ? 196 MET B CB  1 
ATOM   5792  C  CG  . MET B 1 165 ? 80.176  17.512  -8.203  1.00 2.00  ? 196 MET B CG  1 
ATOM   5793  S  SD  . MET B 1 165 ? 80.497  18.216  -6.462  1.00 2.06  ? 196 MET B SD  1 
ATOM   5794  C  CE  . MET B 1 165 ? 80.463  19.929  -6.874  1.00 2.00  ? 196 MET B CE  1 
ATOM   5795  N  N   . MET B 1 166 ? 76.973  14.371  -7.214  1.00 7.44  ? 197 MET B N   1 
ATOM   5796  C  CA  . MET B 1 166 ? 75.585  13.985  -7.415  1.00 4.09  ? 197 MET B CA  1 
ATOM   5797  C  C   . MET B 1 166 ? 74.819  14.493  -6.202  1.00 5.47  ? 197 MET B C   1 
ATOM   5798  O  O   . MET B 1 166 ? 73.734  15.036  -6.347  1.00 8.27  ? 197 MET B O   1 
ATOM   5799  C  CB  . MET B 1 166 ? 75.453  12.476  -7.514  1.00 2.03  ? 197 MET B CB  1 
ATOM   5800  C  CG  . MET B 1 166 ? 74.267  12.048  -8.294  1.00 2.00  ? 197 MET B CG  1 
ATOM   5801  S  SD  . MET B 1 166 ? 74.559  11.980  -10.068 1.00 5.08  ? 197 MET B SD  1 
ATOM   5802  C  CE  . MET B 1 166 ? 74.877  13.628  -10.521 1.00 2.01  ? 197 MET B CE  1 
ATOM   5803  N  N   . PHE B 1 167 ? 75.404  14.357  -5.017  1.00 3.15  ? 198 PHE B N   1 
ATOM   5804  C  CA  . PHE B 1 167 ? 74.774  14.847  -3.804  1.00 2.36  ? 198 PHE B CA  1 
ATOM   5805  C  C   . PHE B 1 167 ? 74.685  16.371  -3.769  1.00 3.19  ? 198 PHE B C   1 
ATOM   5806  O  O   . PHE B 1 167 ? 73.610  16.910  -3.767  1.00 4.54  ? 198 PHE B O   1 
ATOM   5807  C  CB  . PHE B 1 167 ? 75.518  14.322  -2.595  1.00 2.00  ? 198 PHE B CB  1 
ATOM   5808  C  CG  . PHE B 1 167 ? 75.176  14.995  -1.301  1.00 2.00  ? 198 PHE B CG  1 
ATOM   5809  C  CD1 . PHE B 1 167 ? 75.590  16.297  -1.040  1.00 2.00  ? 198 PHE B CD1 1 
ATOM   5810  C  CD2 . PHE B 1 167 ? 74.573  14.269  -0.279  1.00 3.40  ? 198 PHE B CD2 1 
ATOM   5811  C  CE1 . PHE B 1 167 ? 75.426  16.858  0.214   1.00 3.71  ? 198 PHE B CE1 1 
ATOM   5812  C  CE2 . PHE B 1 167 ? 74.395  14.813  1.002   1.00 2.66  ? 198 PHE B CE2 1 
ATOM   5813  C  CZ  . PHE B 1 167 ? 74.827  16.109  1.246   1.00 5.05  ? 198 PHE B CZ  1 
ATOM   5814  N  N   . ALA B 1 168 ? 75.799  17.075  -3.737  1.00 5.76  ? 199 ALA B N   1 
ATOM   5815  C  CA  . ALA B 1 168 ? 75.757  18.542  -3.662  1.00 7.88  ? 199 ALA B CA  1 
ATOM   5816  C  C   . ALA B 1 168 ? 74.763  19.163  -4.621  1.00 8.35  ? 199 ALA B C   1 
ATOM   5817  O  O   . ALA B 1 168 ? 74.042  20.093  -4.252  1.00 9.19  ? 199 ALA B O   1 
ATOM   5818  C  CB  . ALA B 1 168 ? 77.137  19.157  -3.905  1.00 12.62 ? 199 ALA B CB  1 
ATOM   5819  N  N   . PHE B 1 169 ? 74.733  18.688  -5.858  1.00 6.08  ? 200 PHE B N   1 
ATOM   5820  C  CA  . PHE B 1 169 ? 73.777  19.252  -6.796  1.00 7.79  ? 200 PHE B CA  1 
ATOM   5821  C  C   . PHE B 1 169 ? 72.298  18.862  -6.449  1.00 9.70  ? 200 PHE B C   1 
ATOM   5822  O  O   . PHE B 1 169 ? 71.366  19.692  -6.545  1.00 8.51  ? 200 PHE B O   1 
ATOM   5823  C  CB  . PHE B 1 169 ? 74.171  18.896  -8.229  1.00 4.68  ? 200 PHE B CB  1 
ATOM   5824  C  CG  . PHE B 1 169 ? 75.193  19.802  -8.799  1.00 3.63  ? 200 PHE B CG  1 
ATOM   5825  C  CD1 . PHE B 1 169 ? 75.094  21.169  -8.609  1.00 6.94  ? 200 PHE B CD1 1 
ATOM   5826  C  CD2 . PHE B 1 169 ? 76.237  19.307  -9.567  1.00 3.97  ? 200 PHE B CD2 1 
ATOM   5827  C  CE1 . PHE B 1 169 ? 76.029  22.049  -9.191  1.00 8.60  ? 200 PHE B CE1 1 
ATOM   5828  C  CE2 . PHE B 1 169 ? 77.179  20.170  -10.152 1.00 2.95  ? 200 PHE B CE2 1 
ATOM   5829  C  CZ  . PHE B 1 169 ? 77.071  21.545  -9.965  1.00 5.78  ? 200 PHE B CZ  1 
ATOM   5830  N  N   . PHE B 1 170 ? 72.093  17.625  -6.000  1.00 7.00  ? 201 PHE B N   1 
ATOM   5831  C  CA  . PHE B 1 170 ? 70.778  17.176  -5.604  1.00 3.08  ? 201 PHE B CA  1 
ATOM   5832  C  C   . PHE B 1 170 ? 70.282  18.153  -4.545  1.00 3.14  ? 201 PHE B C   1 
ATOM   5833  O  O   . PHE B 1 170 ? 69.254  18.778  -4.737  1.00 5.99  ? 201 PHE B O   1 
ATOM   5834  C  CB  . PHE B 1 170 ? 70.854  15.776  -5.028  1.00 4.46  ? 201 PHE B CB  1 
ATOM   5835  C  CG  . PHE B 1 170 ? 69.523  15.141  -4.807  1.00 5.11  ? 201 PHE B CG  1 
ATOM   5836  C  CD1 . PHE B 1 170 ? 68.810  15.375  -3.629  1.00 2.79  ? 201 PHE B CD1 1 
ATOM   5837  C  CD2 . PHE B 1 170 ? 68.969  14.320  -5.793  1.00 4.11  ? 201 PHE B CD2 1 
ATOM   5838  C  CE1 . PHE B 1 170 ? 67.575  14.805  -3.446  1.00 2.01  ? 201 PHE B CE1 1 
ATOM   5839  C  CE2 . PHE B 1 170 ? 67.734  13.744  -5.616  1.00 3.11  ? 201 PHE B CE2 1 
ATOM   5840  C  CZ  . PHE B 1 170 ? 67.033  13.988  -4.439  1.00 3.50  ? 201 PHE B CZ  1 
ATOM   5841  N  N   . ALA B 1 171 ? 71.025  18.341  -3.460  1.00 2.19  ? 202 ALA B N   1 
ATOM   5842  C  CA  . ALA B 1 171 ? 70.622  19.299  -2.422  1.00 2.04  ? 202 ALA B CA  1 
ATOM   5843  C  C   . ALA B 1 171 ? 70.415  20.731  -2.959  1.00 3.52  ? 202 ALA B C   1 
ATOM   5844  O  O   . ALA B 1 171 ? 69.700  21.528  -2.333  1.00 2.00  ? 202 ALA B O   1 
ATOM   5845  C  CB  . ALA B 1 171 ? 71.630  19.326  -1.303  1.00 2.00  ? 202 ALA B CB  1 
ATOM   5846  N  N   . GLN B 1 172 ? 71.061  21.090  -4.074  1.00 3.66  ? 203 GLN B N   1 
ATOM   5847  C  CA  . GLN B 1 172 ? 70.858  22.441  -4.603  1.00 5.86  ? 203 GLN B CA  1 
ATOM   5848  C  C   . GLN B 1 172 ? 69.474  22.519  -5.220  1.00 6.69  ? 203 GLN B C   1 
ATOM   5849  O  O   . GLN B 1 172 ? 68.672  23.386  -4.871  1.00 7.99  ? 203 GLN B O   1 
ATOM   5850  C  CB  . GLN B 1 172 ? 71.903  22.835  -5.643  1.00 4.58  ? 203 GLN B CB  1 
ATOM   5851  C  CG  . GLN B 1 172 ? 71.732  24.289  -6.074  1.00 4.34  ? 203 GLN B CG  1 
ATOM   5852  C  CD  . GLN B 1 172 ? 72.812  24.795  -6.990  1.00 5.19  ? 203 GLN B CD  1 
ATOM   5853  O  OE1 . GLN B 1 172 ? 72.864  25.978  -7.297  1.00 6.31  ? 203 GLN B OE1 1 
ATOM   5854  N  NE2 . GLN B 1 172 ? 73.686  23.917  -7.418  1.00 6.03  ? 203 GLN B NE2 1 
ATOM   5855  N  N   . HIS B 1 173 ? 69.229  21.591  -6.135  1.00 5.03  ? 204 HIS B N   1 
ATOM   5856  C  CA  . HIS B 1 173 ? 67.975  21.419  -6.838  1.00 3.82  ? 204 HIS B CA  1 
ATOM   5857  C  C   . HIS B 1 173 ? 66.845  21.256  -5.818  1.00 4.99  ? 204 HIS B C   1 
ATOM   5858  O  O   . HIS B 1 173 ? 65.930  22.065  -5.777  1.00 6.80  ? 204 HIS B O   1 
ATOM   5859  C  CB  . HIS B 1 173 ? 68.119  20.142  -7.623  1.00 7.20  ? 204 HIS B CB  1 
ATOM   5860  C  CG  . HIS B 1 173 ? 66.965  19.808  -8.506  1.00 5.17  ? 204 HIS B CG  1 
ATOM   5861  N  ND1 . HIS B 1 173 ? 66.595  20.603  -9.569  1.00 3.99  ? 204 HIS B ND1 1 
ATOM   5862  C  CD2 . HIS B 1 173 ? 66.249  18.666  -8.620  1.00 4.82  ? 204 HIS B CD2 1 
ATOM   5863  C  CE1 . HIS B 1 173 ? 65.717  19.959  -10.312 1.00 7.68  ? 204 HIS B CE1 1 
ATOM   5864  N  NE2 . HIS B 1 173 ? 65.491  18.780  -9.759  1.00 9.42  ? 204 HIS B NE2 1 
ATOM   5865  N  N   . PHE B 1 174 ? 66.934  20.231  -4.974  1.00 4.71  ? 205 PHE B N   1 
ATOM   5866  C  CA  . PHE B 1 174 ? 65.925  19.948  -3.951  1.00 3.21  ? 205 PHE B CA  1 
ATOM   5867  C  C   . PHE B 1 174 ? 65.527  21.172  -3.146  1.00 2.05  ? 205 PHE B C   1 
ATOM   5868  O  O   . PHE B 1 174 ? 64.455  21.691  -3.354  1.00 6.24  ? 205 PHE B O   1 
ATOM   5869  C  CB  . PHE B 1 174 ? 66.386  18.818  -3.036  1.00 2.90  ? 205 PHE B CB  1 
ATOM   5870  C  CG  . PHE B 1 174 ? 65.447  18.513  -1.914  1.00 3.98  ? 205 PHE B CG  1 
ATOM   5871  C  CD1 . PHE B 1 174 ? 64.227  17.898  -2.154  1.00 5.66  ? 205 PHE B CD1 1 
ATOM   5872  C  CD2 . PHE B 1 174 ? 65.800  18.815  -0.604  1.00 4.38  ? 205 PHE B CD2 1 
ATOM   5873  C  CE1 . PHE B 1 174 ? 63.372  17.586  -1.097  1.00 5.95  ? 205 PHE B CE1 1 
ATOM   5874  C  CE2 . PHE B 1 174 ? 64.948  18.505  0.469   1.00 7.21  ? 205 PHE B CE2 1 
ATOM   5875  C  CZ  . PHE B 1 174 ? 63.734  17.889  0.220   1.00 6.76  ? 205 PHE B CZ  1 
ATOM   5876  N  N   . THR B 1 175 ? 66.380  21.672  -2.273  1.00 2.00  ? 206 THR B N   1 
ATOM   5877  C  CA  . THR B 1 175 ? 66.028  22.852  -1.477  1.00 3.81  ? 206 THR B CA  1 
ATOM   5878  C  C   . THR B 1 175 ? 65.640  24.079  -2.301  1.00 3.77  ? 206 THR B C   1 
ATOM   5879  O  O   . THR B 1 175 ? 65.083  25.015  -1.769  1.00 3.83  ? 206 THR B O   1 
ATOM   5880  C  CB  . THR B 1 175 ? 67.196  23.314  -0.620  1.00 7.44  ? 206 THR B CB  1 
ATOM   5881  O  OG1 . THR B 1 175 ? 68.273  23.760  -1.479  1.00 11.52 ? 206 THR B OG1 1 
ATOM   5882  C  CG2 . THR B 1 175 ? 67.664  22.178  0.267   1.00 6.29  ? 206 THR B CG2 1 
ATOM   5883  N  N   . HIS B 1 176 ? 65.949  24.098  -3.588  1.00 4.39  ? 207 HIS B N   1 
ATOM   5884  C  CA  . HIS B 1 176 ? 65.640  25.273  -4.395  1.00 5.43  ? 207 HIS B CA  1 
ATOM   5885  C  C   . HIS B 1 176 ? 64.240  25.429  -4.904  1.00 6.97  ? 207 HIS B C   1 
ATOM   5886  O  O   . HIS B 1 176 ? 63.952  26.254  -5.784  1.00 7.52  ? 207 HIS B O   1 
ATOM   5887  C  CB  . HIS B 1 176 ? 66.673  25.487  -5.503  1.00 5.81  ? 207 HIS B CB  1 
ATOM   5888  C  CG  . HIS B 1 176 ? 67.917  26.145  -5.005  1.00 3.19  ? 207 HIS B CG  1 
ATOM   5889  N  ND1 . HIS B 1 176 ? 68.565  25.725  -3.859  1.00 2.99  ? 207 HIS B ND1 1 
ATOM   5890  C  CD2 . HIS B 1 176 ? 68.542  27.276  -5.401  1.00 2.48  ? 207 HIS B CD2 1 
ATOM   5891  C  CE1 . HIS B 1 176 ? 69.523  26.579  -3.560  1.00 3.81  ? 207 HIS B CE1 1 
ATOM   5892  N  NE2 . HIS B 1 176 ? 69.531  27.530  -4.479  1.00 5.98  ? 207 HIS B NE2 1 
ATOM   5893  N  N   . GLN B 1 177 ? 63.367  24.576  -4.403  1.00 8.51  ? 208 GLN B N   1 
ATOM   5894  C  CA  . GLN B 1 177 ? 61.966  24.673  -4.750  1.00 6.31  ? 208 GLN B CA  1 
ATOM   5895  C  C   . GLN B 1 177 ? 61.386  25.387  -3.531  1.00 6.32  ? 208 GLN B C   1 
ATOM   5896  O  O   . GLN B 1 177 ? 60.481  26.193  -3.682  1.00 8.74  ? 208 GLN B O   1 
ATOM   5897  C  CB  . GLN B 1 177 ? 61.343  23.308  -4.951  1.00 3.07  ? 208 GLN B CB  1 
ATOM   5898  C  CG  . GLN B 1 177 ? 61.288  22.474  -3.707  1.00 3.79  ? 208 GLN B CG  1 
ATOM   5899  C  CD  . GLN B 1 177 ? 60.801  21.114  -4.045  1.00 6.22  ? 208 GLN B CD  1 
ATOM   5900  O  OE1 . GLN B 1 177 ? 60.825  20.723  -5.217  1.00 2.12  ? 208 GLN B OE1 1 
ATOM   5901  N  NE2 . GLN B 1 177 ? 60.284  20.399  -3.054  1.00 7.73  ? 208 GLN B NE2 1 
ATOM   5902  N  N   . PHE B 1 178 ? 61.884  25.092  -2.330  1.00 3.93  ? 209 PHE B N   1 
ATOM   5903  C  CA  . PHE B 1 178 ? 61.390  25.825  -1.180  1.00 2.24  ? 209 PHE B CA  1 
ATOM   5904  C  C   . PHE B 1 178 ? 62.171  27.029  -0.764  1.00 2.00  ? 209 PHE B C   1 
ATOM   5905  O  O   . PHE B 1 178 ? 61.650  27.823  -0.031  1.00 3.11  ? 209 PHE B O   1 
ATOM   5906  C  CB  . PHE B 1 178 ? 61.082  24.996  0.060   1.00 2.00  ? 209 PHE B CB  1 
ATOM   5907  C  CG  . PHE B 1 178 ? 61.874  23.752  0.203   1.00 3.14  ? 209 PHE B CG  1 
ATOM   5908  C  CD1 . PHE B 1 178 ? 61.551  22.621  -0.533  1.00 2.05  ? 209 PHE B CD1 1 
ATOM   5909  C  CD2 . PHE B 1 178 ? 62.818  23.651  1.216   1.00 5.64  ? 209 PHE B CD2 1 
ATOM   5910  C  CE1 . PHE B 1 178 ? 62.138  21.415  -0.245  1.00 2.01  ? 209 PHE B CE1 1 
ATOM   5911  C  CE2 . PHE B 1 178 ? 63.424  22.443  1.522   1.00 4.15  ? 209 PHE B CE2 1 
ATOM   5912  C  CZ  . PHE B 1 178 ? 63.081  21.323  0.798   1.00 5.14  ? 209 PHE B CZ  1 
ATOM   5913  N  N   . PHE B 1 179 ? 63.432  27.148  -1.142  1.00 3.00  ? 210 PHE B N   1 
ATOM   5914  C  CA  . PHE B 1 179 ? 64.184  28.344  -0.774  1.00 2.00  ? 210 PHE B CA  1 
ATOM   5915  C  C   . PHE B 1 179 ? 64.150  29.102  -2.069  1.00 2.00  ? 210 PHE B C   1 
ATOM   5916  O  O   . PHE B 1 179 ? 64.663  28.615  -3.078  1.00 2.00  ? 210 PHE B O   1 
ATOM   5917  C  CB  . PHE B 1 179 ? 65.623  28.025  -0.381  1.00 2.01  ? 210 PHE B CB  1 
ATOM   5918  C  CG  . PHE B 1 179 ? 65.758  27.187  0.878   1.00 3.73  ? 210 PHE B CG  1 
ATOM   5919  C  CD1 . PHE B 1 179 ? 64.983  27.446  2.006   1.00 2.00  ? 210 PHE B CD1 1 
ATOM   5920  C  CD2 . PHE B 1 179 ? 66.717  26.181  0.952   1.00 2.45  ? 210 PHE B CD2 1 
ATOM   5921  C  CE1 . PHE B 1 179 ? 65.166  26.725  3.180   1.00 2.00  ? 210 PHE B CE1 1 
ATOM   5922  C  CE2 . PHE B 1 179 ? 66.898  25.467  2.125   1.00 4.41  ? 210 PHE B CE2 1 
ATOM   5923  C  CZ  . PHE B 1 179 ? 66.120  25.745  3.241   1.00 2.00  ? 210 PHE B CZ  1 
ATOM   5924  N  N   . LYS B 1 180 ? 63.412  30.211  -2.077  1.00 2.14  ? 211 LYS B N   1 
ATOM   5925  C  CA  . LYS B 1 180 ? 63.273  31.050  -3.271  1.00 3.47  ? 211 LYS B CA  1 
ATOM   5926  C  C   . LYS B 1 180 ? 63.019  32.502  -2.898  1.00 5.12  ? 211 LYS B C   1 
ATOM   5927  O  O   . LYS B 1 180 ? 61.993  33.037  -3.286  1.00 7.94  ? 211 LYS B O   1 
ATOM   5928  C  CB  . LYS B 1 180 ? 62.104  30.591  -4.138  1.00 2.00  ? 211 LYS B CB  1 
ATOM   5929  C  CG  . LYS B 1 180 ? 62.166  29.155  -4.618  1.00 5.23  ? 211 LYS B CG  1 
ATOM   5930  C  CD  . LYS B 1 180 ? 60.806  28.671  -5.158  1.00 3.89  ? 211 LYS B CD  1 
ATOM   5931  C  CE  . LYS B 1 180 ? 60.292  29.544  -6.289  1.00 2.51  ? 211 LYS B CE  1 
ATOM   5932  N  NZ  . LYS B 1 180 ? 59.199  28.889  -7.022  1.00 2.00  ? 211 LYS B NZ  1 
ATOM   5933  N  N   . THR B 1 181 ? 63.946  33.151  -2.197  1.00 2.42  ? 212 THR B N   1 
ATOM   5934  C  CA  . THR B 1 181 ? 63.775  34.530  -1.806  1.00 2.00  ? 212 THR B CA  1 
ATOM   5935  C  C   . THR B 1 181 ? 63.266  35.526  -2.870  1.00 2.49  ? 212 THR B C   1 
ATOM   5936  O  O   . THR B 1 181 ? 63.659  35.496  -4.028  1.00 2.00  ? 212 THR B O   1 
ATOM   5937  C  CB  . THR B 1 181 ? 65.042  35.035  -1.157  1.00 3.05  ? 212 THR B CB  1 
ATOM   5938  O  OG1 . THR B 1 181 ? 65.334  34.220  -0.006  1.00 2.96  ? 212 THR B OG1 1 
ATOM   5939  C  CG2 . THR B 1 181 ? 64.884  36.507  -0.728  1.00 3.64  ? 212 THR B CG2 1 
ATOM   5940  N  N   . ASP B 1 182 ? 62.356  36.392  -2.432  1.00 6.96  ? 213 ASP B N   1 
ATOM   5941  C  CA  . ASP B 1 182 ? 61.724  37.433  -3.236  1.00 8.99  ? 213 ASP B CA  1 
ATOM   5942  C  C   . ASP B 1 182 ? 62.531  38.666  -2.953  1.00 9.26  ? 213 ASP B C   1 
ATOM   5943  O  O   . ASP B 1 182 ? 62.135  39.502  -2.136  1.00 8.98  ? 213 ASP B O   1 
ATOM   5944  C  CB  . ASP B 1 182 ? 60.297  37.653  -2.715  1.00 13.05 ? 213 ASP B CB  1 
ATOM   5945  C  CG  . ASP B 1 182 ? 59.476  38.606  -3.586  1.00 17.53 ? 213 ASP B CG  1 
ATOM   5946  O  OD1 . ASP B 1 182 ? 60.047  39.255  -4.504  1.00 17.09 ? 213 ASP B OD1 1 
ATOM   5947  O  OD2 . ASP B 1 182 ? 58.241  38.685  -3.349  1.00 17.81 ? 213 ASP B OD2 1 
ATOM   5948  N  N   . HIS B 1 183 ? 63.663  38.785  -3.628  1.00 10.75 ? 214 HIS B N   1 
ATOM   5949  C  CA  . HIS B 1 183 ? 64.569  39.911  -3.392  1.00 14.85 ? 214 HIS B CA  1 
ATOM   5950  C  C   . HIS B 1 183 ? 63.980  41.269  -3.536  1.00 16.71 ? 214 HIS B C   1 
ATOM   5951  O  O   . HIS B 1 183 ? 64.347  42.193  -2.830  1.00 15.63 ? 214 HIS B O   1 
ATOM   5952  C  CB  . HIS B 1 183 ? 65.792  39.789  -4.265  1.00 13.69 ? 214 HIS B CB  1 
ATOM   5953  C  CG  . HIS B 1 183 ? 66.633  38.624  -3.891  1.00 11.42 ? 214 HIS B CG  1 
ATOM   5954  N  ND1 . HIS B 1 183 ? 66.883  37.588  -4.762  1.00 8.53  ? 214 HIS B ND1 1 
ATOM   5955  C  CD2 . HIS B 1 183 ? 67.170  38.267  -2.697  1.00 6.67  ? 214 HIS B CD2 1 
ATOM   5956  C  CE1 . HIS B 1 183 ? 67.531  36.634  -4.116  1.00 11.14 ? 214 HIS B CE1 1 
ATOM   5957  N  NE2 . HIS B 1 183 ? 67.717  37.024  -2.864  1.00 10.18 ? 214 HIS B NE2 1 
ATOM   5958  N  N   . LYS B 1 184 ? 63.041  41.362  -4.458  1.00 22.25 ? 215 LYS B N   1 
ATOM   5959  C  CA  . LYS B 1 184 ? 62.337  42.598  -4.742  1.00 24.93 ? 215 LYS B CA  1 
ATOM   5960  C  C   . LYS B 1 184 ? 61.591  43.011  -3.449  1.00 24.74 ? 215 LYS B C   1 
ATOM   5961  O  O   . LYS B 1 184 ? 61.427  44.201  -3.171  1.00 27.09 ? 215 LYS B O   1 
ATOM   5962  C  CB  . LYS B 1 184 ? 61.381  42.422  -5.954  1.00 27.23 ? 215 LYS B CB  1 
ATOM   5963  C  CG  . LYS B 1 184 ? 61.369  40.996  -6.640  1.00 31.59 ? 215 LYS B CG  1 
ATOM   5964  C  CD  . LYS B 1 184 ? 62.759  40.541  -7.278  1.00 31.44 ? 215 LYS B CD  1 
ATOM   5965  C  CE  . LYS B 1 184 ? 62.883  38.983  -7.614  1.00 23.55 ? 215 LYS B CE  1 
ATOM   5966  N  NZ  . LYS B 1 184 ? 63.237  38.034  -6.486  1.00 10.50 ? 215 LYS B NZ  1 
ATOM   5967  N  N   . ARG B 1 185 ? 61.210  42.035  -2.628  1.00 21.73 ? 216 ARG B N   1 
ATOM   5968  C  CA  . ARG B 1 185 ? 60.526  42.336  -1.380  1.00 21.03 ? 216 ARG B CA  1 
ATOM   5969  C  C   . ARG B 1 185 ? 61.568  42.504  -0.277  1.00 18.29 ? 216 ARG B C   1 
ATOM   5970  O  O   . ARG B 1 185 ? 61.471  43.413  0.562   1.00 16.29 ? 216 ARG B O   1 
ATOM   5971  C  CB  . ARG B 1 185 ? 59.555  41.205  -1.015  1.00 24.38 ? 216 ARG B CB  1 
ATOM   5972  C  CG  . ARG B 1 185 ? 58.204  41.678  -0.445  1.00 24.98 ? 216 ARG B CG  1 
ATOM   5973  C  CD  . ARG B 1 185 ? 57.236  42.040  -1.566  1.00 26.49 ? 216 ARG B CD  1 
ATOM   5974  N  NE  . ARG B 1 185 ? 56.780  40.846  -2.272  1.00 26.63 ? 216 ARG B NE  1 
ATOM   5975  C  CZ  . ARG B 1 185 ? 55.547  40.342  -2.195  1.00 27.88 ? 216 ARG B CZ  1 
ATOM   5976  N  NH1 . ARG B 1 185 ? 54.610  40.938  -1.455  1.00 24.50 ? 216 ARG B NH1 1 
ATOM   5977  N  NH2 . ARG B 1 185 ? 55.274  39.181  -2.788  1.00 30.17 ? 216 ARG B NH2 1 
ATOM   5978  N  N   . GLY B 1 186 ? 62.534  41.589  -0.262  1.00 16.84 ? 217 GLY B N   1 
ATOM   5979  C  CA  . GLY B 1 186 ? 63.603  41.634  0.727   1.00 17.68 ? 217 GLY B CA  1 
ATOM   5980  C  C   . GLY B 1 186 ? 63.931  40.257  1.254   1.00 17.52 ? 217 GLY B C   1 
ATOM   5981  O  O   . GLY B 1 186 ? 63.273  39.290  0.833   1.00 19.13 ? 217 GLY B O   1 
ATOM   5982  N  N   . PRO B 1 187 ? 65.029  40.084  2.023   1.00 17.20 ? 218 PRO B N   1 
ATOM   5983  C  CA  . PRO B 1 187 ? 65.273  38.724  2.517   1.00 17.09 ? 218 PRO B CA  1 
ATOM   5984  C  C   . PRO B 1 187 ? 64.188  38.546  3.561   1.00 17.41 ? 218 PRO B C   1 
ATOM   5985  O  O   . PRO B 1 187 ? 63.676  39.538  4.123   1.00 18.77 ? 218 PRO B O   1 
ATOM   5986  C  CB  . PRO B 1 187 ? 66.649  38.829  3.173   1.00 15.05 ? 218 PRO B CB  1 
ATOM   5987  C  CG  . PRO B 1 187 ? 66.713  40.244  3.637   1.00 12.81 ? 218 PRO B CG  1 
ATOM   5988  C  CD  . PRO B 1 187 ? 66.105  40.993  2.453   1.00 17.92 ? 218 PRO B CD  1 
ATOM   5989  N  N   . GLY B 1 188 ? 63.822  37.306  3.817   1.00 15.67 ? 219 GLY B N   1 
ATOM   5990  C  CA  . GLY B 1 188 ? 62.769  37.084  4.779   1.00 13.55 ? 219 GLY B CA  1 
ATOM   5991  C  C   . GLY B 1 188 ? 61.497  36.819  4.010   1.00 9.41  ? 219 GLY B C   1 
ATOM   5992  O  O   . GLY B 1 188 ? 60.565  36.273  4.571   1.00 11.41 ? 219 GLY B O   1 
ATOM   5993  N  N   . PHE B 1 189 ? 61.494  37.142  2.721   1.00 4.88  ? 220 PHE B N   1 
ATOM   5994  C  CA  . PHE B 1 189 ? 60.357  36.920  1.856   1.00 3.45  ? 220 PHE B CA  1 
ATOM   5995  C  C   . PHE B 1 189 ? 60.644  35.815  0.852   1.00 2.03  ? 220 PHE B C   1 
ATOM   5996  O  O   . PHE B 1 189 ? 61.607  35.899  0.125   1.00 2.00  ? 220 PHE B O   1 
ATOM   5997  C  CB  . PHE B 1 189 ? 60.009  38.197  1.089   1.00 4.44  ? 220 PHE B CB  1 
ATOM   5998  C  CG  . PHE B 1 189 ? 59.341  39.260  1.927   1.00 6.06  ? 220 PHE B CG  1 
ATOM   5999  C  CD1 . PHE B 1 189 ? 57.977  39.248  2.128   1.00 7.11  ? 220 PHE B CD1 1 
ATOM   6000  C  CD2 . PHE B 1 189 ? 60.076  40.310  2.466   1.00 6.55  ? 220 PHE B CD2 1 
ATOM   6001  C  CE1 . PHE B 1 189 ? 57.368  40.273  2.849   1.00 9.18  ? 220 PHE B CE1 1 
ATOM   6002  C  CE2 . PHE B 1 189 ? 59.469  41.332  3.185   1.00 4.15  ? 220 PHE B CE2 1 
ATOM   6003  C  CZ  . PHE B 1 189 ? 58.128  41.317  3.376   1.00 5.50  ? 220 PHE B CZ  1 
ATOM   6004  N  N   . THR B 1 190 ? 59.785  34.793  0.819   1.00 3.76  ? 221 THR B N   1 
ATOM   6005  C  CA  . THR B 1 190 ? 59.884  33.653  -0.107  1.00 3.33  ? 221 THR B CA  1 
ATOM   6006  C  C   . THR B 1 190 ? 58.934  33.878  -1.247  1.00 2.00  ? 221 THR B C   1 
ATOM   6007  O  O   . THR B 1 190 ? 57.949  34.554  -1.087  1.00 2.00  ? 221 THR B O   1 
ATOM   6008  C  CB  . THR B 1 190 ? 59.443  32.344  0.566   1.00 4.09  ? 221 THR B CB  1 
ATOM   6009  O  OG1 . THR B 1 190 ? 59.370  31.282  -0.404  1.00 2.03  ? 221 THR B OG1 1 
ATOM   6010  C  CG2 . THR B 1 190 ? 58.107  32.547  1.248   1.00 2.03  ? 221 THR B CG2 1 
ATOM   6011  N  N   . ARG B 1 191 ? 59.260  33.360  -2.410  1.00 2.00  ? 222 ARG B N   1 
ATOM   6012  C  CA  . ARG B 1 191 ? 58.385  33.499  -3.554  1.00 3.78  ? 222 ARG B CA  1 
ATOM   6013  C  C   . ARG B 1 191 ? 57.781  32.092  -3.759  1.00 3.62  ? 222 ARG B C   1 
ATOM   6014  O  O   . ARG B 1 191 ? 56.972  31.847  -4.650  1.00 2.00  ? 222 ARG B O   1 
ATOM   6015  C  CB  . ARG B 1 191 ? 59.164  34.006  -4.780  1.00 7.58  ? 222 ARG B CB  1 
ATOM   6016  C  CG  . ARG B 1 191 ? 59.670  32.897  -5.694  1.00 20.86 ? 222 ARG B CG  1 
ATOM   6017  C  CD  . ARG B 1 191 ? 61.006  33.205  -6.419  1.00 28.52 ? 222 ARG B CD  1 
ATOM   6018  N  NE  . ARG B 1 191 ? 60.831  33.866  -7.721  1.00 32.74 ? 222 ARG B NE  1 
ATOM   6019  C  CZ  . ARG B 1 191 ? 60.573  35.160  -7.877  1.00 31.48 ? 222 ARG B CZ  1 
ATOM   6020  N  NH1 . ARG B 1 191 ? 60.450  35.947  -6.817  1.00 32.27 ? 222 ARG B NH1 1 
ATOM   6021  N  NH2 . ARG B 1 191 ? 60.468  35.670  -9.096  1.00 32.26 ? 222 ARG B NH2 1 
ATOM   6022  N  N   . GLY B 1 192 ? 58.185  31.162  -2.904  1.00 4.65  ? 223 GLY B N   1 
ATOM   6023  C  CA  . GLY B 1 192 ? 57.660  29.809  -2.982  1.00 5.31  ? 223 GLY B CA  1 
ATOM   6024  C  C   . GLY B 1 192 ? 56.594  29.647  -1.913  1.00 4.23  ? 223 GLY B C   1 
ATOM   6025  O  O   . GLY B 1 192 ? 56.827  29.090  -0.825  1.00 2.00  ? 223 GLY B O   1 
ATOM   6026  N  N   . LEU B 1 193 ? 55.407  30.138  -2.234  1.00 3.58  ? 224 LEU B N   1 
ATOM   6027  C  CA  . LEU B 1 193 ? 54.296  30.110  -1.299  1.00 2.83  ? 224 LEU B CA  1 
ATOM   6028  C  C   . LEU B 1 193 ? 53.840  28.707  -0.910  1.00 3.16  ? 224 LEU B C   1 
ATOM   6029  O  O   . LEU B 1 193 ? 53.078  28.524  0.042   1.00 2.00  ? 224 LEU B O   1 
ATOM   6030  C  CB  . LEU B 1 193 ? 53.177  30.931  -1.890  1.00 3.66  ? 224 LEU B CB  1 
ATOM   6031  C  CG  . LEU B 1 193 ? 53.666  32.360  -2.126  1.00 2.18  ? 224 LEU B CG  1 
ATOM   6032  C  CD1 . LEU B 1 193 ? 52.799  32.998  -3.202  1.00 3.97  ? 224 LEU B CD1 1 
ATOM   6033  C  CD2 . LEU B 1 193 ? 53.693  33.163  -0.810  1.00 2.00  ? 224 LEU B CD2 1 
ATOM   6034  N  N   . GLY B 1 194 ? 54.386  27.716  -1.621  1.00 5.37  ? 225 GLY B N   1 
ATOM   6035  C  CA  . GLY B 1 194 ? 54.077  26.315  -1.361  1.00 4.70  ? 225 GLY B CA  1 
ATOM   6036  C  C   . GLY B 1 194 ? 54.585  25.869  0.003   1.00 6.80  ? 225 GLY B C   1 
ATOM   6037  O  O   . GLY B 1 194 ? 54.017  24.961  0.619   1.00 8.44  ? 225 GLY B O   1 
ATOM   6038  N  N   . HIS B 1 195 ? 55.674  26.506  0.450   1.00 6.31  ? 226 HIS B N   1 
ATOM   6039  C  CA  . HIS B 1 195 ? 56.324  26.247  1.732   1.00 3.00  ? 226 HIS B CA  1 
ATOM   6040  C  C   . HIS B 1 195 ? 56.666  24.803  1.997   1.00 2.64  ? 226 HIS B C   1 
ATOM   6041  O  O   . HIS B 1 195 ? 56.693  24.381  3.160   1.00 2.87  ? 226 HIS B O   1 
ATOM   6042  C  CB  . HIS B 1 195 ? 55.519  26.824  2.901   1.00 3.79  ? 226 HIS B CB  1 
ATOM   6043  C  CG  . HIS B 1 195 ? 55.603  28.318  3.005   1.00 4.99  ? 226 HIS B CG  1 
ATOM   6044  N  ND1 . HIS B 1 195 ? 55.999  28.967  4.158   1.00 4.17  ? 226 HIS B ND1 1 
ATOM   6045  C  CD2 . HIS B 1 195 ? 55.388  29.289  2.083   1.00 2.01  ? 226 HIS B CD2 1 
ATOM   6046  C  CE1 . HIS B 1 195 ? 56.029  30.269  3.941   1.00 2.00  ? 226 HIS B CE1 1 
ATOM   6047  N  NE2 . HIS B 1 195 ? 55.664  30.490  2.691   1.00 2.79  ? 226 HIS B NE2 1 
ATOM   6048  N  N   . GLY B 1 196 ? 57.011  24.068  0.943   1.00 2.00  ? 227 GLY B N   1 
ATOM   6049  C  CA  . GLY B 1 196 ? 57.344  22.678  1.137   1.00 2.00  ? 227 GLY B CA  1 
ATOM   6050  C  C   . GLY B 1 196 ? 57.604  21.920  -0.133  1.00 2.00  ? 227 GLY B C   1 
ATOM   6051  O  O   . GLY B 1 196 ? 57.700  22.496  -1.224  1.00 2.00  ? 227 GLY B O   1 
ATOM   6052  N  N   . VAL B 1 197 ? 57.690  20.602  0.013   1.00 2.79  ? 228 VAL B N   1 
ATOM   6053  C  CA  . VAL B 1 197 ? 57.973  19.737  -1.122  1.00 3.97  ? 228 VAL B CA  1 
ATOM   6054  C  C   . VAL B 1 197 ? 56.795  19.657  -2.118  1.00 5.00  ? 228 VAL B C   1 
ATOM   6055  O  O   . VAL B 1 197 ? 56.014  18.697  -2.121  1.00 2.00  ? 228 VAL B O   1 
ATOM   6056  C  CB  . VAL B 1 197 ? 58.351  18.341  -0.655  1.00 2.04  ? 228 VAL B CB  1 
ATOM   6057  C  CG1 . VAL B 1 197 ? 59.094  17.633  -1.744  1.00 2.00  ? 228 VAL B CG1 1 
ATOM   6058  C  CG2 . VAL B 1 197 ? 59.145  18.401  0.614   1.00 2.00  ? 228 VAL B CG2 1 
ATOM   6059  N  N   . ASP B 1 198 ? 56.668  20.664  -2.968  1.00 2.00  ? 229 ASP B N   1 
ATOM   6060  C  CA  . ASP B 1 198 ? 55.586  20.649  -3.918  1.00 2.00  ? 229 ASP B CA  1 
ATOM   6061  C  C   . ASP B 1 198 ? 56.049  20.432  -5.344  1.00 2.00  ? 229 ASP B C   1 
ATOM   6062  O  O   . ASP B 1 198 ? 55.283  20.551  -6.278  1.00 2.51  ? 229 ASP B O   1 
ATOM   6063  C  CB  . ASP B 1 198 ? 54.807  21.947  -3.808  1.00 5.10  ? 229 ASP B CB  1 
ATOM   6064  C  CG  . ASP B 1 198 ? 55.663  23.190  -4.105  1.00 14.03 ? 229 ASP B CG  1 
ATOM   6065  O  OD1 . ASP B 1 198 ? 56.796  23.042  -4.652  1.00 14.45 ? 229 ASP B OD1 1 
ATOM   6066  O  OD2 . ASP B 1 198 ? 55.188  24.329  -3.786  1.00 17.50 ? 229 ASP B OD2 1 
ATOM   6067  N  N   . LEU B 1 199 ? 57.322  20.131  -5.523  1.00 3.95  ? 230 LEU B N   1 
ATOM   6068  C  CA  . LEU B 1 199 ? 57.883  19.915  -6.862  1.00 4.07  ? 230 LEU B CA  1 
ATOM   6069  C  C   . LEU B 1 199 ? 57.499  21.035  -7.808  1.00 2.90  ? 230 LEU B C   1 
ATOM   6070  O  O   . LEU B 1 199 ? 57.299  20.848  -9.013  1.00 2.00  ? 230 LEU B O   1 
ATOM   6071  C  CB  . LEU B 1 199 ? 57.520  18.540  -7.447  1.00 3.10  ? 230 LEU B CB  1 
ATOM   6072  C  CG  . LEU B 1 199 ? 57.945  17.326  -6.585  1.00 3.78  ? 230 LEU B CG  1 
ATOM   6073  C  CD1 . LEU B 1 199 ? 58.445  16.189  -7.444  1.00 3.70  ? 230 LEU B CD1 1 
ATOM   6074  C  CD2 . LEU B 1 199 ? 58.977  17.682  -5.523  1.00 2.00  ? 230 LEU B CD2 1 
ATOM   6075  N  N   . ASN B 1 200 ? 57.487  22.230  -7.240  1.00 2.00  ? 231 ASN B N   1 
ATOM   6076  C  CA  . ASN B 1 200 ? 57.167  23.419  -7.994  1.00 3.39  ? 231 ASN B CA  1 
ATOM   6077  C  C   . ASN B 1 200 ? 58.251  23.709  -9.007  1.00 2.94  ? 231 ASN B C   1 
ATOM   6078  O  O   . ASN B 1 200 ? 57.974  24.238  -10.066 1.00 2.00  ? 231 ASN B O   1 
ATOM   6079  C  CB  . ASN B 1 200 ? 56.947  24.601  -7.040  1.00 2.00  ? 231 ASN B CB  1 
ATOM   6080  C  CG  . ASN B 1 200 ? 58.080  25.620  -7.050  1.00 2.21  ? 231 ASN B CG  1 
ATOM   6081  O  OD1 . ASN B 1 200 ? 58.469  26.168  -8.104  1.00 2.00  ? 231 ASN B OD1 1 
ATOM   6082  N  ND2 . ASN B 1 200 ? 58.542  25.958  -5.857  1.00 2.00  ? 231 ASN B ND2 1 
ATOM   6083  N  N   . HIS B 1 201 ? 59.487  23.347  -8.648  1.00 7.64  ? 232 HIS B N   1 
ATOM   6084  C  CA  . HIS B 1 201 ? 60.677  23.560  -9.486  1.00 6.10  ? 232 HIS B CA  1 
ATOM   6085  C  C   . HIS B 1 201 ? 60.629  22.787  -10.798 1.00 6.05  ? 232 HIS B C   1 
ATOM   6086  O  O   . HIS B 1 201 ? 61.181  23.226  -11.809 1.00 4.39  ? 232 HIS B O   1 
ATOM   6087  C  CB  . HIS B 1 201 ? 61.947  23.256  -8.699  1.00 2.00  ? 232 HIS B CB  1 
ATOM   6088  C  CG  . HIS B 1 201 ? 61.986  21.886  -8.128  1.00 2.06  ? 232 HIS B CG  1 
ATOM   6089  N  ND1 . HIS B 1 201 ? 62.941  21.486  -7.223  1.00 5.44  ? 232 HIS B ND1 1 
ATOM   6090  C  CD2 . HIS B 1 201 ? 61.235  20.798  -8.377  1.00 3.03  ? 232 HIS B CD2 1 
ATOM   6091  C  CE1 . HIS B 1 201 ? 62.786  20.206  -6.946  1.00 5.77  ? 232 HIS B CE1 1 
ATOM   6092  N  NE2 . HIS B 1 201 ? 61.754  19.764  -7.634  1.00 7.33  ? 232 HIS B NE2 1 
ATOM   6093  N  N   . ILE B 1 202 ? 59.911  21.670  -10.789 1.00 5.53  ? 233 ILE B N   1 
ATOM   6094  C  CA  . ILE B 1 202 ? 59.772  20.879  -11.999 1.00 6.29  ? 233 ILE B CA  1 
ATOM   6095  C  C   . ILE B 1 202 ? 58.590  21.441  -12.772 1.00 5.72  ? 233 ILE B C   1 
ATOM   6096  O  O   . ILE B 1 202 ? 58.676  21.651  -13.981 1.00 4.52  ? 233 ILE B O   1 
ATOM   6097  C  CB  . ILE B 1 202 ? 59.413  19.350  -11.724 1.00 5.13  ? 233 ILE B CB  1 
ATOM   6098  C  CG1 . ILE B 1 202 ? 60.465  18.659  -10.847 1.00 7.14  ? 233 ILE B CG1 1 
ATOM   6099  C  CG2 . ILE B 1 202 ? 59.232  18.588  -13.049 1.00 2.00  ? 233 ILE B CG2 1 
ATOM   6100  C  CD1 . ILE B 1 202 ? 60.170  17.184  -10.572 1.00 2.00  ? 233 ILE B CD1 1 
ATOM   6101  N  N   . TYR B 1 203 ? 57.501  21.709  -12.037 1.00 6.45  ? 234 TYR B N   1 
ATOM   6102  C  CA  . TYR B 1 203 ? 56.224  22.119  -12.629 1.00 3.84  ? 234 TYR B CA  1 
ATOM   6103  C  C   . TYR B 1 203 ? 55.871  23.554  -12.866 1.00 2.45  ? 234 TYR B C   1 
ATOM   6104  O  O   . TYR B 1 203 ? 55.036  23.831  -13.696 1.00 2.33  ? 234 TYR B O   1 
ATOM   6105  C  CB  . TYR B 1 203 ? 55.074  21.449  -11.879 1.00 2.00  ? 234 TYR B CB  1 
ATOM   6106  C  CG  . TYR B 1 203 ? 55.144  19.946  -11.931 1.00 2.00  ? 234 TYR B CG  1 
ATOM   6107  C  CD1 . TYR B 1 203 ? 54.906  19.265  -13.120 1.00 2.00  ? 234 TYR B CD1 1 
ATOM   6108  C  CD2 . TYR B 1 203 ? 55.470  19.205  -10.792 1.00 2.00  ? 234 TYR B CD2 1 
ATOM   6109  C  CE1 . TYR B 1 203 ? 54.987  17.903  -13.174 1.00 2.00  ? 234 TYR B CE1 1 
ATOM   6110  C  CE2 . TYR B 1 203 ? 55.552  17.842  -10.833 1.00 2.00  ? 234 TYR B CE2 1 
ATOM   6111  C  CZ  . TYR B 1 203 ? 55.310  17.192  -12.028 1.00 2.00  ? 234 TYR B CZ  1 
ATOM   6112  O  OH  . TYR B 1 203 ? 55.390  15.813  -12.097 1.00 2.00  ? 234 TYR B OH  1 
ATOM   6113  N  N   . GLY B 1 204 ? 56.518  24.474  -12.189 1.00 2.56  ? 235 GLY B N   1 
ATOM   6114  C  CA  . GLY B 1 204 ? 56.163  25.855  -12.378 1.00 2.37  ? 235 GLY B CA  1 
ATOM   6115  C  C   . GLY B 1 204 ? 55.497  26.313  -11.103 1.00 4.57  ? 235 GLY B C   1 
ATOM   6116  O  O   . GLY B 1 204 ? 54.801  25.566  -10.435 1.00 3.65  ? 235 GLY B O   1 
ATOM   6117  N  N   . GLU B 1 205 ? 55.739  27.563  -10.764 1.00 9.97  ? 236 GLU B N   1 
ATOM   6118  C  CA  . GLU B 1 205 ? 55.212  28.182  -9.564  1.00 13.30 ? 236 GLU B CA  1 
ATOM   6119  C  C   . GLU B 1 205 ? 53.695  28.382  -9.708  1.00 14.46 ? 236 GLU B C   1 
ATOM   6120  O  O   . GLU B 1 205 ? 52.930  28.172  -8.763  1.00 17.63 ? 236 GLU B O   1 
ATOM   6121  C  CB  . GLU B 1 205 ? 55.907  29.539  -9.345  1.00 19.36 ? 236 GLU B CB  1 
ATOM   6122  C  CG  . GLU B 1 205 ? 57.457  29.529  -9.085  1.00 29.37 ? 236 GLU B CG  1 
ATOM   6123  C  CD  . GLU B 1 205 ? 58.383  29.002  -10.235 1.00 32.57 ? 236 GLU B CD  1 
ATOM   6124  O  OE1 . GLU B 1 205 ? 58.614  29.741  -11.251 1.00 34.39 ? 236 GLU B OE1 1 
ATOM   6125  O  OE2 . GLU B 1 205 ? 58.905  27.858  -10.079 1.00 27.11 ? 236 GLU B OE2 1 
ATOM   6126  N  N   . THR B 1 206 ? 53.245  28.739  -10.908 1.00 12.35 ? 237 THR B N   1 
ATOM   6127  C  CA  . THR B 1 206 ? 51.836  29.005  -11.117 1.00 6.61  ? 237 THR B CA  1 
ATOM   6128  C  C   . THR B 1 206 ? 51.246  28.138  -12.202 1.00 5.49  ? 237 THR B C   1 
ATOM   6129  O  O   . THR B 1 206 ? 51.946  27.675  -13.101 1.00 3.56  ? 237 THR B O   1 
ATOM   6130  C  CB  . THR B 1 206 ? 51.633  30.489  -11.505 1.00 7.19  ? 237 THR B CB  1 
ATOM   6131  O  OG1 . THR B 1 206 ? 52.301  30.765  -12.754 1.00 6.24  ? 237 THR B OG1 1 
ATOM   6132  C  CG2 . THR B 1 206 ? 52.209  31.402  -10.424 1.00 4.39  ? 237 THR B CG2 1 
ATOM   6133  N  N   . LEU B 1 207 ? 49.930  27.988  -12.131 1.00 5.79  ? 238 LEU B N   1 
ATOM   6134  C  CA  . LEU B 1 207 ? 49.124  27.211  -13.077 1.00 4.80  ? 238 LEU B CA  1 
ATOM   6135  C  C   . LEU B 1 207 ? 49.295  27.753  -14.493 1.00 5.48  ? 238 LEU B C   1 
ATOM   6136  O  O   . LEU B 1 207 ? 49.153  27.051  -15.476 1.00 3.46  ? 238 LEU B O   1 
ATOM   6137  C  CB  . LEU B 1 207 ? 47.634  27.245  -12.635 1.00 4.08  ? 238 LEU B CB  1 
ATOM   6138  C  CG  . LEU B 1 207 ? 46.495  26.480  -13.341 1.00 5.63  ? 238 LEU B CG  1 
ATOM   6139  C  CD1 . LEU B 1 207 ? 46.073  27.200  -14.609 1.00 2.00  ? 238 LEU B CD1 1 
ATOM   6140  C  CD2 . LEU B 1 207 ? 46.859  25.014  -13.658 1.00 8.30  ? 238 LEU B CD2 1 
ATOM   6141  N  N   . ASP B 1 208 ? 49.602  29.028  -14.587 1.00 10.26 ? 239 ASP B N   1 
ATOM   6142  C  CA  . ASP B 1 208 ? 49.787  29.643  -15.863 1.00 13.73 ? 239 ASP B CA  1 
ATOM   6143  C  C   . ASP B 1 208 ? 51.071  29.094  -16.421 1.00 14.33 ? 239 ASP B C   1 
ATOM   6144  O  O   . ASP B 1 208 ? 51.144  28.746  -17.605 1.00 13.85 ? 239 ASP B O   1 
ATOM   6145  C  CB  . ASP B 1 208 ? 49.908  31.138  -15.678 1.00 22.74 ? 239 ASP B CB  1 
ATOM   6146  C  CG  . ASP B 1 208 ? 50.161  31.847  -16.985 1.00 34.40 ? 239 ASP B CG  1 
ATOM   6147  O  OD1 . ASP B 1 208 ? 49.529  31.447  -17.999 1.00 38.02 ? 239 ASP B OD1 1 
ATOM   6148  O  OD2 . ASP B 1 208 ? 51.007  32.781  -17.006 1.00 42.40 ? 239 ASP B OD2 1 
ATOM   6149  N  N   . ARG B 1 209 ? 52.082  29.019  -15.548 1.00 13.51 ? 240 ARG B N   1 
ATOM   6150  C  CA  . ARG B 1 209 ? 53.425  28.519  -15.899 1.00 8.70  ? 240 ARG B CA  1 
ATOM   6151  C  C   . ARG B 1 209 ? 53.353  27.040  -16.221 1.00 5.16  ? 240 ARG B C   1 
ATOM   6152  O  O   . ARG B 1 209 ? 53.729  26.606  -17.314 1.00 2.00  ? 240 ARG B O   1 
ATOM   6153  C  CB  . ARG B 1 209 ? 54.390  28.749  -14.720 1.00 8.43  ? 240 ARG B CB  1 
ATOM   6154  C  CG  . ARG B 1 209 ? 55.878  28.501  -15.004 1.00 8.23  ? 240 ARG B CG  1 
ATOM   6155  C  CD  . ARG B 1 209 ? 56.781  29.170  -13.938 1.00 6.97  ? 240 ARG B CD  1 
ATOM   6156  N  NE  . ARG B 1 209 ? 58.189  28.794  -14.078 1.00 8.71  ? 240 ARG B NE  1 
ATOM   6157  C  CZ  . ARG B 1 209 ? 59.006  29.248  -15.025 1.00 8.91  ? 240 ARG B CZ  1 
ATOM   6158  N  NH1 . ARG B 1 209 ? 58.560  30.124  -15.910 1.00 7.43  ? 240 ARG B NH1 1 
ATOM   6159  N  NH2 . ARG B 1 209 ? 60.225  28.725  -15.171 1.00 6.74  ? 240 ARG B NH2 1 
ATOM   6160  N  N   . GLN B 1 210 ? 52.798  26.282  -15.284 1.00 2.72  ? 241 GLN B N   1 
ATOM   6161  C  CA  . GLN B 1 210 ? 52.677  24.850  -15.445 1.00 2.57  ? 241 GLN B CA  1 
ATOM   6162  C  C   . GLN B 1 210 ? 52.029  24.505  -16.763 1.00 3.80  ? 241 GLN B C   1 
ATOM   6163  O  O   . GLN B 1 210 ? 52.369  23.511  -17.390 1.00 4.44  ? 241 GLN B O   1 
ATOM   6164  C  CB  . GLN B 1 210 ? 51.893  24.252  -14.282 1.00 2.00  ? 241 GLN B CB  1 
ATOM   6165  C  CG  . GLN B 1 210 ? 50.517  23.832  -14.628 1.00 2.85  ? 241 GLN B CG  1 
ATOM   6166  C  CD  . GLN B 1 210 ? 50.173  22.497  -14.056 1.00 5.90  ? 241 GLN B CD  1 
ATOM   6167  O  OE1 . GLN B 1 210 ? 49.846  21.549  -14.796 1.00 2.90  ? 241 GLN B OE1 1 
ATOM   6168  N  NE2 . GLN B 1 210 ? 50.232  22.399  -12.721 1.00 8.55  ? 241 GLN B NE2 1 
ATOM   6169  N  N   . HIS B 1 211 ? 51.093  25.337  -17.191 1.00 5.65  ? 242 HIS B N   1 
ATOM   6170  C  CA  . HIS B 1 211 ? 50.409  25.093  -18.453 1.00 8.32  ? 242 HIS B CA  1 
ATOM   6171  C  C   . HIS B 1 211 ? 51.331  25.337  -19.672 1.00 7.91  ? 242 HIS B C   1 
ATOM   6172  O  O   . HIS B 1 211 ? 51.213  24.643  -20.674 1.00 5.99  ? 242 HIS B O   1 
ATOM   6173  C  CB  . HIS B 1 211 ? 49.064  25.873  -18.537 1.00 10.88 ? 242 HIS B CB  1 
ATOM   6174  C  CG  . HIS B 1 211 ? 47.916  25.225  -17.797 1.00 9.44  ? 242 HIS B CG  1 
ATOM   6175  N  ND1 . HIS B 1 211 ? 47.976  23.950  -17.276 1.00 6.80  ? 242 HIS B ND1 1 
ATOM   6176  C  CD2 . HIS B 1 211 ? 46.689  25.694  -17.470 1.00 5.91  ? 242 HIS B CD2 1 
ATOM   6177  C  CE1 . HIS B 1 211 ? 46.848  23.667  -16.656 1.00 2.96  ? 242 HIS B CE1 1 
ATOM   6178  N  NE2 . HIS B 1 211 ? 46.051  24.707  -16.759 1.00 2.00  ? 242 HIS B NE2 1 
ATOM   6179  N  N   . LYS B 1 212 ? 52.282  26.265  -19.554 1.00 10.27 ? 243 LYS B N   1 
ATOM   6180  C  CA  . LYS B 1 212 ? 53.227  26.560  -20.646 1.00 11.64 ? 243 LYS B CA  1 
ATOM   6181  C  C   . LYS B 1 212 ? 54.285  25.467  -20.705 1.00 8.77  ? 243 LYS B C   1 
ATOM   6182  O  O   . LYS B 1 212 ? 55.082  25.386  -21.642 1.00 7.58  ? 243 LYS B O   1 
ATOM   6183  C  CB  . LYS B 1 212 ? 53.954  27.907  -20.435 1.00 15.07 ? 243 LYS B CB  1 
ATOM   6184  C  CG  . LYS B 1 212 ? 53.092  29.147  -20.603 1.00 22.49 ? 243 LYS B CG  1 
ATOM   6185  C  CD  . LYS B 1 212 ? 53.956  30.381  -20.861 1.00 27.04 ? 243 LYS B CD  1 
ATOM   6186  C  CE  . LYS B 1 212 ? 53.178  31.726  -20.727 1.00 28.93 ? 243 LYS B CE  1 
ATOM   6187  N  NZ  . LYS B 1 212 ? 54.092  32.918  -20.483 1.00 27.95 ? 243 LYS B NZ  1 
ATOM   6188  N  N   . LEU B 1 213 ? 54.338  24.676  -19.651 1.00 5.54  ? 244 LEU B N   1 
ATOM   6189  C  CA  . LEU B 1 213 ? 55.307  23.605  -19.572 1.00 5.36  ? 244 LEU B CA  1 
ATOM   6190  C  C   . LEU B 1 213 ? 54.734  22.240  -19.975 1.00 4.87  ? 244 LEU B C   1 
ATOM   6191  O  O   . LEU B 1 213 ? 55.484  21.309  -20.293 1.00 2.02  ? 244 LEU B O   1 
ATOM   6192  C  CB  . LEU B 1 213 ? 55.825  23.524  -18.141 1.00 3.40  ? 244 LEU B CB  1 
ATOM   6193  C  CG  . LEU B 1 213 ? 56.514  24.782  -17.681 1.00 2.00  ? 244 LEU B CG  1 
ATOM   6194  C  CD1 . LEU B 1 213 ? 56.817  24.743  -16.219 1.00 2.00  ? 244 LEU B CD1 1 
ATOM   6195  C  CD2 . LEU B 1 213 ? 57.745  24.887  -18.472 1.00 2.25  ? 244 LEU B CD2 1 
ATOM   6196  N  N   . ARG B 1 214 ? 53.409  22.109  -19.912 1.00 6.51  ? 245 ARG B N   1 
ATOM   6197  C  CA  . ARG B 1 214 ? 52.762  20.843  -20.236 1.00 4.78  ? 245 ARG B CA  1 
ATOM   6198  C  C   . ARG B 1 214 ? 52.451  20.598  -21.715 1.00 3.04  ? 245 ARG B C   1 
ATOM   6199  O  O   . ARG B 1 214 ? 52.238  21.514  -22.498 1.00 2.00  ? 245 ARG B O   1 
ATOM   6200  C  CB  . ARG B 1 214 ? 51.516  20.614  -19.384 1.00 2.03  ? 245 ARG B CB  1 
ATOM   6201  C  CG  . ARG B 1 214 ? 51.263  19.132  -19.159 1.00 2.01  ? 245 ARG B CG  1 
ATOM   6202  C  CD  . ARG B 1 214 ? 49.853  18.839  -18.718 1.00 4.15  ? 245 ARG B CD  1 
ATOM   6203  N  NE  . ARG B 1 214 ? 49.435  19.739  -17.653 1.00 5.86  ? 245 ARG B NE  1 
ATOM   6204  C  CZ  . ARG B 1 214 ? 48.179  19.901  -17.274 1.00 3.23  ? 245 ARG B CZ  1 
ATOM   6205  N  NH1 . ARG B 1 214 ? 47.221  19.213  -17.864 1.00 2.18  ? 245 ARG B NH1 1 
ATOM   6206  N  NH2 . ARG B 1 214 ? 47.881  20.819  -16.372 1.00 2.03  ? 245 ARG B NH2 1 
ATOM   6207  N  N   . LEU B 1 215 ? 52.461  19.332  -22.090 1.00 2.38  ? 246 LEU B N   1 
ATOM   6208  C  CA  . LEU B 1 215 ? 52.207  18.941  -23.458 1.00 3.49  ? 246 LEU B CA  1 
ATOM   6209  C  C   . LEU B 1 215 ? 50.706  18.713  -23.653 1.00 7.66  ? 246 LEU B C   1 
ATOM   6210  O  O   . LEU B 1 215 ? 50.201  18.792  -24.799 1.00 8.46  ? 246 LEU B O   1 
ATOM   6211  C  CB  . LEU B 1 215 ? 52.991  17.668  -23.745 1.00 2.05  ? 246 LEU B CB  1 
ATOM   6212  C  CG  . LEU B 1 215 ? 52.731  16.894  -25.028 1.00 3.54  ? 246 LEU B CG  1 
ATOM   6213  C  CD1 . LEU B 1 215 ? 53.366  17.599  -26.206 1.00 2.00  ? 246 LEU B CD1 1 
ATOM   6214  C  CD2 . LEU B 1 215 ? 53.225  15.429  -24.866 1.00 3.45  ? 246 LEU B CD2 1 
ATOM   6215  N  N   . PHE B 1 216 ? 49.999  18.441  -22.537 1.00 7.62  ? 247 PHE B N   1 
ATOM   6216  C  CA  . PHE B 1 216 ? 48.550  18.187  -22.550 1.00 4.75  ? 247 PHE B CA  1 
ATOM   6217  C  C   . PHE B 1 216 ? 48.327  17.042  -23.505 1.00 4.47  ? 247 PHE B C   1 
ATOM   6218  O  O   . PHE B 1 216 ? 47.782  17.216  -24.574 1.00 6.45  ? 247 PHE B O   1 
ATOM   6219  C  CB  . PHE B 1 216 ? 47.761  19.421  -23.036 1.00 3.51  ? 247 PHE B CB  1 
ATOM   6220  C  CG  . PHE B 1 216 ? 47.814  20.588  -22.104 1.00 2.00  ? 247 PHE B CG  1 
ATOM   6221  C  CD1 . PHE B 1 216 ? 47.450  20.444  -20.778 1.00 2.00  ? 247 PHE B CD1 1 
ATOM   6222  C  CD2 . PHE B 1 216 ? 48.207  21.830  -22.556 1.00 2.00  ? 247 PHE B CD2 1 
ATOM   6223  C  CE1 . PHE B 1 216 ? 47.472  21.525  -19.906 1.00 2.66  ? 247 PHE B CE1 1 
ATOM   6224  C  CE2 . PHE B 1 216 ? 48.236  22.930  -21.686 1.00 3.25  ? 247 PHE B CE2 1 
ATOM   6225  C  CZ  . PHE B 1 216 ? 47.865  22.775  -20.360 1.00 2.20  ? 247 PHE B CZ  1 
ATOM   6226  N  N   . LYS B 1 217 ? 48.863  15.888  -23.145 1.00 6.69  ? 248 LYS B N   1 
ATOM   6227  C  CA  . LYS B 1 217 ? 48.781  14.664  -23.954 1.00 4.07  ? 248 LYS B CA  1 
ATOM   6228  C  C   . LYS B 1 217 ? 49.443  13.570  -23.138 1.00 2.00  ? 248 LYS B C   1 
ATOM   6229  O  O   . LYS B 1 217 ? 50.617  13.624  -22.865 1.00 2.00  ? 248 LYS B O   1 
ATOM   6230  C  CB  . LYS B 1 217 ? 49.544  14.877  -25.233 1.00 2.00  ? 248 LYS B CB  1 
ATOM   6231  C  CG  . LYS B 1 217 ? 49.361  13.854  -26.243 1.00 2.10  ? 248 LYS B CG  1 
ATOM   6232  C  CD  . LYS B 1 217 ? 50.027  14.370  -27.514 1.00 7.96  ? 248 LYS B CD  1 
ATOM   6233  C  CE  . LYS B 1 217 ? 49.645  15.843  -27.815 1.00 10.13 ? 248 LYS B CE  1 
ATOM   6234  N  NZ  . LYS B 1 217 ? 50.323  16.401  -29.034 1.00 8.12  ? 248 LYS B NZ  1 
ATOM   6235  N  N   . ASP B 1 218 ? 48.667  12.614  -22.681 1.00 2.00  ? 249 ASP B N   1 
ATOM   6236  C  CA  . ASP B 1 218 ? 49.188  11.535  -21.853 1.00 4.02  ? 249 ASP B CA  1 
ATOM   6237  C  C   . ASP B 1 218 ? 49.766  12.101  -20.586 1.00 2.81  ? 249 ASP B C   1 
ATOM   6238  O  O   . ASP B 1 218 ? 50.533  11.433  -19.923 1.00 6.81  ? 249 ASP B O   1 
ATOM   6239  C  CB  . ASP B 1 218 ? 50.263  10.708  -22.551 1.00 4.75  ? 249 ASP B CB  1 
ATOM   6240  C  CG  . ASP B 1 218 ? 49.828  10.208  -23.900 1.00 13.99 ? 249 ASP B CG  1 
ATOM   6241  O  OD1 . ASP B 1 218 ? 48.958  9.334   -23.925 1.00 16.42 ? 249 ASP B OD1 1 
ATOM   6242  O  OD2 . ASP B 1 218 ? 50.335  10.687  -24.944 1.00 21.41 ? 249 ASP B OD2 1 
ATOM   6243  N  N   . GLY B 1 219 ? 49.397  13.326  -20.245 1.00 2.18  ? 250 GLY B N   1 
ATOM   6244  C  CA  . GLY B 1 219 ? 49.892  13.941  -19.021 1.00 3.93  ? 250 GLY B CA  1 
ATOM   6245  C  C   . GLY B 1 219 ? 51.349  14.372  -19.043 1.00 4.29  ? 250 GLY B C   1 
ATOM   6246  O  O   . GLY B 1 219 ? 51.855  14.975  -18.094 1.00 4.54  ? 250 GLY B O   1 
ATOM   6247  N  N   . LYS B 1 220 ? 52.016  14.078  -20.146 1.00 4.90  ? 251 LYS B N   1 
ATOM   6248  C  CA  . LYS B 1 220 ? 53.420  14.391  -20.319 1.00 5.32  ? 251 LYS B CA  1 
ATOM   6249  C  C   . LYS B 1 220 ? 53.773  15.879  -20.291 1.00 7.23  ? 251 LYS B C   1 
ATOM   6250  O  O   . LYS B 1 220 ? 52.972  16.737  -20.693 1.00 8.15  ? 251 LYS B O   1 
ATOM   6251  C  CB  . LYS B 1 220 ? 53.908  13.783  -21.634 1.00 2.01  ? 251 LYS B CB  1 
ATOM   6252  C  CG  . LYS B 1 220 ? 53.902  12.272  -21.637 1.00 3.69  ? 251 LYS B CG  1 
ATOM   6253  C  CD  . LYS B 1 220 ? 54.029  11.739  -23.062 1.00 7.22  ? 251 LYS B CD  1 
ATOM   6254  C  CE  . LYS B 1 220 ? 54.344  10.249  -23.090 1.00 6.88  ? 251 LYS B CE  1 
ATOM   6255  N  NZ  . LYS B 1 220 ? 55.669  9.952   -22.446 1.00 8.00  ? 251 LYS B NZ  1 
ATOM   6256  N  N   . LEU B 1 221 ? 54.956  16.174  -19.751 1.00 5.82  ? 252 LEU B N   1 
ATOM   6257  C  CA  . LEU B 1 221 ? 55.501  17.521  -19.730 1.00 3.02  ? 252 LEU B CA  1 
ATOM   6258  C  C   . LEU B 1 221 ? 56.052  17.741  -21.149 1.00 2.04  ? 252 LEU B C   1 
ATOM   6259  O  O   . LEU B 1 221 ? 56.361  16.802  -21.872 1.00 5.21  ? 252 LEU B O   1 
ATOM   6260  C  CB  . LEU B 1 221 ? 56.649  17.595  -18.728 1.00 2.78  ? 252 LEU B CB  1 
ATOM   6261  C  CG  . LEU B 1 221 ? 56.529  18.422  -17.446 1.00 4.01  ? 252 LEU B CG  1 
ATOM   6262  C  CD1 . LEU B 1 221 ? 55.637  19.648  -17.713 1.00 2.82  ? 252 LEU B CD1 1 
ATOM   6263  C  CD2 . LEU B 1 221 ? 56.003  17.582  -16.292 1.00 2.35  ? 252 LEU B CD2 1 
ATOM   6264  N  N   . LYS B 1 222 ? 56.168  18.971  -21.580 1.00 4.16  ? 253 LYS B N   1 
ATOM   6265  C  CA  . LYS B 1 222 ? 56.672  19.199  -22.918 1.00 6.82  ? 253 LYS B CA  1 
ATOM   6266  C  C   . LYS B 1 222 ? 58.177  18.904  -22.867 1.00 8.85  ? 253 LYS B C   1 
ATOM   6267  O  O   . LYS B 1 222 ? 58.774  18.956  -21.787 1.00 10.57 ? 253 LYS B O   1 
ATOM   6268  C  CB  . LYS B 1 222 ? 56.394  20.652  -23.287 1.00 9.88  ? 253 LYS B CB  1 
ATOM   6269  C  CG  . LYS B 1 222 ? 56.318  20.924  -24.778 1.00 16.97 ? 253 LYS B CG  1 
ATOM   6270  C  CD  . LYS B 1 222 ? 55.120  21.811  -25.148 1.00 19.69 ? 253 LYS B CD  1 
ATOM   6271  C  CE  . LYS B 1 222 ? 55.192  23.207  -24.534 1.00 22.07 ? 253 LYS B CE  1 
ATOM   6272  N  NZ  . LYS B 1 222 ? 55.142  23.218  -23.029 1.00 21.25 ? 253 LYS B NZ  1 
ATOM   6273  N  N   . TYR B 1 223 ? 58.793  18.569  -24.001 1.00 6.66  ? 254 TYR B N   1 
ATOM   6274  C  CA  . TYR B 1 223 ? 60.233  18.282  -24.041 1.00 7.02  ? 254 TYR B CA  1 
ATOM   6275  C  C   . TYR B 1 223 ? 60.709  18.266  -25.499 1.00 7.67  ? 254 TYR B C   1 
ATOM   6276  O  O   . TYR B 1 223 ? 59.905  18.439  -26.414 1.00 6.77  ? 254 TYR B O   1 
ATOM   6277  C  CB  . TYR B 1 223 ? 60.523  16.916  -23.399 1.00 10.38 ? 254 TYR B CB  1 
ATOM   6278  C  CG  . TYR B 1 223 ? 59.998  15.743  -24.237 1.00 11.94 ? 254 TYR B CG  1 
ATOM   6279  C  CD1 . TYR B 1 223 ? 60.636  15.376  -25.430 1.00 10.03 ? 254 TYR B CD1 1 
ATOM   6280  C  CD2 . TYR B 1 223 ? 58.797  15.085  -23.903 1.00 9.31  ? 254 TYR B CD2 1 
ATOM   6281  C  CE1 . TYR B 1 223 ? 60.097  14.425  -26.270 1.00 11.75 ? 254 TYR B CE1 1 
ATOM   6282  C  CE2 . TYR B 1 223 ? 58.254  14.125  -24.741 1.00 11.71 ? 254 TYR B CE2 1 
ATOM   6283  C  CZ  . TYR B 1 223 ? 58.910  13.812  -25.935 1.00 12.86 ? 254 TYR B CZ  1 
ATOM   6284  O  OH  . TYR B 1 223 ? 58.360  12.976  -26.870 1.00 15.83 ? 254 TYR B OH  1 
ATOM   6285  N  N   . GLN B 1 224 ? 62.001  17.999  -25.712 1.00 9.60  ? 255 GLN B N   1 
ATOM   6286  C  CA  . GLN B 1 224 ? 62.582  17.933  -27.061 1.00 9.18  ? 255 GLN B CA  1 
ATOM   6287  C  C   . GLN B 1 224 ? 63.665  16.903  -27.143 1.00 10.69 ? 255 GLN B C   1 
ATOM   6288  O  O   . GLN B 1 224 ? 64.323  16.606  -26.146 1.00 11.51 ? 255 GLN B O   1 
ATOM   6289  C  CB  . GLN B 1 224 ? 63.195  19.254  -27.478 1.00 10.32 ? 255 GLN B CB  1 
ATOM   6290  C  CG  . GLN B 1 224 ? 64.413  19.703  -26.681 1.00 7.84  ? 255 GLN B CG  1 
ATOM   6291  C  CD  . GLN B 1 224 ? 64.912  21.094  -27.148 1.00 9.39  ? 255 GLN B CD  1 
ATOM   6292  O  OE1 . GLN B 1 224 ? 65.301  21.302  -28.309 1.00 8.62  ? 255 GLN B OE1 1 
ATOM   6293  N  NE2 . GLN B 1 224 ? 64.861  22.046  -26.252 1.00 6.46  ? 255 GLN B NE2 1 
ATOM   6294  N  N   . VAL B 1 225 ? 63.874  16.372  -28.342 1.00 10.17 ? 256 VAL B N   1 
ATOM   6295  C  CA  . VAL B 1 225 ? 64.903  15.359  -28.538 1.00 9.95  ? 256 VAL B CA  1 
ATOM   6296  C  C   . VAL B 1 225 ? 66.093  15.928  -29.289 1.00 11.49 ? 256 VAL B C   1 
ATOM   6297  O  O   . VAL B 1 225 ? 66.032  16.171  -30.508 1.00 10.33 ? 256 VAL B O   1 
ATOM   6298  C  CB  . VAL B 1 225 ? 64.394  14.131  -29.303 1.00 7.97  ? 256 VAL B CB  1 
ATOM   6299  C  CG1 . VAL B 1 225 ? 65.556  13.185  -29.619 1.00 8.29  ? 256 VAL B CG1 1 
ATOM   6300  C  CG2 . VAL B 1 225 ? 63.371  13.418  -28.484 1.00 9.12  ? 256 VAL B CG2 1 
ATOM   6301  N  N   . ILE B 1 226 ? 67.166  16.167  -28.536 1.00 13.50 ? 257 ILE B N   1 
ATOM   6302  C  CA  . ILE B 1 226 ? 68.420  16.690  -29.074 1.00 11.34 ? 257 ILE B CA  1 
ATOM   6303  C  C   . ILE B 1 226 ? 69.292  15.464  -29.229 1.00 9.31  ? 257 ILE B C   1 
ATOM   6304  O  O   . ILE B 1 226 ? 69.358  14.620  -28.319 1.00 7.75  ? 257 ILE B O   1 
ATOM   6305  C  CB  . ILE B 1 226 ? 69.087  17.675  -28.103 1.00 9.35  ? 257 ILE B CB  1 
ATOM   6306  C  CG1 . ILE B 1 226 ? 68.400  19.032  -28.174 1.00 8.75  ? 257 ILE B CG1 1 
ATOM   6307  C  CG2 . ILE B 1 226 ? 70.525  17.826  -28.444 1.00 8.92  ? 257 ILE B CG2 1 
ATOM   6308  C  CD1 . ILE B 1 226 ? 68.876  19.987  -27.102 1.00 12.51 ? 257 ILE B CD1 1 
ATOM   6309  N  N   . GLY B 1 227 ? 69.958  15.361  -30.370 1.00 7.02  ? 258 GLY B N   1 
ATOM   6310  C  CA  . GLY B 1 227 ? 70.779  14.196  -30.590 1.00 12.59 ? 258 GLY B CA  1 
ATOM   6311  C  C   . GLY B 1 227 ? 69.814  13.038  -30.554 1.00 16.92 ? 258 GLY B C   1 
ATOM   6312  O  O   . GLY B 1 227 ? 68.906  12.956  -31.387 1.00 22.50 ? 258 GLY B O   1 
ATOM   6313  N  N   . GLY B 1 228 ? 69.953  12.161  -29.577 1.00 16.66 ? 259 GLY B N   1 
ATOM   6314  C  CA  . GLY B 1 228 ? 69.008  11.076  -29.501 1.00 15.91 ? 259 GLY B CA  1 
ATOM   6315  C  C   . GLY B 1 228 ? 68.433  11.140  -28.123 1.00 14.56 ? 259 GLY B C   1 
ATOM   6316  O  O   . GLY B 1 228 ? 67.689  10.269  -27.742 1.00 18.09 ? 259 GLY B O   1 
ATOM   6317  N  N   . GLU B 1 229 ? 68.761  12.172  -27.370 1.00 13.80 ? 260 GLU B N   1 
ATOM   6318  C  CA  . GLU B 1 229 ? 68.276  12.249  -26.003 1.00 17.40 ? 260 GLU B CA  1 
ATOM   6319  C  C   . GLU B 1 229 ? 67.175  13.280  -25.796 1.00 19.62 ? 260 GLU B C   1 
ATOM   6320  O  O   . GLU B 1 229 ? 67.021  14.216  -26.606 1.00 20.09 ? 260 GLU B O   1 
ATOM   6321  C  CB  . GLU B 1 229 ? 69.440  12.543  -25.049 1.00 17.96 ? 260 GLU B CB  1 
ATOM   6322  C  CG  . GLU B 1 229 ? 70.638  11.628  -25.188 1.00 18.54 ? 260 GLU B CG  1 
ATOM   6323  C  CD  . GLU B 1 229 ? 70.322  10.152  -24.930 1.00 18.60 ? 260 GLU B CD  1 
ATOM   6324  O  OE1 . GLU B 1 229 ? 70.184  9.779   -23.737 1.00 15.67 ? 260 GLU B OE1 1 
ATOM   6325  O  OE2 . GLU B 1 229 ? 70.257  9.371   -25.925 1.00 19.28 ? 260 GLU B OE2 1 
ATOM   6326  N  N   . VAL B 1 230 ? 66.439  13.124  -24.692 1.00 18.45 ? 261 VAL B N   1 
ATOM   6327  C  CA  . VAL B 1 230 ? 65.346  14.033  -24.350 1.00 17.19 ? 261 VAL B CA  1 
ATOM   6328  C  C   . VAL B 1 230 ? 65.901  15.158  -23.481 1.00 15.83 ? 261 VAL B C   1 
ATOM   6329  O  O   . VAL B 1 230 ? 66.695  14.898  -22.582 1.00 14.23 ? 261 VAL B O   1 
ATOM   6330  C  CB  . VAL B 1 230 ? 64.201  13.278  -23.560 1.00 19.80 ? 261 VAL B CB  1 
ATOM   6331  C  CG1 . VAL B 1 230 ? 63.412  14.236  -22.621 1.00 15.08 ? 261 VAL B CG1 1 
ATOM   6332  C  CG2 . VAL B 1 230 ? 63.249  12.597  -24.533 1.00 16.34 ? 261 VAL B CG2 1 
ATOM   6333  N  N   . TYR B 1 231 ? 65.452  16.393  -23.735 1.00 14.95 ? 262 TYR B N   1 
ATOM   6334  C  CA  . TYR B 1 231 ? 65.861  17.586  -22.981 1.00 11.06 ? 262 TYR B CA  1 
ATOM   6335  C  C   . TYR B 1 231 ? 64.669  18.529  -22.804 1.00 10.34 ? 262 TYR B C   1 
ATOM   6336  O  O   . TYR B 1 231 ? 63.682  18.461  -23.548 1.00 10.29 ? 262 TYR B O   1 
ATOM   6337  C  CB  . TYR B 1 231 ? 66.962  18.335  -23.740 1.00 12.44 ? 262 TYR B CB  1 
ATOM   6338  C  CG  . TYR B 1 231 ? 68.282  17.612  -23.784 1.00 13.41 ? 262 TYR B CG  1 
ATOM   6339  C  CD1 . TYR B 1 231 ? 69.096  17.577  -22.641 1.00 12.09 ? 262 TYR B CD1 1 
ATOM   6340  C  CD2 . TYR B 1 231 ? 68.656  16.845  -24.915 1.00 8.12  ? 262 TYR B CD2 1 
ATOM   6341  C  CE1 . TYR B 1 231 ? 70.227  16.784  -22.600 1.00 12.07 ? 262 TYR B CE1 1 
ATOM   6342  C  CE2 . TYR B 1 231 ? 69.784  16.051  -24.891 1.00 9.24  ? 262 TYR B CE2 1 
ATOM   6343  C  CZ  . TYR B 1 231 ? 70.559  16.011  -23.721 1.00 12.47 ? 262 TYR B CZ  1 
ATOM   6344  O  OH  . TYR B 1 231 ? 71.592  15.114  -23.604 1.00 14.28 ? 262 TYR B OH  1 
ATOM   6345  N  N   . PRO B 1 232 ? 64.729  19.403  -21.798 1.00 9.91  ? 263 PRO B N   1 
ATOM   6346  C  CA  . PRO B 1 232 ? 63.656  20.358  -21.553 1.00 11.00 ? 263 PRO B CA  1 
ATOM   6347  C  C   . PRO B 1 232 ? 63.429  21.141  -22.840 1.00 12.22 ? 263 PRO B C   1 
ATOM   6348  O  O   . PRO B 1 232 ? 64.335  21.265  -23.670 1.00 13.90 ? 263 PRO B O   1 
ATOM   6349  C  CB  . PRO B 1 232 ? 64.254  21.265  -20.484 1.00 9.81  ? 263 PRO B CB  1 
ATOM   6350  C  CG  . PRO B 1 232 ? 65.047  20.356  -19.691 1.00 12.14 ? 263 PRO B CG  1 
ATOM   6351  C  CD  . PRO B 1 232 ? 65.757  19.524  -20.759 1.00 13.87 ? 263 PRO B CD  1 
ATOM   6352  N  N   . PRO B 1 233 ? 62.227  21.693  -23.018 1.00 12.11 ? 264 PRO B N   1 
ATOM   6353  C  CA  . PRO B 1 233 ? 61.885  22.463  -24.211 1.00 10.98 ? 264 PRO B CA  1 
ATOM   6354  C  C   . PRO B 1 233 ? 62.428  23.888  -24.155 1.00 10.55 ? 264 PRO B C   1 
ATOM   6355  O  O   . PRO B 1 233 ? 62.796  24.405  -23.073 1.00 6.84  ? 264 PRO B O   1 
ATOM   6356  C  CB  . PRO B 1 233 ? 60.375  22.426  -24.195 1.00 13.85 ? 264 PRO B CB  1 
ATOM   6357  C  CG  . PRO B 1 233 ? 60.080  22.532  -22.700 1.00 13.88 ? 264 PRO B CG  1 
ATOM   6358  C  CD  . PRO B 1 233 ? 61.094  21.624  -22.076 1.00 14.14 ? 264 PRO B CD  1 
ATOM   6359  N  N   . THR B 1 234 ? 62.421  24.529  -25.322 1.00 10.05 ? 265 THR B N   1 
ATOM   6360  C  CA  . THR B 1 234 ? 62.967  25.866  -25.458 1.00 12.42 ? 265 THR B CA  1 
ATOM   6361  C  C   . THR B 1 234 ? 62.113  26.939  -24.857 1.00 8.09  ? 265 THR B C   1 
ATOM   6362  O  O   . THR B 1 234 ? 60.906  26.824  -24.879 1.00 6.96  ? 265 THR B O   1 
ATOM   6363  C  CB  . THR B 1 234 ? 63.240  26.239  -26.951 1.00 15.66 ? 265 THR B CB  1 
ATOM   6364  O  OG1 . THR B 1 234 ? 62.049  26.079  -27.722 1.00 20.74 ? 265 THR B OG1 1 
ATOM   6365  C  CG2 . THR B 1 234 ? 64.301  25.346  -27.548 1.00 22.26 ? 265 THR B CG2 1 
ATOM   6366  N  N   . VAL B 1 235 ? 62.756  27.960  -24.285 1.00 7.22  ? 266 VAL B N   1 
ATOM   6367  C  CA  . VAL B 1 235 ? 62.055  29.113  -23.738 1.00 4.35  ? 266 VAL B CA  1 
ATOM   6368  C  C   . VAL B 1 235 ? 61.360  29.733  -24.943 1.00 5.03  ? 266 VAL B C   1 
ATOM   6369  O  O   . VAL B 1 235 ? 60.251  30.250  -24.843 1.00 3.35  ? 266 VAL B O   1 
ATOM   6370  C  CB  . VAL B 1 235 ? 63.022  30.137  -23.153 1.00 3.33  ? 266 VAL B CB  1 
ATOM   6371  C  CG1 . VAL B 1 235 ? 62.426  31.513  -23.199 1.00 2.00  ? 266 VAL B CG1 1 
ATOM   6372  C  CG2 . VAL B 1 235 ? 63.327  29.784  -21.716 1.00 6.28  ? 266 VAL B CG2 1 
ATOM   6373  N  N   . LYS B 1 236 ? 62.009  29.616  -26.096 1.00 4.60  ? 267 LYS B N   1 
ATOM   6374  C  CA  . LYS B 1 236 ? 61.466  30.135  -27.343 1.00 7.83  ? 267 LYS B CA  1 
ATOM   6375  C  C   . LYS B 1 236 ? 60.074  29.552  -27.632 1.00 7.76  ? 267 LYS B C   1 
ATOM   6376  O  O   . LYS B 1 236 ? 59.110  30.284  -27.835 1.00 8.59  ? 267 LYS B O   1 
ATOM   6377  C  CB  . LYS B 1 236 ? 62.410  29.821  -28.505 1.00 5.15  ? 267 LYS B CB  1 
ATOM   6378  C  CG  . LYS B 1 236 ? 62.177  30.674  -29.727 1.00 2.04  ? 267 LYS B CG  1 
ATOM   6379  C  CD  . LYS B 1 236 ? 62.459  29.852  -30.943 1.00 3.85  ? 267 LYS B CD  1 
ATOM   6380  C  CE  . LYS B 1 236 ? 62.294  30.634  -32.222 1.00 5.86  ? 267 LYS B CE  1 
ATOM   6381  N  NZ  . LYS B 1 236 ? 62.542  29.747  -33.381 1.00 2.17  ? 267 LYS B NZ  1 
ATOM   6382  N  N   . ASP B 1 237 ? 59.985  28.231  -27.631 1.00 10.02 ? 268 ASP B N   1 
ATOM   6383  C  CA  . ASP B 1 237 ? 58.734  27.510  -27.878 1.00 10.08 ? 268 ASP B CA  1 
ATOM   6384  C  C   . ASP B 1 237 ? 57.699  27.653  -26.751 1.00 6.32  ? 268 ASP B C   1 
ATOM   6385  O  O   . ASP B 1 237 ? 56.649  28.235  -26.968 1.00 8.49  ? 268 ASP B O   1 
ATOM   6386  C  CB  . ASP B 1 237 ? 59.048  26.020  -28.135 1.00 17.01 ? 268 ASP B CB  1 
ATOM   6387  C  CG  . ASP B 1 237 ? 57.805  25.150  -28.268 1.00 21.97 ? 268 ASP B CG  1 
ATOM   6388  O  OD1 . ASP B 1 237 ? 57.053  25.327  -29.276 1.00 25.98 ? 268 ASP B OD1 1 
ATOM   6389  O  OD2 . ASP B 1 237 ? 57.610  24.262  -27.380 1.00 21.65 ? 268 ASP B OD2 1 
ATOM   6390  N  N   . THR B 1 238 ? 57.994  27.162  -25.551 1.00 2.00  ? 269 THR B N   1 
ATOM   6391  C  CA  . THR B 1 238 ? 57.025  27.234  -24.468 1.00 2.19  ? 269 THR B CA  1 
ATOM   6392  C  C   . THR B 1 238 ? 56.726  28.635  -24.005 1.00 4.93  ? 269 THR B C   1 
ATOM   6393  O  O   . THR B 1 238 ? 55.727  28.870  -23.320 1.00 8.39  ? 269 THR B O   1 
ATOM   6394  C  CB  . THR B 1 238 ? 57.453  26.475  -23.221 1.00 2.00  ? 269 THR B CB  1 
ATOM   6395  O  OG1 . THR B 1 238 ? 58.503  27.191  -22.578 1.00 2.02  ? 269 THR B OG1 1 
ATOM   6396  C  CG2 . THR B 1 238 ? 57.905  25.092  -23.556 1.00 2.11  ? 269 THR B CG2 1 
ATOM   6397  N  N   . GLN B 1 239 ? 57.651  29.541  -24.253 1.00 5.28  ? 270 GLN B N   1 
ATOM   6398  C  CA  . GLN B 1 239 ? 57.451  30.917  -23.854 1.00 6.50  ? 270 GLN B CA  1 
ATOM   6399  C  C   . GLN B 1 239 ? 57.562  31.157  -22.361 1.00 4.59  ? 270 GLN B C   1 
ATOM   6400  O  O   . GLN B 1 239 ? 57.270  32.260  -21.896 1.00 3.27  ? 270 GLN B O   1 
ATOM   6401  C  CB  . GLN B 1 239 ? 56.093  31.408  -24.314 1.00 7.88  ? 270 GLN B CB  1 
ATOM   6402  C  CG  . GLN B 1 239 ? 56.141  32.750  -24.933 1.00 16.82 ? 270 GLN B CG  1 
ATOM   6403  C  CD  . GLN B 1 239 ? 56.355  32.628  -26.409 1.00 24.61 ? 270 GLN B CD  1 
ATOM   6404  O  OE1 . GLN B 1 239 ? 55.392  32.569  -27.186 1.00 31.58 ? 270 GLN B OE1 1 
ATOM   6405  N  NE2 . GLN B 1 239 ? 57.619  32.544  -26.819 1.00 28.92 ? 270 GLN B NE2 1 
ATOM   6406  N  N   . VAL B 1 240 ? 57.961  30.149  -21.600 1.00 2.01  ? 271 VAL B N   1 
ATOM   6407  C  CA  . VAL B 1 240 ? 58.095  30.388  -20.175 1.00 6.60  ? 271 VAL B CA  1 
ATOM   6408  C  C   . VAL B 1 240 ? 59.354  31.234  -19.894 1.00 11.27 ? 271 VAL B C   1 
ATOM   6409  O  O   . VAL B 1 240 ? 60.395  31.075  -20.541 1.00 12.87 ? 271 VAL B O   1 
ATOM   6410  C  CB  . VAL B 1 240 ? 58.054  29.079  -19.334 1.00 2.76  ? 271 VAL B CB  1 
ATOM   6411  C  CG1 . VAL B 1 240 ? 57.638  27.945  -20.184 1.00 2.00  ? 271 VAL B CG1 1 
ATOM   6412  C  CG2 . VAL B 1 240 ? 59.341  28.813  -18.605 1.00 2.00  ? 271 VAL B CG2 1 
ATOM   6413  N  N   . GLU B 1 241 ? 59.226  32.210  -19.006 1.00 13.23 ? 272 GLU B N   1 
ATOM   6414  C  CA  . GLU B 1 241 ? 60.356  33.046  -18.680 1.00 10.99 ? 272 GLU B CA  1 
ATOM   6415  C  C   . GLU B 1 241 ? 61.324  32.275  -17.816 1.00 8.42  ? 272 GLU B C   1 
ATOM   6416  O  O   . GLU B 1 241 ? 60.923  31.642  -16.840 1.00 5.46  ? 272 GLU B O   1 
ATOM   6417  C  CB  . GLU B 1 241 ? 59.902  34.317  -17.969 1.00 12.17 ? 272 GLU B CB  1 
ATOM   6418  C  CG  . GLU B 1 241 ? 59.182  35.259  -18.888 1.00 22.73 ? 272 GLU B CG  1 
ATOM   6419  C  CD  . GLU B 1 241 ? 58.874  36.595  -18.243 1.00 31.56 ? 272 GLU B CD  1 
ATOM   6420  O  OE1 . GLU B 1 241 ? 59.049  36.734  -17.007 1.00 35.85 ? 272 GLU B OE1 1 
ATOM   6421  O  OE2 . GLU B 1 241 ? 58.448  37.512  -18.981 1.00 35.41 ? 272 GLU B OE2 1 
ATOM   6422  N  N   . MET B 1 242 ? 62.599  32.344  -18.198 1.00 9.21  ? 273 MET B N   1 
ATOM   6423  C  CA  . MET B 1 242 ? 63.690  31.714  -17.484 1.00 6.99  ? 273 MET B CA  1 
ATOM   6424  C  C   . MET B 1 242 ? 64.784  32.772  -17.371 1.00 6.92  ? 273 MET B C   1 
ATOM   6425  O  O   . MET B 1 242 ? 64.773  33.745  -18.119 1.00 5.99  ? 273 MET B O   1 
ATOM   6426  C  CB  . MET B 1 242 ? 64.178  30.509  -18.292 1.00 6.11  ? 273 MET B CB  1 
ATOM   6427  C  CG  . MET B 1 242 ? 63.333  29.267  -18.107 1.00 2.16  ? 273 MET B CG  1 
ATOM   6428  S  SD  . MET B 1 242 ? 63.347  28.812  -16.314 1.00 6.06  ? 273 MET B SD  1 
ATOM   6429  C  CE  . MET B 1 242 ? 64.867  27.929  -16.297 1.00 8.20  ? 273 MET B CE  1 
ATOM   6430  N  N   . ILE B 1 243 ? 65.689  32.616  -16.406 1.00 11.23 ? 274 ILE B N   1 
ATOM   6431  C  CA  . ILE B 1 243 ? 66.830  33.542  -16.230 1.00 11.76 ? 274 ILE B CA  1 
ATOM   6432  C  C   . ILE B 1 243 ? 68.080  33.042  -17.002 1.00 10.76 ? 274 ILE B C   1 
ATOM   6433  O  O   . ILE B 1 243 ? 68.663  32.005  -16.678 1.00 11.85 ? 274 ILE B O   1 
ATOM   6434  C  CB  . ILE B 1 243 ? 67.195  33.699  -14.754 1.00 11.33 ? 274 ILE B CB  1 
ATOM   6435  C  CG1 . ILE B 1 243 ? 65.987  34.187  -13.975 1.00 13.49 ? 274 ILE B CG1 1 
ATOM   6436  C  CG2 . ILE B 1 243 ? 68.312  34.658  -14.601 1.00 12.17 ? 274 ILE B CG2 1 
ATOM   6437  C  CD1 . ILE B 1 243 ? 66.241  34.263  -12.472 1.00 18.26 ? 274 ILE B CD1 1 
ATOM   6438  N  N   . TYR B 1 244 ? 68.462  33.783  -18.029 1.00 7.38  ? 275 TYR B N   1 
ATOM   6439  C  CA  . TYR B 1 244 ? 69.599  33.443  -18.862 1.00 10.07 ? 275 TYR B CA  1 
ATOM   6440  C  C   . TYR B 1 244 ? 70.371  34.684  -19.362 1.00 15.40 ? 275 TYR B C   1 
ATOM   6441  O  O   . TYR B 1 244 ? 69.769  35.653  -19.865 1.00 17.28 ? 275 TYR B O   1 
ATOM   6442  C  CB  . TYR B 1 244 ? 69.107  32.680  -20.069 1.00 7.47  ? 275 TYR B CB  1 
ATOM   6443  C  CG  . TYR B 1 244 ? 68.822  31.227  -19.817 1.00 8.78  ? 275 TYR B CG  1 
ATOM   6444  C  CD1 . TYR B 1 244 ? 69.828  30.356  -19.369 1.00 9.13  ? 275 TYR B CD1 1 
ATOM   6445  C  CD2 . TYR B 1 244 ? 67.586  30.689  -20.142 1.00 8.93  ? 275 TYR B CD2 1 
ATOM   6446  C  CE1 . TYR B 1 244 ? 69.603  28.984  -19.272 1.00 9.08  ? 275 TYR B CE1 1 
ATOM   6447  C  CE2 . TYR B 1 244 ? 67.349  29.320  -20.045 1.00 9.65  ? 275 TYR B CE2 1 
ATOM   6448  C  CZ  . TYR B 1 244 ? 68.359  28.469  -19.614 1.00 10.20 ? 275 TYR B CZ  1 
ATOM   6449  O  OH  . TYR B 1 244 ? 68.118  27.108  -19.533 1.00 11.44 ? 275 TYR B OH  1 
ATOM   6450  N  N   . PRO B 1 245 ? 71.720  34.655  -19.271 1.00 15.73 ? 276 PRO B N   1 
ATOM   6451  C  CA  . PRO B 1 245 ? 72.575  35.769  -19.708 1.00 12.05 ? 276 PRO B CA  1 
ATOM   6452  C  C   . PRO B 1 245 ? 72.352  36.025  -21.187 1.00 11.72 ? 276 PRO B C   1 
ATOM   6453  O  O   . PRO B 1 245 ? 72.372  35.100  -21.986 1.00 9.33  ? 276 PRO B O   1 
ATOM   6454  C  CB  . PRO B 1 245 ? 73.970  35.229  -19.461 1.00 15.19 ? 276 PRO B CB  1 
ATOM   6455  C  CG  . PRO B 1 245 ? 73.762  34.219  -18.362 1.00 16.98 ? 276 PRO B CG  1 
ATOM   6456  C  CD  . PRO B 1 245 ? 72.534  33.525  -18.788 1.00 15.12 ? 276 PRO B CD  1 
ATOM   6457  N  N   . PRO B 1 246 ? 72.255  37.296  -21.581 1.00 12.81 ? 277 PRO B N   1 
ATOM   6458  C  CA  . PRO B 1 246 ? 72.025  37.690  -22.977 1.00 13.32 ? 277 PRO B CA  1 
ATOM   6459  C  C   . PRO B 1 246 ? 72.892  37.009  -24.025 1.00 15.31 ? 277 PRO B C   1 
ATOM   6460  O  O   . PRO B 1 246 ? 72.447  36.821  -25.164 1.00 16.48 ? 277 PRO B O   1 
ATOM   6461  C  CB  . PRO B 1 246 ? 72.207  39.209  -22.952 1.00 12.03 ? 277 PRO B CB  1 
ATOM   6462  C  CG  . PRO B 1 246 ? 73.060  39.449  -21.720 1.00 13.64 ? 277 PRO B CG  1 
ATOM   6463  C  CD  . PRO B 1 246 ? 72.506  38.474  -20.733 1.00 13.39 ? 277 PRO B CD  1 
ATOM   6464  N  N   . HIS B 1 247 ? 74.110  36.613  -23.648 1.00 17.20 ? 278 HIS B N   1 
ATOM   6465  C  CA  . HIS B 1 247 ? 75.010  35.939  -24.598 1.00 17.62 ? 278 HIS B CA  1 
ATOM   6466  C  C   . HIS B 1 247 ? 74.573  34.510  -24.979 1.00 19.84 ? 278 HIS B C   1 
ATOM   6467  O  O   . HIS B 1 247 ? 75.032  33.971  -25.991 1.00 21.57 ? 278 HIS B O   1 
ATOM   6468  C  CB  . HIS B 1 247 ? 76.460  35.949  -24.093 1.00 12.16 ? 278 HIS B CB  1 
ATOM   6469  C  CG  . HIS B 1 247 ? 76.643  35.360  -22.730 1.00 9.32  ? 278 HIS B CG  1 
ATOM   6470  N  ND1 . HIS B 1 247 ? 76.780  36.130  -21.593 1.00 10.53 ? 278 HIS B ND1 1 
ATOM   6471  C  CD2 . HIS B 1 247 ? 76.756  34.075  -22.323 1.00 9.28  ? 278 HIS B CD2 1 
ATOM   6472  C  CE1 . HIS B 1 247 ? 76.974  35.347  -20.546 1.00 8.48  ? 278 HIS B CE1 1 
ATOM   6473  N  NE2 . HIS B 1 247 ? 76.962  34.096  -20.963 1.00 12.15 ? 278 HIS B NE2 1 
ATOM   6474  N  N   . ILE B 1 248 ? 73.710  33.897  -24.156 1.00 19.61 ? 279 ILE B N   1 
ATOM   6475  C  CA  . ILE B 1 248 ? 73.206  32.545  -24.411 1.00 15.69 ? 279 ILE B CA  1 
ATOM   6476  C  C   . ILE B 1 248 ? 72.502  32.658  -25.744 1.00 17.12 ? 279 ILE B C   1 
ATOM   6477  O  O   . ILE B 1 248 ? 71.670  33.536  -25.935 1.00 16.94 ? 279 ILE B O   1 
ATOM   6478  C  CB  . ILE B 1 248 ? 72.201  32.120  -23.383 1.00 11.77 ? 279 ILE B CB  1 
ATOM   6479  C  CG1 . ILE B 1 248 ? 72.811  32.228  -21.987 1.00 7.03  ? 279 ILE B CG1 1 
ATOM   6480  C  CG2 . ILE B 1 248 ? 71.730  30.728  -23.701 1.00 11.60 ? 279 ILE B CG2 1 
ATOM   6481  C  CD1 . ILE B 1 248 ? 73.801  31.197  -21.675 1.00 2.25  ? 279 ILE B CD1 1 
ATOM   6482  N  N   . PRO B 1 249 ? 72.782  31.729  -26.661 1.00 19.26 ? 280 PRO B N   1 
ATOM   6483  C  CA  . PRO B 1 249 ? 72.186  31.752  -27.997 1.00 19.61 ? 280 PRO B CA  1 
ATOM   6484  C  C   . PRO B 1 249 ? 70.739  31.392  -28.118 1.00 18.60 ? 280 PRO B C   1 
ATOM   6485  O  O   . PRO B 1 249 ? 70.273  31.167  -29.245 1.00 17.87 ? 280 PRO B O   1 
ATOM   6486  C  CB  . PRO B 1 249 ? 73.059  30.761  -28.773 1.00 19.17 ? 280 PRO B CB  1 
ATOM   6487  C  CG  . PRO B 1 249 ? 73.307  29.721  -27.743 1.00 19.92 ? 280 PRO B CG  1 
ATOM   6488  C  CD  . PRO B 1 249 ? 73.639  30.541  -26.494 1.00 20.66 ? 280 PRO B CD  1 
ATOM   6489  N  N   . GLU B 1 250 ? 70.006  31.398  -27.005 1.00 18.93 ? 281 GLU B N   1 
ATOM   6490  C  CA  . GLU B 1 250 ? 68.595  30.985  -27.078 1.00 22.60 ? 281 GLU B CA  1 
ATOM   6491  C  C   . GLU B 1 250 ? 68.854  29.548  -27.557 1.00 19.79 ? 281 GLU B C   1 
ATOM   6492  O  O   . GLU B 1 250 ? 69.932  29.039  -27.267 1.00 22.53 ? 281 GLU B O   1 
ATOM   6493  C  CB  . GLU B 1 250 ? 67.869  31.876  -28.103 1.00 25.57 ? 281 GLU B CB  1 
ATOM   6494  C  CG  . GLU B 1 250 ? 66.427  31.572  -28.431 1.00 29.65 ? 281 GLU B CG  1 
ATOM   6495  C  CD  . GLU B 1 250 ? 65.986  32.378  -29.662 1.00 32.04 ? 281 GLU B CD  1 
ATOM   6496  O  OE1 . GLU B 1 250 ? 66.022  33.640  -29.579 1.00 33.31 ? 281 GLU B OE1 1 
ATOM   6497  O  OE2 . GLU B 1 250 ? 65.656  31.751  -30.715 1.00 33.79 ? 281 GLU B OE2 1 
ATOM   6498  N  N   . ASN B 1 251 ? 67.918  28.842  -28.171 1.00 15.60 ? 282 ASN B N   1 
ATOM   6499  C  CA  . ASN B 1 251 ? 68.243  27.484  -28.657 1.00 13.64 ? 282 ASN B CA  1 
ATOM   6500  C  C   . ASN B 1 251 ? 68.888  26.526  -27.624 1.00 10.05 ? 282 ASN B C   1 
ATOM   6501  O  O   . ASN B 1 251 ? 69.079  25.350  -27.892 1.00 8.92  ? 282 ASN B O   1 
ATOM   6502  C  CB  . ASN B 1 251 ? 69.171  27.607  -29.872 1.00 18.67 ? 282 ASN B CB  1 
ATOM   6503  C  CG  . ASN B 1 251 ? 68.937  28.914  -30.655 1.00 24.12 ? 282 ASN B CG  1 
ATOM   6504  O  OD1 . ASN B 1 251 ? 68.000  29.651  -30.332 1.00 26.23 ? 282 ASN B OD1 1 
ATOM   6505  N  ND2 . ASN B 1 251 ? 69.776  29.204  -31.684 1.00 23.78 ? 282 ASN B ND2 1 
ATOM   6506  N  N   . LEU B 1 252 ? 69.163  27.036  -26.435 1.00 6.83  ? 283 LEU B N   1 
ATOM   6507  C  CA  . LEU B 1 252 ? 69.785  26.292  -25.371 1.00 10.82 ? 283 LEU B CA  1 
ATOM   6508  C  C   . LEU B 1 252 ? 69.248  26.862  -24.090 1.00 11.45 ? 283 LEU B C   1 
ATOM   6509  O  O   . LEU B 1 252 ? 69.736  26.524  -23.002 1.00 10.69 ? 283 LEU B O   1 
ATOM   6510  C  CB  . LEU B 1 252 ? 71.295  26.484  -25.384 1.00 17.42 ? 283 LEU B CB  1 
ATOM   6511  C  CG  . LEU B 1 252 ? 72.090  26.075  -26.637 1.00 23.08 ? 283 LEU B CG  1 
ATOM   6512  C  CD1 . LEU B 1 252 ? 73.460  26.729  -26.598 1.00 23.80 ? 283 LEU B CD1 1 
ATOM   6513  C  CD2 . LEU B 1 252 ? 72.225  24.562  -26.755 1.00 23.96 ? 283 LEU B CD2 1 
ATOM   6514  N  N   . GLN B 1 253 ? 68.331  27.821  -24.231 1.00 14.08 ? 284 GLN B N   1 
ATOM   6515  C  CA  . GLN B 1 253 ? 67.636  28.420  -23.080 1.00 13.91 ? 284 GLN B CA  1 
ATOM   6516  C  C   . GLN B 1 253 ? 66.543  27.384  -22.638 1.00 11.57 ? 284 GLN B C   1 
ATOM   6517  O  O   . GLN B 1 253 ? 65.383  27.436  -23.060 1.00 11.09 ? 284 GLN B O   1 
ATOM   6518  C  CB  . GLN B 1 253 ? 66.973  29.736  -23.509 1.00 13.66 ? 284 GLN B CB  1 
ATOM   6519  C  CG  . GLN B 1 253 ? 67.924  30.864  -23.834 1.00 12.86 ? 284 GLN B CG  1 
ATOM   6520  C  CD  . GLN B 1 253 ? 67.232  32.226  -23.836 1.00 11.54 ? 284 GLN B CD  1 
ATOM   6521  O  OE1 . GLN B 1 253 ? 66.797  32.712  -22.786 1.00 9.82  ? 284 GLN B OE1 1 
ATOM   6522  N  NE2 . GLN B 1 253 ? 67.136  32.850  -25.011 1.00 2.00  ? 284 GLN B NE2 1 
ATOM   6523  N  N   . PHE B 1 254 ? 66.949  26.396  -21.868 1.00 6.37  ? 285 PHE B N   1 
ATOM   6524  C  CA  . PHE B 1 254 ? 66.044  25.364  -21.438 1.00 7.00  ? 285 PHE B CA  1 
ATOM   6525  C  C   . PHE B 1 254 ? 64.932  25.888  -20.515 1.00 9.82  ? 285 PHE B C   1 
ATOM   6526  O  O   . PHE B 1 254 ? 65.216  26.687  -19.612 1.00 13.66 ? 285 PHE B O   1 
ATOM   6527  C  CB  . PHE B 1 254 ? 66.891  24.271  -20.780 1.00 6.65  ? 285 PHE B CB  1 
ATOM   6528  C  CG  . PHE B 1 254 ? 67.714  23.482  -21.764 1.00 5.53  ? 285 PHE B CG  1 
ATOM   6529  C  CD1 . PHE B 1 254 ? 67.792  23.876  -23.106 1.00 4.01  ? 285 PHE B CD1 1 
ATOM   6530  C  CD2 . PHE B 1 254 ? 68.359  22.317  -21.375 1.00 6.28  ? 285 PHE B CD2 1 
ATOM   6531  C  CE1 . PHE B 1 254 ? 68.508  23.110  -24.061 1.00 4.02  ? 285 PHE B CE1 1 
ATOM   6532  C  CE2 . PHE B 1 254 ? 69.085  21.532  -22.333 1.00 8.41  ? 285 PHE B CE2 1 
ATOM   6533  C  CZ  . PHE B 1 254 ? 69.156  21.937  -23.680 1.00 3.73  ? 285 PHE B CZ  1 
ATOM   6534  N  N   . ALA B 1 255 ? 63.682  25.444  -20.732 1.00 7.50  ? 286 ALA B N   1 
ATOM   6535  C  CA  . ALA B 1 255 ? 62.523  25.882  -19.936 1.00 4.34  ? 286 ALA B CA  1 
ATOM   6536  C  C   . ALA B 1 255 ? 62.400  25.377  -18.478 1.00 3.18  ? 286 ALA B C   1 
ATOM   6537  O  O   . ALA B 1 255 ? 62.304  26.164  -17.553 1.00 5.63  ? 286 ALA B O   1 
ATOM   6538  C  CB  . ALA B 1 255 ? 61.301  25.596  -20.687 1.00 3.04  ? 286 ALA B CB  1 
ATOM   6539  N  N   . VAL B 1 256 ? 62.294  24.079  -18.270 1.00 3.20  ? 287 VAL B N   1 
ATOM   6540  C  CA  . VAL B 1 256 ? 62.224  23.505  -16.906 1.00 8.94  ? 287 VAL B CA  1 
ATOM   6541  C  C   . VAL B 1 256 ? 61.169  23.852  -15.821 1.00 8.99  ? 287 VAL B C   1 
ATOM   6542  O  O   . VAL B 1 256 ? 60.549  22.924  -15.260 1.00 13.14 ? 287 VAL B O   1 
ATOM   6543  C  CB  . VAL B 1 256 ? 63.619  23.486  -16.154 1.00 10.37 ? 287 VAL B CB  1 
ATOM   6544  C  CG1 . VAL B 1 256 ? 64.736  22.960  -17.062 1.00 13.37 ? 287 VAL B CG1 1 
ATOM   6545  C  CG2 . VAL B 1 256 ? 63.942  24.837  -15.523 1.00 7.32  ? 287 VAL B CG2 1 
ATOM   6546  N  N   . GLY B 1 257 ? 61.034  25.107  -15.411 1.00 2.09  ? 288 GLY B N   1 
ATOM   6547  C  CA  . GLY B 1 257 ? 60.033  25.332  -14.394 1.00 2.24  ? 288 GLY B CA  1 
ATOM   6548  C  C   . GLY B 1 257 ? 60.468  26.033  -13.127 1.00 5.59  ? 288 GLY B C   1 
ATOM   6549  O  O   . GLY B 1 257 ? 59.682  26.207  -12.193 1.00 4.75  ? 288 GLY B O   1 
ATOM   6550  N  N   . GLN B 1 258 ? 61.716  26.474  -13.102 1.00 7.89  ? 289 GLN B N   1 
ATOM   6551  C  CA  . GLN B 1 258 ? 62.259  27.212  -11.956 1.00 5.07  ? 289 GLN B CA  1 
ATOM   6552  C  C   . GLN B 1 258 ? 63.247  28.121  -12.665 1.00 7.54  ? 289 GLN B C   1 
ATOM   6553  O  O   . GLN B 1 258 ? 64.329  27.693  -13.030 1.00 10.31 ? 289 GLN B O   1 
ATOM   6554  C  CB  . GLN B 1 258 ? 62.986  26.272  -11.007 1.00 2.00  ? 289 GLN B CB  1 
ATOM   6555  C  CG  . GLN B 1 258 ? 62.888  26.591  -9.550  1.00 2.11  ? 289 GLN B CG  1 
ATOM   6556  C  CD  . GLN B 1 258 ? 63.508  27.889  -9.179  1.00 2.00  ? 289 GLN B CD  1 
ATOM   6557  O  OE1 . GLN B 1 258 ? 63.623  28.788  -10.007 1.00 2.00  ? 289 GLN B OE1 1 
ATOM   6558  N  NE2 . GLN B 1 258 ? 63.898  28.015  -7.913  1.00 2.00  ? 289 GLN B NE2 1 
ATOM   6559  N  N   . GLU B 1 259 ? 62.832  29.348  -12.938 1.00 11.54 ? 290 GLU B N   1 
ATOM   6560  C  CA  . GLU B 1 259 ? 63.639  30.332  -13.662 1.00 14.00 ? 290 GLU B CA  1 
ATOM   6561  C  C   . GLU B 1 259 ? 65.172  30.325  -13.504 1.00 13.38 ? 290 GLU B C   1 
ATOM   6562  O  O   . GLU B 1 259 ? 65.920  30.428  -14.498 1.00 13.05 ? 290 GLU B O   1 
ATOM   6563  C  CB  . GLU B 1 259 ? 63.081  31.722  -13.387 1.00 19.10 ? 290 GLU B CB  1 
ATOM   6564  C  CG  . GLU B 1 259 ? 62.750  31.988  -11.924 1.00 29.45 ? 290 GLU B CG  1 
ATOM   6565  C  CD  . GLU B 1 259 ? 61.966  33.280  -11.762 1.00 38.70 ? 290 GLU B CD  1 
ATOM   6566  O  OE1 . GLU B 1 259 ? 60.748  33.255  -12.087 1.00 43.17 ? 290 GLU B OE1 1 
ATOM   6567  O  OE2 . GLU B 1 259 ? 62.562  34.317  -11.345 1.00 39.93 ? 290 GLU B OE2 1 
ATOM   6568  N  N   . VAL B 1 260 ? 65.642  30.137  -12.278 1.00 9.54  ? 291 VAL B N   1 
ATOM   6569  C  CA  . VAL B 1 260 ? 67.065  30.141  -12.033 1.00 7.49  ? 291 VAL B CA  1 
ATOM   6570  C  C   . VAL B 1 260 ? 67.869  28.887  -12.446 1.00 9.47  ? 291 VAL B C   1 
ATOM   6571  O  O   . VAL B 1 260 ? 69.086  28.973  -12.684 1.00 11.13 ? 291 VAL B O   1 
ATOM   6572  C  CB  . VAL B 1 260 ? 67.340  30.464  -10.577 1.00 6.46  ? 291 VAL B CB  1 
ATOM   6573  C  CG1 . VAL B 1 260 ? 67.174  29.220  -9.714  1.00 5.44  ? 291 VAL B CG1 1 
ATOM   6574  C  CG2 . VAL B 1 260 ? 68.740  31.083  -10.452 1.00 9.08  ? 291 VAL B CG2 1 
ATOM   6575  N  N   . PHE B 1 261 ? 67.205  27.739  -12.579 1.00 8.51  ? 292 PHE B N   1 
ATOM   6576  C  CA  . PHE B 1 261 ? 67.878  26.496  -12.940 1.00 7.05  ? 292 PHE B CA  1 
ATOM   6577  C  C   . PHE B 1 261 ? 68.634  26.475  -14.243 1.00 9.06  ? 292 PHE B C   1 
ATOM   6578  O  O   . PHE B 1 261 ? 69.118  25.420  -14.640 1.00 11.96 ? 292 PHE B O   1 
ATOM   6579  C  CB  . PHE B 1 261 ? 66.917  25.327  -12.882 1.00 2.05  ? 292 PHE B CB  1 
ATOM   6580  C  CG  . PHE B 1 261 ? 66.585  24.913  -11.494 1.00 2.00  ? 292 PHE B CG  1 
ATOM   6581  C  CD1 . PHE B 1 261 ? 66.860  25.748  -10.420 1.00 2.00  ? 292 PHE B CD1 1 
ATOM   6582  C  CD2 . PHE B 1 261 ? 66.005  23.688  -11.253 1.00 2.00  ? 292 PHE B CD2 1 
ATOM   6583  C  CE1 . PHE B 1 261 ? 66.560  25.372  -9.124  1.00 2.00  ? 292 PHE B CE1 1 
ATOM   6584  C  CE2 . PHE B 1 261 ? 65.708  23.310  -9.968  1.00 3.46  ? 292 PHE B CE2 1 
ATOM   6585  C  CZ  . PHE B 1 261 ? 65.987  24.161  -8.893  1.00 2.00  ? 292 PHE B CZ  1 
ATOM   6586  N  N   . GLY B 1 262 ? 68.744  27.620  -14.906 1.00 10.58 ? 293 GLY B N   1 
ATOM   6587  C  CA  . GLY B 1 262 ? 69.486  27.683  -16.150 1.00 14.95 ? 293 GLY B CA  1 
ATOM   6588  C  C   . GLY B 1 262 ? 70.883  28.279  -15.959 1.00 18.46 ? 293 GLY B C   1 
ATOM   6589  O  O   . GLY B 1 262 ? 71.552  28.678  -16.937 1.00 20.99 ? 293 GLY B O   1 
ATOM   6590  N  N   . LEU B 1 263 ? 71.367  28.309  -14.718 1.00 16.27 ? 294 LEU B N   1 
ATOM   6591  C  CA  . LEU B 1 263 ? 72.675  28.898  -14.461 1.00 12.94 ? 294 LEU B CA  1 
ATOM   6592  C  C   . LEU B 1 263 ? 73.731  27.966  -13.882 1.00 10.26 ? 294 LEU B C   1 
ATOM   6593  O  O   . LEU B 1 263 ? 74.718  28.432  -13.323 1.00 10.68 ? 294 LEU B O   1 
ATOM   6594  C  CB  . LEU B 1 263 ? 72.494  30.126  -13.565 1.00 12.20 ? 294 LEU B CB  1 
ATOM   6595  C  CG  . LEU B 1 263 ? 71.513  31.114  -14.176 1.00 9.40  ? 294 LEU B CG  1 
ATOM   6596  C  CD1 . LEU B 1 263 ? 71.155  32.175  -13.153 1.00 10.17 ? 294 LEU B CD1 1 
ATOM   6597  C  CD2 . LEU B 1 263 ? 72.099  31.688  -15.474 1.00 7.68  ? 294 LEU B CD2 1 
ATOM   6598  N  N   . VAL B 1 264 ? 73.563  26.663  -14.080 1.00 7.90  ? 295 VAL B N   1 
ATOM   6599  C  CA  . VAL B 1 264 ? 74.500  25.652  -13.549 1.00 6.79  ? 295 VAL B CA  1 
ATOM   6600  C  C   . VAL B 1 264 ? 74.064  24.324  -14.096 1.00 4.02  ? 295 VAL B C   1 
ATOM   6601  O  O   . VAL B 1 264 ? 73.023  23.824  -13.696 1.00 6.40  ? 295 VAL B O   1 
ATOM   6602  C  CB  . VAL B 1 264 ? 74.454  25.556  -11.935 1.00 8.29  ? 295 VAL B CB  1 
ATOM   6603  C  CG1 . VAL B 1 264 ? 74.747  24.136  -11.415 1.00 2.66  ? 295 VAL B CG1 1 
ATOM   6604  C  CG2 . VAL B 1 264 ? 75.487  26.486  -11.316 1.00 12.23 ? 295 VAL B CG2 1 
ATOM   6605  N  N   . PRO B 1 265 ? 74.828  23.736  -15.016 1.00 2.00  ? 296 PRO B N   1 
ATOM   6606  C  CA  . PRO B 1 265 ? 74.456  22.436  -15.579 1.00 2.00  ? 296 PRO B CA  1 
ATOM   6607  C  C   . PRO B 1 265 ? 74.184  21.311  -14.560 1.00 2.12  ? 296 PRO B C   1 
ATOM   6608  O  O   . PRO B 1 265 ? 73.735  20.253  -14.925 1.00 2.00  ? 296 PRO B O   1 
ATOM   6609  C  CB  . PRO B 1 265 ? 75.635  22.135  -16.471 1.00 3.83  ? 296 PRO B CB  1 
ATOM   6610  C  CG  . PRO B 1 265 ? 75.944  23.490  -17.019 1.00 3.06  ? 296 PRO B CG  1 
ATOM   6611  C  CD  . PRO B 1 265 ? 75.918  24.342  -15.787 1.00 2.00  ? 296 PRO B CD  1 
ATOM   6612  N  N   . GLY B 1 266 ? 74.466  21.561  -13.287 1.00 3.52  ? 297 GLY B N   1 
ATOM   6613  C  CA  . GLY B 1 266 ? 74.223  20.596  -12.231 1.00 5.13  ? 297 GLY B CA  1 
ATOM   6614  C  C   . GLY B 1 266 ? 72.755  20.576  -11.873 1.00 7.05  ? 297 GLY B C   1 
ATOM   6615  O  O   . GLY B 1 266 ? 72.232  19.559  -11.426 1.00 9.97  ? 297 GLY B O   1 
ATOM   6616  N  N   . LEU B 1 267 ? 72.106  21.728  -12.022 1.00 8.36  ? 298 LEU B N   1 
ATOM   6617  C  CA  . LEU B 1 267 ? 70.674  21.874  -11.778 1.00 4.02  ? 298 LEU B CA  1 
ATOM   6618  C  C   . LEU B 1 267 ? 70.018  21.278  -12.994 1.00 2.82  ? 298 LEU B C   1 
ATOM   6619  O  O   . LEU B 1 267 ? 69.396  20.237  -12.916 1.00 6.31  ? 298 LEU B O   1 
ATOM   6620  C  CB  . LEU B 1 267 ? 70.275  23.346  -11.638 1.00 2.00  ? 298 LEU B CB  1 
ATOM   6621  C  CG  . LEU B 1 267 ? 70.353  23.893  -10.191 1.00 4.76  ? 298 LEU B CG  1 
ATOM   6622  C  CD1 . LEU B 1 267 ? 70.629  22.759  -9.180  1.00 4.33  ? 298 LEU B CD1 1 
ATOM   6623  C  CD2 . LEU B 1 267 ? 71.406  24.988  -10.036 1.00 2.00  ? 298 LEU B CD2 1 
ATOM   6624  N  N   . MET B 1 268 ? 70.243  21.872  -14.145 1.00 2.00  ? 299 MET B N   1 
ATOM   6625  C  CA  . MET B 1 268 ? 69.650  21.353  -15.358 1.00 2.01  ? 299 MET B CA  1 
ATOM   6626  C  C   . MET B 1 268 ? 69.830  19.856  -15.597 1.00 2.19  ? 299 MET B C   1 
ATOM   6627  O  O   . MET B 1 268 ? 69.065  19.251  -16.338 1.00 2.61  ? 299 MET B O   1 
ATOM   6628  C  CB  . MET B 1 268 ? 70.173  22.110  -16.559 1.00 2.00  ? 299 MET B CB  1 
ATOM   6629  C  CG  . MET B 1 268 ? 69.470  21.773  -17.870 1.00 5.37  ? 299 MET B CG  1 
ATOM   6630  S  SD  . MET B 1 268 ? 67.941  22.760  -18.147 1.00 12.62 ? 299 MET B SD  1 
ATOM   6631  C  CE  . MET B 1 268 ? 68.384  24.375  -17.328 1.00 2.00  ? 299 MET B CE  1 
ATOM   6632  N  N   . MET B 1 269 ? 70.837  19.242  -14.995 1.00 4.71  ? 300 MET B N   1 
ATOM   6633  C  CA  . MET B 1 269 ? 71.045  17.803  -15.213 1.00 6.92  ? 300 MET B CA  1 
ATOM   6634  C  C   . MET B 1 269 ? 69.891  17.094  -14.561 1.00 6.51  ? 300 MET B C   1 
ATOM   6635  O  O   . MET B 1 269 ? 69.161  16.318  -15.182 1.00 6.50  ? 300 MET B O   1 
ATOM   6636  C  CB  . MET B 1 269 ? 72.353  17.306  -14.574 1.00 7.17  ? 300 MET B CB  1 
ATOM   6637  C  CG  . MET B 1 269 ? 72.644  15.796  -14.802 1.00 5.23  ? 300 MET B CG  1 
ATOM   6638  S  SD  . MET B 1 269 ? 73.596  15.032  -13.442 1.00 6.35  ? 300 MET B SD  1 
ATOM   6639  C  CE  . MET B 1 269 ? 73.470  16.400  -12.158 1.00 6.27  ? 300 MET B CE  1 
ATOM   6640  N  N   . TYR B 1 270 ? 69.747  17.373  -13.282 1.00 4.99  ? 301 TYR B N   1 
ATOM   6641  C  CA  . TYR B 1 270 ? 68.681  16.808  -12.505 1.00 4.97  ? 301 TYR B CA  1 
ATOM   6642  C  C   . TYR B 1 270 ? 67.335  17.250  -13.060 1.00 6.70  ? 301 TYR B C   1 
ATOM   6643  O  O   . TYR B 1 270 ? 66.434  16.444  -13.199 1.00 9.42  ? 301 TYR B O   1 
ATOM   6644  C  CB  . TYR B 1 270 ? 68.830  17.270  -11.078 1.00 2.21  ? 301 TYR B CB  1 
ATOM   6645  C  CG  . TYR B 1 270 ? 69.668  16.360  -10.236 1.00 3.20  ? 301 TYR B CG  1 
ATOM   6646  C  CD1 . TYR B 1 270 ? 69.505  14.978  -10.304 1.00 3.93  ? 301 TYR B CD1 1 
ATOM   6647  C  CD2 . TYR B 1 270 ? 70.514  16.876  -9.257  1.00 4.50  ? 301 TYR B CD2 1 
ATOM   6648  C  CE1 . TYR B 1 270 ? 70.137  14.142  -9.408  1.00 4.85  ? 301 TYR B CE1 1 
ATOM   6649  C  CE2 . TYR B 1 270 ? 71.156  16.047  -8.356  1.00 2.16  ? 301 TYR B CE2 1 
ATOM   6650  C  CZ  . TYR B 1 270 ? 70.959  14.685  -8.424  1.00 6.60  ? 301 TYR B CZ  1 
ATOM   6651  O  OH  . TYR B 1 270 ? 71.522  13.873  -7.456  1.00 8.39  ? 301 TYR B OH  1 
ATOM   6652  N  N   . ALA B 1 271 ? 67.220  18.521  -13.429 1.00 7.82  ? 302 ALA B N   1 
ATOM   6653  C  CA  . ALA B 1 271 ? 65.975  19.066  -13.977 1.00 7.81  ? 302 ALA B CA  1 
ATOM   6654  C  C   . ALA B 1 271 ? 65.549  18.350  -15.236 1.00 5.42  ? 302 ALA B C   1 
ATOM   6655  O  O   . ALA B 1 271 ? 64.402  18.485  -15.639 1.00 5.74  ? 302 ALA B O   1 
ATOM   6656  C  CB  . ALA B 1 271 ? 66.102  20.570  -14.251 1.00 10.95 ? 302 ALA B CB  1 
ATOM   6657  N  N   . THR B 1 272 ? 66.480  17.641  -15.878 1.00 4.15  ? 303 THR B N   1 
ATOM   6658  C  CA  . THR B 1 272 ? 66.149  16.867  -17.080 1.00 4.23  ? 303 THR B CA  1 
ATOM   6659  C  C   . THR B 1 272 ? 65.891  15.418  -16.653 1.00 2.64  ? 303 THR B C   1 
ATOM   6660  O  O   . THR B 1 272 ? 65.082  14.733  -17.256 1.00 2.00  ? 303 THR B O   1 
ATOM   6661  C  CB  . THR B 1 272 ? 67.239  16.934  -18.191 1.00 2.01  ? 303 THR B CB  1 
ATOM   6662  O  OG1 . THR B 1 272 ? 67.586  18.297  -18.445 1.00 2.95  ? 303 THR B OG1 1 
ATOM   6663  C  CG2 . THR B 1 272 ? 66.725  16.333  -19.486 1.00 2.00  ? 303 THR B CG2 1 
ATOM   6664  N  N   . ILE B 1 273 ? 66.519  14.987  -15.563 1.00 2.46  ? 304 ILE B N   1 
ATOM   6665  C  CA  . ILE B 1 273 ? 66.309  13.635  -15.073 1.00 5.66  ? 304 ILE B CA  1 
ATOM   6666  C  C   . ILE B 1 273 ? 64.854  13.495  -14.583 1.00 8.27  ? 304 ILE B C   1 
ATOM   6667  O  O   . ILE B 1 273 ? 64.181  12.498  -14.893 1.00 11.09 ? 304 ILE B O   1 
ATOM   6668  C  CB  . ILE B 1 273 ? 67.316  13.268  -13.950 1.00 4.75  ? 304 ILE B CB  1 
ATOM   6669  C  CG1 . ILE B 1 273 ? 68.734  13.209  -14.527 1.00 8.75  ? 304 ILE B CG1 1 
ATOM   6670  C  CG2 . ILE B 1 273 ? 66.964  11.933  -13.314 1.00 2.06  ? 304 ILE B CG2 1 
ATOM   6671  C  CD1 . ILE B 1 273 ? 69.847  13.001  -13.485 1.00 7.14  ? 304 ILE B CD1 1 
ATOM   6672  N  N   . TRP B 1 274 ? 64.361  14.496  -13.848 1.00 6.83  ? 305 TRP B N   1 
ATOM   6673  C  CA  . TRP B 1 274 ? 62.995  14.477  -13.339 1.00 2.93  ? 305 TRP B CA  1 
ATOM   6674  C  C   . TRP B 1 274 ? 61.971  14.745  -14.441 1.00 2.00  ? 305 TRP B C   1 
ATOM   6675  O  O   . TRP B 1 274 ? 60.873  14.203  -14.401 1.00 2.00  ? 305 TRP B O   1 
ATOM   6676  C  CB  . TRP B 1 274 ? 62.813  15.435  -12.179 1.00 2.00  ? 305 TRP B CB  1 
ATOM   6677  C  CG  . TRP B 1 274 ? 63.391  14.982  -10.880 1.00 2.00  ? 305 TRP B CG  1 
ATOM   6678  C  CD1 . TRP B 1 274 ? 64.460  15.505  -10.272 1.00 2.00  ? 305 TRP B CD1 1 
ATOM   6679  C  CD2 . TRP B 1 274 ? 62.830  14.031  -9.954  1.00 3.33  ? 305 TRP B CD2 1 
ATOM   6680  N  NE1 . TRP B 1 274 ? 64.605  14.978  -9.019  1.00 2.00  ? 305 TRP B NE1 1 
ATOM   6681  C  CE2 . TRP B 1 274 ? 63.614  14.065  -8.797  1.00 2.52  ? 305 TRP B CE2 1 
ATOM   6682  C  CE3 . TRP B 1 274 ? 61.737  13.154  -9.988  1.00 4.69  ? 305 TRP B CE3 1 
ATOM   6683  C  CZ2 . TRP B 1 274 ? 63.348  13.259  -7.675  1.00 2.00  ? 305 TRP B CZ2 1 
ATOM   6684  C  CZ3 . TRP B 1 274 ? 61.475  12.355  -8.869  1.00 2.00  ? 305 TRP B CZ3 1 
ATOM   6685  C  CH2 . TRP B 1 274 ? 62.279  12.416  -7.734  1.00 2.00  ? 305 TRP B CH2 1 
ATOM   6686  N  N   . LEU B 1 275 ? 62.320  15.563  -15.426 1.00 2.00  ? 306 LEU B N   1 
ATOM   6687  C  CA  . LEU B 1 275 ? 61.406  15.800  -16.534 1.00 2.00  ? 306 LEU B CA  1 
ATOM   6688  C  C   . LEU B 1 275 ? 61.187  14.451  -17.147 1.00 2.00  ? 306 LEU B C   1 
ATOM   6689  O  O   . LEU B 1 275 ? 60.071  14.053  -17.398 1.00 2.00  ? 306 LEU B O   1 
ATOM   6690  C  CB  . LEU B 1 275 ? 62.028  16.718  -17.575 1.00 2.00  ? 306 LEU B CB  1 
ATOM   6691  C  CG  . LEU B 1 275 ? 61.324  16.863  -18.925 1.00 3.09  ? 306 LEU B CG  1 
ATOM   6692  C  CD1 . LEU B 1 275 ? 61.831  18.107  -19.617 1.00 4.25  ? 306 LEU B CD1 1 
ATOM   6693  C  CD2 . LEU B 1 275 ? 61.565  15.661  -19.815 1.00 2.01  ? 306 LEU B CD2 1 
ATOM   6694  N  N   . ARG B 1 276 ? 62.290  13.749  -17.374 1.00 6.65  ? 307 ARG B N   1 
ATOM   6695  C  CA  . ARG B 1 276 ? 62.289  12.392  -17.939 1.00 6.57  ? 307 ARG B CA  1 
ATOM   6696  C  C   . ARG B 1 276 ? 61.473  11.425  -17.079 1.00 2.32  ? 307 ARG B C   1 
ATOM   6697  O  O   . ARG B 1 276 ? 60.745  10.583  -17.607 1.00 2.04  ? 307 ARG B O   1 
ATOM   6698  C  CB  . ARG B 1 276 ? 63.747  11.894  -18.103 1.00 7.39  ? 307 ARG B CB  1 
ATOM   6699  C  CG  . ARG B 1 276 ? 64.523  12.670  -19.187 1.00 11.33 ? 307 ARG B CG  1 
ATOM   6700  C  CD  . ARG B 1 276 ? 66.034  12.636  -18.995 1.00 11.19 ? 307 ARG B CD  1 
ATOM   6701  N  NE  . ARG B 1 276 ? 66.696  11.626  -19.815 1.00 10.87 ? 307 ARG B NE  1 
ATOM   6702  C  CZ  . ARG B 1 276 ? 67.413  11.890  -20.899 1.00 8.33  ? 307 ARG B CZ  1 
ATOM   6703  N  NH1 . ARG B 1 276 ? 67.565  13.130  -21.311 1.00 5.56  ? 307 ARG B NH1 1 
ATOM   6704  N  NH2 . ARG B 1 276 ? 67.989  10.907  -21.566 1.00 12.49 ? 307 ARG B NH2 1 
ATOM   6705  N  N   . GLU B 1 277 ? 61.577  11.580  -15.763 1.00 2.00  ? 308 GLU B N   1 
ATOM   6706  C  CA  . GLU B 1 277 ? 60.869  10.722  -14.832 1.00 3.76  ? 308 GLU B CA  1 
ATOM   6707  C  C   . GLU B 1 277 ? 59.380  10.968  -14.832 1.00 8.20  ? 308 GLU B C   1 
ATOM   6708  O  O   . GLU B 1 277 ? 58.588  10.083  -14.475 1.00 9.35  ? 308 GLU B O   1 
ATOM   6709  C  CB  . GLU B 1 277 ? 61.432  10.843  -13.414 1.00 2.81  ? 308 GLU B CB  1 
ATOM   6710  C  CG  . GLU B 1 277 ? 60.669  10.020  -12.351 1.00 2.56  ? 308 GLU B CG  1 
ATOM   6711  C  CD  . GLU B 1 277 ? 60.643  8.492   -12.579 1.00 4.87  ? 308 GLU B CD  1 
ATOM   6712  O  OE1 . GLU B 1 277 ? 61.007  7.983   -13.673 1.00 3.22  ? 308 GLU B OE1 1 
ATOM   6713  O  OE2 . GLU B 1 277 ? 60.229  7.798   -11.628 1.00 2.00  ? 308 GLU B OE2 1 
ATOM   6714  N  N   . HIS B 1 278 ? 58.977  12.179  -15.213 1.00 12.14 ? 309 HIS B N   1 
ATOM   6715  C  CA  . HIS B 1 278 ? 57.542  12.508  -15.278 1.00 9.08  ? 309 HIS B CA  1 
ATOM   6716  C  C   . HIS B 1 278 ? 56.944  11.617  -16.361 1.00 3.70  ? 309 HIS B C   1 
ATOM   6717  O  O   . HIS B 1 278 ? 56.309  10.634  -16.052 1.00 4.46  ? 309 HIS B O   1 
ATOM   6718  C  CB  . HIS B 1 278 ? 57.311  13.995  -15.603 1.00 6.31  ? 309 HIS B CB  1 
ATOM   6719  C  CG  . HIS B 1 278 ? 55.886  14.408  -15.492 1.00 2.92  ? 309 HIS B CG  1 
ATOM   6720  N  ND1 . HIS B 1 278 ? 55.312  14.753  -14.290 1.00 2.00  ? 309 HIS B ND1 1 
ATOM   6721  C  CD2 . HIS B 1 278 ? 54.894  14.439  -16.413 1.00 3.04  ? 309 HIS B CD2 1 
ATOM   6722  C  CE1 . HIS B 1 278 ? 54.022  14.969  -14.472 1.00 2.00  ? 309 HIS B CE1 1 
ATOM   6723  N  NE2 . HIS B 1 278 ? 53.742  14.785  -15.751 1.00 3.04  ? 309 HIS B NE2 1 
ATOM   6724  N  N   . GLN B 1 279 ? 57.252  11.905  -17.611 1.00 2.00  ? 310 GLN B N   1 
ATOM   6725  C  CA  . GLN B 1 279 ? 56.754  11.120  -18.716 1.00 5.91  ? 310 GLN B CA  1 
ATOM   6726  C  C   . GLN B 1 279 ? 56.763  9.642   -18.469 1.00 7.66  ? 310 GLN B C   1 
ATOM   6727  O  O   . GLN B 1 279 ? 55.906  8.934   -18.985 1.00 9.44  ? 310 GLN B O   1 
ATOM   6728  C  CB  . GLN B 1 279 ? 57.590  11.358  -19.958 1.00 7.05  ? 310 GLN B CB  1 
ATOM   6729  C  CG  . GLN B 1 279 ? 57.109  12.442  -20.847 1.00 4.74  ? 310 GLN B CG  1 
ATOM   6730  C  CD  . GLN B 1 279 ? 57.165  13.758  -20.204 1.00 2.11  ? 310 GLN B CD  1 
ATOM   6731  O  OE1 . GLN B 1 279 ? 56.716  13.944  -19.067 1.00 2.00  ? 310 GLN B OE1 1 
ATOM   6732  N  NE2 . GLN B 1 279 ? 57.705  14.708  -20.926 1.00 2.61  ? 310 GLN B NE2 1 
ATOM   6733  N  N   . ARG B 1 280 ? 57.767  9.182   -17.729 1.00 9.97  ? 311 ARG B N   1 
ATOM   6734  C  CA  . ARG B 1 280 ? 57.915  7.762   -17.415 1.00 10.54 ? 311 ARG B CA  1 
ATOM   6735  C  C   . ARG B 1 280 ? 56.710  7.249   -16.623 1.00 9.40  ? 311 ARG B C   1 
ATOM   6736  O  O   . ARG B 1 280 ? 56.084  6.245   -17.012 1.00 7.84  ? 311 ARG B O   1 
ATOM   6737  C  CB  . ARG B 1 280 ? 59.220  7.493   -16.640 1.00 11.52 ? 311 ARG B CB  1 
ATOM   6738  C  CG  . ARG B 1 280 ? 59.611  6.009   -16.635 1.00 9.74  ? 311 ARG B CG  1 
ATOM   6739  C  CD  . ARG B 1 280 ? 60.591  5.657   -15.586 1.00 4.04  ? 311 ARG B CD  1 
ATOM   6740  N  NE  . ARG B 1 280 ? 60.187  4.425   -14.939 1.00 2.00  ? 311 ARG B NE  1 
ATOM   6741  C  CZ  . ARG B 1 280 ? 59.995  4.321   -13.630 1.00 3.51  ? 311 ARG B CZ  1 
ATOM   6742  N  NH1 . ARG B 1 280 ? 60.189  5.381   -12.858 1.00 2.48  ? 311 ARG B NH1 1 
ATOM   6743  N  NH2 . ARG B 1 280 ? 59.579  3.176   -13.089 1.00 3.77  ? 311 ARG B NH2 1 
ATOM   6744  N  N   . VAL B 1 281 ? 56.409  7.919   -15.506 1.00 6.66  ? 312 VAL B N   1 
ATOM   6745  C  CA  . VAL B 1 281 ? 55.265  7.552   -14.693 1.00 4.29  ? 312 VAL B CA  1 
ATOM   6746  C  C   . VAL B 1 281 ? 53.989  7.721   -15.518 1.00 2.02  ? 312 VAL B C   1 
ATOM   6747  O  O   . VAL B 1 281 ? 53.052  6.959   -15.396 1.00 2.00  ? 312 VAL B O   1 
ATOM   6748  C  CB  . VAL B 1 281 ? 55.207  8.347   -13.390 1.00 2.79  ? 312 VAL B CB  1 
ATOM   6749  C  CG1 . VAL B 1 281 ? 53.795  8.306   -12.806 1.00 2.00  ? 312 VAL B CG1 1 
ATOM   6750  C  CG2 . VAL B 1 281 ? 56.174  7.746   -12.400 1.00 2.13  ? 312 VAL B CG2 1 
ATOM   6751  N  N   . CYS B 1 282 ? 53.987  8.684   -16.412 1.00 2.00  ? 313 CYS B N   1 
ATOM   6752  C  CA  . CYS B 1 282 ? 52.833  8.883   -17.250 1.00 2.01  ? 313 CYS B CA  1 
ATOM   6753  C  C   . CYS B 1 282 ? 52.594  7.614   -18.017 1.00 2.23  ? 313 CYS B C   1 
ATOM   6754  O  O   . CYS B 1 282 ? 51.639  6.918   -17.747 1.00 4.56  ? 313 CYS B O   1 
ATOM   6755  C  CB  . CYS B 1 282 ? 52.999  10.095  -18.174 1.00 2.00  ? 313 CYS B CB  1 
ATOM   6756  S  SG  . CYS B 1 282 ? 52.707  11.646  -17.277 1.00 2.00  ? 313 CYS B SG  1 
ATOM   6757  N  N   . ASP B 1 283 ? 53.502  7.256   -18.902 1.00 2.27  ? 314 ASP B N   1 
ATOM   6758  C  CA  . ASP B 1 283 ? 53.371  6.034   -19.684 1.00 2.00  ? 314 ASP B CA  1 
ATOM   6759  C  C   . ASP B 1 283 ? 53.017  4.793   -18.875 1.00 2.00  ? 314 ASP B C   1 
ATOM   6760  O  O   . ASP B 1 283 ? 52.467  3.849   -19.397 1.00 2.00  ? 314 ASP B O   1 
ATOM   6761  C  CB  . ASP B 1 283 ? 54.640  5.793   -20.468 1.00 3.74  ? 314 ASP B CB  1 
ATOM   6762  C  CG  . ASP B 1 283 ? 54.822  6.803   -21.561 1.00 9.15  ? 314 ASP B CG  1 
ATOM   6763  O  OD1 . ASP B 1 283 ? 53.771  7.351   -22.005 1.00 10.55 ? 314 ASP B OD1 1 
ATOM   6764  O  OD2 . ASP B 1 283 ? 55.996  7.045   -21.973 1.00 9.72  ? 314 ASP B OD2 1 
ATOM   6765  N  N   . ILE B 1 284 ? 53.346  4.790   -17.598 1.00 2.24  ? 315 ILE B N   1 
ATOM   6766  C  CA  . ILE B 1 284 ? 53.012  3.682   -16.740 1.00 4.10  ? 315 ILE B CA  1 
ATOM   6767  C  C   . ILE B 1 284 ? 51.533  3.786   -16.383 1.00 8.49  ? 315 ILE B C   1 
ATOM   6768  O  O   . ILE B 1 284 ? 50.757  2.831   -16.576 1.00 13.48 ? 315 ILE B O   1 
ATOM   6769  C  CB  . ILE B 1 284 ? 53.844  3.721   -15.477 1.00 5.08  ? 315 ILE B CB  1 
ATOM   6770  C  CG1 . ILE B 1 284 ? 55.325  3.581   -15.867 1.00 7.47  ? 315 ILE B CG1 1 
ATOM   6771  C  CG2 . ILE B 1 284 ? 53.384  2.653   -14.501 1.00 2.40  ? 315 ILE B CG2 1 
ATOM   6772  C  CD1 . ILE B 1 284 ? 56.273  3.458   -14.699 1.00 8.39  ? 315 ILE B CD1 1 
ATOM   6773  N  N   . LEU B 1 285 ? 51.122  4.953   -15.889 1.00 8.97  ? 316 LEU B N   1 
ATOM   6774  C  CA  . LEU B 1 285 ? 49.730  5.189   -15.523 1.00 3.53  ? 316 LEU B CA  1 
ATOM   6775  C  C   . LEU B 1 285 ? 48.877  5.014   -16.751 1.00 2.42  ? 316 LEU B C   1 
ATOM   6776  O  O   . LEU B 1 285 ? 47.972  4.224   -16.737 1.00 4.46  ? 316 LEU B O   1 
ATOM   6777  C  CB  . LEU B 1 285 ? 49.582  6.575   -14.938 1.00 2.00  ? 316 LEU B CB  1 
ATOM   6778  C  CG  . LEU B 1 285 ? 49.464  6.642   -13.415 1.00 2.00  ? 316 LEU B CG  1 
ATOM   6779  C  CD1 . LEU B 1 285 ? 50.125  5.482   -12.716 1.00 2.41  ? 316 LEU B CD1 1 
ATOM   6780  C  CD2 . LEU B 1 285 ? 50.037  7.932   -12.957 1.00 2.00  ? 316 LEU B CD2 1 
ATOM   6781  N  N   . LYS B 1 286 ? 49.222  5.676   -17.841 1.00 2.00  ? 317 LYS B N   1 
ATOM   6782  C  CA  . LYS B 1 286 ? 48.482  5.544   -19.074 1.00 3.97  ? 317 LYS B CA  1 
ATOM   6783  C  C   . LYS B 1 286 ? 48.334  4.096   -19.531 1.00 8.01  ? 317 LYS B C   1 
ATOM   6784  O  O   . LYS B 1 286 ? 47.398  3.764   -20.250 1.00 12.26 ? 317 LYS B O   1 
ATOM   6785  C  CB  . LYS B 1 286 ? 49.136  6.337   -20.182 1.00 2.00  ? 317 LYS B CB  1 
ATOM   6786  C  CG  . LYS B 1 286 ? 48.488  6.097   -21.533 1.00 4.53  ? 317 LYS B CG  1 
ATOM   6787  C  CD  . LYS B 1 286 ? 49.432  6.451   -22.677 1.00 10.11 ? 317 LYS B CD  1 
ATOM   6788  C  CE  . LYS B 1 286 ? 48.836  6.191   -24.081 1.00 10.28 ? 317 LYS B CE  1 
ATOM   6789  N  NZ  . LYS B 1 286 ? 49.733  6.723   -25.192 1.00 9.03  ? 317 LYS B NZ  1 
ATOM   6790  N  N   . GLN B 1 287 ? 49.258  3.221   -19.174 1.00 10.85 ? 318 GLN B N   1 
ATOM   6791  C  CA  . GLN B 1 287 ? 49.090  1.836   -19.608 1.00 14.09 ? 318 GLN B CA  1 
ATOM   6792  C  C   . GLN B 1 287 ? 47.975  1.324   -18.734 1.00 12.88 ? 318 GLN B C   1 
ATOM   6793  O  O   . GLN B 1 287 ? 46.923  0.913   -19.225 1.00 12.62 ? 318 GLN B O   1 
ATOM   6794  C  CB  . GLN B 1 287 ? 50.345  0.982   -19.354 1.00 22.29 ? 318 GLN B CB  1 
ATOM   6795  C  CG  . GLN B 1 287 ? 50.324  -0.413  -20.028 1.00 27.47 ? 318 GLN B CG  1 
ATOM   6796  C  CD  . GLN B 1 287 ? 48.966  -1.134  -19.897 1.00 32.93 ? 318 GLN B CD  1 
ATOM   6797  O  OE1 . GLN B 1 287 ? 48.506  -1.445  -18.786 1.00 37.83 ? 318 GLN B OE1 1 
ATOM   6798  N  NE2 . GLN B 1 287 ? 48.302  -1.345  -21.023 1.00 30.09 ? 318 GLN B NE2 1 
ATOM   6799  N  N   . GLU B 1 288 ? 48.257  1.296   -17.439 1.00 10.65 ? 319 GLU B N   1 
ATOM   6800  C  CA  . GLU B 1 288 ? 47.315  0.844   -16.436 1.00 12.76 ? 319 GLU B CA  1 
ATOM   6801  C  C   . GLU B 1 288 ? 45.904  1.441   -16.526 1.00 12.01 ? 319 GLU B C   1 
ATOM   6802  O  O   . GLU B 1 288 ? 44.938  0.824   -16.078 1.00 13.19 ? 319 GLU B O   1 
ATOM   6803  C  CB  . GLU B 1 288 ? 47.901  1.134   -15.068 1.00 15.36 ? 319 GLU B CB  1 
ATOM   6804  C  CG  . GLU B 1 288 ? 48.878  0.093   -14.654 1.00 21.81 ? 319 GLU B CG  1 
ATOM   6805  C  CD  . GLU B 1 288 ? 48.163  -1.179  -14.227 1.00 24.70 ? 319 GLU B CD  1 
ATOM   6806  O  OE1 . GLU B 1 288 ? 47.429  -1.117  -13.199 1.00 21.75 ? 319 GLU B OE1 1 
ATOM   6807  O  OE2 . GLU B 1 288 ? 48.326  -2.222  -14.922 1.00 26.85 ? 319 GLU B OE2 1 
ATOM   6808  N  N   . HIS B 1 289 ? 45.791  2.653   -17.071 1.00 9.59  ? 320 HIS B N   1 
ATOM   6809  C  CA  . HIS B 1 289 ? 44.511  3.325   -17.193 1.00 5.66  ? 320 HIS B CA  1 
ATOM   6810  C  C   . HIS B 1 289 ? 44.275  3.811   -18.610 1.00 4.12  ? 320 HIS B C   1 
ATOM   6811  O  O   . HIS B 1 289 ? 44.360  5.000   -18.892 1.00 3.04  ? 320 HIS B O   1 
ATOM   6812  C  CB  . HIS B 1 289 ? 44.422  4.461   -16.186 1.00 2.00  ? 320 HIS B CB  1 
ATOM   6813  C  CG  . HIS B 1 289 ? 44.234  3.998   -14.779 1.00 2.00  ? 320 HIS B CG  1 
ATOM   6814  N  ND1 . HIS B 1 289 ? 44.958  4.498   -13.724 1.00 2.00  ? 320 HIS B ND1 1 
ATOM   6815  C  CD2 . HIS B 1 289 ? 43.381  3.097   -14.247 1.00 2.00  ? 320 HIS B CD2 1 
ATOM   6816  C  CE1 . HIS B 1 289 ? 44.559  3.932   -12.602 1.00 2.00  ? 320 HIS B CE1 1 
ATOM   6817  N  NE2 . HIS B 1 289 ? 43.600  3.077   -12.891 1.00 2.00  ? 320 HIS B NE2 1 
ATOM   6818  N  N   . PRO B 1 290 ? 43.877  2.886   -19.501 1.00 4.11  ? 321 PRO B N   1 
ATOM   6819  C  CA  . PRO B 1 290 ? 43.599  3.156   -20.913 1.00 4.25  ? 321 PRO B CA  1 
ATOM   6820  C  C   . PRO B 1 290 ? 42.509  4.196   -20.994 1.00 8.79  ? 321 PRO B C   1 
ATOM   6821  O  O   . PRO B 1 290 ? 42.361  4.913   -21.996 1.00 10.92 ? 321 PRO B O   1 
ATOM   6822  C  CB  . PRO B 1 290 ? 43.026  1.837   -21.399 1.00 2.00  ? 321 PRO B CB  1 
ATOM   6823  C  CG  . PRO B 1 290 ? 43.582  0.828   -20.443 1.00 2.11  ? 321 PRO B CG  1 
ATOM   6824  C  CD  . PRO B 1 290 ? 43.495  1.510   -19.147 1.00 2.03  ? 321 PRO B CD  1 
ATOM   6825  N  N   . GLU B 1 291 ? 41.723  4.237   -19.919 1.00 8.28  ? 322 GLU B N   1 
ATOM   6826  C  CA  . GLU B 1 291 ? 40.594  5.128   -19.800 1.00 8.22  ? 322 GLU B CA  1 
ATOM   6827  C  C   . GLU B 1 291 ? 40.816  6.474   -19.108 1.00 10.77 ? 322 GLU B C   1 
ATOM   6828  O  O   . GLU B 1 291 ? 39.845  7.179   -18.850 1.00 14.32 ? 322 GLU B O   1 
ATOM   6829  C  CB  . GLU B 1 291 ? 39.479  4.371   -19.113 1.00 6.48  ? 322 GLU B CB  1 
ATOM   6830  C  CG  . GLU B 1 291 ? 39.980  3.247   -18.235 1.00 11.71 ? 322 GLU B CG  1 
ATOM   6831  C  CD  . GLU B 1 291 ? 40.485  3.717   -16.883 1.00 15.67 ? 322 GLU B CD  1 
ATOM   6832  O  OE1 . GLU B 1 291 ? 41.428  4.519   -16.863 1.00 17.92 ? 322 GLU B OE1 1 
ATOM   6833  O  OE2 . GLU B 1 291 ? 39.952  3.290   -15.836 1.00 15.90 ? 322 GLU B OE2 1 
ATOM   6834  N  N   . TRP B 1 292 ? 42.056  6.825   -18.758 1.00 11.14 ? 323 TRP B N   1 
ATOM   6835  C  CA  . TRP B 1 292 ? 42.300  8.113   -18.103 1.00 7.52  ? 323 TRP B CA  1 
ATOM   6836  C  C   . TRP B 1 292 ? 42.553  9.179   -19.141 1.00 7.81  ? 323 TRP B C   1 
ATOM   6837  O  O   . TRP B 1 292 ? 42.839  8.870   -20.315 1.00 7.57  ? 323 TRP B O   1 
ATOM   6838  C  CB  . TRP B 1 292 ? 43.496  8.051   -17.167 1.00 7.56  ? 323 TRP B CB  1 
ATOM   6839  C  CG  . TRP B 1 292 ? 43.167  7.592   -15.798 1.00 7.99  ? 323 TRP B CG  1 
ATOM   6840  C  CD1 . TRP B 1 292 ? 42.029  6.965   -15.396 1.00 7.38  ? 323 TRP B CD1 1 
ATOM   6841  C  CD2 . TRP B 1 292 ? 44.006  7.692   -14.643 1.00 8.67  ? 323 TRP B CD2 1 
ATOM   6842  N  NE1 . TRP B 1 292 ? 42.104  6.659   -14.060 1.00 5.89  ? 323 TRP B NE1 1 
ATOM   6843  C  CE2 . TRP B 1 292 ? 43.308  7.093   -13.571 1.00 8.32  ? 323 TRP B CE2 1 
ATOM   6844  C  CE3 . TRP B 1 292 ? 45.279  8.227   -14.406 1.00 6.28  ? 323 TRP B CE3 1 
ATOM   6845  C  CZ2 . TRP B 1 292 ? 43.842  7.014   -12.279 1.00 10.14 ? 323 TRP B CZ2 1 
ATOM   6846  C  CZ3 . TRP B 1 292 ? 45.803  8.148   -13.126 1.00 8.52  ? 323 TRP B CZ3 1 
ATOM   6847  C  CH2 . TRP B 1 292 ? 45.084  7.545   -12.078 1.00 8.77  ? 323 TRP B CH2 1 
ATOM   6848  N  N   . GLY B 1 293 ? 42.452  10.432  -18.708 1.00 5.86  ? 324 GLY B N   1 
ATOM   6849  C  CA  . GLY B 1 293 ? 42.682  11.526  -19.632 1.00 8.00  ? 324 GLY B CA  1 
ATOM   6850  C  C   . GLY B 1 293 ? 43.914  12.303  -19.252 1.00 10.93 ? 324 GLY B C   1 
ATOM   6851  O  O   . GLY B 1 293 ? 44.427  12.136  -18.125 1.00 12.86 ? 324 GLY B O   1 
ATOM   6852  N  N   . ASP B 1 294 ? 44.360  13.188  -20.151 1.00 10.07 ? 325 ASP B N   1 
ATOM   6853  C  CA  . ASP B 1 294 ? 45.554  14.000  -19.903 1.00 8.72  ? 325 ASP B CA  1 
ATOM   6854  C  C   . ASP B 1 294 ? 45.663  14.545  -18.478 1.00 3.35  ? 325 ASP B C   1 
ATOM   6855  O  O   . ASP B 1 294 ? 46.495  14.112  -17.713 1.00 4.49  ? 325 ASP B O   1 
ATOM   6856  C  CB  . ASP B 1 294 ? 45.664  15.124  -20.935 1.00 12.69 ? 325 ASP B CB  1 
ATOM   6857  C  CG  . ASP B 1 294 ? 46.741  16.139  -20.589 1.00 18.16 ? 325 ASP B CG  1 
ATOM   6858  O  OD1 . ASP B 1 294 ? 47.936  15.858  -20.778 1.00 21.16 ? 325 ASP B OD1 1 
ATOM   6859  O  OD2 . ASP B 1 294 ? 46.395  17.236  -20.117 1.00 25.55 ? 325 ASP B OD2 1 
ATOM   6860  N  N   . GLU B 1 295 ? 44.767  15.424  -18.105 1.00 2.00  ? 326 GLU B N   1 
ATOM   6861  C  CA  . GLU B 1 295 ? 44.804  16.022  -16.791 1.00 2.00  ? 326 GLU B CA  1 
ATOM   6862  C  C   . GLU B 1 295 ? 44.846  15.095  -15.602 1.00 2.00  ? 326 GLU B C   1 
ATOM   6863  O  O   . GLU B 1 295 ? 45.368  15.460  -14.554 1.00 2.40  ? 326 GLU B O   1 
ATOM   6864  C  CB  . GLU B 1 295 ? 43.676  17.051  -16.631 1.00 2.76  ? 326 GLU B CB  1 
ATOM   6865  C  CG  . GLU B 1 295 ? 44.155  18.521  -16.684 1.00 2.33  ? 326 GLU B CG  1 
ATOM   6866  C  CD  . GLU B 1 295 ? 44.565  19.066  -15.314 1.00 3.29  ? 326 GLU B CD  1 
ATOM   6867  O  OE1 . GLU B 1 295 ? 44.470  18.318  -14.324 1.00 5.23  ? 326 GLU B OE1 1 
ATOM   6868  O  OE2 . GLU B 1 295 ? 44.965  20.248  -15.220 1.00 3.99  ? 326 GLU B OE2 1 
ATOM   6869  N  N   . GLN B 1 296 ? 44.319  13.901  -15.739 1.00 2.00  ? 327 GLN B N   1 
ATOM   6870  C  CA  . GLN B 1 296 ? 44.353  13.016  -14.595 1.00 4.42  ? 327 GLN B CA  1 
ATOM   6871  C  C   . GLN B 1 296 ? 45.703  12.356  -14.541 1.00 3.21  ? 327 GLN B C   1 
ATOM   6872  O  O   . GLN B 1 296 ? 46.313  12.252  -13.480 1.00 2.00  ? 327 GLN B O   1 
ATOM   6873  C  CB  . GLN B 1 296 ? 43.250  11.969  -14.656 1.00 10.78 ? 327 GLN B CB  1 
ATOM   6874  C  CG  . GLN B 1 296 ? 43.172  11.152  -13.371 1.00 11.23 ? 327 GLN B CG  1 
ATOM   6875  C  CD  . GLN B 1 296 ? 42.001  10.214  -13.358 1.00 10.54 ? 327 GLN B CD  1 
ATOM   6876  O  OE1 . GLN B 1 296 ? 41.262  10.105  -14.341 1.00 8.38  ? 327 GLN B OE1 1 
ATOM   6877  N  NE2 . GLN B 1 296 ? 41.832  9.503   -12.244 1.00 13.61 ? 327 GLN B NE2 1 
ATOM   6878  N  N   . LEU B 1 297 ? 46.153  11.893  -15.702 1.00 3.33  ? 328 LEU B N   1 
ATOM   6879  C  CA  . LEU B 1 297 ? 47.464  11.292  -15.816 1.00 4.48  ? 328 LEU B CA  1 
ATOM   6880  C  C   . LEU B 1 297 ? 48.451  12.285  -15.159 1.00 4.97  ? 328 LEU B C   1 
ATOM   6881  O  O   . LEU B 1 297 ? 49.123  11.957  -14.168 1.00 5.45  ? 328 LEU B O   1 
ATOM   6882  C  CB  . LEU B 1 297 ? 47.794  11.064  -17.293 1.00 2.62  ? 328 LEU B CB  1 
ATOM   6883  C  CG  . LEU B 1 297 ? 47.062  9.841   -17.844 1.00 2.42  ? 328 LEU B CG  1 
ATOM   6884  C  CD1 . LEU B 1 297 ? 47.260  9.726   -19.332 1.00 2.00  ? 328 LEU B CD1 1 
ATOM   6885  C  CD2 . LEU B 1 297 ? 47.572  8.573   -17.154 1.00 2.39  ? 328 LEU B CD2 1 
ATOM   6886  N  N   . PHE B 1 298 ? 48.451  13.520  -15.647 1.00 2.28  ? 329 PHE B N   1 
ATOM   6887  C  CA  . PHE B 1 298 ? 49.300  14.563  -15.108 1.00 2.00  ? 329 PHE B CA  1 
ATOM   6888  C  C   . PHE B 1 298 ? 49.195  14.663  -13.570 1.00 2.00  ? 329 PHE B C   1 
ATOM   6889  O  O   . PHE B 1 298 ? 50.139  14.404  -12.836 1.00 2.00  ? 329 PHE B O   1 
ATOM   6890  C  CB  . PHE B 1 298 ? 48.923  15.912  -15.742 1.00 2.62  ? 329 PHE B CB  1 
ATOM   6891  C  CG  . PHE B 1 298 ? 49.790  17.054  -15.292 1.00 3.35  ? 329 PHE B CG  1 
ATOM   6892  C  CD1 . PHE B 1 298 ? 49.579  17.672  -14.083 1.00 3.54  ? 329 PHE B CD1 1 
ATOM   6893  C  CD2 . PHE B 1 298 ? 50.860  17.466  -16.046 1.00 2.71  ? 329 PHE B CD2 1 
ATOM   6894  C  CE1 . PHE B 1 298 ? 50.419  18.666  -13.642 1.00 2.05  ? 329 PHE B CE1 1 
ATOM   6895  C  CE2 . PHE B 1 298 ? 51.689  18.458  -15.595 1.00 2.00  ? 329 PHE B CE2 1 
ATOM   6896  C  CZ  . PHE B 1 298 ? 51.458  19.047  -14.394 1.00 2.00  ? 329 PHE B CZ  1 
ATOM   6897  N  N   . GLN B 1 299 ? 48.033  15.046  -13.081 1.00 4.17  ? 330 GLN B N   1 
ATOM   6898  C  CA  . GLN B 1 299 ? 47.842  15.218  -11.648 1.00 4.21  ? 330 GLN B CA  1 
ATOM   6899  C  C   . GLN B 1 299 ? 48.286  14.077  -10.765 1.00 4.37  ? 330 GLN B C   1 
ATOM   6900  O  O   . GLN B 1 299 ? 48.695  14.321  -9.622  1.00 2.92  ? 330 GLN B O   1 
ATOM   6901  C  CB  . GLN B 1 299 ? 46.383  15.593  -11.344 1.00 2.00  ? 330 GLN B CB  1 
ATOM   6902  C  CG  . GLN B 1 299 ? 46.070  17.010  -11.748 1.00 2.00  ? 330 GLN B CG  1 
ATOM   6903  C  CD  . GLN B 1 299 ? 46.955  18.040  -11.046 1.00 3.26  ? 330 GLN B CD  1 
ATOM   6904  O  OE1 . GLN B 1 299 ? 47.605  17.764  -10.013 1.00 3.42  ? 330 GLN B OE1 1 
ATOM   6905  N  NE2 . GLN B 1 299 ? 46.973  19.241  -11.595 1.00 2.00  ? 330 GLN B NE2 1 
ATOM   6906  N  N   . THR B 1 300 ? 48.171  12.845  -11.277 1.00 5.76  ? 331 THR B N   1 
ATOM   6907  C  CA  . THR B 1 300 ? 48.560  11.651  -10.511 1.00 5.99  ? 331 THR B CA  1 
ATOM   6908  C  C   . THR B 1 300 ? 50.087  11.510  -10.517 1.00 7.57  ? 331 THR B C   1 
ATOM   6909  O  O   . THR B 1 300 ? 50.683  11.141  -9.488  1.00 8.04  ? 331 THR B O   1 
ATOM   6910  C  CB  . THR B 1 300 ? 47.932  10.354  -11.076 1.00 6.12  ? 331 THR B CB  1 
ATOM   6911  O  OG1 . THR B 1 300 ? 46.637  10.638  -11.607 1.00 6.50  ? 331 THR B OG1 1 
ATOM   6912  C  CG2 . THR B 1 300 ? 47.795  9.290   -9.991  1.00 2.00  ? 331 THR B CG2 1 
ATOM   6913  N  N   . SER B 1 301 ? 50.717  11.786  -11.667 1.00 4.89  ? 332 SER B N   1 
ATOM   6914  C  CA  . SER B 1 301 ? 52.172  11.731  -11.762 1.00 3.27  ? 332 SER B CA  1 
ATOM   6915  C  C   . SER B 1 301 ? 52.777  12.733  -10.746 1.00 3.13  ? 332 SER B C   1 
ATOM   6916  O  O   . SER B 1 301 ? 53.455  12.314  -9.818  1.00 3.35  ? 332 SER B O   1 
ATOM   6917  C  CB  . SER B 1 301 ? 52.624  12.028  -13.179 1.00 3.48  ? 332 SER B CB  1 
ATOM   6918  O  OG  . SER B 1 301 ? 52.207  11.017  -14.065 1.00 2.09  ? 332 SER B OG  1 
ATOM   6919  N  N   . LYS B 1 302 ? 52.450  14.019  -10.844 1.00 2.00  ? 333 LYS B N   1 
ATOM   6920  C  CA  . LYS B 1 302 ? 52.952  14.992  -9.874  1.00 2.00  ? 333 LYS B CA  1 
ATOM   6921  C  C   . LYS B 1 302 ? 52.838  14.487  -8.416  1.00 2.00  ? 333 LYS B C   1 
ATOM   6922  O  O   . LYS B 1 302 ? 53.618  14.852  -7.551  1.00 2.00  ? 333 LYS B O   1 
ATOM   6923  C  CB  . LYS B 1 302 ? 52.230  16.355  -10.042 1.00 2.05  ? 333 LYS B CB  1 
ATOM   6924  C  CG  . LYS B 1 302 ? 52.583  17.438  -9.005  1.00 2.00  ? 333 LYS B CG  1 
ATOM   6925  C  CD  . LYS B 1 302 ? 52.251  18.860  -9.502  1.00 3.07  ? 333 LYS B CD  1 
ATOM   6926  C  CE  . LYS B 1 302 ? 52.601  19.961  -8.468  1.00 3.07  ? 333 LYS B CE  1 
ATOM   6927  N  NZ  . LYS B 1 302 ? 52.656  21.285  -9.091  1.00 2.00  ? 333 LYS B NZ  1 
ATOM   6928  N  N   . LEU B 1 303 ? 51.893  13.613  -8.147  1.00 2.00  ? 334 LEU B N   1 
ATOM   6929  C  CA  . LEU B 1 303 ? 51.739  13.110  -6.792  1.00 3.82  ? 334 LEU B CA  1 
ATOM   6930  C  C   . LEU B 1 303 ? 52.768  12.024  -6.504  1.00 3.94  ? 334 LEU B C   1 
ATOM   6931  O  O   . LEU B 1 303 ? 53.465  12.054  -5.482  1.00 3.04  ? 334 LEU B O   1 
ATOM   6932  C  CB  . LEU B 1 303 ? 50.290  12.623  -6.523  1.00 3.67  ? 334 LEU B CB  1 
ATOM   6933  C  CG  . LEU B 1 303 ? 49.194  13.659  -6.215  1.00 2.00  ? 334 LEU B CG  1 
ATOM   6934  C  CD1 . LEU B 1 303 ? 47.972  12.920  -5.850  1.00 2.00  ? 334 LEU B CD1 1 
ATOM   6935  C  CD2 . LEU B 1 303 ? 49.570  14.583  -5.057  1.00 2.00  ? 334 LEU B CD2 1 
ATOM   6936  N  N   . ILE B 1 304 ? 52.881  11.073  -7.422  1.00 5.09  ? 335 ILE B N   1 
ATOM   6937  C  CA  . ILE B 1 304 ? 53.844  9.985   -7.291  1.00 4.87  ? 335 ILE B CA  1 
ATOM   6938  C  C   . ILE B 1 304 ? 55.255  10.596  -7.198  1.00 3.15  ? 335 ILE B C   1 
ATOM   6939  O  O   . ILE B 1 304 ? 55.978  10.311  -6.255  1.00 2.00  ? 335 ILE B O   1 
ATOM   6940  C  CB  . ILE B 1 304 ? 53.749  8.994   -8.485  1.00 5.66  ? 335 ILE B CB  1 
ATOM   6941  C  CG1 . ILE B 1 304 ? 52.335  8.432   -8.599  1.00 3.04  ? 335 ILE B CG1 1 
ATOM   6942  C  CG2 . ILE B 1 304 ? 54.678  7.837   -8.262  1.00 6.81  ? 335 ILE B CG2 1 
ATOM   6943  C  CD1 . ILE B 1 304 ? 52.186  7.417   -9.684  1.00 2.02  ? 335 ILE B CD1 1 
ATOM   6944  N  N   . LEU B 1 305 ? 55.629  11.460  -8.147  1.00 2.83  ? 336 LEU B N   1 
ATOM   6945  C  CA  . LEU B 1 305 ? 56.931  12.133  -8.106  1.00 2.00  ? 336 LEU B CA  1 
ATOM   6946  C  C   . LEU B 1 305 ? 57.191  12.809  -6.745  1.00 3.17  ? 336 LEU B C   1 
ATOM   6947  O  O   . LEU B 1 305 ? 58.315  12.823  -6.268  1.00 5.46  ? 336 LEU B O   1 
ATOM   6948  C  CB  . LEU B 1 305 ? 57.084  13.136  -9.244  1.00 2.00  ? 336 LEU B CB  1 
ATOM   6949  C  CG  . LEU B 1 305 ? 57.649  12.536  -10.532 1.00 2.05  ? 336 LEU B CG  1 
ATOM   6950  C  CD1 . LEU B 1 305 ? 56.866  11.287  -10.926 1.00 3.29  ? 336 LEU B CD1 1 
ATOM   6951  C  CD2 . LEU B 1 305 ? 57.661  13.536  -11.674 1.00 2.00  ? 336 LEU B CD2 1 
ATOM   6952  N  N   . ILE B 1 306 ? 56.178  13.374  -6.109  1.00 2.22  ? 337 ILE B N   1 
ATOM   6953  C  CA  . ILE B 1 306 ? 56.411  13.957  -4.813  1.00 2.00  ? 337 ILE B CA  1 
ATOM   6954  C  C   . ILE B 1 306 ? 56.632  12.806  -3.864  1.00 2.00  ? 337 ILE B C   1 
ATOM   6955  O  O   . ILE B 1 306 ? 57.390  12.926  -2.909  1.00 2.00  ? 337 ILE B O   1 
ATOM   6956  C  CB  . ILE B 1 306 ? 55.237  14.765  -4.317  1.00 2.00  ? 337 ILE B CB  1 
ATOM   6957  C  CG1 . ILE B 1 306 ? 54.997  15.941  -5.242  1.00 2.00  ? 337 ILE B CG1 1 
ATOM   6958  C  CG2 . ILE B 1 306 ? 55.509  15.250  -2.893  1.00 2.00  ? 337 ILE B CG2 1 
ATOM   6959  C  CD1 . ILE B 1 306 ? 55.054  17.314  -4.551  1.00 3.96  ? 337 ILE B CD1 1 
ATOM   6960  N  N   . GLY B 1 307 ? 55.955  11.695  -4.116  1.00 2.00  ? 338 GLY B N   1 
ATOM   6961  C  CA  . GLY B 1 307 ? 56.102  10.540  -3.252  1.00 2.55  ? 338 GLY B CA  1 
ATOM   6962  C  C   . GLY B 1 307 ? 57.525  10.016  -3.306  1.00 2.95  ? 338 GLY B C   1 
ATOM   6963  O  O   . GLY B 1 307 ? 58.117  9.687   -2.275  1.00 2.00  ? 338 GLY B O   1 
ATOM   6964  N  N   . GLU B 1 308 ? 58.064  9.945   -4.526  1.00 4.34  ? 339 GLU B N   1 
ATOM   6965  C  CA  . GLU B 1 308 ? 59.435  9.507   -4.787  1.00 2.51  ? 339 GLU B CA  1 
ATOM   6966  C  C   . GLU B 1 308 ? 60.413  10.452  -4.089  1.00 5.10  ? 339 GLU B C   1 
ATOM   6967  O  O   . GLU B 1 308 ? 61.241  10.021  -3.278  1.00 5.09  ? 339 GLU B O   1 
ATOM   6968  C  CB  . GLU B 1 308 ? 59.720  9.496   -6.288  1.00 2.00  ? 339 GLU B CB  1 
ATOM   6969  C  CG  . GLU B 1 308 ? 59.045  8.385   -7.066  1.00 2.00  ? 339 GLU B CG  1 
ATOM   6970  C  CD  . GLU B 1 308 ? 59.686  8.163   -8.438  1.00 4.68  ? 339 GLU B CD  1 
ATOM   6971  O  OE1 . GLU B 1 308 ? 60.770  7.518   -8.512  1.00 8.66  ? 339 GLU B OE1 1 
ATOM   6972  O  OE2 . GLU B 1 308 ? 59.120  8.620   -9.450  1.00 2.00  ? 339 GLU B OE2 1 
ATOM   6973  N  N   . THR B 1 309 ? 60.303  11.743  -4.404  1.00 5.06  ? 340 THR B N   1 
ATOM   6974  C  CA  . THR B 1 309 ? 61.136  12.777  -3.798  1.00 3.84  ? 340 THR B CA  1 
ATOM   6975  C  C   . THR B 1 309 ? 61.223  12.641  -2.273  1.00 2.18  ? 340 THR B C   1 
ATOM   6976  O  O   . THR B 1 309 ? 62.299  12.643  -1.703  1.00 3.31  ? 340 THR B O   1 
ATOM   6977  C  CB  . THR B 1 309 ? 60.626  14.174  -4.151  1.00 2.00  ? 340 THR B CB  1 
ATOM   6978  O  OG1 . THR B 1 309 ? 60.829  14.427  -5.550  1.00 2.57  ? 340 THR B OG1 1 
ATOM   6979  C  CG2 . THR B 1 309 ? 61.336  15.201  -3.339  1.00 2.12  ? 340 THR B CG2 1 
ATOM   6980  N  N   . ILE B 1 310 ? 60.103  12.514  -1.600  1.00 2.63  ? 341 ILE B N   1 
ATOM   6981  C  CA  . ILE B 1 310 ? 60.180  12.364  -0.158  1.00 4.39  ? 341 ILE B CA  1 
ATOM   6982  C  C   . ILE B 1 310 ? 60.859  11.020  0.194   1.00 5.06  ? 341 ILE B C   1 
ATOM   6983  O  O   . ILE B 1 310 ? 61.588  10.931  1.186   1.00 5.58  ? 341 ILE B O   1 
ATOM   6984  C  CB  . ILE B 1 310 ? 58.775  12.487  0.517   1.00 4.29  ? 341 ILE B CB  1 
ATOM   6985  C  CG1 . ILE B 1 310 ? 58.130  13.817  0.111   1.00 2.05  ? 341 ILE B CG1 1 
ATOM   6986  C  CG2 . ILE B 1 310 ? 58.909  12.400  2.035   1.00 2.00  ? 341 ILE B CG2 1 
ATOM   6987  C  CD1 . ILE B 1 310 ? 56.789  14.108  0.720   1.00 2.00  ? 341 ILE B CD1 1 
ATOM   6988  N  N   . LYS B 1 311 ? 60.667  10.009  -0.659  1.00 4.02  ? 342 LYS B N   1 
ATOM   6989  C  CA  . LYS B 1 311 ? 61.242  8.664   -0.462  1.00 4.14  ? 342 LYS B CA  1 
ATOM   6990  C  C   . LYS B 1 311 ? 62.750  8.738   -0.480  1.00 4.46  ? 342 LYS B C   1 
ATOM   6991  O  O   . LYS B 1 311 ? 63.436  8.302   0.457   1.00 4.44  ? 342 LYS B O   1 
ATOM   6992  C  CB  . LYS B 1 311 ? 60.782  7.741   -1.599  1.00 3.77  ? 342 LYS B CB  1 
ATOM   6993  C  CG  . LYS B 1 311 ? 61.445  6.357   -1.701  1.00 4.64  ? 342 LYS B CG  1 
ATOM   6994  C  CD  . LYS B 1 311 ? 61.274  5.481   -0.452  1.00 3.57  ? 342 LYS B CD  1 
ATOM   6995  C  CE  . LYS B 1 311 ? 61.427  4.016   -0.782  1.00 2.00  ? 342 LYS B CE  1 
ATOM   6996  N  NZ  . LYS B 1 311 ? 61.506  3.259   0.471   1.00 2.00  ? 342 LYS B NZ  1 
ATOM   6997  N  N   . ILE B 1 312 ? 63.251  9.273   -1.584  1.00 4.50  ? 343 ILE B N   1 
ATOM   6998  C  CA  . ILE B 1 312 ? 64.667  9.461   -1.793  1.00 2.38  ? 343 ILE B CA  1 
ATOM   6999  C  C   . ILE B 1 312 ? 65.282  10.433  -0.758  1.00 2.01  ? 343 ILE B C   1 
ATOM   7000  O  O   . ILE B 1 312 ? 66.266  10.112  -0.132  1.00 2.02  ? 343 ILE B O   1 
ATOM   7001  C  CB  . ILE B 1 312 ? 64.898  9.961   -3.205  1.00 2.14  ? 343 ILE B CB  1 
ATOM   7002  C  CG1 . ILE B 1 312 ? 64.414  8.915   -4.200  1.00 2.00  ? 343 ILE B CG1 1 
ATOM   7003  C  CG2 . ILE B 1 312 ? 66.333  10.359  -3.399  1.00 2.00  ? 343 ILE B CG2 1 
ATOM   7004  C  CD1 . ILE B 1 312 ? 64.725  9.251   -5.651  1.00 2.02  ? 343 ILE B CD1 1 
ATOM   7005  N  N   . VAL B 1 313 ? 64.678  11.585  -0.520  1.00 2.00  ? 344 VAL B N   1 
ATOM   7006  C  CA  . VAL B 1 313 ? 65.246  12.504  0.450   1.00 4.72  ? 344 VAL B CA  1 
ATOM   7007  C  C   . VAL B 1 313 ? 65.400  11.942  1.870   1.00 5.95  ? 344 VAL B C   1 
ATOM   7008  O  O   . VAL B 1 313 ? 66.292  12.365  2.595   1.00 10.52 ? 344 VAL B O   1 
ATOM   7009  C  CB  . VAL B 1 313 ? 64.508  13.894  0.462   1.00 2.95  ? 344 VAL B CB  1 
ATOM   7010  C  CG1 . VAL B 1 313 ? 64.967  14.759  1.647   1.00 2.00  ? 344 VAL B CG1 1 
ATOM   7011  C  CG2 . VAL B 1 313 ? 64.798  14.628  -0.838  1.00 2.00  ? 344 VAL B CG2 1 
ATOM   7012  N  N   . ILE B 1 314 ? 64.583  10.990  2.285   1.00 5.24  ? 345 ILE B N   1 
ATOM   7013  C  CA  . ILE B 1 314 ? 64.737  10.469  3.643   1.00 7.22  ? 345 ILE B CA  1 
ATOM   7014  C  C   . ILE B 1 314 ? 65.665  9.245   3.696   1.00 10.04 ? 345 ILE B C   1 
ATOM   7015  O  O   . ILE B 1 314 ? 66.545  9.135   4.568   1.00 9.11  ? 345 ILE B O   1 
ATOM   7016  C  CB  . ILE B 1 314 ? 63.353  10.120  4.290   1.00 7.86  ? 345 ILE B CB  1 
ATOM   7017  C  CG1 . ILE B 1 314 ? 62.760  11.350  4.951   1.00 8.62  ? 345 ILE B CG1 1 
ATOM   7018  C  CG2 . ILE B 1 314 ? 63.458  9.018   5.363   1.00 6.65  ? 345 ILE B CG2 1 
ATOM   7019  C  CD1 . ILE B 1 314 ? 61.321  11.118  5.457   1.00 7.94  ? 345 ILE B CD1 1 
ATOM   7020  N  N   . GLU B 1 315 ? 65.505  8.347   2.732   1.00 12.28 ? 346 GLU B N   1 
ATOM   7021  C  CA  . GLU B 1 315 ? 66.285  7.119   2.717   1.00 11.29 ? 346 GLU B CA  1 
ATOM   7022  C  C   . GLU B 1 315 ? 67.689  7.116   2.058   1.00 6.72  ? 346 GLU B C   1 
ATOM   7023  O  O   . GLU B 1 315 ? 68.508  6.237   2.323   1.00 7.65  ? 346 GLU B O   1 
ATOM   7024  C  CB  . GLU B 1 315 ? 65.371  5.971   2.262   1.00 15.44 ? 346 GLU B CB  1 
ATOM   7025  C  CG  . GLU B 1 315 ? 64.113  5.861   3.163   1.00 17.44 ? 346 GLU B CG  1 
ATOM   7026  C  CD  . GLU B 1 315 ? 63.443  4.497   3.125   1.00 21.73 ? 346 GLU B CD  1 
ATOM   7027  O  OE1 . GLU B 1 315 ? 64.059  3.538   3.638   1.00 26.13 ? 346 GLU B OE1 1 
ATOM   7028  O  OE2 . GLU B 1 315 ? 62.303  4.384   2.613   1.00 19.31 ? 346 GLU B OE2 1 
ATOM   7029  N  N   . ASP B 1 316 ? 67.978  8.115   1.245   1.00 3.44  ? 347 ASP B N   1 
ATOM   7030  C  CA  . ASP B 1 316 ? 69.294  8.255   0.628   1.00 3.24  ? 347 ASP B CA  1 
ATOM   7031  C  C   . ASP B 1 316 ? 69.997  9.522   1.158   1.00 5.22  ? 347 ASP B C   1 
ATOM   7032  O  O   . ASP B 1 316 ? 70.886  9.453   2.017   1.00 4.60  ? 347 ASP B O   1 
ATOM   7033  C  CB  . ASP B 1 316 ? 69.166  8.339   -0.886  1.00 2.00  ? 347 ASP B CB  1 
ATOM   7034  C  CG  . ASP B 1 316 ? 68.639  7.091   -1.470  1.00 2.00  ? 347 ASP B CG  1 
ATOM   7035  O  OD1 . ASP B 1 316 ? 68.668  6.063   -0.773  1.00 3.89  ? 347 ASP B OD1 1 
ATOM   7036  O  OD2 . ASP B 1 316 ? 68.201  7.117   -2.626  1.00 2.05  ? 347 ASP B OD2 1 
ATOM   7037  N  N   . TYR B 1 317 ? 69.564  10.668  0.642   1.00 3.70  ? 348 TYR B N   1 
ATOM   7038  C  CA  . TYR B 1 317 ? 70.066  11.964  1.013   1.00 2.00  ? 348 TYR B CA  1 
ATOM   7039  C  C   . TYR B 1 317 ? 70.211  12.161  2.527   1.00 2.00  ? 348 TYR B C   1 
ATOM   7040  O  O   . TYR B 1 317 ? 71.294  12.362  3.017   1.00 6.23  ? 348 TYR B O   1 
ATOM   7041  C  CB  . TYR B 1 317 ? 69.151  13.008  0.407   1.00 2.00  ? 348 TYR B CB  1 
ATOM   7042  C  CG  . TYR B 1 317 ? 69.526  14.440  0.637   1.00 2.00  ? 348 TYR B CG  1 
ATOM   7043  C  CD1 . TYR B 1 317 ? 69.382  15.029  1.897   1.00 2.95  ? 348 TYR B CD1 1 
ATOM   7044  C  CD2 . TYR B 1 317 ? 69.918  15.242  -0.427  1.00 2.63  ? 348 TYR B CD2 1 
ATOM   7045  C  CE1 . TYR B 1 317 ? 69.605  16.382  2.092   1.00 2.00  ? 348 TYR B CE1 1 
ATOM   7046  C  CE2 . TYR B 1 317 ? 70.146  16.598  -0.255  1.00 4.18  ? 348 TYR B CE2 1 
ATOM   7047  C  CZ  . TYR B 1 317 ? 69.985  17.165  1.010   1.00 3.96  ? 348 TYR B CZ  1 
ATOM   7048  O  OH  . TYR B 1 317 ? 70.209  18.515  1.172   1.00 3.36  ? 348 TYR B OH  1 
ATOM   7049  N  N   . VAL B 1 318 ? 69.148  12.139  3.288   1.00 2.00  ? 349 VAL B N   1 
ATOM   7050  C  CA  . VAL B 1 318 ? 69.327  12.333  4.714   1.00 2.29  ? 349 VAL B CA  1 
ATOM   7051  C  C   . VAL B 1 318 ? 70.091  11.171  5.341   1.00 3.07  ? 349 VAL B C   1 
ATOM   7052  O  O   . VAL B 1 318 ? 70.956  11.365  6.196   1.00 2.07  ? 349 VAL B O   1 
ATOM   7053  C  CB  . VAL B 1 318 ? 67.978  12.519  5.426   1.00 2.00  ? 349 VAL B CB  1 
ATOM   7054  C  CG1 . VAL B 1 318 ? 68.128  12.357  6.939   1.00 2.00  ? 349 VAL B CG1 1 
ATOM   7055  C  CG2 . VAL B 1 318 ? 67.426  13.875  5.102   1.00 2.00  ? 349 VAL B CG2 1 
ATOM   7056  N  N   . GLN B 1 319 ? 69.766  9.958   4.911   1.00 6.14  ? 350 GLN B N   1 
ATOM   7057  C  CA  . GLN B 1 319 ? 70.402  8.744   5.431   1.00 6.59  ? 350 GLN B CA  1 
ATOM   7058  C  C   . GLN B 1 319 ? 71.906  8.873   5.366   1.00 5.76  ? 350 GLN B C   1 
ATOM   7059  O  O   . GLN B 1 319 ? 72.585  8.651   6.356   1.00 6.22  ? 350 GLN B O   1 
ATOM   7060  C  CB  . GLN B 1 319 ? 69.956  7.523   4.631   1.00 5.73  ? 350 GLN B CB  1 
ATOM   7061  C  CG  . GLN B 1 319 ? 70.637  6.269   5.044   1.00 8.05  ? 350 GLN B CG  1 
ATOM   7062  C  CD  . GLN B 1 319 ? 69.897  5.527   6.142   1.00 12.03 ? 350 GLN B CD  1 
ATOM   7063  O  OE1 . GLN B 1 319 ? 70.075  5.792   7.343   1.00 5.11  ? 350 GLN B OE1 1 
ATOM   7064  N  NE2 . GLN B 1 319 ? 69.067  4.558   5.727   1.00 15.27 ? 350 GLN B NE2 1 
ATOM   7065  N  N   . HIS B 1 320 ? 72.407  9.264   4.196   1.00 5.80  ? 351 HIS B N   1 
ATOM   7066  C  CA  . HIS B 1 320 ? 73.838  9.469   3.947   1.00 5.08  ? 351 HIS B CA  1 
ATOM   7067  C  C   . HIS B 1 320 ? 74.365  10.606  4.827   1.00 4.15  ? 351 HIS B C   1 
ATOM   7068  O  O   . HIS B 1 320 ? 75.175  10.412  5.721   1.00 5.73  ? 351 HIS B O   1 
ATOM   7069  C  CB  . HIS B 1 320 ? 74.042  9.806   2.472   1.00 6.00  ? 351 HIS B CB  1 
ATOM   7070  C  CG  . HIS B 1 320 ? 75.393  10.360  2.148   1.00 7.83  ? 351 HIS B CG  1 
ATOM   7071  N  ND1 . HIS B 1 320 ? 75.727  11.681  2.362   1.00 10.27 ? 351 HIS B ND1 1 
ATOM   7072  C  CD2 . HIS B 1 320 ? 76.474  9.787   1.568   1.00 7.09  ? 351 HIS B CD2 1 
ATOM   7073  C  CE1 . HIS B 1 320 ? 76.954  11.898  1.922   1.00 7.56  ? 351 HIS B CE1 1 
ATOM   7074  N  NE2 . HIS B 1 320 ? 77.427  10.765  1.435   1.00 7.61  ? 351 HIS B NE2 1 
ATOM   7075  N  N   . LEU B 1 321 ? 73.873  11.795  4.568   1.00 2.87  ? 352 LEU B N   1 
ATOM   7076  C  CA  . LEU B 1 321 ? 74.228  12.967  5.303   1.00 2.00  ? 352 LEU B CA  1 
ATOM   7077  C  C   . LEU B 1 321 ? 74.239  12.712  6.799   1.00 2.00  ? 352 LEU B C   1 
ATOM   7078  O  O   . LEU B 1 321 ? 74.865  13.451  7.520   1.00 2.01  ? 352 LEU B O   1 
ATOM   7079  C  CB  . LEU B 1 321 ? 73.210  14.038  4.962   1.00 4.21  ? 352 LEU B CB  1 
ATOM   7080  C  CG  . LEU B 1 321 ? 73.576  15.495  5.086   1.00 7.62  ? 352 LEU B CG  1 
ATOM   7081  C  CD1 . LEU B 1 321 ? 74.984  15.697  4.629   1.00 10.01 ? 352 LEU B CD1 1 
ATOM   7082  C  CD2 . LEU B 1 321 ? 72.641  16.276  4.208   1.00 10.87 ? 352 LEU B CD2 1 
ATOM   7083  N  N   . SER B 1 322 ? 73.551  11.685  7.282   1.00 3.30  ? 353 SER B N   1 
ATOM   7084  C  CA  . SER B 1 322 ? 73.537  11.421  8.731   1.00 6.49  ? 353 SER B CA  1 
ATOM   7085  C  C   . SER B 1 322 ? 74.730  10.597  9.189   1.00 10.26 ? 353 SER B C   1 
ATOM   7086  O  O   . SER B 1 322 ? 75.384  10.935  10.191  1.00 12.26 ? 353 SER B O   1 
ATOM   7087  C  CB  . SER B 1 322 ? 72.243  10.715  9.165   1.00 2.04  ? 353 SER B CB  1 
ATOM   7088  O  OG  . SER B 1 322 ? 72.357  9.312   9.128   1.00 2.00  ? 353 SER B OG  1 
ATOM   7089  N  N   . GLY B 1 323 ? 75.005  9.530   8.431   1.00 13.37 ? 354 GLY B N   1 
ATOM   7090  C  CA  . GLY B 1 323 ? 76.071  8.598   8.746   1.00 15.16 ? 354 GLY B CA  1 
ATOM   7091  C  C   . GLY B 1 323 ? 75.526  7.841   9.943   1.00 18.43 ? 354 GLY B C   1 
ATOM   7092  O  O   . GLY B 1 323 ? 76.120  7.877   11.036  1.00 20.04 ? 354 GLY B O   1 
ATOM   7093  N  N   . TYR B 1 324 ? 74.429  7.106   9.744   1.00 18.00 ? 355 TYR B N   1 
ATOM   7094  C  CA  . TYR B 1 324 ? 73.800  6.467   10.885  1.00 18.30 ? 355 TYR B CA  1 
ATOM   7095  C  C   . TYR B 1 324 ? 73.876  5.011   11.253  1.00 18.63 ? 355 TYR B C   1 
ATOM   7096  O  O   . TYR B 1 324 ? 73.719  4.704   12.435  1.00 19.18 ? 355 TYR B O   1 
ATOM   7097  C  CB  . TYR B 1 324 ? 72.334  6.935   11.003  1.00 19.17 ? 355 TYR B CB  1 
ATOM   7098  C  CG  . TYR B 1 324 ? 72.179  8.219   11.775  1.00 17.60 ? 355 TYR B CG  1 
ATOM   7099  C  CD1 . TYR B 1 324 ? 73.267  9.048   11.978  1.00 19.50 ? 355 TYR B CD1 1 
ATOM   7100  C  CD2 . TYR B 1 324 ? 70.958  8.587   12.324  1.00 17.62 ? 355 TYR B CD2 1 
ATOM   7101  C  CE1 . TYR B 1 324 ? 73.162  10.206  12.701  1.00 23.38 ? 355 TYR B CE1 1 
ATOM   7102  C  CE2 . TYR B 1 324 ? 70.827  9.767   13.065  1.00 19.65 ? 355 TYR B CE2 1 
ATOM   7103  C  CZ  . TYR B 1 324 ? 71.941  10.574  13.250  1.00 22.68 ? 355 TYR B CZ  1 
ATOM   7104  O  OH  . TYR B 1 324 ? 71.868  11.754  13.986  1.00 26.16 ? 355 TYR B OH  1 
ATOM   7105  N  N   . HIS B 1 325 ? 74.090  4.107   10.300  1.00 20.35 ? 356 HIS B N   1 
ATOM   7106  C  CA  . HIS B 1 325 ? 74.109  2.641   10.609  1.00 24.75 ? 356 HIS B CA  1 
ATOM   7107  C  C   . HIS B 1 325 ? 72.679  2.109   10.719  1.00 26.85 ? 356 HIS B C   1 
ATOM   7108  O  O   . HIS B 1 325 ? 72.393  0.981   10.282  1.00 29.65 ? 356 HIS B O   1 
ATOM   7109  C  CB  . HIS B 1 325 ? 74.860  2.269   11.907  1.00 22.74 ? 356 HIS B CB  1 
ATOM   7110  C  CG  . HIS B 1 325 ? 76.338  2.190   11.735  1.00 22.70 ? 356 HIS B CG  1 
ATOM   7111  N  ND1 . HIS B 1 325 ? 77.182  1.859   12.768  1.00 21.76 ? 356 HIS B ND1 1 
ATOM   7112  C  CD2 . HIS B 1 325 ? 77.127  2.419   10.655  1.00 21.24 ? 356 HIS B CD2 1 
ATOM   7113  C  CE1 . HIS B 1 325 ? 78.431  1.890   12.335  1.00 24.22 ? 356 HIS B CE1 1 
ATOM   7114  N  NE2 . HIS B 1 325 ? 78.424  2.226   11.056  1.00 23.10 ? 356 HIS B NE2 1 
ATOM   7115  N  N   . PHE B 1 326 ? 71.816  2.875   11.391  1.00 25.53 ? 357 PHE B N   1 
ATOM   7116  C  CA  . PHE B 1 326 ? 70.416  2.529   11.494  1.00 21.58 ? 357 PHE B CA  1 
ATOM   7117  C  C   . PHE B 1 326 ? 69.795  3.059   10.210  1.00 21.06 ? 357 PHE B C   1 
ATOM   7118  O  O   . PHE B 1 326 ? 70.008  4.231   9.868   1.00 19.83 ? 357 PHE B O   1 
ATOM   7119  C  CB  . PHE B 1 326 ? 69.749  3.252   12.655  1.00 19.48 ? 357 PHE B CB  1 
ATOM   7120  C  CG  . PHE B 1 326 ? 68.250  3.146   12.625  1.00 18.43 ? 357 PHE B CG  1 
ATOM   7121  C  CD1 . PHE B 1 326 ? 67.629  1.898   12.580  1.00 18.93 ? 357 PHE B CD1 1 
ATOM   7122  C  CD2 . PHE B 1 326 ? 67.471  4.274   12.578  1.00 16.65 ? 357 PHE B CD2 1 
ATOM   7123  C  CE1 . PHE B 1 326 ? 66.269  1.785   12.487  1.00 15.91 ? 357 PHE B CE1 1 
ATOM   7124  C  CE2 . PHE B 1 326 ? 66.111  4.174   12.485  1.00 15.60 ? 357 PHE B CE2 1 
ATOM   7125  C  CZ  . PHE B 1 326 ? 65.506  2.926   12.438  1.00 17.13 ? 357 PHE B CZ  1 
ATOM   7126  N  N   . LYS B 1 327 ? 69.046  2.222   9.497   1.00 19.41 ? 358 LYS B N   1 
ATOM   7127  C  CA  . LYS B 1 327 ? 68.420  2.689   8.274   1.00 17.45 ? 358 LYS B CA  1 
ATOM   7128  C  C   . LYS B 1 327 ? 67.131  3.447   8.527   1.00 15.02 ? 358 LYS B C   1 
ATOM   7129  O  O   . LYS B 1 327 ? 66.203  2.935   9.141   1.00 14.09 ? 358 LYS B O   1 
ATOM   7130  C  CB  . LYS B 1 327 ? 68.171  1.563   7.295   1.00 20.15 ? 358 LYS B CB  1 
ATOM   7131  C  CG  . LYS B 1 327 ? 69.414  1.021   6.624   1.00 23.37 ? 358 LYS B CG  1 
ATOM   7132  C  CD  . LYS B 1 327 ? 69.049  -0.239  5.795   1.00 28.87 ? 358 LYS B CD  1 
ATOM   7133  C  CE  . LYS B 1 327 ? 68.297  -1.283  6.663   1.00 30.78 ? 358 LYS B CE  1 
ATOM   7134  N  NZ  . LYS B 1 327 ? 68.264  -2.673  6.135   1.00 32.66 ? 358 LYS B NZ  1 
ATOM   7135  N  N   . LEU B 1 328 ? 67.149  4.717   8.147   1.00 14.19 ? 359 LEU B N   1 
ATOM   7136  C  CA  . LEU B 1 328 ? 65.999  5.586   8.257   1.00 12.56 ? 359 LEU B CA  1 
ATOM   7137  C  C   . LEU B 1 328 ? 65.038  5.022   7.221   1.00 15.07 ? 359 LEU B C   1 
ATOM   7138  O  O   . LEU B 1 328 ? 65.465  4.515   6.156   1.00 13.25 ? 359 LEU B O   1 
ATOM   7139  C  CB  . LEU B 1 328 ? 66.379  7.030   7.889   1.00 9.68  ? 359 LEU B CB  1 
ATOM   7140  C  CG  . LEU B 1 328 ? 67.282  7.792   8.870   1.00 6.74  ? 359 LEU B CG  1 
ATOM   7141  C  CD1 . LEU B 1 328 ? 67.650  9.148   8.264   1.00 3.98  ? 359 LEU B CD1 1 
ATOM   7142  C  CD2 . LEU B 1 328 ? 66.591  7.955   10.233  1.00 2.91  ? 359 LEU B CD2 1 
ATOM   7143  N  N   . LYS B 1 329 ? 63.747  5.149   7.519   1.00 16.72 ? 360 LYS B N   1 
ATOM   7144  C  CA  . LYS B 1 329 ? 62.690  4.622   6.654   1.00 16.24 ? 360 LYS B CA  1 
ATOM   7145  C  C   . LYS B 1 329 ? 61.642  5.684   6.435   1.00 13.24 ? 360 LYS B C   1 
ATOM   7146  O  O   . LYS B 1 329 ? 61.402  6.494   7.320   1.00 13.52 ? 360 LYS B O   1 
ATOM   7147  C  CB  . LYS B 1 329 ? 62.042  3.435   7.370   1.00 20.01 ? 360 LYS B CB  1 
ATOM   7148  C  CG  . LYS B 1 329 ? 60.917  2.736   6.657   1.00 21.34 ? 360 LYS B CG  1 
ATOM   7149  C  CD  . LYS B 1 329 ? 60.360  1.726   7.635   1.00 24.83 ? 360 LYS B CD  1 
ATOM   7150  C  CE  . LYS B 1 329 ? 59.105  1.019   7.142   1.00 28.22 ? 360 LYS B CE  1 
ATOM   7151  N  NZ  . LYS B 1 329 ? 58.486  0.323   8.315   1.00 31.64 ? 360 LYS B NZ  1 
ATOM   7152  N  N   . PHE B 1 330 ? 61.039  5.696   5.257   1.00 10.03 ? 361 PHE B N   1 
ATOM   7153  C  CA  . PHE B 1 330 ? 59.975  6.643   4.974   1.00 9.73  ? 361 PHE B CA  1 
ATOM   7154  C  C   . PHE B 1 330 ? 58.669  5.871   5.038   1.00 10.33 ? 361 PHE B C   1 
ATOM   7155  O  O   . PHE B 1 330 ? 58.268  5.209   4.071   1.00 10.08 ? 361 PHE B O   1 
ATOM   7156  C  CB  . PHE B 1 330 ? 60.133  7.286   3.591   1.00 10.70 ? 361 PHE B CB  1 
ATOM   7157  C  CG  . PHE B 1 330 ? 58.901  8.035   3.102   1.00 13.14 ? 361 PHE B CG  1 
ATOM   7158  C  CD1 . PHE B 1 330 ? 58.276  9.023   3.898   1.00 15.23 ? 361 PHE B CD1 1 
ATOM   7159  C  CD2 . PHE B 1 330 ? 58.371  7.765   1.832   1.00 12.95 ? 361 PHE B CD2 1 
ATOM   7160  C  CE1 . PHE B 1 330 ? 57.136  9.729   3.423   1.00 14.37 ? 361 PHE B CE1 1 
ATOM   7161  C  CE2 . PHE B 1 330 ? 57.237  8.462   1.340   1.00 12.78 ? 361 PHE B CE2 1 
ATOM   7162  C  CZ  . PHE B 1 330 ? 56.619  9.443   2.133   1.00 13.16 ? 361 PHE B CZ  1 
ATOM   7163  N  N   . ASP B 1 331 ? 58.015  5.941   6.188   1.00 10.34 ? 362 ASP B N   1 
ATOM   7164  C  CA  . ASP B 1 331 ? 56.759  5.258   6.353   1.00 10.10 ? 362 ASP B CA  1 
ATOM   7165  C  C   . ASP B 1 331 ? 55.757  6.139   7.092   1.00 10.03 ? 362 ASP B C   1 
ATOM   7166  O  O   . ASP B 1 331 ? 55.652  6.060   8.330   1.00 10.14 ? 362 ASP B O   1 
ATOM   7167  C  CB  . ASP B 1 331 ? 56.986  3.978   7.113   1.00 13.61 ? 362 ASP B CB  1 
ATOM   7168  C  CG  . ASP B 1 331 ? 55.751  3.151   7.191   1.00 19.05 ? 362 ASP B CG  1 
ATOM   7169  O  OD1 . ASP B 1 331 ? 54.882  3.293   6.282   1.00 21.83 ? 362 ASP B OD1 1 
ATOM   7170  O  OD2 . ASP B 1 331 ? 55.641  2.368   8.162   1.00 19.72 ? 362 ASP B OD2 1 
ATOM   7171  N  N   . PRO B 1 332 ? 54.944  6.916   6.335   1.00 6.55  ? 363 PRO B N   1 
ATOM   7172  C  CA  . PRO B 1 332 ? 53.913  7.848   6.816   1.00 7.29  ? 363 PRO B CA  1 
ATOM   7173  C  C   . PRO B 1 332 ? 53.082  7.402   8.023   1.00 8.35  ? 363 PRO B C   1 
ATOM   7174  O  O   . PRO B 1 332 ? 52.608  8.219   8.832   1.00 8.39  ? 363 PRO B O   1 
ATOM   7175  C  CB  . PRO B 1 332 ? 53.047  8.036   5.580   1.00 7.45  ? 363 PRO B CB  1 
ATOM   7176  C  CG  . PRO B 1 332 ? 54.068  7.976   4.471   1.00 3.64  ? 363 PRO B CG  1 
ATOM   7177  C  CD  . PRO B 1 332 ? 54.868  6.784   4.868   1.00 3.82  ? 363 PRO B CD  1 
ATOM   7178  N  N   . GLU B 1 333 ? 52.996  6.098   8.190   1.00 8.36  ? 364 GLU B N   1 
ATOM   7179  C  CA  . GLU B 1 333 ? 52.218  5.528   9.261   1.00 9.67  ? 364 GLU B CA  1 
ATOM   7180  C  C   . GLU B 1 333 ? 52.781  5.639   10.650  1.00 7.81  ? 364 GLU B C   1 
ATOM   7181  O  O   . GLU B 1 333 ? 52.048  5.671   11.625  1.00 7.54  ? 364 GLU B O   1 
ATOM   7182  C  CB  . GLU B 1 333 ? 51.935  4.075   8.940   1.00 13.89 ? 364 GLU B CB  1 
ATOM   7183  C  CG  . GLU B 1 333 ? 51.458  3.943   7.527   1.00 22.13 ? 364 GLU B CG  1 
ATOM   7184  C  CD  . GLU B 1 333 ? 50.784  2.651   7.275   1.00 26.00 ? 364 GLU B CD  1 
ATOM   7185  O  OE1 . GLU B 1 333 ? 50.190  2.089   8.255   1.00 24.63 ? 364 GLU B OE1 1 
ATOM   7186  O  OE2 . GLU B 1 333 ? 50.860  2.235   6.081   1.00 27.39 ? 364 GLU B OE2 1 
ATOM   7187  N  N   . LEU B 1 334 ? 54.082  5.721   10.769  1.00 8.26  ? 365 LEU B N   1 
ATOM   7188  C  CA  . LEU B 1 334 ? 54.648  5.774   12.106  1.00 9.31  ? 365 LEU B CA  1 
ATOM   7189  C  C   . LEU B 1 334 ? 54.019  6.927   12.884  1.00 9.33  ? 365 LEU B C   1 
ATOM   7190  O  O   . LEU B 1 334 ? 53.973  6.933   14.120  1.00 8.95  ? 365 LEU B O   1 
ATOM   7191  C  CB  . LEU B 1 334 ? 56.161  5.901   12.010  1.00 9.82  ? 365 LEU B CB  1 
ATOM   7192  C  CG  . LEU B 1 334 ? 56.721  4.858   11.059  1.00 9.24  ? 365 LEU B CG  1 
ATOM   7193  C  CD1 . LEU B 1 334 ? 58.063  5.285   10.516  1.00 10.70 ? 365 LEU B CD1 1 
ATOM   7194  C  CD2 . LEU B 1 334 ? 56.772  3.539   11.800  1.00 9.39  ? 365 LEU B CD2 1 
ATOM   7195  N  N   . LEU B 1 335 ? 53.477  7.881   12.139  1.00 8.40  ? 366 LEU B N   1 
ATOM   7196  C  CA  . LEU B 1 335 ? 52.842  9.040   12.749  1.00 8.58  ? 366 LEU B CA  1 
ATOM   7197  C  C   . LEU B 1 335 ? 51.317  8.927   12.887  1.00 9.20  ? 366 LEU B C   1 
ATOM   7198  O  O   . LEU B 1 335 ? 50.723  9.615   13.723  1.00 6.53  ? 366 LEU B O   1 
ATOM   7199  C  CB  . LEU B 1 335 ? 53.225  10.302  11.984  1.00 6.91  ? 366 LEU B CB  1 
ATOM   7200  C  CG  . LEU B 1 335 ? 54.684  10.680  12.142  1.00 2.00  ? 366 LEU B CG  1 
ATOM   7201  C  CD1 . LEU B 1 335 ? 54.883  11.964  11.447  1.00 2.02  ? 366 LEU B CD1 1 
ATOM   7202  C  CD2 . LEU B 1 335 ? 55.042  10.791  13.595  1.00 2.03  ? 366 LEU B CD2 1 
ATOM   7203  N  N   . PHE B 1 336 ? 50.700  8.032   12.102  1.00 9.51  ? 367 PHE B N   1 
ATOM   7204  C  CA  . PHE B 1 336 ? 49.246  7.808   12.134  1.00 7.11  ? 367 PHE B CA  1 
ATOM   7205  C  C   . PHE B 1 336 ? 48.664  7.681   13.545  1.00 8.26  ? 367 PHE B C   1 
ATOM   7206  O  O   . PHE B 1 336 ? 47.460  7.810   13.723  1.00 12.71 ? 367 PHE B O   1 
ATOM   7207  C  CB  . PHE B 1 336 ? 48.809  6.584   11.316  1.00 3.30  ? 367 PHE B CB  1 
ATOM   7208  C  CG  . PHE B 1 336 ? 48.780  6.804   9.836   1.00 2.00  ? 367 PHE B CG  1 
ATOM   7209  C  CD1 . PHE B 1 336 ? 49.237  7.971   9.279   1.00 2.00  ? 367 PHE B CD1 1 
ATOM   7210  C  CD2 . PHE B 1 336 ? 48.350  5.796   8.990   1.00 2.00  ? 367 PHE B CD2 1 
ATOM   7211  C  CE1 . PHE B 1 336 ? 49.276  8.132   7.875   1.00 3.31  ? 367 PHE B CE1 1 
ATOM   7212  C  CE2 . PHE B 1 336 ? 48.383  5.943   7.590   1.00 2.00  ? 367 PHE B CE2 1 
ATOM   7213  C  CZ  . PHE B 1 336 ? 48.850  7.113   7.033   1.00 2.00  ? 367 PHE B CZ  1 
ATOM   7214  N  N   . ASN B 1 337 ? 49.468  7.387   14.549  1.00 5.88  ? 368 ASN B N   1 
ATOM   7215  C  CA  . ASN B 1 337 ? 48.900  7.313   15.876  1.00 5.91  ? 368 ASN B CA  1 
ATOM   7216  C  C   . ASN B 1 337 ? 49.617  8.269   16.795  1.00 7.03  ? 368 ASN B C   1 
ATOM   7217  O  O   . ASN B 1 337 ? 49.872  7.978   17.971  1.00 7.71  ? 368 ASN B O   1 
ATOM   7218  C  CB  . ASN B 1 337 ? 48.870  5.872   16.419  1.00 7.99  ? 368 ASN B CB  1 
ATOM   7219  C  CG  . ASN B 1 337 ? 50.242  5.208   16.481  1.00 10.00 ? 368 ASN B CG  1 
ATOM   7220  O  OD1 . ASN B 1 337 ? 51.094  5.388   15.584  1.00 11.78 ? 368 ASN B OD1 1 
ATOM   7221  N  ND2 . ASN B 1 337 ? 50.434  4.368   17.508  1.00 2.02  ? 368 ASN B ND2 1 
ATOM   7222  N  N   . GLN B 1 338 ? 49.932  9.437   16.253  1.00 7.50  ? 369 GLN B N   1 
ATOM   7223  C  CA  . GLN B 1 338 ? 50.638  10.452  17.022  1.00 9.75  ? 369 GLN B CA  1 
ATOM   7224  C  C   . GLN B 1 338 ? 49.983  11.772  16.710  1.00 10.19 ? 369 GLN B C   1 
ATOM   7225  O  O   . GLN B 1 338 ? 49.344  11.930  15.655  1.00 11.17 ? 369 GLN B O   1 
ATOM   7226  C  CB  . GLN B 1 338 ? 52.112  10.618  16.557  1.00 13.23 ? 369 GLN B CB  1 
ATOM   7227  C  CG  . GLN B 1 338 ? 52.912  9.387   16.099  1.00 9.57  ? 369 GLN B CG  1 
ATOM   7228  C  CD  . GLN B 1 338 ? 53.310  8.545   17.242  1.00 7.49  ? 369 GLN B CD  1 
ATOM   7229  O  OE1 . GLN B 1 338 ? 53.576  9.055   18.333  1.00 5.96  ? 369 GLN B OE1 1 
ATOM   7230  N  NE2 . GLN B 1 338 ? 53.324  7.244   17.030  1.00 6.85  ? 369 GLN B NE2 1 
ATOM   7231  N  N   . GLN B 1 339 ? 50.155  12.723  17.621  1.00 9.84  ? 370 GLN B N   1 
ATOM   7232  C  CA  . GLN B 1 339 ? 49.666  14.068  17.395  1.00 12.65 ? 370 GLN B CA  1 
ATOM   7233  C  C   . GLN B 1 339 ? 50.701  14.631  16.388  1.00 11.96 ? 370 GLN B C   1 
ATOM   7234  O  O   . GLN B 1 339 ? 51.909  14.563  16.630  1.00 13.12 ? 370 GLN B O   1 
ATOM   7235  C  CB  . GLN B 1 339 ? 49.715  14.880  18.688  1.00 15.91 ? 370 GLN B CB  1 
ATOM   7236  C  CG  . GLN B 1 339 ? 49.093  14.198  19.892  1.00 24.78 ? 370 GLN B CG  1 
ATOM   7237  C  CD  . GLN B 1 339 ? 49.091  15.089  21.164  1.00 31.24 ? 370 GLN B CD  1 
ATOM   7238  O  OE1 . GLN B 1 339 ? 50.112  15.208  21.863  1.00 32.59 ? 370 GLN B OE1 1 
ATOM   7239  N  NE2 . GLN B 1 339 ? 47.934  15.706  21.466  1.00 33.28 ? 370 GLN B NE2 1 
ATOM   7240  N  N   . PHE B 1 340 ? 50.254  15.113  15.240  1.00 9.31  ? 371 PHE B N   1 
ATOM   7241  C  CA  . PHE B 1 340 ? 51.194  15.638  14.261  1.00 8.42  ? 371 PHE B CA  1 
ATOM   7242  C  C   . PHE B 1 340 ? 50.481  16.537  13.244  1.00 8.76  ? 371 PHE B C   1 
ATOM   7243  O  O   . PHE B 1 340 ? 49.587  16.107  12.517  1.00 10.32 ? 371 PHE B O   1 
ATOM   7244  C  CB  . PHE B 1 340 ? 51.947  14.491  13.554  1.00 3.64  ? 371 PHE B CB  1 
ATOM   7245  C  CG  . PHE B 1 340 ? 52.920  14.951  12.501  1.00 3.33  ? 371 PHE B CG  1 
ATOM   7246  C  CD1 . PHE B 1 340 ? 54.179  15.427  12.867  1.00 2.90  ? 371 PHE B CD1 1 
ATOM   7247  C  CD2 . PHE B 1 340 ? 52.585  14.902  11.129  1.00 3.89  ? 371 PHE B CD2 1 
ATOM   7248  C  CE1 . PHE B 1 340 ? 55.116  15.855  11.886  1.00 2.03  ? 371 PHE B CE1 1 
ATOM   7249  C  CE2 . PHE B 1 340 ? 53.507  15.322  10.125  1.00 3.32  ? 371 PHE B CE2 1 
ATOM   7250  C  CZ  . PHE B 1 340 ? 54.784  15.803  10.511  1.00 2.00  ? 371 PHE B CZ  1 
ATOM   7251  N  N   . GLN B 1 341 ? 50.897  17.792  13.189  1.00 7.59  ? 372 GLN B N   1 
ATOM   7252  C  CA  . GLN B 1 341 ? 50.313  18.752  12.275  1.00 5.32  ? 372 GLN B CA  1 
ATOM   7253  C  C   . GLN B 1 341 ? 50.822  18.576  10.863  1.00 3.76  ? 372 GLN B C   1 
ATOM   7254  O  O   . GLN B 1 341 ? 51.996  18.751  10.595  1.00 5.94  ? 372 GLN B O   1 
ATOM   7255  C  CB  . GLN B 1 341 ? 50.647  20.157  12.754  1.00 9.39  ? 372 GLN B CB  1 
ATOM   7256  C  CG  . GLN B 1 341 ? 50.174  20.432  14.157  1.00 10.66 ? 372 GLN B CG  1 
ATOM   7257  C  CD  . GLN B 1 341 ? 48.722  20.110  14.302  1.00 9.44  ? 372 GLN B CD  1 
ATOM   7258  O  OE1 . GLN B 1 341 ? 47.887  20.591  13.534  1.00 10.36 ? 372 GLN B OE1 1 
ATOM   7259  N  NE2 . GLN B 1 341 ? 48.412  19.251  15.251  1.00 12.12 ? 372 GLN B NE2 1 
ATOM   7260  N  N   . TYR B 1 342 ? 49.931  18.289  9.943   1.00 2.00  ? 373 TYR B N   1 
ATOM   7261  C  CA  . TYR B 1 342 ? 50.338  18.110  8.568   1.00 3.53  ? 373 TYR B CA  1 
ATOM   7262  C  C   . TYR B 1 342 ? 50.418  19.405  7.800   1.00 4.13  ? 373 TYR B C   1 
ATOM   7263  O  O   . TYR B 1 342 ? 49.881  19.525  6.687   1.00 3.14  ? 373 TYR B O   1 
ATOM   7264  C  CB  . TYR B 1 342 ? 49.403  17.153  7.869   1.00 3.20  ? 373 TYR B CB  1 
ATOM   7265  C  CG  . TYR B 1 342 ? 49.720  15.736  8.181   1.00 5.72  ? 373 TYR B CG  1 
ATOM   7266  C  CD1 . TYR B 1 342 ? 49.196  15.129  9.322   1.00 8.83  ? 373 TYR B CD1 1 
ATOM   7267  C  CD2 . TYR B 1 342 ? 50.496  14.974  7.311   1.00 5.15  ? 373 TYR B CD2 1 
ATOM   7268  C  CE1 . TYR B 1 342 ? 49.428  13.769  9.595   1.00 10.46 ? 373 TYR B CE1 1 
ATOM   7269  C  CE2 . TYR B 1 342 ? 50.730  13.633  7.559   1.00 9.06  ? 373 TYR B CE2 1 
ATOM   7270  C  CZ  . TYR B 1 342 ? 50.191  13.026  8.701   1.00 11.71 ? 373 TYR B CZ  1 
ATOM   7271  O  OH  . TYR B 1 342 ? 50.382  11.674  8.926   1.00 14.43 ? 373 TYR B OH  1 
ATOM   7272  N  N   . GLN B 1 343 ? 51.068  20.387  8.409   1.00 5.28  ? 374 GLN B N   1 
ATOM   7273  C  CA  . GLN B 1 343 ? 51.232  21.675  7.762   1.00 8.55  ? 374 GLN B CA  1 
ATOM   7274  C  C   . GLN B 1 343 ? 52.690  22.063  7.950   1.00 9.84  ? 374 GLN B C   1 
ATOM   7275  O  O   . GLN B 1 343 ? 53.368  21.489  8.804   1.00 8.72  ? 374 GLN B O   1 
ATOM   7276  C  CB  . GLN B 1 343 ? 50.277  22.723  8.367   1.00 6.86  ? 374 GLN B CB  1 
ATOM   7277  C  CG  . GLN B 1 343 ? 50.652  23.213  9.728   1.00 11.44 ? 374 GLN B CG  1 
ATOM   7278  C  CD  . GLN B 1 343 ? 49.484  23.818  10.471  1.00 14.21 ? 374 GLN B CD  1 
ATOM   7279  O  OE1 . GLN B 1 343 ? 49.211  25.021  10.388  1.00 16.62 ? 374 GLN B OE1 1 
ATOM   7280  N  NE2 . GLN B 1 343 ? 48.793  22.983  11.227  1.00 17.89 ? 374 GLN B NE2 1 
ATOM   7281  N  N   . ASN B 1 344 ? 53.170  23.022  7.151   1.00 12.48 ? 375 ASN B N   1 
ATOM   7282  C  CA  . ASN B 1 344 ? 54.564  23.487  7.232   1.00 9.85  ? 375 ASN B CA  1 
ATOM   7283  C  C   . ASN B 1 344 ? 54.792  24.892  6.610   1.00 8.71  ? 375 ASN B C   1 
ATOM   7284  O  O   . ASN B 1 344 ? 54.161  25.270  5.613   1.00 5.25  ? 375 ASN B O   1 
ATOM   7285  C  CB  . ASN B 1 344 ? 55.470  22.449  6.555   1.00 7.47  ? 375 ASN B CB  1 
ATOM   7286  C  CG  . ASN B 1 344 ? 56.920  22.764  6.705   1.00 5.83  ? 375 ASN B CG  1 
ATOM   7287  O  OD1 . ASN B 1 344 ? 57.468  22.740  7.820   1.00 4.37  ? 375 ASN B OD1 1 
ATOM   7288  N  ND2 . ASN B 1 344 ? 57.565  23.084  5.586   1.00 3.26  ? 375 ASN B ND2 1 
ATOM   7289  N  N   . ARG B 1 345 ? 55.739  25.633  7.180   1.00 9.31  ? 376 ARG B N   1 
ATOM   7290  C  CA  . ARG B 1 345 ? 56.082  26.992  6.727   1.00 9.09  ? 376 ARG B CA  1 
ATOM   7291  C  C   . ARG B 1 345 ? 57.609  27.103  6.794   1.00 11.50 ? 376 ARG B C   1 
ATOM   7292  O  O   . ARG B 1 345 ? 58.173  27.004  7.897   1.00 13.45 ? 376 ARG B O   1 
ATOM   7293  C  CB  . ARG B 1 345 ? 55.494  27.988  7.733   1.00 7.85  ? 376 ARG B CB  1 
ATOM   7294  C  CG  . ARG B 1 345 ? 55.326  29.397  7.260   1.00 2.00  ? 376 ARG B CG  1 
ATOM   7295  C  CD  . ARG B 1 345 ? 54.075  29.509  6.458   1.00 2.94  ? 376 ARG B CD  1 
ATOM   7296  N  NE  . ARG B 1 345 ? 53.360  30.724  6.799   1.00 4.67  ? 376 ARG B NE  1 
ATOM   7297  C  CZ  . ARG B 1 345 ? 52.122  30.758  7.263   1.00 2.60  ? 376 ARG B CZ  1 
ATOM   7298  N  NH1 . ARG B 1 345 ? 51.455  29.631  7.449   1.00 5.82  ? 376 ARG B NH1 1 
ATOM   7299  N  NH2 . ARG B 1 345 ? 51.540  31.920  7.487   1.00 3.66  ? 376 ARG B NH2 1 
ATOM   7300  N  N   . ILE B 1 346 ? 58.286  27.319  5.662   1.00 9.14  ? 377 ILE B N   1 
ATOM   7301  C  CA  . ILE B 1 346 ? 59.753  27.396  5.709   1.00 7.71  ? 377 ILE B CA  1 
ATOM   7302  C  C   . ILE B 1 346 ? 60.235  28.606  6.501   1.00 6.38  ? 377 ILE B C   1 
ATOM   7303  O  O   . ILE B 1 346 ? 59.675  29.705  6.357   1.00 3.99  ? 377 ILE B O   1 
ATOM   7304  C  CB  . ILE B 1 346 ? 60.398  27.373  4.307   1.00 6.97  ? 377 ILE B CB  1 
ATOM   7305  C  CG1 . ILE B 1 346 ? 59.866  28.545  3.506   1.00 8.12  ? 377 ILE B CG1 1 
ATOM   7306  C  CG2 . ILE B 1 346 ? 60.155  26.017  3.615   1.00 2.36  ? 377 ILE B CG2 1 
ATOM   7307  C  CD1 . ILE B 1 346 ? 60.187  28.519  2.060   1.00 8.21  ? 377 ILE B CD1 1 
ATOM   7308  N  N   . ALA B 1 347 ? 61.203  28.359  7.392   1.00 4.87  ? 378 ALA B N   1 
ATOM   7309  C  CA  . ALA B 1 347 ? 61.793  29.384  8.263   1.00 6.04  ? 378 ALA B CA  1 
ATOM   7310  C  C   . ALA B 1 347 ? 63.024  29.998  7.624   1.00 5.53  ? 378 ALA B C   1 
ATOM   7311  O  O   . ALA B 1 347 ? 63.773  29.259  6.970   1.00 7.61  ? 378 ALA B O   1 
ATOM   7312  C  CB  . ALA B 1 347 ? 62.167  28.771  9.601   1.00 2.00  ? 378 ALA B CB  1 
ATOM   7313  N  N   . SER B 1 348 ? 63.264  31.307  7.797   1.00 3.15  ? 379 SER B N   1 
ATOM   7314  C  CA  . SER B 1 348 ? 64.470  31.866  7.192   1.00 6.15  ? 379 SER B CA  1 
ATOM   7315  C  C   . SER B 1 348 ? 65.697  31.138  7.748   1.00 6.23  ? 379 SER B C   1 
ATOM   7316  O  O   . SER B 1 348 ? 66.582  30.772  6.973   1.00 6.00  ? 379 SER B O   1 
ATOM   7317  C  CB  . SER B 1 348 ? 64.579  33.389  7.343   1.00 6.75  ? 379 SER B CB  1 
ATOM   7318  O  OG  . SER B 1 348 ? 63.873  33.853  8.485   1.00 10.89 ? 379 SER B OG  1 
ATOM   7319  N  N   . GLU B 1 349 ? 65.684  30.818  9.048   1.00 3.41  ? 380 GLU B N   1 
ATOM   7320  C  CA  . GLU B 1 349 ? 66.784  30.099  9.654   1.00 2.25  ? 380 GLU B CA  1 
ATOM   7321  C  C   . GLU B 1 349 ? 67.130  28.864  8.844   1.00 5.14  ? 380 GLU B C   1 
ATOM   7322  O  O   . GLU B 1 349 ? 68.298  28.659  8.504   1.00 10.92 ? 380 GLU B O   1 
ATOM   7323  C  CB  . GLU B 1 349 ? 66.484  29.716  11.081  1.00 2.00  ? 380 GLU B CB  1 
ATOM   7324  C  CG  . GLU B 1 349 ? 66.488  30.900  12.032  1.00 6.43  ? 380 GLU B CG  1 
ATOM   7325  C  CD  . GLU B 1 349 ? 65.091  31.451  12.285  1.00 12.06 ? 380 GLU B CD  1 
ATOM   7326  O  OE1 . GLU B 1 349 ? 64.220  31.323  11.383  1.00 15.22 ? 380 GLU B OE1 1 
ATOM   7327  O  OE2 . GLU B 1 349 ? 64.851  31.994  13.394  1.00 11.76 ? 380 GLU B OE2 1 
ATOM   7328  N  N   . PHE B 1 350 ? 66.135  28.067  8.465   1.00 4.14  ? 381 PHE B N   1 
ATOM   7329  C  CA  . PHE B 1 350 ? 66.419  26.874  7.671   1.00 2.86  ? 381 PHE B CA  1 
ATOM   7330  C  C   . PHE B 1 350 ? 67.091  27.327  6.379   1.00 4.13  ? 381 PHE B C   1 
ATOM   7331  O  O   . PHE B 1 350 ? 68.099  26.774  5.968   1.00 5.56  ? 381 PHE B O   1 
ATOM   7332  C  CB  . PHE B 1 350 ? 65.140  26.124  7.342   1.00 2.02  ? 381 PHE B CB  1 
ATOM   7333  C  CG  . PHE B 1 350 ? 65.350  24.703  6.883   1.00 3.66  ? 381 PHE B CG  1 
ATOM   7334  C  CD1 . PHE B 1 350 ? 66.035  23.797  7.685   1.00 5.83  ? 381 PHE B CD1 1 
ATOM   7335  C  CD2 . PHE B 1 350 ? 64.804  24.245  5.681   1.00 3.30  ? 381 PHE B CD2 1 
ATOM   7336  C  CE1 . PHE B 1 350 ? 66.174  22.442  7.314   1.00 2.45  ? 381 PHE B CE1 1 
ATOM   7337  C  CE2 . PHE B 1 350 ? 64.932  22.915  5.303   1.00 2.00  ? 381 PHE B CE2 1 
ATOM   7338  C  CZ  . PHE B 1 350 ? 65.621  22.010  6.131   1.00 2.26  ? 381 PHE B CZ  1 
ATOM   7339  N  N   . ASN B 1 351 ? 66.579  28.393  5.781   1.00 4.17  ? 382 ASN B N   1 
ATOM   7340  C  CA  . ASN B 1 351 ? 67.146  28.877  4.542   1.00 4.53  ? 382 ASN B CA  1 
ATOM   7341  C  C   . ASN B 1 351 ? 68.625  29.191  4.719   1.00 5.14  ? 382 ASN B C   1 
ATOM   7342  O  O   . ASN B 1 351 ? 69.450  28.821  3.877   1.00 3.59  ? 382 ASN B O   1 
ATOM   7343  C  CB  . ASN B 1 351 ? 66.364  30.105  4.062   1.00 4.97  ? 382 ASN B CB  1 
ATOM   7344  C  CG  . ASN B 1 351 ? 66.834  30.605  2.696   1.00 9.97  ? 382 ASN B CG  1 
ATOM   7345  O  OD1 . ASN B 1 351 ? 67.119  31.793  2.522   1.00 16.62 ? 382 ASN B OD1 1 
ATOM   7346  N  ND2 . ASN B 1 351 ? 66.956  29.707  1.741   1.00 9.73  ? 382 ASN B ND2 1 
ATOM   7347  N  N   . THR B 1 352 ? 68.942  29.821  5.855   1.00 5.96  ? 383 THR B N   1 
ATOM   7348  C  CA  . THR B 1 352 ? 70.296  30.263  6.222   1.00 5.51  ? 383 THR B CA  1 
ATOM   7349  C  C   . THR B 1 352 ? 71.247  29.107  6.459   1.00 4.67  ? 383 THR B C   1 
ATOM   7350  O  O   . THR B 1 352 ? 72.209  28.946  5.700   1.00 6.09  ? 383 THR B O   1 
ATOM   7351  C  CB  . THR B 1 352 ? 70.276  31.249  7.462   1.00 6.70  ? 383 THR B CB  1 
ATOM   7352  O  OG1 . THR B 1 352 ? 70.159  32.617  7.014   1.00 5.04  ? 383 THR B OG1 1 
ATOM   7353  C  CG2 . THR B 1 352 ? 71.522  31.084  8.329   1.00 6.00  ? 383 THR B CG2 1 
ATOM   7354  N  N   . LEU B 1 353 ? 70.950  28.259  7.438   1.00 2.66  ? 384 LEU B N   1 
ATOM   7355  C  CA  . LEU B 1 353 ? 71.830  27.130  7.728   1.00 2.61  ? 384 LEU B CA  1 
ATOM   7356  C  C   . LEU B 1 353 ? 72.035  26.217  6.531   1.00 2.40  ? 384 LEU B C   1 
ATOM   7357  O  O   . LEU B 1 353 ? 72.903  25.356  6.540   1.00 4.32  ? 384 LEU B O   1 
ATOM   7358  C  CB  . LEU B 1 353 ? 71.327  26.325  8.922   1.00 2.24  ? 384 LEU B CB  1 
ATOM   7359  C  CG  . LEU B 1 353 ? 70.054  25.483  8.882   1.00 2.76  ? 384 LEU B CG  1 
ATOM   7360  C  CD1 . LEU B 1 353 ? 70.286  24.154  8.172   1.00 2.00  ? 384 LEU B CD1 1 
ATOM   7361  C  CD2 . LEU B 1 353 ? 69.640  25.247  10.339  1.00 2.90  ? 384 LEU B CD2 1 
ATOM   7362  N  N   . TYR B 1 354 ? 71.251  26.408  5.490   1.00 2.02  ? 385 TYR B N   1 
ATOM   7363  C  CA  . TYR B 1 354 ? 71.397  25.575  4.332   1.00 4.24  ? 385 TYR B CA  1 
ATOM   7364  C  C   . TYR B 1 354 ? 72.257  26.200  3.283   1.00 6.95  ? 385 TYR B C   1 
ATOM   7365  O  O   . TYR B 1 354 ? 72.241  25.763  2.119   1.00 9.82  ? 385 TYR B O   1 
ATOM   7366  C  CB  . TYR B 1 354 ? 70.060  25.237  3.728   1.00 4.55  ? 385 TYR B CB  1 
ATOM   7367  C  CG  . TYR B 1 354 ? 69.828  23.771  3.612   1.00 2.45  ? 385 TYR B CG  1 
ATOM   7368  C  CD1 . TYR B 1 354 ? 70.240  23.068  2.488   1.00 2.00  ? 385 TYR B CD1 1 
ATOM   7369  C  CD2 . TYR B 1 354 ? 69.121  23.093  4.592   1.00 3.35  ? 385 TYR B CD2 1 
ATOM   7370  C  CE1 . TYR B 1 354 ? 69.939  21.704  2.336   1.00 3.05  ? 385 TYR B CE1 1 
ATOM   7371  C  CE2 . TYR B 1 354 ? 68.811  21.739  4.451   1.00 7.31  ? 385 TYR B CE2 1 
ATOM   7372  C  CZ  . TYR B 1 354 ? 69.217  21.048  3.319   1.00 5.24  ? 385 TYR B CZ  1 
ATOM   7373  O  OH  . TYR B 1 354 ? 68.838  19.725  3.176   1.00 5.39  ? 385 TYR B OH  1 
ATOM   7374  N  N   . HIS B 1 355 ? 72.976  27.248  3.647   1.00 6.99  ? 386 HIS B N   1 
ATOM   7375  C  CA  . HIS B 1 355 ? 73.861  27.854  2.668   1.00 11.24 ? 386 HIS B CA  1 
ATOM   7376  C  C   . HIS B 1 355 ? 75.203  27.096  2.673   1.00 11.89 ? 386 HIS B C   1 
ATOM   7377  O  O   . HIS B 1 355 ? 76.233  27.603  3.141   1.00 14.23 ? 386 HIS B O   1 
ATOM   7378  C  CB  . HIS B 1 355 ? 74.043  29.341  2.947   1.00 13.84 ? 386 HIS B CB  1 
ATOM   7379  C  CG  . HIS B 1 355 ? 72.889  30.187  2.491   1.00 15.61 ? 386 HIS B CG  1 
ATOM   7380  N  ND1 . HIS B 1 355 ? 71.796  30.452  3.292   1.00 15.14 ? 386 HIS B ND1 1 
ATOM   7381  C  CD2 . HIS B 1 355 ? 72.674  30.852  1.326   1.00 15.21 ? 386 HIS B CD2 1 
ATOM   7382  C  CE1 . HIS B 1 355 ? 70.962  31.244  2.641   1.00 13.67 ? 386 HIS B CE1 1 
ATOM   7383  N  NE2 . HIS B 1 355 ? 71.471  31.501  1.447   1.00 13.46 ? 386 HIS B NE2 1 
ATOM   7384  N  N   . TRP B 1 356 ? 75.146  25.884  2.122   1.00 8.40  ? 387 TRP B N   1 
ATOM   7385  C  CA  . TRP B 1 356 ? 76.239  24.931  2.020   1.00 3.50  ? 387 TRP B CA  1 
ATOM   7386  C  C   . TRP B 1 356 ? 77.102  25.074  0.793   1.00 3.65  ? 387 TRP B C   1 
ATOM   7387  O  O   . TRP B 1 356 ? 77.311  24.088  0.055   1.00 2.00  ? 387 TRP B O   1 
ATOM   7388  C  CB  . TRP B 1 356 ? 75.657  23.543  1.963   1.00 3.62  ? 387 TRP B CB  1 
ATOM   7389  C  CG  . TRP B 1 356 ? 74.917  23.153  3.145   1.00 3.20  ? 387 TRP B CG  1 
ATOM   7390  C  CD1 . TRP B 1 356 ? 74.784  23.859  4.325   1.00 2.00  ? 387 TRP B CD1 1 
ATOM   7391  C  CD2 . TRP B 1 356 ? 74.252  21.910  3.331   1.00 2.00  ? 387 TRP B CD2 1 
ATOM   7392  N  NE1 . TRP B 1 356 ? 74.083  23.106  5.236   1.00 2.00  ? 387 TRP B NE1 1 
ATOM   7393  C  CE2 . TRP B 1 356 ? 73.745  21.904  4.656   1.00 3.24  ? 387 TRP B CE2 1 
ATOM   7394  C  CE3 . TRP B 1 356 ? 74.052  20.790  2.513   1.00 2.10  ? 387 TRP B CE3 1 
ATOM   7395  C  CZ2 . TRP B 1 356 ? 73.043  20.816  5.177   1.00 2.00  ? 387 TRP B CZ2 1 
ATOM   7396  C  CZ3 . TRP B 1 356 ? 73.358  19.710  3.039   1.00 2.00  ? 387 TRP B CZ3 1 
ATOM   7397  C  CH2 . TRP B 1 356 ? 72.866  19.735  4.357   1.00 2.00  ? 387 TRP B CH2 1 
ATOM   7398  N  N   . HIS B 1 357 ? 77.598  26.294  0.574   1.00 6.50  ? 388 HIS B N   1 
ATOM   7399  C  CA  . HIS B 1 357 ? 78.484  26.606  -0.560  1.00 6.64  ? 388 HIS B CA  1 
ATOM   7400  C  C   . HIS B 1 357 ? 79.815  25.806  -0.572  1.00 4.41  ? 388 HIS B C   1 
ATOM   7401  O  O   . HIS B 1 357 ? 80.349  25.513  -1.658  1.00 2.00  ? 388 HIS B O   1 
ATOM   7402  C  CB  . HIS B 1 357 ? 78.615  28.112  -0.706  1.00 5.90  ? 388 HIS B CB  1 
ATOM   7403  C  CG  . HIS B 1 357 ? 77.251  28.634  -1.199  1.00 7.99  ? 388 HIS B CG  1 
ATOM   7404  N  ND1 . HIS B 1 357 ? 76.611  29.750  -0.667  1.00 8.04  ? 388 HIS B ND1 1 
ATOM   7405  C  CD2 . HIS B 1 357 ? 76.546  28.146  -2.321  1.00 7.21  ? 388 HIS B CD2 1 
ATOM   7406  C  CE1 . HIS B 1 357 ? 75.542  29.920  -1.500  1.00 7.08  ? 388 HIS B CE1 1 
ATOM   7407  N  NE2 . HIS B 1 357 ? 75.458  29.023  -2.451  1.00 7.52  ? 388 HIS B NE2 1 
ATOM   7408  N  N   . PRO B 1 358 ? 80.330  25.419  0.639   1.00 4.40  ? 389 PRO B N   1 
ATOM   7409  C  CA  . PRO B 1 358 ? 81.548  24.624  0.848   1.00 3.80  ? 389 PRO B CA  1 
ATOM   7410  C  C   . PRO B 1 358 ? 81.542  23.286  0.083   1.00 2.73  ? 389 PRO B C   1 
ATOM   7411  O  O   . PRO B 1 358 ? 82.574  22.663  -0.105  1.00 3.71  ? 389 PRO B O   1 
ATOM   7412  C  CB  . PRO B 1 358 ? 81.505  24.353  2.351   1.00 2.00  ? 389 PRO B CB  1 
ATOM   7413  C  CG  . PRO B 1 358 ? 81.082  25.642  2.881   1.00 2.64  ? 389 PRO B CG  1 
ATOM   7414  C  CD  . PRO B 1 358 ? 80.043  26.167  1.888   1.00 2.33  ? 389 PRO B CD  1 
ATOM   7415  N  N   . LEU B 1 359 ? 80.372  22.792  -0.274  1.00 4.17  ? 390 LEU B N   1 
ATOM   7416  C  CA  . LEU B 1 359 ? 80.309  21.545  -1.016  1.00 4.49  ? 390 LEU B CA  1 
ATOM   7417  C  C   . LEU B 1 359 ? 81.005  21.722  -2.369  1.00 4.48  ? 390 LEU B C   1 
ATOM   7418  O  O   . LEU B 1 359 ? 81.564  20.788  -2.937  1.00 3.22  ? 390 LEU B O   1 
ATOM   7419  C  CB  . LEU B 1 359 ? 78.851  21.143  -1.239  1.00 5.12  ? 390 LEU B CB  1 
ATOM   7420  C  CG  . LEU B 1 359 ? 78.056  20.562  -0.080  1.00 5.77  ? 390 LEU B CG  1 
ATOM   7421  C  CD1 . LEU B 1 359 ? 76.647  20.176  -0.563  1.00 6.64  ? 390 LEU B CD1 1 
ATOM   7422  C  CD2 . LEU B 1 359 ? 78.785  19.325  0.420   1.00 8.44  ? 390 LEU B CD2 1 
ATOM   7423  N  N   . LEU B 1 360 ? 80.955  22.938  -2.883  1.00 4.62  ? 391 LEU B N   1 
ATOM   7424  C  CA  . LEU B 1 360 ? 81.554  23.230  -4.160  1.00 8.39  ? 391 LEU B CA  1 
ATOM   7425  C  C   . LEU B 1 360 ? 83.079  23.072  -4.197  1.00 12.30 ? 391 LEU B C   1 
ATOM   7426  O  O   . LEU B 1 360 ? 83.786  23.388  -3.240  1.00 13.68 ? 391 LEU B O   1 
ATOM   7427  C  CB  . LEU B 1 360 ? 81.219  24.655  -4.560  1.00 6.77  ? 391 LEU B CB  1 
ATOM   7428  C  CG  . LEU B 1 360 ? 79.795  25.050  -4.855  1.00 5.62  ? 391 LEU B CG  1 
ATOM   7429  C  CD1 . LEU B 1 360 ? 79.810  26.555  -5.082  1.00 5.10  ? 391 LEU B CD1 1 
ATOM   7430  C  CD2 . LEU B 1 360 ? 79.264  24.297  -6.078  1.00 2.00  ? 391 LEU B CD2 1 
ATOM   7431  N  N   . PRO B 1 361 ? 83.600  22.512  -5.287  1.00 14.27 ? 392 PRO B N   1 
ATOM   7432  C  CA  . PRO B 1 361 ? 85.044  22.351  -5.401  1.00 15.34 ? 392 PRO B CA  1 
ATOM   7433  C  C   . PRO B 1 361 ? 85.567  23.590  -6.131  1.00 16.01 ? 392 PRO B C   1 
ATOM   7434  O  O   . PRO B 1 361 ? 84.996  24.676  -6.021  1.00 14.97 ? 392 PRO B O   1 
ATOM   7435  C  CB  . PRO B 1 361 ? 85.171  21.095  -6.262  1.00 16.43 ? 392 PRO B CB  1 
ATOM   7436  C  CG  . PRO B 1 361 ? 84.068  21.273  -7.217  1.00 17.64 ? 392 PRO B CG  1 
ATOM   7437  C  CD  . PRO B 1 361 ? 82.910  21.733  -6.326  1.00 15.71 ? 392 PRO B CD  1 
ATOM   7438  N  N   . ASP B 1 362 ? 86.607  23.410  -6.935  1.00 18.01 ? 393 ASP B N   1 
ATOM   7439  C  CA  . ASP B 1 362 ? 87.194  24.528  -7.647  1.00 19.69 ? 393 ASP B CA  1 
ATOM   7440  C  C   . ASP B 1 362 ? 87.078  24.360  -9.150  1.00 18.50 ? 393 ASP B C   1 
ATOM   7441  O  O   . ASP B 1 362 ? 87.151  25.341  -9.907  1.00 18.37 ? 393 ASP B O   1 
ATOM   7442  C  CB  . ASP B 1 362 ? 88.636  24.692  -7.205  1.00 25.44 ? 393 ASP B CB  1 
ATOM   7443  C  CG  . ASP B 1 362 ? 88.760  24.830  -5.688  1.00 29.64 ? 393 ASP B CG  1 
ATOM   7444  O  OD1 . ASP B 1 362 ? 88.290  25.866  -5.129  1.00 33.30 ? 393 ASP B OD1 1 
ATOM   7445  O  OD2 . ASP B 1 362 ? 89.307  23.890  -5.059  1.00 29.16 ? 393 ASP B OD2 1 
ATOM   7446  N  N   . THR B 1 363 ? 86.974  23.110  -9.581  1.00 16.26 ? 394 THR B N   1 
ATOM   7447  C  CA  . THR B 1 363 ? 86.753  22.810  -10.989 1.00 15.90 ? 394 THR B CA  1 
ATOM   7448  C  C   . THR B 1 363 ? 85.635  21.785  -11.000 1.00 15.07 ? 394 THR B C   1 
ATOM   7449  O  O   . THR B 1 363 ? 85.446  21.029  -10.029 1.00 13.70 ? 394 THR B O   1 
ATOM   7450  C  CB  . THR B 1 363 ? 87.954  22.157  -11.688 1.00 16.32 ? 394 THR B CB  1 
ATOM   7451  O  OG1 . THR B 1 363 ? 88.656  21.331  -10.746 1.00 20.51 ? 394 THR B OG1 1 
ATOM   7452  C  CG2 . THR B 1 363 ? 88.859  23.185  -12.324 1.00 16.14 ? 394 THR B CG2 1 
ATOM   7453  N  N   . PHE B 1 364 ? 84.872  21.765  -12.076 1.00 12.65 ? 395 PHE B N   1 
ATOM   7454  C  CA  . PHE B 1 364 ? 83.810  20.794  -12.172 1.00 10.76 ? 395 PHE B CA  1 
ATOM   7455  C  C   . PHE B 1 364 ? 84.380  19.884  -13.228 1.00 8.30  ? 395 PHE B C   1 
ATOM   7456  O  O   . PHE B 1 364 ? 84.686  20.300  -14.347 1.00 4.26  ? 395 PHE B O   1 
ATOM   7457  C  CB  . PHE B 1 364 ? 82.475  21.467  -12.569 1.00 11.85 ? 395 PHE B CB  1 
ATOM   7458  C  CG  . PHE B 1 364 ? 81.913  22.402  -11.496 1.00 8.02  ? 395 PHE B CG  1 
ATOM   7459  C  CD1 . PHE B 1 364 ? 81.393  21.899  -10.303 1.00 4.35  ? 395 PHE B CD1 1 
ATOM   7460  C  CD2 . PHE B 1 364 ? 81.944  23.786  -11.675 1.00 6.35  ? 395 PHE B CD2 1 
ATOM   7461  C  CE1 . PHE B 1 364 ? 80.918  22.764  -9.312  1.00 3.74  ? 395 PHE B CE1 1 
ATOM   7462  C  CE2 . PHE B 1 364 ? 81.468  24.647  -10.688 1.00 3.58  ? 395 PHE B CE2 1 
ATOM   7463  C  CZ  . PHE B 1 364 ? 80.956  24.138  -9.508  1.00 2.00  ? 395 PHE B CZ  1 
ATOM   7464  N  N   . ASN B 1 365 ? 84.653  18.666  -12.814 1.00 7.85  ? 396 ASN B N   1 
ATOM   7465  C  CA  . ASN B 1 365 ? 85.260  17.725  -13.719 1.00 11.77 ? 396 ASN B CA  1 
ATOM   7466  C  C   . ASN B 1 365 ? 84.268  16.710  -14.282 1.00 13.67 ? 396 ASN B C   1 
ATOM   7467  O  O   . ASN B 1 365 ? 83.840  15.764  -13.611 1.00 13.00 ? 396 ASN B O   1 
ATOM   7468  C  CB  . ASN B 1 365 ? 86.423  17.020  -13.019 1.00 15.68 ? 396 ASN B CB  1 
ATOM   7469  C  CG  . ASN B 1 365 ? 87.238  17.963  -12.101 1.00 17.83 ? 396 ASN B CG  1 
ATOM   7470  O  OD1 . ASN B 1 365 ? 87.798  17.539  -11.078 1.00 19.39 ? 396 ASN B OD1 1 
ATOM   7471  N  ND2 . ASN B 1 365 ? 87.301  19.234  -12.463 1.00 16.10 ? 396 ASN B ND2 1 
ATOM   7472  N  N   . ILE B 1 366 ? 83.846  16.967  -15.507 1.00 13.71 ? 397 ILE B N   1 
ATOM   7473  C  CA  . ILE B 1 366 ? 82.937  16.085  -16.184 1.00 14.59 ? 397 ILE B CA  1 
ATOM   7474  C  C   . ILE B 1 366 ? 83.833  15.255  -17.084 1.00 18.23 ? 397 ILE B C   1 
ATOM   7475  O  O   . ILE B 1 366 ? 84.332  15.739  -18.104 1.00 17.61 ? 397 ILE B O   1 
ATOM   7476  C  CB  . ILE B 1 366 ? 81.871  16.859  -16.996 1.00 14.36 ? 397 ILE B CB  1 
ATOM   7477  C  CG1 . ILE B 1 366 ? 80.729  17.340  -16.068 1.00 14.15 ? 397 ILE B CG1 1 
ATOM   7478  C  CG2 . ILE B 1 366 ? 81.272  15.954  -18.064 1.00 15.26 ? 397 ILE B CG2 1 
ATOM   7479  C  CD1 . ILE B 1 366 ? 80.834  18.776  -15.546 1.00 10.45 ? 397 ILE B CD1 1 
ATOM   7480  N  N   . GLU B 1 367 ? 84.096  14.035  -16.613 1.00 22.89 ? 398 GLU B N   1 
ATOM   7481  C  CA  . GLU B 1 367 ? 84.946  13.011  -17.242 1.00 25.07 ? 398 GLU B CA  1 
ATOM   7482  C  C   . GLU B 1 367 ? 85.736  13.432  -18.473 1.00 24.83 ? 398 GLU B C   1 
ATOM   7483  O  O   . GLU B 1 367 ? 85.239  13.352  -19.605 1.00 24.82 ? 398 GLU B O   1 
ATOM   7484  C  CB  . GLU B 1 367 ? 84.146  11.725  -17.494 1.00 26.79 ? 398 GLU B CB  1 
ATOM   7485  C  CG  . GLU B 1 367 ? 84.949  10.422  -17.207 1.00 32.72 ? 398 GLU B CG  1 
ATOM   7486  C  CD  . GLU B 1 367 ? 84.228  9.369   -16.307 1.00 32.71 ? 398 GLU B CD  1 
ATOM   7487  O  OE1 . GLU B 1 367 ? 84.240  9.511   -15.056 1.00 30.15 ? 398 GLU B OE1 1 
ATOM   7488  O  OE2 . GLU B 1 367 ? 83.705  8.363   -16.849 1.00 32.88 ? 398 GLU B OE2 1 
ATOM   7489  N  N   . ASP B 1 368 ? 86.941  13.944  -18.201 1.00 25.07 ? 399 ASP B N   1 
ATOM   7490  C  CA  . ASP B 1 368 ? 87.935  14.430  -19.191 1.00 26.53 ? 399 ASP B CA  1 
ATOM   7491  C  C   . ASP B 1 368 ? 88.421  15.895  -19.049 1.00 24.02 ? 399 ASP B C   1 
ATOM   7492  O  O   . ASP B 1 368 ? 89.605  16.194  -19.282 1.00 21.66 ? 399 ASP B O   1 
ATOM   7493  C  CB  . ASP B 1 368 ? 87.527  14.151  -20.655 1.00 28.20 ? 399 ASP B CB  1 
ATOM   7494  C  CG  . ASP B 1 368 ? 88.510  13.213  -21.373 1.00 31.96 ? 399 ASP B CG  1 
ATOM   7495  O  OD1 . ASP B 1 368 ? 89.505  12.769  -20.726 1.00 31.07 ? 399 ASP B OD1 1 
ATOM   7496  O  OD2 . ASP B 1 368 ? 88.281  12.923  -22.582 1.00 31.59 ? 399 ASP B OD2 1 
ATOM   7497  N  N   . GLN B 1 369 ? 87.513  16.812  -18.731 1.00 18.93 ? 400 GLN B N   1 
ATOM   7498  C  CA  . GLN B 1 369 ? 87.908  18.196  -18.553 1.00 15.01 ? 400 GLN B CA  1 
ATOM   7499  C  C   . GLN B 1 369 ? 87.563  18.628  -17.132 1.00 17.30 ? 400 GLN B C   1 
ATOM   7500  O  O   . GLN B 1 369 ? 86.875  17.904  -16.390 1.00 17.95 ? 400 GLN B O   1 
ATOM   7501  C  CB  . GLN B 1 369 ? 87.198  19.113  -19.525 1.00 5.12  ? 400 GLN B CB  1 
ATOM   7502  C  CG  . GLN B 1 369 ? 86.522  18.417  -20.631 1.00 6.48  ? 400 GLN B CG  1 
ATOM   7503  C  CD  . GLN B 1 369 ? 87.316  18.449  -21.915 1.00 8.26  ? 400 GLN B CD  1 
ATOM   7504  O  OE1 . GLN B 1 369 ? 87.262  19.422  -22.669 1.00 4.95  ? 400 GLN B OE1 1 
ATOM   7505  N  NE2 . GLN B 1 369 ? 88.030  17.367  -22.195 1.00 8.58  ? 400 GLN B NE2 1 
ATOM   7506  N  N   . GLU B 1 370 ? 88.120  19.766  -16.737 1.00 17.74 ? 401 GLU B N   1 
ATOM   7507  C  CA  . GLU B 1 370 ? 87.884  20.351  -15.430 1.00 21.34 ? 401 GLU B CA  1 
ATOM   7508  C  C   . GLU B 1 370 ? 87.464  21.744  -15.849 1.00 21.41 ? 401 GLU B C   1 
ATOM   7509  O  O   . GLU B 1 370 ? 88.110  22.341  -16.706 1.00 23.14 ? 401 GLU B O   1 
ATOM   7510  C  CB  . GLU B 1 370 ? 89.171  20.416  -14.598 1.00 25.68 ? 401 GLU B CB  1 
ATOM   7511  C  CG  . GLU B 1 370 ? 89.876  19.046  -14.414 1.00 36.74 ? 401 GLU B CG  1 
ATOM   7512  C  CD  . GLU B 1 370 ? 91.004  19.041  -13.340 1.00 42.55 ? 401 GLU B CD  1 
ATOM   7513  O  OE1 . GLU B 1 370 ? 91.671  20.085  -13.120 1.00 43.95 ? 401 GLU B OE1 1 
ATOM   7514  O  OE2 . GLU B 1 370 ? 91.229  17.976  -12.712 1.00 44.40 ? 401 GLU B OE2 1 
ATOM   7515  N  N   . TYR B 1 371 ? 86.330  22.229  -15.354 1.00 18.39 ? 402 TYR B N   1 
ATOM   7516  C  CA  . TYR B 1 371 ? 85.896  23.555  -15.752 1.00 10.76 ? 402 TYR B CA  1 
ATOM   7517  C  C   . TYR B 1 371 ? 85.876  24.425  -14.518 1.00 9.16  ? 402 TYR B C   1 
ATOM   7518  O  O   . TYR B 1 371 ? 85.695  23.922  -13.392 1.00 6.82  ? 402 TYR B O   1 
ATOM   7519  C  CB  . TYR B 1 371 ? 84.493  23.510  -16.370 1.00 9.11  ? 402 TYR B CB  1 
ATOM   7520  C  CG  . TYR B 1 371 ? 84.316  22.671  -17.631 1.00 5.54  ? 402 TYR B CG  1 
ATOM   7521  C  CD1 . TYR B 1 371 ? 84.029  21.294  -17.547 1.00 3.80  ? 402 TYR B CD1 1 
ATOM   7522  C  CD2 . TYR B 1 371 ? 84.331  23.268  -18.907 1.00 2.21  ? 402 TYR B CD2 1 
ATOM   7523  C  CE1 . TYR B 1 371 ? 83.753  20.539  -18.700 1.00 3.04  ? 402 TYR B CE1 1 
ATOM   7524  C  CE2 . TYR B 1 371 ? 84.052  22.520  -20.060 1.00 2.00  ? 402 TYR B CE2 1 
ATOM   7525  C  CZ  . TYR B 1 371 ? 83.765  21.161  -19.948 1.00 2.40  ? 402 TYR B CZ  1 
ATOM   7526  O  OH  . TYR B 1 371 ? 83.493  20.408  -21.065 1.00 2.00  ? 402 TYR B OH  1 
ATOM   7527  N  N   . SER B 1 372 ? 86.114  25.717  -14.736 1.00 6.75  ? 403 SER B N   1 
ATOM   7528  C  CA  . SER B 1 372 ? 86.083  26.713  -13.668 1.00 8.03  ? 403 SER B CA  1 
ATOM   7529  C  C   . SER B 1 372 ? 84.619  27.166  -13.491 1.00 10.55 ? 403 SER B C   1 
ATOM   7530  O  O   . SER B 1 372 ? 83.734  26.835  -14.319 1.00 11.45 ? 403 SER B O   1 
ATOM   7531  C  CB  . SER B 1 372 ? 86.888  27.925  -14.093 1.00 7.65  ? 403 SER B CB  1 
ATOM   7532  O  OG  . SER B 1 372 ? 86.348  28.479  -15.291 1.00 6.45  ? 403 SER B OG  1 
ATOM   7533  N  N   . PHE B 1 373 ? 84.364  27.961  -12.454 1.00 8.52  ? 404 PHE B N   1 
ATOM   7534  C  CA  . PHE B 1 373 ? 83.022  28.463  -12.257 1.00 7.11  ? 404 PHE B CA  1 
ATOM   7535  C  C   . PHE B 1 373 ? 82.706  29.251  -13.513 1.00 6.79  ? 404 PHE B C   1 
ATOM   7536  O  O   . PHE B 1 373 ? 81.755  28.978  -14.217 1.00 8.44  ? 404 PHE B O   1 
ATOM   7537  C  CB  . PHE B 1 373 ? 82.961  29.343  -11.024 1.00 3.47  ? 404 PHE B CB  1 
ATOM   7538  C  CG  . PHE B 1 373 ? 82.830  28.575  -9.754  1.00 3.40  ? 404 PHE B CG  1 
ATOM   7539  C  CD1 . PHE B 1 373 ? 83.333  27.304  -9.641  1.00 2.56  ? 404 PHE B CD1 1 
ATOM   7540  C  CD2 . PHE B 1 373 ? 82.185  29.123  -8.665  1.00 8.09  ? 404 PHE B CD2 1 
ATOM   7541  C  CE1 . PHE B 1 373 ? 83.192  26.590  -8.457  1.00 6.80  ? 404 PHE B CE1 1 
ATOM   7542  C  CE2 . PHE B 1 373 ? 82.041  28.412  -7.472  1.00 7.04  ? 404 PHE B CE2 1 
ATOM   7543  C  CZ  . PHE B 1 373 ? 82.543  27.149  -7.370  1.00 6.76  ? 404 PHE B CZ  1 
ATOM   7544  N  N   . LYS B 1 374 ? 83.659  30.066  -13.898 1.00 8.50  ? 405 LYS B N   1 
ATOM   7545  C  CA  . LYS B 1 374 ? 83.549  30.902  -15.080 1.00 14.48 ? 405 LYS B CA  1 
ATOM   7546  C  C   . LYS B 1 374 ? 83.262  30.116  -16.381 1.00 15.20 ? 405 LYS B C   1 
ATOM   7547  O  O   . LYS B 1 374 ? 82.979  30.696  -17.437 1.00 16.21 ? 405 LYS B O   1 
ATOM   7548  C  CB  . LYS B 1 374 ? 84.848  31.711  -15.240 1.00 18.27 ? 405 LYS B CB  1 
ATOM   7549  C  CG  . LYS B 1 374 ? 85.458  32.206  -13.917 1.00 24.52 ? 405 LYS B CG  1 
ATOM   7550  C  CD  . LYS B 1 374 ? 86.337  31.116  -13.270 1.00 28.66 ? 405 LYS B CD  1 
ATOM   7551  C  CE  . LYS B 1 374 ? 86.517  31.323  -11.752 1.00 29.12 ? 405 LYS B CE  1 
ATOM   7552  N  NZ  . LYS B 1 374 ? 86.797  30.023  -11.076 1.00 30.26 ? 405 LYS B NZ  1 
ATOM   7553  N  N   . GLN B 1 375 ? 83.391  28.805  -16.327 1.00 12.48 ? 406 GLN B N   1 
ATOM   7554  C  CA  . GLN B 1 375 ? 83.128  28.014  -17.501 1.00 14.15 ? 406 GLN B CA  1 
ATOM   7555  C  C   . GLN B 1 375 ? 81.890  27.141  -17.329 1.00 15.43 ? 406 GLN B C   1 
ATOM   7556  O  O   . GLN B 1 375 ? 81.289  26.654  -18.311 1.00 16.30 ? 406 GLN B O   1 
ATOM   7557  C  CB  . GLN B 1 375 ? 84.289  27.124  -17.773 1.00 17.04 ? 406 GLN B CB  1 
ATOM   7558  C  CG  . GLN B 1 375 ? 85.535  27.815  -18.167 1.00 22.63 ? 406 GLN B CG  1 
ATOM   7559  C  CD  . GLN B 1 375 ? 86.599  26.781  -18.461 1.00 26.59 ? 406 GLN B CD  1 
ATOM   7560  O  OE1 . GLN B 1 375 ? 87.263  26.306  -17.543 1.00 26.23 ? 406 GLN B OE1 1 
ATOM   7561  N  NE2 . GLN B 1 375 ? 86.695  26.349  -19.724 1.00 28.24 ? 406 GLN B NE2 1 
ATOM   7562  N  N   . PHE B 1 376 ? 81.555  26.877  -16.077 1.00 13.29 ? 407 PHE B N   1 
ATOM   7563  C  CA  . PHE B 1 376 ? 80.384  26.080  -15.768 1.00 13.10 ? 407 PHE B CA  1 
ATOM   7564  C  C   . PHE B 1 376 ? 79.092  26.951  -15.796 1.00 15.30 ? 407 PHE B C   1 
ATOM   7565  O  O   . PHE B 1 376 ? 78.149  26.685  -16.586 1.00 15.83 ? 407 PHE B O   1 
ATOM   7566  C  CB  . PHE B 1 376 ? 80.570  25.453  -14.394 1.00 9.81  ? 407 PHE B CB  1 
ATOM   7567  C  CG  . PHE B 1 376 ? 79.982  24.088  -14.280 1.00 9.07  ? 407 PHE B CG  1 
ATOM   7568  C  CD1 . PHE B 1 376 ? 80.198  23.142  -15.292 1.00 10.23 ? 407 PHE B CD1 1 
ATOM   7569  C  CD2 . PHE B 1 376 ? 79.216  23.735  -13.155 1.00 6.52  ? 407 PHE B CD2 1 
ATOM   7570  C  CE1 . PHE B 1 376 ? 79.653  21.850  -15.178 1.00 13.54 ? 407 PHE B CE1 1 
ATOM   7571  C  CE2 . PHE B 1 376 ? 78.668  22.463  -13.022 1.00 6.10  ? 407 PHE B CE2 1 
ATOM   7572  C  CZ  . PHE B 1 376 ? 78.882  21.512  -14.031 1.00 12.29 ? 407 PHE B CZ  1 
ATOM   7573  N  N   . LEU B 1 377 ? 79.064  27.995  -14.955 1.00 15.34 ? 408 LEU B N   1 
ATOM   7574  C  CA  . LEU B 1 377 ? 77.924  28.912  -14.838 1.00 12.99 ? 408 LEU B CA  1 
ATOM   7575  C  C   . LEU B 1 377 ? 77.324  29.283  -16.175 1.00 14.47 ? 408 LEU B C   1 
ATOM   7576  O  O   . LEU B 1 377 ? 78.026  29.672  -17.105 1.00 14.41 ? 408 LEU B O   1 
ATOM   7577  C  CB  . LEU B 1 377 ? 78.312  30.167  -14.064 1.00 9.07  ? 408 LEU B CB  1 
ATOM   7578  C  CG  . LEU B 1 377 ? 78.773  29.765  -12.663 1.00 11.10 ? 408 LEU B CG  1 
ATOM   7579  C  CD1 . LEU B 1 377 ? 79.196  30.961  -11.849 1.00 13.14 ? 408 LEU B CD1 1 
ATOM   7580  C  CD2 . LEU B 1 377 ? 77.677  29.026  -11.964 1.00 11.41 ? 408 LEU B CD2 1 
ATOM   7581  N  N   . TYR B 1 378 ? 76.004  29.152  -16.255 1.00 17.92 ? 409 TYR B N   1 
ATOM   7582  C  CA  . TYR B 1 378 ? 75.241  29.438  -17.473 1.00 20.77 ? 409 TYR B CA  1 
ATOM   7583  C  C   . TYR B 1 378 ? 75.838  28.860  -18.766 1.00 20.53 ? 409 TYR B C   1 
ATOM   7584  O  O   . TYR B 1 378 ? 75.958  29.542  -19.789 1.00 17.07 ? 409 TYR B O   1 
ATOM   7585  C  CB  . TYR B 1 378 ? 74.922  30.937  -17.644 1.00 23.77 ? 409 TYR B CB  1 
ATOM   7586  C  CG  . TYR B 1 378 ? 75.652  31.900  -16.735 1.00 29.15 ? 409 TYR B CG  1 
ATOM   7587  C  CD1 . TYR B 1 378 ? 75.301  32.017  -15.384 1.00 30.13 ? 409 TYR B CD1 1 
ATOM   7588  C  CD2 . TYR B 1 378 ? 76.630  32.775  -17.247 1.00 30.84 ? 409 TYR B CD2 1 
ATOM   7589  C  CE1 . TYR B 1 378 ? 75.890  32.987  -14.563 1.00 34.05 ? 409 TYR B CE1 1 
ATOM   7590  C  CE2 . TYR B 1 378 ? 77.230  33.758  -16.428 1.00 33.39 ? 409 TYR B CE2 1 
ATOM   7591  C  CZ  . TYR B 1 378 ? 76.852  33.860  -15.087 1.00 33.90 ? 409 TYR B CZ  1 
ATOM   7592  O  OH  . TYR B 1 378 ? 77.412  34.835  -14.277 1.00 34.14 ? 409 TYR B OH  1 
ATOM   7593  N  N   . ASN B 1 379 ? 76.181  27.580  -18.726 1.00 22.49 ? 410 ASN B N   1 
ATOM   7594  C  CA  . ASN B 1 379 ? 76.733  26.931  -19.908 1.00 25.89 ? 410 ASN B CA  1 
ATOM   7595  C  C   . ASN B 1 379 ? 76.161  25.514  -20.143 1.00 26.51 ? 410 ASN B C   1 
ATOM   7596  O  O   . ASN B 1 379 ? 76.687  24.497  -19.667 1.00 24.25 ? 410 ASN B O   1 
ATOM   7597  C  CB  . ASN B 1 379 ? 78.255  26.904  -19.796 1.00 28.99 ? 410 ASN B CB  1 
ATOM   7598  C  CG  . ASN B 1 379 ? 78.920  26.395  -21.044 1.00 27.79 ? 410 ASN B CG  1 
ATOM   7599  O  OD1 . ASN B 1 379 ? 78.263  26.053  -22.056 1.00 26.54 ? 410 ASN B OD1 1 
ATOM   7600  N  ND2 . ASN B 1 379 ? 80.242  26.354  -20.978 1.00 27.59 ? 410 ASN B ND2 1 
ATOM   7601  N  N   . ASN B 1 380 ? 75.065  25.463  -20.888 1.00 28.89 ? 411 ASN B N   1 
ATOM   7602  C  CA  . ASN B 1 380 ? 74.386  24.197  -21.179 1.00 28.90 ? 411 ASN B CA  1 
ATOM   7603  C  C   . ASN B 1 380 ? 75.246  23.274  -22.053 1.00 23.13 ? 411 ASN B C   1 
ATOM   7604  O  O   . ASN B 1 380 ? 75.198  22.061  -21.911 1.00 21.99 ? 411 ASN B O   1 
ATOM   7605  C  CB  . ASN B 1 380 ? 73.102  24.453  -21.986 1.00 35.98 ? 411 ASN B CB  1 
ATOM   7606  C  CG  . ASN B 1 380 ? 73.355  24.335  -23.523 1.00 41.31 ? 411 ASN B CG  1 
ATOM   7607  O  OD1 . ASN B 1 380 ? 73.199  23.259  -24.126 1.00 42.60 ? 411 ASN B OD1 1 
ATOM   7608  N  ND2 . ASN B 1 380 ? 73.907  25.396  -24.104 1.00 42.39 ? 411 ASN B ND2 1 
ATOM   7609  N  N   . SER B 1 381 ? 75.907  23.876  -23.038 1.00 17.30 ? 412 SER B N   1 
ATOM   7610  C  CA  . SER B 1 381 ? 76.702  23.178  -24.029 1.00 12.16 ? 412 SER B CA  1 
ATOM   7611  C  C   . SER B 1 381 ? 77.460  22.056  -23.379 1.00 9.47  ? 412 SER B C   1 
ATOM   7612  O  O   . SER B 1 381 ? 77.480  20.936  -23.883 1.00 2.00  ? 412 SER B O   1 
ATOM   7613  C  CB  . SER B 1 381 ? 77.641  24.165  -24.689 1.00 12.75 ? 412 SER B CB  1 
ATOM   7614  O  OG  . SER B 1 381 ? 77.076  25.462  -24.619 1.00 16.77 ? 412 SER B OG  1 
ATOM   7615  N  N   . ILE B 1 382 ? 78.013  22.350  -22.206 1.00 8.77  ? 413 ILE B N   1 
ATOM   7616  C  CA  . ILE B 1 382 ? 78.751  21.354  -21.439 1.00 7.79  ? 413 ILE B CA  1 
ATOM   7617  C  C   . ILE B 1 382 ? 77.875  20.093  -21.329 1.00 8.09  ? 413 ILE B C   1 
ATOM   7618  O  O   . ILE B 1 382 ? 78.235  19.041  -21.847 1.00 8.29  ? 413 ILE B O   1 
ATOM   7619  C  CB  . ILE B 1 382 ? 79.122  21.896  -20.021 1.00 7.80  ? 413 ILE B CB  1 
ATOM   7620  C  CG1 . ILE B 1 382 ? 80.075  23.107  -20.119 1.00 2.00  ? 413 ILE B CG1 1 
ATOM   7621  C  CG2 . ILE B 1 382 ? 79.722  20.783  -19.156 1.00 5.51  ? 413 ILE B CG2 1 
ATOM   7622  C  CD1 . ILE B 1 382 ? 80.443  23.703  -18.749 1.00 2.17  ? 413 ILE B CD1 1 
ATOM   7623  N  N   . LEU B 1 383 ? 76.693  20.236  -20.731 1.00 9.98  ? 414 LEU B N   1 
ATOM   7624  C  CA  . LEU B 1 383 ? 75.739  19.137  -20.558 1.00 8.27  ? 414 LEU B CA  1 
ATOM   7625  C  C   . LEU B 1 383 ? 75.366  18.497  -21.878 1.00 6.03  ? 414 LEU B C   1 
ATOM   7626  O  O   . LEU B 1 383 ? 75.298  17.290  -21.965 1.00 5.27  ? 414 LEU B O   1 
ATOM   7627  C  CB  . LEU B 1 383 ? 74.462  19.629  -19.880 1.00 12.55 ? 414 LEU B CB  1 
ATOM   7628  C  CG  . LEU B 1 383 ? 73.334  18.594  -19.774 1.00 17.68 ? 414 LEU B CG  1 
ATOM   7629  C  CD1 . LEU B 1 383 ? 73.717  17.532  -18.738 1.00 19.13 ? 414 LEU B CD1 1 
ATOM   7630  C  CD2 . LEU B 1 383 ? 72.006  19.251  -19.384 1.00 16.94 ? 414 LEU B CD2 1 
ATOM   7631  N  N   . LEU B 1 384 ? 75.085  19.308  -22.887 1.00 5.59  ? 415 LEU B N   1 
ATOM   7632  C  CA  . LEU B 1 384 ? 74.729  18.796  -24.207 1.00 7.23  ? 415 LEU B CA  1 
ATOM   7633  C  C   . LEU B 1 384 ? 75.921  18.167  -24.880 1.00 10.86 ? 415 LEU B C   1 
ATOM   7634  O  O   . LEU B 1 384 ? 75.755  17.268  -25.710 1.00 12.22 ? 415 LEU B O   1 
ATOM   7635  C  CB  . LEU B 1 384 ? 74.229  19.894  -25.146 1.00 4.72  ? 415 LEU B CB  1 
ATOM   7636  C  CG  . LEU B 1 384 ? 72.782  20.341  -25.178 1.00 2.34  ? 415 LEU B CG  1 
ATOM   7637  C  CD1 . LEU B 1 384 ? 72.563  21.065  -26.471 1.00 2.06  ? 415 LEU B CD1 1 
ATOM   7638  C  CD2 . LEU B 1 384 ? 71.847  19.160  -25.099 1.00 6.85  ? 415 LEU B CD2 1 
ATOM   7639  N  N   . GLU B 1 385 ? 77.119  18.632  -24.530 1.00 13.05 ? 416 GLU B N   1 
ATOM   7640  C  CA  . GLU B 1 385 ? 78.329  18.108  -25.155 1.00 16.83 ? 416 GLU B CA  1 
ATOM   7641  C  C   . GLU B 1 385 ? 78.802  16.851  -24.443 1.00 16.10 ? 416 GLU B C   1 
ATOM   7642  O  O   . GLU B 1 385 ? 79.440  15.995  -25.049 1.00 16.88 ? 416 GLU B O   1 
ATOM   7643  C  CB  . GLU B 1 385 ? 79.425  19.179  -25.181 1.00 21.41 ? 416 GLU B CB  1 
ATOM   7644  C  CG  . GLU B 1 385 ? 80.418  19.074  -26.358 1.00 26.17 ? 416 GLU B CG  1 
ATOM   7645  C  CD  . GLU B 1 385 ? 81.761  18.514  -25.939 1.00 30.54 ? 416 GLU B CD  1 
ATOM   7646  O  OE1 . GLU B 1 385 ? 82.366  19.050  -24.969 1.00 34.09 ? 416 GLU B OE1 1 
ATOM   7647  O  OE2 . GLU B 1 385 ? 82.204  17.527  -26.573 1.00 31.64 ? 416 GLU B OE2 1 
ATOM   7648  N  N   . HIS B 1 386 ? 78.440  16.711  -23.175 1.00 14.12 ? 417 HIS B N   1 
ATOM   7649  C  CA  . HIS B 1 386 ? 78.865  15.556  -22.432 1.00 15.24 ? 417 HIS B CA  1 
ATOM   7650  C  C   . HIS B 1 386 ? 77.837  14.464  -22.193 1.00 18.07 ? 417 HIS B C   1 
ATOM   7651  O  O   . HIS B 1 386 ? 78.204  13.322  -21.892 1.00 20.91 ? 417 HIS B O   1 
ATOM   7652  C  CB  . HIS B 1 386 ? 79.504  15.994  -21.134 1.00 16.00 ? 417 HIS B CB  1 
ATOM   7653  C  CG  . HIS B 1 386 ? 80.901  16.505  -21.310 1.00 21.76 ? 417 HIS B CG  1 
ATOM   7654  N  ND1 . HIS B 1 386 ? 81.182  17.778  -21.767 1.00 23.78 ? 417 HIS B ND1 1 
ATOM   7655  C  CD2 . HIS B 1 386 ? 82.100  15.926  -21.059 1.00 21.54 ? 417 HIS B CD2 1 
ATOM   7656  C  CE1 . HIS B 1 386 ? 82.488  17.966  -21.776 1.00 20.77 ? 417 HIS B CE1 1 
ATOM   7657  N  NE2 . HIS B 1 386 ? 83.067  16.859  -21.350 1.00 23.00 ? 417 HIS B NE2 1 
ATOM   7658  N  N   . GLY B 1 387 ? 76.558  14.777  -22.367 1.00 17.83 ? 418 GLY B N   1 
ATOM   7659  C  CA  . GLY B 1 387 ? 75.536  13.774  -22.122 1.00 16.63 ? 418 GLY B CA  1 
ATOM   7660  C  C   . GLY B 1 387 ? 75.327  13.565  -20.629 1.00 14.98 ? 418 GLY B C   1 
ATOM   7661  O  O   . GLY B 1 387 ? 76.195  13.900  -19.812 1.00 11.43 ? 418 GLY B O   1 
ATOM   7662  N  N   . LEU B 1 388 ? 74.178  13.002  -20.262 1.00 15.08 ? 419 LEU B N   1 
ATOM   7663  C  CA  . LEU B 1 388 ? 73.896  12.799  -18.850 1.00 14.80 ? 419 LEU B CA  1 
ATOM   7664  C  C   . LEU B 1 388 ? 74.550  11.575  -18.228 1.00 15.90 ? 419 LEU B C   1 
ATOM   7665  O  O   . LEU B 1 388 ? 74.822  11.559  -17.017 1.00 16.87 ? 419 LEU B O   1 
ATOM   7666  C  CB  . LEU B 1 388 ? 72.396  12.833  -18.562 1.00 12.42 ? 419 LEU B CB  1 
ATOM   7667  C  CG  . LEU B 1 388 ? 71.725  14.212  -18.683 1.00 13.27 ? 419 LEU B CG  1 
ATOM   7668  C  CD1 . LEU B 1 388 ? 71.567  14.616  -20.152 1.00 11.34 ? 419 LEU B CD1 1 
ATOM   7669  C  CD2 . LEU B 1 388 ? 70.374  14.181  -18.013 1.00 13.19 ? 419 LEU B CD2 1 
ATOM   7670  N  N   . THR B 1 389 ? 74.855  10.567  -19.045 1.00 15.45 ? 420 THR B N   1 
ATOM   7671  C  CA  . THR B 1 389 ? 75.474  9.341   -18.524 1.00 13.37 ? 420 THR B CA  1 
ATOM   7672  C  C   . THR B 1 389 ? 76.865  9.717   -18.051 1.00 13.41 ? 420 THR B C   1 
ATOM   7673  O  O   . THR B 1 389 ? 77.202  9.604   -16.863 1.00 11.15 ? 420 THR B O   1 
ATOM   7674  C  CB  . THR B 1 389 ? 75.518  8.263   -19.610 1.00 12.37 ? 420 THR B CB  1 
ATOM   7675  O  OG1 . THR B 1 389 ? 74.833  8.752   -20.768 1.00 15.81 ? 420 THR B OG1 1 
ATOM   7676  C  CG2 . THR B 1 389 ? 74.816  6.993   -19.148 1.00 6.25  ? 420 THR B CG2 1 
ATOM   7677  N  N   . GLN B 1 390 ? 77.628  10.283  -18.977 1.00 16.06 ? 421 GLN B N   1 
ATOM   7678  C  CA  . GLN B 1 390 ? 78.988  10.749  -18.693 1.00 17.62 ? 421 GLN B CA  1 
ATOM   7679  C  C   . GLN B 1 390 ? 78.857  12.127  -18.046 1.00 12.33 ? 421 GLN B C   1 
ATOM   7680  O  O   . GLN B 1 390 ? 79.417  13.103  -18.533 1.00 11.69 ? 421 GLN B O   1 
ATOM   7681  C  CB  . GLN B 1 390 ? 79.799  10.864  -20.002 1.00 22.18 ? 421 GLN B CB  1 
ATOM   7682  C  CG  . GLN B 1 390 ? 81.309  11.069  -19.792 1.00 32.28 ? 421 GLN B CG  1 
ATOM   7683  C  CD  . GLN B 1 390 ? 81.922  9.991   -18.876 1.00 35.57 ? 421 GLN B CD  1 
ATOM   7684  O  OE1 . GLN B 1 390 ? 81.585  9.908   -17.682 1.00 37.46 ? 421 GLN B OE1 1 
ATOM   7685  N  NE2 . GLN B 1 390 ? 82.832  9.173   -19.427 1.00 35.59 ? 421 GLN B NE2 1 
ATOM   7686  N  N   . PHE B 1 391 ? 78.064  12.197  -16.986 1.00 6.45  ? 422 PHE B N   1 
ATOM   7687  C  CA  . PHE B 1 391 ? 77.807  13.439  -16.280 1.00 3.89  ? 422 PHE B CA  1 
ATOM   7688  C  C   . PHE B 1 391 ? 77.422  12.907  -14.939 1.00 2.88  ? 422 PHE B C   1 
ATOM   7689  O  O   . PHE B 1 391 ? 77.758  13.473  -13.899 1.00 2.00  ? 422 PHE B O   1 
ATOM   7690  C  CB  . PHE B 1 391 ? 76.624  14.179  -16.906 1.00 2.26  ? 422 PHE B CB  1 
ATOM   7691  C  CG  . PHE B 1 391 ? 76.833  15.658  -17.050 1.00 4.88  ? 422 PHE B CG  1 
ATOM   7692  C  CD1 . PHE B 1 391 ? 76.472  16.540  -16.019 1.00 6.00  ? 422 PHE B CD1 1 
ATOM   7693  C  CD2 . PHE B 1 391 ? 77.383  16.186  -18.221 1.00 4.89  ? 422 PHE B CD2 1 
ATOM   7694  C  CE1 . PHE B 1 391 ? 76.658  17.934  -16.154 1.00 4.58  ? 422 PHE B CE1 1 
ATOM   7695  C  CE2 . PHE B 1 391 ? 77.576  17.574  -18.371 1.00 5.27  ? 422 PHE B CE2 1 
ATOM   7696  C  CZ  . PHE B 1 391 ? 77.210  18.451  -17.331 1.00 4.52  ? 422 PHE B CZ  1 
ATOM   7697  N  N   . VAL B 1 392 ? 76.731  11.774  -14.977 1.00 4.93  ? 423 VAL B N   1 
ATOM   7698  C  CA  . VAL B 1 392 ? 76.305  11.105  -13.754 1.00 7.42  ? 423 VAL B CA  1 
ATOM   7699  C  C   . VAL B 1 392 ? 77.528  10.330  -13.294 1.00 5.36  ? 423 VAL B C   1 
ATOM   7700  O  O   . VAL B 1 392 ? 77.869  10.347  -12.110 1.00 2.00  ? 423 VAL B O   1 
ATOM   7701  C  CB  . VAL B 1 392 ? 75.048  10.170  -13.975 1.00 7.36  ? 423 VAL B CB  1 
ATOM   7702  C  CG1 . VAL B 1 392 ? 75.042  9.022   -12.946 1.00 8.58  ? 423 VAL B CG1 1 
ATOM   7703  C  CG2 . VAL B 1 392 ? 73.772  10.969  -13.816 1.00 2.89  ? 423 VAL B CG2 1 
ATOM   7704  N  N   . GLU B 1 393 ? 78.242  9.758   -14.266 1.00 6.29  ? 424 GLU B N   1 
ATOM   7705  C  CA  . GLU B 1 393 ? 79.450  8.988   -13.991 1.00 8.27  ? 424 GLU B CA  1 
ATOM   7706  C  C   . GLU B 1 393 ? 80.496  9.882   -13.343 1.00 8.09  ? 424 GLU B C   1 
ATOM   7707  O  O   . GLU B 1 393 ? 80.974  9.626   -12.232 1.00 7.83  ? 424 GLU B O   1 
ATOM   7708  C  CB  . GLU B 1 393 ? 79.998  8.380   -15.281 1.00 8.94  ? 424 GLU B CB  1 
ATOM   7709  C  CG  . GLU B 1 393 ? 79.262  7.113   -15.698 1.00 15.80 ? 424 GLU B CG  1 
ATOM   7710  C  CD  . GLU B 1 393 ? 79.795  6.496   -16.984 1.00 19.17 ? 424 GLU B CD  1 
ATOM   7711  O  OE1 . GLU B 1 393 ? 80.371  7.208   -17.842 1.00 19.42 ? 424 GLU B OE1 1 
ATOM   7712  O  OE2 . GLU B 1 393 ? 79.613  5.278   -17.147 1.00 22.68 ? 424 GLU B OE2 1 
ATOM   7713  N  N   . SER B 1 394 ? 80.752  11.000  -14.006 1.00 6.59  ? 425 SER B N   1 
ATOM   7714  C  CA  . SER B 1 394 ? 81.719  11.967  -13.546 1.00 4.06  ? 425 SER B CA  1 
ATOM   7715  C  C   . SER B 1 394 ? 81.398  12.555  -12.181 1.00 4.99  ? 425 SER B C   1 
ATOM   7716  O  O   . SER B 1 394 ? 82.303  12.771  -11.389 1.00 6.57  ? 425 SER B O   1 
ATOM   7717  C  CB  . SER B 1 394 ? 81.859  13.056  -14.589 1.00 2.00  ? 425 SER B CB  1 
ATOM   7718  O  OG  . SER B 1 394 ? 81.817  12.482  -15.887 1.00 2.00  ? 425 SER B OG  1 
ATOM   7719  N  N   . PHE B 1 395 ? 80.126  12.809  -11.891 1.00 6.64  ? 426 PHE B N   1 
ATOM   7720  C  CA  . PHE B 1 395 ? 79.772  13.378  -10.588 1.00 7.77  ? 426 PHE B CA  1 
ATOM   7721  C  C   . PHE B 1 395 ? 79.744  12.342  -9.456  1.00 6.74  ? 426 PHE B C   1 
ATOM   7722  O  O   . PHE B 1 395 ? 79.966  12.673  -8.289  1.00 2.11  ? 426 PHE B O   1 
ATOM   7723  C  CB  . PHE B 1 395 ? 78.436  14.151  -10.644 1.00 10.12 ? 426 PHE B CB  1 
ATOM   7724  C  CG  . PHE B 1 395 ? 78.529  15.514  -11.296 1.00 12.18 ? 426 PHE B CG  1 
ATOM   7725  C  CD1 . PHE B 1 395 ? 79.726  16.007  -11.761 1.00 12.49 ? 426 PHE B CD1 1 
ATOM   7726  C  CD2 . PHE B 1 395 ? 77.399  16.292  -11.477 1.00 14.56 ? 426 PHE B CD2 1 
ATOM   7727  C  CE1 . PHE B 1 395 ? 79.794  17.252  -12.399 1.00 11.71 ? 426 PHE B CE1 1 
ATOM   7728  C  CE2 . PHE B 1 395 ? 77.474  17.537  -12.119 1.00 12.07 ? 426 PHE B CE2 1 
ATOM   7729  C  CZ  . PHE B 1 395 ? 78.675  18.004  -12.574 1.00 9.38  ? 426 PHE B CZ  1 
ATOM   7730  N  N   . THR B 1 396 ? 79.449  11.092  -9.790  1.00 7.93  ? 427 THR B N   1 
ATOM   7731  C  CA  . THR B 1 396 ? 79.394  10.031  -8.784  1.00 11.53 ? 427 THR B CA  1 
ATOM   7732  C  C   . THR B 1 396 ? 80.757  9.904   -8.116  1.00 13.25 ? 427 THR B C   1 
ATOM   7733  O  O   . THR B 1 396 ? 80.873  9.527   -6.930  1.00 11.57 ? 427 THR B O   1 
ATOM   7734  C  CB  . THR B 1 396 ? 79.038  8.670   -9.423  1.00 12.60 ? 427 THR B CB  1 
ATOM   7735  O  OG1 . THR B 1 396 ? 77.708  8.715   -9.973  1.00 12.31 ? 427 THR B OG1 1 
ATOM   7736  C  CG2 . THR B 1 396 ? 79.130  7.553   -8.372  1.00 13.97 ? 427 THR B CG2 1 
ATOM   7737  N  N   . ARG B 1 397 ? 81.777  10.204  -8.922  1.00 15.92 ? 428 ARG B N   1 
ATOM   7738  C  CA  . ARG B 1 397 ? 83.179  10.171  -8.527  1.00 14.11 ? 428 ARG B CA  1 
ATOM   7739  C  C   . ARG B 1 397 ? 83.719  11.609  -8.572  1.00 12.09 ? 428 ARG B C   1 
ATOM   7740  O  O   . ARG B 1 397 ? 84.086  12.107  -9.644  1.00 13.56 ? 428 ARG B O   1 
ATOM   7741  C  CB  . ARG B 1 397 ? 83.989  9.302   -9.518  1.00 18.20 ? 428 ARG B CB  1 
ATOM   7742  C  CG  . ARG B 1 397 ? 83.531  7.832   -9.691  1.00 23.13 ? 428 ARG B CG  1 
ATOM   7743  C  CD  . ARG B 1 397 ? 82.190  7.722   -10.390 1.00 25.43 ? 428 ARG B CD  1 
ATOM   7744  N  NE  . ARG B 1 397 ? 81.715  6.351   -10.540 1.00 30.38 ? 428 ARG B NE  1 
ATOM   7745  C  CZ  . ARG B 1 397 ? 80.632  6.005   -11.242 1.00 31.99 ? 428 ARG B CZ  1 
ATOM   7746  N  NH1 . ARG B 1 397 ? 79.905  6.921   -11.853 1.00 29.18 ? 428 ARG B NH1 1 
ATOM   7747  N  NH2 . ARG B 1 397 ? 80.290  4.731   -11.378 1.00 33.66 ? 428 ARG B NH2 1 
ATOM   7748  N  N   . GLN B 1 398 ? 83.629  12.318  -7.454  1.00 7.38  ? 429 GLN B N   1 
ATOM   7749  C  CA  . GLN B 1 398 ? 84.177  13.676  -7.346  1.00 6.23  ? 429 GLN B CA  1 
ATOM   7750  C  C   . GLN B 1 398 ? 83.798  14.289  -6.032  1.00 6.13  ? 429 GLN B C   1 
ATOM   7751  O  O   . GLN B 1 398 ? 82.936  15.135  -5.981  1.00 5.97  ? 429 GLN B O   1 
ATOM   7752  C  CB  . GLN B 1 398 ? 83.788  14.640  -8.487  1.00 3.50  ? 429 GLN B CB  1 
ATOM   7753  C  CG  . GLN B 1 398 ? 84.430  16.044  -8.262  1.00 2.68  ? 429 GLN B CG  1 
ATOM   7754  C  CD  . GLN B 1 398 ? 84.302  17.044  -9.437  1.00 6.31  ? 429 GLN B CD  1 
ATOM   7755  O  OE1 . GLN B 1 398 ? 83.803  16.733  -10.540 1.00 4.66  ? 429 GLN B OE1 1 
ATOM   7756  N  NE2 . GLN B 1 398 ? 84.764  18.275  -9.185  1.00 6.63  ? 429 GLN B NE2 1 
ATOM   7757  N  N   . ILE B 1 399 ? 84.490  13.884  -4.974  1.00 7.36  ? 430 ILE B N   1 
ATOM   7758  C  CA  . ILE B 1 399 ? 84.228  14.389  -3.636  1.00 6.36  ? 430 ILE B CA  1 
ATOM   7759  C  C   . ILE B 1 399 ? 83.943  15.904  -3.599  1.00 7.08  ? 430 ILE B C   1 
ATOM   7760  O  O   . ILE B 1 399 ? 84.454  16.679  -4.422  1.00 6.55  ? 430 ILE B O   1 
ATOM   7761  C  CB  . ILE B 1 399 ? 85.396  14.072  -2.697  1.00 3.58  ? 430 ILE B CB  1 
ATOM   7762  C  CG1 . ILE B 1 399 ? 84.914  14.023  -1.248  1.00 5.22  ? 430 ILE B CG1 1 
ATOM   7763  C  CG2 . ILE B 1 399 ? 86.440  15.136  -2.818  1.00 3.63  ? 430 ILE B CG2 1 
ATOM   7764  C  CD1 . ILE B 1 399 ? 85.965  13.622  -0.247  1.00 2.14  ? 430 ILE B CD1 1 
ATOM   7765  N  N   . ALA B 1 400 ? 83.115  16.298  -2.642  1.00 5.98  ? 431 ALA B N   1 
ATOM   7766  C  CA  . ALA B 1 400 ? 82.734  17.678  -2.463  1.00 5.87  ? 431 ALA B CA  1 
ATOM   7767  C  C   . ALA B 1 400 ? 83.281  18.083  -1.108  1.00 3.85  ? 431 ALA B C   1 
ATOM   7768  O  O   . ALA B 1 400 ? 83.566  17.225  -0.262  1.00 2.00  ? 431 ALA B O   1 
ATOM   7769  C  CB  . ALA B 1 400 ? 81.178  17.830  -2.525  1.00 9.78  ? 431 ALA B CB  1 
ATOM   7770  N  N   . GLY B 1 401 ? 83.405  19.391  -0.912  1.00 4.66  ? 432 GLY B N   1 
ATOM   7771  C  CA  . GLY B 1 401 ? 83.956  19.925  0.316   1.00 6.58  ? 432 GLY B CA  1 
ATOM   7772  C  C   . GLY B 1 401 ? 83.201  19.733  1.615   1.00 6.51  ? 432 GLY B C   1 
ATOM   7773  O  O   . GLY B 1 401 ? 82.007  19.572  1.646   1.00 9.21  ? 432 GLY B O   1 
ATOM   7774  N  N   . ARG B 1 402 ? 83.945  19.691  2.703   1.00 9.26  ? 433 ARG B N   1 
ATOM   7775  C  CA  . ARG B 1 402 ? 83.395  19.583  4.039   1.00 9.83  ? 433 ARG B CA  1 
ATOM   7776  C  C   . ARG B 1 402 ? 82.695  20.942  4.215   1.00 11.25 ? 433 ARG B C   1 
ATOM   7777  O  O   . ARG B 1 402 ? 83.156  21.952  3.681   1.00 13.90 ? 433 ARG B O   1 
ATOM   7778  C  CB  . ARG B 1 402 ? 84.565  19.450  5.025   1.00 11.78 ? 433 ARG B CB  1 
ATOM   7779  C  CG  . ARG B 1 402 ? 84.202  18.825  6.333   1.00 17.47 ? 433 ARG B CG  1 
ATOM   7780  C  CD  . ARG B 1 402 ? 85.383  18.695  7.299   1.00 20.36 ? 433 ARG B CD  1 
ATOM   7781  N  NE  . ARG B 1 402 ? 84.977  17.957  8.509   1.00 24.28 ? 433 ARG B NE  1 
ATOM   7782  C  CZ  . ARG B 1 402 ? 85.638  16.916  9.023   1.00 25.65 ? 433 ARG B CZ  1 
ATOM   7783  N  NH1 . ARG B 1 402 ? 86.758  16.488  8.435   1.00 23.44 ? 433 ARG B NH1 1 
ATOM   7784  N  NH2 . ARG B 1 402 ? 85.147  16.254  10.081  1.00 23.24 ? 433 ARG B NH2 1 
ATOM   7785  N  N   . VAL B 1 403 ? 81.576  20.991  4.921   1.00 10.61 ? 434 VAL B N   1 
ATOM   7786  C  CA  . VAL B 1 403 ? 80.882  22.273  5.084   1.00 8.87  ? 434 VAL B CA  1 
ATOM   7787  C  C   . VAL B 1 403 ? 81.308  22.913  6.388   1.00 5.24  ? 434 VAL B C   1 
ATOM   7788  O  O   . VAL B 1 403 ? 81.775  24.050  6.394   1.00 4.24  ? 434 VAL B O   1 
ATOM   7789  C  CB  . VAL B 1 403 ? 79.304  22.125  5.012   1.00 11.72 ? 434 VAL B CB  1 
ATOM   7790  C  CG1 . VAL B 1 403 ? 78.616  23.488  5.168   1.00 7.06  ? 434 VAL B CG1 1 
ATOM   7791  C  CG2 . VAL B 1 403 ? 78.875  21.468  3.678   1.00 6.11  ? 434 VAL B CG2 1 
ATOM   7792  N  N   . ALA B 1 404 ? 81.147  22.175  7.478   1.00 3.63  ? 435 ALA B N   1 
ATOM   7793  C  CA  . ALA B 1 404 ? 81.534  22.666  8.785   1.00 8.89  ? 435 ALA B CA  1 
ATOM   7794  C  C   . ALA B 1 404 ? 83.038  22.532  8.887   1.00 13.74 ? 435 ALA B C   1 
ATOM   7795  O  O   . ALA B 1 404 ? 83.682  22.055  7.944   1.00 16.05 ? 435 ALA B O   1 
ATOM   7796  C  CB  . ALA B 1 404 ? 80.881  21.866  9.856   1.00 6.04  ? 435 ALA B CB  1 
ATOM   7797  N  N   . GLY B 1 405 ? 83.611  22.948  10.012  1.00 16.50 ? 436 GLY B N   1 
ATOM   7798  C  CA  . GLY B 1 405 ? 85.056  22.829  10.157  1.00 20.41 ? 436 GLY B CA  1 
ATOM   7799  C  C   . GLY B 1 405 ? 85.888  24.101  10.041  1.00 20.28 ? 436 GLY B C   1 
ATOM   7800  O  O   . GLY B 1 405 ? 86.608  24.457  10.990  1.00 25.41 ? 436 GLY B O   1 
ATOM   7801  N  N   . GLY B 1 406 ? 85.884  24.733  8.869   1.00 16.21 ? 437 GLY B N   1 
ATOM   7802  C  CA  . GLY B 1 406 ? 86.624  25.972  8.733   1.00 10.99 ? 437 GLY B CA  1 
ATOM   7803  C  C   . GLY B 1 406 ? 86.976  26.363  7.313   1.00 9.54  ? 437 GLY B C   1 
ATOM   7804  O  O   . GLY B 1 406 ? 86.857  25.565  6.362   1.00 8.31  ? 437 GLY B O   1 
ATOM   7805  N  N   . ARG B 1 407 ? 87.320  27.632  7.171   1.00 3.51  ? 438 ARG B N   1 
ATOM   7806  C  CA  . ARG B 1 407 ? 87.773  28.197  5.924   1.00 3.12  ? 438 ARG B CA  1 
ATOM   7807  C  C   . ARG B 1 407 ? 87.617  27.380  4.633   1.00 2.51  ? 438 ARG B C   1 
ATOM   7808  O  O   . ARG B 1 407 ? 88.609  27.118  3.947   1.00 5.40  ? 438 ARG B O   1 
ATOM   7809  C  CB  . ARG B 1 407 ? 89.248  28.529  6.088   1.00 3.08  ? 438 ARG B CB  1 
ATOM   7810  C  CG  . ARG B 1 407 ? 89.582  29.243  7.359   1.00 7.27  ? 438 ARG B CG  1 
ATOM   7811  C  CD  . ARG B 1 407 ? 91.080  29.498  7.441   1.00 12.74 ? 438 ARG B CD  1 
ATOM   7812  N  NE  . ARG B 1 407 ? 91.369  30.586  8.362   1.00 9.94  ? 438 ARG B NE  1 
ATOM   7813  C  CZ  . ARG B 1 407 ? 92.220  30.508  9.367   1.00 8.19  ? 438 ARG B CZ  1 
ATOM   7814  N  NH1 . ARG B 1 407 ? 92.896  29.392  9.569   1.00 8.80  ? 438 ARG B NH1 1 
ATOM   7815  N  NH2 . ARG B 1 407 ? 92.294  31.501  10.244  1.00 10.67 ? 438 ARG B NH2 1 
ATOM   7816  N  N   . ASN B 1 408 ? 86.405  27.010  4.248   1.00 3.66  ? 439 ASN B N   1 
ATOM   7817  C  CA  . ASN B 1 408 ? 86.286  26.257  3.000   1.00 5.76  ? 439 ASN B CA  1 
ATOM   7818  C  C   . ASN B 1 408 ? 85.301  26.873  1.960   1.00 5.77  ? 439 ASN B C   1 
ATOM   7819  O  O   . ASN B 1 408 ? 84.853  26.196  1.011   1.00 5.33  ? 439 ASN B O   1 
ATOM   7820  C  CB  . ASN B 1 408 ? 86.003  24.769  3.279   1.00 3.61  ? 439 ASN B CB  1 
ATOM   7821  C  CG  . ASN B 1 408 ? 86.475  23.868  2.149   1.00 2.00  ? 439 ASN B CG  1 
ATOM   7822  O  OD1 . ASN B 1 408 ? 87.437  24.181  1.454   1.00 2.00  ? 439 ASN B OD1 1 
ATOM   7823  N  ND2 . ASN B 1 408 ? 85.809  22.741  1.973   1.00 3.02  ? 439 ASN B ND2 1 
ATOM   7824  N  N   . VAL B 1 409 ? 85.049  28.180  2.084   1.00 2.00  ? 440 VAL B N   1 
ATOM   7825  C  CA  . VAL B 1 409 ? 84.153  28.870  1.158   1.00 2.15  ? 440 VAL B CA  1 
ATOM   7826  C  C   . VAL B 1 409 ? 84.846  29.341  -0.132  1.00 2.00  ? 440 VAL B C   1 
ATOM   7827  O  O   . VAL B 1 409 ? 85.761  30.162  -0.113  1.00 4.62  ? 440 VAL B O   1 
ATOM   7828  C  CB  . VAL B 1 409 ? 83.459  30.084  1.850   1.00 4.70  ? 440 VAL B CB  1 
ATOM   7829  C  CG1 . VAL B 1 409 ? 82.542  30.824  0.868   1.00 2.00  ? 440 VAL B CG1 1 
ATOM   7830  C  CG2 . VAL B 1 409 ? 82.657  29.629  3.085   1.00 2.00  ? 440 VAL B CG2 1 
ATOM   7831  N  N   . PRO B 1 410 ? 84.434  28.806  -1.275  1.00 2.00  ? 441 PRO B N   1 
ATOM   7832  C  CA  . PRO B 1 410 ? 85.039  29.204  -2.548  1.00 5.40  ? 441 PRO B CA  1 
ATOM   7833  C  C   . PRO B 1 410 ? 85.042  30.699  -2.803  1.00 6.19  ? 441 PRO B C   1 
ATOM   7834  O  O   . PRO B 1 410 ? 84.010  31.310  -2.883  1.00 6.86  ? 441 PRO B O   1 
ATOM   7835  C  CB  . PRO B 1 410 ? 84.172  28.474  -3.574  1.00 3.42  ? 441 PRO B CB  1 
ATOM   7836  C  CG  . PRO B 1 410 ? 83.933  27.189  -2.903  1.00 3.91  ? 441 PRO B CG  1 
ATOM   7837  C  CD  . PRO B 1 410 ? 83.598  27.614  -1.456  1.00 3.41  ? 441 PRO B CD  1 
ATOM   7838  N  N   . ILE B 1 411 ? 86.214  31.265  -3.008  1.00 10.19 ? 442 ILE B N   1 
ATOM   7839  C  CA  . ILE B 1 411 ? 86.374  32.695  -3.276  1.00 13.00 ? 442 ILE B CA  1 
ATOM   7840  C  C   . ILE B 1 411 ? 85.438  33.220  -4.369  1.00 12.35 ? 442 ILE B C   1 
ATOM   7841  O  O   . ILE B 1 411 ? 85.280  34.436  -4.529  1.00 11.09 ? 442 ILE B O   1 
ATOM   7842  C  CB  . ILE B 1 411 ? 87.903  33.030  -3.594  1.00 15.63 ? 442 ILE B CB  1 
ATOM   7843  C  CG1 . ILE B 1 411 ? 88.682  33.216  -2.277  1.00 18.28 ? 442 ILE B CG1 1 
ATOM   7844  C  CG2 . ILE B 1 411 ? 88.076  34.244  -4.515  1.00 13.32 ? 442 ILE B CG2 1 
ATOM   7845  C  CD1 . ILE B 1 411 ? 88.994  31.891  -1.530  1.00 17.01 ? 442 ILE B CD1 1 
ATOM   7846  N  N   . ALA B 1 412 ? 84.840  32.319  -5.145  1.00 12.73 ? 443 ALA B N   1 
ATOM   7847  C  CA  . ALA B 1 412 ? 83.895  32.759  -6.187  1.00 14.91 ? 443 ALA B CA  1 
ATOM   7848  C  C   . ALA B 1 412 ? 82.554  33.125  -5.482  1.00 15.51 ? 443 ALA B C   1 
ATOM   7849  O  O   . ALA B 1 412 ? 82.090  34.291  -5.420  1.00 14.11 ? 443 ALA B O   1 
ATOM   7850  C  CB  . ALA B 1 412 ? 83.680  31.637  -7.196  1.00 13.09 ? 443 ALA B CB  1 
ATOM   7851  N  N   . VAL B 1 413 ? 82.015  32.112  -4.825  1.00 14.71 ? 444 VAL B N   1 
ATOM   7852  C  CA  . VAL B 1 413 ? 80.788  32.203  -4.074  1.00 10.70 ? 444 VAL B CA  1 
ATOM   7853  C  C   . VAL B 1 413 ? 81.126  32.950  -2.776  1.00 11.06 ? 444 VAL B C   1 
ATOM   7854  O  O   . VAL B 1 413 ? 80.551  32.678  -1.716  1.00 10.58 ? 444 VAL B O   1 
ATOM   7855  C  CB  . VAL B 1 413 ? 80.330  30.769  -3.771  1.00 8.40  ? 444 VAL B CB  1 
ATOM   7856  C  CG1 . VAL B 1 413 ? 79.025  30.761  -3.101  1.00 13.13 ? 444 VAL B CG1 1 
ATOM   7857  C  CG2 . VAL B 1 413 ? 80.224  29.997  -5.053  1.00 8.34  ? 444 VAL B CG2 1 
ATOM   7858  N  N   . GLN B 1 414 ? 82.076  33.879  -2.844  1.00 11.67 ? 445 GLN B N   1 
ATOM   7859  C  CA  . GLN B 1 414 ? 82.481  34.609  -1.647  1.00 15.76 ? 445 GLN B CA  1 
ATOM   7860  C  C   . GLN B 1 414 ? 81.517  35.745  -1.481  1.00 14.31 ? 445 GLN B C   1 
ATOM   7861  O  O   . GLN B 1 414 ? 81.136  36.087  -0.361  1.00 13.58 ? 445 GLN B O   1 
ATOM   7862  C  CB  . GLN B 1 414 ? 83.917  35.161  -1.763  1.00 21.70 ? 445 GLN B CB  1 
ATOM   7863  C  CG  . GLN B 1 414 ? 84.079  36.342  -2.731  1.00 23.67 ? 445 GLN B CG  1 
ATOM   7864  C  CD  . GLN B 1 414 ? 85.285  37.185  -2.430  1.00 21.80 ? 445 GLN B CD  1 
ATOM   7865  O  OE1 . GLN B 1 414 ? 85.721  37.283  -1.280  1.00 23.25 ? 445 GLN B OE1 1 
ATOM   7866  N  NE2 . GLN B 1 414 ? 85.814  37.827  -3.455  1.00 22.32 ? 445 GLN B NE2 1 
ATOM   7867  N  N   . ALA B 1 415 ? 81.122  36.315  -2.618  1.00 12.40 ? 446 ALA B N   1 
ATOM   7868  C  CA  . ALA B 1 415 ? 80.181  37.421  -2.650  1.00 10.77 ? 446 ALA B CA  1 
ATOM   7869  C  C   . ALA B 1 415 ? 78.948  37.005  -1.848  1.00 10.52 ? 446 ALA B C   1 
ATOM   7870  O  O   . ALA B 1 415 ? 78.376  37.786  -1.069  1.00 11.05 ? 446 ALA B O   1 
ATOM   7871  C  CB  . ALA B 1 415 ? 79.802  37.700  -4.091  1.00 10.74 ? 446 ALA B CB  1 
ATOM   7872  N  N   . VAL B 1 416 ? 78.596  35.731  -2.024  1.00 9.01  ? 447 VAL B N   1 
ATOM   7873  C  CA  . VAL B 1 416 ? 77.466  35.085  -1.381  1.00 4.48  ? 447 VAL B CA  1 
ATOM   7874  C  C   . VAL B 1 416 ? 77.590  35.045  0.137   1.00 4.20  ? 447 VAL B C   1 
ATOM   7875  O  O   . VAL B 1 416 ? 76.900  35.770  0.822   1.00 6.38  ? 447 VAL B O   1 
ATOM   7876  C  CB  . VAL B 1 416 ? 77.308  33.682  -1.927  1.00 3.03  ? 447 VAL B CB  1 
ATOM   7877  C  CG1 . VAL B 1 416 ? 76.217  32.973  -1.218  1.00 3.23  ? 447 VAL B CG1 1 
ATOM   7878  C  CG2 . VAL B 1 416 ? 77.058  33.740  -3.419  1.00 2.00  ? 447 VAL B CG2 1 
ATOM   7879  N  N   . ALA B 1 417 ? 78.484  34.239  0.677   1.00 3.88  ? 448 ALA B N   1 
ATOM   7880  C  CA  . ALA B 1 417 ? 78.624  34.182  2.133   1.00 4.88  ? 448 ALA B CA  1 
ATOM   7881  C  C   . ALA B 1 417 ? 78.720  35.548  2.838   1.00 4.20  ? 448 ALA B C   1 
ATOM   7882  O  O   . ALA B 1 417 ? 78.401  35.664  4.030   1.00 2.00  ? 448 ALA B O   1 
ATOM   7883  C  CB  . ALA B 1 417 ? 79.815  33.336  2.500   1.00 8.44  ? 448 ALA B CB  1 
ATOM   7884  N  N   . LYS B 1 418 ? 79.231  36.545  2.111   1.00 3.85  ? 449 LYS B N   1 
ATOM   7885  C  CA  . LYS B 1 418 ? 79.381  37.906  2.613   1.00 4.18  ? 449 LYS B CA  1 
ATOM   7886  C  C   . LYS B 1 418 ? 77.952  38.352  2.826   1.00 5.43  ? 449 LYS B C   1 
ATOM   7887  O  O   . LYS B 1 418 ? 77.543  38.756  3.932   1.00 3.33  ? 449 LYS B O   1 
ATOM   7888  C  CB  . LYS B 1 418 ? 80.033  38.787  1.533   1.00 6.28  ? 449 LYS B CB  1 
ATOM   7889  C  CG  . LYS B 1 418 ? 80.978  39.918  2.057   1.00 8.74  ? 449 LYS B CG  1 
ATOM   7890  C  CD  . LYS B 1 418 ? 80.270  41.195  2.483   1.00 4.34  ? 449 LYS B CD  1 
ATOM   7891  C  CE  . LYS B 1 418 ? 81.215  42.157  3.126   1.00 2.00  ? 449 LYS B CE  1 
ATOM   7892  N  NZ  . LYS B 1 418 ? 80.506  43.416  3.447   1.00 7.98  ? 449 LYS B NZ  1 
ATOM   7893  N  N   . ALA B 1 419 ? 77.202  38.282  1.734   1.00 5.72  ? 450 ALA B N   1 
ATOM   7894  C  CA  . ALA B 1 419 ? 75.793  38.617  1.742   1.00 6.71  ? 450 ALA B CA  1 
ATOM   7895  C  C   . ALA B 1 419 ? 75.123  37.848  2.892   1.00 5.47  ? 450 ALA B C   1 
ATOM   7896  O  O   . ALA B 1 419 ? 74.582  38.468  3.794   1.00 6.82  ? 450 ALA B O   1 
ATOM   7897  C  CB  . ALA B 1 419 ? 75.165  38.242  0.416   1.00 7.03  ? 450 ALA B CB  1 
ATOM   7898  N  N   . SER B 1 420 ? 75.233  36.522  2.914   1.00 2.00  ? 451 SER B N   1 
ATOM   7899  C  CA  . SER B 1 420 ? 74.628  35.741  3.979   1.00 3.06  ? 451 SER B CA  1 
ATOM   7900  C  C   . SER B 1 420 ? 74.898  36.335  5.339   1.00 4.69  ? 451 SER B C   1 
ATOM   7901  O  O   . SER B 1 420 ? 74.048  36.319  6.221   1.00 3.92  ? 451 SER B O   1 
ATOM   7902  C  CB  . SER B 1 420 ? 75.139  34.316  3.957   1.00 4.36  ? 451 SER B CB  1 
ATOM   7903  O  OG  . SER B 1 420 ? 74.589  33.623  2.852   1.00 10.38 ? 451 SER B OG  1 
ATOM   7904  N  N   . ILE B 1 421 ? 76.089  36.873  5.517   1.00 8.80  ? 452 ILE B N   1 
ATOM   7905  C  CA  . ILE B 1 421 ? 76.421  37.478  6.797   1.00 9.60  ? 452 ILE B CA  1 
ATOM   7906  C  C   . ILE B 1 421 ? 75.631  38.760  6.978   1.00 8.86  ? 452 ILE B C   1 
ATOM   7907  O  O   . ILE B 1 421 ? 74.977  38.952  7.999   1.00 6.37  ? 452 ILE B O   1 
ATOM   7908  C  CB  . ILE B 1 421 ? 77.925  37.719  6.921   1.00 10.97 ? 452 ILE B CB  1 
ATOM   7909  C  CG1 . ILE B 1 421 ? 78.611  36.355  7.113   1.00 12.50 ? 452 ILE B CG1 1 
ATOM   7910  C  CG2 . ILE B 1 421 ? 78.208  38.720  8.056   1.00 8.64  ? 452 ILE B CG2 1 
ATOM   7911  C  CD1 . ILE B 1 421 ? 80.099  36.395  7.178   1.00 17.32 ? 452 ILE B CD1 1 
ATOM   7912  N  N   . ASP B 1 422 ? 75.629  39.579  5.935   1.00 9.42  ? 453 ASP B N   1 
ATOM   7913  C  CA  . ASP B 1 422 ? 74.908  40.851  5.914   1.00 10.66 ? 453 ASP B CA  1 
ATOM   7914  C  C   . ASP B 1 422 ? 73.383  40.795  6.049   1.00 10.70 ? 453 ASP B C   1 
ATOM   7915  O  O   . ASP B 1 422 ? 72.770  41.711  6.617   1.00 13.63 ? 453 ASP B O   1 
ATOM   7916  C  CB  . ASP B 1 422 ? 75.215  41.573  4.621   1.00 9.93  ? 453 ASP B CB  1 
ATOM   7917  C  CG  . ASP B 1 422 ? 76.649  41.778  4.440   1.00 6.70  ? 453 ASP B CG  1 
ATOM   7918  O  OD1 . ASP B 1 422 ? 77.318  42.008  5.479   1.00 5.87  ? 453 ASP B OD1 1 
ATOM   7919  O  OD2 . ASP B 1 422 ? 77.078  41.696  3.276   1.00 5.70  ? 453 ASP B OD2 1 
ATOM   7920  N  N   . GLN B 1 423 ? 72.769  39.796  5.420   1.00 6.24  ? 454 GLN B N   1 
ATOM   7921  C  CA  . GLN B 1 423 ? 71.345  39.639  5.466   1.00 2.00  ? 454 GLN B CA  1 
ATOM   7922  C  C   . GLN B 1 423 ? 70.886  39.230  6.824   1.00 2.00  ? 454 GLN B C   1 
ATOM   7923  O  O   . GLN B 1 423 ? 70.148  39.951  7.445   1.00 2.00  ? 454 GLN B O   1 
ATOM   7924  C  CB  . GLN B 1 423 ? 70.900  38.694  4.407   1.00 2.00  ? 454 GLN B CB  1 
ATOM   7925  C  CG  . GLN B 1 423 ? 71.012  39.345  3.061   1.00 2.19  ? 454 GLN B CG  1 
ATOM   7926  C  CD  . GLN B 1 423 ? 70.569  38.429  1.927   1.00 5.47  ? 454 GLN B CD  1 
ATOM   7927  O  OE1 . GLN B 1 423 ? 70.278  38.881  0.804   1.00 4.60  ? 454 GLN B OE1 1 
ATOM   7928  N  NE2 . GLN B 1 423 ? 70.509  37.130  2.216   1.00 4.26  ? 454 GLN B NE2 1 
ATOM   7929  N  N   . SER B 1 424 ? 71.360  38.121  7.340   1.00 2.00  ? 455 SER B N   1 
ATOM   7930  C  CA  . SER B 1 424 ? 70.962  37.719  8.697   1.00 4.67  ? 455 SER B CA  1 
ATOM   7931  C  C   . SER B 1 424 ? 71.107  38.913  9.653   1.00 3.84  ? 455 SER B C   1 
ATOM   7932  O  O   . SER B 1 424 ? 70.407  39.009  10.668  1.00 2.00  ? 455 SER B O   1 
ATOM   7933  C  CB  . SER B 1 424 ? 71.812  36.527  9.215   1.00 9.31  ? 455 SER B CB  1 
ATOM   7934  O  OG  . SER B 1 424 ? 71.495  35.289  8.560   1.00 14.37 ? 455 SER B OG  1 
ATOM   7935  N  N   . ARG B 1 425 ? 72.019  39.818  9.293   1.00 6.06  ? 456 ARG B N   1 
ATOM   7936  C  CA  . ARG B 1 425 ? 72.294  41.035  10.047  1.00 8.10  ? 456 ARG B CA  1 
ATOM   7937  C  C   . ARG B 1 425 ? 71.065  41.909  9.978   1.00 7.21  ? 456 ARG B C   1 
ATOM   7938  O  O   . ARG B 1 425 ? 70.538  42.342  11.011  1.00 5.65  ? 456 ARG B O   1 
ATOM   7939  C  CB  . ARG B 1 425 ? 73.454  41.821  9.411   1.00 10.30 ? 456 ARG B CB  1 
ATOM   7940  C  CG  . ARG B 1 425 ? 74.874  41.250  9.582   1.00 15.62 ? 456 ARG B CG  1 
ATOM   7941  C  CD  . ARG B 1 425 ? 75.555  41.666  10.901  1.00 15.69 ? 456 ARG B CD  1 
ATOM   7942  N  NE  . ARG B 1 425 ? 76.816  40.948  11.115  1.00 16.09 ? 456 ARG B NE  1 
ATOM   7943  C  CZ  . ARG B 1 425 ? 78.032  41.430  10.846  1.00 14.89 ? 456 ARG B CZ  1 
ATOM   7944  N  NH1 . ARG B 1 425 ? 78.202  42.647  10.338  1.00 13.06 ? 456 ARG B NH1 1 
ATOM   7945  N  NH2 . ARG B 1 425 ? 79.088  40.681  11.092  1.00 12.60 ? 456 ARG B NH2 1 
ATOM   7946  N  N   . GLU B 1 426 ? 70.635  42.175  8.742   1.00 7.01  ? 457 GLU B N   1 
ATOM   7947  C  CA  . GLU B 1 426 ? 69.476  43.015  8.499   1.00 7.00  ? 457 GLU B CA  1 
ATOM   7948  C  C   . GLU B 1 426 ? 68.179  42.392  8.957   1.00 7.49  ? 457 GLU B C   1 
ATOM   7949  O  O   . GLU B 1 426 ? 67.292  43.076  9.457   1.00 7.54  ? 457 GLU B O   1 
ATOM   7950  C  CB  . GLU B 1 426 ? 69.399  43.485  7.046   1.00 7.28  ? 457 GLU B CB  1 
ATOM   7951  C  CG  . GLU B 1 426 ? 69.535  42.449  5.993   1.00 15.38 ? 457 GLU B CG  1 
ATOM   7952  C  CD  . GLU B 1 426 ? 69.446  43.018  4.557   1.00 23.45 ? 457 GLU B CD  1 
ATOM   7953  O  OE1 . GLU B 1 426 ? 68.524  43.845  4.272   1.00 19.26 ? 457 GLU B OE1 1 
ATOM   7954  O  OE2 . GLU B 1 426 ? 70.283  42.595  3.703   1.00 27.53 ? 457 GLU B OE2 1 
ATOM   7955  N  N   . MET B 1 427 ? 68.102  41.072  8.904   1.00 8.32  ? 458 MET B N   1 
ATOM   7956  C  CA  . MET B 1 427 ? 66.902  40.378  9.345   1.00 5.24  ? 458 MET B CA  1 
ATOM   7957  C  C   . MET B 1 427 ? 66.914  40.321  10.857  1.00 4.01  ? 458 MET B C   1 
ATOM   7958  O  O   . MET B 1 427 ? 66.233  39.532  11.444  1.00 5.71  ? 458 MET B O   1 
ATOM   7959  C  CB  . MET B 1 427 ? 66.855  38.976  8.749   1.00 2.76  ? 458 MET B CB  1 
ATOM   7960  C  CG  . MET B 1 427 ? 67.105  38.979  7.260   1.00 2.42  ? 458 MET B CG  1 
ATOM   7961  S  SD  . MET B 1 427 ? 66.111  37.856  6.380   1.00 6.96  ? 458 MET B SD  1 
ATOM   7962  C  CE  . MET B 1 427 ? 66.660  36.299  7.085   1.00 8.40  ? 458 MET B CE  1 
ATOM   7963  N  N   . LYS B 1 428 ? 67.710  41.170  11.478  1.00 4.59  ? 459 LYS B N   1 
ATOM   7964  C  CA  . LYS B 1 428 ? 67.838  41.244  12.917  1.00 5.12  ? 459 LYS B CA  1 
ATOM   7965  C  C   . LYS B 1 428 ? 67.851  39.947  13.706  1.00 4.95  ? 459 LYS B C   1 
ATOM   7966  O  O   . LYS B 1 428 ? 67.249  39.880  14.789  1.00 4.56  ? 459 LYS B O   1 
ATOM   7967  C  CB  . LYS B 1 428 ? 66.842  42.245  13.481  1.00 4.00  ? 459 LYS B CB  1 
ATOM   7968  C  CG  . LYS B 1 428 ? 67.075  43.608  12.857  1.00 9.38  ? 459 LYS B CG  1 
ATOM   7969  C  CD  . LYS B 1 428 ? 66.827  44.785  13.823  1.00 15.93 ? 459 LYS B CD  1 
ATOM   7970  C  CE  . LYS B 1 428 ? 67.916  44.935  14.918  1.00 17.67 ? 459 LYS B CE  1 
ATOM   7971  N  NZ  . LYS B 1 428 ? 67.821  43.941  16.047  1.00 15.91 ? 459 LYS B NZ  1 
ATOM   7972  N  N   . TYR B 1 429 ? 68.624  38.967  13.206  1.00 5.76  ? 460 TYR B N   1 
ATOM   7973  C  CA  . TYR B 1 429 ? 68.802  37.621  13.830  1.00 7.27  ? 460 TYR B CA  1 
ATOM   7974  C  C   . TYR B 1 429 ? 69.315  37.640  15.277  1.00 9.18  ? 460 TYR B C   1 
ATOM   7975  O  O   . TYR B 1 429 ? 69.692  38.684  15.802  1.00 11.07 ? 460 TYR B O   1 
ATOM   7976  C  CB  . TYR B 1 429 ? 69.788  36.782  13.029  1.00 4.87  ? 460 TYR B CB  1 
ATOM   7977  C  CG  . TYR B 1 429 ? 69.184  35.845  12.032  1.00 2.59  ? 460 TYR B CG  1 
ATOM   7978  C  CD1 . TYR B 1 429 ? 68.339  36.308  11.038  1.00 7.33  ? 460 TYR B CD1 1 
ATOM   7979  C  CD2 . TYR B 1 429 ? 69.471  34.487  12.077  1.00 5.12  ? 460 TYR B CD2 1 
ATOM   7980  C  CE1 . TYR B 1 429 ? 67.779  35.446  10.104  1.00 7.94  ? 460 TYR B CE1 1 
ATOM   7981  C  CE2 . TYR B 1 429 ? 68.937  33.606  11.152  1.00 6.77  ? 460 TYR B CE2 1 
ATOM   7982  C  CZ  . TYR B 1 429 ? 68.082  34.100  10.165  1.00 10.41 ? 460 TYR B CZ  1 
ATOM   7983  O  OH  . TYR B 1 429 ? 67.520  33.256  9.236   1.00 12.26 ? 460 TYR B OH  1 
ATOM   7984  N  N   . GLN B 1 430 ? 69.399  36.476  15.908  1.00 9.44  ? 461 GLN B N   1 
ATOM   7985  C  CA  . GLN B 1 430 ? 69.857  36.457  17.296  1.00 12.47 ? 461 GLN B CA  1 
ATOM   7986  C  C   . GLN B 1 430 ? 71.156  35.702  17.508  1.00 14.66 ? 461 GLN B C   1 
ATOM   7987  O  O   . GLN B 1 430 ? 71.707  35.110  16.564  1.00 16.32 ? 461 GLN B O   1 
ATOM   7988  C  CB  . GLN B 1 430 ? 68.779  35.898  18.214  1.00 12.72 ? 461 GLN B CB  1 
ATOM   7989  C  CG  . GLN B 1 430 ? 68.054  36.940  19.022  1.00 14.25 ? 461 GLN B CG  1 
ATOM   7990  C  CD  . GLN B 1 430 ? 66.761  36.409  19.630  1.00 14.39 ? 461 GLN B CD  1 
ATOM   7991  O  OE1 . GLN B 1 430 ? 66.769  35.734  20.673  1.00 12.33 ? 461 GLN B OE1 1 
ATOM   7992  N  NE2 . GLN B 1 430 ? 65.646  36.678  18.962  1.00 12.37 ? 461 GLN B NE2 1 
ATOM   7993  N  N   . SER B 1 431 ? 71.645  35.748  18.747  1.00 13.22 ? 462 SER B N   1 
ATOM   7994  C  CA  . SER B 1 431 ? 72.891  35.091  19.130  1.00 13.80 ? 462 SER B CA  1 
ATOM   7995  C  C   . SER B 1 431 ? 72.895  33.586  18.804  1.00 14.20 ? 462 SER B C   1 
ATOM   7996  O  O   . SER B 1 431 ? 71.841  32.927  18.923  1.00 15.17 ? 462 SER B O   1 
ATOM   7997  C  CB  . SER B 1 431 ? 73.125  35.311  20.640  1.00 15.75 ? 462 SER B CB  1 
ATOM   7998  O  OG  . SER B 1 431 ? 73.949  34.300  21.220  1.00 17.63 ? 462 SER B OG  1 
ATOM   7999  N  N   . LEU B 1 432 ? 74.063  33.048  18.412  1.00 11.98 ? 463 LEU B N   1 
ATOM   8000  C  CA  . LEU B 1 432 ? 74.192  31.626  18.111  1.00 6.54  ? 463 LEU B CA  1 
ATOM   8001  C  C   . LEU B 1 432 ? 73.874  30.876  19.391  1.00 4.34  ? 463 LEU B C   1 
ATOM   8002  O  O   . LEU B 1 432 ? 73.294  29.811  19.343  1.00 3.53  ? 463 LEU B O   1 
ATOM   8003  C  CB  . LEU B 1 432 ? 75.605  31.277  17.647  1.00 6.69  ? 463 LEU B CB  1 
ATOM   8004  C  CG  . LEU B 1 432 ? 76.026  29.816  17.928  1.00 9.13  ? 463 LEU B CG  1 
ATOM   8005  C  CD1 . LEU B 1 432 ? 75.403  28.870  16.882  1.00 7.90  ? 463 LEU B CD1 1 
ATOM   8006  C  CD2 . LEU B 1 432 ? 77.544  29.655  17.997  1.00 2.00  ? 463 LEU B CD2 1 
ATOM   8007  N  N   . ASN B 1 433 ? 74.232  31.440  20.537  1.00 2.14  ? 464 ASN B N   1 
ATOM   8008  C  CA  . ASN B 1 433 ? 73.940  30.768  21.794  1.00 8.95  ? 464 ASN B CA  1 
ATOM   8009  C  C   . ASN B 1 433 ? 72.436  30.639  21.998  1.00 8.20  ? 464 ASN B C   1 
ATOM   8010  O  O   . ASN B 1 433 ? 71.918  29.584  22.376  1.00 7.53  ? 464 ASN B O   1 
ATOM   8011  C  CB  . ASN B 1 433 ? 74.580  31.486  23.001  1.00 15.10 ? 464 ASN B CB  1 
ATOM   8012  C  CG  . ASN B 1 433 ? 76.094  31.175  23.170  1.00 19.90 ? 464 ASN B CG  1 
ATOM   8013  O  OD1 . ASN B 1 433 ? 76.896  32.074  23.406  1.00 20.53 ? 464 ASN B OD1 1 
ATOM   8014  N  ND2 . ASN B 1 433 ? 76.473  29.903  23.049  1.00 21.92 ? 464 ASN B ND2 1 
ATOM   8015  N  N   . GLU B 1 434 ? 71.729  31.720  21.713  1.00 10.14 ? 465 GLU B N   1 
ATOM   8016  C  CA  . GLU B 1 434 ? 70.278  31.736  21.845  1.00 10.00 ? 465 GLU B CA  1 
ATOM   8017  C  C   . GLU B 1 434 ? 69.699  30.585  21.037  1.00 6.83  ? 465 GLU B C   1 
ATOM   8018  O  O   . GLU B 1 434 ? 69.008  29.741  21.579  1.00 7.26  ? 465 GLU B O   1 
ATOM   8019  C  CB  . GLU B 1 434 ? 69.693  33.091  21.413  1.00 12.70 ? 465 GLU B CB  1 
ATOM   8020  C  CG  . GLU B 1 434 ? 70.043  34.269  22.358  1.00 19.21 ? 465 GLU B CG  1 
ATOM   8021  C  CD  . GLU B 1 434 ? 69.679  34.030  23.861  1.00 25.54 ? 465 GLU B CD  1 
ATOM   8022  O  OE1 . GLU B 1 434 ? 68.870  33.131  24.193  1.00 27.32 ? 465 GLU B OE1 1 
ATOM   8023  O  OE2 . GLU B 1 434 ? 70.203  34.765  24.733  1.00 27.24 ? 465 GLU B OE2 1 
ATOM   8024  N  N   . TYR B 1 435 ? 70.070  30.490  19.772  1.00 2.18  ? 466 TYR B N   1 
ATOM   8025  C  CA  . TYR B 1 435 ? 69.569  29.413  18.969  1.00 3.81  ? 466 TYR B CA  1 
ATOM   8026  C  C   . TYR B 1 435 ? 69.967  28.062  19.517  1.00 5.15  ? 466 TYR B C   1 
ATOM   8027  O  O   . TYR B 1 435 ? 69.277  27.055  19.290  1.00 10.43 ? 466 TYR B O   1 
ATOM   8028  C  CB  . TYR B 1 435 ? 70.053  29.524  17.541  1.00 3.90  ? 466 TYR B CB  1 
ATOM   8029  C  CG  . TYR B 1 435 ? 69.308  30.552  16.758  1.00 5.76  ? 466 TYR B CG  1 
ATOM   8030  C  CD1 . TYR B 1 435 ? 69.740  31.860  16.739  1.00 6.65  ? 466 TYR B CD1 1 
ATOM   8031  C  CD2 . TYR B 1 435 ? 68.161  30.221  16.032  1.00 6.98  ? 466 TYR B CD2 1 
ATOM   8032  C  CE1 . TYR B 1 435 ? 69.059  32.832  16.018  1.00 10.09 ? 466 TYR B CE1 1 
ATOM   8033  C  CE2 . TYR B 1 435 ? 67.470  31.184  15.306  1.00 8.26  ? 466 TYR B CE2 1 
ATOM   8034  C  CZ  . TYR B 1 435 ? 67.934  32.490  15.311  1.00 10.16 ? 466 TYR B CZ  1 
ATOM   8035  O  OH  . TYR B 1 435 ? 67.292  33.484  14.631  1.00 15.15 ? 466 TYR B OH  1 
ATOM   8036  N  N   . ARG B 1 436 ? 71.079  28.001  20.226  1.00 6.71  ? 467 ARG B N   1 
ATOM   8037  C  CA  . ARG B 1 436 ? 71.494  26.697  20.730  1.00 9.03  ? 467 ARG B CA  1 
ATOM   8038  C  C   . ARG B 1 436 ? 70.562  26.330  21.832  1.00 6.77  ? 467 ARG B C   1 
ATOM   8039  O  O   . ARG B 1 436 ? 69.998  25.239  21.817  1.00 6.69  ? 467 ARG B O   1 
ATOM   8040  C  CB  . ARG B 1 436 ? 72.974  26.666  21.181  1.00 12.44 ? 467 ARG B CB  1 
ATOM   8041  C  CG  . ARG B 1 436 ? 74.012  26.547  20.012  1.00 12.95 ? 467 ARG B CG  1 
ATOM   8042  C  CD  . ARG B 1 436 ? 75.452  26.591  20.530  1.00 13.24 ? 467 ARG B CD  1 
ATOM   8043  N  NE  . ARG B 1 436 ? 75.738  25.445  21.388  1.00 11.74 ? 467 ARG B NE  1 
ATOM   8044  C  CZ  . ARG B 1 436 ? 75.894  24.197  20.946  1.00 8.48  ? 467 ARG B CZ  1 
ATOM   8045  N  NH1 . ARG B 1 436 ? 75.805  23.935  19.642  1.00 2.05  ? 467 ARG B NH1 1 
ATOM   8046  N  NH2 . ARG B 1 436 ? 76.098  23.212  21.825  1.00 4.00  ? 467 ARG B NH2 1 
ATOM   8047  N  N   . LYS B 1 437 ? 70.298  27.301  22.698  1.00 4.15  ? 468 LYS B N   1 
ATOM   8048  C  CA  . LYS B 1 437 ? 69.402  27.104  23.835  1.00 6.43  ? 468 LYS B CA  1 
ATOM   8049  C  C   . LYS B 1 437 ? 67.994  26.729  23.329  1.00 6.69  ? 468 LYS B C   1 
ATOM   8050  O  O   . LYS B 1 437 ? 67.302  25.847  23.875  1.00 5.12  ? 468 LYS B O   1 
ATOM   8051  C  CB  . LYS B 1 437 ? 69.310  28.385  24.658  1.00 3.82  ? 468 LYS B CB  1 
ATOM   8052  C  CG  . LYS B 1 437 ? 70.626  28.986  25.007  1.00 2.01  ? 468 LYS B CG  1 
ATOM   8053  C  CD  . LYS B 1 437 ? 70.465  30.469  25.279  1.00 2.61  ? 468 LYS B CD  1 
ATOM   8054  C  CE  . LYS B 1 437 ? 70.056  30.775  26.719  1.00 2.52  ? 468 LYS B CE  1 
ATOM   8055  N  NZ  . LYS B 1 437 ? 69.929  32.243  26.922  1.00 2.56  ? 468 LYS B NZ  1 
ATOM   8056  N  N   . ARG B 1 438 ? 67.590  27.411  22.269  1.00 5.54  ? 469 ARG B N   1 
ATOM   8057  C  CA  . ARG B 1 438 ? 66.303  27.193  21.639  1.00 5.60  ? 469 ARG B CA  1 
ATOM   8058  C  C   . ARG B 1 438 ? 66.173  25.739  21.218  1.00 5.89  ? 469 ARG B C   1 
ATOM   8059  O  O   . ARG B 1 438 ? 65.155  25.105  21.482  1.00 9.16  ? 469 ARG B O   1 
ATOM   8060  C  CB  . ARG B 1 438 ? 66.163  28.123  20.439  1.00 5.23  ? 469 ARG B CB  1 
ATOM   8061  C  CG  . ARG B 1 438 ? 64.973  27.864  19.578  1.00 7.48  ? 469 ARG B CG  1 
ATOM   8062  C  CD  . ARG B 1 438 ? 63.644  27.865  20.361  1.00 7.40  ? 469 ARG B CD  1 
ATOM   8063  N  NE  . ARG B 1 438 ? 62.772  26.818  19.826  1.00 6.66  ? 469 ARG B NE  1 
ATOM   8064  C  CZ  . ARG B 1 438 ? 62.151  26.891  18.658  1.00 3.94  ? 469 ARG B CZ  1 
ATOM   8065  N  NH1 . ARG B 1 438 ? 62.260  27.970  17.906  1.00 3.38  ? 469 ARG B NH1 1 
ATOM   8066  N  NH2 . ARG B 1 438 ? 61.538  25.832  18.185  1.00 4.82  ? 469 ARG B NH2 1 
ATOM   8067  N  N   . PHE B 1 439 ? 67.199  25.181  20.599  1.00 5.87  ? 470 PHE B N   1 
ATOM   8068  C  CA  . PHE B 1 439 ? 67.100  23.783  20.221  1.00 8.01  ? 470 PHE B CA  1 
ATOM   8069  C  C   . PHE B 1 439 ? 67.611  22.796  21.281  1.00 8.51  ? 470 PHE B C   1 
ATOM   8070  O  O   . PHE B 1 439 ? 68.017  21.663  20.973  1.00 8.82  ? 470 PHE B O   1 
ATOM   8071  C  CB  . PHE B 1 439 ? 67.705  23.551  18.847  1.00 7.18  ? 470 PHE B CB  1 
ATOM   8072  C  CG  . PHE B 1 439 ? 66.888  24.139  17.751  1.00 5.11  ? 470 PHE B CG  1 
ATOM   8073  C  CD1 . PHE B 1 439 ? 66.780  25.505  17.620  1.00 2.56  ? 470 PHE B CD1 1 
ATOM   8074  C  CD2 . PHE B 1 439 ? 66.229  23.328  16.852  1.00 4.90  ? 470 PHE B CD2 1 
ATOM   8075  C  CE1 . PHE B 1 439 ? 66.028  26.053  16.607  1.00 4.56  ? 470 PHE B CE1 1 
ATOM   8076  C  CE2 . PHE B 1 439 ? 65.468  23.878  15.827  1.00 3.60  ? 470 PHE B CE2 1 
ATOM   8077  C  CZ  . PHE B 1 439 ? 65.369  25.235  15.705  1.00 3.23  ? 470 PHE B CZ  1 
ATOM   8078  N  N   . SER B 1 440 ? 67.501  23.219  22.540  1.00 9.53  ? 471 SER B N   1 
ATOM   8079  C  CA  . SER B 1 440 ? 67.892  22.418  23.689  1.00 13.00 ? 471 SER B CA  1 
ATOM   8080  C  C   . SER B 1 440 ? 69.375  22.006  23.646  1.00 15.79 ? 471 SER B C   1 
ATOM   8081  O  O   . SER B 1 440 ? 69.735  20.868  23.978  1.00 18.56 ? 471 SER B O   1 
ATOM   8082  C  CB  . SER B 1 440 ? 66.993  21.175  23.772  1.00 14.62 ? 471 SER B CB  1 
ATOM   8083  O  OG  . SER B 1 440 ? 65.617  21.520  23.688  1.00 16.82 ? 471 SER B OG  1 
ATOM   8084  N  N   . LEU B 1 441 ? 70.239  22.920  23.233  1.00 14.39 ? 472 LEU B N   1 
ATOM   8085  C  CA  . LEU B 1 441 ? 71.659  22.617  23.175  1.00 13.12 ? 472 LEU B CA  1 
ATOM   8086  C  C   . LEU B 1 441 ? 72.348  23.518  24.192  1.00 15.51 ? 472 LEU B C   1 
ATOM   8087  O  O   . LEU B 1 441 ? 71.833  24.590  24.514  1.00 17.58 ? 472 LEU B O   1 
ATOM   8088  C  CB  . LEU B 1 441 ? 72.199  22.879  21.770  1.00 8.27  ? 472 LEU B CB  1 
ATOM   8089  C  CG  . LEU B 1 441 ? 71.481  22.194  20.608  1.00 2.49  ? 472 LEU B CG  1 
ATOM   8090  C  CD1 . LEU B 1 441 ? 72.235  22.445  19.319  1.00 2.70  ? 472 LEU B CD1 1 
ATOM   8091  C  CD2 . LEU B 1 441 ? 71.395  20.738  20.851  1.00 2.00  ? 472 LEU B CD2 1 
ATOM   8092  N  N   . LYS B 1 442 ? 73.453  23.061  24.766  1.00 16.63 ? 473 LYS B N   1 
ATOM   8093  C  CA  . LYS B 1 442 ? 74.168  23.888  25.731  1.00 18.69 ? 473 LYS B CA  1 
ATOM   8094  C  C   . LYS B 1 442 ? 75.028  24.877  24.976  1.00 17.78 ? 473 LYS B C   1 
ATOM   8095  O  O   . LYS B 1 442 ? 75.765  24.506  24.051  1.00 17.26 ? 473 LYS B O   1 
ATOM   8096  C  CB  . LYS B 1 442 ? 75.053  23.051  26.651  1.00 27.04 ? 473 LYS B CB  1 
ATOM   8097  C  CG  . LYS B 1 442 ? 74.340  22.481  27.894  1.00 34.15 ? 473 LYS B CG  1 
ATOM   8098  C  CD  . LYS B 1 442 ? 75.356  21.900  28.951  1.00 35.32 ? 473 LYS B CD  1 
ATOM   8099  C  CE  . LYS B 1 442 ? 74.679  21.561  30.305  1.00 34.01 ? 473 LYS B CE  1 
ATOM   8100  N  NZ  . LYS B 1 442 ? 74.150  22.768  31.052  1.00 29.44 ? 473 LYS B NZ  1 
ATOM   8101  N  N   . PRO B 1 443 ? 74.948  26.155  25.361  1.00 16.67 ? 474 PRO B N   1 
ATOM   8102  C  CA  . PRO B 1 443 ? 75.733  27.209  24.698  1.00 17.11 ? 474 PRO B CA  1 
ATOM   8103  C  C   . PRO B 1 443 ? 77.267  27.119  24.856  1.00 18.77 ? 474 PRO B C   1 
ATOM   8104  O  O   . PRO B 1 443 ? 77.779  26.681  25.906  1.00 20.59 ? 474 PRO B O   1 
ATOM   8105  C  CB  . PRO B 1 443 ? 75.155  28.502  25.297  1.00 13.55 ? 474 PRO B CB  1 
ATOM   8106  C  CG  . PRO B 1 443 ? 74.618  28.064  26.624  1.00 13.25 ? 474 PRO B CG  1 
ATOM   8107  C  CD  . PRO B 1 443 ? 74.008  26.720  26.343  1.00 14.08 ? 474 PRO B CD  1 
ATOM   8108  N  N   . TYR B 1 444 ? 77.981  27.493  23.785  1.00 16.86 ? 475 TYR B N   1 
ATOM   8109  C  CA  . TYR B 1 444 ? 79.444  27.498  23.774  1.00 10.87 ? 475 TYR B CA  1 
ATOM   8110  C  C   . TYR B 1 444 ? 79.972  28.499  24.761  1.00 11.91 ? 475 TYR B C   1 
ATOM   8111  O  O   . TYR B 1 444 ? 79.551  29.666  24.760  1.00 14.35 ? 475 TYR B O   1 
ATOM   8112  C  CB  . TYR B 1 444 ? 79.963  27.857  22.398  1.00 6.28  ? 475 TYR B CB  1 
ATOM   8113  C  CG  . TYR B 1 444 ? 79.737  26.746  21.439  1.00 4.26  ? 475 TYR B CG  1 
ATOM   8114  C  CD1 . TYR B 1 444 ? 79.753  25.425  21.879  1.00 4.05  ? 475 TYR B CD1 1 
ATOM   8115  C  CD2 . TYR B 1 444 ? 79.499  26.994  20.098  1.00 4.02  ? 475 TYR B CD2 1 
ATOM   8116  C  CE1 . TYR B 1 444 ? 79.544  24.374  21.003  1.00 2.32  ? 475 TYR B CE1 1 
ATOM   8117  C  CE2 . TYR B 1 444 ? 79.282  25.953  19.211  1.00 3.74  ? 475 TYR B CE2 1 
ATOM   8118  C  CZ  . TYR B 1 444 ? 79.308  24.651  19.672  1.00 3.55  ? 475 TYR B CZ  1 
ATOM   8119  O  OH  . TYR B 1 444 ? 79.106  23.646  18.776  1.00 7.14  ? 475 TYR B OH  1 
ATOM   8120  N  N   . THR B 1 445 ? 80.869  28.032  25.619  1.00 12.16 ? 476 THR B N   1 
ATOM   8121  C  CA  . THR B 1 445 ? 81.510  28.871  26.630  1.00 11.87 ? 476 THR B CA  1 
ATOM   8122  C  C   . THR B 1 445 ? 82.707  29.736  26.107  1.00 12.85 ? 476 THR B C   1 
ATOM   8123  O  O   . THR B 1 445 ? 83.138  30.688  26.768  1.00 13.98 ? 476 THR B O   1 
ATOM   8124  C  CB  . THR B 1 445 ? 81.981  28.003  27.799  1.00 8.43  ? 476 THR B CB  1 
ATOM   8125  O  OG1 . THR B 1 445 ? 82.350  26.698  27.322  1.00 9.03  ? 476 THR B OG1 1 
ATOM   8126  C  CG2 . THR B 1 445 ? 80.908  27.886  28.808  1.00 6.34  ? 476 THR B CG2 1 
ATOM   8127  N  N   . SER B 1 446 ? 83.196  29.446  24.904  1.00 10.62 ? 477 SER B N   1 
ATOM   8128  C  CA  . SER B 1 446 ? 84.330  30.173  24.349  1.00 8.61  ? 477 SER B CA  1 
ATOM   8129  C  C   . SER B 1 446 ? 84.406  29.957  22.849  1.00 5.97  ? 477 SER B C   1 
ATOM   8130  O  O   . SER B 1 446 ? 84.072  28.892  22.366  1.00 4.42  ? 477 SER B O   1 
ATOM   8131  C  CB  . SER B 1 446 ? 85.588  29.616  24.980  1.00 12.64 ? 477 SER B CB  1 
ATOM   8132  O  OG  . SER B 1 446 ? 85.549  28.189  24.925  1.00 17.07 ? 477 SER B OG  1 
ATOM   8133  N  N   . PHE B 1 447 ? 84.928  30.925  22.117  1.00 2.49  ? 478 PHE B N   1 
ATOM   8134  C  CA  . PHE B 1 447 ? 85.014  30.780  20.679  1.00 5.31  ? 478 PHE B CA  1 
ATOM   8135  C  C   . PHE B 1 447 ? 85.839  29.581  20.405  1.00 10.06 ? 478 PHE B C   1 
ATOM   8136  O  O   . PHE B 1 447 ? 85.813  28.989  19.332  1.00 13.73 ? 478 PHE B O   1 
ATOM   8137  C  CB  . PHE B 1 447 ? 85.738  31.936  20.065  1.00 4.23  ? 478 PHE B CB  1 
ATOM   8138  C  CG  . PHE B 1 447 ? 85.094  33.234  20.312  1.00 8.20  ? 478 PHE B CG  1 
ATOM   8139  C  CD1 . PHE B 1 447 ? 85.008  33.752  21.608  1.00 6.83  ? 478 PHE B CD1 1 
ATOM   8140  C  CD2 . PHE B 1 447 ? 84.586  33.975  19.242  1.00 9.30  ? 478 PHE B CD2 1 
ATOM   8141  C  CE1 . PHE B 1 447 ? 84.425  34.992  21.841  1.00 8.74  ? 478 PHE B CE1 1 
ATOM   8142  C  CE2 . PHE B 1 447 ? 84.002  35.218  19.457  1.00 11.62 ? 478 PHE B CE2 1 
ATOM   8143  C  CZ  . PHE B 1 447 ? 83.920  35.734  20.762  1.00 11.95 ? 478 PHE B CZ  1 
ATOM   8144  N  N   . GLU B 1 448 ? 86.674  29.292  21.372  1.00 13.93 ? 479 GLU B N   1 
ATOM   8145  C  CA  . GLU B 1 448 ? 87.561  28.172  21.284  1.00 17.20 ? 479 GLU B CA  1 
ATOM   8146  C  C   . GLU B 1 448 ? 86.744  26.878  21.403  1.00 17.97 ? 479 GLU B C   1 
ATOM   8147  O  O   . GLU B 1 448 ? 86.960  25.942  20.622  1.00 15.66 ? 479 GLU B O   1 
ATOM   8148  C  CB  . GLU B 1 448 ? 88.644  28.343  22.337  1.00 21.09 ? 479 GLU B CB  1 
ATOM   8149  C  CG  . GLU B 1 448 ? 89.525  29.611  22.117  1.00 21.81 ? 479 GLU B CG  1 
ATOM   8150  C  CD  . GLU B 1 448 ? 88.905  30.967  22.518  1.00 24.43 ? 479 GLU B CD  1 
ATOM   8151  O  OE1 . GLU B 1 448 ? 88.166  31.074  23.541  1.00 24.64 ? 479 GLU B OE1 1 
ATOM   8152  O  OE2 . GLU B 1 448 ? 89.211  31.946  21.799  1.00 22.67 ? 479 GLU B OE2 1 
ATOM   8153  N  N   . GLU B 1 449 ? 85.728  26.880  22.280  1.00 19.79 ? 480 GLU B N   1 
ATOM   8154  C  CA  . GLU B 1 449 ? 84.833  25.718  22.452  1.00 18.82 ? 480 GLU B CA  1 
ATOM   8155  C  C   . GLU B 1 449 ? 84.093  25.428  21.138  1.00 15.07 ? 480 GLU B C   1 
ATOM   8156  O  O   . GLU B 1 449 ? 83.928  24.276  20.738  1.00 15.33 ? 480 GLU B O   1 
ATOM   8157  C  CB  . GLU B 1 449 ? 83.804  25.924  23.584  1.00 19.69 ? 480 GLU B CB  1 
ATOM   8158  C  CG  . GLU B 1 449 ? 82.687  24.873  23.500  1.00 27.13 ? 480 GLU B CG  1 
ATOM   8159  C  CD  . GLU B 1 449 ? 81.885  24.676  24.784  1.00 32.71 ? 480 GLU B CD  1 
ATOM   8160  O  OE1 . GLU B 1 449 ? 82.383  23.971  25.701  1.00 36.22 ? 480 GLU B OE1 1 
ATOM   8161  O  OE2 . GLU B 1 449 ? 80.733  25.182  24.861  1.00 34.09 ? 480 GLU B OE2 1 
ATOM   8162  N  N   . LEU B 1 450 ? 83.665  26.493  20.478  1.00 10.89 ? 481 LEU B N   1 
ATOM   8163  C  CA  . LEU B 1 450 ? 82.952  26.400  19.221  1.00 8.23  ? 481 LEU B CA  1 
ATOM   8164  C  C   . LEU B 1 450 ? 83.780  25.765  18.100  1.00 8.83  ? 481 LEU B C   1 
ATOM   8165  O  O   . LEU B 1 450 ? 83.310  24.875  17.383  1.00 2.76  ? 481 LEU B O   1 
ATOM   8166  C  CB  . LEU B 1 450 ? 82.495  27.806  18.800  1.00 6.85  ? 481 LEU B CB  1 
ATOM   8167  C  CG  . LEU B 1 450 ? 82.145  28.129  17.337  1.00 5.64  ? 481 LEU B CG  1 
ATOM   8168  C  CD1 . LEU B 1 450 ? 80.830  27.480  16.900  1.00 4.43  ? 481 LEU B CD1 1 
ATOM   8169  C  CD2 . LEU B 1 450 ? 82.052  29.628  17.202  1.00 5.45  ? 481 LEU B CD2 1 
ATOM   8170  N  N   . THR B 1 451 ? 85.024  26.216  17.970  1.00 12.71 ? 482 THR B N   1 
ATOM   8171  C  CA  . THR B 1 451 ? 85.921  25.750  16.900  1.00 15.19 ? 482 THR B CA  1 
ATOM   8172  C  C   . THR B 1 451 ? 86.618  24.414  17.137  1.00 15.83 ? 482 THR B C   1 
ATOM   8173  O  O   . THR B 1 451 ? 86.850  23.632  16.189  1.00 13.81 ? 482 THR B O   1 
ATOM   8174  C  CB  . THR B 1 451 ? 87.006  26.799  16.596  1.00 16.03 ? 482 THR B CB  1 
ATOM   8175  O  OG1 . THR B 1 451 ? 87.701  27.095  17.813  1.00 18.81 ? 482 THR B OG1 1 
ATOM   8176  C  CG2 . THR B 1 451 ? 86.387  28.116  16.033  1.00 15.27 ? 482 THR B CG2 1 
ATOM   8177  N  N   . GLY B 1 452 ? 86.994  24.165  18.392  1.00 16.70 ? 483 GLY B N   1 
ATOM   8178  C  CA  . GLY B 1 452 ? 87.686  22.923  18.713  1.00 16.74 ? 483 GLY B CA  1 
ATOM   8179  C  C   . GLY B 1 452 ? 89.172  23.099  18.457  1.00 15.92 ? 483 GLY B C   1 
ATOM   8180  O  O   . GLY B 1 452 ? 89.989  22.370  18.993  1.00 17.08 ? 483 GLY B O   1 
ATOM   8181  N  N   . GLU B 1 453 ? 89.510  24.060  17.607  1.00 15.05 ? 484 GLU B N   1 
ATOM   8182  C  CA  . GLU B 1 453 ? 90.885  24.380  17.287  1.00 12.22 ? 484 GLU B CA  1 
ATOM   8183  C  C   . GLU B 1 453 ? 91.187  25.692  18.015  1.00 13.00 ? 484 GLU B C   1 
ATOM   8184  O  O   . GLU B 1 453 ? 90.427  26.096  18.896  1.00 13.10 ? 484 GLU B O   1 
ATOM   8185  C  CB  . GLU B 1 453 ? 91.059  24.500  15.775  1.00 9.15  ? 484 GLU B CB  1 
ATOM   8186  C  CG  . GLU B 1 453 ? 90.177  25.522  15.109  1.00 10.45 ? 484 GLU B CG  1 
ATOM   8187  C  CD  . GLU B 1 453 ? 90.777  26.906  15.076  1.00 9.86  ? 484 GLU B CD  1 
ATOM   8188  O  OE1 . GLU B 1 453 ? 91.663  27.143  14.220  1.00 9.92  ? 484 GLU B OE1 1 
ATOM   8189  O  OE2 . GLU B 1 453 ? 90.340  27.749  15.890  1.00 4.70  ? 484 GLU B OE2 1 
ATOM   8190  N  N   . LYS B 1 454 ? 92.267  26.380  17.650  1.00 14.86 ? 485 LYS B N   1 
ATOM   8191  C  CA  . LYS B 1 454 ? 92.588  27.617  18.356  1.00 13.21 ? 485 LYS B CA  1 
ATOM   8192  C  C   . LYS B 1 454 ? 92.991  28.857  17.562  1.00 10.74 ? 485 LYS B C   1 
ATOM   8193  O  O   . LYS B 1 454 ? 92.899  29.963  18.086  1.00 6.63  ? 485 LYS B O   1 
ATOM   8194  C  CB  . LYS B 1 454 ? 93.620  27.322  19.439  1.00 14.48 ? 485 LYS B CB  1 
ATOM   8195  C  CG  . LYS B 1 454 ? 93.041  27.325  20.824  1.00 13.74 ? 485 LYS B CG  1 
ATOM   8196  C  CD  . LYS B 1 454 ? 92.496  28.682  21.193  1.00 8.37  ? 485 LYS B CD  1 
ATOM   8197  C  CE  . LYS B 1 454 ? 92.442  28.781  22.708  1.00 11.69 ? 485 LYS B CE  1 
ATOM   8198  N  NZ  . LYS B 1 454 ? 91.586  27.719  23.337  1.00 5.30  ? 485 LYS B NZ  1 
ATOM   8199  N  N   . GLU B 1 455 ? 93.453  28.678  16.327  1.00 10.35 ? 486 GLU B N   1 
ATOM   8200  C  CA  . GLU B 1 455 ? 93.842  29.817  15.508  1.00 14.22 ? 486 GLU B CA  1 
ATOM   8201  C  C   . GLU B 1 455 ? 92.586  30.645  15.221  1.00 17.12 ? 486 GLU B C   1 
ATOM   8202  O  O   . GLU B 1 455 ? 92.495  31.811  15.602  1.00 20.03 ? 486 GLU B O   1 
ATOM   8203  C  CB  . GLU B 1 455 ? 94.500  29.372  14.193  1.00 16.44 ? 486 GLU B CB  1 
ATOM   8204  C  CG  . GLU B 1 455 ? 95.054  30.534  13.325  1.00 18.23 ? 486 GLU B CG  1 
ATOM   8205  C  CD  . GLU B 1 455 ? 96.006  30.074  12.201  1.00 18.86 ? 486 GLU B CD  1 
ATOM   8206  O  OE1 . GLU B 1 455 ? 96.944  29.283  12.486  1.00 19.60 ? 486 GLU B OE1 1 
ATOM   8207  O  OE2 . GLU B 1 455 ? 95.843  30.528  11.038  1.00 18.34 ? 486 GLU B OE2 1 
ATOM   8208  N  N   . MET B 1 456 ? 91.610  30.034  14.556  1.00 17.57 ? 487 MET B N   1 
ATOM   8209  C  CA  . MET B 1 456 ? 90.354  30.704  14.235  1.00 13.38 ? 487 MET B CA  1 
ATOM   8210  C  C   . MET B 1 456 ? 89.664  31.190  15.507  1.00 10.01 ? 487 MET B C   1 
ATOM   8211  O  O   . MET B 1 456 ? 89.288  32.351  15.592  1.00 3.01  ? 487 MET B O   1 
ATOM   8212  C  CB  . MET B 1 456 ? 89.420  29.742  13.494  1.00 13.45 ? 487 MET B CB  1 
ATOM   8213  C  CG  . MET B 1 456 ? 89.980  29.215  12.208  1.00 15.20 ? 487 MET B CG  1 
ATOM   8214  S  SD  . MET B 1 456 ? 88.758  28.281  11.250  1.00 18.55 ? 487 MET B SD  1 
ATOM   8215  C  CE  . MET B 1 456 ? 88.485  26.922  12.358  1.00 13.60 ? 487 MET B CE  1 
ATOM   8216  N  N   . ALA B 1 457 ? 89.526  30.290  16.485  1.00 8.71  ? 488 ALA B N   1 
ATOM   8217  C  CA  . ALA B 1 457 ? 88.867  30.581  17.749  1.00 10.52 ? 488 ALA B CA  1 
ATOM   8218  C  C   . ALA B 1 457 ? 89.369  31.918  18.261  1.00 11.77 ? 488 ALA B C   1 
ATOM   8219  O  O   . ALA B 1 457 ? 88.618  32.881  18.348  1.00 12.79 ? 488 ALA B O   1 
ATOM   8220  C  CB  . ALA B 1 457 ? 89.146  29.483  18.762  1.00 8.22  ? 488 ALA B CB  1 
ATOM   8221  N  N   . ALA B 1 458 ? 90.664  32.003  18.510  1.00 13.50 ? 489 ALA B N   1 
ATOM   8222  C  CA  . ALA B 1 458 ? 91.242  33.240  18.999  1.00 16.24 ? 489 ALA B CA  1 
ATOM   8223  C  C   . ALA B 1 458 ? 91.108  34.360  17.964  1.00 17.14 ? 489 ALA B C   1 
ATOM   8224  O  O   . ALA B 1 458 ? 91.018  35.544  18.312  1.00 14.64 ? 489 ALA B O   1 
ATOM   8225  C  CB  . ALA B 1 458 ? 92.674  33.021  19.341  1.00 19.64 ? 489 ALA B CB  1 
ATOM   8226  N  N   . GLU B 1 459 ? 91.098  33.972  16.690  1.00 19.52 ? 490 GLU B N   1 
ATOM   8227  C  CA  . GLU B 1 459 ? 90.956  34.917  15.600  1.00 18.15 ? 490 GLU B CA  1 
ATOM   8228  C  C   . GLU B 1 459 ? 89.544  35.523  15.653  1.00 17.72 ? 490 GLU B C   1 
ATOM   8229  O  O   . GLU B 1 459 ? 89.387  36.728  15.469  1.00 17.83 ? 490 GLU B O   1 
ATOM   8230  C  CB  . GLU B 1 459 ? 91.211  34.219  14.267  1.00 21.87 ? 490 GLU B CB  1 
ATOM   8231  C  CG  . GLU B 1 459 ? 91.042  35.114  13.072  1.00 30.40 ? 490 GLU B CG  1 
ATOM   8232  C  CD  . GLU B 1 459 ? 91.901  36.364  13.172  1.00 36.26 ? 490 GLU B CD  1 
ATOM   8233  O  OE1 . GLU B 1 459 ? 91.566  37.251  13.991  1.00 39.09 ? 490 GLU B OE1 1 
ATOM   8234  O  OE2 . GLU B 1 459 ? 92.911  36.471  12.430  1.00 40.18 ? 490 GLU B OE2 1 
ATOM   8235  N  N   . LEU B 1 460 ? 88.538  34.705  15.984  1.00 15.38 ? 491 LEU B N   1 
ATOM   8236  C  CA  . LEU B 1 460 ? 87.145  35.153  16.088  1.00 11.78 ? 491 LEU B CA  1 
ATOM   8237  C  C   . LEU B 1 460 ? 87.055  36.018  17.345  1.00 10.36 ? 491 LEU B C   1 
ATOM   8238  O  O   . LEU B 1 460 ? 86.612  37.147  17.290  1.00 9.51  ? 491 LEU B O   1 
ATOM   8239  C  CB  . LEU B 1 460 ? 86.190  33.958  16.250  1.00 12.95 ? 491 LEU B CB  1 
ATOM   8240  C  CG  . LEU B 1 460 ? 85.907  32.894  15.171  1.00 14.04 ? 491 LEU B CG  1 
ATOM   8241  C  CD1 . LEU B 1 460 ? 85.396  31.608  15.862  1.00 14.03 ? 491 LEU B CD1 1 
ATOM   8242  C  CD2 . LEU B 1 460 ? 84.886  33.382  14.140  1.00 11.58 ? 491 LEU B CD2 1 
ATOM   8243  N  N   . LYS B 1 461 ? 87.531  35.482  18.465  1.00 7.72  ? 492 LYS B N   1 
ATOM   8244  C  CA  . LYS B 1 461 ? 87.519  36.160  19.750  1.00 6.62  ? 492 LYS B CA  1 
ATOM   8245  C  C   . LYS B 1 461 ? 88.004  37.577  19.564  1.00 7.54  ? 492 LYS B C   1 
ATOM   8246  O  O   . LYS B 1 461 ? 87.599  38.494  20.280  1.00 8.32  ? 492 LYS B O   1 
ATOM   8247  C  CB  . LYS B 1 461 ? 88.425  35.404  20.728  1.00 7.32  ? 492 LYS B CB  1 
ATOM   8248  C  CG  . LYS B 1 461 ? 89.029  36.224  21.875  1.00 10.70 ? 492 LYS B CG  1 
ATOM   8249  C  CD  . LYS B 1 461 ? 88.031  36.583  22.969  1.00 14.07 ? 492 LYS B CD  1 
ATOM   8250  C  CE  . LYS B 1 461 ? 88.045  35.592  24.158  1.00 15.88 ? 492 LYS B CE  1 
ATOM   8251  N  NZ  . LYS B 1 461 ? 87.547  34.194  23.866  1.00 18.07 ? 492 LYS B NZ  1 
ATOM   8252  N  N   . ALA B 1 462 ? 88.840  37.761  18.556  1.00 9.86  ? 493 ALA B N   1 
ATOM   8253  C  CA  . ALA B 1 462 ? 89.400  39.072  18.261  1.00 12.96 ? 493 ALA B CA  1 
ATOM   8254  C  C   . ALA B 1 462 ? 88.309  40.047  17.952  1.00 12.55 ? 493 ALA B C   1 
ATOM   8255  O  O   . ALA B 1 462 ? 88.313  41.169  18.446  1.00 14.27 ? 493 ALA B O   1 
ATOM   8256  C  CB  . ALA B 1 462 ? 90.353  38.999  17.078  1.00 15.26 ? 493 ALA B CB  1 
ATOM   8257  N  N   . LEU B 1 463 ? 87.378  39.615  17.114  1.00 11.34 ? 494 LEU B N   1 
ATOM   8258  C  CA  . LEU B 1 463 ? 86.264  40.466  16.704  1.00 8.84  ? 494 LEU B CA  1 
ATOM   8259  C  C   . LEU B 1 463 ? 84.989  40.361  17.564  1.00 8.11  ? 494 LEU B C   1 
ATOM   8260  O  O   . LEU B 1 463 ? 84.484  41.361  18.052  1.00 7.95  ? 494 LEU B O   1 
ATOM   8261  C  CB  . LEU B 1 463 ? 85.953  40.236  15.228  1.00 4.49  ? 494 LEU B CB  1 
ATOM   8262  C  CG  . LEU B 1 463 ? 87.114  39.789  14.337  1.00 5.64  ? 494 LEU B CG  1 
ATOM   8263  C  CD1 . LEU B 1 463 ? 87.192  38.283  14.368  1.00 3.90  ? 494 LEU B CD1 1 
ATOM   8264  C  CD2 . LEU B 1 463 ? 86.903  40.234  12.900  1.00 5.52  ? 494 LEU B CD2 1 
ATOM   8265  N  N   . TYR B 1 464 ? 84.485  39.160  17.794  1.00 9.07  ? 495 TYR B N   1 
ATOM   8266  C  CA  . TYR B 1 464 ? 83.274  39.017  18.590  1.00 11.53 ? 495 TYR B CA  1 
ATOM   8267  C  C   . TYR B 1 464 ? 83.412  39.245  20.096  1.00 12.91 ? 495 TYR B C   1 
ATOM   8268  O  O   . TYR B 1 464 ? 82.462  39.649  20.736  1.00 14.83 ? 495 TYR B O   1 
ATOM   8269  C  CB  . TYR B 1 464 ? 82.576  37.698  18.290  1.00 10.40 ? 495 TYR B CB  1 
ATOM   8270  C  CG  . TYR B 1 464 ? 82.056  37.615  16.874  1.00 10.68 ? 495 TYR B CG  1 
ATOM   8271  C  CD1 . TYR B 1 464 ? 80.780  38.055  16.559  1.00 10.91 ? 495 TYR B CD1 1 
ATOM   8272  C  CD2 . TYR B 1 464 ? 82.841  37.112  15.847  1.00 11.76 ? 495 TYR B CD2 1 
ATOM   8273  C  CE1 . TYR B 1 464 ? 80.301  37.999  15.268  1.00 9.72  ? 495 TYR B CE1 1 
ATOM   8274  C  CE2 . TYR B 1 464 ? 82.369  37.055  14.550  1.00 10.62 ? 495 TYR B CE2 1 
ATOM   8275  C  CZ  . TYR B 1 464 ? 81.104  37.502  14.277  1.00 10.06 ? 495 TYR B CZ  1 
ATOM   8276  O  OH  . TYR B 1 464 ? 80.654  37.469  12.993  1.00 14.14 ? 495 TYR B OH  1 
ATOM   8277  N  N   . SER B 1 465 ? 84.591  39.028  20.653  1.00 14.81 ? 496 SER B N   1 
ATOM   8278  C  CA  . SER B 1 465 ? 84.820  39.235  22.075  1.00 17.57 ? 496 SER B CA  1 
ATOM   8279  C  C   . SER B 1 465 ? 84.017  38.331  22.997  1.00 19.01 ? 496 SER B C   1 
ATOM   8280  O  O   . SER B 1 465 ? 84.595  37.626  23.835  1.00 21.87 ? 496 SER B O   1 
ATOM   8281  C  CB  . SER B 1 465 ? 84.557  40.684  22.437  1.00 21.06 ? 496 SER B CB  1 
ATOM   8282  O  OG  . SER B 1 465 ? 85.393  41.526  21.674  1.00 27.37 ? 496 SER B OG  1 
ATOM   8283  N  N   . ASP B 1 466 ? 82.692  38.387  22.917  1.00 15.54 ? 497 ASP B N   1 
ATOM   8284  C  CA  . ASP B 1 466 ? 81.906  37.530  23.767  1.00 11.46 ? 497 ASP B CA  1 
ATOM   8285  C  C   . ASP B 1 466 ? 81.332  36.502  22.867  1.00 8.79  ? 497 ASP B C   1 
ATOM   8286  O  O   . ASP B 1 466 ? 81.007  36.790  21.721  1.00 7.54  ? 497 ASP B O   1 
ATOM   8287  C  CB  . ASP B 1 466 ? 80.796  38.275  24.476  1.00 13.00 ? 497 ASP B CB  1 
ATOM   8288  C  CG  . ASP B 1 466 ? 80.230  37.494  25.648  1.00 14.47 ? 497 ASP B CG  1 
ATOM   8289  O  OD1 . ASP B 1 466 ? 80.674  36.332  25.887  1.00 5.79  ? 497 ASP B OD1 1 
ATOM   8290  O  OD2 . ASP B 1 466 ? 79.345  38.066  26.336  1.00 18.80 ? 497 ASP B OD2 1 
ATOM   8291  N  N   . ILE B 1 467 ? 81.313  35.274  23.368  1.00 8.28  ? 498 ILE B N   1 
ATOM   8292  C  CA  . ILE B 1 467 ? 80.777  34.141  22.627  1.00 6.53  ? 498 ILE B CA  1 
ATOM   8293  C  C   . ILE B 1 467 ? 79.259  34.424  22.510  1.00 5.78  ? 498 ILE B C   1 
ATOM   8294  O  O   . ILE B 1 467 ? 78.630  34.272  21.451  1.00 3.42  ? 498 ILE B O   1 
ATOM   8295  C  CB  . ILE B 1 467 ? 81.135  32.800  23.380  1.00 6.00  ? 498 ILE B CB  1 
ATOM   8296  C  CG1 . ILE B 1 467 ? 80.679  31.571  22.574  1.00 6.16  ? 498 ILE B CG1 1 
ATOM   8297  C  CG2 . ILE B 1 467 ? 80.606  32.821  24.827  1.00 2.02  ? 498 ILE B CG2 1 
ATOM   8298  C  CD1 . ILE B 1 467 ? 81.265  31.493  21.194  1.00 8.57  ? 498 ILE B CD1 1 
ATOM   8299  N  N   . ASP B 1 468 ? 78.728  35.007  23.568  1.00 3.24  ? 499 ASP B N   1 
ATOM   8300  C  CA  . ASP B 1 468 ? 77.342  35.354  23.613  1.00 3.93  ? 499 ASP B CA  1 
ATOM   8301  C  C   . ASP B 1 468 ? 77.102  36.556  22.721  1.00 6.67  ? 499 ASP B C   1 
ATOM   8302  O  O   . ASP B 1 468 ? 76.376  37.463  23.116  1.00 10.58 ? 499 ASP B O   1 
ATOM   8303  C  CB  . ASP B 1 468 ? 76.928  35.701  25.041  1.00 2.04  ? 499 ASP B CB  1 
ATOM   8304  C  CG  . ASP B 1 468 ? 77.196  34.591  26.015  1.00 2.03  ? 499 ASP B CG  1 
ATOM   8305  O  OD1 . ASP B 1 468 ? 77.115  33.424  25.598  1.00 5.87  ? 499 ASP B OD1 1 
ATOM   8306  O  OD2 . ASP B 1 468 ? 77.478  34.879  27.202  1.00 2.06  ? 499 ASP B OD2 1 
ATOM   8307  N  N   . VAL B 1 469 ? 77.793  36.640  21.590  1.00 4.48  ? 500 VAL B N   1 
ATOM   8308  C  CA  . VAL B 1 469 ? 77.575  37.733  20.646  1.00 3.63  ? 500 VAL B CA  1 
ATOM   8309  C  C   . VAL B 1 469 ? 78.028  37.214  19.304  1.00 4.26  ? 500 VAL B C   1 
ATOM   8310  O  O   . VAL B 1 469 ? 78.020  37.942  18.310  1.00 7.94  ? 500 VAL B O   1 
ATOM   8311  C  CB  . VAL B 1 469 ? 78.371  39.025  20.994  1.00 4.18  ? 500 VAL B CB  1 
ATOM   8312  C  CG1 . VAL B 1 469 ? 78.080  40.121  19.969  1.00 3.09  ? 500 VAL B CG1 1 
ATOM   8313  C  CG2 . VAL B 1 469 ? 78.018  39.539  22.393  1.00 2.41  ? 500 VAL B CG2 1 
ATOM   8314  N  N   . MET B 1 470 ? 78.408  35.941  19.271  1.00 2.13  ? 501 MET B N   1 
ATOM   8315  C  CA  . MET B 1 470 ? 78.853  35.324  18.037  1.00 2.88  ? 501 MET B CA  1 
ATOM   8316  C  C   . MET B 1 470 ? 77.580  35.015  17.229  1.00 3.63  ? 501 MET B C   1 
ATOM   8317  O  O   . MET B 1 470 ? 76.569  34.581  17.796  1.00 4.94  ? 501 MET B O   1 
ATOM   8318  C  CB  . MET B 1 470 ? 79.685  34.066  18.364  1.00 2.16  ? 501 MET B CB  1 
ATOM   8319  C  CG  . MET B 1 470 ? 80.183  33.240  17.175  1.00 2.00  ? 501 MET B CG  1 
ATOM   8320  S  SD  . MET B 1 470 ? 81.004  34.204  15.885  1.00 2.00  ? 501 MET B SD  1 
ATOM   8321  C  CE  . MET B 1 470 ? 81.140  32.980  14.531  1.00 2.00  ? 501 MET B CE  1 
ATOM   8322  N  N   . GLU B 1 471 ? 77.623  35.305  15.933  1.00 2.00  ? 502 GLU B N   1 
ATOM   8323  C  CA  . GLU B 1 471 ? 76.516  35.079  15.015  1.00 6.14  ? 502 GLU B CA  1 
ATOM   8324  C  C   . GLU B 1 471 ? 76.152  33.585  14.678  1.00 8.99  ? 502 GLU B C   1 
ATOM   8325  O  O   . GLU B 1 471 ? 76.799  32.677  15.172  1.00 10.12 ? 502 GLU B O   1 
ATOM   8326  C  CB  . GLU B 1 471 ? 76.791  35.914  13.764  1.00 4.43  ? 502 GLU B CB  1 
ATOM   8327  C  CG  . GLU B 1 471 ? 76.962  37.407  14.117  1.00 4.39  ? 502 GLU B CG  1 
ATOM   8328  C  CD  . GLU B 1 471 ? 77.211  38.336  12.907  1.00 5.26  ? 502 GLU B CD  1 
ATOM   8329  O  OE1 . GLU B 1 471 ? 77.030  37.945  11.745  1.00 6.78  ? 502 GLU B OE1 1 
ATOM   8330  O  OE2 . GLU B 1 471 ? 77.603  39.491  13.121  1.00 6.03  ? 502 GLU B OE2 1 
ATOM   8331  N  N   . LEU B 1 472 ? 75.065  33.332  13.930  1.00 10.35 ? 503 LEU B N   1 
ATOM   8332  C  CA  . LEU B 1 472 ? 74.685  31.964  13.564  1.00 7.05  ? 503 LEU B CA  1 
ATOM   8333  C  C   . LEU B 1 472 ? 75.360  31.451  12.276  1.00 6.79  ? 503 LEU B C   1 
ATOM   8334  O  O   . LEU B 1 472 ? 76.029  30.433  12.318  1.00 10.39 ? 503 LEU B O   1 
ATOM   8335  C  CB  . LEU B 1 472 ? 73.170  31.807  13.450  1.00 5.45  ? 503 LEU B CB  1 
ATOM   8336  C  CG  . LEU B 1 472 ? 72.700  30.405  12.978  1.00 5.35  ? 503 LEU B CG  1 
ATOM   8337  C  CD1 . LEU B 1 472 ? 72.706  29.420  14.130  1.00 3.52  ? 503 LEU B CD1 1 
ATOM   8338  C  CD2 . LEU B 1 472 ? 71.313  30.448  12.339  1.00 2.00  ? 503 LEU B CD2 1 
ATOM   8339  N  N   . TYR B 1 473 ? 75.199  32.129  11.145  1.00 5.38  ? 504 TYR B N   1 
ATOM   8340  C  CA  . TYR B 1 473 ? 75.821  31.686  9.894   1.00 6.52  ? 504 TYR B CA  1 
ATOM   8341  C  C   . TYR B 1 473 ? 77.314  31.361  9.987   1.00 9.00  ? 504 TYR B C   1 
ATOM   8342  O  O   . TYR B 1 473 ? 77.714  30.277  9.582   1.00 9.50  ? 504 TYR B O   1 
ATOM   8343  C  CB  . TYR B 1 473 ? 75.623  32.712  8.787   1.00 10.03 ? 504 TYR B CB  1 
ATOM   8344  C  CG  . TYR B 1 473 ? 76.270  32.336  7.477   1.00 10.23 ? 504 TYR B CG  1 
ATOM   8345  C  CD1 . TYR B 1 473 ? 75.899  31.177  6.829   1.00 14.18 ? 504 TYR B CD1 1 
ATOM   8346  C  CD2 . TYR B 1 473 ? 77.208  33.159  6.866   1.00 11.93 ? 504 TYR B CD2 1 
ATOM   8347  C  CE1 . TYR B 1 473 ? 76.429  30.835  5.595   1.00 17.49 ? 504 TYR B CE1 1 
ATOM   8348  C  CE2 . TYR B 1 473 ? 77.760  32.829  5.620   1.00 14.49 ? 504 TYR B CE2 1 
ATOM   8349  C  CZ  . TYR B 1 473 ? 77.354  31.658  4.985   1.00 16.19 ? 504 TYR B CZ  1 
ATOM   8350  O  OH  . TYR B 1 473 ? 77.797  31.295  3.723   1.00 15.33 ? 504 TYR B OH  1 
ATOM   8351  N  N   . PRO B 1 474 ? 78.167  32.332  10.425  1.00 10.50 ? 505 PRO B N   1 
ATOM   8352  C  CA  . PRO B 1 474 ? 79.604  32.052  10.530  1.00 8.07  ? 505 PRO B CA  1 
ATOM   8353  C  C   . PRO B 1 474 ? 79.873  30.793  11.336  1.00 6.90  ? 505 PRO B C   1 
ATOM   8354  O  O   . PRO B 1 474 ? 80.239  29.746  10.767  1.00 6.39  ? 505 PRO B O   1 
ATOM   8355  C  CB  . PRO B 1 474 ? 80.143  33.308  11.228  1.00 6.04  ? 505 PRO B CB  1 
ATOM   8356  C  CG  . PRO B 1 474 ? 79.330  34.393  10.579  1.00 6.96  ? 505 PRO B CG  1 
ATOM   8357  C  CD  . PRO B 1 474 ? 77.924  33.778  10.675  1.00 12.08 ? 505 PRO B CD  1 
ATOM   8358  N  N   . ALA B 1 475 ? 79.596  30.863  12.635  1.00 5.21  ? 506 ALA B N   1 
ATOM   8359  C  CA  . ALA B 1 475 ? 79.840  29.729  13.530  1.00 5.62  ? 506 ALA B CA  1 
ATOM   8360  C  C   . ALA B 1 475 ? 79.334  28.370  13.017  1.00 5.52  ? 506 ALA B C   1 
ATOM   8361  O  O   . ALA B 1 475 ? 79.756  27.313  13.483  1.00 3.52  ? 506 ALA B O   1 
ATOM   8362  C  CB  . ALA B 1 475 ? 79.273  30.015  14.892  1.00 4.86  ? 506 ALA B CB  1 
ATOM   8363  N  N   . LEU B 1 476 ? 78.433  28.387  12.050  1.00 6.41  ? 507 LEU B N   1 
ATOM   8364  C  CA  . LEU B 1 476 ? 77.918  27.140  11.524  1.00 7.00  ? 507 LEU B CA  1 
ATOM   8365  C  C   . LEU B 1 476 ? 79.001  26.492  10.686  1.00 6.11  ? 507 LEU B C   1 
ATOM   8366  O  O   . LEU B 1 476 ? 79.146  25.257  10.706  1.00 6.52  ? 507 LEU B O   1 
ATOM   8367  C  CB  . LEU B 1 476 ? 76.621  27.369  10.718  1.00 8.03  ? 507 LEU B CB  1 
ATOM   8368  C  CG  . LEU B 1 476 ? 75.292  27.424  11.504  1.00 5.10  ? 507 LEU B CG  1 
ATOM   8369  C  CD1 . LEU B 1 476 ? 74.223  27.976  10.624  1.00 6.37  ? 507 LEU B CD1 1 
ATOM   8370  C  CD2 . LEU B 1 476 ? 74.869  26.069  12.013  1.00 5.49  ? 507 LEU B CD2 1 
ATOM   8371  N  N   . LEU B 1 477 ? 79.738  27.331  9.957   1.00 2.99  ? 508 LEU B N   1 
ATOM   8372  C  CA  . LEU B 1 477 ? 80.839  26.893  9.120   1.00 5.47  ? 508 LEU B CA  1 
ATOM   8373  C  C   . LEU B 1 477 ? 82.169  26.732  9.937   1.00 8.40  ? 508 LEU B C   1 
ATOM   8374  O  O   . LEU B 1 477 ? 82.872  25.712  9.854   1.00 9.19  ? 508 LEU B O   1 
ATOM   8375  C  CB  . LEU B 1 477 ? 80.990  27.878  7.966   1.00 4.44  ? 508 LEU B CB  1 
ATOM   8376  C  CG  . LEU B 1 477 ? 79.724  28.085  7.143   1.00 2.00  ? 508 LEU B CG  1 
ATOM   8377  C  CD1 . LEU B 1 477 ? 79.994  28.675  5.783   1.00 2.00  ? 508 LEU B CD1 1 
ATOM   8378  C  CD2 . LEU B 1 477 ? 79.128  26.768  6.922   1.00 4.38  ? 508 LEU B CD2 1 
ATOM   8379  N  N   . VAL B 1 478 ? 82.456  27.729  10.766  1.00 7.33  ? 509 VAL B N   1 
ATOM   8380  C  CA  . VAL B 1 478 ? 83.623  27.798  11.649  1.00 3.55  ? 509 VAL B CA  1 
ATOM   8381  C  C   . VAL B 1 478 ? 83.333  26.933  12.855  1.00 2.02  ? 509 VAL B C   1 
ATOM   8382  O  O   . VAL B 1 478 ? 83.439  27.396  13.984  1.00 4.82  ? 509 VAL B O   1 
ATOM   8383  C  CB  . VAL B 1 478 ? 83.753  29.260  12.132  1.00 5.04  ? 509 VAL B CB  1 
ATOM   8384  C  CG1 . VAL B 1 478 ? 84.846  29.454  13.190  1.00 2.99  ? 509 VAL B CG1 1 
ATOM   8385  C  CG2 . VAL B 1 478 ? 83.974  30.153  10.924  1.00 9.26  ? 509 VAL B CG2 1 
ATOM   8386  N  N   . GLU B 1 479 ? 82.971  25.682  12.648  1.00 2.00  ? 510 GLU B N   1 
ATOM   8387  C  CA  . GLU B 1 479 ? 82.628  24.884  13.797  1.00 2.42  ? 510 GLU B CA  1 
ATOM   8388  C  C   . GLU B 1 479 ? 83.234  23.516  13.732  1.00 3.88  ? 510 GLU B C   1 
ATOM   8389  O  O   . GLU B 1 479 ? 83.541  23.016  12.644  1.00 2.25  ? 510 GLU B O   1 
ATOM   8390  C  CB  . GLU B 1 479 ? 81.115  24.774  13.929  1.00 5.40  ? 510 GLU B CB  1 
ATOM   8391  C  CG  . GLU B 1 479 ? 80.619  24.158  15.251  1.00 8.53  ? 510 GLU B CG  1 
ATOM   8392  C  CD  . GLU B 1 479 ? 79.177  23.673  15.173  1.00 12.15 ? 510 GLU B CD  1 
ATOM   8393  O  OE1 . GLU B 1 479 ? 78.684  23.371  14.050  1.00 15.56 ? 510 GLU B OE1 1 
ATOM   8394  O  OE2 . GLU B 1 479 ? 78.536  23.586  16.233  1.00 7.59  ? 510 GLU B OE2 1 
ATOM   8395  N  N   . LYS B 1 480 ? 83.313  22.891  14.907  1.00 3.95  ? 511 LYS B N   1 
ATOM   8396  C  CA  . LYS B 1 480 ? 83.914  21.581  15.079  1.00 3.11  ? 511 LYS B CA  1 
ATOM   8397  C  C   . LYS B 1 480 ? 83.147  20.388  14.564  1.00 2.28  ? 511 LYS B C   1 
ATOM   8398  O  O   . LYS B 1 480 ? 82.209  19.921  15.197  1.00 4.87  ? 511 LYS B O   1 
ATOM   8399  C  CB  . LYS B 1 480 ? 84.263  21.366  16.548  1.00 4.03  ? 511 LYS B CB  1 
ATOM   8400  C  CG  . LYS B 1 480 ? 84.702  19.948  16.860  1.00 10.73 ? 511 LYS B CG  1 
ATOM   8401  C  CD  . LYS B 1 480 ? 84.734  19.706  18.363  1.00 14.14 ? 511 LYS B CD  1 
ATOM   8402  C  CE  . LYS B 1 480 ? 84.717  18.226  18.686  1.00 14.22 ? 511 LYS B CE  1 
ATOM   8403  N  NZ  . LYS B 1 480 ? 84.648  18.051  20.154  1.00 17.35 ? 511 LYS B NZ  1 
ATOM   8404  N  N   . PRO B 1 481 ? 83.529  19.875  13.399  1.00 2.58  ? 512 PRO B N   1 
ATOM   8405  C  CA  . PRO B 1 481 ? 82.850  18.711  12.836  1.00 5.47  ? 512 PRO B CA  1 
ATOM   8406  C  C   . PRO B 1 481 ? 82.872  17.552  13.833  1.00 6.81  ? 512 PRO B C   1 
ATOM   8407  O  O   . PRO B 1 481 ? 83.850  17.310  14.536  1.00 8.93  ? 512 PRO B O   1 
ATOM   8408  C  CB  . PRO B 1 481 ? 83.699  18.387  11.609  1.00 5.82  ? 512 PRO B CB  1 
ATOM   8409  C  CG  . PRO B 1 481 ? 84.142  19.735  11.162  1.00 4.10  ? 512 PRO B CG  1 
ATOM   8410  C  CD  . PRO B 1 481 ? 84.535  20.395  12.463  1.00 4.35  ? 512 PRO B CD  1 
ATOM   8411  N  N   . ARG B 1 482 ? 81.740  16.903  13.976  1.00 9.20  ? 513 ARG B N   1 
ATOM   8412  C  CA  . ARG B 1 482 ? 81.653  15.764  14.871  1.00 11.91 ? 513 ARG B CA  1 
ATOM   8413  C  C   . ARG B 1 482 ? 82.464  14.771  14.055  1.00 11.75 ? 513 ARG B C   1 
ATOM   8414  O  O   . ARG B 1 482 ? 82.389  14.824  12.809  1.00 12.15 ? 513 ARG B O   1 
ATOM   8415  C  CB  . ARG B 1 482 ? 80.183  15.314  14.978  1.00 16.27 ? 513 ARG B CB  1 
ATOM   8416  C  CG  . ARG B 1 482 ? 79.249  16.414  15.494  1.00 18.67 ? 513 ARG B CG  1 
ATOM   8417  C  CD  . ARG B 1 482 ? 77.799  16.008  15.519  1.00 18.39 ? 513 ARG B CD  1 
ATOM   8418  N  NE  . ARG B 1 482 ? 77.233  16.189  16.853  1.00 20.74 ? 513 ARG B NE  1 
ATOM   8419  C  CZ  . ARG B 1 482 ? 75.949  16.010  17.137  1.00 24.10 ? 513 ARG B CZ  1 
ATOM   8420  N  NH1 . ARG B 1 482 ? 75.112  15.652  16.167  1.00 24.05 ? 513 ARG B NH1 1 
ATOM   8421  N  NH2 . ARG B 1 482 ? 75.512  16.138  18.390  1.00 23.02 ? 513 ARG B NH2 1 
ATOM   8422  N  N   . PRO B 1 483 ? 83.226  13.853  14.716  1.00 9.45  ? 514 PRO B N   1 
ATOM   8423  C  CA  . PRO B 1 483 ? 84.052  12.857  14.027  1.00 6.89  ? 514 PRO B CA  1 
ATOM   8424  C  C   . PRO B 1 483 ? 84.375  13.073  12.561  1.00 9.40  ? 514 PRO B C   1 
ATOM   8425  O  O   . PRO B 1 483 ? 84.727  14.189  12.157  1.00 14.42 ? 514 PRO B O   1 
ATOM   8426  C  CB  . PRO B 1 483 ? 83.347  11.587  14.370  1.00 3.97  ? 514 PRO B CB  1 
ATOM   8427  C  CG  . PRO B 1 483 ? 83.202  11.859  15.954  1.00 6.04  ? 514 PRO B CG  1 
ATOM   8428  C  CD  . PRO B 1 483 ? 83.003  13.397  16.101  1.00 4.81  ? 514 PRO B CD  1 
ATOM   8429  N  N   . ASP B 1 484 ? 84.351  12.051  11.741  1.00 11.11 ? 515 ASP B N   1 
ATOM   8430  C  CA  . ASP B 1 484 ? 84.716  12.337  10.356  1.00 16.20 ? 515 ASP B CA  1 
ATOM   8431  C  C   . ASP B 1 484 ? 83.502  12.726  9.549   1.00 15.21 ? 515 ASP B C   1 
ATOM   8432  O  O   . ASP B 1 484 ? 83.226  12.157  8.492   1.00 15.97 ? 515 ASP B O   1 
ATOM   8433  C  CB  . ASP B 1 484 ? 85.499  11.171  9.737   1.00 23.07 ? 515 ASP B CB  1 
ATOM   8434  C  CG  . ASP B 1 484 ? 86.923  11.064  10.306  1.00 27.62 ? 515 ASP B CG  1 
ATOM   8435  O  OD1 . ASP B 1 484 ? 87.579  12.128  10.514  1.00 26.53 ? 515 ASP B OD1 1 
ATOM   8436  O  OD2 . ASP B 1 484 ? 87.362  9.915   10.567  1.00 29.81 ? 515 ASP B OD2 1 
ATOM   8437  N  N   . ALA B 1 485 ? 82.813  13.750  10.041  1.00 13.69 ? 516 ALA B N   1 
ATOM   8438  C  CA  . ALA B 1 485 ? 81.588  14.218  9.425   1.00 11.54 ? 516 ALA B CA  1 
ATOM   8439  C  C   . ALA B 1 485 ? 81.679  15.613  8.876   1.00 9.54  ? 516 ALA B C   1 
ATOM   8440  O  O   . ALA B 1 485 ? 82.529  16.391  9.286   1.00 8.54  ? 516 ALA B O   1 
ATOM   8441  C  CB  . ALA B 1 485 ? 80.440  14.126  10.405  1.00 16.07 ? 516 ALA B CB  1 
ATOM   8442  N  N   . ILE B 1 486 ? 80.684  15.946  8.055   1.00 8.28  ? 517 ILE B N   1 
ATOM   8443  C  CA  . ILE B 1 486 ? 80.587  17.217  7.352   1.00 4.33  ? 517 ILE B CA  1 
ATOM   8444  C  C   . ILE B 1 486 ? 80.028  18.414  8.112   1.00 3.32  ? 517 ILE B C   1 
ATOM   8445  O  O   . ILE B 1 486 ? 80.326  19.565  7.762   1.00 2.00  ? 517 ILE B O   1 
ATOM   8446  C  CB  . ILE B 1 486 ? 79.851  17.007  6.020   1.00 2.00  ? 517 ILE B CB  1 
ATOM   8447  C  CG1 . ILE B 1 486 ? 79.766  18.298  5.246   1.00 2.88  ? 517 ILE B CG1 1 
ATOM   8448  C  CG2 . ILE B 1 486 ? 78.505  16.359  6.236   1.00 2.00  ? 517 ILE B CG2 1 
ATOM   8449  C  CD1 . ILE B 1 486 ? 79.391  18.067  3.799   1.00 6.47  ? 517 ILE B CD1 1 
ATOM   8450  N  N   . PHE B 1 487 ? 79.244  18.148  9.154   1.00 3.55  ? 518 PHE B N   1 
ATOM   8451  C  CA  . PHE B 1 487 ? 78.660  19.227  9.952   1.00 4.60  ? 518 PHE B CA  1 
ATOM   8452  C  C   . PHE B 1 487 ? 78.942  19.041  11.433  1.00 4.37  ? 518 PHE B C   1 
ATOM   8453  O  O   . PHE B 1 487 ? 79.280  17.947  11.887  1.00 5.79  ? 518 PHE B O   1 
ATOM   8454  C  CB  . PHE B 1 487 ? 77.121  19.295  9.829   1.00 5.40  ? 518 PHE B CB  1 
ATOM   8455  C  CG  . PHE B 1 487 ? 76.592  19.179  8.438   1.00 3.41  ? 518 PHE B CG  1 
ATOM   8456  C  CD1 . PHE B 1 487 ? 76.959  20.076  7.453   1.00 2.00  ? 518 PHE B CD1 1 
ATOM   8457  C  CD2 . PHE B 1 487 ? 75.709  18.153  8.118   1.00 3.55  ? 518 PHE B CD2 1 
ATOM   8458  C  CE1 . PHE B 1 487 ? 76.458  19.952  6.165   1.00 2.00  ? 518 PHE B CE1 1 
ATOM   8459  C  CE2 . PHE B 1 487 ? 75.204  18.022  6.836   1.00 2.38  ? 518 PHE B CE2 1 
ATOM   8460  C  CZ  . PHE B 1 487 ? 75.578  18.922  5.852   1.00 2.00  ? 518 PHE B CZ  1 
ATOM   8461  N  N   . GLY B 1 488 ? 78.694  20.106  12.186  1.00 4.95  ? 519 GLY B N   1 
ATOM   8462  C  CA  . GLY B 1 488 ? 78.859  20.059  13.622  1.00 6.95  ? 519 GLY B CA  1 
ATOM   8463  C  C   . GLY B 1 488 ? 77.480  19.993  14.245  1.00 7.72  ? 519 GLY B C   1 
ATOM   8464  O  O   . GLY B 1 488 ? 76.488  20.277  13.587  1.00 10.86 ? 519 GLY B O   1 
ATOM   8465  N  N   . GLU B 1 489 ? 77.414  19.671  15.526  1.00 8.59  ? 520 GLU B N   1 
ATOM   8466  C  CA  . GLU B 1 489 ? 76.149  19.543  16.251  1.00 7.05  ? 520 GLU B CA  1 
ATOM   8467  C  C   . GLU B 1 489 ? 75.125  20.605  15.948  1.00 7.31  ? 520 GLU B C   1 
ATOM   8468  O  O   . GLU B 1 489 ? 74.007  20.270  15.556  1.00 6.29  ? 520 GLU B O   1 
ATOM   8469  C  CB  . GLU B 1 489 ? 76.417  19.512  17.740  1.00 8.16  ? 520 GLU B CB  1 
ATOM   8470  C  CG  . GLU B 1 489 ? 75.203  19.540  18.599  1.00 6.64  ? 520 GLU B CG  1 
ATOM   8471  C  CD  . GLU B 1 489 ? 75.557  19.958  20.000  1.00 6.47  ? 520 GLU B CD  1 
ATOM   8472  O  OE1 . GLU B 1 489 ? 76.040  21.091  20.132  1.00 5.99  ? 520 GLU B OE1 1 
ATOM   8473  O  OE2 . GLU B 1 489 ? 75.374  19.173  20.957  1.00 5.12  ? 520 GLU B OE2 1 
ATOM   8474  N  N   . THR B 1 490 ? 75.498  21.877  16.133  1.00 8.38  ? 521 THR B N   1 
ATOM   8475  C  CA  . THR B 1 490 ? 74.587  23.008  15.853  1.00 7.03  ? 521 THR B CA  1 
ATOM   8476  C  C   . THR B 1 490 ? 73.848  22.899  14.518  1.00 5.02  ? 521 THR B C   1 
ATOM   8477  O  O   . THR B 1 490 ? 72.652  23.074  14.501  1.00 6.32  ? 521 THR B O   1 
ATOM   8478  C  CB  . THR B 1 490 ? 75.293  24.383  15.921  1.00 6.48  ? 521 THR B CB  1 
ATOM   8479  O  OG1 . THR B 1 490 ? 75.610  24.698  17.288  1.00 7.07  ? 521 THR B OG1 1 
ATOM   8480  C  CG2 . THR B 1 490 ? 74.384  25.467  15.360  1.00 5.09  ? 521 THR B CG2 1 
ATOM   8481  N  N   . MET B 1 491 ? 74.548  22.619  13.421  1.00 3.12  ? 522 MET B N   1 
ATOM   8482  C  CA  . MET B 1 491 ? 73.908  22.469  12.125  1.00 2.32  ? 522 MET B CA  1 
ATOM   8483  C  C   . MET B 1 491 ? 73.042  21.216  12.076  1.00 5.26  ? 522 MET B C   1 
ATOM   8484  O  O   . MET B 1 491 ? 72.011  21.183  11.385  1.00 6.08  ? 522 MET B O   1 
ATOM   8485  C  CB  . MET B 1 491 ? 74.925  22.422  10.996  1.00 2.00  ? 522 MET B CB  1 
ATOM   8486  C  CG  . MET B 1 491 ? 74.365  21.848  9.705   1.00 2.00  ? 522 MET B CG  1 
ATOM   8487  S  SD  . MET B 1 491 ? 74.367  22.988  8.326   1.00 2.00  ? 522 MET B SD  1 
ATOM   8488  C  CE  . MET B 1 491 ? 74.434  24.483  9.119   1.00 2.00  ? 522 MET B CE  1 
ATOM   8489  N  N   . VAL B 1 492 ? 73.434  20.173  12.791  1.00 7.28  ? 523 VAL B N   1 
ATOM   8490  C  CA  . VAL B 1 492 ? 72.602  18.975  12.754  1.00 10.81 ? 523 VAL B CA  1 
ATOM   8491  C  C   . VAL B 1 492 ? 71.352  19.093  13.619  1.00 11.04 ? 523 VAL B C   1 
ATOM   8492  O  O   . VAL B 1 492 ? 70.286  18.585  13.244  1.00 11.85 ? 523 VAL B O   1 
ATOM   8493  C  CB  . VAL B 1 492 ? 73.394  17.684  13.083  1.00 12.37 ? 523 VAL B CB  1 
ATOM   8494  C  CG1 . VAL B 1 492 ? 72.445  16.578  13.540  1.00 10.25 ? 523 VAL B CG1 1 
ATOM   8495  C  CG2 . VAL B 1 492 ? 74.135  17.215  11.833  1.00 13.12 ? 523 VAL B CG2 1 
ATOM   8496  N  N   . GLU B 1 493 ? 71.460  19.815  14.732  1.00 10.34 ? 524 GLU B N   1 
ATOM   8497  C  CA  . GLU B 1 493 ? 70.316  19.980  15.635  1.00 12.34 ? 524 GLU B CA  1 
ATOM   8498  C  C   . GLU B 1 493 ? 69.232  21.002  15.224  1.00 9.29  ? 524 GLU B C   1 
ATOM   8499  O  O   . GLU B 1 493 ? 68.064  20.843  15.556  1.00 7.51  ? 524 GLU B O   1 
ATOM   8500  C  CB  . GLU B 1 493 ? 70.795  20.205  17.079  1.00 13.91 ? 524 GLU B CB  1 
ATOM   8501  C  CG  . GLU B 1 493 ? 71.485  18.986  17.703  1.00 16.42 ? 524 GLU B CG  1 
ATOM   8502  C  CD  . GLU B 1 493 ? 70.626  17.699  17.675  1.00 16.50 ? 524 GLU B CD  1 
ATOM   8503  O  OE1 . GLU B 1 493 ? 70.636  16.970  16.659  1.00 17.89 ? 524 GLU B OE1 1 
ATOM   8504  O  OE2 . GLU B 1 493 ? 69.944  17.406  18.674  1.00 18.04 ? 524 GLU B OE2 1 
ATOM   8505  N  N   . LEU B 1 494 ? 69.626  22.040  14.502  1.00 6.77  ? 525 LEU B N   1 
ATOM   8506  C  CA  . LEU B 1 494 ? 68.684  23.044  14.035  1.00 5.77  ? 525 LEU B CA  1 
ATOM   8507  C  C   . LEU B 1 494 ? 67.989  22.600  12.755  1.00 5.60  ? 525 LEU B C   1 
ATOM   8508  O  O   . LEU B 1 494 ? 66.805  22.892  12.538  1.00 6.75  ? 525 LEU B O   1 
ATOM   8509  C  CB  . LEU B 1 494 ? 69.387  24.378  13.771  1.00 4.21  ? 525 LEU B CB  1 
ATOM   8510  C  CG  . LEU B 1 494 ? 69.976  25.103  14.977  1.00 3.89  ? 525 LEU B CG  1 
ATOM   8511  C  CD1 . LEU B 1 494 ? 69.497  26.535  15.031  1.00 2.03  ? 525 LEU B CD1 1 
ATOM   8512  C  CD2 . LEU B 1 494 ? 69.598  24.396  16.254  1.00 2.00  ? 525 LEU B CD2 1 
ATOM   8513  N  N   . GLY B 1 495 ? 68.730  21.909  11.902  1.00 3.90  ? 526 GLY B N   1 
ATOM   8514  C  CA  . GLY B 1 495 ? 68.160  21.467  10.647  1.00 4.28  ? 526 GLY B CA  1 
ATOM   8515  C  C   . GLY B 1 495 ? 67.245  20.255  10.671  1.00 2.95  ? 526 GLY B C   1 
ATOM   8516  O  O   . GLY B 1 495 ? 66.244  20.265  9.985   1.00 4.36  ? 526 GLY B O   1 
ATOM   8517  N  N   . ALA B 1 496 ? 67.573  19.216  11.434  1.00 3.83  ? 527 ALA B N   1 
ATOM   8518  C  CA  . ALA B 1 496 ? 66.751  18.003  11.465  1.00 5.50  ? 527 ALA B CA  1 
ATOM   8519  C  C   . ALA B 1 496 ? 65.291  18.245  11.846  1.00 7.10  ? 527 ALA B C   1 
ATOM   8520  O  O   . ALA B 1 496 ? 64.384  17.619  11.283  1.00 6.15  ? 527 ALA B O   1 
ATOM   8521  C  CB  . ALA B 1 496 ? 67.377  16.930  12.360  1.00 3.93  ? 527 ALA B CB  1 
ATOM   8522  N  N   . PRO B 1 497 ? 65.036  19.109  12.843  1.00 8.26  ? 528 PRO B N   1 
ATOM   8523  C  CA  . PRO B 1 497 ? 63.626  19.328  13.171  1.00 8.20  ? 528 PRO B CA  1 
ATOM   8524  C  C   . PRO B 1 497 ? 63.011  20.011  11.938  1.00 8.95  ? 528 PRO B C   1 
ATOM   8525  O  O   . PRO B 1 497 ? 62.063  19.511  11.363  1.00 10.67 ? 528 PRO B O   1 
ATOM   8526  C  CB  . PRO B 1 497 ? 63.701  20.260  14.377  1.00 9.01  ? 528 PRO B CB  1 
ATOM   8527  C  CG  . PRO B 1 497 ? 64.995  19.861  15.025  1.00 8.65  ? 528 PRO B CG  1 
ATOM   8528  C  CD  . PRO B 1 497 ? 65.910  19.772  13.826  1.00 8.35  ? 528 PRO B CD  1 
ATOM   8529  N  N   . PHE B 1 498 ? 63.643  21.081  11.463  1.00 6.46  ? 529 PHE B N   1 
ATOM   8530  C  CA  . PHE B 1 498 ? 63.174  21.786  10.281  1.00 4.61  ? 529 PHE B CA  1 
ATOM   8531  C  C   . PHE B 1 498 ? 62.936  20.847  9.097   1.00 3.29  ? 529 PHE B C   1 
ATOM   8532  O  O   . PHE B 1 498 ? 61.989  21.012  8.366   1.00 5.50  ? 529 PHE B O   1 
ATOM   8533  C  CB  . PHE B 1 498 ? 64.208  22.814  9.791   1.00 2.03  ? 529 PHE B CB  1 
ATOM   8534  C  CG  . PHE B 1 498 ? 64.345  24.050  10.627  1.00 2.75  ? 529 PHE B CG  1 
ATOM   8535  C  CD1 . PHE B 1 498 ? 63.339  24.462  11.498  1.00 5.45  ? 529 PHE B CD1 1 
ATOM   8536  C  CD2 . PHE B 1 498 ? 65.482  24.840  10.509  1.00 2.00  ? 529 PHE B CD2 1 
ATOM   8537  C  CE1 . PHE B 1 498 ? 63.472  25.664  12.247  1.00 5.87  ? 529 PHE B CE1 1 
ATOM   8538  C  CE2 . PHE B 1 498 ? 65.625  26.022  11.241  1.00 3.19  ? 529 PHE B CE2 1 
ATOM   8539  C  CZ  . PHE B 1 498 ? 64.623  26.441  12.112  1.00 4.05  ? 529 PHE B CZ  1 
ATOM   8540  N  N   . SER B 1 499 ? 63.784  19.853  8.912   1.00 4.57  ? 530 SER B N   1 
ATOM   8541  C  CA  . SER B 1 499 ? 63.667  18.983  7.749   1.00 9.80  ? 530 SER B CA  1 
ATOM   8542  C  C   . SER B 1 499 ? 62.585  17.908  7.759   1.00 10.44 ? 530 SER B C   1 
ATOM   8543  O  O   . SER B 1 499 ? 61.972  17.608  6.711   1.00 7.82  ? 530 SER B O   1 
ATOM   8544  C  CB  . SER B 1 499 ? 65.032  18.331  7.420   1.00 14.92 ? 530 SER B CB  1 
ATOM   8545  O  OG  . SER B 1 499 ? 65.249  18.225  5.999   1.00 20.97 ? 530 SER B OG  1 
ATOM   8546  N  N   . LEU B 1 500 ? 62.371  17.290  8.916   1.00 10.14 ? 531 LEU B N   1 
ATOM   8547  C  CA  . LEU B 1 500 ? 61.371  16.230  8.990   1.00 11.84 ? 531 LEU B CA  1 
ATOM   8548  C  C   . LEU B 1 500 ? 59.900  16.702  9.049   1.00 11.64 ? 531 LEU B C   1 
ATOM   8549  O  O   . LEU B 1 500 ? 58.972  15.918  8.799   1.00 13.74 ? 531 LEU B O   1 
ATOM   8550  C  CB  . LEU B 1 500 ? 61.751  15.209  10.077  1.00 11.30 ? 531 LEU B CB  1 
ATOM   8551  C  CG  . LEU B 1 500 ? 63.101  14.530  9.682   1.00 13.06 ? 531 LEU B CG  1 
ATOM   8552  C  CD1 . LEU B 1 500 ? 63.772  13.842  10.877  1.00 9.71  ? 531 LEU B CD1 1 
ATOM   8553  C  CD2 . LEU B 1 500 ? 62.958  13.559  8.475   1.00 9.41  ? 531 LEU B CD2 1 
ATOM   8554  N  N   . LYS B 1 501 ? 59.702  17.998  9.284   1.00 8.57  ? 532 LYS B N   1 
ATOM   8555  C  CA  . LYS B 1 501 ? 58.389  18.595  9.312   1.00 2.02  ? 532 LYS B CA  1 
ATOM   8556  C  C   . LYS B 1 501 ? 58.022  18.788  7.860   1.00 2.00  ? 532 LYS B C   1 
ATOM   8557  O  O   . LYS B 1 501 ? 57.226  18.071  7.322   1.00 6.67  ? 532 LYS B O   1 
ATOM   8558  C  CB  . LYS B 1 501 ? 58.436  19.930  10.009  1.00 2.06  ? 532 LYS B CB  1 
ATOM   8559  C  CG  . LYS B 1 501 ? 57.451  20.056  11.121  1.00 2.05  ? 532 LYS B CG  1 
ATOM   8560  C  CD  . LYS B 1 501 ? 56.053  20.097  10.599  1.00 6.25  ? 532 LYS B CD  1 
ATOM   8561  C  CE  . LYS B 1 501 ? 55.065  20.390  11.725  1.00 11.01 ? 532 LYS B CE  1 
ATOM   8562  N  NZ  . LYS B 1 501 ? 53.704  20.817  11.217  1.00 13.33 ? 532 LYS B NZ  1 
ATOM   8563  N  N   . GLY B 1 502 ? 58.687  19.677  7.169   1.00 2.87  ? 533 GLY B N   1 
ATOM   8564  C  CA  . GLY B 1 502 ? 58.338  19.879  5.776   1.00 4.29  ? 533 GLY B CA  1 
ATOM   8565  C  C   . GLY B 1 502 ? 58.376  18.637  4.921   1.00 2.98  ? 533 GLY B C   1 
ATOM   8566  O  O   . GLY B 1 502 ? 58.022  18.665  3.746   1.00 2.87  ? 533 GLY B O   1 
ATOM   8567  N  N   . LEU B 1 503 ? 58.858  17.547  5.489   1.00 4.47  ? 534 LEU B N   1 
ATOM   8568  C  CA  . LEU B 1 503 ? 58.944  16.287  4.751   1.00 7.64  ? 534 LEU B CA  1 
ATOM   8569  C  C   . LEU B 1 503 ? 57.768  15.385  5.128   1.00 6.16  ? 534 LEU B C   1 
ATOM   8570  O  O   . LEU B 1 503 ? 57.057  14.859  4.260   1.00 2.00  ? 534 LEU B O   1 
ATOM   8571  C  CB  . LEU B 1 503 ? 60.270  15.588  5.090   1.00 11.43 ? 534 LEU B CB  1 
ATOM   8572  C  CG  . LEU B 1 503 ? 61.263  15.269  3.968   1.00 9.78  ? 534 LEU B CG  1 
ATOM   8573  C  CD1 . LEU B 1 503 ? 61.402  16.443  3.001   1.00 6.55  ? 534 LEU B CD1 1 
ATOM   8574  C  CD2 . LEU B 1 503 ? 62.609  14.894  4.606   1.00 8.51  ? 534 LEU B CD2 1 
ATOM   8575  N  N   . MET B 1 504 ? 57.604  15.191  6.434   1.00 5.68  ? 535 MET B N   1 
ATOM   8576  C  CA  . MET B 1 504 ? 56.518  14.388  6.961   1.00 8.18  ? 535 MET B CA  1 
ATOM   8577  C  C   . MET B 1 504 ? 55.160  15.107  6.924   1.00 8.20  ? 535 MET B C   1 
ATOM   8578  O  O   . MET B 1 504 ? 54.174  14.524  6.505   1.00 7.00  ? 535 MET B O   1 
ATOM   8579  C  CB  . MET B 1 504 ? 56.861  13.876  8.365   1.00 6.39  ? 535 MET B CB  1 
ATOM   8580  C  CG  . MET B 1 504 ? 57.891  12.788  8.332   1.00 3.82  ? 535 MET B CG  1 
ATOM   8581  S  SD  . MET B 1 504 ? 57.453  11.642  6.998   1.00 14.41 ? 535 MET B SD  1 
ATOM   8582  C  CE  . MET B 1 504 ? 57.317  10.153  7.867   1.00 7.55  ? 535 MET B CE  1 
ATOM   8583  N  N   . GLY B 1 505 ? 55.137  16.377  7.337   1.00 9.84  ? 536 GLY B N   1 
ATOM   8584  C  CA  . GLY B 1 505 ? 53.933  17.197  7.326   1.00 8.60  ? 536 GLY B CA  1 
ATOM   8585  C  C   . GLY B 1 505 ? 53.545  17.660  5.925   1.00 8.04  ? 536 GLY B C   1 
ATOM   8586  O  O   . GLY B 1 505 ? 53.469  18.846  5.674   1.00 12.80 ? 536 GLY B O   1 
ATOM   8587  N  N   . ASN B 1 506 ? 53.264  16.724  5.027   1.00 6.82  ? 537 ASN B N   1 
ATOM   8588  C  CA  . ASN B 1 506 ? 52.872  17.012  3.653   1.00 5.43  ? 537 ASN B CA  1 
ATOM   8589  C  C   . ASN B 1 506 ? 51.519  16.312  3.441   1.00 7.62  ? 537 ASN B C   1 
ATOM   8590  O  O   . ASN B 1 506 ? 51.323  15.200  3.940   1.00 9.33  ? 537 ASN B O   1 
ATOM   8591  C  CB  . ASN B 1 506 ? 53.918  16.412  2.721   1.00 6.47  ? 537 ASN B CB  1 
ATOM   8592  C  CG  . ASN B 1 506 ? 53.635  16.671  1.254   1.00 7.85  ? 537 ASN B CG  1 
ATOM   8593  O  OD1 . ASN B 1 506 ? 52.720  16.078  0.682   1.00 6.85  ? 537 ASN B OD1 1 
ATOM   8594  N  ND2 . ASN B 1 506 ? 54.450  17.531  0.621   1.00 8.96  ? 537 ASN B ND2 1 
ATOM   8595  N  N   . PRO B 1 507 ? 50.555  16.951  2.727   1.00 6.85  ? 538 PRO B N   1 
ATOM   8596  C  CA  . PRO B 1 507 ? 49.258  16.311  2.504   1.00 3.30  ? 538 PRO B CA  1 
ATOM   8597  C  C   . PRO B 1 507 ? 49.320  14.861  2.017   1.00 3.50  ? 538 PRO B C   1 
ATOM   8598  O  O   . PRO B 1 507 ? 48.609  14.013  2.566   1.00 2.73  ? 538 PRO B O   1 
ATOM   8599  C  CB  . PRO B 1 507 ? 48.603  17.216  1.468   1.00 2.35  ? 538 PRO B CB  1 
ATOM   8600  C  CG  . PRO B 1 507 ? 49.731  17.866  0.794   1.00 2.97  ? 538 PRO B CG  1 
ATOM   8601  C  CD  . PRO B 1 507 ? 50.603  18.212  1.970   1.00 6.94  ? 538 PRO B CD  1 
ATOM   8602  N  N   . ILE B 1 508 ? 50.177  14.540  1.045   1.00 2.00  ? 539 ILE B N   1 
ATOM   8603  C  CA  . ILE B 1 508 ? 50.219  13.162  0.581   1.00 2.00  ? 539 ILE B CA  1 
ATOM   8604  C  C   . ILE B 1 508 ? 50.662  12.195  1.678   1.00 2.79  ? 539 ILE B C   1 
ATOM   8605  O  O   . ILE B 1 508 ? 50.569  10.997  1.517   1.00 2.06  ? 539 ILE B O   1 
ATOM   8606  C  CB  . ILE B 1 508 ? 51.063  12.978  -0.667  1.00 2.00  ? 539 ILE B CB  1 
ATOM   8607  C  CG1 . ILE B 1 508 ? 52.554  12.967  -0.315  1.00 5.57  ? 539 ILE B CG1 1 
ATOM   8608  C  CG2 . ILE B 1 508 ? 50.780  14.092  -1.634  1.00 2.11  ? 539 ILE B CG2 1 
ATOM   8609  C  CD1 . ILE B 1 508 ? 53.397  11.906  -1.081  1.00 2.02  ? 539 ILE B CD1 1 
ATOM   8610  N  N   . CYS B 1 509 ? 51.142  12.726  2.797   1.00 5.52  ? 540 CYS B N   1 
ATOM   8611  C  CA  . CYS B 1 509 ? 51.577  11.911  3.934   1.00 8.15  ? 540 CYS B CA  1 
ATOM   8612  C  C   . CYS B 1 509 ? 50.450  11.744  4.919   1.00 8.90  ? 540 CYS B C   1 
ATOM   8613  O  O   . CYS B 1 509 ? 50.581  10.983  5.881   1.00 10.70 ? 540 CYS B O   1 
ATOM   8614  C  CB  . CYS B 1 509 ? 52.735  12.560  4.697   1.00 10.79 ? 540 CYS B CB  1 
ATOM   8615  S  SG  . CYS B 1 509 ? 54.414  12.103  4.232   1.00 14.07 ? 540 CYS B SG  1 
ATOM   8616  N  N   . SER B 1 510 ? 49.381  12.513  4.731   1.00 8.65  ? 541 SER B N   1 
ATOM   8617  C  CA  . SER B 1 510 ? 48.223  12.440  5.621   1.00 6.90  ? 541 SER B CA  1 
ATOM   8618  C  C   . SER B 1 510 ? 47.336  11.229  5.312   1.00 4.86  ? 541 SER B C   1 
ATOM   8619  O  O   . SER B 1 510 ? 47.096  10.898  4.152   1.00 2.00  ? 541 SER B O   1 
ATOM   8620  C  CB  . SER B 1 510 ? 47.406  13.760  5.592   1.00 6.50  ? 541 SER B CB  1 
ATOM   8621  O  OG  . SER B 1 510 ? 46.938  14.088  4.280   1.00 2.00  ? 541 SER B OG  1 
ATOM   8622  N  N   . PRO B 1 511 ? 46.830  10.572  6.362   1.00 2.81  ? 542 PRO B N   1 
ATOM   8623  C  CA  . PRO B 1 511 ? 45.975  9.409   6.243   1.00 2.56  ? 542 PRO B CA  1 
ATOM   8624  C  C   . PRO B 1 511 ? 44.983  9.415   5.111   1.00 4.03  ? 542 PRO B C   1 
ATOM   8625  O  O   . PRO B 1 511 ? 44.822  8.390   4.440   1.00 8.75  ? 542 PRO B O   1 
ATOM   8626  C  CB  . PRO B 1 511 ? 45.296  9.328   7.609   1.00 2.00  ? 542 PRO B CB  1 
ATOM   8627  C  CG  . PRO B 1 511 ? 45.686  10.566  8.327   1.00 2.05  ? 542 PRO B CG  1 
ATOM   8628  C  CD  . PRO B 1 511 ? 47.019  10.898  7.777   1.00 3.71  ? 542 PRO B CD  1 
ATOM   8629  N  N   . GLN B 1 512 ? 44.357  10.556  4.842   1.00 2.00  ? 543 GLN B N   1 
ATOM   8630  C  CA  . GLN B 1 512 ? 43.363  10.602  3.762   1.00 3.49  ? 543 GLN B CA  1 
ATOM   8631  C  C   . GLN B 1 512 ? 43.987  10.461  2.388   1.00 4.78  ? 543 GLN B C   1 
ATOM   8632  O  O   . GLN B 1 512 ? 43.310  10.078  1.433   1.00 2.00  ? 543 GLN B O   1 
ATOM   8633  C  CB  . GLN B 1 512 ? 42.528  11.867  3.805   1.00 2.00  ? 543 GLN B CB  1 
ATOM   8634  C  CG  . GLN B 1 512 ? 42.346  12.448  5.193   1.00 6.02  ? 543 GLN B CG  1 
ATOM   8635  C  CD  . GLN B 1 512 ? 43.457  13.433  5.558   1.00 7.64  ? 543 GLN B CD  1 
ATOM   8636  O  OE1 . GLN B 1 512 ? 43.949  13.444  6.700   1.00 2.00  ? 543 GLN B OE1 1 
ATOM   8637  N  NE2 . GLN B 1 512 ? 43.853  14.280  4.585   1.00 7.19  ? 543 GLN B NE2 1 
ATOM   8638  N  N   . TYR B 1 513 ? 45.268  10.821  2.285   1.00 7.18  ? 544 TYR B N   1 
ATOM   8639  C  CA  . TYR B 1 513 ? 46.009  10.727  1.025   1.00 3.60  ? 544 TYR B CA  1 
ATOM   8640  C  C   . TYR B 1 513 ? 46.812  9.444   0.909   1.00 4.11  ? 544 TYR B C   1 
ATOM   8641  O  O   . TYR B 1 513 ? 46.895  8.879   -0.175  1.00 2.00  ? 544 TYR B O   1 
ATOM   8642  C  CB  . TYR B 1 513 ? 46.957  11.912  0.877   1.00 2.00  ? 544 TYR B CB  1 
ATOM   8643  C  CG  . TYR B 1 513 ? 46.337  13.184  0.358   1.00 2.00  ? 544 TYR B CG  1 
ATOM   8644  C  CD1 . TYR B 1 513 ? 45.672  14.067  1.211   1.00 2.27  ? 544 TYR B CD1 1 
ATOM   8645  C  CD2 . TYR B 1 513 ? 46.434  13.518  -0.998  1.00 2.00  ? 544 TYR B CD2 1 
ATOM   8646  C  CE1 . TYR B 1 513 ? 45.114  15.253  0.709   1.00 2.00  ? 544 TYR B CE1 1 
ATOM   8647  C  CE2 . TYR B 1 513 ? 45.895  14.683  -1.495  1.00 2.00  ? 544 TYR B CE2 1 
ATOM   8648  C  CZ  . TYR B 1 513 ? 45.234  15.542  -0.647  1.00 2.00  ? 544 TYR B CZ  1 
ATOM   8649  O  OH  . TYR B 1 513 ? 44.667  16.668  -1.175  1.00 2.00  ? 544 TYR B OH  1 
ATOM   8650  N  N   . TRP B 1 514 ? 47.370  8.963   2.026   1.00 4.81  ? 545 TRP B N   1 
ATOM   8651  C  CA  . TRP B 1 514 ? 48.223  7.762   2.002   1.00 5.63  ? 545 TRP B CA  1 
ATOM   8652  C  C   . TRP B 1 514 ? 47.555  6.417   1.663   1.00 5.37  ? 545 TRP B C   1 
ATOM   8653  O  O   . TRP B 1 514 ? 47.360  5.568   2.548   1.00 6.11  ? 545 TRP B O   1 
ATOM   8654  C  CB  . TRP B 1 514 ? 49.076  7.655   3.293   1.00 5.50  ? 545 TRP B CB  1 
ATOM   8655  C  CG  . TRP B 1 514 ? 50.346  6.817   3.129   1.00 7.87  ? 545 TRP B CG  1 
ATOM   8656  C  CD1 . TRP B 1 514 ? 50.709  5.735   3.875   1.00 10.54 ? 545 TRP B CD1 1 
ATOM   8657  C  CD2 . TRP B 1 514 ? 51.385  6.975   2.134   1.00 7.99  ? 545 TRP B CD2 1 
ATOM   8658  N  NE1 . TRP B 1 514 ? 51.892  5.205   3.408   1.00 9.12  ? 545 TRP B NE1 1 
ATOM   8659  C  CE2 . TRP B 1 514 ? 52.325  5.951   2.345   1.00 6.64  ? 545 TRP B CE2 1 
ATOM   8660  C  CE3 . TRP B 1 514 ? 51.604  7.883   1.086   1.00 7.85  ? 545 TRP B CE3 1 
ATOM   8661  C  CZ2 . TRP B 1 514 ? 53.468  5.812   1.552   1.00 6.31  ? 545 TRP B CZ2 1 
ATOM   8662  C  CZ3 . TRP B 1 514 ? 52.749  7.737   0.294   1.00 5.86  ? 545 TRP B CZ3 1 
ATOM   8663  C  CH2 . TRP B 1 514 ? 53.660  6.715   0.533   1.00 5.22  ? 545 TRP B CH2 1 
ATOM   8664  N  N   . LYS B 1 515 ? 47.222  6.211   0.387   1.00 2.00  ? 546 LYS B N   1 
ATOM   8665  C  CA  . LYS B 1 515 ? 46.634  4.957   -0.024  1.00 2.00  ? 546 LYS B CA  1 
ATOM   8666  C  C   . LYS B 1 515 ? 46.608  4.867   -1.516  1.00 2.00  ? 546 LYS B C   1 
ATOM   8667  O  O   . LYS B 1 515 ? 46.428  5.848   -2.192  1.00 2.00  ? 546 LYS B O   1 
ATOM   8668  C  CB  . LYS B 1 515 ? 45.271  4.764   0.594   1.00 6.76  ? 546 LYS B CB  1 
ATOM   8669  C  CG  . LYS B 1 515 ? 44.268  5.883   0.359   1.00 13.70 ? 546 LYS B CG  1 
ATOM   8670  C  CD  . LYS B 1 515 ? 42.976  5.552   1.096   1.00 18.21 ? 546 LYS B CD  1 
ATOM   8671  C  CE  . LYS B 1 515 ? 41.851  6.545   0.858   1.00 21.61 ? 546 LYS B CE  1 
ATOM   8672  N  NZ  . LYS B 1 515 ? 40.618  6.150   1.629   1.00 22.71 ? 546 LYS B NZ  1 
ATOM   8673  N  N   . PRO B 1 516 ? 46.780  3.666   -2.051  1.00 2.00  ? 547 PRO B N   1 
ATOM   8674  C  CA  . PRO B 1 516 ? 46.814  3.308   -3.473  1.00 2.00  ? 547 PRO B CA  1 
ATOM   8675  C  C   . PRO B 1 516 ? 46.036  4.176   -4.434  1.00 3.45  ? 547 PRO B C   1 
ATOM   8676  O  O   . PRO B 1 516 ? 46.559  4.638   -5.443  1.00 3.41  ? 547 PRO B O   1 
ATOM   8677  C  CB  . PRO B 1 516 ? 46.300  1.884   -3.482  1.00 2.00  ? 547 PRO B CB  1 
ATOM   8678  C  CG  . PRO B 1 516 ? 46.886  1.363   -2.246  1.00 2.28  ? 547 PRO B CG  1 
ATOM   8679  C  CD  . PRO B 1 516 ? 46.690  2.454   -1.228  1.00 2.07  ? 547 PRO B CD  1 
ATOM   8680  N  N   . SER B 1 517 ? 44.777  4.419   -4.119  1.00 5.30  ? 548 SER B N   1 
ATOM   8681  C  CA  . SER B 1 517 ? 43.950  5.212   -5.003  1.00 5.11  ? 548 SER B CA  1 
ATOM   8682  C  C   . SER B 1 517 ? 44.514  6.585   -5.309  1.00 3.98  ? 548 SER B C   1 
ATOM   8683  O  O   . SER B 1 517 ? 44.573  6.977   -6.467  1.00 4.29  ? 548 SER B O   1 
ATOM   8684  C  CB  . SER B 1 517 ? 42.550  5.294   -4.439  1.00 3.51  ? 548 SER B CB  1 
ATOM   8685  O  OG  . SER B 1 517 ? 42.062  3.976   -4.264  1.00 2.00  ? 548 SER B OG  1 
ATOM   8686  N  N   . THR B 1 518 ? 45.027  7.260   -4.288  1.00 3.68  ? 549 THR B N   1 
ATOM   8687  C  CA  . THR B 1 518 ? 45.583  8.589   -4.455  1.00 2.00  ? 549 THR B CA  1 
ATOM   8688  C  C   . THR B 1 518 ? 46.577  8.616   -5.594  1.00 2.01  ? 549 THR B C   1 
ATOM   8689  O  O   . THR B 1 518 ? 46.558  9.526   -6.404  1.00 2.00  ? 549 THR B O   1 
ATOM   8690  C  CB  . THR B 1 518 ? 46.293  9.048   -3.184  1.00 2.00  ? 549 THR B CB  1 
ATOM   8691  O  OG1 . THR B 1 518 ? 45.487  8.740   -2.054  1.00 2.00  ? 549 THR B OG1 1 
ATOM   8692  C  CG2 . THR B 1 518 ? 46.537  10.513  -3.206  1.00 2.00  ? 549 THR B CG2 1 
ATOM   8693  N  N   . PHE B 1 519 ? 47.346  7.541   -5.730  1.00 3.75  ? 550 PHE B N   1 
ATOM   8694  C  CA  . PHE B 1 519 ? 48.407  7.470   -6.738  1.00 3.96  ? 550 PHE B CA  1 
ATOM   8695  C  C   . PHE B 1 519 ? 48.120  6.750   -8.059  1.00 2.01  ? 550 PHE B C   1 
ATOM   8696  O  O   . PHE B 1 519 ? 48.996  6.560   -8.883  1.00 2.04  ? 550 PHE B O   1 
ATOM   8697  C  CB  . PHE B 1 519 ? 49.681  6.940   -6.061  1.00 2.34  ? 550 PHE B CB  1 
ATOM   8698  C  CG  . PHE B 1 519 ? 49.980  7.619   -4.759  1.00 2.00  ? 550 PHE B CG  1 
ATOM   8699  C  CD1 . PHE B 1 519 ? 50.297  8.965   -4.728  1.00 2.05  ? 550 PHE B CD1 1 
ATOM   8700  C  CD2 . PHE B 1 519 ? 49.879  6.937   -3.561  1.00 2.00  ? 550 PHE B CD2 1 
ATOM   8701  C  CE1 . PHE B 1 519 ? 50.504  9.633   -3.515  1.00 2.02  ? 550 PHE B CE1 1 
ATOM   8702  C  CE2 . PHE B 1 519 ? 50.091  7.594   -2.336  1.00 2.00  ? 550 PHE B CE2 1 
ATOM   8703  C  CZ  . PHE B 1 519 ? 50.402  8.942   -2.318  1.00 2.00  ? 550 PHE B CZ  1 
ATOM   8704  N  N   . GLY B 1 520 ? 46.880  6.369   -8.276  1.00 4.11  ? 551 GLY B N   1 
ATOM   8705  C  CA  . GLY B 1 520 ? 46.552  5.696   -9.516  1.00 4.32  ? 551 GLY B CA  1 
ATOM   8706  C  C   . GLY B 1 520 ? 46.467  4.196   -9.452  1.00 2.01  ? 551 GLY B C   1 
ATOM   8707  O  O   . GLY B 1 520 ? 46.197  3.585   -10.464 1.00 2.06  ? 551 GLY B O   1 
ATOM   8708  N  N   . GLY B 1 521 ? 46.656  3.605   -8.280  1.00 2.25  ? 552 GLY B N   1 
ATOM   8709  C  CA  . GLY B 1 521 ? 46.586  2.165   -8.178  1.00 6.78  ? 552 GLY B CA  1 
ATOM   8710  C  C   . GLY B 1 521 ? 47.508  1.604   -7.125  1.00 10.65 ? 552 GLY B C   1 
ATOM   8711  O  O   . GLY B 1 521 ? 47.779  2.273   -6.139  1.00 10.86 ? 552 GLY B O   1 
ATOM   8712  N  N   . GLU B 1 522 ? 47.915  0.341   -7.279  1.00 13.39 ? 553 GLU B N   1 
ATOM   8713  C  CA  . GLU B 1 522 ? 48.852  -0.286  -6.331  1.00 11.63 ? 553 GLU B CA  1 
ATOM   8714  C  C   . GLU B 1 522 ? 50.218  -0.170  -7.007  1.00 9.28  ? 553 GLU B C   1 
ATOM   8715  O  O   . GLU B 1 522 ? 51.257  -0.233  -6.350  1.00 7.66  ? 553 GLU B O   1 
ATOM   8716  C  CB  . GLU B 1 522 ? 48.486  -1.748  -6.060  1.00 12.61 ? 553 GLU B CB  1 
ATOM   8717  C  CG  . GLU B 1 522 ? 48.989  -2.266  -4.715  1.00 19.48 ? 553 GLU B CG  1 
ATOM   8718  C  CD  . GLU B 1 522 ? 48.214  -1.736  -3.506  1.00 22.64 ? 553 GLU B CD  1 
ATOM   8719  O  OE1 . GLU B 1 522 ? 46.977  -1.611  -3.597  1.00 26.75 ? 553 GLU B OE1 1 
ATOM   8720  O  OE2 . GLU B 1 522 ? 48.829  -1.485  -2.446  1.00 23.67 ? 553 GLU B OE2 1 
ATOM   8721  N  N   . VAL B 1 523 ? 50.182  0.023   -8.330  1.00 5.37  ? 554 VAL B N   1 
ATOM   8722  C  CA  . VAL B 1 523 ? 51.371  0.207   -9.140  1.00 3.98  ? 554 VAL B CA  1 
ATOM   8723  C  C   . VAL B 1 523 ? 51.963  1.526   -8.684  1.00 4.43  ? 554 VAL B C   1 
ATOM   8724  O  O   . VAL B 1 523 ? 52.874  1.544   -7.877  1.00 8.58  ? 554 VAL B O   1 
ATOM   8725  C  CB  . VAL B 1 523 ? 51.024  0.292   -10.633 1.00 2.00  ? 554 VAL B CB  1 
ATOM   8726  C  CG1 . VAL B 1 523 ? 52.108  0.987   -11.403 1.00 2.00  ? 554 VAL B CG1 1 
ATOM   8727  C  CG2 . VAL B 1 523 ? 50.862  -1.060  -11.180 1.00 4.39  ? 554 VAL B CG2 1 
ATOM   8728  N  N   . GLY B 1 524 ? 51.401  2.630   -9.151  1.00 3.47  ? 555 GLY B N   1 
ATOM   8729  C  CA  . GLY B 1 524 ? 51.884  3.934   -8.753  1.00 2.04  ? 555 GLY B CA  1 
ATOM   8730  C  C   . GLY B 1 524 ? 52.161  4.050   -7.258  1.00 2.00  ? 555 GLY B C   1 
ATOM   8731  O  O   . GLY B 1 524 ? 52.959  4.877   -6.865  1.00 5.59  ? 555 GLY B O   1 
ATOM   8732  N  N   . PHE B 1 525 ? 51.553  3.226   -6.418  1.00 2.20  ? 556 PHE B N   1 
ATOM   8733  C  CA  . PHE B 1 525 ? 51.824  3.343   -5.004  1.00 2.00  ? 556 PHE B CA  1 
ATOM   8734  C  C   . PHE B 1 525 ? 53.201  2.798   -4.736  1.00 5.38  ? 556 PHE B C   1 
ATOM   8735  O  O   . PHE B 1 525 ? 53.928  3.342   -3.917  1.00 8.75  ? 556 PHE B O   1 
ATOM   8736  C  CB  . PHE B 1 525 ? 50.799  2.584   -4.172  1.00 3.50  ? 556 PHE B CB  1 
ATOM   8737  C  CG  . PHE B 1 525 ? 50.852  2.894   -2.699  1.00 2.00  ? 556 PHE B CG  1 
ATOM   8738  C  CD1 . PHE B 1 525 ? 51.168  4.148   -2.257  1.00 2.19  ? 556 PHE B CD1 1 
ATOM   8739  C  CD2 . PHE B 1 525 ? 50.564  1.926   -1.762  1.00 2.00  ? 556 PHE B CD2 1 
ATOM   8740  C  CE1 . PHE B 1 525 ? 51.193  4.431   -0.911  1.00 2.00  ? 556 PHE B CE1 1 
ATOM   8741  C  CE2 . PHE B 1 525 ? 50.588  2.215   -0.410  1.00 2.00  ? 556 PHE B CE2 1 
ATOM   8742  C  CZ  . PHE B 1 525 ? 50.903  3.462   0.012   1.00 2.00  ? 556 PHE B CZ  1 
ATOM   8743  N  N   . LYS B 1 526 ? 53.563  1.686   -5.372  1.00 9.25  ? 557 LYS B N   1 
ATOM   8744  C  CA  . LYS B 1 526 ? 54.902  1.123   -5.162  1.00 9.10  ? 557 LYS B CA  1 
ATOM   8745  C  C   . LYS B 1 526 ? 55.985  1.918   -5.812  1.00 8.98  ? 557 LYS B C   1 
ATOM   8746  O  O   . LYS B 1 526 ? 57.111  1.870   -5.336  1.00 10.38 ? 557 LYS B O   1 
ATOM   8747  C  CB  . LYS B 1 526 ? 55.017  -0.344  -5.537  1.00 10.08 ? 557 LYS B CB  1 
ATOM   8748  C  CG  . LYS B 1 526 ? 55.085  -1.183  -4.261  1.00 14.67 ? 557 LYS B CG  1 
ATOM   8749  C  CD  . LYS B 1 526 ? 53.969  -0.774  -3.221  1.00 15.04 ? 557 LYS B CD  1 
ATOM   8750  C  CE  . LYS B 1 526 ? 52.544  -1.148  -3.692  1.00 13.53 ? 557 LYS B CE  1 
ATOM   8751  N  NZ  . LYS B 1 526 ? 52.406  -2.636  -3.976  1.00 15.11 ? 557 LYS B NZ  1 
ATOM   8752  N  N   . ILE B 1 527 ? 55.648  2.659   -6.876  1.00 7.65  ? 558 ILE B N   1 
ATOM   8753  C  CA  . ILE B 1 527 ? 56.609  3.544   -7.532  1.00 5.00  ? 558 ILE B CA  1 
ATOM   8754  C  C   . ILE B 1 527 ? 57.142  4.439   -6.393  1.00 3.96  ? 558 ILE B C   1 
ATOM   8755  O  O   . ILE B 1 527 ? 58.355  4.566   -6.198  1.00 5.74  ? 558 ILE B O   1 
ATOM   8756  C  CB  . ILE B 1 527 ? 55.984  4.404   -8.663  1.00 2.28  ? 558 ILE B CB  1 
ATOM   8757  C  CG1 . ILE B 1 527 ? 55.568  3.536   -9.846  1.00 5.44  ? 558 ILE B CG1 1 
ATOM   8758  C  CG2 . ILE B 1 527 ? 56.996  5.388   -9.195  1.00 6.13  ? 558 ILE B CG2 1 
ATOM   8759  C  CD1 . ILE B 1 527 ? 55.294  4.321   -11.132 1.00 2.00  ? 558 ILE B CD1 1 
ATOM   8760  N  N   . ILE B 1 528 ? 56.248  4.999   -5.597  1.00 2.00  ? 559 ILE B N   1 
ATOM   8761  C  CA  . ILE B 1 528 ? 56.698  5.778   -4.481  1.00 2.52  ? 559 ILE B CA  1 
ATOM   8762  C  C   . ILE B 1 528 ? 57.451  4.855   -3.542  1.00 3.86  ? 559 ILE B C   1 
ATOM   8763  O  O   . ILE B 1 528 ? 58.603  5.097   -3.207  1.00 7.85  ? 559 ILE B O   1 
ATOM   8764  C  CB  . ILE B 1 528 ? 55.541  6.366   -3.701  1.00 2.06  ? 559 ILE B CB  1 
ATOM   8765  C  CG1 . ILE B 1 528 ? 54.799  7.338   -4.595  1.00 2.00  ? 559 ILE B CG1 1 
ATOM   8766  C  CG2 . ILE B 1 528 ? 56.017  7.024   -2.390  1.00 2.11  ? 559 ILE B CG2 1 
ATOM   8767  C  CD1 . ILE B 1 528 ? 53.631  7.958   -3.915  1.00 3.52  ? 559 ILE B CD1 1 
ATOM   8768  N  N   . ASN B 1 529 ? 56.839  3.745   -3.191  1.00 3.44  ? 560 ASN B N   1 
ATOM   8769  C  CA  . ASN B 1 529 ? 57.440  2.813   -2.254  1.00 4.65  ? 560 ASN B CA  1 
ATOM   8770  C  C   . ASN B 1 529 ? 58.784  2.119   -2.561  1.00 4.80  ? 560 ASN B C   1 
ATOM   8771  O  O   . ASN B 1 529 ? 59.349  1.415   -1.726  1.00 2.00  ? 560 ASN B O   1 
ATOM   8772  C  CB  . ASN B 1 529 ? 56.390  1.791   -1.907  1.00 8.47  ? 560 ASN B CB  1 
ATOM   8773  C  CG  . ASN B 1 529 ? 55.266  2.388   -1.122  1.00 4.71  ? 560 ASN B CG  1 
ATOM   8774  O  OD1 . ASN B 1 529 ? 55.485  3.238   -0.268  1.00 2.33  ? 560 ASN B OD1 1 
ATOM   8775  N  ND2 . ASN B 1 529 ? 54.056  1.944   -1.398  1.00 3.43  ? 560 ASN B ND2 1 
ATOM   8776  N  N   . THR B 1 530 ? 59.282  2.282   -3.770  1.00 7.25  ? 561 THR B N   1 
ATOM   8777  C  CA  . THR B 1 530 ? 60.551  1.678   -4.121  1.00 7.25  ? 561 THR B CA  1 
ATOM   8778  C  C   . THR B 1 530 ? 61.550  2.684   -4.696  1.00 10.84 ? 561 THR B C   1 
ATOM   8779  O  O   . THR B 1 530 ? 62.610  2.291   -5.197  1.00 12.34 ? 561 THR B O   1 
ATOM   8780  C  CB  . THR B 1 530 ? 60.361  0.532   -5.123  1.00 5.15  ? 561 THR B CB  1 
ATOM   8781  O  OG1 . THR B 1 530 ? 59.730  1.004   -6.320  1.00 2.00  ? 561 THR B OG1 1 
ATOM   8782  C  CG2 . THR B 1 530 ? 59.548  -0.560  -4.499  1.00 3.34  ? 561 THR B CG2 1 
ATOM   8783  N  N   . ALA B 1 531 ? 61.218  3.975   -4.619  1.00 12.48 ? 562 ALA B N   1 
ATOM   8784  C  CA  . ALA B 1 531 ? 62.078  5.028   -5.146  1.00 11.29 ? 562 ALA B CA  1 
ATOM   8785  C  C   . ALA B 1 531 ? 63.479  5.007   -4.517  1.00 10.40 ? 562 ALA B C   1 
ATOM   8786  O  O   . ALA B 1 531 ? 63.638  4.687   -3.324  1.00 8.30  ? 562 ALA B O   1 
ATOM   8787  C  CB  . ALA B 1 531 ? 61.427  6.380   -4.927  1.00 10.19 ? 562 ALA B CB  1 
ATOM   8788  N  N   . SER B 1 532 ? 64.483  5.334   -5.339  1.00 9.03  ? 563 SER B N   1 
ATOM   8789  C  CA  . SER B 1 532 ? 65.888  5.404   -4.915  1.00 6.87  ? 563 SER B CA  1 
ATOM   8790  C  C   . SER B 1 532 ? 66.659  6.283   -5.883  1.00 5.95  ? 563 SER B C   1 
ATOM   8791  O  O   . SER B 1 532 ? 66.284  6.404   -7.065  1.00 3.56  ? 563 SER B O   1 
ATOM   8792  C  CB  . SER B 1 532 ? 66.531  4.009   -4.902  1.00 11.23 ? 563 SER B CB  1 
ATOM   8793  O  OG  . SER B 1 532 ? 66.419  3.336   -6.158  1.00 10.19 ? 563 SER B OG  1 
ATOM   8794  N  N   . ILE B 1 533 ? 67.760  6.864   -5.411  1.00 5.56  ? 564 ILE B N   1 
ATOM   8795  C  CA  . ILE B 1 533 ? 68.586  7.717   -6.284  1.00 5.63  ? 564 ILE B CA  1 
ATOM   8796  C  C   . ILE B 1 533 ? 69.254  6.878   -7.387  1.00 5.21  ? 564 ILE B C   1 
ATOM   8797  O  O   . ILE B 1 533 ? 69.554  7.385   -8.481  1.00 3.38  ? 564 ILE B O   1 
ATOM   8798  C  CB  . ILE B 1 533 ? 69.607  8.591   -5.491  1.00 2.00  ? 564 ILE B CB  1 
ATOM   8799  C  CG1 . ILE B 1 533 ? 70.355  9.527   -6.424  1.00 2.00  ? 564 ILE B CG1 1 
ATOM   8800  C  CG2 . ILE B 1 533 ? 70.509  7.752   -4.700  1.00 2.00  ? 564 ILE B CG2 1 
ATOM   8801  C  CD1 . ILE B 1 533 ? 69.509  10.585  -7.084  1.00 2.00  ? 564 ILE B CD1 1 
ATOM   8802  N  N   . GLN B 1 534 ? 69.412  5.580   -7.119  1.00 5.38  ? 565 GLN B N   1 
ATOM   8803  C  CA  . GLN B 1 534 ? 69.974  4.678   -8.103  1.00 8.25  ? 565 GLN B CA  1 
ATOM   8804  C  C   . GLN B 1 534 ? 68.927  4.391   -9.196  1.00 7.19  ? 565 GLN B C   1 
ATOM   8805  O  O   . GLN B 1 534 ? 69.235  4.352   -10.402 1.00 2.20  ? 565 GLN B O   1 
ATOM   8806  C  CB  . GLN B 1 534 ? 70.441  3.378   -7.449  1.00 16.48 ? 565 GLN B CB  1 
ATOM   8807  C  CG  . GLN B 1 534 ? 70.962  2.298   -8.468  1.00 26.79 ? 565 GLN B CG  1 
ATOM   8808  C  CD  . GLN B 1 534 ? 72.104  2.800   -9.395  1.00 30.69 ? 565 GLN B CD  1 
ATOM   8809  O  OE1 . GLN B 1 534 ? 73.249  2.960   -8.954  1.00 33.64 ? 565 GLN B OE1 1 
ATOM   8810  N  NE2 . GLN B 1 534 ? 71.786  3.039   -10.680 1.00 30.95 ? 565 GLN B NE2 1 
ATOM   8811  N  N   . SER B 1 535 ? 67.681  4.198   -8.780  1.00 8.05  ? 566 SER B N   1 
ATOM   8812  C  CA  . SER B 1 535 ? 66.621  3.964   -9.745  1.00 9.04  ? 566 SER B CA  1 
ATOM   8813  C  C   . SER B 1 535 ? 66.245  5.205   -10.522 1.00 5.96  ? 566 SER B C   1 
ATOM   8814  O  O   . SER B 1 535 ? 65.935  5.115   -11.711 1.00 5.04  ? 566 SER B O   1 
ATOM   8815  C  CB  . SER B 1 535 ? 65.380  3.393   -9.085  1.00 12.76 ? 566 SER B CB  1 
ATOM   8816  O  OG  . SER B 1 535 ? 65.284  2.009   -9.394  1.00 24.39 ? 566 SER B OG  1 
ATOM   8817  N  N   . LEU B 1 536 ? 66.301  6.370   -9.884  1.00 2.79  ? 567 LEU B N   1 
ATOM   8818  C  CA  . LEU B 1 536 ? 65.945  7.582   -10.605 1.00 2.25  ? 567 LEU B CA  1 
ATOM   8819  C  C   . LEU B 1 536 ? 66.826  7.678   -11.854 1.00 2.10  ? 567 LEU B C   1 
ATOM   8820  O  O   . LEU B 1 536 ? 66.336  7.829   -12.985 1.00 2.00  ? 567 LEU B O   1 
ATOM   8821  C  CB  . LEU B 1 536 ? 66.096  8.823   -9.712  1.00 2.74  ? 567 LEU B CB  1 
ATOM   8822  C  CG  . LEU B 1 536 ? 65.277  10.025  -10.194 1.00 2.07  ? 567 LEU B CG  1 
ATOM   8823  C  CD1 . LEU B 1 536 ? 63.917  9.890   -9.647  1.00 2.00  ? 567 LEU B CD1 1 
ATOM   8824  C  CD2 . LEU B 1 536 ? 65.865  11.319  -9.743  1.00 2.02  ? 567 LEU B CD2 1 
ATOM   8825  N  N   . ILE B 1 537 ? 68.121  7.467   -11.645 1.00 2.17  ? 568 ILE B N   1 
ATOM   8826  C  CA  . ILE B 1 537 ? 69.093  7.537   -12.712 1.00 2.68  ? 568 ILE B CA  1 
ATOM   8827  C  C   . ILE B 1 537 ? 69.036  6.352   -13.657 1.00 3.54  ? 568 ILE B C   1 
ATOM   8828  O  O   . ILE B 1 537 ? 69.171  6.498   -14.874 1.00 2.00  ? 568 ILE B O   1 
ATOM   8829  C  CB  . ILE B 1 537 ? 70.480  7.715   -12.125 1.00 2.00  ? 568 ILE B CB  1 
ATOM   8830  C  CG1 . ILE B 1 537 ? 70.815  9.202   -12.091 1.00 4.10  ? 568 ILE B CG1 1 
ATOM   8831  C  CG2 . ILE B 1 537 ? 71.502  6.994   -12.948 1.00 4.22  ? 568 ILE B CG2 1 
ATOM   8832  C  CD1 . ILE B 1 537 ? 70.054  9.995   -11.068 1.00 6.40  ? 568 ILE B CD1 1 
ATOM   8833  N  N   . CYS B 1 538 ? 68.827  5.178   -13.071 1.00 5.76  ? 569 CYS B N   1 
ATOM   8834  C  CA  . CYS B 1 538 ? 68.730  3.937   -13.822 1.00 6.93  ? 569 CYS B CA  1 
ATOM   8835  C  C   . CYS B 1 538 ? 67.702  4.031   -14.941 1.00 5.22  ? 569 CYS B C   1 
ATOM   8836  O  O   . CYS B 1 538 ? 68.019  3.891   -16.121 1.00 3.19  ? 569 CYS B O   1 
ATOM   8837  C  CB  . CYS B 1 538 ? 68.342  2.790   -12.884 1.00 9.45  ? 569 CYS B CB  1 
ATOM   8838  S  SG  . CYS B 1 538 ? 69.327  1.262   -13.138 1.00 19.82 ? 569 CYS B SG  1 
ATOM   8839  N  N   . ASN B 1 539 ? 66.472  4.326   -14.540 1.00 6.66  ? 570 ASN B N   1 
ATOM   8840  C  CA  . ASN B 1 539 ? 65.334  4.437   -15.442 1.00 4.47  ? 570 ASN B CA  1 
ATOM   8841  C  C   . ASN B 1 539 ? 65.417  5.617   -16.377 1.00 6.85  ? 570 ASN B C   1 
ATOM   8842  O  O   . ASN B 1 539 ? 64.853  5.561   -17.475 1.00 9.55  ? 570 ASN B O   1 
ATOM   8843  C  CB  . ASN B 1 539 ? 64.047  4.590   -14.656 1.00 2.00  ? 570 ASN B CB  1 
ATOM   8844  C  CG  . ASN B 1 539 ? 63.763  3.433   -13.783 1.00 5.25  ? 570 ASN B CG  1 
ATOM   8845  O  OD1 . ASN B 1 539 ? 63.724  2.298   -14.247 1.00 8.38  ? 570 ASN B OD1 1 
ATOM   8846  N  ND2 . ASN B 1 539 ? 63.551  3.696   -12.493 1.00 7.30  ? 570 ASN B ND2 1 
ATOM   8847  N  N   . ASN B 1 540 ? 66.089  6.694   -15.953 1.00 6.82  ? 571 ASN B N   1 
ATOM   8848  C  CA  . ASN B 1 540 ? 66.155  7.873   -16.787 1.00 4.27  ? 571 ASN B CA  1 
ATOM   8849  C  C   . ASN B 1 540 ? 67.435  8.210   -17.473 1.00 4.39  ? 571 ASN B C   1 
ATOM   8850  O  O   . ASN B 1 540 ? 67.429  8.938   -18.466 1.00 2.42  ? 571 ASN B O   1 
ATOM   8851  C  CB  . ASN B 1 540 ? 65.617  9.021   -16.010 1.00 2.18  ? 571 ASN B CB  1 
ATOM   8852  C  CG  . ASN B 1 540 ? 64.261  8.725   -15.531 1.00 2.00  ? 571 ASN B CG  1 
ATOM   8853  O  OD1 . ASN B 1 540 ? 63.361  8.501   -16.330 1.00 2.00  ? 571 ASN B OD1 1 
ATOM   8854  N  ND2 . ASN B 1 540 ? 64.115  8.581   -14.230 1.00 2.90  ? 571 ASN B ND2 1 
ATOM   8855  N  N   . VAL B 1 541 ? 68.527  7.604   -17.026 1.00 8.26  ? 572 VAL B N   1 
ATOM   8856  C  CA  . VAL B 1 541 ? 69.809  7.892   -17.653 1.00 9.23  ? 572 VAL B CA  1 
ATOM   8857  C  C   . VAL B 1 541 ? 70.268  6.781   -18.591 1.00 8.87  ? 572 VAL B C   1 
ATOM   8858  O  O   . VAL B 1 541 ? 70.199  5.608   -18.257 1.00 7.11  ? 572 VAL B O   1 
ATOM   8859  C  CB  . VAL B 1 541 ? 70.875  8.238   -16.627 1.00 11.04 ? 572 VAL B CB  1 
ATOM   8860  C  CG1 . VAL B 1 541 ? 72.049  8.856   -17.341 1.00 12.93 ? 572 VAL B CG1 1 
ATOM   8861  C  CG2 . VAL B 1 541 ? 70.317  9.219   -15.592 1.00 10.71 ? 572 VAL B CG2 1 
ATOM   8862  N  N   . LYS B 1 542 ? 70.757  7.186   -19.755 1.00 11.06 ? 573 LYS B N   1 
ATOM   8863  C  CA  . LYS B 1 542 ? 71.210  6.290   -20.818 1.00 13.41 ? 573 LYS B CA  1 
ATOM   8864  C  C   . LYS B 1 542 ? 71.673  4.848   -20.594 1.00 14.12 ? 573 LYS B C   1 
ATOM   8865  O  O   . LYS B 1 542 ? 71.442  4.036   -21.481 1.00 18.02 ? 573 LYS B O   1 
ATOM   8866  C  CB  . LYS B 1 542 ? 72.246  6.990   -21.689 1.00 17.08 ? 573 LYS B CB  1 
ATOM   8867  C  CG  . LYS B 1 542 ? 72.583  6.235   -22.957 1.00 17.37 ? 573 LYS B CG  1 
ATOM   8868  C  CD  . LYS B 1 542 ? 71.319  5.860   -23.704 1.00 19.45 ? 573 LYS B CD  1 
ATOM   8869  C  CE  . LYS B 1 542 ? 71.632  5.462   -25.131 1.00 25.33 ? 573 LYS B CE  1 
ATOM   8870  N  NZ  . LYS B 1 542 ? 72.241  6.593   -25.933 1.00 28.60 ? 573 LYS B NZ  1 
ATOM   8871  N  N   . GLY B 1 543 ? 72.376  4.508   -19.510 1.00 11.21 ? 574 GLY B N   1 
ATOM   8872  C  CA  . GLY B 1 543 ? 72.772  3.116   -19.361 1.00 8.78  ? 574 GLY B CA  1 
ATOM   8873  C  C   . GLY B 1 543 ? 72.868  2.685   -17.927 1.00 10.47 ? 574 GLY B C   1 
ATOM   8874  O  O   . GLY B 1 543 ? 73.887  2.173   -17.515 1.00 16.19 ? 574 GLY B O   1 
ATOM   8875  N  N   . CYS B 1 544 ? 71.801  2.856   -17.168 1.00 9.29  ? 575 CYS B N   1 
ATOM   8876  C  CA  . CYS B 1 544 ? 71.787  2.529   -15.747 1.00 8.13  ? 575 CYS B CA  1 
ATOM   8877  C  C   . CYS B 1 544 ? 73.112  2.757   -15.007 1.00 8.11  ? 575 CYS B C   1 
ATOM   8878  O  O   . CYS B 1 544 ? 73.647  1.849   -14.338 1.00 10.48 ? 575 CYS B O   1 
ATOM   8879  C  CB  . CYS B 1 544 ? 71.237  1.138   -15.491 1.00 8.05  ? 575 CYS B CB  1 
ATOM   8880  S  SG  . CYS B 1 544 ? 69.439  1.078   -15.159 1.00 17.13 ? 575 CYS B SG  1 
ATOM   8881  N  N   . PRO B 1 545 ? 73.674  3.970   -15.147 1.00 2.00  ? 576 PRO B N   1 
ATOM   8882  C  CA  . PRO B 1 545 ? 74.918  4.329   -14.498 1.00 3.20  ? 576 PRO B CA  1 
ATOM   8883  C  C   . PRO B 1 545 ? 74.777  4.141   -13.005 1.00 4.00  ? 576 PRO B C   1 
ATOM   8884  O  O   . PRO B 1 545 ? 73.754  4.504   -12.434 1.00 3.80  ? 576 PRO B O   1 
ATOM   8885  C  CB  . PRO B 1 545 ? 75.017  5.812   -14.803 1.00 2.61  ? 576 PRO B CB  1 
ATOM   8886  C  CG  . PRO B 1 545 ? 74.418  5.908   -16.102 1.00 2.00  ? 576 PRO B CG  1 
ATOM   8887  C  CD  . PRO B 1 545 ? 73.198  5.096   -15.951 1.00 2.00  ? 576 PRO B CD  1 
ATOM   8888  N  N   . PHE B 1 546 ? 75.771  3.537   -12.371 1.00 4.96  ? 577 PHE B N   1 
ATOM   8889  C  CA  . PHE B 1 546 ? 75.698  3.371   -10.936 1.00 6.06  ? 577 PHE B CA  1 
ATOM   8890  C  C   . PHE B 1 546 ? 75.840  4.770   -10.339 1.00 3.79  ? 577 PHE B C   1 
ATOM   8891  O  O   . PHE B 1 546 ? 76.520  5.613   -10.904 1.00 5.07  ? 577 PHE B O   1 
ATOM   8892  C  CB  . PHE B 1 546 ? 76.820  2.465   -10.427 1.00 9.33  ? 577 PHE B CB  1 
ATOM   8893  C  CG  . PHE B 1 546 ? 77.214  2.763   -9.021  1.00 12.55 ? 577 PHE B CG  1 
ATOM   8894  C  CD1 . PHE B 1 546 ? 76.474  2.244   -7.966  1.00 14.22 ? 577 PHE B CD1 1 
ATOM   8895  C  CD2 . PHE B 1 546 ? 78.266  3.644   -8.756  1.00 13.84 ? 577 PHE B CD2 1 
ATOM   8896  C  CE1 . PHE B 1 546 ? 76.757  2.598   -6.659  1.00 16.61 ? 577 PHE B CE1 1 
ATOM   8897  C  CE2 . PHE B 1 546 ? 78.569  4.010   -7.467  1.00 17.54 ? 577 PHE B CE2 1 
ATOM   8898  C  CZ  . PHE B 1 546 ? 77.808  3.487   -6.399  1.00 19.70 ? 577 PHE B CZ  1 
ATOM   8899  N  N   . THR B 1 547 ? 75.200  5.022   -9.215  1.00 2.00  ? 578 THR B N   1 
ATOM   8900  C  CA  . THR B 1 547 ? 75.301  6.324   -8.609  1.00 2.59  ? 578 THR B CA  1 
ATOM   8901  C  C   . THR B 1 547 ? 75.136  6.187   -7.140  1.00 3.25  ? 578 THR B C   1 
ATOM   8902  O  O   . THR B 1 547 ? 74.870  5.107   -6.617  1.00 3.28  ? 578 THR B O   1 
ATOM   8903  C  CB  . THR B 1 547 ? 74.187  7.237   -9.039  1.00 2.23  ? 578 THR B CB  1 
ATOM   8904  O  OG1 . THR B 1 547 ? 73.451  6.614   -10.083 1.00 9.23  ? 578 THR B OG1 1 
ATOM   8905  C  CG2 . THR B 1 547 ? 74.724  8.514   -9.555  1.00 2.00  ? 578 THR B CG2 1 
ATOM   8906  N  N   . SER B 1 548 ? 75.302  7.313   -6.476  1.00 3.44  ? 579 SER B N   1 
ATOM   8907  C  CA  . SER B 1 548 ? 75.156  7.390   -5.051  1.00 6.16  ? 579 SER B CA  1 
ATOM   8908  C  C   . SER B 1 548 ? 75.578  8.764   -4.646  1.00 9.66  ? 579 SER B C   1 
ATOM   8909  O  O   . SER B 1 548 ? 76.116  9.515   -5.454  1.00 8.33  ? 579 SER B O   1 
ATOM   8910  C  CB  . SER B 1 548 ? 76.029  6.399   -4.329  1.00 3.88  ? 579 SER B CB  1 
ATOM   8911  O  OG  . SER B 1 548 ? 75.746  6.508   -2.947  1.00 10.93 ? 579 SER B OG  1 
ATOM   8912  N  N   . PHE B 1 549 ? 75.292  9.099   -3.395  1.00 14.46 ? 580 PHE B N   1 
ATOM   8913  C  CA  . PHE B 1 549 ? 75.642  10.402  -2.849  1.00 17.83 ? 580 PHE B CA  1 
ATOM   8914  C  C   . PHE B 1 549 ? 77.023  10.298  -2.187  1.00 18.03 ? 580 PHE B C   1 
ATOM   8915  O  O   . PHE B 1 549 ? 77.440  11.166  -1.395  1.00 17.28 ? 580 PHE B O   1 
ATOM   8916  C  CB  . PHE B 1 549 ? 74.531  10.903  -1.896  1.00 17.34 ? 580 PHE B CB  1 
ATOM   8917  C  CG  . PHE B 1 549 ? 73.177  11.106  -2.592  1.00 18.86 ? 580 PHE B CG  1 
ATOM   8918  C  CD1 . PHE B 1 549 ? 73.091  11.771  -3.847  1.00 17.13 ? 580 PHE B CD1 1 
ATOM   8919  C  CD2 . PHE B 1 549 ? 71.993  10.621  -2.011  1.00 16.16 ? 580 PHE B CD2 1 
ATOM   8920  C  CE1 . PHE B 1 549 ? 71.854  11.939  -4.491  1.00 12.44 ? 580 PHE B CE1 1 
ATOM   8921  C  CE2 . PHE B 1 549 ? 70.760  10.786  -2.650  1.00 12.67 ? 580 PHE B CE2 1 
ATOM   8922  C  CZ  . PHE B 1 549 ? 70.692  11.443  -3.887  1.00 11.51 ? 580 PHE B CZ  1 
ATOM   8923  N  N   . ASN B 1 550 ? 77.729  9.223   -2.543  1.00 18.51 ? 581 ASN B N   1 
ATOM   8924  C  CA  . ASN B 1 550 ? 79.069  8.987   -2.049  1.00 18.85 ? 581 ASN B CA  1 
ATOM   8925  C  C   . ASN B 1 550 ? 80.105  8.641   -3.111  1.00 17.97 ? 581 ASN B C   1 
ATOM   8926  O  O   . ASN B 1 550 ? 79.927  7.726   -3.938  1.00 17.46 ? 581 ASN B O   1 
ATOM   8927  C  CB  . ASN B 1 550 ? 79.122  7.898   -0.992  1.00 20.17 ? 581 ASN B CB  1 
ATOM   8928  C  CG  . ASN B 1 550 ? 80.429  7.948   -0.214  1.00 24.15 ? 581 ASN B CG  1 
ATOM   8929  O  OD1 . ASN B 1 550 ? 80.554  8.771   0.697   1.00 25.02 ? 581 ASN B OD1 1 
ATOM   8930  N  ND2 . ASN B 1 550 ? 81.438  7.146   -0.617  1.00 24.68 ? 581 ASN B ND2 1 
ATOM   8931  N  N   . VAL B 1 551 ? 81.194  9.390   -3.081  1.00 17.95 ? 582 VAL B N   1 
ATOM   8932  C  CA  . VAL B 1 551 ? 82.296  9.154   -3.986  1.00 15.36 ? 582 VAL B CA  1 
ATOM   8933  C  C   . VAL B 1 551 ? 82.892  7.879   -3.394  1.00 14.84 ? 582 VAL B C   1 
ATOM   8934  O  O   . VAL B 1 551 ? 83.591  7.906   -2.372  1.00 11.63 ? 582 VAL B O   1 
ATOM   8935  C  CB  . VAL B 1 551 ? 83.286  10.346  -3.993  1.00 14.94 ? 582 VAL B CB  1 
ATOM   8936  C  CG1 . VAL B 1 551 ? 83.840  10.626  -2.576  1.00 11.55 ? 582 VAL B CG1 1 
ATOM   8937  C  CG2 . VAL B 1 551 ? 84.381  10.100  -5.034  1.00 12.86 ? 582 VAL B CG2 1 
ATOM   8938  N  N   . GLN B 1 552 ? 82.339  6.780   -3.899  1.00 16.30 ? 583 GLN B N   1 
ATOM   8939  C  CA  . GLN B 1 552 ? 82.660  5.406   -3.519  1.00 19.05 ? 583 GLN B CA  1 
ATOM   8940  C  C   . GLN B 1 552 ? 83.696  5.220   -2.414  1.00 20.13 ? 583 GLN B C   1 
ATOM   8941  O  O   . GLN B 1 552 ? 84.904  5.227   -2.751  1.00 23.31 ? 583 GLN B O   1 
ATOM   8942  C  CB  . GLN B 1 552 ? 82.995  4.574   -4.763  1.00 19.66 ? 583 GLN B CB  1 
ATOM   8943  C  CG  . GLN B 1 552 ? 83.847  5.298   -5.823  1.00 26.52 ? 583 GLN B CG  1 
ATOM   8944  C  CD  . GLN B 1 552 ? 83.075  6.326   -6.637  1.00 29.35 ? 583 GLN B CD  1 
ATOM   8945  O  OE1 . GLN B 1 552 ? 83.348  7.525   -6.543  1.00 33.71 ? 583 GLN B OE1 1 
ATOM   8946  N  NE2 . GLN B 1 552 ? 82.114  5.865   -7.450  1.00 28.37 ? 583 GLN B NE2 1 
ATOM   8947  N  N   . ALA C 1 1   ? 54.578  58.442  40.720  1.00 22.79 ? 33  ALA C N   1 
ATOM   8948  C  CA  . ALA C 1 1   ? 54.128  59.722  40.087  1.00 21.51 ? 33  ALA C CA  1 
ATOM   8949  C  C   . ALA C 1 1   ? 53.214  60.397  41.094  1.00 20.54 ? 33  ALA C C   1 
ATOM   8950  O  O   . ALA C 1 1   ? 53.188  61.618  41.198  1.00 20.91 ? 33  ALA C O   1 
ATOM   8951  C  CB  . ALA C 1 1   ? 53.388  59.456  38.771  1.00 18.39 ? 33  ALA C CB  1 
ATOM   8952  N  N   . ASN C 1 2   ? 52.517  59.568  41.869  1.00 18.11 ? 34  ASN C N   1 
ATOM   8953  C  CA  . ASN C 1 2   ? 51.611  60.031  42.906  1.00 17.05 ? 34  ASN C CA  1 
ATOM   8954  C  C   . ASN C 1 2   ? 52.373  60.990  43.825  1.00 15.00 ? 34  ASN C C   1 
ATOM   8955  O  O   . ASN C 1 2   ? 53.415  60.643  44.369  1.00 10.89 ? 34  ASN C O   1 
ATOM   8956  C  CB  . ASN C 1 2   ? 51.023  58.810  43.652  1.00 16.50 ? 34  ASN C CB  1 
ATOM   8957  C  CG  . ASN C 1 2   ? 50.609  59.114  45.083  1.00 17.28 ? 34  ASN C CG  1 
ATOM   8958  O  OD1 . ASN C 1 2   ? 50.276  60.254  45.452  1.00 14.06 ? 34  ASN C OD1 1 
ATOM   8959  N  ND2 . ASN C 1 2   ? 50.639  58.078  45.910  1.00 19.63 ? 34  ASN C ND2 1 
ATOM   8960  N  N   . PRO C 1 3   ? 51.876  62.230  43.950  1.00 15.60 ? 35  PRO C N   1 
ATOM   8961  C  CA  . PRO C 1 3   ? 52.480  63.263  44.780  1.00 16.00 ? 35  PRO C CA  1 
ATOM   8962  C  C   . PRO C 1 3   ? 52.783  62.791  46.188  1.00 15.96 ? 35  PRO C C   1 
ATOM   8963  O  O   . PRO C 1 3   ? 53.725  63.280  46.842  1.00 16.27 ? 35  PRO C O   1 
ATOM   8964  C  CB  . PRO C 1 3   ? 51.426  64.385  44.746  1.00 17.08 ? 35  PRO C CB  1 
ATOM   8965  C  CG  . PRO C 1 3   ? 50.168  63.693  44.374  1.00 14.60 ? 35  PRO C CG  1 
ATOM   8966  C  CD  . PRO C 1 3   ? 50.635  62.742  43.339  1.00 15.35 ? 35  PRO C CD  1 
ATOM   8967  N  N   . CYS C 1 4   ? 51.974  61.859  46.674  1.00 13.73 ? 36  CYS C N   1 
ATOM   8968  C  CA  . CYS C 1 4   ? 52.216  61.333  48.002  1.00 13.81 ? 36  CYS C CA  1 
ATOM   8969  C  C   . CYS C 1 4   ? 53.477  60.463  48.079  1.00 12.58 ? 36  CYS C C   1 
ATOM   8970  O  O   . CYS C 1 4   ? 54.034  60.275  49.170  1.00 12.65 ? 36  CYS C O   1 
ATOM   8971  C  CB  . CYS C 1 4   ? 50.995  60.609  48.523  1.00 12.82 ? 36  CYS C CB  1 
ATOM   8972  S  SG  . CYS C 1 4   ? 49.708  61.799  48.953  1.00 12.03 ? 36  CYS C SG  1 
ATOM   8973  N  N   . CYS C 1 5   ? 53.953  60.007  46.917  1.00 8.51  ? 37  CYS C N   1 
ATOM   8974  C  CA  . CYS C 1 5   ? 55.158  59.188  46.800  1.00 6.57  ? 37  CYS C CA  1 
ATOM   8975  C  C   . CYS C 1 5   ? 56.284  59.572  47.764  1.00 7.41  ? 37  CYS C C   1 
ATOM   8976  O  O   . CYS C 1 5   ? 56.887  58.699  48.395  1.00 8.26  ? 37  CYS C O   1 
ATOM   8977  C  CB  . CYS C 1 5   ? 55.712  59.263  45.379  1.00 5.35  ? 37  CYS C CB  1 
ATOM   8978  S  SG  . CYS C 1 5   ? 55.000  58.094  44.156  1.00 6.90  ? 37  CYS C SG  1 
ATOM   8979  N  N   . SER C 1 6   ? 56.559  60.868  47.889  1.00 7.77  ? 38  SER C N   1 
ATOM   8980  C  CA  . SER C 1 6   ? 57.617  61.346  48.768  1.00 7.20  ? 38  SER C CA  1 
ATOM   8981  C  C   . SER C 1 6   ? 57.266  61.369  50.249  1.00 4.31  ? 38  SER C C   1 
ATOM   8982  O  O   . SER C 1 6   ? 57.950  62.026  51.013  1.00 2.41  ? 38  SER C O   1 
ATOM   8983  C  CB  . SER C 1 6   ? 58.081  62.740  48.352  1.00 12.07 ? 38  SER C CB  1 
ATOM   8984  O  OG  . SER C 1 6   ? 57.180  63.743  48.802  1.00 20.37 ? 38  SER C OG  1 
ATOM   8985  N  N   . ASN C 1 7   ? 56.183  60.708  50.644  1.00 2.00  ? 39  ASN C N   1 
ATOM   8986  C  CA  . ASN C 1 7   ? 55.784  60.652  52.049  1.00 4.09  ? 39  ASN C CA  1 
ATOM   8987  C  C   . ASN C 1 7   ? 55.811  62.015  52.749  1.00 6.63  ? 39  ASN C C   1 
ATOM   8988  O  O   . ASN C 1 7   ? 56.104  62.097  53.957  1.00 7.98  ? 39  ASN C O   1 
ATOM   8989  C  CB  . ASN C 1 7   ? 56.733  59.719  52.784  1.00 5.28  ? 39  ASN C CB  1 
ATOM   8990  C  CG  . ASN C 1 7   ? 56.607  58.278  52.334  1.00 9.91  ? 39  ASN C CG  1 
ATOM   8991  O  OD1 . ASN C 1 7   ? 56.510  57.371  53.165  1.00 13.55 ? 39  ASN C OD1 1 
ATOM   8992  N  ND2 . ASN C 1 7   ? 56.609  58.050  51.020  1.00 7.84  ? 39  ASN C ND2 1 
ATOM   8993  N  N   . PRO C 1 8   ? 55.360  63.074  52.050  1.00 6.17  ? 40  PRO C N   1 
ATOM   8994  C  CA  . PRO C 1 8   ? 55.363  64.426  52.602  1.00 5.56  ? 40  PRO C CA  1 
ATOM   8995  C  C   . PRO C 1 8   ? 54.765  64.632  53.992  1.00 7.68  ? 40  PRO C C   1 
ATOM   8996  O  O   . PRO C 1 8   ? 55.307  65.376  54.831  1.00 7.61  ? 40  PRO C O   1 
ATOM   8997  C  CB  . PRO C 1 8   ? 54.575  65.202  51.559  1.00 2.87  ? 40  PRO C CB  1 
ATOM   8998  C  CG  . PRO C 1 8   ? 54.690  64.376  50.315  1.00 2.00  ? 40  PRO C CG  1 
ATOM   8999  C  CD  . PRO C 1 8   ? 54.546  63.029  50.823  1.00 3.34  ? 40  PRO C CD  1 
ATOM   9000  N  N   . CYS C 1 9   ? 53.659  63.954  54.243  1.00 9.01  ? 41  CYS C N   1 
ATOM   9001  C  CA  . CYS C 1 9   ? 52.955  64.167  55.492  1.00 11.90 ? 41  CYS C CA  1 
ATOM   9002  C  C   . CYS C 1 9   ? 53.625  63.688  56.769  1.00 13.05 ? 41  CYS C C   1 
ATOM   9003  O  O   . CYS C 1 9   ? 53.591  62.511  57.133  1.00 15.08 ? 41  CYS C O   1 
ATOM   9004  C  CB  . CYS C 1 9   ? 51.481  63.748  55.344  1.00 9.72  ? 41  CYS C CB  1 
ATOM   9005  S  SG  . CYS C 1 9   ? 50.765  64.441  53.796  1.00 3.68  ? 41  CYS C SG  1 
ATOM   9006  N  N   . GLN C 1 10  ? 54.286  64.631  57.421  1.00 12.68 ? 42  GLN C N   1 
ATOM   9007  C  CA  . GLN C 1 10  ? 54.958  64.353  58.663  1.00 14.38 ? 42  GLN C CA  1 
ATOM   9008  C  C   . GLN C 1 10  ? 53.988  64.205  59.839  1.00 11.74 ? 42  GLN C C   1 
ATOM   9009  O  O   . GLN C 1 10  ? 52.784  64.245  59.673  1.00 10.83 ? 42  GLN C O   1 
ATOM   9010  C  CB  . GLN C 1 10  ? 55.993  65.440  58.934  1.00 15.29 ? 42  GLN C CB  1 
ATOM   9011  C  CG  . GLN C 1 10  ? 57.418  64.907  58.907  1.00 25.53 ? 42  GLN C CG  1 
ATOM   9012  C  CD  . GLN C 1 10  ? 57.808  64.318  57.550  1.00 30.90 ? 42  GLN C CD  1 
ATOM   9013  O  OE1 . GLN C 1 10  ? 58.220  65.047  56.646  1.00 35.80 ? 42  GLN C OE1 1 
ATOM   9014  N  NE2 . GLN C 1 10  ? 57.695  62.995  57.407  1.00 35.49 ? 42  GLN C NE2 1 
ATOM   9015  N  N   . ASN C 1 11  ? 54.535  63.907  61.004  1.00 11.63 ? 43  ASN C N   1 
ATOM   9016  C  CA  . ASN C 1 11  ? 53.774  63.771  62.223  1.00 11.78 ? 43  ASN C CA  1 
ATOM   9017  C  C   . ASN C 1 11  ? 52.531  62.874  62.286  1.00 13.31 ? 43  ASN C C   1 
ATOM   9018  O  O   . ASN C 1 11  ? 51.594  63.141  63.074  1.00 16.18 ? 43  ASN C O   1 
ATOM   9019  C  CB  . ASN C 1 11  ? 53.451  65.156  62.754  1.00 12.35 ? 43  ASN C CB  1 
ATOM   9020  C  CG  . ASN C 1 11  ? 54.552  65.700  63.606  1.00 13.04 ? 43  ASN C CG  1 
ATOM   9021  O  OD1 . ASN C 1 11  ? 55.149  64.978  64.423  1.00 11.91 ? 43  ASN C OD1 1 
ATOM   9022  N  ND2 . ASN C 1 11  ? 54.835  66.975  63.442  1.00 12.98 ? 43  ASN C ND2 1 
ATOM   9023  N  N   . ARG C 1 12  ? 52.516  61.799  61.502  1.00 10.89 ? 44  ARG C N   1 
ATOM   9024  C  CA  . ARG C 1 12  ? 51.377  60.880  61.524  1.00 7.05  ? 44  ARG C CA  1 
ATOM   9025  C  C   . ARG C 1 12  ? 50.116  61.404  60.817  1.00 5.61  ? 44  ARG C C   1 
ATOM   9026  O  O   . ARG C 1 12  ? 49.027  60.894  61.032  1.00 4.15  ? 44  ARG C O   1 
ATOM   9027  C  CB  . ARG C 1 12  ? 51.065  60.497  62.974  1.00 5.55  ? 44  ARG C CB  1 
ATOM   9028  C  CG  . ARG C 1 12  ? 50.812  59.014  63.180  1.00 7.24  ? 44  ARG C CG  1 
ATOM   9029  C  CD  . ARG C 1 12  ? 51.337  58.555  64.550  1.00 10.47 ? 44  ARG C CD  1 
ATOM   9030  N  NE  . ARG C 1 12  ? 50.539  57.513  65.232  1.00 10.01 ? 44  ARG C NE  1 
ATOM   9031  C  CZ  . ARG C 1 12  ? 49.894  56.506  64.641  1.00 9.62  ? 44  ARG C CZ  1 
ATOM   9032  N  NH1 . ARG C 1 12  ? 49.913  56.361  63.310  1.00 5.82  ? 44  ARG C NH1 1 
ATOM   9033  N  NH2 . ARG C 1 12  ? 49.284  55.598  65.405  1.00 5.65  ? 44  ARG C NH2 1 
ATOM   9034  N  N   . GLY C 1 13  ? 50.269  62.452  60.011  1.00 6.72  ? 45  GLY C N   1 
ATOM   9035  C  CA  . GLY C 1 13  ? 49.156  63.001  59.257  1.00 5.97  ? 45  GLY C CA  1 
ATOM   9036  C  C   . GLY C 1 13  ? 48.958  62.087  58.064  1.00 6.26  ? 45  GLY C C   1 
ATOM   9037  O  O   . GLY C 1 13  ? 49.771  61.192  57.880  1.00 4.44  ? 45  GLY C O   1 
ATOM   9038  N  N   . GLU C 1 14  ? 47.897  62.279  57.275  1.00 8.16  ? 46  GLU C N   1 
ATOM   9039  C  CA  . GLU C 1 14  ? 47.643  61.415  56.113  1.00 10.43 ? 46  GLU C CA  1 
ATOM   9040  C  C   . GLU C 1 14  ? 47.733  62.097  54.761  1.00 8.19  ? 46  GLU C C   1 
ATOM   9041  O  O   . GLU C 1 14  ? 46.997  63.050  54.498  1.00 9.99  ? 46  GLU C O   1 
ATOM   9042  C  CB  . GLU C 1 14  ? 46.281  60.756  56.249  1.00 16.04 ? 46  GLU C CB  1 
ATOM   9043  C  CG  . GLU C 1 14  ? 46.096  60.037  57.580  1.00 25.89 ? 46  GLU C CG  1 
ATOM   9044  C  CD  . GLU C 1 14  ? 45.064  58.908  57.522  1.00 30.98 ? 46  GLU C CD  1 
ATOM   9045  O  OE1 . GLU C 1 14  ? 44.184  58.939  56.632  1.00 33.64 ? 46  GLU C OE1 1 
ATOM   9046  O  OE2 . GLU C 1 14  ? 45.142  57.972  58.362  1.00 34.02 ? 46  GLU C OE2 1 
ATOM   9047  N  N   . CYS C 1 15  ? 48.582  61.583  53.885  1.00 6.47  ? 47  CYS C N   1 
ATOM   9048  C  CA  . CYS C 1 15  ? 48.742  62.204  52.582  1.00 10.81 ? 47  CYS C CA  1 
ATOM   9049  C  C   . CYS C 1 15  ? 47.688  61.735  51.619  1.00 12.50 ? 47  CYS C C   1 
ATOM   9050  O  O   . CYS C 1 15  ? 47.444  60.538  51.520  1.00 15.05 ? 47  CYS C O   1 
ATOM   9051  C  CB  . CYS C 1 15  ? 50.122  61.908  51.984  1.00 12.45 ? 47  CYS C CB  1 
ATOM   9052  S  SG  . CYS C 1 15  ? 50.553  62.836  50.466  1.00 10.34 ? 47  CYS C SG  1 
ATOM   9053  N  N   . MET C 1 16  ? 47.092  62.672  50.888  1.00 12.57 ? 48  MET C N   1 
ATOM   9054  C  CA  . MET C 1 16  ? 46.076  62.328  49.920  1.00 14.37 ? 48  MET C CA  1 
ATOM   9055  C  C   . MET C 1 16  ? 46.381  63.092  48.654  1.00 12.54 ? 48  MET C C   1 
ATOM   9056  O  O   . MET C 1 16  ? 46.677  64.294  48.704  1.00 11.39 ? 48  MET C O   1 
ATOM   9057  C  CB  . MET C 1 16  ? 44.656  62.636  50.467  1.00 15.88 ? 48  MET C CB  1 
ATOM   9058  C  CG  . MET C 1 16  ? 44.010  63.944  50.031  1.00 17.88 ? 48  MET C CG  1 
ATOM   9059  S  SD  . MET C 1 16  ? 42.442  63.687  49.133  1.00 24.27 ? 48  MET C SD  1 
ATOM   9060  C  CE  . MET C 1 16  ? 41.541  62.809  50.373  1.00 17.27 ? 48  MET C CE  1 
ATOM   9061  N  N   . SER C 1 17  ? 46.396  62.369  47.537  1.00 11.10 ? 49  SER C N   1 
ATOM   9062  C  CA  . SER C 1 17  ? 46.647  62.981  46.234  1.00 11.67 ? 49  SER C CA  1 
ATOM   9063  C  C   . SER C 1 17  ? 45.489  63.910  45.898  1.00 9.57  ? 49  SER C C   1 
ATOM   9064  O  O   . SER C 1 17  ? 44.343  63.621  46.244  1.00 10.67 ? 49  SER C O   1 
ATOM   9065  C  CB  . SER C 1 17  ? 46.804  61.901  45.147  1.00 13.08 ? 49  SER C CB  1 
ATOM   9066  O  OG  . SER C 1 17  ? 45.852  60.857  45.290  1.00 15.21 ? 49  SER C OG  1 
ATOM   9067  N  N   . THR C 1 18  ? 45.767  65.044  45.273  1.00 8.53  ? 50  THR C N   1 
ATOM   9068  C  CA  . THR C 1 18  ? 44.676  65.945  44.933  1.00 7.91  ? 50  THR C CA  1 
ATOM   9069  C  C   . THR C 1 18  ? 44.793  66.534  43.543  1.00 7.02  ? 50  THR C C   1 
ATOM   9070  O  O   . THR C 1 18  ? 44.554  67.718  43.354  1.00 4.81  ? 50  THR C O   1 
ATOM   9071  C  CB  . THR C 1 18  ? 44.454  67.070  46.007  1.00 8.90  ? 50  THR C CB  1 
ATOM   9072  O  OG1 . THR C 1 18  ? 45.607  67.924  46.088  1.00 11.16 ? 50  THR C OG1 1 
ATOM   9073  C  CG2 . THR C 1 18  ? 44.209  66.461  47.392  1.00 10.08 ? 50  THR C CG2 1 
ATOM   9074  N  N   . GLY C 1 19  ? 45.191  65.713  42.575  1.00 7.16  ? 51  GLY C N   1 
ATOM   9075  C  CA  . GLY C 1 19  ? 45.278  66.196  41.212  1.00 10.93 ? 51  GLY C CA  1 
ATOM   9076  C  C   . GLY C 1 19  ? 46.587  65.955  40.482  1.00 14.86 ? 51  GLY C C   1 
ATOM   9077  O  O   . GLY C 1 19  ? 47.200  66.895  39.959  1.00 18.72 ? 51  GLY C O   1 
ATOM   9078  N  N   . PHE C 1 20  ? 47.057  64.716  40.483  1.00 16.30 ? 52  PHE C N   1 
ATOM   9079  C  CA  . PHE C 1 20  ? 48.286  64.350  39.768  1.00 18.60 ? 52  PHE C CA  1 
ATOM   9080  C  C   . PHE C 1 20  ? 49.636  64.807  40.368  1.00 21.75 ? 52  PHE C C   1 
ATOM   9081  O  O   . PHE C 1 20  ? 50.525  63.974  40.612  1.00 21.56 ? 52  PHE C O   1 
ATOM   9082  C  CB  . PHE C 1 20  ? 48.219  64.856  38.338  1.00 13.34 ? 52  PHE C CB  1 
ATOM   9083  C  CG  . PHE C 1 20  ? 47.093  64.304  37.547  1.00 8.97  ? 52  PHE C CG  1 
ATOM   9084  C  CD1 . PHE C 1 20  ? 47.095  62.958  37.162  1.00 7.17  ? 52  PHE C CD1 1 
ATOM   9085  C  CD2 . PHE C 1 20  ? 46.113  65.164  37.046  1.00 8.10  ? 52  PHE C CD2 1 
ATOM   9086  C  CE1 . PHE C 1 20  ? 46.136  62.463  36.260  1.00 7.46  ? 52  PHE C CE1 1 
ATOM   9087  C  CE2 . PHE C 1 20  ? 45.151  64.702  36.152  1.00 10.85 ? 52  PHE C CE2 1 
ATOM   9088  C  CZ  . PHE C 1 20  ? 45.157  63.339  35.745  1.00 10.19 ? 52  PHE C CZ  1 
ATOM   9089  N  N   . ASP C 1 21  ? 49.809  66.125  40.521  1.00 23.85 ? 53  ASP C N   1 
ATOM   9090  C  CA  . ASP C 1 21  ? 51.042  66.670  41.070  1.00 21.95 ? 53  ASP C CA  1 
ATOM   9091  C  C   . ASP C 1 21  ? 50.922  67.188  42.469  1.00 18.26 ? 53  ASP C C   1 
ATOM   9092  O  O   . ASP C 1 21  ? 51.892  67.188  43.197  1.00 17.81 ? 53  ASP C O   1 
ATOM   9093  C  CB  . ASP C 1 21  ? 51.570  67.765  40.178  1.00 28.06 ? 53  ASP C CB  1 
ATOM   9094  C  CG  . ASP C 1 21  ? 51.844  67.269  38.797  1.00 35.78 ? 53  ASP C CG  1 
ATOM   9095  O  OD1 . ASP C 1 21  ? 52.181  66.053  38.708  1.00 35.64 ? 53  ASP C OD1 1 
ATOM   9096  O  OD2 . ASP C 1 21  ? 51.707  68.077  37.825  1.00 41.73 ? 53  ASP C OD2 1 
ATOM   9097  N  N   . GLN C 1 22  ? 49.735  67.602  42.868  1.00 15.48 ? 54  GLN C N   1 
ATOM   9098  C  CA  . GLN C 1 22  ? 49.563  68.126  44.207  1.00 15.49 ? 54  GLN C CA  1 
ATOM   9099  C  C   . GLN C 1 22  ? 49.045  67.029  45.116  1.00 13.20 ? 54  GLN C C   1 
ATOM   9100  O  O   . GLN C 1 22  ? 48.436  66.076  44.626  1.00 10.60 ? 54  GLN C O   1 
ATOM   9101  C  CB  . GLN C 1 22  ? 48.585  69.290  44.189  1.00 20.92 ? 54  GLN C CB  1 
ATOM   9102  C  CG  . GLN C 1 22  ? 48.925  70.398  43.159  1.00 32.84 ? 54  GLN C CG  1 
ATOM   9103  C  CD  . GLN C 1 22  ? 48.722  69.981  41.667  1.00 38.60 ? 54  GLN C CD  1 
ATOM   9104  O  OE1 . GLN C 1 22  ? 49.614  69.386  41.036  1.00 37.20 ? 54  GLN C OE1 1 
ATOM   9105  N  NE2 . GLN C 1 22  ? 47.550  70.308  41.109  1.00 40.84 ? 54  GLN C NE2 1 
ATOM   9106  N  N   . TYR C 1 23  ? 49.319  67.157  46.419  1.00 10.78 ? 55  TYR C N   1 
ATOM   9107  C  CA  . TYR C 1 23  ? 48.900  66.208  47.464  1.00 8.94  ? 55  TYR C CA  1 
ATOM   9108  C  C   . TYR C 1 23  ? 48.332  67.051  48.627  1.00 7.71  ? 55  TYR C C   1 
ATOM   9109  O  O   . TYR C 1 23  ? 48.471  68.279  48.602  1.00 8.21  ? 55  TYR C O   1 
ATOM   9110  C  CB  . TYR C 1 23  ? 50.086  65.344  47.949  1.00 8.47  ? 55  TYR C CB  1 
ATOM   9111  C  CG  . TYR C 1 23  ? 51.080  66.095  48.805  1.00 8.69  ? 55  TYR C CG  1 
ATOM   9112  C  CD1 . TYR C 1 23  ? 52.117  66.811  48.216  1.00 10.01 ? 55  TYR C CD1 1 
ATOM   9113  C  CD2 . TYR C 1 23  ? 50.936  66.160  50.199  1.00 7.74  ? 55  TYR C CD2 1 
ATOM   9114  C  CE1 . TYR C 1 23  ? 52.985  67.579  48.980  1.00 11.70 ? 55  TYR C CE1 1 
ATOM   9115  C  CE2 . TYR C 1 23  ? 51.791  66.930  50.975  1.00 8.63  ? 55  TYR C CE2 1 
ATOM   9116  C  CZ  . TYR C 1 23  ? 52.822  67.641  50.356  1.00 10.99 ? 55  TYR C CZ  1 
ATOM   9117  O  OH  . TYR C 1 23  ? 53.711  68.406  51.087  1.00 10.01 ? 55  TYR C OH  1 
ATOM   9118  N  N   . LYS C 1 24  ? 47.795  66.406  49.670  1.00 4.45  ? 56  LYS C N   1 
ATOM   9119  C  CA  . LYS C 1 24  ? 47.182  67.105  50.804  1.00 3.17  ? 56  LYS C CA  1 
ATOM   9120  C  C   . LYS C 1 24  ? 47.366  66.275  52.097  1.00 3.10  ? 56  LYS C C   1 
ATOM   9121  O  O   . LYS C 1 24  ? 47.229  65.065  52.055  1.00 2.01  ? 56  LYS C O   1 
ATOM   9122  C  CB  . LYS C 1 24  ? 45.692  67.256  50.481  1.00 2.01  ? 56  LYS C CB  1 
ATOM   9123  C  CG  . LYS C 1 24  ? 45.026  68.521  50.946  1.00 2.12  ? 56  LYS C CG  1 
ATOM   9124  C  CD  . LYS C 1 24  ? 44.887  68.614  52.492  1.00 8.14  ? 56  LYS C CD  1 
ATOM   9125  C  CE  . LYS C 1 24  ? 44.085  69.880  52.924  1.00 15.14 ? 56  LYS C CE  1 
ATOM   9126  N  NZ  . LYS C 1 24  ? 44.433  71.175  52.180  1.00 16.36 ? 56  LYS C NZ  1 
ATOM   9127  N  N   . CYS C 1 25  ? 47.606  66.914  53.244  1.00 5.62  ? 57  CYS C N   1 
ATOM   9128  C  CA  . CYS C 1 25  ? 47.821  66.178  54.507  1.00 5.92  ? 57  CYS C CA  1 
ATOM   9129  C  C   . CYS C 1 25  ? 46.732  66.215  55.575  1.00 6.26  ? 57  CYS C C   1 
ATOM   9130  O  O   . CYS C 1 25  ? 46.425  67.274  56.113  1.00 12.54 ? 57  CYS C O   1 
ATOM   9131  C  CB  . CYS C 1 25  ? 49.120  66.632  55.190  1.00 7.47  ? 57  CYS C CB  1 
ATOM   9132  S  SG  . CYS C 1 25  ? 50.628  66.431  54.200  1.00 11.26 ? 57  CYS C SG  1 
ATOM   9133  N  N   . ASP C 1 26  ? 46.254  65.060  56.014  1.00 3.93  ? 58  ASP C N   1 
ATOM   9134  C  CA  . ASP C 1 26  ? 45.230  65.044  57.046  1.00 4.90  ? 58  ASP C CA  1 
ATOM   9135  C  C   . ASP C 1 26  ? 45.852  65.150  58.424  1.00 2.19  ? 58  ASP C C   1 
ATOM   9136  O  O   . ASP C 1 26  ? 46.010  64.147  59.125  1.00 2.00  ? 58  ASP C O   1 
ATOM   9137  C  CB  . ASP C 1 26  ? 44.388  63.775  56.931  1.00 6.06  ? 58  ASP C CB  1 
ATOM   9138  C  CG  . ASP C 1 26  ? 42.948  63.968  57.409  1.00 2.34  ? 58  ASP C CG  1 
ATOM   9139  O  OD1 . ASP C 1 26  ? 42.579  65.108  57.715  1.00 3.19  ? 58  ASP C OD1 1 
ATOM   9140  O  OD2 . ASP C 1 26  ? 42.179  62.982  57.449  1.00 2.00  ? 58  ASP C OD2 1 
ATOM   9141  N  N   . CYS C 1 27  ? 46.159  66.373  58.835  1.00 2.00  ? 59  CYS C N   1 
ATOM   9142  C  CA  . CYS C 1 27  ? 46.792  66.568  60.143  1.00 8.77  ? 59  CYS C CA  1 
ATOM   9143  C  C   . CYS C 1 27  ? 45.843  66.405  61.322  1.00 9.04  ? 59  CYS C C   1 
ATOM   9144  O  O   . CYS C 1 27  ? 46.131  66.818  62.452  1.00 5.54  ? 59  CYS C O   1 
ATOM   9145  C  CB  . CYS C 1 27  ? 47.497  67.923  60.230  1.00 10.71 ? 59  CYS C CB  1 
ATOM   9146  S  SG  . CYS C 1 27  ? 48.573  68.383  58.821  1.00 11.84 ? 59  CYS C SG  1 
ATOM   9147  N  N   . THR C 1 28  ? 44.752  65.704  61.065  1.00 12.30 ? 60  THR C N   1 
ATOM   9148  C  CA  . THR C 1 28  ? 43.729  65.502  62.066  1.00 12.52 ? 60  THR C CA  1 
ATOM   9149  C  C   . THR C 1 28  ? 44.164  64.796  63.333  1.00 12.49 ? 60  THR C C   1 
ATOM   9150  O  O   . THR C 1 28  ? 44.701  63.698  63.288  1.00 11.52 ? 60  THR C O   1 
ATOM   9151  C  CB  . THR C 1 28  ? 42.590  64.732  61.481  1.00 12.95 ? 60  THR C CB  1 
ATOM   9152  O  OG1 . THR C 1 28  ? 42.414  65.122  60.113  1.00 4.94  ? 60  THR C OG1 1 
ATOM   9153  C  CG2 . THR C 1 28  ? 41.332  65.010  62.296  1.00 15.97 ? 60  THR C CG2 1 
ATOM   9154  N  N   . ARG C 1 29  ? 43.892  65.441  64.457  1.00 12.07 ? 61  ARG C N   1 
ATOM   9155  C  CA  . ARG C 1 29  ? 44.227  64.911  65.765  1.00 13.03 ? 61  ARG C CA  1 
ATOM   9156  C  C   . ARG C 1 29  ? 45.712  64.550  65.972  1.00 13.37 ? 61  ARG C C   1 
ATOM   9157  O  O   . ARG C 1 29  ? 46.051  63.846  66.924  1.00 12.37 ? 61  ARG C O   1 
ATOM   9158  C  CB  . ARG C 1 29  ? 43.295  63.739  66.075  1.00 11.67 ? 61  ARG C CB  1 
ATOM   9159  C  CG  . ARG C 1 29  ? 42.107  64.145  66.944  1.00 11.06 ? 61  ARG C CG  1 
ATOM   9160  C  CD  . ARG C 1 29  ? 40.918  63.183  66.860  1.00 11.50 ? 61  ARG C CD  1 
ATOM   9161  N  NE  . ARG C 1 29  ? 40.138  63.396  65.645  1.00 9.73  ? 61  ARG C NE  1 
ATOM   9162  C  CZ  . ARG C 1 29  ? 39.721  62.418  64.856  1.00 11.23 ? 61  ARG C CZ  1 
ATOM   9163  N  NH1 . ARG C 1 29  ? 40.017  61.161  65.177  1.00 11.49 ? 61  ARG C NH1 1 
ATOM   9164  N  NH2 . ARG C 1 29  ? 39.062  62.687  63.731  1.00 9.82  ? 61  ARG C NH2 1 
ATOM   9165  N  N   . THR C 1 30  ? 46.593  65.083  65.120  1.00 11.92 ? 62  THR C N   1 
ATOM   9166  C  CA  . THR C 1 30  ? 48.018  64.795  65.233  1.00 10.45 ? 62  THR C CA  1 
ATOM   9167  C  C   . THR C 1 30  ? 48.636  65.640  66.343  1.00 12.32 ? 62  THR C C   1 
ATOM   9168  O  O   . THR C 1 30  ? 49.413  65.149  67.177  1.00 13.26 ? 62  THR C O   1 
ATOM   9169  C  CB  . THR C 1 30  ? 48.797  65.062  63.891  1.00 10.61 ? 62  THR C CB  1 
ATOM   9170  O  OG1 . THR C 1 30  ? 48.830  66.466  63.588  1.00 11.18 ? 62  THR C OG1 1 
ATOM   9171  C  CG2 . THR C 1 30  ? 48.148  64.343  62.736  1.00 9.84  ? 62  THR C CG2 1 
ATOM   9172  N  N   . GLY C 1 31  ? 48.228  66.904  66.394  1.00 11.66 ? 63  GLY C N   1 
ATOM   9173  C  CA  . GLY C 1 31  ? 48.790  67.814  67.369  1.00 9.40  ? 63  GLY C CA  1 
ATOM   9174  C  C   . GLY C 1 31  ? 49.764  68.684  66.619  1.00 6.71  ? 63  GLY C C   1 
ATOM   9175  O  O   . GLY C 1 31  ? 50.636  69.291  67.218  1.00 6.11  ? 63  GLY C O   1 
ATOM   9176  N  N   . PHE C 1 32  ? 49.614  68.714  65.300  1.00 7.02  ? 64  PHE C N   1 
ATOM   9177  C  CA  . PHE C 1 32  ? 50.456  69.495  64.401  1.00 10.99 ? 64  PHE C CA  1 
ATOM   9178  C  C   . PHE C 1 32  ? 49.641  69.936  63.197  1.00 12.43 ? 64  PHE C C   1 
ATOM   9179  O  O   . PHE C 1 32  ? 48.846  69.151  62.677  1.00 12.80 ? 64  PHE C O   1 
ATOM   9180  C  CB  . PHE C 1 32  ? 51.618  68.650  63.852  1.00 11.58 ? 64  PHE C CB  1 
ATOM   9181  C  CG  . PHE C 1 32  ? 52.623  68.254  64.882  1.00 12.84 ? 64  PHE C CG  1 
ATOM   9182  C  CD1 . PHE C 1 32  ? 52.361  67.218  65.763  1.00 12.73 ? 64  PHE C CD1 1 
ATOM   9183  C  CD2 . PHE C 1 32  ? 53.815  68.944  65.009  1.00 14.95 ? 64  PHE C CD2 1 
ATOM   9184  C  CE1 . PHE C 1 32  ? 53.266  66.876  66.760  1.00 11.71 ? 64  PHE C CE1 1 
ATOM   9185  C  CE2 . PHE C 1 32  ? 54.726  68.603  66.006  1.00 16.95 ? 64  PHE C CE2 1 
ATOM   9186  C  CZ  . PHE C 1 32  ? 54.441  67.562  66.886  1.00 13.34 ? 64  PHE C CZ  1 
ATOM   9187  N  N   . TYR C 1 33  ? 49.893  71.154  62.717  1.00 13.76 ? 65  TYR C N   1 
ATOM   9188  C  CA  . TYR C 1 33  ? 49.216  71.682  61.537  1.00 11.51 ? 65  TYR C CA  1 
ATOM   9189  C  C   . TYR C 1 33  ? 50.202  72.094  60.481  1.00 11.99 ? 65  TYR C C   1 
ATOM   9190  O  O   . TYR C 1 33  ? 51.417  71.865  60.625  1.00 12.33 ? 65  TYR C O   1 
ATOM   9191  C  CB  . TYR C 1 33  ? 48.391  72.877  61.892  1.00 11.08 ? 65  TYR C CB  1 
ATOM   9192  C  CG  . TYR C 1 33  ? 49.141  73.889  62.676  1.00 9.34  ? 65  TYR C CG  1 
ATOM   9193  C  CD1 . TYR C 1 33  ? 49.206  73.793  64.061  1.00 11.52 ? 65  TYR C CD1 1 
ATOM   9194  C  CD2 . TYR C 1 33  ? 49.686  75.008  62.057  1.00 9.95  ? 65  TYR C CD2 1 
ATOM   9195  C  CE1 . TYR C 1 33  ? 49.777  74.793  64.819  1.00 14.06 ? 65  TYR C CE1 1 
ATOM   9196  C  CE2 . TYR C 1 33  ? 50.257  76.027  62.790  1.00 13.16 ? 65  TYR C CE2 1 
ATOM   9197  C  CZ  . TYR C 1 33  ? 50.298  75.910  64.185  1.00 14.60 ? 65  TYR C CZ  1 
ATOM   9198  O  OH  . TYR C 1 33  ? 50.850  76.892  64.976  1.00 15.98 ? 65  TYR C OH  1 
ATOM   9199  N  N   . GLY C 1 34  ? 49.685  72.715  59.424  1.00 13.05 ? 66  GLY C N   1 
ATOM   9200  C  CA  . GLY C 1 34  ? 50.556  73.166  58.347  1.00 16.76 ? 66  GLY C CA  1 
ATOM   9201  C  C   . GLY C 1 34  ? 50.715  72.130  57.250  1.00 15.39 ? 66  GLY C C   1 
ATOM   9202  O  O   . GLY C 1 34  ? 50.485  70.966  57.502  1.00 14.71 ? 66  GLY C O   1 
ATOM   9203  N  N   . GLU C 1 35  ? 51.204  72.546  56.080  1.00 15.30 ? 67  GLU C N   1 
ATOM   9204  C  CA  . GLU C 1 35  ? 51.341  71.676  54.913  1.00 13.59 ? 67  GLU C CA  1 
ATOM   9205  C  C   . GLU C 1 35  ? 51.773  70.250  55.126  1.00 11.82 ? 67  GLU C C   1 
ATOM   9206  O  O   . GLU C 1 35  ? 51.313  69.362  54.415  1.00 11.21 ? 67  GLU C O   1 
ATOM   9207  C  CB  . GLU C 1 35  ? 52.206  72.316  53.821  1.00 17.44 ? 67  GLU C CB  1 
ATOM   9208  C  CG  . GLU C 1 35  ? 52.233  71.494  52.512  1.00 23.09 ? 67  GLU C CG  1 
ATOM   9209  C  CD  . GLU C 1 35  ? 52.994  72.159  51.362  1.00 27.07 ? 67  GLU C CD  1 
ATOM   9210  O  OE1 . GLU C 1 35  ? 53.579  73.245  51.570  1.00 30.37 ? 67  GLU C OE1 1 
ATOM   9211  O  OE2 . GLU C 1 35  ? 53.003  71.587  50.246  1.00 25.62 ? 67  GLU C OE2 1 
ATOM   9212  N  N   . ASN C 1 36  ? 52.639  70.011  56.098  1.00 12.18 ? 68  ASN C N   1 
ATOM   9213  C  CA  . ASN C 1 36  ? 53.097  68.641  56.327  1.00 11.93 ? 68  ASN C CA  1 
ATOM   9214  C  C   . ASN C 1 36  ? 52.877  68.167  57.749  1.00 10.67 ? 68  ASN C C   1 
ATOM   9215  O  O   . ASN C 1 36  ? 53.563  67.264  58.215  1.00 9.95  ? 68  ASN C O   1 
ATOM   9216  C  CB  . ASN C 1 36  ? 54.572  68.483  55.950  1.00 13.16 ? 68  ASN C CB  1 
ATOM   9217  C  CG  . ASN C 1 36  ? 54.834  68.766  54.485  1.00 16.90 ? 68  ASN C CG  1 
ATOM   9218  O  OD1 . ASN C 1 36  ? 54.027  68.450  53.621  1.00 12.00 ? 68  ASN C OD1 1 
ATOM   9219  N  ND2 . ASN C 1 36  ? 55.971  69.391  54.215  1.00 21.94 ? 68  ASN C ND2 1 
ATOM   9220  N  N   . CYS C 1 37  ? 51.932  68.789  58.443  1.00 10.87 ? 69  CYS C N   1 
ATOM   9221  C  CA  . CYS C 1 37  ? 51.621  68.422  59.820  1.00 13.66 ? 69  CYS C CA  1 
ATOM   9222  C  C   . CYS C 1 37  ? 52.917  68.525  60.611  1.00 13.78 ? 69  CYS C C   1 
ATOM   9223  O  O   . CYS C 1 37  ? 53.223  67.734  61.504  1.00 11.74 ? 69  CYS C O   1 
ATOM   9224  C  CB  . CYS C 1 37  ? 51.030  67.012  59.828  1.00 16.24 ? 69  CYS C CB  1 
ATOM   9225  S  SG  . CYS C 1 37  ? 49.813  66.816  58.476  1.00 14.72 ? 69  CYS C SG  1 
ATOM   9226  N  N   . THR C 1 38  ? 53.642  69.577  60.261  1.00 18.03 ? 70  THR C N   1 
ATOM   9227  C  CA  . THR C 1 38  ? 54.948  69.932  60.811  1.00 18.32 ? 70  THR C CA  1 
ATOM   9228  C  C   . THR C 1 38  ? 54.926  70.844  62.049  1.00 17.69 ? 70  THR C C   1 
ATOM   9229  O  O   . THR C 1 38  ? 55.592  70.538  63.043  1.00 18.17 ? 70  THR C O   1 
ATOM   9230  C  CB  . THR C 1 38  ? 55.827  70.559  59.699  1.00 17.76 ? 70  THR C CB  1 
ATOM   9231  O  OG1 . THR C 1 38  ? 55.000  71.255  58.736  1.00 20.83 ? 70  THR C OG1 1 
ATOM   9232  C  CG2 . THR C 1 38  ? 56.593  69.471  58.988  1.00 19.94 ? 70  THR C CG2 1 
ATOM   9233  N  N   . THR C 1 39  ? 54.148  71.931  62.020  1.00 14.91 ? 71  THR C N   1 
ATOM   9234  C  CA  . THR C 1 39  ? 54.116  72.813  63.178  1.00 12.92 ? 71  THR C CA  1 
ATOM   9235  C  C   . THR C 1 39  ? 53.208  72.334  64.290  1.00 12.15 ? 71  THR C C   1 
ATOM   9236  O  O   . THR C 1 39  ? 52.042  72.077  64.086  1.00 11.98 ? 71  THR C O   1 
ATOM   9237  C  CB  . THR C 1 39  ? 53.836  74.287  62.815  1.00 12.99 ? 71  THR C CB  1 
ATOM   9238  O  OG1 . THR C 1 39  ? 52.968  74.875  63.800  1.00 10.55 ? 71  THR C OG1 1 
ATOM   9239  C  CG2 . THR C 1 39  ? 53.302  74.429  61.369  1.00 11.15 ? 71  THR C CG2 1 
ATOM   9240  N  N   . PRO C 1 40  ? 53.751  72.210  65.497  1.00 14.05 ? 72  PRO C N   1 
ATOM   9241  C  CA  . PRO C 1 40  ? 52.998  71.751  66.661  1.00 16.17 ? 72  PRO C CA  1 
ATOM   9242  C  C   . PRO C 1 40  ? 52.015  72.715  67.237  1.00 16.74 ? 72  PRO C C   1 
ATOM   9243  O  O   . PRO C 1 40  ? 52.193  73.926  67.156  1.00 17.16 ? 72  PRO C O   1 
ATOM   9244  C  CB  . PRO C 1 40  ? 54.096  71.482  67.696  1.00 17.67 ? 72  PRO C CB  1 
ATOM   9245  C  CG  . PRO C 1 40  ? 55.106  72.509  67.385  1.00 18.39 ? 72  PRO C CG  1 
ATOM   9246  C  CD  . PRO C 1 40  ? 55.161  72.452  65.854  1.00 16.94 ? 72  PRO C CD  1 
ATOM   9247  N  N   . GLU C 1 41  ? 50.994  72.142  67.861  1.00 19.66 ? 73  GLU C N   1 
ATOM   9248  C  CA  . GLU C 1 41  ? 49.965  72.894  68.563  1.00 21.56 ? 73  GLU C CA  1 
ATOM   9249  C  C   . GLU C 1 41  ? 50.697  73.273  69.835  1.00 20.26 ? 73  GLU C C   1 
ATOM   9250  O  O   . GLU C 1 41  ? 51.519  72.515  70.337  1.00 19.47 ? 73  GLU C O   1 
ATOM   9251  C  CB  . GLU C 1 41  ? 48.769  72.001  68.898  1.00 24.59 ? 73  GLU C CB  1 
ATOM   9252  C  CG  . GLU C 1 41  ? 47.886  71.641  67.684  1.00 33.15 ? 73  GLU C CG  1 
ATOM   9253  C  CD  . GLU C 1 41  ? 46.916  70.452  67.949  1.00 38.78 ? 73  GLU C CD  1 
ATOM   9254  O  OE1 . GLU C 1 41  ? 46.840  69.952  69.108  1.00 41.97 ? 73  GLU C OE1 1 
ATOM   9255  O  OE2 . GLU C 1 41  ? 46.242  69.996  66.983  1.00 41.73 ? 73  GLU C OE2 1 
ATOM   9256  N  N   . PHE C 1 42  ? 50.449  74.468  70.325  1.00 22.36 ? 74  PHE C N   1 
ATOM   9257  C  CA  . PHE C 1 42  ? 51.122  74.938  71.524  1.00 24.56 ? 74  PHE C CA  1 
ATOM   9258  C  C   . PHE C 1 42  ? 51.247  73.890  72.626  1.00 23.96 ? 74  PHE C C   1 
ATOM   9259  O  O   . PHE C 1 42  ? 52.349  73.651  73.128  1.00 23.62 ? 74  PHE C O   1 
ATOM   9260  C  CB  . PHE C 1 42  ? 50.420  76.172  72.070  1.00 28.74 ? 74  PHE C CB  1 
ATOM   9261  C  CG  . PHE C 1 42  ? 51.247  76.936  73.029  1.00 31.91 ? 74  PHE C CG  1 
ATOM   9262  C  CD1 . PHE C 1 42  ? 51.286  76.573  74.377  1.00 33.49 ? 74  PHE C CD1 1 
ATOM   9263  C  CD2 . PHE C 1 42  ? 52.033  77.990  72.577  1.00 34.56 ? 74  PHE C CD2 1 
ATOM   9264  C  CE1 . PHE C 1 42  ? 52.105  77.243  75.278  1.00 36.60 ? 74  PHE C CE1 1 
ATOM   9265  C  CE2 . PHE C 1 42  ? 52.868  78.684  73.458  1.00 39.76 ? 74  PHE C CE2 1 
ATOM   9266  C  CZ  . PHE C 1 42  ? 52.907  78.307  74.825  1.00 40.39 ? 74  PHE C CZ  1 
ATOM   9267  N  N   . LEU C 1 43  ? 50.121  73.288  73.019  1.00 23.18 ? 75  LEU C N   1 
ATOM   9268  C  CA  . LEU C 1 43  ? 50.138  72.255  74.063  1.00 23.23 ? 75  LEU C CA  1 
ATOM   9269  C  C   . LEU C 1 43  ? 51.071  71.087  73.652  1.00 22.10 ? 75  LEU C C   1 
ATOM   9270  O  O   . LEU C 1 43  ? 51.703  70.443  74.500  1.00 18.16 ? 75  LEU C O   1 
ATOM   9271  C  CB  . LEU C 1 43  ? 48.712  71.750  74.334  1.00 21.84 ? 75  LEU C CB  1 
ATOM   9272  C  CG  . LEU C 1 43  ? 48.573  70.486  75.196  1.00 22.68 ? 75  LEU C CG  1 
ATOM   9273  C  CD1 . LEU C 1 43  ? 48.997  70.723  76.644  1.00 22.81 ? 75  LEU C CD1 1 
ATOM   9274  C  CD2 . LEU C 1 43  ? 47.148  70.011  75.150  1.00 22.67 ? 75  LEU C CD2 1 
ATOM   9275  N  N   . THR C 1 44  ? 51.150  70.850  72.343  1.00 23.33 ? 76  THR C N   1 
ATOM   9276  C  CA  . THR C 1 44  ? 51.984  69.808  71.773  1.00 23.70 ? 76  THR C CA  1 
ATOM   9277  C  C   . THR C 1 44  ? 53.410  70.093  72.196  1.00 26.71 ? 76  THR C C   1 
ATOM   9278  O  O   . THR C 1 44  ? 54.123  69.184  72.654  1.00 28.26 ? 76  THR C O   1 
ATOM   9279  C  CB  . THR C 1 44  ? 51.857  69.770  70.225  1.00 22.44 ? 76  THR C CB  1 
ATOM   9280  O  OG1 . THR C 1 44  ? 50.535  69.320  69.854  1.00 16.90 ? 76  THR C OG1 1 
ATOM   9281  C  CG2 . THR C 1 44  ? 52.915  68.865  69.613  1.00 20.76 ? 76  THR C CG2 1 
ATOM   9282  N  N   . ARG C 1 45  ? 53.811  71.360  72.090  1.00 30.04 ? 77  ARG C N   1 
ATOM   9283  C  CA  . ARG C 1 45  ? 55.160  71.794  72.503  1.00 30.60 ? 77  ARG C CA  1 
ATOM   9284  C  C   . ARG C 1 45  ? 55.426  71.378  73.956  1.00 27.32 ? 77  ARG C C   1 
ATOM   9285  O  O   . ARG C 1 45  ? 56.394  70.689  74.246  1.00 26.93 ? 77  ARG C O   1 
ATOM   9286  C  CB  . ARG C 1 45  ? 55.292  73.309  72.398  1.00 35.28 ? 77  ARG C CB  1 
ATOM   9287  C  CG  . ARG C 1 45  ? 55.080  73.860  70.996  1.00 40.76 ? 77  ARG C CG  1 
ATOM   9288  C  CD  . ARG C 1 45  ? 55.478  75.341  70.966  1.00 45.49 ? 77  ARG C CD  1 
ATOM   9289  N  NE  . ARG C 1 45  ? 55.458  75.891  69.615  1.00 45.30 ? 77  ARG C NE  1 
ATOM   9290  C  CZ  . ARG C 1 45  ? 54.697  76.912  69.239  1.00 44.51 ? 77  ARG C CZ  1 
ATOM   9291  N  NH1 . ARG C 1 45  ? 53.896  77.509  70.124  1.00 45.02 ? 77  ARG C NH1 1 
ATOM   9292  N  NH2 . ARG C 1 45  ? 54.704  77.300  67.964  1.00 45.26 ? 77  ARG C NH2 1 
ATOM   9293  N  N   . ILE C 1 46  ? 54.518  71.749  74.845  1.00 25.27 ? 78  ILE C N   1 
ATOM   9294  C  CA  . ILE C 1 46  ? 54.619  71.407  76.257  1.00 26.62 ? 78  ILE C CA  1 
ATOM   9295  C  C   . ILE C 1 46  ? 54.985  69.933  76.466  1.00 28.49 ? 78  ILE C C   1 
ATOM   9296  O  O   . ILE C 1 46  ? 55.880  69.595  77.239  1.00 28.56 ? 78  ILE C O   1 
ATOM   9297  C  CB  . ILE C 1 46  ? 53.264  71.651  76.966  1.00 26.99 ? 78  ILE C CB  1 
ATOM   9298  C  CG1 . ILE C 1 46  ? 52.731  73.054  76.632  1.00 25.50 ? 78  ILE C CG1 1 
ATOM   9299  C  CG2 . ILE C 1 46  ? 53.399  71.394  78.470  1.00 25.29 ? 78  ILE C CG2 1 
ATOM   9300  C  CD1 . ILE C 1 46  ? 53.780  74.158  76.733  1.00 26.10 ? 78  ILE C CD1 1 
ATOM   9301  N  N   . LYS C 1 47  ? 54.267  69.057  75.781  1.00 30.86 ? 79  LYS C N   1 
ATOM   9302  C  CA  . LYS C 1 47  ? 54.494  67.628  75.888  1.00 30.64 ? 79  LYS C CA  1 
ATOM   9303  C  C   . LYS C 1 47  ? 55.816  67.270  75.259  1.00 28.32 ? 79  LYS C C   1 
ATOM   9304  O  O   . LYS C 1 47  ? 56.634  66.586  75.881  1.00 28.40 ? 79  LYS C O   1 
ATOM   9305  C  CB  . LYS C 1 47  ? 53.346  66.875  75.226  1.00 35.29 ? 79  LYS C CB  1 
ATOM   9306  C  CG  . LYS C 1 47  ? 51.968  67.337  75.783  1.00 39.26 ? 79  LYS C CG  1 
ATOM   9307  C  CD  . LYS C 1 47  ? 50.776  66.640  75.122  1.00 40.60 ? 79  LYS C CD  1 
ATOM   9308  C  CE  . LYS C 1 47  ? 49.477  67.277  75.565  1.00 40.70 ? 79  LYS C CE  1 
ATOM   9309  N  NZ  . LYS C 1 47  ? 49.306  67.284  77.059  1.00 40.34 ? 79  LYS C NZ  1 
ATOM   9310  N  N   . LEU C 1 48  ? 56.063  67.803  74.069  1.00 26.84 ? 80  LEU C N   1 
ATOM   9311  C  CA  . LEU C 1 48  ? 57.326  67.531  73.382  1.00 27.07 ? 80  LEU C CA  1 
ATOM   9312  C  C   . LEU C 1 48  ? 58.526  67.793  74.288  1.00 26.71 ? 80  LEU C C   1 
ATOM   9313  O  O   . LEU C 1 48  ? 59.458  66.990  74.332  1.00 24.65 ? 80  LEU C O   1 
ATOM   9314  C  CB  . LEU C 1 48  ? 57.455  68.333  72.071  1.00 26.24 ? 80  LEU C CB  1 
ATOM   9315  C  CG  . LEU C 1 48  ? 56.691  67.811  70.838  1.00 26.35 ? 80  LEU C CG  1 
ATOM   9316  C  CD1 . LEU C 1 48  ? 57.406  68.261  69.550  1.00 23.78 ? 80  LEU C CD1 1 
ATOM   9317  C  CD2 . LEU C 1 48  ? 56.595  66.261  70.868  1.00 25.76 ? 80  LEU C CD2 1 
ATOM   9318  N  N   . LEU C 1 49  ? 58.480  68.890  75.044  1.00 28.75 ? 81  LEU C N   1 
ATOM   9319  C  CA  . LEU C 1 49  ? 59.577  69.228  75.953  1.00 29.01 ? 81  LEU C CA  1 
ATOM   9320  C  C   . LEU C 1 49  ? 59.746  68.155  77.009  1.00 28.23 ? 81  LEU C C   1 
ATOM   9321  O  O   . LEU C 1 49  ? 60.832  67.629  77.204  1.00 29.10 ? 81  LEU C O   1 
ATOM   9322  C  CB  . LEU C 1 49  ? 59.337  70.550  76.676  1.00 29.29 ? 81  LEU C CB  1 
ATOM   9323  C  CG  . LEU C 1 49  ? 59.415  71.852  75.899  1.00 28.90 ? 81  LEU C CG  1 
ATOM   9324  C  CD1 . LEU C 1 49  ? 59.459  72.994  76.931  1.00 30.87 ? 81  LEU C CD1 1 
ATOM   9325  C  CD2 . LEU C 1 49  ? 60.640  71.855  75.001  1.00 27.02 ? 81  LEU C CD2 1 
ATOM   9326  N  N   . LEU C 1 50  ? 58.661  67.823  77.683  1.00 26.10 ? 82  LEU C N   1 
ATOM   9327  C  CA  . LEU C 1 50  ? 58.750  66.840  78.735  1.00 28.00 ? 82  LEU C CA  1 
ATOM   9328  C  C   . LEU C 1 50  ? 59.058  65.410  78.296  1.00 27.78 ? 82  LEU C C   1 
ATOM   9329  O  O   . LEU C 1 50  ? 59.522  64.602  79.111  1.00 26.66 ? 82  LEU C O   1 
ATOM   9330  C  CB  . LEU C 1 50  ? 57.501  66.901  79.621  1.00 30.17 ? 82  LEU C CB  1 
ATOM   9331  C  CG  . LEU C 1 50  ? 57.706  67.970  80.697  1.00 30.92 ? 82  LEU C CG  1 
ATOM   9332  C  CD1 . LEU C 1 50  ? 57.877  69.365  80.037  1.00 31.92 ? 82  LEU C CD1 1 
ATOM   9333  C  CD2 . LEU C 1 50  ? 56.548  67.930  81.697  1.00 30.53 ? 82  LEU C CD2 1 
ATOM   9334  N  N   . LYS C 1 51  ? 58.867  65.121  77.009  1.00 26.47 ? 83  LYS C N   1 
ATOM   9335  C  CA  . LYS C 1 51  ? 59.102  63.779  76.468  1.00 25.17 ? 83  LYS C CA  1 
ATOM   9336  C  C   . LYS C 1 51  ? 60.490  63.219  76.744  1.00 23.26 ? 83  LYS C C   1 
ATOM   9337  O  O   . LYS C 1 51  ? 61.447  63.606  76.064  1.00 25.13 ? 83  LYS C O   1 
ATOM   9338  C  CB  . LYS C 1 51  ? 58.850  63.773  74.950  1.00 27.00 ? 83  LYS C CB  1 
ATOM   9339  C  CG  . LYS C 1 51  ? 59.325  62.509  74.190  1.00 28.69 ? 83  LYS C CG  1 
ATOM   9340  C  CD  . LYS C 1 51  ? 58.273  61.375  74.083  1.00 32.91 ? 83  LYS C CD  1 
ATOM   9341  C  CE  . LYS C 1 51  ? 57.867  60.735  75.429  1.00 33.50 ? 83  LYS C CE  1 
ATOM   9342  N  NZ  . LYS C 1 51  ? 56.811  61.480  76.202  1.00 31.76 ? 83  LYS C NZ  1 
ATOM   9343  N  N   . PRO C 1 52  ? 60.626  62.292  77.728  1.00 21.84 ? 84  PRO C N   1 
ATOM   9344  C  CA  . PRO C 1 52  ? 61.962  61.733  78.005  1.00 20.89 ? 84  PRO C CA  1 
ATOM   9345  C  C   . PRO C 1 52  ? 62.283  60.725  76.910  1.00 20.53 ? 84  PRO C C   1 
ATOM   9346  O  O   . PRO C 1 52  ? 61.381  60.011  76.440  1.00 21.68 ? 84  PRO C O   1 
ATOM   9347  C  CB  . PRO C 1 52  ? 61.778  61.039  79.355  1.00 19.81 ? 84  PRO C CB  1 
ATOM   9348  C  CG  . PRO C 1 52  ? 60.381  60.516  79.259  1.00 20.80 ? 84  PRO C CG  1 
ATOM   9349  C  CD  . PRO C 1 52  ? 59.620  61.693  78.628  1.00 22.90 ? 84  PRO C CD  1 
ATOM   9350  N  N   . THR C 1 53  ? 63.542  60.667  76.490  1.00 18.83 ? 85  THR C N   1 
ATOM   9351  C  CA  . THR C 1 53  ? 63.907  59.742  75.437  1.00 18.08 ? 85  THR C CA  1 
ATOM   9352  C  C   . THR C 1 53  ? 63.806  58.309  75.953  1.00 17.43 ? 85  THR C C   1 
ATOM   9353  O  O   . THR C 1 53  ? 64.167  58.006  77.098  1.00 12.74 ? 85  THR C O   1 
ATOM   9354  C  CB  . THR C 1 53  ? 65.328  60.034  74.856  1.00 19.52 ? 85  THR C CB  1 
ATOM   9355  O  OG1 . THR C 1 53  ? 65.484  59.390  73.582  1.00 20.71 ? 85  THR C OG1 1 
ATOM   9356  C  CG2 . THR C 1 53  ? 66.406  59.530  75.765  1.00 20.20 ? 85  THR C CG2 1 
ATOM   9357  N  N   . PRO C 1 54  ? 63.328  57.400  75.089  1.00 18.34 ? 86  PRO C N   1 
ATOM   9358  C  CA  . PRO C 1 54  ? 63.156  55.975  75.396  1.00 19.22 ? 86  PRO C CA  1 
ATOM   9359  C  C   . PRO C 1 54  ? 64.375  55.404  76.116  1.00 20.43 ? 86  PRO C C   1 
ATOM   9360  O  O   . PRO C 1 54  ? 64.265  54.586  77.033  1.00 19.14 ? 86  PRO C O   1 
ATOM   9361  C  CB  . PRO C 1 54  ? 62.997  55.339  74.001  1.00 18.49 ? 86  PRO C CB  1 
ATOM   9362  C  CG  . PRO C 1 54  ? 63.644  56.355  73.044  1.00 17.92 ? 86  PRO C CG  1 
ATOM   9363  C  CD  . PRO C 1 54  ? 63.148  57.646  73.642  1.00 19.10 ? 86  PRO C CD  1 
ATOM   9364  N  N   . ASN C 1 55  ? 65.538  55.870  75.688  1.00 19.63 ? 87  ASN C N   1 
ATOM   9365  C  CA  . ASN C 1 55  ? 66.777  55.429  76.243  1.00 18.45 ? 87  ASN C CA  1 
ATOM   9366  C  C   . ASN C 1 55  ? 66.932  55.937  77.656  1.00 16.84 ? 87  ASN C C   1 
ATOM   9367  O  O   . ASN C 1 55  ? 67.414  55.209  78.518  1.00 15.48 ? 87  ASN C O   1 
ATOM   9368  C  CB  . ASN C 1 55  ? 67.906  55.902  75.357  1.00 23.87 ? 87  ASN C CB  1 
ATOM   9369  C  CG  . ASN C 1 55  ? 67.668  55.571  73.886  1.00 28.15 ? 87  ASN C CG  1 
ATOM   9370  O  OD1 . ASN C 1 55  ? 68.159  54.558  73.370  1.00 31.33 ? 87  ASN C OD1 1 
ATOM   9371  N  ND2 . ASN C 1 55  ? 66.922  56.434  73.201  1.00 28.03 ? 87  ASN C ND2 1 
ATOM   9372  N  N   . THR C 1 56  ? 66.490  57.162  77.915  1.00 16.14 ? 88  THR C N   1 
ATOM   9373  C  CA  . THR C 1 56  ? 66.591  57.731  79.274  1.00 17.98 ? 88  THR C CA  1 
ATOM   9374  C  C   . THR C 1 56  ? 65.783  56.796  80.160  1.00 17.76 ? 88  THR C C   1 
ATOM   9375  O  O   . THR C 1 56  ? 66.274  56.241  81.158  1.00 14.18 ? 88  THR C O   1 
ATOM   9376  C  CB  . THR C 1 56  ? 65.904  59.163  79.409  1.00 19.84 ? 88  THR C CB  1 
ATOM   9377  O  OG1 . THR C 1 56  ? 66.416  60.081  78.429  1.00 19.22 ? 88  THR C OG1 1 
ATOM   9378  C  CG2 . THR C 1 56  ? 66.134  59.746  80.810  1.00 15.24 ? 88  THR C CG2 1 
ATOM   9379  N  N   . VAL C 1 57  ? 64.531  56.621  79.744  1.00 19.19 ? 89  VAL C N   1 
ATOM   9380  C  CA  . VAL C 1 57  ? 63.597  55.775  80.459  1.00 22.17 ? 89  VAL C CA  1 
ATOM   9381  C  C   . VAL C 1 57  ? 64.228  54.403  80.601  1.00 23.07 ? 89  VAL C C   1 
ATOM   9382  O  O   . VAL C 1 57  ? 64.250  53.807  81.686  1.00 22.42 ? 89  VAL C O   1 
ATOM   9383  C  CB  . VAL C 1 57  ? 62.292  55.642  79.691  1.00 22.29 ? 89  VAL C CB  1 
ATOM   9384  C  CG1 . VAL C 1 57  ? 61.235  55.082  80.618  1.00 23.71 ? 89  VAL C CG1 1 
ATOM   9385  C  CG2 . VAL C 1 57  ? 61.866  57.007  79.115  1.00 24.29 ? 89  VAL C CG2 1 
ATOM   9386  N  N   . HIS C 1 58  ? 64.811  53.948  79.499  1.00 23.40 ? 90  HIS C N   1 
ATOM   9387  C  CA  . HIS C 1 58  ? 65.476  52.663  79.478  1.00 22.95 ? 90  HIS C CA  1 
ATOM   9388  C  C   . HIS C 1 58  ? 66.502  52.615  80.600  1.00 21.36 ? 90  HIS C C   1 
ATOM   9389  O  O   . HIS C 1 58  ? 66.543  51.655  81.363  1.00 21.38 ? 90  HIS C O   1 
ATOM   9390  C  CB  . HIS C 1 58  ? 66.185  52.419  78.137  1.00 22.69 ? 90  HIS C CB  1 
ATOM   9391  C  CG  . HIS C 1 58  ? 66.697  51.023  77.989  1.00 23.30 ? 90  HIS C CG  1 
ATOM   9392  N  ND1 . HIS C 1 58  ? 67.398  50.376  78.986  1.00 23.07 ? 90  HIS C ND1 1 
ATOM   9393  C  CD2 . HIS C 1 58  ? 66.505  50.109  77.012  1.00 25.48 ? 90  HIS C CD2 1 
ATOM   9394  C  CE1 . HIS C 1 58  ? 67.605  49.124  78.637  1.00 24.32 ? 90  HIS C CE1 1 
ATOM   9395  N  NE2 . HIS C 1 58  ? 67.072  48.935  77.442  1.00 28.91 ? 90  HIS C NE2 1 
ATOM   9396  N  N   . TYR C 1 59  ? 67.328  53.652  80.697  1.00 21.37 ? 91  TYR C N   1 
ATOM   9397  C  CA  . TYR C 1 59  ? 68.362  53.698  81.725  1.00 21.10 ? 91  TYR C CA  1 
ATOM   9398  C  C   . TYR C 1 59  ? 67.665  53.588  83.076  1.00 21.46 ? 91  TYR C C   1 
ATOM   9399  O  O   . TYR C 1 59  ? 67.838  52.599  83.815  1.00 20.69 ? 91  TYR C O   1 
ATOM   9400  C  CB  . TYR C 1 59  ? 69.149  55.023  81.643  1.00 20.46 ? 91  TYR C CB  1 
ATOM   9401  C  CG  . TYR C 1 59  ? 70.214  55.201  82.701  1.00 15.55 ? 91  TYR C CG  1 
ATOM   9402  C  CD1 . TYR C 1 59  ? 69.887  55.545  84.021  1.00 15.27 ? 91  TYR C CD1 1 
ATOM   9403  C  CD2 . TYR C 1 59  ? 71.541  54.996  82.392  1.00 16.43 ? 91  TYR C CD2 1 
ATOM   9404  C  CE1 . TYR C 1 59  ? 70.869  55.665  85.007  1.00 14.66 ? 91  TYR C CE1 1 
ATOM   9405  C  CE2 . TYR C 1 59  ? 72.535  55.122  83.363  1.00 16.76 ? 91  TYR C CE2 1 
ATOM   9406  C  CZ  . TYR C 1 59  ? 72.197  55.446  84.666  1.00 15.00 ? 91  TYR C CZ  1 
ATOM   9407  O  OH  . TYR C 1 59  ? 73.187  55.496  85.621  1.00 11.28 ? 91  TYR C OH  1 
ATOM   9408  N  N   . ILE C 1 60  ? 66.830  54.586  83.353  1.00 19.37 ? 92  ILE C N   1 
ATOM   9409  C  CA  . ILE C 1 60  ? 66.113  54.669  84.607  1.00 17.70 ? 92  ILE C CA  1 
ATOM   9410  C  C   . ILE C 1 60  ? 65.417  53.362  84.981  1.00 19.41 ? 92  ILE C C   1 
ATOM   9411  O  O   . ILE C 1 60  ? 65.373  52.981  86.159  1.00 18.35 ? 92  ILE C O   1 
ATOM   9412  C  CB  . ILE C 1 60  ? 65.093  55.750  84.527  1.00 15.28 ? 92  ILE C CB  1 
ATOM   9413  C  CG1 . ILE C 1 60  ? 65.737  56.998  83.917  1.00 14.45 ? 92  ILE C CG1 1 
ATOM   9414  C  CG2 . ILE C 1 60  ? 64.546  55.998  85.917  1.00 16.74 ? 92  ILE C CG2 1 
ATOM   9415  C  CD1 . ILE C 1 60  ? 64.730  58.023  83.347  1.00 16.09 ? 92  ILE C CD1 1 
ATOM   9416  N  N   . LEU C 1 61  ? 64.930  52.656  83.963  1.00 19.80 ? 93  LEU C N   1 
ATOM   9417  C  CA  . LEU C 1 61  ? 64.224  51.402  84.164  1.00 20.13 ? 93  LEU C CA  1 
ATOM   9418  C  C   . LEU C 1 61  ? 65.202  50.301  84.562  1.00 20.96 ? 93  LEU C C   1 
ATOM   9419  O  O   . LEU C 1 61  ? 65.017  49.629  85.574  1.00 21.22 ? 93  LEU C O   1 
ATOM   9420  C  CB  . LEU C 1 61  ? 63.481  51.031  82.881  1.00 18.30 ? 93  LEU C CB  1 
ATOM   9421  C  CG  . LEU C 1 61  ? 62.109  50.352  82.984  1.00 19.00 ? 93  LEU C CG  1 
ATOM   9422  C  CD1 . LEU C 1 61  ? 61.449  50.525  84.356  1.00 17.27 ? 93  LEU C CD1 1 
ATOM   9423  C  CD2 . LEU C 1 61  ? 61.211  50.942  81.896  1.00 20.63 ? 93  LEU C CD2 1 
ATOM   9424  N  N   . THR C 1 62  ? 66.296  50.208  83.810  1.00 21.76 ? 94  THR C N   1 
ATOM   9425  C  CA  . THR C 1 62  ? 67.340  49.208  84.006  1.00 19.38 ? 94  THR C CA  1 
ATOM   9426  C  C   . THR C 1 62  ? 68.283  49.417  85.213  1.00 21.29 ? 94  THR C C   1 
ATOM   9427  O  O   . THR C 1 62  ? 69.049  48.521  85.568  1.00 19.93 ? 94  THR C O   1 
ATOM   9428  C  CB  . THR C 1 62  ? 68.171  49.114  82.734  1.00 17.41 ? 94  THR C CB  1 
ATOM   9429  O  OG1 . THR C 1 62  ? 67.296  49.086  81.594  1.00 15.51 ? 94  THR C OG1 1 
ATOM   9430  C  CG2 . THR C 1 62  ? 69.000  47.849  82.743  1.00 22.73 ? 94  THR C CG2 1 
ATOM   9431  N  N   . HIS C 1 63  ? 68.247  50.591  85.842  1.00 24.33 ? 95  HIS C N   1 
ATOM   9432  C  CA  . HIS C 1 63  ? 69.103  50.862  87.001  1.00 23.32 ? 95  HIS C CA  1 
ATOM   9433  C  C   . HIS C 1 63  ? 68.332  50.929  88.320  1.00 23.42 ? 95  HIS C C   1 
ATOM   9434  O  O   . HIS C 1 63  ? 67.276  50.306  88.465  1.00 22.87 ? 95  HIS C O   1 
ATOM   9435  C  CB  . HIS C 1 63  ? 69.864  52.147  86.781  1.00 23.78 ? 95  HIS C CB  1 
ATOM   9436  C  CG  . HIS C 1 63  ? 70.792  52.073  85.628  1.00 27.47 ? 95  HIS C CG  1 
ATOM   9437  N  ND1 . HIS C 1 63  ? 72.149  52.268  85.750  1.00 30.86 ? 95  HIS C ND1 1 
ATOM   9438  C  CD2 . HIS C 1 63  ? 70.570  51.753  84.332  1.00 30.63 ? 95  HIS C CD2 1 
ATOM   9439  C  CE1 . HIS C 1 63  ? 72.729  52.068  84.578  1.00 31.79 ? 95  HIS C CE1 1 
ATOM   9440  N  NE2 . HIS C 1 63  ? 71.792  51.756  83.700  1.00 34.32 ? 95  HIS C NE2 1 
ATOM   9441  N  N   . PHE C 1 64  ? 68.944  51.557  89.322  1.00 21.09 ? 96  PHE C N   1 
ATOM   9442  C  CA  . PHE C 1 64  ? 68.323  51.747  90.634  1.00 19.89 ? 96  PHE C CA  1 
ATOM   9443  C  C   . PHE C 1 64  ? 67.680  50.511  91.266  1.00 20.71 ? 96  PHE C C   1 
ATOM   9444  O  O   . PHE C 1 64  ? 66.763  50.631  92.080  1.00 20.88 ? 96  PHE C O   1 
ATOM   9445  C  CB  . PHE C 1 64  ? 67.324  52.893  90.532  1.00 19.12 ? 96  PHE C CB  1 
ATOM   9446  C  CG  . PHE C 1 64  ? 67.805  54.016  89.640  1.00 21.82 ? 96  PHE C CG  1 
ATOM   9447  C  CD1 . PHE C 1 64  ? 69.078  54.579  89.831  1.00 22.34 ? 96  PHE C CD1 1 
ATOM   9448  C  CD2 . PHE C 1 64  ? 67.038  54.446  88.545  1.00 23.79 ? 96  PHE C CD2 1 
ATOM   9449  C  CE1 . PHE C 1 64  ? 69.596  55.548  88.947  1.00 21.73 ? 96  PHE C CE1 1 
ATOM   9450  C  CE2 . PHE C 1 64  ? 67.538  55.414  87.648  1.00 23.50 ? 96  PHE C CE2 1 
ATOM   9451  C  CZ  . PHE C 1 64  ? 68.832  55.966  87.854  1.00 22.42 ? 96  PHE C CZ  1 
ATOM   9452  N  N   . LYS C 1 65  ? 68.236  49.339  90.947  1.00 21.91 ? 97  LYS C N   1 
ATOM   9453  C  CA  . LYS C 1 65  ? 67.788  48.034  91.443  1.00 22.99 ? 97  LYS C CA  1 
ATOM   9454  C  C   . LYS C 1 65  ? 67.149  48.041  92.848  1.00 22.78 ? 97  LYS C C   1 
ATOM   9455  O  O   . LYS C 1 65  ? 66.203  47.300  93.092  1.00 26.03 ? 97  LYS C O   1 
ATOM   9456  C  CB  . LYS C 1 65  ? 68.980  47.043  91.391  1.00 25.48 ? 97  LYS C CB  1 
ATOM   9457  C  CG  . LYS C 1 65  ? 68.659  45.564  91.680  1.00 29.53 ? 97  LYS C CG  1 
ATOM   9458  C  CD  . LYS C 1 65  ? 67.627  45.010  90.687  1.00 34.31 ? 97  LYS C CD  1 
ATOM   9459  C  CE  . LYS C 1 65  ? 67.066  43.626  91.062  1.00 36.39 ? 97  LYS C CE  1 
ATOM   9460  N  NZ  . LYS C 1 65  ? 65.856  43.254  90.222  1.00 37.08 ? 97  LYS C NZ  1 
ATOM   9461  N  N   . GLY C 1 66  ? 67.659  48.867  93.757  1.00 22.03 ? 98  GLY C N   1 
ATOM   9462  C  CA  . GLY C 1 66  ? 67.113  48.925  95.102  1.00 24.58 ? 98  GLY C CA  1 
ATOM   9463  C  C   . GLY C 1 66  ? 65.869  49.797  95.178  1.00 26.36 ? 98  GLY C C   1 
ATOM   9464  O  O   . GLY C 1 66  ? 64.892  49.508  95.900  1.00 30.12 ? 98  GLY C O   1 
ATOM   9465  N  N   . VAL C 1 67  ? 65.923  50.915  94.472  1.00 25.21 ? 99  VAL C N   1 
ATOM   9466  C  CA  . VAL C 1 67  ? 64.784  51.813  94.423  1.00 24.66 ? 99  VAL C CA  1 
ATOM   9467  C  C   . VAL C 1 67  ? 63.689  50.910  93.857  1.00 23.86 ? 99  VAL C C   1 
ATOM   9468  O  O   . VAL C 1 67  ? 62.641  50.700  94.481  1.00 23.92 ? 99  VAL C O   1 
ATOM   9469  C  CB  . VAL C 1 67  ? 65.058  52.974  93.423  1.00 25.02 ? 99  VAL C CB  1 
ATOM   9470  C  CG1 . VAL C 1 67  ? 63.934  53.985  93.437  1.00 20.87 ? 99  VAL C CG1 1 
ATOM   9471  C  CG2 . VAL C 1 67  ? 66.387  53.636  93.748  1.00 23.73 ? 99  VAL C CG2 1 
ATOM   9472  N  N   . TRP C 1 68  ? 64.017  50.281  92.733  1.00 21.94 ? 100 TRP C N   1 
ATOM   9473  C  CA  . TRP C 1 68  ? 63.099  49.393  92.066  1.00 21.85 ? 100 TRP C CA  1 
ATOM   9474  C  C   . TRP C 1 68  ? 62.565  48.296  92.945  1.00 21.20 ? 100 TRP C C   1 
ATOM   9475  O  O   . TRP C 1 68  ? 61.416  47.888  92.791  1.00 23.56 ? 100 TRP C O   1 
ATOM   9476  C  CB  . TRP C 1 68  ? 63.731  48.809  90.822  1.00 22.32 ? 100 TRP C CB  1 
ATOM   9477  C  CG  . TRP C 1 68  ? 63.614  49.758  89.705  1.00 24.30 ? 100 TRP C CG  1 
ATOM   9478  C  CD1 . TRP C 1 68  ? 64.630  50.332  88.988  1.00 25.42 ? 100 TRP C CD1 1 
ATOM   9479  C  CD2 . TRP C 1 68  ? 62.406  50.294  89.181  1.00 25.07 ? 100 TRP C CD2 1 
ATOM   9480  N  NE1 . TRP C 1 68  ? 64.124  51.191  88.047  1.00 23.75 ? 100 TRP C NE1 1 
ATOM   9481  C  CE2 . TRP C 1 68  ? 62.759  51.187  88.146  1.00 24.99 ? 100 TRP C CE2 1 
ATOM   9482  C  CE3 . TRP C 1 68  ? 61.052  50.106  89.487  1.00 25.27 ? 100 TRP C CE3 1 
ATOM   9483  C  CZ2 . TRP C 1 68  ? 61.807  51.887  87.416  1.00 27.20 ? 100 TRP C CZ2 1 
ATOM   9484  C  CZ3 . TRP C 1 68  ? 60.101  50.803  88.756  1.00 23.96 ? 100 TRP C CZ3 1 
ATOM   9485  C  CH2 . TRP C 1 68  ? 60.483  51.680  87.734  1.00 26.34 ? 100 TRP C CH2 1 
ATOM   9486  N  N   . ASN C 1 69  ? 63.371  47.842  93.889  1.00 18.44 ? 101 ASN C N   1 
ATOM   9487  C  CA  . ASN C 1 69  ? 62.928  46.795  94.774  1.00 21.12 ? 101 ASN C CA  1 
ATOM   9488  C  C   . ASN C 1 69  ? 61.852  47.293  95.724  1.00 22.39 ? 101 ASN C C   1 
ATOM   9489  O  O   . ASN C 1 69  ? 60.926  46.562  96.066  1.00 25.97 ? 101 ASN C O   1 
ATOM   9490  C  CB  . ASN C 1 69  ? 64.083  46.206  95.558  1.00 24.80 ? 101 ASN C CB  1 
ATOM   9491  C  CG  . ASN C 1 69  ? 63.675  44.968  96.318  1.00 33.41 ? 101 ASN C CG  1 
ATOM   9492  O  OD1 . ASN C 1 69  ? 63.625  43.850  95.756  1.00 37.03 ? 101 ASN C OD1 1 
ATOM   9493  N  ND2 . ASN C 1 69  ? 63.315  45.155  97.587  1.00 35.48 ? 101 ASN C ND2 1 
ATOM   9494  N  N   . ILE C 1 70  ? 61.972  48.533  96.169  1.00 23.21 ? 102 ILE C N   1 
ATOM   9495  C  CA  . ILE C 1 70  ? 60.957  49.112  97.054  1.00 24.60 ? 102 ILE C CA  1 
ATOM   9496  C  C   . ILE C 1 70  ? 59.607  49.073  96.296  1.00 23.70 ? 102 ILE C C   1 
ATOM   9497  O  O   . ILE C 1 70  ? 58.599  48.558  96.797  1.00 20.89 ? 102 ILE C O   1 
ATOM   9498  C  CB  . ILE C 1 70  ? 61.338  50.573  97.386  1.00 25.57 ? 102 ILE C CB  1 
ATOM   9499  C  CG1 . ILE C 1 70  ? 62.609  50.583  98.237  1.00 24.33 ? 102 ILE C CG1 1 
ATOM   9500  C  CG2 . ILE C 1 70  ? 60.149  51.329  98.012  1.00 25.15 ? 102 ILE C CG2 1 
ATOM   9501  C  CD1 . ILE C 1 70  ? 63.275  51.928  98.302  1.00 28.47 ? 102 ILE C CD1 1 
ATOM   9502  N  N   . VAL C 1 71  ? 59.642  49.589  95.069  1.00 22.76 ? 103 VAL C N   1 
ATOM   9503  C  CA  . VAL C 1 71  ? 58.500  49.629  94.168  1.00 21.76 ? 103 VAL C CA  1 
ATOM   9504  C  C   . VAL C 1 71  ? 57.856  48.233  94.068  1.00 22.76 ? 103 VAL C C   1 
ATOM   9505  O  O   . VAL C 1 71  ? 56.676  48.059  94.397  1.00 23.77 ? 103 VAL C O   1 
ATOM   9506  C  CB  . VAL C 1 71  ? 58.951  50.107  92.757  1.00 20.01 ? 103 VAL C CB  1 
ATOM   9507  C  CG1 . VAL C 1 71  ? 57.788  50.096  91.785  1.00 21.13 ? 103 VAL C CG1 1 
ATOM   9508  C  CG2 . VAL C 1 71  ? 59.573  51.499  92.846  1.00 18.86 ? 103 VAL C CG2 1 
ATOM   9509  N  N   . ASN C 1 72  ? 58.649  47.232  93.686  1.00 23.14 ? 104 ASN C N   1 
ATOM   9510  C  CA  . ASN C 1 72  ? 58.174  45.847  93.549  1.00 23.08 ? 104 ASN C CA  1 
ATOM   9511  C  C   . ASN C 1 72  ? 57.519  45.258  94.807  1.00 24.48 ? 104 ASN C C   1 
ATOM   9512  O  O   . ASN C 1 72  ? 57.094  44.099  94.809  1.00 21.74 ? 104 ASN C O   1 
ATOM   9513  C  CB  . ASN C 1 72  ? 59.323  44.934  93.142  1.00 20.55 ? 104 ASN C CB  1 
ATOM   9514  C  CG  . ASN C 1 72  ? 59.687  45.049  91.660  1.00 22.93 ? 104 ASN C CG  1 
ATOM   9515  O  OD1 . ASN C 1 72  ? 59.006  45.684  90.857  1.00 22.51 ? 104 ASN C OD1 1 
ATOM   9516  N  ND2 . ASN C 1 72  ? 60.770  44.399  91.294  1.00 26.42 ? 104 ASN C ND2 1 
ATOM   9517  N  N   . ASN C 1 73  ? 57.482  46.031  95.890  1.00 28.42 ? 105 ASN C N   1 
ATOM   9518  C  CA  . ASN C 1 73  ? 56.881  45.574  97.142  1.00 31.31 ? 105 ASN C CA  1 
ATOM   9519  C  C   . ASN C 1 73  ? 55.776  46.491  97.668  1.00 32.26 ? 105 ASN C C   1 
ATOM   9520  O  O   . ASN C 1 73  ? 55.212  46.230  98.735  1.00 31.89 ? 105 ASN C O   1 
ATOM   9521  C  CB  . ASN C 1 73  ? 57.940  45.373  98.221  1.00 39.46 ? 105 ASN C CB  1 
ATOM   9522  C  CG  . ASN C 1 73  ? 58.682  44.035  98.088  1.00 45.99 ? 105 ASN C CG  1 
ATOM   9523  O  OD1 . ASN C 1 73  ? 59.752  43.933  97.434  1.00 47.92 ? 105 ASN C OD1 1 
ATOM   9524  N  ND2 . ASN C 1 73  ? 58.143  43.006  98.753  1.00 50.00 ? 105 ASN C ND2 1 
ATOM   9525  N  N   . ILE C 1 74  A 55.520  47.602  96.969  1.00 31.67 ? 105 ILE C N   1 
ATOM   9526  C  CA  . ILE C 1 74  A 54.423  48.517  97.318  1.00 28.72 ? 105 ILE C CA  1 
ATOM   9527  C  C   . ILE C 1 74  A 53.447  48.268  96.170  1.00 27.66 ? 105 ILE C C   1 
ATOM   9528  O  O   . ILE C 1 74  A 53.513  48.937  95.130  1.00 27.91 ? 105 ILE C O   1 
ATOM   9529  C  CB  . ILE C 1 74  A 54.858  50.004  97.317  1.00 29.69 ? 105 ILE C CB  1 
ATOM   9530  C  CG1 . ILE C 1 74  A 55.764  50.279  98.516  1.00 31.70 ? 105 ILE C CG1 1 
ATOM   9531  C  CG2 . ILE C 1 74  A 53.647  50.914  97.385  1.00 29.32 ? 105 ILE C CG2 1 
ATOM   9532  C  CD1 . ILE C 1 74  A 56.056  51.758  98.735  1.00 32.31 ? 105 ILE C CD1 1 
ATOM   9533  N  N   . PRO C 1 75  ? 52.537  47.280  96.337  1.00 26.37 ? 106 PRO C N   1 
ATOM   9534  C  CA  . PRO C 1 75  ? 51.526  46.872  95.350  1.00 23.61 ? 106 PRO C CA  1 
ATOM   9535  C  C   . PRO C 1 75  ? 50.932  48.050  94.591  1.00 23.72 ? 106 PRO C C   1 
ATOM   9536  O  O   . PRO C 1 75  ? 51.080  48.159  93.363  1.00 22.66 ? 106 PRO C O   1 
ATOM   9537  C  CB  . PRO C 1 75  ? 50.495  46.178  96.220  1.00 22.47 ? 106 PRO C CB  1 
ATOM   9538  C  CG  . PRO C 1 75  ? 51.335  45.504  97.240  1.00 22.66 ? 106 PRO C CG  1 
ATOM   9539  C  CD  . PRO C 1 75  ? 52.281  46.613  97.631  1.00 25.51 ? 106 PRO C CD  1 
ATOM   9540  N  N   . PHE C 1 76  ? 50.385  48.983  95.368  1.00 23.23 ? 107 PHE C N   1 
ATOM   9541  C  CA  . PHE C 1 76  ? 49.741  50.210  94.886  1.00 22.58 ? 107 PHE C CA  1 
ATOM   9542  C  C   . PHE C 1 76  ? 50.663  50.914  93.890  1.00 19.37 ? 107 PHE C C   1 
ATOM   9543  O  O   . PHE C 1 76  ? 50.236  51.385  92.844  1.00 17.41 ? 107 PHE C O   1 
ATOM   9544  C  CB  . PHE C 1 76  ? 49.426  51.107  96.090  1.00 26.31 ? 107 PHE C CB  1 
ATOM   9545  C  CG  . PHE C 1 76  ? 49.568  50.395  97.414  1.00 34.72 ? 107 PHE C CG  1 
ATOM   9546  C  CD1 . PHE C 1 76  ? 48.856  49.198  97.667  1.00 37.74 ? 107 PHE C CD1 1 
ATOM   9547  C  CD2 . PHE C 1 76  ? 50.492  50.844  98.373  1.00 37.93 ? 107 PHE C CD2 1 
ATOM   9548  C  CE1 . PHE C 1 76  ? 49.069  48.438  98.859  1.00 38.67 ? 107 PHE C CE1 1 
ATOM   9549  C  CE2 . PHE C 1 76  ? 50.718  50.101  99.573  1.00 41.54 ? 107 PHE C CE2 1 
ATOM   9550  C  CZ  . PHE C 1 76  ? 49.997  48.885  99.810  1.00 40.93 ? 107 PHE C CZ  1 
ATOM   9551  N  N   . LEU C 1 77  ? 51.950  50.875  94.184  1.00 17.34 ? 108 LEU C N   1 
ATOM   9552  C  CA  . LEU C 1 77  ? 52.950  51.498  93.341  1.00 16.38 ? 108 LEU C CA  1 
ATOM   9553  C  C   . LEU C 1 77  ? 53.200  50.744  92.062  1.00 14.60 ? 108 LEU C C   1 
ATOM   9554  O  O   . LEU C 1 77  ? 53.181  51.309  90.965  1.00 10.39 ? 108 LEU C O   1 
ATOM   9555  C  CB  . LEU C 1 77  ? 54.267  51.623  94.102  1.00 17.08 ? 108 LEU C CB  1 
ATOM   9556  C  CG  . LEU C 1 77  ? 54.505  53.000  94.686  1.00 18.66 ? 108 LEU C CG  1 
ATOM   9557  C  CD1 . LEU C 1 77  ? 55.751  52.959  95.523  1.00 18.61 ? 108 LEU C CD1 1 
ATOM   9558  C  CD2 . LEU C 1 77  ? 54.623  54.026  93.533  1.00 20.00 ? 108 LEU C CD2 1 
ATOM   9559  N  N   . ARG C 1 78  ? 53.488  49.462  92.225  1.00 16.15 ? 109 ARG C N   1 
ATOM   9560  C  CA  . ARG C 1 78  ? 53.797  48.593  91.093  1.00 19.28 ? 109 ARG C CA  1 
ATOM   9561  C  C   . ARG C 1 78  ? 52.686  48.617  90.045  1.00 19.68 ? 109 ARG C C   1 
ATOM   9562  O  O   . ARG C 1 78  ? 52.935  48.902  88.869  1.00 18.45 ? 109 ARG C O   1 
ATOM   9563  C  CB  . ARG C 1 78  ? 54.039  47.145  91.562  1.00 19.91 ? 109 ARG C CB  1 
ATOM   9564  C  CG  . ARG C 1 78  ? 54.294  46.147  90.412  1.00 17.56 ? 109 ARG C CG  1 
ATOM   9565  C  CD  . ARG C 1 78  ? 54.493  44.768  90.956  1.00 12.24 ? 109 ARG C CD  1 
ATOM   9566  N  NE  . ARG C 1 78  ? 54.699  43.806  89.895  1.00 12.32 ? 109 ARG C NE  1 
ATOM   9567  C  CZ  . ARG C 1 78  ? 54.592  42.494  90.077  1.00 15.04 ? 109 ARG C CZ  1 
ATOM   9568  N  NH1 . ARG C 1 78  ? 54.278  42.024  91.286  1.00 12.42 ? 109 ARG C NH1 1 
ATOM   9569  N  NH2 . ARG C 1 78  ? 54.810  41.653  89.059  1.00 16.01 ? 109 ARG C NH2 1 
ATOM   9570  N  N   . SER C 1 79  ? 51.476  48.279  90.479  1.00 18.37 ? 110 SER C N   1 
ATOM   9571  C  CA  . SER C 1 79  ? 50.322  48.263  89.600  1.00 17.87 ? 110 SER C CA  1 
ATOM   9572  C  C   . SER C 1 79  ? 50.284  49.625  88.903  1.00 19.12 ? 110 SER C C   1 
ATOM   9573  O  O   . SER C 1 79  ? 50.176  49.717  87.662  1.00 18.80 ? 110 SER C O   1 
ATOM   9574  C  CB  . SER C 1 79  ? 49.076  48.070  90.445  1.00 17.36 ? 110 SER C CB  1 
ATOM   9575  O  OG  . SER C 1 79  ? 49.092  49.013  91.501  1.00 19.55 ? 110 SER C OG  1 
ATOM   9576  N  N   . LEU C 1 80  ? 50.426  50.673  89.718  1.00 17.95 ? 111 LEU C N   1 
ATOM   9577  C  CA  . LEU C 1 80  ? 50.450  52.043  89.231  1.00 16.16 ? 111 LEU C CA  1 
ATOM   9578  C  C   . LEU C 1 80  ? 51.439  52.124  88.046  1.00 15.65 ? 111 LEU C C   1 
ATOM   9579  O  O   . LEU C 1 80  ? 51.050  52.546  86.944  1.00 12.67 ? 111 LEU C O   1 
ATOM   9580  C  CB  . LEU C 1 80  ? 50.846  52.972  90.397  1.00 18.16 ? 111 LEU C CB  1 
ATOM   9581  C  CG  . LEU C 1 80  ? 50.847  54.512  90.375  1.00 19.27 ? 111 LEU C CG  1 
ATOM   9582  C  CD1 . LEU C 1 80  ? 52.180  55.090  89.898  1.00 21.86 ? 111 LEU C CD1 1 
ATOM   9583  C  CD2 . LEU C 1 80  ? 49.701  55.015  89.529  1.00 23.66 ? 111 LEU C CD2 1 
ATOM   9584  N  N   . ILE C 1 81  ? 52.666  51.619  88.248  1.00 13.52 ? 112 ILE C N   1 
ATOM   9585  C  CA  . ILE C 1 81  ? 53.699  51.626  87.204  1.00 11.78 ? 112 ILE C CA  1 
ATOM   9586  C  C   . ILE C 1 81  ? 53.258  50.792  85.988  1.00 13.30 ? 112 ILE C C   1 
ATOM   9587  O  O   . ILE C 1 81  ? 53.297  51.258  84.836  1.00 12.67 ? 112 ILE C O   1 
ATOM   9588  C  CB  . ILE C 1 81  ? 55.037  51.032  87.706  1.00 11.80 ? 112 ILE C CB  1 
ATOM   9589  C  CG1 . ILE C 1 81  ? 55.338  51.457  89.149  1.00 10.64 ? 112 ILE C CG1 1 
ATOM   9590  C  CG2 . ILE C 1 81  ? 56.162  51.418  86.744  1.00 12.19 ? 112 ILE C CG2 1 
ATOM   9591  C  CD1 . ILE C 1 81  ? 55.605  52.921  89.345  1.00 10.39 ? 112 ILE C CD1 1 
ATOM   9592  N  N   . MET C 1 82  ? 52.808  49.565  86.270  1.00 13.73 ? 113 MET C N   1 
ATOM   9593  C  CA  . MET C 1 82  ? 52.361  48.600  85.266  1.00 12.35 ? 113 MET C CA  1 
ATOM   9594  C  C   . MET C 1 82  ? 51.353  49.265  84.339  1.00 12.39 ? 113 MET C C   1 
ATOM   9595  O  O   . MET C 1 82  ? 51.443  49.157  83.107  1.00 11.15 ? 113 MET C O   1 
ATOM   9596  C  CB  . MET C 1 82  ? 51.750  47.362  85.963  1.00 11.86 ? 113 MET C CB  1 
ATOM   9597  C  CG  . MET C 1 82  ? 51.976  46.003  85.241  1.00 9.56  ? 113 MET C CG  1 
ATOM   9598  S  SD  . MET C 1 82  ? 52.963  46.154  83.709  1.00 10.46 ? 113 MET C SD  1 
ATOM   9599  C  CE  . MET C 1 82  ? 52.105  45.096  82.579  1.00 7.65  ? 113 MET C CE  1 
ATOM   9600  N  N   . LYS C 1 83  ? 50.450  50.030  84.939  1.00 11.81 ? 114 LYS C N   1 
ATOM   9601  C  CA  . LYS C 1 83  ? 49.437  50.715  84.169  1.00 12.81 ? 114 LYS C CA  1 
ATOM   9602  C  C   . LYS C 1 83  ? 50.077  51.623  83.115  1.00 14.30 ? 114 LYS C C   1 
ATOM   9603  O  O   . LYS C 1 83  ? 49.858  51.428  81.914  1.00 8.90  ? 114 LYS C O   1 
ATOM   9604  C  CB  . LYS C 1 83  ? 48.520  51.507  85.106  1.00 11.42 ? 114 LYS C CB  1 
ATOM   9605  C  CG  . LYS C 1 83  ? 47.278  52.059  84.412  1.00 10.75 ? 114 LYS C CG  1 
ATOM   9606  C  CD  . LYS C 1 83  ? 46.249  52.577  85.412  1.00 14.53 ? 114 LYS C CD  1 
ATOM   9607  C  CE  . LYS C 1 83  ? 45.873  51.494  86.428  1.00 20.93 ? 114 LYS C CE  1 
ATOM   9608  N  NZ  . LYS C 1 83  ? 44.658  51.822  87.243  1.00 23.69 ? 114 LYS C NZ  1 
ATOM   9609  N  N   . TYR C 1 84  ? 50.929  52.550  83.569  1.00 18.56 ? 115 TYR C N   1 
ATOM   9610  C  CA  . TYR C 1 84  ? 51.601  53.503  82.684  1.00 23.02 ? 115 TYR C CA  1 
ATOM   9611  C  C   . TYR C 1 84  ? 52.207  52.845  81.472  1.00 22.03 ? 115 TYR C C   1 
ATOM   9612  O  O   . TYR C 1 84  ? 51.947  53.261  80.332  1.00 22.59 ? 115 TYR C O   1 
ATOM   9613  C  CB  . TYR C 1 84  ? 52.707  54.286  83.415  1.00 30.70 ? 115 TYR C CB  1 
ATOM   9614  C  CG  . TYR C 1 84  ? 53.821  54.803  82.488  1.00 37.88 ? 115 TYR C CG  1 
ATOM   9615  C  CD1 . TYR C 1 84  ? 53.620  55.921  81.645  1.00 39.14 ? 115 TYR C CD1 1 
ATOM   9616  C  CD2 . TYR C 1 84  ? 55.058  54.131  82.416  1.00 41.36 ? 115 TYR C CD2 1 
ATOM   9617  C  CE1 . TYR C 1 84  ? 54.627  56.350  80.752  1.00 41.95 ? 115 TYR C CE1 1 
ATOM   9618  C  CE2 . TYR C 1 84  ? 56.074  54.544  81.526  1.00 43.33 ? 115 TYR C CE2 1 
ATOM   9619  C  CZ  . TYR C 1 84  ? 55.856  55.655  80.694  1.00 44.09 ? 115 TYR C CZ  1 
ATOM   9620  O  OH  . TYR C 1 84  ? 56.857  56.048  79.809  1.00 41.80 ? 115 TYR C OH  1 
ATOM   9621  N  N   . VAL C 1 85  ? 53.080  51.878  81.725  1.00 20.61 ? 116 VAL C N   1 
ATOM   9622  C  CA  . VAL C 1 85  ? 53.724  51.181  80.629  1.00 20.31 ? 116 VAL C CA  1 
ATOM   9623  C  C   . VAL C 1 85  ? 52.643  50.635  79.704  1.00 18.36 ? 116 VAL C C   1 
ATOM   9624  O  O   . VAL C 1 85  ? 52.633  50.941  78.511  1.00 18.24 ? 116 VAL C O   1 
ATOM   9625  C  CB  . VAL C 1 85  ? 54.683  50.058  81.131  1.00 21.72 ? 116 VAL C CB  1 
ATOM   9626  C  CG1 . VAL C 1 85  ? 54.140  49.387  82.398  1.00 18.04 ? 116 VAL C CG1 1 
ATOM   9627  C  CG2 . VAL C 1 85  ? 54.932  49.036  80.010  1.00 21.31 ? 116 VAL C CG2 1 
ATOM   9628  N  N   . LEU C 1 86  ? 51.636  50.020  80.317  1.00 16.80 ? 117 LEU C N   1 
ATOM   9629  C  CA  . LEU C 1 86  ? 50.516  49.416  79.606  1.00 15.92 ? 117 LEU C CA  1 
ATOM   9630  C  C   . LEU C 1 86  ? 49.767  50.320  78.623  1.00 17.19 ? 117 LEU C C   1 
ATOM   9631  O  O   . LEU C 1 86  ? 49.468  49.921  77.489  1.00 14.40 ? 117 LEU C O   1 
ATOM   9632  C  CB  . LEU C 1 86  ? 49.554  48.821  80.628  1.00 13.13 ? 117 LEU C CB  1 
ATOM   9633  C  CG  . LEU C 1 86  ? 49.138  47.363  80.441  1.00 11.12 ? 117 LEU C CG  1 
ATOM   9634  C  CD1 . LEU C 1 86  ? 50.278  46.506  79.900  1.00 9.63  ? 117 LEU C CD1 1 
ATOM   9635  C  CD2 . LEU C 1 86  ? 48.663  46.851  81.792  1.00 11.17 ? 117 LEU C CD2 1 
ATOM   9636  N  N   . THR C 1 87  ? 49.494  51.548  79.052  1.00 22.41 ? 118 THR C N   1 
ATOM   9637  C  CA  . THR C 1 87  ? 48.763  52.537  78.231  1.00 25.92 ? 118 THR C CA  1 
ATOM   9638  C  C   . THR C 1 87  ? 49.594  53.215  77.141  1.00 28.81 ? 118 THR C C   1 
ATOM   9639  O  O   . THR C 1 87  ? 49.238  53.150  75.944  1.00 30.98 ? 118 THR C O   1 
ATOM   9640  C  CB  . THR C 1 87  ? 48.182  53.660  79.095  1.00 24.06 ? 118 THR C CB  1 
ATOM   9641  O  OG1 . THR C 1 87  ? 49.256  54.336  79.782  1.00 21.82 ? 118 THR C OG1 1 
ATOM   9642  C  CG2 . THR C 1 87  ? 47.166  53.073  80.096  1.00 25.57 ? 118 THR C CG2 1 
ATOM   9643  N  N   . SER C 1 88  ? 50.647  53.920  77.577  1.00 29.28 ? 119 SER C N   1 
ATOM   9644  C  CA  . SER C 1 88  ? 51.560  54.637  76.694  1.00 29.43 ? 119 SER C CA  1 
ATOM   9645  C  C   . SER C 1 88  ? 51.890  53.774  75.477  1.00 29.70 ? 119 SER C C   1 
ATOM   9646  O  O   . SER C 1 88  ? 51.670  54.171  74.317  1.00 27.86 ? 119 SER C O   1 
ATOM   9647  C  CB  . SER C 1 88  ? 52.821  54.981  77.483  1.00 29.58 ? 119 SER C CB  1 
ATOM   9648  O  OG  . SER C 1 88  ? 53.286  53.852  78.205  1.00 27.65 ? 119 SER C OG  1 
ATOM   9649  N  N   . ARG C 1 89  ? 52.328  52.555  75.778  1.00 30.44 ? 120 ARG C N   1 
ATOM   9650  C  CA  . ARG C 1 89  ? 52.684  51.561  74.770  1.00 32.30 ? 120 ARG C CA  1 
ATOM   9651  C  C   . ARG C 1 89  ? 51.615  51.472  73.661  1.00 31.36 ? 120 ARG C C   1 
ATOM   9652  O  O   . ARG C 1 89  ? 51.917  51.454  72.460  1.00 31.61 ? 120 ARG C O   1 
ATOM   9653  C  CB  . ARG C 1 89  ? 52.820  50.182  75.455  1.00 32.97 ? 120 ARG C CB  1 
ATOM   9654  C  CG  . ARG C 1 89  ? 54.232  49.590  75.529  1.00 36.00 ? 120 ARG C CG  1 
ATOM   9655  C  CD  . ARG C 1 89  ? 55.246  50.438  76.349  1.00 39.95 ? 120 ARG C CD  1 
ATOM   9656  N  NE  . ARG C 1 89  ? 56.483  49.671  76.584  1.00 45.09 ? 120 ARG C NE  1 
ATOM   9657  C  CZ  . ARG C 1 89  ? 57.425  49.945  77.494  1.00 45.67 ? 120 ARG C CZ  1 
ATOM   9658  N  NH1 . ARG C 1 89  ? 57.322  51.016  78.289  1.00 47.04 ? 120 ARG C NH1 1 
ATOM   9659  N  NH2 . ARG C 1 89  ? 58.420  49.069  77.690  1.00 43.58 ? 120 ARG C NH2 1 
ATOM   9660  N  N   . SER C 1 90  ? 50.359  51.515  74.071  1.00 29.92 ? 121 SER C N   1 
ATOM   9661  C  CA  . SER C 1 90  ? 49.270  51.367  73.134  1.00 28.55 ? 121 SER C CA  1 
ATOM   9662  C  C   . SER C 1 90  ? 48.803  52.542  72.255  1.00 27.41 ? 121 SER C C   1 
ATOM   9663  O  O   . SER C 1 90  ? 48.346  52.319  71.131  1.00 27.19 ? 121 SER C O   1 
ATOM   9664  C  CB  . SER C 1 90  ? 48.115  50.684  73.858  1.00 28.54 ? 121 SER C CB  1 
ATOM   9665  O  OG  . SER C 1 90  ? 48.590  49.489  74.470  1.00 30.05 ? 121 SER C OG  1 
ATOM   9666  N  N   . TYR C 1 91  ? 48.959  53.786  72.685  1.00 24.23 ? 122 TYR C N   1 
ATOM   9667  C  CA  . TYR C 1 91  ? 48.499  54.862  71.808  1.00 23.82 ? 122 TYR C CA  1 
ATOM   9668  C  C   . TYR C 1 91  ? 49.184  54.766  70.441  1.00 20.57 ? 122 TYR C C   1 
ATOM   9669  O  O   . TYR C 1 91  ? 48.823  55.470  69.501  1.00 21.60 ? 122 TYR C O   1 
ATOM   9670  C  CB  . TYR C 1 91  ? 48.756  56.261  72.422  1.00 30.14 ? 122 TYR C CB  1 
ATOM   9671  C  CG  . TYR C 1 91  ? 50.119  56.898  72.101  1.00 36.35 ? 122 TYR C CG  1 
ATOM   9672  C  CD1 . TYR C 1 91  ? 50.385  57.464  70.835  1.00 35.32 ? 122 TYR C CD1 1 
ATOM   9673  C  CD2 . TYR C 1 91  ? 51.149  56.915  73.062  1.00 38.66 ? 122 TYR C CD2 1 
ATOM   9674  C  CE1 . TYR C 1 91  ? 51.643  58.020  70.538  1.00 37.19 ? 122 TYR C CE1 1 
ATOM   9675  C  CE2 . TYR C 1 91  ? 52.416  57.474  72.774  1.00 38.77 ? 122 TYR C CE2 1 
ATOM   9676  C  CZ  . TYR C 1 91  ? 52.658  58.019  71.513  1.00 37.48 ? 122 TYR C CZ  1 
ATOM   9677  O  OH  . TYR C 1 91  ? 53.923  58.518  71.234  1.00 36.78 ? 122 TYR C OH  1 
ATOM   9678  N  N   . LEU C 1 92  ? 50.222  53.948  70.350  1.00 17.42 ? 123 LEU C N   1 
ATOM   9679  C  CA  . LEU C 1 92  ? 50.950  53.830  69.098  1.00 15.93 ? 123 LEU C CA  1 
ATOM   9680  C  C   . LEU C 1 92  ? 50.328  52.992  67.999  1.00 15.87 ? 123 LEU C C   1 
ATOM   9681  O  O   . LEU C 1 92  ? 50.533  53.309  66.829  1.00 12.11 ? 123 LEU C O   1 
ATOM   9682  C  CB  . LEU C 1 92  ? 52.393  53.361  69.331  1.00 12.67 ? 123 LEU C CB  1 
ATOM   9683  C  CG  . LEU C 1 92  ? 53.403  54.336  69.934  1.00 6.80  ? 123 LEU C CG  1 
ATOM   9684  C  CD1 . LEU C 1 92  ? 53.567  55.548  69.039  1.00 8.36  ? 123 LEU C CD1 1 
ATOM   9685  C  CD2 . LEU C 1 92  ? 52.971  54.710  71.338  1.00 2.28  ? 123 LEU C CD2 1 
ATOM   9686  N  N   . ILE C 1 93  ? 49.586  51.938  68.362  1.00 17.45 ? 124 ILE C N   1 
ATOM   9687  C  CA  . ILE C 1 93  ? 48.970  51.031  67.359  1.00 19.82 ? 124 ILE C CA  1 
ATOM   9688  C  C   . ILE C 1 93  ? 47.544  51.301  66.929  1.00 18.17 ? 124 ILE C C   1 
ATOM   9689  O  O   . ILE C 1 93  ? 46.715  51.686  67.742  1.00 19.73 ? 124 ILE C O   1 
ATOM   9690  C  CB  . ILE C 1 93  ? 49.077  49.527  67.739  1.00 22.54 ? 124 ILE C CB  1 
ATOM   9691  C  CG1 . ILE C 1 93  ? 49.322  49.342  69.247  1.00 24.54 ? 124 ILE C CG1 1 
ATOM   9692  C  CG2 . ILE C 1 93  ? 50.175  48.858  66.903  1.00 25.68 ? 124 ILE C CG2 1 
ATOM   9693  C  CD1 . ILE C 1 93  ? 48.141  49.695  70.143  1.00 22.80 ? 124 ILE C CD1 1 
ATOM   9694  N  N   . ASP C 1 94  ? 47.269  51.054  65.651  1.00 16.81 ? 125 ASP C N   1 
ATOM   9695  C  CA  . ASP C 1 94  ? 45.945  51.289  65.053  1.00 16.45 ? 125 ASP C CA  1 
ATOM   9696  C  C   . ASP C 1 94  ? 44.833  50.259  65.313  1.00 15.73 ? 125 ASP C C   1 
ATOM   9697  O  O   . ASP C 1 94  ? 44.825  49.177  64.716  1.00 18.94 ? 125 ASP C O   1 
ATOM   9698  C  CB  . ASP C 1 94  ? 46.088  51.471  63.536  1.00 16.80 ? 125 ASP C CB  1 
ATOM   9699  C  CG  . ASP C 1 94  ? 46.336  52.900  63.145  1.00 18.22 ? 125 ASP C CG  1 
ATOM   9700  O  OD1 . ASP C 1 94  ? 46.208  53.780  64.034  1.00 19.73 ? 125 ASP C OD1 1 
ATOM   9701  O  OD2 . ASP C 1 94  ? 46.637  53.144  61.948  1.00 17.87 ? 125 ASP C OD2 1 
ATOM   9702  N  N   . SER C 1 95  ? 43.841  50.642  66.103  1.00 12.96 ? 126 SER C N   1 
ATOM   9703  C  CA  . SER C 1 95  ? 42.741  49.760  66.420  1.00 11.69 ? 126 SER C CA  1 
ATOM   9704  C  C   . SER C 1 95  ? 41.460  50.545  66.505  1.00 9.11  ? 126 SER C C   1 
ATOM   9705  O  O   . SER C 1 95  ? 41.294  51.390  67.389  1.00 12.94 ? 126 SER C O   1 
ATOM   9706  C  CB  . SER C 1 95  ? 43.012  49.040  67.744  1.00 12.24 ? 126 SER C CB  1 
ATOM   9707  O  OG  . SER C 1 95  ? 42.897  47.624  67.594  1.00 17.02 ? 126 SER C OG  1 
ATOM   9708  N  N   . PRO C 1 96  ? 40.512  50.248  65.624  1.00 6.58  ? 127 PRO C N   1 
ATOM   9709  C  CA  . PRO C 1 96  ? 40.595  49.238  64.589  1.00 4.55  ? 127 PRO C CA  1 
ATOM   9710  C  C   . PRO C 1 96  ? 41.619  49.476  63.522  1.00 2.44  ? 127 PRO C C   1 
ATOM   9711  O  O   . PRO C 1 96  ? 42.017  50.587  63.274  1.00 2.00  ? 127 PRO C O   1 
ATOM   9712  C  CB  . PRO C 1 96  ? 39.196  49.261  64.004  1.00 7.39  ? 127 PRO C CB  1 
ATOM   9713  C  CG  . PRO C 1 96  ? 38.373  49.550  65.195  1.00 10.55 ? 127 PRO C CG  1 
ATOM   9714  C  CD  . PRO C 1 96  ? 39.118  50.688  65.772  1.00 9.75  ? 127 PRO C CD  1 
ATOM   9715  N  N   . PRO C 1 97  ? 42.039  48.396  62.863  1.00 2.94  ? 128 PRO C N   1 
ATOM   9716  C  CA  . PRO C 1 97  ? 43.017  48.300  61.781  1.00 4.79  ? 128 PRO C CA  1 
ATOM   9717  C  C   . PRO C 1 97  ? 42.786  49.199  60.585  1.00 7.00  ? 128 PRO C C   1 
ATOM   9718  O  O   . PRO C 1 97  ? 41.658  49.581  60.295  1.00 9.83  ? 128 PRO C O   1 
ATOM   9719  C  CB  . PRO C 1 97  ? 42.934  46.824  61.378  1.00 3.65  ? 128 PRO C CB  1 
ATOM   9720  C  CG  . PRO C 1 97  ? 41.654  46.336  61.973  1.00 2.00  ? 128 PRO C CG  1 
ATOM   9721  C  CD  . PRO C 1 97  ? 41.607  47.046  63.266  1.00 2.06  ? 128 PRO C CD  1 
ATOM   9722  N  N   . THR C 1 98  ? 43.868  49.488  59.863  1.00 10.21 ? 129 THR C N   1 
ATOM   9723  C  CA  . THR C 1 98  ? 43.815  50.338  58.688  1.00 8.28  ? 129 THR C CA  1 
ATOM   9724  C  C   . THR C 1 98  ? 44.375  49.674  57.426  1.00 8.12  ? 129 THR C C   1 
ATOM   9725  O  O   . THR C 1 98  ? 43.742  48.760  56.910  1.00 9.47  ? 129 THR C O   1 
ATOM   9726  C  CB  . THR C 1 98  ? 44.473  51.736  58.958  1.00 9.06  ? 129 THR C CB  1 
ATOM   9727  O  OG1 . THR C 1 98  ? 45.812  51.589  59.449  1.00 13.06 ? 129 THR C OG1 1 
ATOM   9728  C  CG2 . THR C 1 98  ? 43.698  52.486  60.005  1.00 11.52 ? 129 THR C CG2 1 
ATOM   9729  N  N   . TYR C 1 99  ? 45.602  50.036  57.030  1.00 8.03  ? 130 TYR C N   1 
ATOM   9730  C  CA  . TYR C 1 99  ? 46.253  49.575  55.778  1.00 6.89  ? 130 TYR C CA  1 
ATOM   9731  C  C   . TYR C 1 99  ? 46.779  48.146  55.659  1.00 6.38  ? 130 TYR C C   1 
ATOM   9732  O  O   . TYR C 1 99  ? 46.703  47.332  56.594  1.00 6.64  ? 130 TYR C O   1 
ATOM   9733  C  CB  . TYR C 1 99  ? 47.426  50.514  55.394  1.00 4.97  ? 130 TYR C CB  1 
ATOM   9734  C  CG  . TYR C 1 99  ? 47.199  51.966  55.705  1.00 4.31  ? 130 TYR C CG  1 
ATOM   9735  C  CD1 . TYR C 1 99  ? 47.324  52.442  57.018  1.00 2.00  ? 130 TYR C CD1 1 
ATOM   9736  C  CD2 . TYR C 1 99  ? 46.823  52.854  54.706  1.00 2.60  ? 130 TYR C CD2 1 
ATOM   9737  C  CE1 . TYR C 1 99  ? 47.069  53.767  57.330  1.00 2.00  ? 130 TYR C CE1 1 
ATOM   9738  C  CE2 . TYR C 1 99  ? 46.571  54.187  54.995  1.00 2.87  ? 130 TYR C CE2 1 
ATOM   9739  C  CZ  . TYR C 1 99  ? 46.690  54.651  56.312  1.00 4.57  ? 130 TYR C CZ  1 
ATOM   9740  O  OH  . TYR C 1 99  ? 46.432  55.997  56.598  1.00 3.75  ? 130 TYR C OH  1 
ATOM   9741  N  N   . ASN C 1 100 ? 47.329  47.878  54.474  1.00 5.36  ? 131 ASN C N   1 
ATOM   9742  C  CA  . ASN C 1 100 ? 47.937  46.608  54.145  1.00 5.08  ? 131 ASN C CA  1 
ATOM   9743  C  C   . ASN C 1 100 ? 48.551  46.534  52.745  1.00 4.16  ? 131 ASN C C   1 
ATOM   9744  O  O   . ASN C 1 100 ? 48.404  47.430  51.923  1.00 2.00  ? 131 ASN C O   1 
ATOM   9745  C  CB  . ASN C 1 100 ? 46.955  45.454  54.333  1.00 6.28  ? 131 ASN C CB  1 
ATOM   9746  C  CG  . ASN C 1 100 ? 45.878  45.397  53.261  1.00 8.02  ? 131 ASN C CG  1 
ATOM   9747  O  OD1 . ASN C 1 100 ? 46.116  45.543  52.037  1.00 6.76  ? 131 ASN C OD1 1 
ATOM   9748  N  ND2 . ASN C 1 100 ? 44.680  45.115  53.716  1.00 11.32 ? 131 ASN C ND2 1 
ATOM   9749  N  N   . VAL C 1 101 ? 49.200  45.403  52.497  1.00 6.29  ? 132 VAL C N   1 
ATOM   9750  C  CA  . VAL C 1 101 ? 49.875  45.059  51.239  1.00 4.90  ? 132 VAL C CA  1 
ATOM   9751  C  C   . VAL C 1 101 ? 49.273  45.747  50.038  1.00 6.39  ? 132 VAL C C   1 
ATOM   9752  O  O   . VAL C 1 101 ? 50.008  46.299  49.232  1.00 7.46  ? 132 VAL C O   1 
ATOM   9753  C  CB  . VAL C 1 101 ? 49.757  43.527  50.923  1.00 5.63  ? 132 VAL C CB  1 
ATOM   9754  C  CG1 . VAL C 1 101 ? 50.636  43.163  49.772  1.00 3.22  ? 132 VAL C CG1 1 
ATOM   9755  C  CG2 . VAL C 1 101 ? 50.053  42.657  52.159  1.00 8.12  ? 132 VAL C CG2 1 
ATOM   9756  N  N   . HIS C 1 102 ? 47.938  45.694  49.931  1.00 6.56  ? 133 HIS C N   1 
ATOM   9757  C  CA  . HIS C 1 102 ? 47.202  46.252  48.809  1.00 2.38  ? 133 HIS C CA  1 
ATOM   9758  C  C   . HIS C 1 102 ? 46.551  47.608  49.008  1.00 3.44  ? 133 HIS C C   1 
ATOM   9759  O  O   . HIS C 1 102 ? 46.271  48.343  48.022  1.00 2.00  ? 133 HIS C O   1 
ATOM   9760  C  CB  . HIS C 1 102 ? 46.118  45.290  48.455  1.00 2.00  ? 133 HIS C CB  1 
ATOM   9761  C  CG  . HIS C 1 102 ? 46.614  43.986  47.945  1.00 6.29  ? 133 HIS C CG  1 
ATOM   9762  N  ND1 . HIS C 1 102 ? 46.227  42.789  48.494  1.00 10.00 ? 133 HIS C ND1 1 
ATOM   9763  C  CD2 . HIS C 1 102 ? 47.338  43.677  46.847  1.00 9.95  ? 133 HIS C CD2 1 
ATOM   9764  C  CE1 . HIS C 1 102 ? 46.669  41.794  47.746  1.00 12.68 ? 133 HIS C CE1 1 
ATOM   9765  N  NE2 . HIS C 1 102 ? 47.350  42.307  46.740  1.00 13.66 ? 133 HIS C NE2 1 
ATOM   9766  N  N   . TYR C 1 103 ? 46.269  47.933  50.267  1.00 2.00  ? 134 TYR C N   1 
ATOM   9767  C  CA  . TYR C 1 103 ? 45.595  49.180  50.536  1.00 2.00  ? 134 TYR C CA  1 
ATOM   9768  C  C   . TYR C 1 103 ? 46.377  50.215  51.278  1.00 2.73  ? 134 TYR C C   1 
ATOM   9769  O  O   . TYR C 1 103 ? 46.625  50.122  52.481  1.00 2.63  ? 134 TYR C O   1 
ATOM   9770  C  CB  . TYR C 1 103 ? 44.217  48.931  51.160  1.00 2.00  ? 134 TYR C CB  1 
ATOM   9771  C  CG  . TYR C 1 103 ? 43.288  48.154  50.227  1.00 3.58  ? 134 TYR C CG  1 
ATOM   9772  C  CD1 . TYR C 1 103 ? 42.566  48.808  49.222  1.00 2.03  ? 134 TYR C CD1 1 
ATOM   9773  C  CD2 . TYR C 1 103 ? 43.234  46.754  50.261  1.00 2.00  ? 134 TYR C CD2 1 
ATOM   9774  C  CE1 . TYR C 1 103 ? 41.836  48.102  48.271  1.00 2.02  ? 134 TYR C CE1 1 
ATOM   9775  C  CE2 . TYR C 1 103 ? 42.505  46.049  49.306  1.00 2.00  ? 134 TYR C CE2 1 
ATOM   9776  C  CZ  . TYR C 1 103 ? 41.814  46.733  48.316  1.00 2.05  ? 134 TYR C CZ  1 
ATOM   9777  O  OH  . TYR C 1 103 ? 41.102  46.048  47.369  1.00 4.51  ? 134 TYR C OH  1 
ATOM   9778  N  N   . GLY C 1 104 ? 46.816  51.193  50.499  1.00 5.05  ? 135 GLY C N   1 
ATOM   9779  C  CA  . GLY C 1 104 ? 47.561  52.311  51.042  1.00 6.62  ? 135 GLY C CA  1 
ATOM   9780  C  C   . GLY C 1 104 ? 46.571  53.297  51.625  1.00 7.57  ? 135 GLY C C   1 
ATOM   9781  O  O   . GLY C 1 104 ? 46.970  54.267  52.296  1.00 6.26  ? 135 GLY C O   1 
ATOM   9782  N  N   . TYR C 1 105 ? 45.288  53.088  51.284  1.00 8.16  ? 136 TYR C N   1 
ATOM   9783  C  CA  . TYR C 1 105 ? 44.176  53.905  51.776  1.00 6.01  ? 136 TYR C CA  1 
ATOM   9784  C  C   . TYR C 1 105 ? 43.347  53.030  52.667  1.00 6.74  ? 136 TYR C C   1 
ATOM   9785  O  O   . TYR C 1 105 ? 43.482  51.810  52.593  1.00 8.50  ? 136 TYR C O   1 
ATOM   9786  C  CB  . TYR C 1 105 ? 43.318  54.494  50.654  1.00 4.36  ? 136 TYR C CB  1 
ATOM   9787  C  CG  . TYR C 1 105 ? 42.919  53.579  49.530  1.00 2.15  ? 136 TYR C CG  1 
ATOM   9788  C  CD1 . TYR C 1 105 ? 42.143  52.457  49.751  1.00 6.44  ? 136 TYR C CD1 1 
ATOM   9789  C  CD2 . TYR C 1 105 ? 43.265  53.876  48.227  1.00 2.00  ? 136 TYR C CD2 1 
ATOM   9790  C  CE1 . TYR C 1 105 ? 41.723  51.657  48.679  1.00 5.79  ? 136 TYR C CE1 1 
ATOM   9791  C  CE2 . TYR C 1 105 ? 42.857  53.089  47.174  1.00 2.91  ? 136 TYR C CE2 1 
ATOM   9792  C  CZ  . TYR C 1 105 ? 42.095  51.987  47.395  1.00 2.00  ? 136 TYR C CZ  1 
ATOM   9793  O  OH  . TYR C 1 105 ? 41.761  51.202  46.322  1.00 2.00  ? 136 TYR C OH  1 
ATOM   9794  N  N   . LYS C 1 106 ? 42.437  53.624  53.439  1.00 5.83  ? 137 LYS C N   1 
ATOM   9795  C  CA  . LYS C 1 106 ? 41.651  52.844  54.379  1.00 3.88  ? 137 LYS C CA  1 
ATOM   9796  C  C   . LYS C 1 106 ? 40.718  51.720  53.956  1.00 4.14  ? 137 LYS C C   1 
ATOM   9797  O  O   . LYS C 1 106 ? 40.672  50.711  54.648  1.00 5.76  ? 137 LYS C O   1 
ATOM   9798  C  CB  . LYS C 1 106 ? 41.011  53.733  55.398  1.00 2.00  ? 137 LYS C CB  1 
ATOM   9799  C  CG  . LYS C 1 106 ? 41.873  53.911  56.599  1.00 2.00  ? 137 LYS C CG  1 
ATOM   9800  C  CD  . LYS C 1 106 ? 42.153  55.366  56.775  1.00 3.93  ? 137 LYS C CD  1 
ATOM   9801  C  CE  . LYS C 1 106 ? 42.405  55.689  58.223  1.00 2.00  ? 137 LYS C CE  1 
ATOM   9802  N  NZ  . LYS C 1 106 ? 42.388  57.142  58.398  1.00 3.33  ? 137 LYS C NZ  1 
ATOM   9803  N  N   . SER C 1 107 ? 39.960  51.892  52.876  1.00 2.94  ? 138 SER C N   1 
ATOM   9804  C  CA  . SER C 1 107 ? 39.043  50.852  52.350  1.00 3.96  ? 138 SER C CA  1 
ATOM   9805  C  C   . SER C 1 107 ? 38.329  49.792  53.254  1.00 4.70  ? 138 SER C C   1 
ATOM   9806  O  O   . SER C 1 107 ? 38.915  49.248  54.199  1.00 3.38  ? 138 SER C O   1 
ATOM   9807  C  CB  . SER C 1 107 ? 39.738  50.128  51.190  1.00 2.48  ? 138 SER C CB  1 
ATOM   9808  O  OG  . SER C 1 107 ? 39.884  48.743  51.437  1.00 2.00  ? 138 SER C OG  1 
ATOM   9809  N  N   . TRP C 1 108 ? 37.079  49.441  52.918  1.00 5.22  ? 139 TRP C N   1 
ATOM   9810  C  CA  . TRP C 1 108 ? 36.366  48.420  53.711  1.00 5.39  ? 139 TRP C CA  1 
ATOM   9811  C  C   . TRP C 1 108 ? 37.076  47.050  53.524  1.00 5.09  ? 139 TRP C C   1 
ATOM   9812  O  O   . TRP C 1 108 ? 37.332  46.332  54.501  1.00 2.77  ? 139 TRP C O   1 
ATOM   9813  C  CB  . TRP C 1 108 ? 34.858  48.343  53.346  1.00 4.03  ? 139 TRP C CB  1 
ATOM   9814  C  CG  . TRP C 1 108 ? 34.031  47.434  54.285  1.00 2.00  ? 139 TRP C CG  1 
ATOM   9815  C  CD1 . TRP C 1 108 ? 33.698  46.127  54.077  1.00 2.00  ? 139 TRP C CD1 1 
ATOM   9816  C  CD2 . TRP C 1 108 ? 33.597  47.741  55.610  1.00 2.00  ? 139 TRP C CD2 1 
ATOM   9817  N  NE1 . TRP C 1 108 ? 33.116  45.596  55.198  1.00 2.00  ? 139 TRP C NE1 1 
ATOM   9818  C  CE2 . TRP C 1 108 ? 33.047  46.564  56.156  1.00 2.00  ? 139 TRP C CE2 1 
ATOM   9819  C  CE3 . TRP C 1 108 ? 33.636  48.886  56.393  1.00 3.38  ? 139 TRP C CE3 1 
ATOM   9820  C  CZ2 . TRP C 1 108 ? 32.550  46.504  57.453  1.00 2.00  ? 139 TRP C CZ2 1 
ATOM   9821  C  CZ3 . TRP C 1 108 ? 33.139  48.826  57.684  1.00 4.57  ? 139 TRP C CZ3 1 
ATOM   9822  C  CH2 . TRP C 1 108 ? 32.605  47.638  58.203  1.00 2.00  ? 139 TRP C CH2 1 
ATOM   9823  N  N   . GLU C 1 109 ? 37.462  46.760  52.275  1.00 4.04  ? 140 GLU C N   1 
ATOM   9824  C  CA  . GLU C 1 109 ? 38.162  45.535  51.875  1.00 2.00  ? 140 GLU C CA  1 
ATOM   9825  C  C   . GLU C 1 109 ? 39.325  45.248  52.792  1.00 2.00  ? 140 GLU C C   1 
ATOM   9826  O  O   . GLU C 1 109 ? 39.551  44.114  53.208  1.00 2.02  ? 140 GLU C O   1 
ATOM   9827  C  CB  . GLU C 1 109 ? 38.682  45.681  50.455  1.00 2.00  ? 140 GLU C CB  1 
ATOM   9828  C  CG  . GLU C 1 109 ? 39.603  44.609  50.030  1.00 2.45  ? 140 GLU C CG  1 
ATOM   9829  C  CD  . GLU C 1 109 ? 38.987  43.239  50.144  1.00 7.90  ? 140 GLU C CD  1 
ATOM   9830  O  OE1 . GLU C 1 109 ? 37.838  43.041  49.667  1.00 10.53 ? 140 GLU C OE1 1 
ATOM   9831  O  OE2 . GLU C 1 109 ? 39.658  42.342  50.710  1.00 8.78  ? 140 GLU C OE2 1 
ATOM   9832  N  N   . ALA C 1 110 ? 40.083  46.292  53.080  1.00 3.32  ? 141 ALA C N   1 
ATOM   9833  C  CA  . ALA C 1 110 ? 41.220  46.177  53.975  1.00 2.87  ? 141 ALA C CA  1 
ATOM   9834  C  C   . ALA C 1 110 ? 40.679  45.806  55.340  1.00 2.19  ? 141 ALA C C   1 
ATOM   9835  O  O   . ALA C 1 110 ? 40.858  44.706  55.799  1.00 2.00  ? 141 ALA C O   1 
ATOM   9836  C  CB  . ALA C 1 110 ? 41.973  47.508  54.050  1.00 2.58  ? 141 ALA C CB  1 
ATOM   9837  N  N   . PHE C 1 111 ? 39.900  46.713  55.913  1.00 4.69  ? 142 PHE C N   1 
ATOM   9838  C  CA  . PHE C 1 111 ? 39.340  46.525  57.232  1.00 3.79  ? 142 PHE C CA  1 
ATOM   9839  C  C   . PHE C 1 111 ? 38.700  45.199  57.474  1.00 4.04  ? 142 PHE C C   1 
ATOM   9840  O  O   . PHE C 1 111 ? 38.786  44.684  58.579  1.00 3.14  ? 142 PHE C O   1 
ATOM   9841  C  CB  . PHE C 1 111 ? 38.303  47.577  57.576  1.00 2.30  ? 142 PHE C CB  1 
ATOM   9842  C  CG  . PHE C 1 111 ? 37.528  47.218  58.785  1.00 2.00  ? 142 PHE C CG  1 
ATOM   9843  C  CD1 . PHE C 1 111 ? 38.140  47.256  60.038  1.00 2.06  ? 142 PHE C CD1 1 
ATOM   9844  C  CD2 . PHE C 1 111 ? 36.263  46.674  58.664  1.00 2.48  ? 142 PHE C CD2 1 
ATOM   9845  C  CE1 . PHE C 1 111 ? 37.507  46.740  61.159  1.00 5.34  ? 142 PHE C CE1 1 
ATOM   9846  C  CE2 . PHE C 1 111 ? 35.615  46.154  59.766  1.00 6.44  ? 142 PHE C CE2 1 
ATOM   9847  C  CZ  . PHE C 1 111 ? 36.237  46.181  61.029  1.00 6.88  ? 142 PHE C CZ  1 
ATOM   9848  N  N   . SER C 1 112 ? 37.968  44.716  56.476  1.00 5.39  ? 143 SER C N   1 
ATOM   9849  C  CA  . SER C 1 112 ? 37.228  43.451  56.584  1.00 6.12  ? 143 SER C CA  1 
ATOM   9850  C  C   . SER C 1 112 ? 37.975  42.153  56.353  1.00 6.52  ? 143 SER C C   1 
ATOM   9851  O  O   . SER C 1 112 ? 37.773  41.218  57.125  1.00 9.42  ? 143 SER C O   1 
ATOM   9852  C  CB  . SER C 1 112 ? 35.987  43.464  55.686  1.00 6.32  ? 143 SER C CB  1 
ATOM   9853  O  OG  . SER C 1 112 ? 36.318  43.735  54.338  1.00 5.46  ? 143 SER C OG  1 
ATOM   9854  N  N   . ASN C 1 113 ? 38.813  42.091  55.309  1.00 5.41  ? 144 ASN C N   1 
ATOM   9855  C  CA  . ASN C 1 113 ? 39.570  40.879  54.975  1.00 2.79  ? 144 ASN C CA  1 
ATOM   9856  C  C   . ASN C 1 113 ? 40.527  40.353  56.031  1.00 2.00  ? 144 ASN C C   1 
ATOM   9857  O  O   . ASN C 1 113 ? 41.629  40.815  56.142  1.00 3.33  ? 144 ASN C O   1 
ATOM   9858  C  CB  . ASN C 1 113 ? 40.319  41.056  53.669  1.00 2.00  ? 144 ASN C CB  1 
ATOM   9859  C  CG  . ASN C 1 113 ? 40.590  39.755  53.011  1.00 2.00  ? 144 ASN C CG  1 
ATOM   9860  O  OD1 . ASN C 1 113 ? 40.991  38.797  53.670  1.00 2.00  ? 144 ASN C OD1 1 
ATOM   9861  N  ND2 . ASN C 1 113 ? 40.256  39.682  51.734  1.00 2.00  ? 144 ASN C ND2 1 
ATOM   9862  N  N   . LEU C 1 114 ? 40.123  39.342  56.771  1.00 2.00  ? 145 LEU C N   1 
ATOM   9863  C  CA  . LEU C 1 114 ? 40.963  38.806  57.816  1.00 2.38  ? 145 LEU C CA  1 
ATOM   9864  C  C   . LEU C 1 114 ? 42.175  37.990  57.365  1.00 3.93  ? 145 LEU C C   1 
ATOM   9865  O  O   . LEU C 1 114 ? 43.029  37.621  58.200  1.00 2.00  ? 145 LEU C O   1 
ATOM   9866  C  CB  . LEU C 1 114 ? 40.146  38.003  58.817  1.00 2.00  ? 145 LEU C CB  1 
ATOM   9867  C  CG  . LEU C 1 114 ? 39.272  38.770  59.778  1.00 2.00  ? 145 LEU C CG  1 
ATOM   9868  C  CD1 . LEU C 1 114 ? 38.778  37.792  60.781  1.00 2.00  ? 145 LEU C CD1 1 
ATOM   9869  C  CD2 . LEU C 1 114 ? 40.028  39.844  60.483  1.00 2.00  ? 145 LEU C CD2 1 
ATOM   9870  N  N   . SER C 1 115 ? 42.263  37.703  56.071  1.00 2.00  ? 146 SER C N   1 
ATOM   9871  C  CA  . SER C 1 115 ? 43.393  36.947  55.563  1.00 2.16  ? 146 SER C CA  1 
ATOM   9872  C  C   . SER C 1 115 ? 44.700  37.747  55.455  1.00 2.09  ? 146 SER C C   1 
ATOM   9873  O  O   . SER C 1 115 ? 45.793  37.217  55.509  1.00 2.87  ? 146 SER C O   1 
ATOM   9874  C  CB  . SER C 1 115 ? 43.009  36.334  54.237  1.00 4.66  ? 146 SER C CB  1 
ATOM   9875  O  OG  . SER C 1 115 ? 41.900  35.473  54.444  1.00 10.93 ? 146 SER C OG  1 
ATOM   9876  N  N   . TYR C 1 116 ? 44.577  39.042  55.291  1.00 3.36  ? 147 TYR C N   1 
ATOM   9877  C  CA  . TYR C 1 116 ? 45.710  39.939  55.211  1.00 2.43  ? 147 TYR C CA  1 
ATOM   9878  C  C   . TYR C 1 116 ? 46.370  40.125  56.583  1.00 4.21  ? 147 TYR C C   1 
ATOM   9879  O  O   . TYR C 1 116 ? 45.794  39.764  57.613  1.00 7.34  ? 147 TYR C O   1 
ATOM   9880  C  CB  . TYR C 1 116 ? 45.194  41.297  54.806  1.00 2.05  ? 147 TYR C CB  1 
ATOM   9881  C  CG  . TYR C 1 116 ? 44.828  41.445  53.369  1.00 2.00  ? 147 TYR C CG  1 
ATOM   9882  C  CD1 . TYR C 1 116 ? 45.468  40.742  52.388  1.00 2.14  ? 147 TYR C CD1 1 
ATOM   9883  C  CD2 . TYR C 1 116 ? 43.933  42.400  52.990  1.00 2.00  ? 147 TYR C CD2 1 
ATOM   9884  C  CE1 . TYR C 1 116 ? 45.230  41.011  51.077  1.00 2.00  ? 147 TYR C CE1 1 
ATOM   9885  C  CE2 . TYR C 1 116 ? 43.699  42.662  51.679  1.00 2.00  ? 147 TYR C CE2 1 
ATOM   9886  C  CZ  . TYR C 1 116 ? 44.344  41.970  50.737  1.00 2.00  ? 147 TYR C CZ  1 
ATOM   9887  O  OH  . TYR C 1 116 ? 44.072  42.233  49.432  1.00 2.00  ? 147 TYR C OH  1 
ATOM   9888  N  N   . TYR C 1 117 ? 47.587  40.668  56.579  1.00 4.67  ? 148 TYR C N   1 
ATOM   9889  C  CA  . TYR C 1 117 ? 48.327  40.986  57.798  1.00 5.14  ? 148 TYR C CA  1 
ATOM   9890  C  C   . TYR C 1 117 ? 48.128  42.485  57.766  1.00 2.63  ? 148 TYR C C   1 
ATOM   9891  O  O   . TYR C 1 117 ? 48.226  43.086  56.689  1.00 2.00  ? 148 TYR C O   1 
ATOM   9892  C  CB  . TYR C 1 117 ? 49.833  40.695  57.655  1.00 4.36  ? 148 TYR C CB  1 
ATOM   9893  C  CG  . TYR C 1 117 ? 50.297  39.301  58.017  1.00 2.00  ? 148 TYR C CG  1 
ATOM   9894  C  CD1 . TYR C 1 117 ? 50.424  38.901  59.361  1.00 2.00  ? 148 TYR C CD1 1 
ATOM   9895  C  CD2 . TYR C 1 117 ? 50.653  38.396  57.023  1.00 2.00  ? 148 TYR C CD2 1 
ATOM   9896  C  CE1 . TYR C 1 117 ? 50.896  37.625  59.689  1.00 2.00  ? 148 TYR C CE1 1 
ATOM   9897  C  CE2 . TYR C 1 117 ? 51.124  37.125  57.343  1.00 2.00  ? 148 TYR C CE2 1 
ATOM   9898  C  CZ  . TYR C 1 117 ? 51.238  36.754  58.675  1.00 2.00  ? 148 TYR C CZ  1 
ATOM   9899  O  OH  . TYR C 1 117 ? 51.668  35.506  58.990  1.00 2.00  ? 148 TYR C OH  1 
ATOM   9900  N  N   . THR C 1 118 ? 47.841  43.105  58.895  1.00 2.00  ? 149 THR C N   1 
ATOM   9901  C  CA  . THR C 1 118 ? 47.650  44.531  58.830  1.00 4.11  ? 149 THR C CA  1 
ATOM   9902  C  C   . THR C 1 118 ? 49.000  45.187  58.611  1.00 6.48  ? 149 THR C C   1 
ATOM   9903  O  O   . THR C 1 118 ? 50.050  44.538  58.718  1.00 8.10  ? 149 THR C O   1 
ATOM   9904  C  CB  . THR C 1 118 ? 46.961  45.092  60.091  1.00 5.73  ? 149 THR C CB  1 
ATOM   9905  O  OG1 . THR C 1 118 ? 46.689  46.497  59.918  1.00 10.39 ? 149 THR C OG1 1 
ATOM   9906  C  CG2 . THR C 1 118 ? 47.811  44.883  61.316  1.00 4.64  ? 149 THR C CG2 1 
ATOM   9907  N  N   . ARG C 1 119 ? 48.990  46.472  58.297  1.00 6.95  ? 150 ARG C N   1 
ATOM   9908  C  CA  . ARG C 1 119 ? 50.243  47.164  58.077  1.00 7.07  ? 150 ARG C CA  1 
ATOM   9909  C  C   . ARG C 1 119 ? 50.354  48.425  58.930  1.00 8.67  ? 150 ARG C C   1 
ATOM   9910  O  O   . ARG C 1 119 ? 49.439  49.261  58.925  1.00 9.61  ? 150 ARG C O   1 
ATOM   9911  C  CB  . ARG C 1 119 ? 50.389  47.518  56.606  1.00 6.20  ? 150 ARG C CB  1 
ATOM   9912  C  CG  . ARG C 1 119 ? 51.819  47.542  56.186  1.00 3.96  ? 150 ARG C CG  1 
ATOM   9913  C  CD  . ARG C 1 119 ? 52.289  46.167  55.767  1.00 2.38  ? 150 ARG C CD  1 
ATOM   9914  N  NE  . ARG C 1 119 ? 52.658  46.193  54.370  1.00 2.00  ? 150 ARG C NE  1 
ATOM   9915  C  CZ  . ARG C 1 119 ? 53.500  47.079  53.852  1.00 4.34  ? 150 ARG C CZ  1 
ATOM   9916  N  NH1 . ARG C 1 119 ? 54.077  47.998  54.621  1.00 7.17  ? 150 ARG C NH1 1 
ATOM   9917  N  NH2 . ARG C 1 119 ? 53.705  47.110  52.550  1.00 3.79  ? 150 ARG C NH2 1 
ATOM   9918  N  N   . ALA C 1 120 ? 51.483  48.574  59.632  1.00 7.65  ? 151 ALA C N   1 
ATOM   9919  C  CA  . ALA C 1 120 ? 51.705  49.733  60.502  1.00 5.17  ? 151 ALA C CA  1 
ATOM   9920  C  C   . ALA C 1 120 ? 52.058  50.980  59.699  1.00 3.42  ? 151 ALA C C   1 
ATOM   9921  O  O   . ALA C 1 120 ? 52.041  52.085  60.212  1.00 3.70  ? 151 ALA C O   1 
ATOM   9922  C  CB  . ALA C 1 120 ? 52.787  49.433  61.543  1.00 2.68  ? 151 ALA C CB  1 
ATOM   9923  N  N   . LEU C 1 121 ? 52.375  50.798  58.435  1.00 2.00  ? 152 LEU C N   1 
ATOM   9924  C  CA  . LEU C 1 121 ? 52.706  51.916  57.585  1.00 2.66  ? 152 LEU C CA  1 
ATOM   9925  C  C   . LEU C 1 121 ? 52.264  51.449  56.239  1.00 2.01  ? 152 LEU C C   1 
ATOM   9926  O  O   . LEU C 1 121 ? 52.437  50.291  55.880  1.00 3.28  ? 152 LEU C O   1 
ATOM   9927  C  CB  . LEU C 1 121 ? 54.226  52.166  57.570  1.00 7.03  ? 152 LEU C CB  1 
ATOM   9928  C  CG  . LEU C 1 121 ? 54.888  53.399  58.236  1.00 9.02  ? 152 LEU C CG  1 
ATOM   9929  C  CD1 . LEU C 1 121 ? 55.149  54.520  57.222  1.00 9.01  ? 152 LEU C CD1 1 
ATOM   9930  C  CD2 . LEU C 1 121 ? 54.070  53.925  59.398  1.00 7.20  ? 152 LEU C CD2 1 
ATOM   9931  N  N   . PRO C 1 122 ? 51.668  52.333  55.471  1.00 2.00  ? 153 PRO C N   1 
ATOM   9932  C  CA  . PRO C 1 122 ? 51.214  51.936  54.145  1.00 2.00  ? 153 PRO C CA  1 
ATOM   9933  C  C   . PRO C 1 122 ? 52.338  51.449  53.285  1.00 2.00  ? 153 PRO C C   1 
ATOM   9934  O  O   . PRO C 1 122 ? 53.499  51.621  53.620  1.00 3.06  ? 153 PRO C O   1 
ATOM   9935  C  CB  . PRO C 1 122 ? 50.703  53.249  53.568  1.00 3.19  ? 153 PRO C CB  1 
ATOM   9936  C  CG  . PRO C 1 122 ? 51.533  54.259  54.240  1.00 2.50  ? 153 PRO C CG  1 
ATOM   9937  C  CD  . PRO C 1 122 ? 51.526  53.775  55.664  1.00 2.00  ? 153 PRO C CD  1 
ATOM   9938  N  N   . PRO C 1 123 ? 52.017  50.674  52.260  1.00 2.00  ? 154 PRO C N   1 
ATOM   9939  C  CA  . PRO C 1 123 ? 53.102  50.235  51.404  1.00 3.87  ? 154 PRO C CA  1 
ATOM   9940  C  C   . PRO C 1 123 ? 53.373  51.449  50.524  1.00 5.41  ? 154 PRO C C   1 
ATOM   9941  O  O   . PRO C 1 123 ? 52.700  52.488  50.659  1.00 5.59  ? 154 PRO C O   1 
ATOM   9942  C  CB  . PRO C 1 123 ? 52.451  49.124  50.580  1.00 3.99  ? 154 PRO C CB  1 
ATOM   9943  C  CG  . PRO C 1 123 ? 51.029  49.491  50.540  1.00 2.00  ? 154 PRO C CG  1 
ATOM   9944  C  CD  . PRO C 1 123 ? 50.809  49.894  51.979  1.00 3.37  ? 154 PRO C CD  1 
ATOM   9945  N  N   . VAL C 1 124 ? 54.320  51.310  49.613  1.00 5.19  ? 155 VAL C N   1 
ATOM   9946  C  CA  . VAL C 1 124 ? 54.652  52.388  48.709  1.00 7.24  ? 155 VAL C CA  1 
ATOM   9947  C  C   . VAL C 1 124 ? 53.952  52.202  47.362  1.00 8.39  ? 155 VAL C C   1 
ATOM   9948  O  O   . VAL C 1 124 ? 53.800  51.086  46.855  1.00 9.07  ? 155 VAL C O   1 
ATOM   9949  C  CB  . VAL C 1 124 ? 56.165  52.482  48.518  1.00 7.12  ? 155 VAL C CB  1 
ATOM   9950  C  CG1 . VAL C 1 124 ? 56.504  53.626  47.575  1.00 6.34  ? 155 VAL C CG1 1 
ATOM   9951  C  CG2 . VAL C 1 124 ? 56.837  52.646  49.882  1.00 6.34  ? 155 VAL C CG2 1 
ATOM   9952  N  N   . ALA C 1 125 ? 53.502  53.307  46.797  1.00 8.46  ? 156 ALA C N   1 
ATOM   9953  C  CA  . ALA C 1 125 ? 52.814  53.271  45.523  1.00 9.97  ? 156 ALA C CA  1 
ATOM   9954  C  C   . ALA C 1 125 ? 53.619  52.541  44.496  1.00 9.57  ? 156 ALA C C   1 
ATOM   9955  O  O   . ALA C 1 125 ? 54.806  52.748  44.339  1.00 10.31 ? 156 ALA C O   1 
ATOM   9956  C  CB  . ALA C 1 125 ? 52.516  54.690  45.036  1.00 15.64 ? 156 ALA C CB  1 
ATOM   9957  N  N   . ASP C 1 126 ? 52.944  51.726  43.738  1.00 14.11 ? 157 ASP C N   1 
ATOM   9958  C  CA  . ASP C 1 126 ? 53.618  50.973  42.712  1.00 20.39 ? 157 ASP C CA  1 
ATOM   9959  C  C   . ASP C 1 126 ? 54.034  51.879  41.595  1.00 20.46 ? 157 ASP C C   1 
ATOM   9960  O  O   . ASP C 1 126 ? 54.740  51.445  40.709  1.00 23.29 ? 157 ASP C O   1 
ATOM   9961  C  CB  . ASP C 1 126 ? 52.693  49.892  42.161  1.00 29.22 ? 157 ASP C CB  1 
ATOM   9962  C  CG  . ASP C 1 126 ? 52.112  48.994  43.266  1.00 35.87 ? 157 ASP C CG  1 
ATOM   9963  O  OD1 . ASP C 1 126 ? 52.223  49.358  44.468  1.00 38.38 ? 157 ASP C OD1 1 
ATOM   9964  O  OD2 . ASP C 1 126 ? 51.550  47.918  42.929  1.00 40.25 ? 157 ASP C OD2 1 
ATOM   9965  N  N   . ASP C 1 127 ? 53.544  53.115  41.586  1.00 21.50 ? 158 ASP C N   1 
ATOM   9966  C  CA  . ASP C 1 127 ? 53.924  54.050  40.519  1.00 21.31 ? 158 ASP C CA  1 
ATOM   9967  C  C   . ASP C 1 127 ? 54.931  55.125  40.970  1.00 20.19 ? 158 ASP C C   1 
ATOM   9968  O  O   . ASP C 1 127 ? 55.202  56.082  40.245  1.00 23.75 ? 158 ASP C O   1 
ATOM   9969  C  CB  . ASP C 1 127 ? 52.679  54.630  39.785  1.00 20.97 ? 158 ASP C CB  1 
ATOM   9970  C  CG  . ASP C 1 127 ? 52.292  56.047  40.235  1.00 22.13 ? 158 ASP C CG  1 
ATOM   9971  O  OD1 . ASP C 1 127 ? 52.289  56.363  41.458  1.00 24.42 ? 158 ASP C OD1 1 
ATOM   9972  O  OD2 . ASP C 1 127 ? 51.956  56.838  39.328  1.00 20.32 ? 158 ASP C OD2 1 
ATOM   9973  N  N   . CYS C 1 128 ? 55.452  54.998  42.180  1.00 15.52 ? 159 CYS C N   1 
ATOM   9974  C  CA  . CYS C 1 128 ? 56.446  55.934  42.644  1.00 13.78 ? 159 CYS C CA  1 
ATOM   9975  C  C   . CYS C 1 128 ? 57.730  55.776  41.781  1.00 17.53 ? 159 CYS C C   1 
ATOM   9976  O  O   . CYS C 1 128 ? 57.798  54.870  40.940  1.00 18.98 ? 159 CYS C O   1 
ATOM   9977  C  CB  . CYS C 1 128 ? 56.710  55.658  44.106  1.00 10.87 ? 159 CYS C CB  1 
ATOM   9978  S  SG  . CYS C 1 128 ? 55.318  56.299  45.048  1.00 6.75  ? 159 CYS C SG  1 
ATOM   9979  N  N   . PRO C 1 129 ? 58.734  56.685  41.928  1.00 18.35 ? 160 PRO C N   1 
ATOM   9980  C  CA  . PRO C 1 129 ? 59.960  56.570  41.122  1.00 16.51 ? 160 PRO C CA  1 
ATOM   9981  C  C   . PRO C 1 129 ? 60.988  55.583  41.679  1.00 14.62 ? 160 PRO C C   1 
ATOM   9982  O  O   . PRO C 1 129 ? 61.654  54.869  40.922  1.00 12.52 ? 160 PRO C O   1 
ATOM   9983  C  CB  . PRO C 1 129 ? 60.487  58.001  41.123  1.00 15.19 ? 160 PRO C CB  1 
ATOM   9984  C  CG  . PRO C 1 129 ? 60.193  58.427  42.518  1.00 14.56 ? 160 PRO C CG  1 
ATOM   9985  C  CD  . PRO C 1 129 ? 58.769  57.937  42.717  1.00 17.39 ? 160 PRO C CD  1 
ATOM   9986  N  N   . THR C 1 130 ? 61.142  55.566  42.995  1.00 13.70 ? 161 THR C N   1 
ATOM   9987  C  CA  . THR C 1 130 ? 62.102  54.657  43.600  1.00 15.30 ? 161 THR C CA  1 
ATOM   9988  C  C   . THR C 1 130 ? 61.411  53.817  44.660  1.00 13.65 ? 161 THR C C   1 
ATOM   9989  O  O   . THR C 1 130 ? 60.491  54.281  45.346  1.00 11.08 ? 161 THR C O   1 
ATOM   9990  C  CB  . THR C 1 130 ? 63.291  55.389  44.279  1.00 16.60 ? 161 THR C CB  1 
ATOM   9991  O  OG1 . THR C 1 130 ? 62.959  55.697  45.645  1.00 20.09 ? 161 THR C OG1 1 
ATOM   9992  C  CG2 . THR C 1 130 ? 63.642  56.672  43.528  1.00 19.18 ? 161 THR C CG2 1 
ATOM   9993  N  N   . PRO C 1 131 ? 61.879  52.578  44.834  1.00 11.43 ? 162 PRO C N   1 
ATOM   9994  C  CA  . PRO C 1 131 ? 61.319  51.650  45.814  1.00 9.93  ? 162 PRO C CA  1 
ATOM   9995  C  C   . PRO C 1 131 ? 61.157  52.156  47.261  1.00 7.90  ? 162 PRO C C   1 
ATOM   9996  O  O   . PRO C 1 131 ? 60.447  51.557  48.062  1.00 9.90  ? 162 PRO C O   1 
ATOM   9997  C  CB  . PRO C 1 131 ? 62.238  50.422  45.688  1.00 11.85 ? 162 PRO C CB  1 
ATOM   9998  C  CG  . PRO C 1 131 ? 63.473  50.926  44.920  1.00 11.01 ? 162 PRO C CG  1 
ATOM   9999  C  CD  . PRO C 1 131 ? 62.898  51.924  43.991  1.00 9.93  ? 162 PRO C CD  1 
ATOM   10000 N  N   . MET C 1 132 ? 61.799  53.246  47.622  1.00 6.32  ? 163 MET C N   1 
ATOM   10001 C  CA  . MET C 1 132 ? 61.621  53.725  48.982  1.00 6.54  ? 163 MET C CA  1 
ATOM   10002 C  C   . MET C 1 132 ? 60.838  55.008  48.928  1.00 6.61  ? 163 MET C C   1 
ATOM   10003 O  O   . MET C 1 132 ? 60.668  55.719  49.935  1.00 5.42  ? 163 MET C O   1 
ATOM   10004 C  CB  . MET C 1 132 ? 62.965  53.951  49.631  1.00 9.56  ? 163 MET C CB  1 
ATOM   10005 C  CG  . MET C 1 132 ? 63.522  52.707  50.238  1.00 13.69 ? 163 MET C CG  1 
ATOM   10006 S  SD  . MET C 1 132 ? 62.524  52.209  51.629  1.00 14.63 ? 163 MET C SD  1 
ATOM   10007 C  CE  . MET C 1 132 ? 62.223  50.460  51.189  1.00 11.83 ? 163 MET C CE  1 
ATOM   10008 N  N   . GLY C 1 133 ? 60.424  55.315  47.708  1.00 4.91  ? 164 GLY C N   1 
ATOM   10009 C  CA  . GLY C 1 133 ? 59.644  56.493  47.445  1.00 5.80  ? 164 GLY C CA  1 
ATOM   10010 C  C   . GLY C 1 133 ? 60.212  57.232  46.267  1.00 7.85  ? 164 GLY C C   1 
ATOM   10011 O  O   . GLY C 1 133 ? 59.966  56.917  45.089  1.00 4.56  ? 164 GLY C O   1 
ATOM   10012 N  N   . VAL C 1 134 ? 61.008  58.232  46.608  1.00 10.40 ? 165 VAL C N   1 
ATOM   10013 C  CA  . VAL C 1 134 ? 61.617  59.067  45.608  1.00 12.06 ? 165 VAL C CA  1 
ATOM   10014 C  C   . VAL C 1 134 ? 63.132  59.067  45.841  1.00 13.83 ? 165 VAL C C   1 
ATOM   10015 O  O   . VAL C 1 134 ? 63.902  59.246  44.895  1.00 15.30 ? 165 VAL C O   1 
ATOM   10016 C  CB  . VAL C 1 134 ? 60.972  60.461  45.658  1.00 9.36  ? 165 VAL C CB  1 
ATOM   10017 C  CG1 . VAL C 1 134 ? 61.343  61.159  46.949  1.00 11.33 ? 165 VAL C CG1 1 
ATOM   10018 C  CG2 . VAL C 1 134 ? 61.320  61.245  44.422  1.00 12.27 ? 165 VAL C CG2 1 
ATOM   10019 N  N   . LYS C 1 135 ? 63.539  58.744  47.077  1.00 13.90 ? 166 LYS C N   1 
ATOM   10020 C  CA  . LYS C 1 135 ? 64.954  58.654  47.478  1.00 13.08 ? 166 LYS C CA  1 
ATOM   10021 C  C   . LYS C 1 135 ? 65.545  57.303  47.136  1.00 13.51 ? 166 LYS C C   1 
ATOM   10022 O  O   . LYS C 1 135 ? 64.942  56.268  47.430  1.00 14.17 ? 166 LYS C O   1 
ATOM   10023 C  CB  . LYS C 1 135 ? 65.107  58.799  48.984  1.00 12.70 ? 166 LYS C CB  1 
ATOM   10024 C  CG  . LYS C 1 135 ? 64.850  60.166  49.518  1.00 15.40 ? 166 LYS C CG  1 
ATOM   10025 C  CD  . LYS C 1 135 ? 65.154  60.212  50.998  1.00 16.14 ? 166 LYS C CD  1 
ATOM   10026 C  CE  . LYS C 1 135 ? 64.996  61.633  51.522  1.00 21.47 ? 166 LYS C CE  1 
ATOM   10027 N  NZ  . LYS C 1 135 ? 65.202  61.753  52.997  1.00 24.90 ? 166 LYS C NZ  1 
ATOM   10028 N  N   . GLY C 1 136 ? 66.763  57.304  46.606  1.00 15.73 ? 167 GLY C N   1 
ATOM   10029 C  CA  . GLY C 1 136 ? 67.432  56.055  46.251  1.00 14.32 ? 167 GLY C CA  1 
ATOM   10030 C  C   . GLY C 1 136 ? 67.594  55.832  44.754  1.00 12.63 ? 167 GLY C C   1 
ATOM   10031 O  O   . GLY C 1 136 ? 67.401  56.746  43.941  1.00 8.66  ? 167 GLY C O   1 
ATOM   10032 N  N   . ASN C 1 137 ? 67.924  54.598  44.389  1.00 13.41 ? 168 ASN C N   1 
ATOM   10033 C  CA  . ASN C 1 137 ? 68.134  54.247  42.991  1.00 15.80 ? 168 ASN C CA  1 
ATOM   10034 C  C   . ASN C 1 137 ? 67.016  53.361  42.491  1.00 14.91 ? 168 ASN C C   1 
ATOM   10035 O  O   . ASN C 1 137 ? 66.284  52.761  43.286  1.00 14.25 ? 168 ASN C O   1 
ATOM   10036 C  CB  . ASN C 1 137 ? 69.481  53.511  42.835  1.00 20.98 ? 168 ASN C CB  1 
ATOM   10037 C  CG  . ASN C 1 137 ? 69.765  53.066  41.392  1.00 27.64 ? 168 ASN C CG  1 
ATOM   10038 O  OD1 . ASN C 1 137 ? 69.794  51.859  41.096  1.00 31.33 ? 168 ASN C OD1 1 
ATOM   10039 N  ND2 . ASN C 1 137 ? 69.966  54.035  40.487  1.00 28.46 ? 168 ASN C ND2 1 
ATOM   10040 N  N   . LYS C 1 138 ? 66.912  53.266  41.167  1.00 13.57 ? 169 LYS C N   1 
ATOM   10041 C  CA  . LYS C 1 138 ? 65.935  52.419  40.518  1.00 14.89 ? 169 LYS C CA  1 
ATOM   10042 C  C   . LYS C 1 138 ? 65.847  51.105  41.268  1.00 14.27 ? 169 LYS C C   1 
ATOM   10043 O  O   . LYS C 1 138 ? 64.842  50.400  41.169  1.00 17.46 ? 169 LYS C O   1 
ATOM   10044 C  CB  . LYS C 1 138 ? 66.342  52.158  39.076  1.00 17.40 ? 169 LYS C CB  1 
ATOM   10045 C  CG  . LYS C 1 138 ? 65.339  52.671  38.043  1.00 26.06 ? 169 LYS C CG  1 
ATOM   10046 C  CD  . LYS C 1 138 ? 65.173  54.209  38.109  1.00 27.93 ? 169 LYS C CD  1 
ATOM   10047 C  CE  . LYS C 1 138 ? 64.438  54.765  36.877  1.00 28.77 ? 169 LYS C CE  1 
ATOM   10048 N  NZ  . LYS C 1 138 ? 62.997  54.372  36.791  1.00 32.51 ? 169 LYS C NZ  1 
ATOM   10049 N  N   . GLU C 1 139 ? 66.937  50.738  41.938  1.00 12.00 ? 170 GLU C N   1 
ATOM   10050 C  CA  . GLU C 1 139 ? 66.969  49.533  42.743  1.00 10.90 ? 170 GLU C CA  1 
ATOM   10051 C  C   . GLU C 1 139 ? 67.559  49.751  44.109  1.00 10.58 ? 170 GLU C C   1 
ATOM   10052 O  O   . GLU C 1 139 ? 67.981  50.846  44.465  1.00 11.91 ? 170 GLU C O   1 
ATOM   10053 C  CB  . GLU C 1 139 ? 67.714  48.414  42.059  1.00 10.24 ? 170 GLU C CB  1 
ATOM   10054 C  CG  . GLU C 1 139 ? 66.972  47.862  40.870  1.00 16.13 ? 170 GLU C CG  1 
ATOM   10055 C  CD  . GLU C 1 139 ? 67.099  48.762  39.675  1.00 20.36 ? 170 GLU C CD  1 
ATOM   10056 O  OE1 . GLU C 1 139 ? 68.130  49.497  39.631  1.00 25.32 ? 170 GLU C OE1 1 
ATOM   10057 O  OE2 . GLU C 1 139 ? 66.178  48.737  38.806  1.00 19.78 ? 170 GLU C OE2 1 
ATOM   10058 N  N   . LEU C 1 140 ? 67.537  48.685  44.882  1.00 12.09 ? 171 LEU C N   1 
ATOM   10059 C  CA  . LEU C 1 140 ? 68.042  48.665  46.240  1.00 14.65 ? 171 LEU C CA  1 
ATOM   10060 C  C   . LEU C 1 140 ? 69.267  47.737  46.276  1.00 17.71 ? 171 LEU C C   1 
ATOM   10061 O  O   . LEU C 1 140 ? 69.541  46.986  45.312  1.00 20.87 ? 171 LEU C O   1 
ATOM   10062 C  CB  . LEU C 1 140 ? 66.932  48.145  47.178  1.00 11.68 ? 171 LEU C CB  1 
ATOM   10063 C  CG  . LEU C 1 140 ? 66.245  49.125  48.130  1.00 9.80  ? 171 LEU C CG  1 
ATOM   10064 C  CD1 . LEU C 1 140 ? 66.194  50.510  47.525  1.00 12.36 ? 171 LEU C CD1 1 
ATOM   10065 C  CD2 . LEU C 1 140 ? 64.867  48.645  48.449  1.00 5.49  ? 171 LEU C CD2 1 
ATOM   10066 N  N   . PRO C 1 141 ? 70.032  47.781  47.375  1.00 17.17 ? 172 PRO C N   1 
ATOM   10067 C  CA  . PRO C 1 141 ? 71.217  46.936  47.506  1.00 16.22 ? 172 PRO C CA  1 
ATOM   10068 C  C   . PRO C 1 141 ? 70.847  45.504  47.215  1.00 13.67 ? 172 PRO C C   1 
ATOM   10069 O  O   . PRO C 1 141 ? 69.709  45.096  47.443  1.00 14.82 ? 172 PRO C O   1 
ATOM   10070 C  CB  . PRO C 1 141 ? 71.577  47.101  48.985  1.00 17.57 ? 172 PRO C CB  1 
ATOM   10071 C  CG  . PRO C 1 141 ? 71.196  48.521  49.246  1.00 17.07 ? 172 PRO C CG  1 
ATOM   10072 C  CD  . PRO C 1 141 ? 69.834  48.594  48.588  1.00 16.88 ? 172 PRO C CD  1 
ATOM   10073 N  N   . ASP C 1 142 ? 71.784  44.760  46.650  1.00 11.37 ? 173 ASP C N   1 
ATOM   10074 C  CA  . ASP C 1 142 ? 71.550  43.352  46.375  1.00 8.33  ? 173 ASP C CA  1 
ATOM   10075 C  C   . ASP C 1 142 ? 71.378  42.664  47.720  1.00 8.08  ? 173 ASP C C   1 
ATOM   10076 O  O   . ASP C 1 142 ? 72.169  42.849  48.649  1.00 2.04  ? 173 ASP C O   1 
ATOM   10077 C  CB  . ASP C 1 142 ? 72.722  42.732  45.633  1.00 7.64  ? 173 ASP C CB  1 
ATOM   10078 C  CG  . ASP C 1 142 ? 72.488  41.291  45.277  1.00 9.02  ? 173 ASP C CG  1 
ATOM   10079 O  OD1 . ASP C 1 142 ? 72.451  40.442  46.195  1.00 4.15  ? 173 ASP C OD1 1 
ATOM   10080 O  OD2 . ASP C 1 142 ? 72.358  41.022  44.061  1.00 12.34 ? 173 ASP C OD2 1 
ATOM   10081 N  N   . SER C 1 143 ? 70.301  41.896  47.800  1.00 10.06 ? 174 SER C N   1 
ATOM   10082 C  CA  . SER C 1 143 ? 69.903  41.144  48.979  1.00 10.70 ? 174 SER C CA  1 
ATOM   10083 C  C   . SER C 1 143 ? 71.000  40.185  49.408  1.00 13.96 ? 174 SER C C   1 
ATOM   10084 O  O   . SER C 1 143 ? 71.466  40.218  50.549  1.00 12.59 ? 174 SER C O   1 
ATOM   10085 C  CB  . SER C 1 143 ? 68.681  40.345  48.595  1.00 9.80  ? 174 SER C CB  1 
ATOM   10086 O  OG  . SER C 1 143 ? 68.824  39.899  47.242  1.00 6.06  ? 174 SER C OG  1 
ATOM   10087 N  N   . LYS C 1 144 ? 71.397  39.335  48.457  1.00 16.12 ? 175 LYS C N   1 
ATOM   10088 C  CA  . LYS C 1 144 ? 72.427  38.314  48.639  1.00 15.17 ? 175 LYS C CA  1 
ATOM   10089 C  C   . LYS C 1 144 ? 73.620  38.986  49.294  1.00 17.25 ? 175 LYS C C   1 
ATOM   10090 O  O   . LYS C 1 144 ? 74.141  38.506  50.318  1.00 16.56 ? 175 LYS C O   1 
ATOM   10091 C  CB  . LYS C 1 144 ? 72.788  37.697  47.264  1.00 11.06 ? 175 LYS C CB  1 
ATOM   10092 C  CG  . LYS C 1 144 ? 73.780  36.547  47.265  1.00 13.75 ? 175 LYS C CG  1 
ATOM   10093 C  CD  . LYS C 1 144 ? 73.569  35.572  48.423  1.00 22.97 ? 175 LYS C CD  1 
ATOM   10094 C  CE  . LYS C 1 144 ? 72.388  34.606  48.282  1.00 22.08 ? 175 LYS C CE  1 
ATOM   10095 N  NZ  . LYS C 1 144 ? 72.218  33.797  49.568  1.00 26.90 ? 175 LYS C NZ  1 
ATOM   10096 N  N   . GLU C 1 145 ? 73.944  40.175  48.778  1.00 19.27 ? 176 GLU C N   1 
ATOM   10097 C  CA  . GLU C 1 145 ? 75.070  40.955  49.269  1.00 17.87 ? 176 GLU C CA  1 
ATOM   10098 C  C   . GLU C 1 145 ? 74.879  41.439  50.692  1.00 12.08 ? 176 GLU C C   1 
ATOM   10099 O  O   . GLU C 1 145 ? 75.667  41.125  51.568  1.00 10.15 ? 176 GLU C O   1 
ATOM   10100 C  CB  . GLU C 1 145 ? 75.334  42.133  48.358  1.00 24.95 ? 176 GLU C CB  1 
ATOM   10101 C  CG  . GLU C 1 145 ? 76.795  42.536  48.312  1.00 39.91 ? 176 GLU C CG  1 
ATOM   10102 C  CD  . GLU C 1 145 ? 77.236  42.936  46.903  1.00 49.85 ? 176 GLU C CD  1 
ATOM   10103 O  OE1 . GLU C 1 145 ? 77.513  42.001  46.091  1.00 54.31 ? 176 GLU C OE1 1 
ATOM   10104 O  OE2 . GLU C 1 145 ? 77.277  44.173  46.609  1.00 54.85 ? 176 GLU C OE2 1 
ATOM   10105 N  N   . VAL C 1 146 ? 73.808  42.161  50.943  1.00 7.50  ? 177 VAL C N   1 
ATOM   10106 C  CA  . VAL C 1 146 ? 73.564  42.664  52.294  1.00 6.46  ? 177 VAL C CA  1 
ATOM   10107 C  C   . VAL C 1 146 ? 73.586  41.508  53.312  1.00 6.12  ? 177 VAL C C   1 
ATOM   10108 O  O   . VAL C 1 146 ? 74.073  41.626  54.456  1.00 2.00  ? 177 VAL C O   1 
ATOM   10109 C  CB  . VAL C 1 146 ? 72.184  43.357  52.387  1.00 5.67  ? 177 VAL C CB  1 
ATOM   10110 C  CG1 . VAL C 1 146 ? 72.096  44.115  53.694  1.00 2.26  ? 177 VAL C CG1 1 
ATOM   10111 C  CG2 . VAL C 1 146 ? 71.916  44.285  51.152  1.00 4.20  ? 177 VAL C CG2 1 
ATOM   10112 N  N   . LEU C 1 147 ? 73.040  40.388  52.854  1.00 7.73  ? 178 LEU C N   1 
ATOM   10113 C  CA  . LEU C 1 147 ? 72.912  39.157  53.618  1.00 7.20  ? 178 LEU C CA  1 
ATOM   10114 C  C   . LEU C 1 147 ? 74.286  38.738  54.109  1.00 7.87  ? 178 LEU C C   1 
ATOM   10115 O  O   . LEU C 1 147 ? 74.514  38.554  55.314  1.00 6.88  ? 178 LEU C O   1 
ATOM   10116 C  CB  . LEU C 1 147 ? 72.301  38.091  52.691  1.00 6.33  ? 178 LEU C CB  1 
ATOM   10117 C  CG  . LEU C 1 147 ? 71.878  36.691  53.137  1.00 5.20  ? 178 LEU C CG  1 
ATOM   10118 C  CD1 . LEU C 1 147 ? 72.844  35.636  52.584  1.00 2.00  ? 178 LEU C CD1 1 
ATOM   10119 C  CD2 . LEU C 1 147 ? 71.702  36.631  54.653  1.00 2.38  ? 178 LEU C CD2 1 
ATOM   10120 N  N   . GLU C 1 148 ? 75.213  38.659  53.163  1.00 10.60 ? 179 GLU C N   1 
ATOM   10121 C  CA  . GLU C 1 148 ? 76.594  38.262  53.438  1.00 10.26 ? 179 GLU C CA  1 
ATOM   10122 C  C   . GLU C 1 148 ? 77.462  39.291  54.149  1.00 7.65  ? 179 GLU C C   1 
ATOM   10123 O  O   . GLU C 1 148 ? 78.090  38.974  55.152  1.00 7.49  ? 179 GLU C O   1 
ATOM   10124 C  CB  . GLU C 1 148 ? 77.266  37.821  52.155  1.00 10.11 ? 179 GLU C CB  1 
ATOM   10125 C  CG  . GLU C 1 148 ? 76.657  36.559  51.609  1.00 12.92 ? 179 GLU C CG  1 
ATOM   10126 C  CD  . GLU C 1 148 ? 77.053  36.320  50.173  1.00 20.14 ? 179 GLU C CD  1 
ATOM   10127 O  OE1 . GLU C 1 148 ? 77.374  37.297  49.447  1.00 22.12 ? 179 GLU C OE1 1 
ATOM   10128 O  OE2 . GLU C 1 148 ? 77.038  35.145  49.757  1.00 23.92 ? 179 GLU C OE2 1 
ATOM   10129 N  N   . LYS C 1 149 ? 77.492  40.519  53.644  1.00 5.12  ? 180 LYS C N   1 
ATOM   10130 C  CA  . LYS C 1 149 ? 78.296  41.557  54.276  1.00 3.97  ? 180 LYS C CA  1 
ATOM   10131 C  C   . LYS C 1 149 ? 77.990  41.887  55.752  1.00 3.86  ? 180 LYS C C   1 
ATOM   10132 O  O   . LYS C 1 149 ? 78.857  41.735  56.603  1.00 3.30  ? 180 LYS C O   1 
ATOM   10133 C  CB  . LYS C 1 149 ? 78.305  42.802  53.408  1.00 2.01  ? 180 LYS C CB  1 
ATOM   10134 C  CG  . LYS C 1 149 ? 78.899  42.560  52.008  1.00 3.65  ? 180 LYS C CG  1 
ATOM   10135 C  CD  . LYS C 1 149 ? 78.941  43.879  51.262  1.00 9.44  ? 180 LYS C CD  1 
ATOM   10136 C  CE  . LYS C 1 149 ? 79.634  43.856  49.911  1.00 14.41 ? 180 LYS C CE  1 
ATOM   10137 N  NZ  . LYS C 1 149 ? 79.742  45.276  49.388  1.00 15.52 ? 180 LYS C NZ  1 
ATOM   10138 N  N   . VAL C 1 150 ? 76.762  42.266  56.080  1.00 4.37  ? 181 VAL C N   1 
ATOM   10139 C  CA  . VAL C 1 150 ? 76.465  42.595  57.469  1.00 5.16  ? 181 VAL C CA  1 
ATOM   10140 C  C   . VAL C 1 150 ? 75.619  41.623  58.244  1.00 6.38  ? 181 VAL C C   1 
ATOM   10141 O  O   . VAL C 1 150 ? 75.514  41.758  59.482  1.00 7.10  ? 181 VAL C O   1 
ATOM   10142 C  CB  . VAL C 1 150 ? 75.774  43.965  57.615  1.00 6.48  ? 181 VAL C CB  1 
ATOM   10143 C  CG1 . VAL C 1 150 ? 76.793  45.088  57.440  1.00 8.83  ? 181 VAL C CG1 1 
ATOM   10144 C  CG2 . VAL C 1 150 ? 74.621  44.094  56.613  1.00 6.30  ? 181 VAL C CG2 1 
ATOM   10145 N  N   . LEU C 1 151 ? 75.018  40.647  57.560  1.00 6.47  ? 182 LEU C N   1 
ATOM   10146 C  CA  . LEU C 1 151 ? 74.139  39.732  58.279  1.00 8.62  ? 182 LEU C CA  1 
ATOM   10147 C  C   . LEU C 1 151 ? 74.666  38.393  58.769  1.00 7.21  ? 182 LEU C C   1 
ATOM   10148 O  O   . LEU C 1 151 ? 74.627  38.107  59.971  1.00 8.93  ? 182 LEU C O   1 
ATOM   10149 C  CB  . LEU C 1 151 ? 72.817  39.539  57.516  1.00 9.14  ? 182 LEU C CB  1 
ATOM   10150 C  CG  . LEU C 1 151 ? 71.776  40.661  57.479  1.00 7.52  ? 182 LEU C CG  1 
ATOM   10151 C  CD1 . LEU C 1 151 ? 70.792  40.321  56.392  1.00 6.09  ? 182 LEU C CD1 1 
ATOM   10152 C  CD2 . LEU C 1 151 ? 71.088  40.865  58.848  1.00 2.00  ? 182 LEU C CD2 1 
ATOM   10153 N  N   . LEU C 1 152 ? 75.094  37.555  57.844  1.00 3.98  ? 183 LEU C N   1 
ATOM   10154 C  CA  . LEU C 1 152 ? 75.571  36.240  58.208  1.00 6.41  ? 183 LEU C CA  1 
ATOM   10155 C  C   . LEU C 1 152 ? 76.565  36.159  59.381  1.00 7.85  ? 183 LEU C C   1 
ATOM   10156 O  O   . LEU C 1 152 ? 77.359  37.059  59.595  1.00 6.17  ? 183 LEU C O   1 
ATOM   10157 C  CB  . LEU C 1 152 ? 76.144  35.567  56.978  1.00 6.53  ? 183 LEU C CB  1 
ATOM   10158 C  CG  . LEU C 1 152 ? 75.084  35.014  56.037  1.00 6.02  ? 183 LEU C CG  1 
ATOM   10159 C  CD1 . LEU C 1 152 ? 75.717  34.810  54.682  1.00 7.82  ? 183 LEU C CD1 1 
ATOM   10160 C  CD2 . LEU C 1 152 ? 74.551  33.702  56.581  1.00 5.63  ? 183 LEU C CD2 1 
ATOM   10161 N  N   . ARG C 1 153 ? 76.464  35.076  60.149  1.00 10.18 ? 184 ARG C N   1 
ATOM   10162 C  CA  . ARG C 1 153 ? 77.316  34.790  61.310  1.00 11.15 ? 184 ARG C CA  1 
ATOM   10163 C  C   . ARG C 1 153 ? 78.661  34.178  60.912  1.00 12.89 ? 184 ARG C C   1 
ATOM   10164 O  O   . ARG C 1 153 ? 78.720  33.256  60.090  1.00 13.02 ? 184 ARG C O   1 
ATOM   10165 C  CB  . ARG C 1 153 ? 76.592  33.822  62.258  1.00 7.94  ? 184 ARG C CB  1 
ATOM   10166 C  CG  . ARG C 1 153 ? 77.478  32.924  63.084  1.00 4.10  ? 184 ARG C CG  1 
ATOM   10167 C  CD  . ARG C 1 153 ? 76.643  31.930  63.842  1.00 6.29  ? 184 ARG C CD  1 
ATOM   10168 N  NE  . ARG C 1 153 ? 75.741  32.606  64.770  1.00 4.83  ? 184 ARG C NE  1 
ATOM   10169 C  CZ  . ARG C 1 153 ? 74.817  32.007  65.509  1.00 3.90  ? 184 ARG C CZ  1 
ATOM   10170 N  NH1 . ARG C 1 153 ? 74.628  30.701  65.439  1.00 3.78  ? 184 ARG C NH1 1 
ATOM   10171 N  NH2 . ARG C 1 153 ? 74.148  32.713  66.392  1.00 2.01  ? 184 ARG C NH2 1 
ATOM   10172 N  N   . ARG C 1 154 ? 79.737  34.700  61.497  1.00 13.12 ? 185 ARG C N   1 
ATOM   10173 C  CA  . ARG C 1 154 ? 81.074  34.180  61.230  1.00 12.28 ? 185 ARG C CA  1 
ATOM   10174 C  C   . ARG C 1 154 ? 81.348  33.351  62.460  1.00 12.70 ? 185 ARG C C   1 
ATOM   10175 O  O   . ARG C 1 154 ? 81.425  32.128  62.413  1.00 15.02 ? 185 ARG C O   1 
ATOM   10176 C  CB  . ARG C 1 154 ? 82.112  35.294  61.180  1.00 12.32 ? 185 ARG C CB  1 
ATOM   10177 C  CG  . ARG C 1 154 ? 81.659  36.589  60.545  1.00 10.08 ? 185 ARG C CG  1 
ATOM   10178 C  CD  . ARG C 1 154 ? 81.386  36.422  59.088  1.00 8.41  ? 185 ARG C CD  1 
ATOM   10179 N  NE  . ARG C 1 154 ? 81.055  37.710  58.499  1.00 8.74  ? 185 ARG C NE  1 
ATOM   10180 C  CZ  . ARG C 1 154 ? 80.769  37.890  57.209  1.00 13.85 ? 185 ARG C CZ  1 
ATOM   10181 N  NH1 . ARG C 1 154 ? 80.760  36.865  56.347  1.00 15.42 ? 185 ARG C NH1 1 
ATOM   10182 N  NH2 . ARG C 1 154 ? 80.530  39.114  56.764  1.00 14.36 ? 185 ARG C NH2 1 
ATOM   10183 N  N   . GLU C 1 155 ? 81.421  34.023  63.592  1.00 12.55 ? 186 GLU C N   1 
ATOM   10184 C  CA  . GLU C 1 155 ? 81.673  33.317  64.823  1.00 16.10 ? 186 GLU C CA  1 
ATOM   10185 C  C   . GLU C 1 155 ? 80.459  33.565  65.703  1.00 13.61 ? 186 GLU C C   1 
ATOM   10186 O  O   . GLU C 1 155 ? 79.991  34.695  65.826  1.00 9.85  ? 186 GLU C O   1 
ATOM   10187 C  CB  . GLU C 1 155 ? 82.942  33.853  65.474  1.00 23.88 ? 186 GLU C CB  1 
ATOM   10188 C  CG  . GLU C 1 155 ? 83.477  32.977  66.605  1.00 32.13 ? 186 GLU C CG  1 
ATOM   10189 C  CD  . GLU C 1 155 ? 84.564  33.678  67.411  1.00 35.95 ? 186 GLU C CD  1 
ATOM   10190 O  OE1 . GLU C 1 155 ? 85.188  34.618  66.839  1.00 39.34 ? 186 GLU C OE1 1 
ATOM   10191 O  OE2 . GLU C 1 155 ? 84.769  33.304  68.604  1.00 35.07 ? 186 GLU C OE2 1 
ATOM   10192 N  N   . PHE C 1 156 ? 79.922  32.493  66.270  1.00 13.22 ? 187 PHE C N   1 
ATOM   10193 C  CA  . PHE C 1 156 ? 78.749  32.602  67.116  1.00 10.79 ? 187 PHE C CA  1 
ATOM   10194 C  C   . PHE C 1 156 ? 78.943  33.592  68.251  1.00 9.06  ? 187 PHE C C   1 
ATOM   10195 O  O   . PHE C 1 156 ? 79.806  33.398  69.115  1.00 8.90  ? 187 PHE C O   1 
ATOM   10196 C  CB  . PHE C 1 156 ? 78.370  31.233  67.693  1.00 12.63 ? 187 PHE C CB  1 
ATOM   10197 C  CG  . PHE C 1 156 ? 77.345  31.305  68.795  1.00 13.65 ? 187 PHE C CG  1 
ATOM   10198 C  CD1 . PHE C 1 156 ? 77.730  31.539  70.111  1.00 14.18 ? 187 PHE C CD1 1 
ATOM   10199 C  CD2 . PHE C 1 156 ? 75.997  31.190  68.513  1.00 14.83 ? 187 PHE C CD2 1 
ATOM   10200 C  CE1 . PHE C 1 156 ? 76.799  31.662  71.130  1.00 13.25 ? 187 PHE C CE1 1 
ATOM   10201 C  CE2 . PHE C 1 156 ? 75.061  31.312  69.527  1.00 16.82 ? 187 PHE C CE2 1 
ATOM   10202 C  CZ  . PHE C 1 156 ? 75.474  31.551  70.847  1.00 15.54 ? 187 PHE C CZ  1 
ATOM   10203 N  N   . ILE C 1 157 ? 78.114  34.632  68.259  1.00 7.69  ? 188 ILE C N   1 
ATOM   10204 C  CA  . ILE C 1 157 ? 78.144  35.633  69.317  1.00 5.17  ? 188 ILE C CA  1 
ATOM   10205 C  C   . ILE C 1 157 ? 76.992  35.270  70.230  1.00 4.49  ? 188 ILE C C   1 
ATOM   10206 O  O   . ILE C 1 157 ? 75.871  35.103  69.770  1.00 4.25  ? 188 ILE C O   1 
ATOM   10207 C  CB  . ILE C 1 157 ? 77.866  37.036  68.768  1.00 4.24  ? 188 ILE C CB  1 
ATOM   10208 C  CG1 . ILE C 1 157 ? 78.654  37.266  67.482  1.00 3.60  ? 188 ILE C CG1 1 
ATOM   10209 C  CG2 . ILE C 1 157 ? 78.213  38.094  69.818  1.00 2.62  ? 188 ILE C CG2 1 
ATOM   10210 C  CD1 . ILE C 1 157 ? 78.248  38.530  66.745  1.00 6.48  ? 188 ILE C CD1 1 
ATOM   10211 N  N   . PRO C 1 158 ? 77.260  35.076  71.515  1.00 4.51  ? 189 PRO C N   1 
ATOM   10212 C  CA  . PRO C 1 158 ? 76.178  34.730  72.419  1.00 6.68  ? 189 PRO C CA  1 
ATOM   10213 C  C   . PRO C 1 158 ? 75.428  35.986  72.845  1.00 8.34  ? 189 PRO C C   1 
ATOM   10214 O  O   . PRO C 1 158 ? 75.894  37.108  72.644  1.00 7.17  ? 189 PRO C O   1 
ATOM   10215 C  CB  . PRO C 1 158 ? 76.919  34.110  73.599  1.00 6.82  ? 189 PRO C CB  1 
ATOM   10216 C  CG  . PRO C 1 158 ? 78.085  34.979  73.716  1.00 7.60  ? 189 PRO C CG  1 
ATOM   10217 C  CD  . PRO C 1 158 ? 78.541  35.092  72.235  1.00 7.16  ? 189 PRO C CD  1 
ATOM   10218 N  N   . ASP C 1 159 ? 74.244  35.786  73.415  1.00 10.44 ? 190 ASP C N   1 
ATOM   10219 C  CA  . ASP C 1 159 ? 73.431  36.888  73.884  1.00 9.63  ? 190 ASP C CA  1 
ATOM   10220 C  C   . ASP C 1 159 ? 73.968  37.335  75.257  1.00 7.75  ? 190 ASP C C   1 
ATOM   10221 O  O   . ASP C 1 159 ? 74.161  36.514  76.164  1.00 2.00  ? 190 ASP C O   1 
ATOM   10222 C  CB  . ASP C 1 159 ? 71.956  36.454  73.958  1.00 8.64  ? 190 ASP C CB  1 
ATOM   10223 C  CG  . ASP C 1 159 ? 71.103  37.346  74.879  1.00 12.49 ? 190 ASP C CG  1 
ATOM   10224 O  OD1 . ASP C 1 159 ? 71.044  38.572  74.684  1.00 13.14 ? 190 ASP C OD1 1 
ATOM   10225 O  OD2 . ASP C 1 159 ? 70.488  36.822  75.824  1.00 12.15 ? 190 ASP C OD2 1 
ATOM   10226 N  N   . PRO C 1 160 ? 74.289  38.637  75.395  1.00 6.82  ? 191 PRO C N   1 
ATOM   10227 C  CA  . PRO C 1 160 ? 74.790  39.127  76.682  1.00 7.13  ? 191 PRO C CA  1 
ATOM   10228 C  C   . PRO C 1 160 ? 73.696  39.118  77.750  1.00 7.89  ? 191 PRO C C   1 
ATOM   10229 O  O   . PRO C 1 160 ? 73.960  39.466  78.899  1.00 10.93 ? 191 PRO C O   1 
ATOM   10230 C  CB  . PRO C 1 160 ? 75.226  40.552  76.352  1.00 6.71  ? 191 PRO C CB  1 
ATOM   10231 C  CG  . PRO C 1 160 ? 74.261  40.929  75.267  1.00 6.61  ? 191 PRO C CG  1 
ATOM   10232 C  CD  . PRO C 1 160 ? 74.321  39.709  74.385  1.00 2.97  ? 191 PRO C CD  1 
ATOM   10233 N  N   . GLN C 1 161 ? 72.466  38.754  77.369  1.00 7.26  ? 192 GLN C N   1 
ATOM   10234 C  CA  . GLN C 1 161 ? 71.353  38.729  78.318  1.00 4.49  ? 192 GLN C CA  1 
ATOM   10235 C  C   . GLN C 1 161 ? 71.109  37.403  78.982  1.00 2.51  ? 192 GLN C C   1 
ATOM   10236 O  O   . GLN C 1 161 ? 70.509  37.344  80.047  1.00 2.06  ? 192 GLN C O   1 
ATOM   10237 C  CB  . GLN C 1 161 ? 70.080  39.288  77.699  1.00 3.95  ? 192 GLN C CB  1 
ATOM   10238 C  CG  . GLN C 1 161 ? 70.095  40.823  77.610  1.00 7.11  ? 192 GLN C CG  1 
ATOM   10239 C  CD  . GLN C 1 161 ? 68.705  41.435  77.576  1.00 6.42  ? 192 GLN C CD  1 
ATOM   10240 O  OE1 . GLN C 1 161 ? 68.242  41.897  76.521  1.00 4.90  ? 192 GLN C OE1 1 
ATOM   10241 N  NE2 . GLN C 1 161 ? 68.031  41.439  78.725  1.00 5.37  ? 192 GLN C NE2 1 
ATOM   10242 N  N   . GLY C 1 162 ? 71.590  36.340  78.356  1.00 2.62  ? 193 GLY C N   1 
ATOM   10243 C  CA  . GLY C 1 162 ? 71.454  35.018  78.948  1.00 3.08  ? 193 GLY C CA  1 
ATOM   10244 C  C   . GLY C 1 162 ? 70.394  34.126  78.356  1.00 3.84  ? 193 GLY C C   1 
ATOM   10245 O  O   . GLY C 1 162 ? 70.189  33.005  78.814  1.00 3.51  ? 193 GLY C O   1 
ATOM   10246 N  N   . SER C 1 163 ? 69.715  34.635  77.338  1.00 4.85  ? 194 SER C N   1 
ATOM   10247 C  CA  . SER C 1 163 ? 68.655  33.905  76.672  1.00 4.89  ? 194 SER C CA  1 
ATOM   10248 C  C   . SER C 1 163 ? 69.152  32.539  76.369  1.00 4.87  ? 194 SER C C   1 
ATOM   10249 O  O   . SER C 1 163 ? 70.104  32.409  75.624  1.00 4.63  ? 194 SER C O   1 
ATOM   10250 C  CB  . SER C 1 163 ? 68.293  34.582  75.359  1.00 2.00  ? 194 SER C CB  1 
ATOM   10251 O  OG  . SER C 1 163 ? 67.671  35.814  75.655  1.00 8.30  ? 194 SER C OG  1 
ATOM   10252 N  N   . ASN C 1 164 ? 68.562  31.527  76.997  1.00 4.25  ? 195 ASN C N   1 
ATOM   10253 C  CA  . ASN C 1 164 ? 68.993  30.164  76.735  1.00 4.35  ? 195 ASN C CA  1 
ATOM   10254 C  C   . ASN C 1 164 ? 68.195  29.520  75.610  1.00 4.30  ? 195 ASN C C   1 
ATOM   10255 O  O   . ASN C 1 164 ? 67.694  30.226  74.723  1.00 2.95  ? 195 ASN C O   1 
ATOM   10256 C  CB  . ASN C 1 164 ? 68.930  29.325  77.993  1.00 4.55  ? 195 ASN C CB  1 
ATOM   10257 C  CG  . ASN C 1 164 ? 67.583  29.364  78.635  1.00 6.26  ? 195 ASN C CG  1 
ATOM   10258 O  OD1 . ASN C 1 164 ? 66.610  29.784  78.029  1.00 7.01  ? 195 ASN C OD1 1 
ATOM   10259 N  ND2 . ASN C 1 164 ? 67.518  28.947  79.882  1.00 7.29  ? 195 ASN C ND2 1 
ATOM   10260 N  N   . MET C 1 165 ? 68.135  28.185  75.606  1.00 5.36  ? 196 MET C N   1 
ATOM   10261 C  CA  . MET C 1 165 ? 67.407  27.437  74.567  1.00 5.98  ? 196 MET C CA  1 
ATOM   10262 C  C   . MET C 1 165 ? 65.903  27.284  74.871  1.00 4.61  ? 196 MET C C   1 
ATOM   10263 O  O   . MET C 1 165 ? 65.070  27.244  73.969  1.00 4.64  ? 196 MET C O   1 
ATOM   10264 C  CB  . MET C 1 165 ? 68.086  26.086  74.307  1.00 2.00  ? 196 MET C CB  1 
ATOM   10265 C  CG  . MET C 1 165 ? 68.516  25.927  72.884  1.00 2.00  ? 196 MET C CG  1 
ATOM   10266 S  SD  . MET C 1 165 ? 68.995  27.511  72.200  1.00 2.00  ? 196 MET C SD  1 
ATOM   10267 C  CE  . MET C 1 165 ? 68.786  27.223  70.406  1.00 2.00  ? 196 MET C CE  1 
ATOM   10268 N  N   . MET C 1 166 ? 65.573  27.252  76.152  1.00 3.07  ? 197 MET C N   1 
ATOM   10269 C  CA  . MET C 1 166 ? 64.203  27.155  76.588  1.00 3.02  ? 197 MET C CA  1 
ATOM   10270 C  C   . MET C 1 166 ? 63.478  28.377  76.030  1.00 5.46  ? 197 MET C C   1 
ATOM   10271 O  O   . MET C 1 166 ? 62.397  28.254  75.447  1.00 7.20  ? 197 MET C O   1 
ATOM   10272 C  CB  . MET C 1 166 ? 64.142  27.164  78.109  1.00 2.00  ? 197 MET C CB  1 
ATOM   10273 C  CG  . MET C 1 166 ? 62.952  26.461  78.645  1.00 2.03  ? 197 MET C CG  1 
ATOM   10274 S  SD  . MET C 1 166 ? 63.133  24.705  78.766  1.00 8.47  ? 197 MET C SD  1 
ATOM   10275 C  CE  . MET C 1 166 ? 63.284  24.152  77.047  1.00 2.23  ? 197 MET C CE  1 
ATOM   10276 N  N   . PHE C 1 167 ? 64.097  29.548  76.179  1.00 4.45  ? 198 PHE C N   1 
ATOM   10277 C  CA  . PHE C 1 167 ? 63.545  30.796  75.678  1.00 2.00  ? 198 PHE C CA  1 
ATOM   10278 C  C   . PHE C 1 167 ? 63.428  30.808  74.159  1.00 2.00  ? 198 PHE C C   1 
ATOM   10279 O  O   . PHE C 1 167 ? 62.354  30.926  73.643  1.00 3.87  ? 198 PHE C O   1 
ATOM   10280 C  CB  . PHE C 1 167 ? 64.396  31.948  76.173  1.00 2.00  ? 198 PHE C CB  1 
ATOM   10281 C  CG  . PHE C 1 167 ? 64.146  33.264  75.487  1.00 2.00  ? 198 PHE C CG  1 
ATOM   10282 C  CD1 . PHE C 1 167 ? 64.504  33.465  74.153  1.00 2.57  ? 198 PHE C CD1 1 
ATOM   10283 C  CD2 . PHE C 1 167 ? 63.639  34.344  76.206  1.00 2.00  ? 198 PHE C CD2 1 
ATOM   10284 C  CE1 . PHE C 1 167 ? 64.365  34.711  73.550  1.00 3.42  ? 198 PHE C CE1 1 
ATOM   10285 C  CE2 . PHE C 1 167 ? 63.496  35.592  75.615  1.00 2.06  ? 198 PHE C CE2 1 
ATOM   10286 C  CZ  . PHE C 1 167 ? 63.859  35.776  74.289  1.00 3.28  ? 198 PHE C CZ  1 
ATOM   10287 N  N   . ALA C 1 168 ? 64.521  30.680  73.431  1.00 3.47  ? 199 ALA C N   1 
ATOM   10288 C  CA  . ALA C 1 168 ? 64.447  30.715  71.966  1.00 6.49  ? 199 ALA C CA  1 
ATOM   10289 C  C   . ALA C 1 168 ? 63.352  29.860  71.373  1.00 7.30  ? 199 ALA C C   1 
ATOM   10290 O  O   . ALA C 1 168 ? 62.633  30.293  70.465  1.00 8.87  ? 199 ALA C O   1 
ATOM   10291 C  CB  . ALA C 1 168 ? 65.779  30.341  71.341  1.00 8.93  ? 199 ALA C CB  1 
ATOM   10292 N  N   . PHE C 1 169 ? 63.234  28.635  71.868  1.00 7.01  ? 200 PHE C N   1 
ATOM   10293 C  CA  . PHE C 1 169 ? 62.203  27.743  71.382  1.00 5.88  ? 200 PHE C CA  1 
ATOM   10294 C  C   . PHE C 1 169 ? 60.797  28.187  71.828  1.00 6.49  ? 200 PHE C C   1 
ATOM   10295 O  O   . PHE C 1 169 ? 59.850  28.131  71.041  1.00 6.04  ? 200 PHE C O   1 
ATOM   10296 C  CB  . PHE C 1 169 ? 62.540  26.321  71.765  1.00 3.40  ? 200 PHE C CB  1 
ATOM   10297 C  CG  . PHE C 1 169 ? 63.481  25.672  70.814  1.00 2.81  ? 200 PHE C CG  1 
ATOM   10298 C  CD1 . PHE C 1 169 ? 63.324  25.845  69.432  1.00 2.38  ? 200 PHE C CD1 1 
ATOM   10299 C  CD2 . PHE C 1 169 ? 64.522  24.877  71.285  1.00 3.13  ? 200 PHE C CD2 1 
ATOM   10300 C  CE1 . PHE C 1 169 ? 64.192  25.228  68.538  1.00 3.64  ? 200 PHE C CE1 1 
ATOM   10301 C  CE2 . PHE C 1 169 ? 65.399  24.255  70.399  1.00 4.08  ? 200 PHE C CE2 1 
ATOM   10302 C  CZ  . PHE C 1 169 ? 65.233  24.432  69.020  1.00 5.08  ? 200 PHE C CZ  1 
ATOM   10303 N  N   . PHE C 1 170 ? 60.671  28.677  73.062  1.00 4.97  ? 201 PHE C N   1 
ATOM   10304 C  CA  . PHE C 1 170 ? 59.399  29.202  73.550  1.00 2.68  ? 201 PHE C CA  1 
ATOM   10305 C  C   . PHE C 1 170 ? 58.906  30.284  72.573  1.00 2.00  ? 201 PHE C C   1 
ATOM   10306 O  O   . PHE C 1 170 ? 57.819  30.196  72.053  1.00 4.93  ? 201 PHE C O   1 
ATOM   10307 C  CB  . PHE C 1 170 ? 59.563  29.798  74.931  1.00 2.00  ? 201 PHE C CB  1 
ATOM   10308 C  CG  . PHE C 1 170 ? 58.277  30.106  75.593  1.00 4.04  ? 201 PHE C CG  1 
ATOM   10309 C  CD1 . PHE C 1 170 ? 57.594  31.273  75.297  1.00 4.01  ? 201 PHE C CD1 1 
ATOM   10310 C  CD2 . PHE C 1 170 ? 57.719  29.213  76.521  1.00 4.39  ? 201 PHE C CD2 1 
ATOM   10311 C  CE1 . PHE C 1 170 ? 56.363  31.544  75.927  1.00 4.67  ? 201 PHE C CE1 1 
ATOM   10312 C  CE2 . PHE C 1 170 ? 56.486  29.474  77.156  1.00 2.00  ? 201 PHE C CE2 1 
ATOM   10313 C  CZ  . PHE C 1 170 ? 55.818  30.627  76.862  1.00 2.00  ? 201 PHE C CZ  1 
ATOM   10314 N  N   . ALA C 1 171 ? 59.729  31.264  72.263  1.00 2.00  ? 202 ALA C N   1 
ATOM   10315 C  CA  . ALA C 1 171 ? 59.353  32.304  71.325  1.00 2.13  ? 202 ALA C CA  1 
ATOM   10316 C  C   . ALA C 1 171 ? 59.036  31.777  69.937  1.00 2.00  ? 202 ALA C C   1 
ATOM   10317 O  O   . ALA C 1 171 ? 58.341  32.446  69.170  1.00 2.00  ? 202 ALA C O   1 
ATOM   10318 C  CB  . ALA C 1 171 ? 60.455  33.331  71.224  1.00 5.27  ? 202 ALA C CB  1 
ATOM   10319 N  N   . GLN C 1 172 ? 59.583  30.623  69.567  1.00 3.34  ? 203 GLN C N   1 
ATOM   10320 C  CA  . GLN C 1 172 ? 59.280  30.080  68.230  1.00 5.39  ? 203 GLN C CA  1 
ATOM   10321 C  C   . GLN C 1 172 ? 57.849  29.542  68.226  1.00 4.23  ? 203 GLN C C   1 
ATOM   10322 O  O   . GLN C 1 172 ? 57.023  29.875  67.379  1.00 2.00  ? 203 GLN C O   1 
ATOM   10323 C  CB  . GLN C 1 172 ? 60.252  28.959  67.829  1.00 5.56  ? 203 GLN C CB  1 
ATOM   10324 C  CG  . GLN C 1 172 ? 59.996  28.489  66.397  1.00 5.40  ? 203 GLN C CG  1 
ATOM   10325 C  CD  . GLN C 1 172 ? 61.000  27.493  65.870  1.00 5.63  ? 203 GLN C CD  1 
ATOM   10326 O  OE1 . GLN C 1 172 ? 60.997  27.179  64.672  1.00 2.89  ? 203 GLN C OE1 1 
ATOM   10327 N  NE2 . GLN C 1 172 ? 61.863  26.983  66.749  1.00 7.12  ? 203 GLN C NE2 1 
ATOM   10328 N  N   . HIS C 1 173 ? 57.603  28.696  69.207  1.00 3.13  ? 204 HIS C N   1 
ATOM   10329 C  CA  . HIS C 1 173 ? 56.335  28.064  69.463  1.00 4.02  ? 204 HIS C CA  1 
ATOM   10330 C  C   . HIS C 1 173 ? 55.287  29.153  69.621  1.00 4.11  ? 204 HIS C C   1 
ATOM   10331 O  O   . HIS C 1 173 ? 54.364  29.235  68.816  1.00 6.91  ? 204 HIS C O   1 
ATOM   10332 C  CB  . HIS C 1 173 ? 56.497  27.287  70.763  1.00 7.04  ? 204 HIS C CB  1 
ATOM   10333 C  CG  . HIS C 1 173 ? 55.307  26.485  71.179  1.00 4.42  ? 204 HIS C CG  1 
ATOM   10334 N  ND1 . HIS C 1 173 ? 54.762  25.500  70.391  1.00 3.69  ? 204 HIS C ND1 1 
ATOM   10335 C  CD2 . HIS C 1 173 ? 54.652  26.433  72.364  1.00 3.82  ? 204 HIS C CD2 1 
ATOM   10336 C  CE1 . HIS C 1 173 ? 53.826  24.868  71.076  1.00 6.94  ? 204 HIS C CE1 1 
ATOM   10337 N  NE2 . HIS C 1 173 ? 53.743  25.413  72.276  1.00 5.34  ? 204 HIS C NE2 1 
ATOM   10338 N  N   . PHE C 1 174 ? 55.444  29.991  70.642  1.00 3.00  ? 205 PHE C N   1 
ATOM   10339 C  CA  . PHE C 1 174 ? 54.519  31.100  70.925  1.00 3.32  ? 205 PHE C CA  1 
ATOM   10340 C  C   . PHE C 1 174 ? 54.140  31.927  69.685  1.00 3.26  ? 205 PHE C C   1 
ATOM   10341 O  O   . PHE C 1 174 ? 53.031  31.794  69.176  1.00 5.63  ? 205 PHE C O   1 
ATOM   10342 C  CB  . PHE C 1 174 ? 55.095  31.999  72.018  1.00 4.50  ? 205 PHE C CB  1 
ATOM   10343 C  CG  . PHE C 1 174 ? 54.263  33.202  72.328  1.00 5.18  ? 205 PHE C CG  1 
ATOM   10344 C  CD1 . PHE C 1 174 ? 53.089  33.075  73.054  1.00 8.85  ? 205 PHE C CD1 1 
ATOM   10345 C  CD2 . PHE C 1 174 ? 54.671  34.464  71.930  1.00 5.16  ? 205 PHE C CD2 1 
ATOM   10346 C  CE1 . PHE C 1 174 ? 52.321  34.191  73.388  1.00 8.23  ? 205 PHE C CE1 1 
ATOM   10347 C  CE2 . PHE C 1 174 ? 53.923  35.576  72.257  1.00 9.00  ? 205 PHE C CE2 1 
ATOM   10348 C  CZ  . PHE C 1 174 ? 52.735  35.434  72.993  1.00 10.11 ? 205 PHE C CZ  1 
ATOM   10349 N  N   . THR C 1 175 ? 55.049  32.730  69.155  1.00 2.00  ? 206 THR C N   1 
ATOM   10350 C  CA  . THR C 1 175 ? 54.718  33.506  67.965  1.00 4.07  ? 206 THR C CA  1 
ATOM   10351 C  C   . THR C 1 175 ? 54.214  32.692  66.780  1.00 4.62  ? 206 THR C C   1 
ATOM   10352 O  O   . THR C 1 175 ? 53.655  33.271  65.838  1.00 4.44  ? 206 THR C O   1 
ATOM   10353 C  CB  . THR C 1 175 ? 55.920  34.272  67.422  1.00 5.85  ? 206 THR C CB  1 
ATOM   10354 O  OG1 . THR C 1 175 ? 56.903  33.351  66.919  1.00 10.50 ? 206 THR C OG1 1 
ATOM   10355 C  CG2 . THR C 1 175 ? 56.516  35.101  68.504  1.00 6.48  ? 206 THR C CG2 1 
ATOM   10356 N  N   . HIS C 1 176 ? 54.424  31.374  66.796  1.00 4.62  ? 207 HIS C N   1 
ATOM   10357 C  CA  . HIS C 1 176 ? 54.029  30.564  65.651  1.00 7.50  ? 207 HIS C CA  1 
ATOM   10358 C  C   . HIS C 1 176 ? 52.571  30.175  65.535  1.00 8.21  ? 207 HIS C C   1 
ATOM   10359 O  O   . HIS C 1 176 ? 52.184  29.375  64.650  1.00 8.92  ? 207 HIS C O   1 
ATOM   10360 C  CB  . HIS C 1 176 ? 55.011  29.399  65.420  1.00 6.27  ? 207 HIS C CB  1 
ATOM   10361 C  CG  . HIS C 1 176 ? 56.229  29.811  64.655  1.00 3.33  ? 207 HIS C CG  1 
ATOM   10362 N  ND1 . HIS C 1 176 ? 56.991  30.904  65.017  1.00 2.00  ? 207 HIS C ND1 1 
ATOM   10363 C  CD2 . HIS C 1 176 ? 56.745  29.366  63.483  1.00 2.76  ? 207 HIS C CD2 1 
ATOM   10364 C  CE1 . HIS C 1 176 ? 57.913  31.120  64.097  1.00 3.06  ? 207 HIS C CE1 1 
ATOM   10365 N  NE2 . HIS C 1 176 ? 57.788  30.200  63.155  1.00 2.00  ? 207 HIS C NE2 1 
ATOM   10366 N  N   . GLN C 1 177 ? 51.772  30.699  66.470  1.00 7.34  ? 208 GLN C N   1 
ATOM   10367 C  CA  . GLN C 1 177 ? 50.337  30.478  66.423  1.00 3.84  ? 208 GLN C CA  1 
ATOM   10368 C  C   . GLN C 1 177 ? 49.810  31.671  65.685  1.00 3.96  ? 208 GLN C C   1 
ATOM   10369 O  O   . GLN C 1 177 ? 48.919  31.509  64.888  1.00 5.49  ? 208 GLN C O   1 
ATOM   10370 C  CB  . GLN C 1 177 ? 49.720  30.375  67.777  1.00 2.00  ? 208 GLN C CB  1 
ATOM   10371 C  CG  . GLN C 1 177 ? 49.786  31.586  68.555  1.00 2.00  ? 208 GLN C CG  1 
ATOM   10372 C  CD  . GLN C 1 177 ? 49.320  31.314  69.937  1.00 2.00  ? 208 GLN C CD  1 
ATOM   10373 O  OE1 . GLN C 1 177 ? 49.316  30.174  70.365  1.00 2.00  ? 208 GLN C OE1 1 
ATOM   10374 N  NE2 . GLN C 1 177 ? 48.854  32.328  70.626  1.00 5.30  ? 208 GLN C NE2 1 
ATOM   10375 N  N   . PHE C 1 178 ? 50.376  32.863  65.916  1.00 4.22  ? 209 PHE C N   1 
ATOM   10376 C  CA  . PHE C 1 178 ? 49.955  34.034  65.159  1.00 2.00  ? 209 PHE C CA  1 
ATOM   10377 C  C   . PHE C 1 178 ? 50.716  34.351  63.903  1.00 2.00  ? 209 PHE C C   1 
ATOM   10378 O  O   . PHE C 1 178 ? 50.189  35.018  63.046  1.00 3.15  ? 209 PHE C O   1 
ATOM   10379 C  CB  . PHE C 1 178 ? 49.771  35.302  65.965  1.00 2.00  ? 209 PHE C CB  1 
ATOM   10380 C  CG  . PHE C 1 178 ? 50.627  35.432  67.155  1.00 2.00  ? 209 PHE C CG  1 
ATOM   10381 C  CD1 . PHE C 1 178 ? 50.300  34.782  68.323  1.00 2.08  ? 209 PHE C CD1 1 
ATOM   10382 C  CD2 . PHE C 1 178 ? 51.626  36.364  67.182  1.00 2.24  ? 209 PHE C CD2 1 
ATOM   10383 C  CE1 . PHE C 1 178 ? 50.948  35.075  69.513  1.00 2.02  ? 209 PHE C CE1 1 
ATOM   10384 C  CE2 . PHE C 1 178 ? 52.276  36.660  68.366  1.00 5.18  ? 209 PHE C CE2 1 
ATOM   10385 C  CZ  . PHE C 1 178 ? 51.929  36.014  69.539  1.00 2.95  ? 209 PHE C CZ  1 
ATOM   10386 N  N   . PHE C 1 179 ? 51.973  33.955  63.790  1.00 2.87  ? 210 PHE C N   1 
ATOM   10387 C  CA  . PHE C 1 179 ? 52.681  34.197  62.532  1.00 3.29  ? 210 PHE C CA  1 
ATOM   10388 C  C   . PHE C 1 179 ? 52.495  32.861  61.805  1.00 2.19  ? 210 PHE C C   1 
ATOM   10389 O  O   . PHE C 1 179 ? 52.897  31.818  62.329  1.00 2.69  ? 210 PHE C O   1 
ATOM   10390 C  CB  . PHE C 1 179 ? 54.176  34.487  62.754  1.00 4.40  ? 210 PHE C CB  1 
ATOM   10391 C  CG  . PHE C 1 179 ? 54.461  35.759  63.513  1.00 7.75  ? 210 PHE C CG  1 
ATOM   10392 C  CD1 . PHE C 1 179 ? 53.753  36.947  63.233  1.00 5.68  ? 210 PHE C CD1 1 
ATOM   10393 C  CD2 . PHE C 1 179 ? 55.442  35.775  64.521  1.00 7.66  ? 210 PHE C CD2 1 
ATOM   10394 C  CE1 . PHE C 1 179 ? 54.012  38.126  63.946  1.00 4.62  ? 210 PHE C CE1 1 
ATOM   10395 C  CE2 . PHE C 1 179 ? 55.709  36.965  65.244  1.00 10.24 ? 210 PHE C CE2 1 
ATOM   10396 C  CZ  . PHE C 1 179 ? 54.987  38.139  64.951  1.00 6.99  ? 210 PHE C CZ  1 
ATOM   10397 N  N   . LYS C 1 180 ? 51.795  32.881  60.676  1.00 2.00  ? 211 LYS C N   1 
ATOM   10398 C  CA  . LYS C 1 180 ? 51.523  31.682  59.902  1.00 2.00  ? 211 LYS C CA  1 
ATOM   10399 C  C   . LYS C 1 180 ? 51.238  32.037  58.445  1.00 2.00  ? 211 LYS C C   1 
ATOM   10400 O  O   . LYS C 1 180 ? 50.187  31.727  57.939  1.00 3.43  ? 211 LYS C O   1 
ATOM   10401 C  CB  . LYS C 1 180 ? 50.299  30.947  60.466  1.00 2.08  ? 211 LYS C CB  1 
ATOM   10402 C  CG  . LYS C 1 180 ? 50.385  30.476  61.903  1.00 2.00  ? 211 LYS C CG  1 
ATOM   10403 C  CD  . LYS C 1 180 ? 49.052  30.011  62.448  1.00 2.00  ? 211 LYS C CD  1 
ATOM   10404 C  CE  . LYS C 1 180 ? 48.420  28.927  61.593  1.00 3.35  ? 211 LYS C CE  1 
ATOM   10405 N  NZ  . LYS C 1 180 ? 47.260  28.311  62.275  1.00 2.00  ? 211 LYS C NZ  1 
ATOM   10406 N  N   . THR C 1 181 ? 52.160  32.673  57.754  1.00 2.00  ? 212 THR C N   1 
ATOM   10407 C  CA  . THR C 1 181 ? 51.937  33.049  56.366  1.00 2.00  ? 212 THR C CA  1 
ATOM   10408 C  C   . THR C 1 181 ? 51.305  32.011  55.435  1.00 2.38  ? 212 THR C C   1 
ATOM   10409 O  O   . THR C 1 181 ? 51.626  30.853  55.461  1.00 5.04  ? 212 THR C O   1 
ATOM   10410 C  CB  . THR C 1 181 ? 53.217  33.565  55.761  1.00 2.00  ? 212 THR C CB  1 
ATOM   10411 O  OG1 . THR C 1 181 ? 53.640  34.699  56.513  1.00 2.56  ? 212 THR C OG1 1 
ATOM   10412 C  CG2 . THR C 1 181 ? 53.022  33.966  54.317  1.00 2.00  ? 212 THR C CG2 1 
ATOM   10413 N  N   . ASP C 1 182 ? 50.417  32.471  54.576  1.00 7.67  ? 213 ASP C N   1 
ATOM   10414 C  CA  . ASP C 1 182 ? 49.692  31.661  53.611  1.00 8.28  ? 213 ASP C CA  1 
ATOM   10415 C  C   . ASP C 1 182 ? 50.464  31.895  52.330  1.00 8.62  ? 213 ASP C C   1 
ATOM   10416 O  O   . ASP C 1 182 ? 50.083  32.699  51.500  1.00 8.59  ? 213 ASP C O   1 
ATOM   10417 C  CB  . ASP C 1 182 ? 48.267  32.226  53.506  1.00 13.30 ? 213 ASP C CB  1 
ATOM   10418 C  CG  . ASP C 1 182 ? 47.365  31.457  52.545  1.00 17.85 ? 213 ASP C CG  1 
ATOM   10419 O  OD1 . ASP C 1 182 ? 47.813  30.513  51.846  1.00 17.14 ? 213 ASP C OD1 1 
ATOM   10420 O  OD2 . ASP C 1 182 ? 46.172  31.838  52.494  1.00 19.75 ? 213 ASP C OD2 1 
ATOM   10421 N  N   . HIS C 1 183 ? 51.569  31.190  52.176  1.00 11.27 ? 214 HIS C N   1 
ATOM   10422 C  CA  . HIS C 1 183 ? 52.428  31.368  51.003  1.00 14.72 ? 214 HIS C CA  1 
ATOM   10423 C  C   . HIS C 1 183 ? 51.734  31.166  49.681  1.00 14.67 ? 214 HIS C C   1 
ATOM   10424 O  O   . HIS C 1 183 ? 52.106  31.771  48.679  1.00 15.42 ? 214 HIS C O   1 
ATOM   10425 C  CB  . HIS C 1 183 ? 53.664  30.470  51.096  1.00 14.95 ? 214 HIS C CB  1 
ATOM   10426 C  CG  . HIS C 1 183 ? 54.467  30.719  52.324  1.00 13.85 ? 214 HIS C CG  1 
ATOM   10427 N  ND1 . HIS C 1 183 ? 54.507  29.835  53.380  1.00 16.24 ? 214 HIS C ND1 1 
ATOM   10428 C  CD2 . HIS C 1 183 ? 55.162  31.809  52.722  1.00 18.30 ? 214 HIS C CD2 1 
ATOM   10429 C  CE1 . HIS C 1 183 ? 55.183  30.374  54.385  1.00 18.20 ? 214 HIS C CE1 1 
ATOM   10430 N  NE2 . HIS C 1 183 ? 55.591  31.573  54.010  1.00 21.05 ? 214 HIS C NE2 1 
ATOM   10431 N  N   . LYS C 1 184 ? 50.699  30.344  49.696  1.00 16.13 ? 215 LYS C N   1 
ATOM   10432 C  CA  . LYS C 1 184 ? 49.958  30.057  48.479  1.00 19.46 ? 215 LYS C CA  1 
ATOM   10433 C  C   . LYS C 1 184 ? 49.295  31.355  48.040  1.00 18.93 ? 215 LYS C C   1 
ATOM   10434 O  O   . LYS C 1 184 ? 49.094  31.580  46.854  1.00 19.17 ? 215 LYS C O   1 
ATOM   10435 C  CB  . LYS C 1 184 ? 48.929  28.910  48.677  1.00 21.98 ? 215 LYS C CB  1 
ATOM   10436 C  CG  . LYS C 1 184 ? 48.858  28.244  50.097  1.00 25.20 ? 215 LYS C CG  1 
ATOM   10437 C  CD  . LYS C 1 184 ? 50.119  27.444  50.511  1.00 23.63 ? 215 LYS C CD  1 
ATOM   10438 C  CE  . LYS C 1 184 ? 50.195  27.166  52.046  1.00 22.74 ? 215 LYS C CE  1 
ATOM   10439 N  NZ  . LYS C 1 184 ? 51.018  28.148  52.871  1.00 20.33 ? 215 LYS C NZ  1 
ATOM   10440 N  N   . ARG C 1 185 ? 49.005  32.225  49.006  1.00 19.68 ? 216 ARG C N   1 
ATOM   10441 C  CA  . ARG C 1 185 ? 48.394  33.529  48.723  1.00 20.08 ? 216 ARG C CA  1 
ATOM   10442 C  C   . ARG C 1 185 ? 49.496  34.573  48.480  1.00 17.72 ? 216 ARG C C   1 
ATOM   10443 O  O   . ARG C 1 185 ? 49.449  35.364  47.525  1.00 16.18 ? 216 ARG C O   1 
ATOM   10444 C  CB  . ARG C 1 185 ? 47.505  33.964  49.896  1.00 21.69 ? 216 ARG C CB  1 
ATOM   10445 C  CG  . ARG C 1 185 ? 46.195  34.607  49.476  1.00 25.33 ? 216 ARG C CG  1 
ATOM   10446 C  CD  . ARG C 1 185 ? 45.128  33.558  49.168  1.00 26.66 ? 216 ARG C CD  1 
ATOM   10447 N  NE  . ARG C 1 185 ? 44.675  32.931  50.403  1.00 27.42 ? 216 ARG C NE  1 
ATOM   10448 C  CZ  . ARG C 1 185 ? 43.451  33.051  50.920  1.00 26.87 ? 216 ARG C CZ  1 
ATOM   10449 N  NH1 . ARG C 1 185 ? 42.497  33.764  50.311  1.00 21.89 ? 216 ARG C NH1 1 
ATOM   10450 N  NH2 . ARG C 1 185 ? 43.213  32.527  52.117  1.00 27.96 ? 216 ARG C NH2 1 
ATOM   10451 N  N   . GLY C 1 186 ? 50.482  34.567  49.365  1.00 17.12 ? 217 GLY C N   1 
ATOM   10452 C  CA  . GLY C 1 186 ? 51.600  35.476  49.235  1.00 17.62 ? 217 GLY C CA  1 
ATOM   10453 C  C   . GLY C 1 186 ? 52.021  35.998  50.586  1.00 17.26 ? 217 GLY C C   1 
ATOM   10454 O  O   . GLY C 1 186 ? 51.365  35.652  51.583  1.00 17.49 ? 217 GLY C O   1 
ATOM   10455 N  N   . PRO C 1 187 ? 53.189  36.686  50.690  1.00 16.86 ? 218 PRO C N   1 
ATOM   10456 C  CA  . PRO C 1 187 ? 53.527  37.177  52.022  1.00 15.67 ? 218 PRO C CA  1 
ATOM   10457 C  C   . PRO C 1 187 ? 52.514  38.289  52.207  1.00 16.22 ? 218 PRO C C   1 
ATOM   10458 O  O   . PRO C 1 187 ? 51.960  38.827  51.231  1.00 15.44 ? 218 PRO C O   1 
ATOM   10459 C  CB  . PRO C 1 187 ? 54.946  37.701  51.851  1.00 14.07 ? 218 PRO C CB  1 
ATOM   10460 C  CG  . PRO C 1 187 ? 54.978  38.142  50.400  1.00 14.02 ? 218 PRO C CG  1 
ATOM   10461 C  CD  . PRO C 1 187 ? 54.252  37.019  49.718  1.00 16.45 ? 218 PRO C CD  1 
ATOM   10462 N  N   . GLY C 1 188 ? 52.222  38.601  53.454  1.00 17.54 ? 219 GLY C N   1 
ATOM   10463 C  CA  . GLY C 1 188 ? 51.236  39.629  53.699  1.00 15.14 ? 219 GLY C CA  1 
ATOM   10464 C  C   . GLY C 1 188 ? 49.937  38.970  54.072  1.00 11.75 ? 219 GLY C C   1 
ATOM   10465 O  O   . GLY C 1 188 ? 49.115  39.603  54.715  1.00 13.42 ? 219 GLY C O   1 
ATOM   10466 N  N   . PHE C 1 189 ? 49.797  37.686  53.732  1.00 9.37  ? 220 PHE C N   1 
ATOM   10467 C  CA  . PHE C 1 189 ? 48.607  36.884  54.026  1.00 5.19  ? 220 PHE C CA  1 
ATOM   10468 C  C   . PHE C 1 189 ? 48.883  35.870  55.137  1.00 3.68  ? 220 PHE C C   1 
ATOM   10469 O  O   . PHE C 1 189 ? 49.853  35.134  55.049  1.00 4.89  ? 220 PHE C O   1 
ATOM   10470 C  CB  . PHE C 1 189 ? 48.194  36.136  52.787  1.00 4.76  ? 220 PHE C CB  1 
ATOM   10471 C  CG  . PHE C 1 189 ? 47.573  36.999  51.734  1.00 5.15  ? 220 PHE C CG  1 
ATOM   10472 C  CD1 . PHE C 1 189 ? 46.244  37.286  51.776  1.00 8.48  ? 220 PHE C CD1 1 
ATOM   10473 C  CD2 . PHE C 1 189 ? 48.294  37.448  50.652  1.00 3.79  ? 220 PHE C CD2 1 
ATOM   10474 C  CE1 . PHE C 1 189 ? 45.649  38.010  50.735  1.00 10.79 ? 220 PHE C CE1 1 
ATOM   10475 C  CE2 . PHE C 1 189 ? 47.693  38.167  49.624  1.00 2.01  ? 220 PHE C CE2 1 
ATOM   10476 C  CZ  . PHE C 1 189 ? 46.391  38.445  49.659  1.00 2.00  ? 220 PHE C CZ  1 
ATOM   10477 N  N   . THR C 1 190 ? 48.071  35.896  56.199  1.00 2.52  ? 221 THR C N   1 
ATOM   10478 C  CA  . THR C 1 190 ? 48.193  35.007  57.353  1.00 2.00  ? 221 THR C CA  1 
ATOM   10479 C  C   . THR C 1 190 ? 47.200  33.921  57.180  1.00 2.80  ? 221 THR C C   1 
ATOM   10480 O  O   . THR C 1 190 ? 46.253  34.066  56.435  1.00 6.05  ? 221 THR C O   1 
ATOM   10481 C  CB  . THR C 1 190 ? 47.850  35.729  58.661  1.00 2.00  ? 221 THR C CB  1 
ATOM   10482 O  OG1 . THR C 1 190 ? 47.685  34.791  59.728  1.00 2.00  ? 221 THR C OG1 1 
ATOM   10483 C  CG2 . THR C 1 190 ? 46.618  36.529  58.499  1.00 2.00  ? 221 THR C CG2 1 
ATOM   10484 N  N   . ARG C 1 191 ? 47.460  32.782  57.789  1.00 4.32  ? 222 ARG C N   1 
ATOM   10485 C  CA  . ARG C 1 191 ? 46.529  31.674  57.710  1.00 5.34  ? 222 ARG C CA  1 
ATOM   10486 C  C   . ARG C 1 191 ? 45.963  31.538  59.129  1.00 2.83  ? 222 ARG C C   1 
ATOM   10487 O  O   . ARG C 1 191 ? 45.083  30.736  59.400  1.00 3.55  ? 222 ARG C O   1 
ATOM   10488 C  CB  . ARG C 1 191 ? 47.230  30.407  57.222  1.00 8.75  ? 222 ARG C CB  1 
ATOM   10489 C  CG  . ARG C 1 191 ? 47.663  29.447  58.347  1.00 20.74 ? 222 ARG C CG  1 
ATOM   10490 C  CD  . ARG C 1 191 ? 48.917  28.587  57.997  1.00 28.30 ? 222 ARG C CD  1 
ATOM   10491 N  NE  . ARG C 1 191 ? 48.636  27.309  57.335  1.00 30.84 ? 222 ARG C NE  1 
ATOM   10492 C  CZ  . ARG C 1 191 ? 48.373  27.158  56.034  1.00 32.64 ? 222 ARG C CZ  1 
ATOM   10493 N  NH1 . ARG C 1 191 ? 48.335  28.204  55.209  1.00 33.33 ? 222 ARG C NH1 1 
ATOM   10494 N  NH2 . ARG C 1 191 ? 48.182  25.940  55.545  1.00 32.92 ? 222 ARG C NH2 1 
ATOM   10495 N  N   . GLY C 1 192 ? 46.448  32.375  60.029  1.00 2.48  ? 223 GLY C N   1 
ATOM   10496 C  CA  . GLY C 1 192 ? 45.963  32.350  61.390  1.00 2.71  ? 223 GLY C CA  1 
ATOM   10497 C  C   . GLY C 1 192 ? 44.963  33.474  61.571  1.00 4.56  ? 223 GLY C C   1 
ATOM   10498 O  O   . GLY C 1 192 ? 45.258  34.520  62.175  1.00 4.63  ? 223 GLY C O   1 
ATOM   10499 N  N   . LEU C 1 193 ? 43.761  33.245  61.062  1.00 2.00  ? 224 LEU C N   1 
ATOM   10500 C  CA  . LEU C 1 193 ? 42.704  34.209  61.139  1.00 2.00  ? 224 LEU C CA  1 
ATOM   10501 C  C   . LEU C 1 193 ? 42.330  34.622  62.557  1.00 3.36  ? 224 LEU C C   1 
ATOM   10502 O  O   . LEU C 1 193 ? 41.560  35.558  62.743  1.00 8.06  ? 224 LEU C O   1 
ATOM   10503 C  CB  . LEU C 1 193 ? 41.505  33.688  60.399  1.00 2.00  ? 224 LEU C CB  1 
ATOM   10504 C  CG  . LEU C 1 193 ? 41.875  33.401  58.950  1.00 2.00  ? 224 LEU C CG  1 
ATOM   10505 C  CD1 . LEU C 1 193 ? 40.845  32.460  58.367  1.00 2.00  ? 224 LEU C CD1 1 
ATOM   10506 C  CD2 . LEU C 1 193 ? 42.009  34.657  58.110  1.00 2.01  ? 224 LEU C CD2 1 
ATOM   10507 N  N   . GLY C 1 194 ? 42.902  33.979  63.566  1.00 3.34  ? 225 GLY C N   1 
ATOM   10508 C  CA  . GLY C 1 194 ? 42.575  34.356  64.934  1.00 2.29  ? 225 GLY C CA  1 
ATOM   10509 C  C   . GLY C 1 194 ? 43.209  35.674  65.334  1.00 2.23  ? 225 GLY C C   1 
ATOM   10510 O  O   . GLY C 1 194 ? 42.798  36.330  66.283  1.00 2.00  ? 225 GLY C O   1 
ATOM   10511 N  N   . HIS C 1 195 ? 44.277  36.012  64.622  1.00 4.76  ? 226 HIS C N   1 
ATOM   10512 C  CA  . HIS C 1 195 ? 45.042  37.227  64.840  1.00 4.17  ? 226 HIS C CA  1 
ATOM   10513 C  C   . HIS C 1 195 ? 45.480  37.484  66.275  1.00 3.78  ? 226 HIS C C   1 
ATOM   10514 O  O   . HIS C 1 195 ? 45.631  38.637  66.662  1.00 6.86  ? 226 HIS C O   1 
ATOM   10515 C  CB  . HIS C 1 195 ? 44.318  38.433  64.254  1.00 2.01  ? 226 HIS C CB  1 
ATOM   10516 C  CG  . HIS C 1 195 ? 44.377  38.495  62.759  1.00 2.00  ? 226 HIS C CG  1 
ATOM   10517 N  ND1 . HIS C 1 195 ? 44.903  39.568  62.071  1.00 2.00  ? 226 HIS C ND1 1 
ATOM   10518 C  CD2 . HIS C 1 195 ? 43.953  37.621  61.816  1.00 2.00  ? 226 HIS C CD2 1 
ATOM   10519 C  CE1 . HIS C 1 195 ? 44.792  39.355  60.771  1.00 2.00  ? 226 HIS C CE1 1 
ATOM   10520 N  NE2 . HIS C 1 195 ? 44.218  38.181  60.590  1.00 2.00  ? 226 HIS C NE2 1 
ATOM   10521 N  N   . GLY C 1 196 ? 45.806  36.430  67.025  1.00 2.00  ? 227 GLY C N   1 
ATOM   10522 C  CA  . GLY C 1 196 ? 46.226  36.646  68.396  1.00 2.00  ? 227 GLY C CA  1 
ATOM   10523 C  C   . GLY C 1 196 ? 46.481  35.395  69.184  1.00 2.00  ? 227 GLY C C   1 
ATOM   10524 O  O   . GLY C 1 196 ? 46.540  34.307  68.630  1.00 2.00  ? 227 GLY C O   1 
ATOM   10525 N  N   . VAL C 1 197 ? 46.633  35.554  70.487  1.00 2.00  ? 228 VAL C N   1 
ATOM   10526 C  CA  . VAL C 1 197 ? 46.881  34.427  71.364  1.00 2.00  ? 228 VAL C CA  1 
ATOM   10527 C  C   . VAL C 1 197 ? 45.652  33.507  71.525  1.00 3.00  ? 228 VAL C C   1 
ATOM   10528 O  O   . VAL C 1 197 ? 44.965  33.524  72.559  1.00 2.00  ? 228 VAL C O   1 
ATOM   10529 C  CB  . VAL C 1 197 ? 47.283  34.935  72.727  1.00 2.00  ? 228 VAL C CB  1 
ATOM   10530 C  CG1 . VAL C 1 197 ? 47.925  33.840  73.546  1.00 2.04  ? 228 VAL C CG1 1 
ATOM   10531 C  CG2 . VAL C 1 197 ? 48.206  36.094  72.570  1.00 2.00  ? 228 VAL C CG2 1 
ATOM   10532 N  N   . ASP C 1 198 ? 45.381  32.682  70.525  1.00 2.00  ? 229 ASP C N   1 
ATOM   10533 C  CA  . ASP C 1 198 ? 44.221  31.818  70.605  1.00 2.00  ? 229 ASP C CA  1 
ATOM   10534 C  C   . ASP C 1 198 ? 44.580  30.358  70.852  1.00 4.66  ? 229 ASP C C   1 
ATOM   10535 O  O   . ASP C 1 198 ? 43.708  29.494  70.796  1.00 6.17  ? 229 ASP C O   1 
ATOM   10536 C  CB  . ASP C 1 198 ? 43.383  31.957  69.335  1.00 2.00  ? 229 ASP C CB  1 
ATOM   10537 C  CG  . ASP C 1 198 ? 44.148  31.604  68.086  1.00 4.73  ? 229 ASP C CG  1 
ATOM   10538 O  OD1 . ASP C 1 198 ? 45.257  31.058  68.196  1.00 11.84 ? 229 ASP C OD1 1 
ATOM   10539 O  OD2 . ASP C 1 198 ? 43.648  31.861  66.971  1.00 7.74  ? 229 ASP C OD2 1 
ATOM   10540 N  N   . LEU C 1 199 ? 45.863  30.089  71.113  1.00 4.94  ? 230 LEU C N   1 
ATOM   10541 C  CA  . LEU C 1 199 ? 46.375  28.725  71.329  1.00 3.04  ? 230 LEU C CA  1 
ATOM   10542 C  C   . LEU C 1 199 ? 45.913  27.768  70.231  1.00 2.00  ? 230 LEU C C   1 
ATOM   10543 O  O   . LEU C 1 199 ? 45.683  26.590  70.449  1.00 2.00  ? 230 LEU C O   1 
ATOM   10544 C  CB  . LEU C 1 199 ? 46.028  28.207  72.730  1.00 2.66  ? 230 LEU C CB  1 
ATOM   10545 C  CG  . LEU C 1 199 ? 46.516  29.081  73.906  1.00 5.17  ? 230 LEU C CG  1 
ATOM   10546 C  CD1 . LEU C 1 199 ? 46.949  28.233  75.093  1.00 4.91  ? 230 LEU C CD1 1 
ATOM   10547 C  CD2 . LEU C 1 199 ? 47.649  30.010  73.493  1.00 3.10  ? 230 LEU C CD2 1 
ATOM   10548 N  N   . ASN C 1 200 ? 45.869  28.297  69.025  1.00 2.37  ? 231 ASN C N   1 
ATOM   10549 C  CA  . ASN C 1 200 ? 45.441  27.537  67.896  1.00 2.00  ? 231 ASN C CA  1 
ATOM   10550 C  C   . ASN C 1 200 ? 46.443  26.478  67.592  1.00 2.00  ? 231 ASN C C   1 
ATOM   10551 O  O   . ASN C 1 200 ? 46.118  25.410  67.113  1.00 2.00  ? 231 ASN C O   1 
ATOM   10552 C  CB  . ASN C 1 200 ? 45.188  28.458  66.691  1.00 2.00  ? 231 ASN C CB  1 
ATOM   10553 C  CG  . ASN C 1 200 ? 46.254  28.374  65.604  1.00 2.00  ? 231 ASN C CG  1 
ATOM   10554 O  OD1 . ASN C 1 200 ? 46.607  27.309  65.121  1.00 2.08  ? 231 ASN C OD1 1 
ATOM   10555 N  ND2 . ASN C 1 200 ? 46.709  29.520  65.166  1.00 2.00  ? 231 ASN C ND2 1 
ATOM   10556 N  N   . HIS C 1 201 ? 47.689  26.772  67.905  1.00 6.95  ? 232 HIS C N   1 
ATOM   10557 C  CA  . HIS C 1 201 ? 48.795  25.854  67.638  1.00 6.58  ? 232 HIS C CA  1 
ATOM   10558 C  C   . HIS C 1 201 ? 48.683  24.579  68.471  1.00 7.94  ? 232 HIS C C   1 
ATOM   10559 O  O   . HIS C 1 201 ? 49.178  23.530  68.054  1.00 10.94 ? 232 HIS C O   1 
ATOM   10560 C  CB  . HIS C 1 201 ? 50.126  26.556  67.868  1.00 2.00  ? 232 HIS C CB  1 
ATOM   10561 C  CG  . HIS C 1 201 ? 50.240  27.162  69.222  1.00 2.00  ? 232 HIS C CG  1 
ATOM   10562 N  ND1 . HIS C 1 201 ? 51.313  27.934  69.596  1.00 4.83  ? 232 HIS C ND1 1 
ATOM   10563 C  CD2 . HIS C 1 201 ? 49.456  27.040  70.318  1.00 2.00  ? 232 HIS C CD2 1 
ATOM   10564 C  CE1 . HIS C 1 201 ? 51.195  28.249  70.874  1.00 7.69  ? 232 HIS C CE1 1 
ATOM   10565 N  NE2 . HIS C 1 201 ? 50.075  27.718  71.335  1.00 4.90  ? 232 HIS C NE2 1 
ATOM   10566 N  N   . ILE C 1 202 ? 48.039  24.668  69.639  1.00 6.30  ? 233 ILE C N   1 
ATOM   10567 C  CA  . ILE C 1 202 ? 47.854  23.489  70.470  1.00 5.36  ? 233 ILE C CA  1 
ATOM   10568 C  C   . ILE C 1 202 ? 46.593  22.760  70.001  1.00 7.08  ? 233 ILE C C   1 
ATOM   10569 O  O   . ILE C 1 202 ? 46.606  21.535  69.861  1.00 8.22  ? 233 ILE C O   1 
ATOM   10570 C  CB  . ILE C 1 202 ? 47.600  23.821  71.941  1.00 2.97  ? 233 ILE C CB  1 
ATOM   10571 C  CG1 . ILE C 1 202 ? 48.713  24.682  72.531  1.00 2.58  ? 233 ILE C CG1 1 
ATOM   10572 C  CG2 . ILE C 1 202 ? 47.386  22.525  72.714  1.00 4.44  ? 233 ILE C CG2 1 
ATOM   10573 C  CD1 . ILE C 1 202 ? 48.580  24.984  74.019  1.00 2.00  ? 233 ILE C CD1 1 
ATOM   10574 N  N   . TYR C 1 203 ? 45.525  23.534  69.756  1.00 5.67  ? 234 TYR C N   1 
ATOM   10575 C  CA  . TYR C 1 203 ? 44.218  23.005  69.381  1.00 2.00  ? 234 TYR C CA  1 
ATOM   10576 C  C   . TYR C 1 203 ? 43.791  22.802  67.940  1.00 2.00  ? 234 TYR C C   1 
ATOM   10577 O  O   . TYR C 1 203 ? 42.870  22.065  67.688  1.00 2.05  ? 234 TYR C O   1 
ATOM   10578 C  CB  . TYR C 1 203 ? 43.161  23.804  70.082  1.00 2.00  ? 234 TYR C CB  1 
ATOM   10579 C  CG  . TYR C 1 203 ? 43.319  23.794  71.562  1.00 2.00  ? 234 TYR C CG  1 
ATOM   10580 C  CD1 . TYR C 1 203 ? 42.985  22.686  72.293  1.00 2.00  ? 234 TYR C CD1 1 
ATOM   10581 C  CD2 . TYR C 1 203 ? 43.794  24.889  72.224  1.00 2.00  ? 234 TYR C CD2 1 
ATOM   10582 C  CE1 . TYR C 1 203 ? 43.116  22.654  73.648  1.00 2.00  ? 234 TYR C CE1 1 
ATOM   10583 C  CE2 . TYR C 1 203 ? 43.928  24.874  73.576  1.00 2.08  ? 234 TYR C CE2 1 
ATOM   10584 C  CZ  . TYR C 1 203 ? 43.587  23.746  74.279  1.00 2.00  ? 234 TYR C CZ  1 
ATOM   10585 O  OH  . TYR C 1 203 ? 43.755  23.738  75.632  1.00 3.46  ? 234 TYR C OH  1 
ATOM   10586 N  N   . GLY C 1 204 ? 44.474  23.380  66.977  1.00 3.52  ? 235 GLY C N   1 
ATOM   10587 C  CA  . GLY C 1 204 ? 44.046  23.185  65.609  1.00 3.01  ? 235 GLY C CA  1 
ATOM   10588 C  C   . GLY C 1 204 ? 43.420  24.461  65.127  1.00 4.77  ? 235 GLY C C   1 
ATOM   10589 O  O   . GLY C 1 204 ? 42.739  25.184  65.866  1.00 5.51  ? 235 GLY C O   1 
ATOM   10590 N  N   . GLU C 1 205 ? 43.684  24.749  63.870  1.00 8.70  ? 236 GLU C N   1 
ATOM   10591 C  CA  . GLU C 1 205 ? 43.184  25.944  63.226  1.00 13.02 ? 236 GLU C CA  1 
ATOM   10592 C  C   . GLU C 1 205 ? 41.675  25.929  63.113  1.00 13.85 ? 236 GLU C C   1 
ATOM   10593 O  O   . GLU C 1 205 ? 41.024  26.930  63.386  1.00 19.79 ? 236 GLU C O   1 
ATOM   10594 C  CB  . GLU C 1 205 ? 43.803  26.064  61.831  1.00 19.95 ? 236 GLU C CB  1 
ATOM   10595 C  CG  . GLU C 1 205 ? 45.368  26.240  61.784  1.00 32.12 ? 236 GLU C CG  1 
ATOM   10596 C  CD  . GLU C 1 205 ? 46.219  25.044  62.337  1.00 33.88 ? 236 GLU C CD  1 
ATOM   10597 O  OE1 . GLU C 1 205 ? 46.337  23.999  61.636  1.00 34.74 ? 236 GLU C OE1 1 
ATOM   10598 O  OE2 . GLU C 1 205 ? 46.799  25.180  63.449  1.00 29.41 ? 236 GLU C OE2 1 
ATOM   10599 N  N   . THR C 1 206 ? 41.111  24.785  62.738  1.00 12.20 ? 237 THR C N   1 
ATOM   10600 C  CA  . THR C 1 206 ? 39.668  24.670  62.558  1.00 8.02  ? 237 THR C CA  1 
ATOM   10601 C  C   . THR C 1 206 ? 39.013  23.664  63.508  1.00 9.02  ? 237 THR C C   1 
ATOM   10602 O  O   . THR C 1 206 ? 39.679  22.796  64.075  1.00 7.70  ? 237 THR C O   1 
ATOM   10603 C  CB  . THR C 1 206 ? 39.363  24.282  61.128  1.00 5.89  ? 237 THR C CB  1 
ATOM   10604 O  OG1 . THR C 1 206 ? 39.964  23.012  60.848  1.00 6.91  ? 237 THR C OG1 1 
ATOM   10605 C  CG2 . THR C 1 206 ? 39.946  25.302  60.186  1.00 2.53  ? 237 THR C CG2 1 
ATOM   10606 N  N   . LEU C 1 207 ? 37.696  23.795  63.667  1.00 9.87  ? 238 LEU C N   1 
ATOM   10607 C  CA  . LEU C 1 207 ? 36.880  22.932  64.535  1.00 7.72  ? 238 LEU C CA  1 
ATOM   10608 C  C   . LEU C 1 207 ? 36.934  21.504  64.027  1.00 8.86  ? 238 LEU C C   1 
ATOM   10609 O  O   . LEU C 1 207 ? 36.794  20.539  64.790  1.00 8.30  ? 238 LEU C O   1 
ATOM   10610 C  CB  . LEU C 1 207 ? 35.447  23.454  64.540  1.00 6.85  ? 238 LEU C CB  1 
ATOM   10611 C  CG  . LEU C 1 207 ? 34.319  22.888  65.401  1.00 8.16  ? 238 LEU C CG  1 
ATOM   10612 C  CD1 . LEU C 1 207 ? 33.710  21.675  64.742  1.00 8.54  ? 238 LEU C CD1 1 
ATOM   10613 C  CD2 . LEU C 1 207 ? 34.812  22.589  66.814  1.00 10.25 ? 238 LEU C CD2 1 
ATOM   10614 N  N   . ASP C 1 208 ? 37.100  21.374  62.721  1.00 10.33 ? 239 ASP C N   1 
ATOM   10615 C  CA  . ASP C 1 208 ? 37.227  20.067  62.145  1.00 15.48 ? 239 ASP C CA  1 
ATOM   10616 C  C   . ASP C 1 208 ? 38.531  19.451  62.705  1.00 15.14 ? 239 ASP C C   1 
ATOM   10617 O  O   . ASP C 1 208 ? 38.535  18.345  63.249  1.00 17.42 ? 239 ASP C O   1 
ATOM   10618 C  CB  . ASP C 1 208 ? 37.289  20.185  60.636  1.00 23.70 ? 239 ASP C CB  1 
ATOM   10619 C  CG  . ASP C 1 208 ? 37.727  18.890  59.977  1.00 34.55 ? 239 ASP C CG  1 
ATOM   10620 O  OD1 . ASP C 1 208 ? 37.103  17.824  60.252  1.00 40.05 ? 239 ASP C OD1 1 
ATOM   10621 O  OD2 . ASP C 1 208 ? 38.709  18.934  59.200  1.00 36.82 ? 239 ASP C OD2 1 
ATOM   10622 N  N   . ARG C 1 209 ? 39.618  20.204  62.634  1.00 13.02 ? 240 ARG C N   1 
ATOM   10623 C  CA  . ARG C 1 209 ? 40.930  19.761  63.130  1.00 9.84  ? 240 ARG C CA  1 
ATOM   10624 C  C   . ARG C 1 209 ? 40.899  19.520  64.647  1.00 5.10  ? 240 ARG C C   1 
ATOM   10625 O  O   . ARG C 1 209 ? 41.280  18.459  65.127  1.00 2.88  ? 240 ARG C O   1 
ATOM   10626 C  CB  . ARG C 1 209 ? 42.009  20.820  62.757  1.00 10.40 ? 240 ARG C CB  1 
ATOM   10627 C  CG  . ARG C 1 209 ? 43.465  20.507  63.064  1.00 5.92  ? 240 ARG C CG  1 
ATOM   10628 C  CD  . ARG C 1 209 ? 44.386  21.515  62.375  1.00 6.04  ? 240 ARG C CD  1 
ATOM   10629 N  NE  . ARG C 1 209 ? 45.786  21.298  62.730  1.00 7.16  ? 240 ARG C NE  1 
ATOM   10630 C  CZ  . ARG C 1 209 ? 46.567  20.368  62.179  1.00 9.42  ? 240 ARG C CZ  1 
ATOM   10631 N  NH1 . ARG C 1 209 ? 46.099  19.579  61.223  1.00 8.96  ? 240 ARG C NH1 1 
ATOM   10632 N  NH2 . ARG C 1 209 ? 47.770  20.118  62.682  1.00 10.65 ? 240 ARG C NH2 1 
ATOM   10633 N  N   . GLN C 1 210 ? 40.371  20.476  65.384  1.00 2.00  ? 241 GLN C N   1 
ATOM   10634 C  CA  . GLN C 1 210 ? 40.352  20.365  66.814  1.00 2.38  ? 241 GLN C CA  1 
ATOM   10635 C  C   . GLN C 1 210 ? 39.627  19.132  67.222  1.00 4.68  ? 241 GLN C C   1 
ATOM   10636 O  O   . GLN C 1 210 ? 39.895  18.543  68.280  1.00 3.93  ? 241 GLN C O   1 
ATOM   10637 C  CB  . GLN C 1 210 ? 39.703  21.589  67.437  1.00 3.43  ? 241 GLN C CB  1 
ATOM   10638 C  CG  . GLN C 1 210 ? 38.303  21.380  67.950  1.00 7.17  ? 241 GLN C CG  1 
ATOM   10639 C  CD  . GLN C 1 210 ? 38.079  22.000  69.327  1.00 8.82  ? 241 GLN C CD  1 
ATOM   10640 O  OE1 . GLN C 1 210 ? 37.745  21.302  70.275  1.00 11.28 ? 241 GLN C OE1 1 
ATOM   10641 N  NE2 . GLN C 1 210 ? 38.249  23.311  69.435  1.00 8.77  ? 241 GLN C NE2 1 
ATOM   10642 N  N   . HIS C 1 211 ? 38.684  18.733  66.380  1.00 6.78  ? 242 HIS C N   1 
ATOM   10643 C  CA  . HIS C 1 211 ? 37.914  17.538  66.695  1.00 10.22 ? 242 HIS C CA  1 
ATOM   10644 C  C   . HIS C 1 211 ? 38.721  16.251  66.458  1.00 9.79  ? 242 HIS C C   1 
ATOM   10645 O  O   . HIS C 1 211 ? 38.578  15.268  67.213  1.00 10.31 ? 242 HIS C O   1 
ATOM   10646 C  CB  . HIS C 1 211 ? 36.564  17.551  65.968  1.00 11.78 ? 242 HIS C CB  1 
ATOM   10647 C  CG  . HIS C 1 211 ? 35.502  18.357  66.669  1.00 9.83  ? 242 HIS C CG  1 
ATOM   10648 N  ND1 . HIS C 1 211 ? 35.659  18.868  67.946  1.00 6.15  ? 242 HIS C ND1 1 
ATOM   10649 C  CD2 . HIS C 1 211 ? 34.260  18.717  66.268  1.00 6.51  ? 242 HIS C CD2 1 
ATOM   10650 C  CE1 . HIS C 1 211 ? 34.558  19.506  68.297  1.00 6.89  ? 242 HIS C CE1 1 
ATOM   10651 N  NE2 . HIS C 1 211 ? 33.695  19.429  67.297  1.00 7.96  ? 242 HIS C NE2 1 
ATOM   10652 N  N   . LYS C 1 212 ? 39.608  16.292  65.458  1.00 7.63  ? 243 LYS C N   1 
ATOM   10653 C  CA  . LYS C 1 212 ? 40.494  15.174  65.156  1.00 4.23  ? 243 LYS C CA  1 
ATOM   10654 C  C   . LYS C 1 212 ? 41.586  15.042  66.229  1.00 4.03  ? 243 LYS C C   1 
ATOM   10655 O  O   . LYS C 1 212 ? 42.269  14.026  66.304  1.00 5.25  ? 243 LYS C O   1 
ATOM   10656 C  CB  . LYS C 1 212 ? 41.187  15.398  63.828  1.00 2.00  ? 243 LYS C CB  1 
ATOM   10657 C  CG  . LYS C 1 212 ? 40.329  15.338  62.628  1.00 2.00  ? 243 LYS C CG  1 
ATOM   10658 C  CD  . LYS C 1 212 ? 41.225  15.073  61.434  1.00 2.00  ? 243 LYS C CD  1 
ATOM   10659 C  CE  . LYS C 1 212 ? 40.520  15.329  60.102  1.00 5.53  ? 243 LYS C CE  1 
ATOM   10660 N  NZ  . LYS C 1 212 ? 41.449  15.315  58.920  1.00 2.50  ? 243 LYS C NZ  1 
ATOM   10661 N  N   . LEU C 1 213 ? 41.783  16.092  67.017  1.00 2.14  ? 244 LEU C N   1 
ATOM   10662 C  CA  . LEU C 1 213 ? 42.794  16.111  68.059  1.00 2.16  ? 244 LEU C CA  1 
ATOM   10663 C  C   . LEU C 1 213 ? 42.264  15.818  69.448  1.00 4.45  ? 244 LEU C C   1 
ATOM   10664 O  O   . LEU C 1 213 ? 43.038  15.552  70.381  1.00 4.03  ? 244 LEU C O   1 
ATOM   10665 C  CB  . LEU C 1 213 ? 43.421  17.485  68.086  1.00 2.00  ? 244 LEU C CB  1 
ATOM   10666 C  CG  . LEU C 1 213 ? 44.068  17.860  66.768  1.00 3.47  ? 244 LEU C CG  1 
ATOM   10667 C  CD1 . LEU C 1 213 ? 44.427  19.333  66.743  1.00 3.84  ? 244 LEU C CD1 1 
ATOM   10668 C  CD2 . LEU C 1 213 ? 45.292  16.995  66.582  1.00 2.01  ? 244 LEU C CD2 1 
ATOM   10669 N  N   . ARG C 1 214 ? 40.952  15.918  69.613  1.00 6.50  ? 245 ARG C N   1 
ATOM   10670 C  CA  . ARG C 1 214 ? 40.376  15.701  70.923  1.00 6.61  ? 245 ARG C CA  1 
ATOM   10671 C  C   . ARG C 1 214 ? 39.951  14.264  71.213  1.00 6.79  ? 245 ARG C C   1 
ATOM   10672 O  O   . ARG C 1 214 ? 39.531  13.527  70.324  1.00 9.19  ? 245 ARG C O   1 
ATOM   10673 C  CB  . ARG C 1 214 ? 39.215  16.659  71.149  1.00 4.25  ? 245 ARG C CB  1 
ATOM   10674 C  CG  . ARG C 1 214 ? 38.969  16.887  72.624  1.00 7.19  ? 245 ARG C CG  1 
ATOM   10675 C  CD  . ARG C 1 214 ? 37.600  17.433  72.886  1.00 8.76  ? 245 ARG C CD  1 
ATOM   10676 N  NE  . ARG C 1 214 ? 37.194  18.452  71.915  1.00 7.98  ? 245 ARG C NE  1 
ATOM   10677 C  CZ  . ARG C 1 214 ? 36.007  19.041  71.949  1.00 5.27  ? 245 ARG C CZ  1 
ATOM   10678 N  NH1 . ARG C 1 214 ? 35.158  18.700  72.914  1.00 4.75  ? 245 ARG C NH1 1 
ATOM   10679 N  NH2 . ARG C 1 214 ? 35.646  19.892  70.995  1.00 2.04  ? 245 ARG C NH2 1 
ATOM   10680 N  N   . LEU C 1 215 ? 40.051  13.889  72.478  1.00 4.69  ? 246 LEU C N   1 
ATOM   10681 C  CA  . LEU C 1 215 ? 39.679  12.564  72.944  1.00 5.91  ? 246 LEU C CA  1 
ATOM   10682 C  C   . LEU C 1 215 ? 38.160  12.459  73.223  1.00 9.00  ? 246 LEU C C   1 
ATOM   10683 O  O   . LEU C 1 215 ? 37.588  11.348  73.223  1.00 11.48 ? 246 LEU C O   1 
ATOM   10684 C  CB  . LEU C 1 215 ? 40.450  12.286  74.236  1.00 4.18  ? 246 LEU C CB  1 
ATOM   10685 C  CG  . LEU C 1 215 ? 40.132  11.041  75.049  1.00 5.77  ? 246 LEU C CG  1 
ATOM   10686 C  CD1 . LEU C 1 215 ? 40.720  9.791   74.365  1.00 3.51  ? 246 LEU C CD1 1 
ATOM   10687 C  CD2 . LEU C 1 215 ? 40.701  11.235  76.440  1.00 3.77  ? 246 LEU C CD2 1 
ATOM   10688 N  N   . PHE C 1 216 ? 37.532  13.619  73.468  1.00 8.32  ? 247 PHE C N   1 
ATOM   10689 C  CA  . PHE C 1 216 ? 36.115  13.720  73.800  1.00 4.30  ? 247 PHE C CA  1 
ATOM   10690 C  C   . PHE C 1 216 ? 35.911  12.817  74.987  1.00 4.59  ? 247 PHE C C   1 
ATOM   10691 O  O   . PHE C 1 216 ? 35.332  11.748  74.859  1.00 9.90  ? 247 PHE C O   1 
ATOM   10692 C  CB  . PHE C 1 216 ? 35.230  13.282  72.642  1.00 2.00  ? 247 PHE C CB  1 
ATOM   10693 C  CG  . PHE C 1 216 ? 35.291  14.186  71.461  1.00 2.00  ? 247 PHE C CG  1 
ATOM   10694 C  CD1 . PHE C 1 216 ? 34.942  15.517  71.581  1.00 2.00  ? 247 PHE C CD1 1 
ATOM   10695 C  CD2 . PHE C 1 216 ? 35.664  13.701  70.210  1.00 2.00  ? 247 PHE C CD2 1 
ATOM   10696 C  CE1 . PHE C 1 216 ? 34.964  16.354  70.458  1.00 3.34  ? 247 PHE C CE1 1 
ATOM   10697 C  CE2 . PHE C 1 216 ? 35.684  14.528  69.079  1.00 2.00  ? 247 PHE C CE2 1 
ATOM   10698 C  CZ  . PHE C 1 216 ? 35.337  15.846  69.200  1.00 2.01  ? 247 PHE C CZ  1 
ATOM   10699 N  N   . LYS C 1 217 ? 36.459  13.219  76.125  1.00 2.08  ? 248 LYS C N   1 
ATOM   10700 C  CA  . LYS C 1 217 ? 36.351  12.433  77.335  1.00 2.97  ? 248 LYS C CA  1 
ATOM   10701 C  C   . LYS C 1 217 ? 37.091  13.211  78.371  1.00 2.03  ? 248 LYS C C   1 
ATOM   10702 O  O   . LYS C 1 217 ? 38.290  13.364  78.280  1.00 4.35  ? 248 LYS C O   1 
ATOM   10703 C  CB  . LYS C 1 217 ? 37.063  11.096  77.130  1.00 7.04  ? 248 LYS C CB  1 
ATOM   10704 C  CG  . LYS C 1 217 ? 36.888  10.050  78.218  1.00 7.39  ? 248 LYS C CG  1 
ATOM   10705 C  CD  . LYS C 1 217 ? 37.476  8.742   77.706  1.00 14.26 ? 248 LYS C CD  1 
ATOM   10706 C  CE  . LYS C 1 217 ? 36.955  8.426   76.263  1.00 21.30 ? 248 LYS C CE  1 
ATOM   10707 N  NZ  . LYS C 1 217 ? 37.298  7.066   75.684  1.00 24.17 ? 248 LYS C NZ  1 
ATOM   10708 N  N   . ASP C 1 218 ? 36.384  13.706  79.361  1.00 2.14  ? 249 ASP C N   1 
ATOM   10709 C  CA  . ASP C 1 218 ? 37.012  14.483  80.404  1.00 2.03  ? 249 ASP C CA  1 
ATOM   10710 C  C   . ASP C 1 218 ? 37.651  15.713  79.797  1.00 6.17  ? 249 ASP C C   1 
ATOM   10711 O  O   . ASP C 1 218 ? 38.508  16.326  80.419  1.00 13.29 ? 249 ASP C O   1 
ATOM   10712 C  CB  . ASP C 1 218 ? 38.085  13.676  81.133  1.00 2.08  ? 249 ASP C CB  1 
ATOM   10713 C  CG  . ASP C 1 218 ? 37.556  12.417  81.743  1.00 2.00  ? 249 ASP C CG  1 
ATOM   10714 O  OD1 . ASP C 1 218 ? 36.858  12.505  82.751  1.00 3.34  ? 249 ASP C OD1 1 
ATOM   10715 O  OD2 . ASP C 1 218 ? 37.840  11.329  81.228  1.00 2.47  ? 249 ASP C OD2 1 
ATOM   10716 N  N   . GLY C 1 219 ? 37.262  16.060  78.576  1.00 4.88  ? 250 GLY C N   1 
ATOM   10717 C  CA  . GLY C 1 219 ? 37.819  17.228  77.911  1.00 5.93  ? 250 GLY C CA  1 
ATOM   10718 C  C   . GLY C 1 219 ? 39.244  17.106  77.403  1.00 5.05  ? 250 GLY C C   1 
ATOM   10719 O  O   . GLY C 1 219 ? 39.747  17.979  76.694  1.00 6.64  ? 250 GLY C O   1 
ATOM   10720 N  N   . LYS C 1 220 ? 39.888  16.012  77.765  1.00 6.26  ? 251 LYS C N   1 
ATOM   10721 C  CA  . LYS C 1 220 ? 41.263  15.727  77.389  1.00 5.37  ? 251 LYS C CA  1 
ATOM   10722 C  C   . LYS C 1 220 ? 41.550  15.703  75.897  1.00 4.51  ? 251 LYS C C   1 
ATOM   10723 O  O   . LYS C 1 220 ? 40.682  15.393  75.081  1.00 5.23  ? 251 LYS C O   1 
ATOM   10724 C  CB  . LYS C 1 220 ? 41.670  14.385  78.001  1.00 5.76  ? 251 LYS C CB  1 
ATOM   10725 C  CG  . LYS C 1 220 ? 41.635  14.394  79.531  1.00 5.61  ? 251 LYS C CG  1 
ATOM   10726 C  CD  . LYS C 1 220 ? 41.732  12.997  80.098  1.00 5.53  ? 251 LYS C CD  1 
ATOM   10727 C  CE  . LYS C 1 220 ? 42.091  13.032  81.568  1.00 5.89  ? 251 LYS C CE  1 
ATOM   10728 N  NZ  . LYS C 1 220 ? 43.472  13.583  81.791  1.00 7.77  ? 251 LYS C NZ  1 
ATOM   10729 N  N   . LEU C 1 221 ? 42.761  16.114  75.556  1.00 4.92  ? 252 LEU C N   1 
ATOM   10730 C  CA  . LEU C 1 221 ? 43.238  16.082  74.182  1.00 7.03  ? 252 LEU C CA  1 
ATOM   10731 C  C   . LEU C 1 221 ? 43.731  14.630  73.983  1.00 9.17  ? 252 LEU C C   1 
ATOM   10732 O  O   . LEU C 1 221 ? 44.102  13.926  74.951  1.00 7.96  ? 252 LEU C O   1 
ATOM   10733 C  CB  . LEU C 1 221 ? 44.416  17.031  73.996  1.00 6.11  ? 252 LEU C CB  1 
ATOM   10734 C  CG  . LEU C 1 221 ? 44.283  18.296  73.136  1.00 5.26  ? 252 LEU C CG  1 
ATOM   10735 C  CD1 . LEU C 1 221 ? 43.291  18.070  71.998  1.00 2.00  ? 252 LEU C CD1 1 
ATOM   10736 C  CD2 . LEU C 1 221 ? 43.915  19.494  73.999  1.00 2.00  ? 252 LEU C CD2 1 
ATOM   10737 N  N   . LYS C 1 222 ? 43.713  14.164  72.744  1.00 9.12  ? 253 LYS C N   1 
ATOM   10738 C  CA  . LYS C 1 222 ? 44.130  12.801  72.486  1.00 10.30 ? 253 LYS C CA  1 
ATOM   10739 C  C   . LYS C 1 222 ? 45.623  12.780  72.696  1.00 11.86 ? 253 LYS C C   1 
ATOM   10740 O  O   . LYS C 1 222 ? 46.262  13.820  72.538  1.00 14.20 ? 253 LYS C O   1 
ATOM   10741 C  CB  . LYS C 1 222 ? 43.791  12.438  71.049  1.00 13.68 ? 253 LYS C CB  1 
ATOM   10742 C  CG  . LYS C 1 222 ? 43.599  10.949  70.805  1.00 19.98 ? 253 LYS C CG  1 
ATOM   10743 C  CD  . LYS C 1 222 ? 42.309  10.649  69.994  1.00 22.48 ? 253 LYS C CD  1 
ATOM   10744 C  CE  . LYS C 1 222 ? 42.343  11.173  68.553  1.00 19.62 ? 253 LYS C CE  1 
ATOM   10745 N  NZ  . LYS C 1 222 ? 42.354  12.656  68.502  1.00 19.52 ? 253 LYS C NZ  1 
ATOM   10746 N  N   . TYR C 1 223 ? 46.178  11.617  73.045  1.00 13.48 ? 254 TYR C N   1 
ATOM   10747 C  CA  . TYR C 1 223 ? 47.621  11.464  73.274  1.00 13.91 ? 254 TYR C CA  1 
ATOM   10748 C  C   . TYR C 1 223 ? 48.000  9.982   73.256  1.00 14.94 ? 254 TYR C C   1 
ATOM   10749 O  O   . TYR C 1 223 ? 47.128  9.123   73.073  1.00 18.40 ? 254 TYR C O   1 
ATOM   10750 C  CB  . TYR C 1 223 ? 47.997  12.047  74.646  1.00 15.73 ? 254 TYR C CB  1 
ATOM   10751 C  CG  . TYR C 1 223 ? 47.416  11.280  75.824  1.00 16.37 ? 254 TYR C CG  1 
ATOM   10752 C  CD1 . TYR C 1 223 ? 47.948  10.066  76.212  1.00 16.70 ? 254 TYR C CD1 1 
ATOM   10753 C  CD2 . TYR C 1 223 ? 46.331  11.767  76.534  1.00 19.45 ? 254 TYR C CD2 1 
ATOM   10754 C  CE1 . TYR C 1 223 ? 47.421  9.355   77.254  1.00 19.13 ? 254 TYR C CE1 1 
ATOM   10755 C  CE2 . TYR C 1 223 ? 45.795  11.059  77.600  1.00 20.70 ? 254 TYR C CE2 1 
ATOM   10756 C  CZ  . TYR C 1 223 ? 46.347  9.847   77.950  1.00 20.05 ? 254 TYR C CZ  1 
ATOM   10757 O  OH  . TYR C 1 223 ? 45.825  9.112   78.995  1.00 22.30 ? 254 TYR C OH  1 
ATOM   10758 N  N   . GLN C 1 224 ? 49.282  9.693   73.528  1.00 13.48 ? 255 GLN C N   1 
ATOM   10759 C  CA  . GLN C 1 224 ? 49.810  8.325   73.602  1.00 9.35  ? 255 GLN C CA  1 
ATOM   10760 C  C   . GLN C 1 224 ? 50.926  8.201   74.639  1.00 9.35  ? 255 GLN C C   1 
ATOM   10761 O  O   . GLN C 1 224 ? 51.594  9.172   74.958  1.00 10.08 ? 255 GLN C O   1 
ATOM   10762 C  CB  . GLN C 1 224 ? 50.331  7.881   72.249  1.00 6.32  ? 255 GLN C CB  1 
ATOM   10763 C  CG  . GLN C 1 224 ? 51.577  8.537   71.813  1.00 2.00  ? 255 GLN C CG  1 
ATOM   10764 C  CD  . GLN C 1 224 ? 52.012  8.015   70.465  1.00 8.57  ? 255 GLN C CD  1 
ATOM   10765 O  OE1 . GLN C 1 224 ? 52.397  6.863   70.336  1.00 12.05 ? 255 GLN C OE1 1 
ATOM   10766 N  NE2 . GLN C 1 224 ? 51.920  8.845   69.439  1.00 11.01 ? 255 GLN C NE2 1 
ATOM   10767 N  N   . VAL C 1 225 ? 51.090  7.013   75.206  1.00 10.15 ? 256 VAL C N   1 
ATOM   10768 C  CA  . VAL C 1 225 ? 52.151  6.784   76.179  1.00 8.17  ? 256 VAL C CA  1 
ATOM   10769 C  C   . VAL C 1 225 ? 53.228  5.921   75.560  1.00 8.22  ? 256 VAL C C   1 
ATOM   10770 O  O   . VAL C 1 225 ? 53.023  4.744   75.308  1.00 8.03  ? 256 VAL C O   1 
ATOM   10771 C  CB  . VAL C 1 225 ? 51.672  6.074   77.455  1.00 8.37  ? 256 VAL C CB  1 
ATOM   10772 C  CG1 . VAL C 1 225 ? 52.867  5.755   78.351  1.00 5.80  ? 256 VAL C CG1 1 
ATOM   10773 C  CG2 . VAL C 1 225 ? 50.662  6.920   78.197  1.00 7.04  ? 256 VAL C CG2 1 
ATOM   10774 N  N   . ILE C 1 226 ? 54.342  6.556   75.238  1.00 8.95  ? 257 ILE C N   1 
ATOM   10775 C  CA  . ILE C 1 226 ? 55.508  5.894   74.681  1.00 7.90  ? 257 ILE C CA  1 
ATOM   10776 C  C   . ILE C 1 226 ? 56.417  5.733   75.882  1.00 9.16  ? 257 ILE C C   1 
ATOM   10777 O  O   . ILE C 1 226 ? 56.595  6.651   76.690  1.00 11.20 ? 257 ILE C O   1 
ATOM   10778 C  CB  . ILE C 1 226 ? 56.207  6.788   73.683  1.00 7.33  ? 257 ILE C CB  1 
ATOM   10779 C  CG1 . ILE C 1 226 ? 55.482  6.753   72.346  1.00 11.53 ? 257 ILE C CG1 1 
ATOM   10780 C  CG2 . ILE C 1 226 ? 57.634  6.384   73.525  1.00 9.59  ? 257 ILE C CG2 1 
ATOM   10781 C  CD1 . ILE C 1 226 ? 56.011  7.807   71.328  1.00 13.77 ? 257 ILE C CD1 1 
ATOM   10782 N  N   . GLY C 1 227 ? 57.016  4.575   76.012  1.00 9.76  ? 258 GLY C N   1 
ATOM   10783 C  CA  . GLY C 1 227 ? 57.877  4.384   77.156  1.00 13.85 ? 258 GLY C CA  1 
ATOM   10784 C  C   . GLY C 1 227 ? 56.953  4.509   78.334  1.00 15.25 ? 258 GLY C C   1 
ATOM   10785 O  O   . GLY C 1 227 ? 55.960  3.799   78.420  1.00 19.28 ? 258 GLY C O   1 
ATOM   10786 N  N   . GLY C 1 228 ? 57.252  5.412   79.240  1.00 14.19 ? 259 GLY C N   1 
ATOM   10787 C  CA  . GLY C 1 228 ? 56.347  5.586   80.355  1.00 17.37 ? 259 GLY C CA  1 
ATOM   10788 C  C   . GLY C 1 228 ? 55.818  7.012   80.297  1.00 19.54 ? 259 GLY C C   1 
ATOM   10789 O  O   . GLY C 1 228 ? 55.116  7.462   81.209  1.00 19.64 ? 259 GLY C O   1 
ATOM   10790 N  N   . GLU C 1 229 ? 56.138  7.720   79.213  1.00 19.58 ? 260 GLU C N   1 
ATOM   10791 C  CA  . GLU C 1 229 ? 55.757  9.110   79.087  1.00 19.07 ? 260 GLU C CA  1 
ATOM   10792 C  C   . GLU C 1 229 ? 54.619  9.357   78.100  1.00 19.93 ? 260 GLU C C   1 
ATOM   10793 O  O   . GLU C 1 229 ? 54.336  8.514   77.241  1.00 19.03 ? 260 GLU C O   1 
ATOM   10794 C  CB  . GLU C 1 229 ? 57.000  9.918   78.699  1.00 17.58 ? 260 GLU C CB  1 
ATOM   10795 C  CG  . GLU C 1 229 ? 58.198  9.691   79.599  1.00 16.69 ? 260 GLU C CG  1 
ATOM   10796 C  CD  . GLU C 1 229 ? 57.929  10.023  81.078  1.00 19.34 ? 260 GLU C CD  1 
ATOM   10797 O  OE1 . GLU C 1 229 ? 57.838  11.232  81.442  1.00 23.05 ? 260 GLU C OE1 1 
ATOM   10798 O  OE2 . GLU C 1 229 ? 57.842  9.070   81.888  1.00 16.93 ? 260 GLU C OE2 1 
ATOM   10799 N  N   . VAL C 1 230 ? 53.968  10.516  78.248  1.00 18.74 ? 261 VAL C N   1 
ATOM   10800 C  CA  . VAL C 1 230 ? 52.868  10.933  77.371  1.00 17.22 ? 261 VAL C CA  1 
ATOM   10801 C  C   . VAL C 1 230 ? 53.424  11.710  76.181  1.00 15.14 ? 261 VAL C C   1 
ATOM   10802 O  O   . VAL C 1 230 ? 54.299  12.551  76.363  1.00 17.52 ? 261 VAL C O   1 
ATOM   10803 C  CB  . VAL C 1 230 ? 51.864  11.845  78.144  1.00 17.59 ? 261 VAL C CB  1 
ATOM   10804 C  CG1 . VAL C 1 230 ? 51.138  12.791  77.194  1.00 16.07 ? 261 VAL C CG1 1 
ATOM   10805 C  CG2 . VAL C 1 230 ? 50.843  10.997  78.883  1.00 18.29 ? 261 VAL C CG2 1 
ATOM   10806 N  N   . TYR C 1 231 ? 52.893  11.464  74.988  1.00 11.17 ? 262 TYR C N   1 
ATOM   10807 C  CA  . TYR C 1 231 ? 53.330  12.152  73.780  1.00 10.81 ? 262 TYR C CA  1 
ATOM   10808 C  C   . TYR C 1 231 ? 52.139  12.400  72.870  1.00 10.77 ? 262 TYR C C   1 
ATOM   10809 O  O   . TYR C 1 231 ? 51.115  11.749  73.009  1.00 12.41 ? 262 TYR C O   1 
ATOM   10810 C  CB  . TYR C 1 231 ? 54.361  11.305  73.012  1.00 12.51 ? 262 TYR C CB  1 
ATOM   10811 C  CG  . TYR C 1 231 ? 55.689  11.214  73.701  1.00 12.14 ? 262 TYR C CG  1 
ATOM   10812 C  CD1 . TYR C 1 231 ? 56.585  12.269  73.636  1.00 12.73 ? 262 TYR C CD1 1 
ATOM   10813 C  CD2 . TYR C 1 231 ? 55.997  10.134  74.526  1.00 9.33  ? 262 TYR C CD2 1 
ATOM   10814 C  CE1 . TYR C 1 231 ? 57.751  12.269  74.395  1.00 13.28 ? 262 TYR C CE1 1 
ATOM   10815 C  CE2 . TYR C 1 231 ? 57.157  10.120  75.283  1.00 10.36 ? 262 TYR C CE2 1 
ATOM   10816 C  CZ  . TYR C 1 231 ? 58.031  11.203  75.219  1.00 12.34 ? 262 TYR C CZ  1 
ATOM   10817 O  OH  . TYR C 1 231 ? 59.157  11.275  76.016  1.00 12.18 ? 262 TYR C OH  1 
ATOM   10818 N  N   . PRO C 1 232 ? 52.242  13.373  71.944  1.00 11.50 ? 263 PRO C N   1 
ATOM   10819 C  CA  . PRO C 1 232 ? 51.147  13.664  71.018  1.00 11.50 ? 263 PRO C CA  1 
ATOM   10820 C  C   . PRO C 1 232 ? 50.812  12.387  70.277  1.00 12.00 ? 263 PRO C C   1 
ATOM   10821 O  O   . PRO C 1 232 ? 51.661  11.526  70.095  1.00 11.89 ? 263 PRO C O   1 
ATOM   10822 C  CB  . PRO C 1 232 ? 51.773  14.666  70.052  1.00 9.54  ? 263 PRO C CB  1 
ATOM   10823 C  CG  . PRO C 1 232 ? 52.649  15.420  70.923  1.00 13.61 ? 263 PRO C CG  1 
ATOM   10824 C  CD  . PRO C 1 232 ? 53.327  14.349  71.764  1.00 13.91 ? 263 PRO C CD  1 
ATOM   10825 N  N   . PRO C 1 233 ? 49.576  12.262  69.824  1.00 12.65 ? 264 PRO C N   1 
ATOM   10826 C  CA  . PRO C 1 233 ? 49.141  11.073  69.097  1.00 12.93 ? 264 PRO C CA  1 
ATOM   10827 C  C   . PRO C 1 233 ? 49.649  11.056  67.653  1.00 10.81 ? 264 PRO C C   1 
ATOM   10828 O  O   . PRO C 1 233 ? 50.069  12.074  67.110  1.00 7.77  ? 264 PRO C O   1 
ATOM   10829 C  CB  . PRO C 1 233 ? 47.624  11.186  69.172  1.00 19.27 ? 264 PRO C CB  1 
ATOM   10830 C  CG  . PRO C 1 233 ? 47.415  12.712  69.065  1.00 17.91 ? 264 PRO C CG  1 
ATOM   10831 C  CD  . PRO C 1 233 ? 48.496  13.258  69.960  1.00 14.91 ? 264 PRO C CD  1 
ATOM   10832 N  N   . THR C 1 234 ? 49.534  9.903   67.021  1.00 10.25 ? 265 THR C N   1 
ATOM   10833 C  CA  . THR C 1 234 ? 50.012  9.731   65.665  1.00 10.77 ? 265 THR C CA  1 
ATOM   10834 C  C   . THR C 1 234 ? 49.174  10.370  64.603  1.00 5.81  ? 265 THR C C   1 
ATOM   10835 O  O   . THR C 1 234 ? 47.951  10.421  64.721  1.00 10.23 ? 265 THR C O   1 
ATOM   10836 C  CB  . THR C 1 234 ? 50.139  8.208   65.323  1.00 16.96 ? 265 THR C CB  1 
ATOM   10837 O  OG1 . THR C 1 234 ? 48.874  7.547   65.484  1.00 23.14 ? 265 THR C OG1 1 
ATOM   10838 C  CG2 . THR C 1 234 ? 51.154  7.529   66.274  1.00 23.66 ? 265 THR C CG2 1 
ATOM   10839 N  N   . VAL C 1 235 ? 49.824  10.875  63.568  1.00 2.88  ? 266 VAL C N   1 
ATOM   10840 C  CA  . VAL C 1 235 ? 49.092  11.421  62.435  1.00 3.85  ? 266 VAL C CA  1 
ATOM   10841 C  C   . VAL C 1 235 ? 48.236  10.295  61.877  1.00 7.16  ? 266 VAL C C   1 
ATOM   10842 O  O   . VAL C 1 235 ? 47.102  10.521  61.442  1.00 7.53  ? 266 VAL C O   1 
ATOM   10843 C  CB  . VAL C 1 235 ? 50.036  11.871  61.334  1.00 2.00  ? 266 VAL C CB  1 
ATOM   10844 C  CG1 . VAL C 1 235 ? 49.370  11.822  59.974  1.00 2.07  ? 266 VAL C CG1 1 
ATOM   10845 C  CG2 . VAL C 1 235 ? 50.450  13.270  61.611  1.00 8.41  ? 266 VAL C CG2 1 
ATOM   10846 N  N   . LYS C 1 236 ? 48.797  9.083   61.921  1.00 9.45  ? 267 LYS C N   1 
ATOM   10847 C  CA  . LYS C 1 236 ? 48.154  7.858   61.442  1.00 9.46  ? 267 LYS C CA  1 
ATOM   10848 C  C   . LYS C 1 236 ? 46.781  7.657   62.094  1.00 7.53  ? 267 LYS C C   1 
ATOM   10849 O  O   . LYS C 1 236 ? 45.784  7.473   61.401  1.00 5.72  ? 267 LYS C O   1 
ATOM   10850 C  CB  . LYS C 1 236 ? 49.063  6.662   61.755  1.00 13.33 ? 267 LYS C CB  1 
ATOM   10851 C  CG  . LYS C 1 236 ? 48.757  5.391   60.958  1.00 17.85 ? 267 LYS C CG  1 
ATOM   10852 C  CD  . LYS C 1 236 ? 49.089  4.149   61.781  1.00 20.72 ? 267 LYS C CD  1 
ATOM   10853 C  CE  . LYS C 1 236 ? 48.719  2.866   61.053  1.00 20.40 ? 267 LYS C CE  1 
ATOM   10854 N  NZ  . LYS C 1 236 ? 48.836  1.699   61.975  1.00 22.76 ? 267 LYS C NZ  1 
ATOM   10855 N  N   . ASP C 1 237 ? 46.757  7.730   63.422  1.00 6.42  ? 268 ASP C N   1 
ATOM   10856 C  CA  . ASP C 1 237 ? 45.556  7.563   64.206  1.00 6.59  ? 268 ASP C CA  1 
ATOM   10857 C  C   . ASP C 1 237 ? 44.573  8.736   64.053  1.00 5.94  ? 268 ASP C C   1 
ATOM   10858 O  O   . ASP C 1 237 ? 43.492  8.574   63.479  1.00 6.83  ? 268 ASP C O   1 
ATOM   10859 C  CB  . ASP C 1 237 ? 45.953  7.338   65.672  1.00 9.51  ? 268 ASP C CB  1 
ATOM   10860 C  CG  . ASP C 1 237 ? 44.762  7.293   66.609  1.00 20.51 ? 268 ASP C CG  1 
ATOM   10861 O  OD1 . ASP C 1 237 ? 43.938  6.358   66.477  1.00 28.46 ? 268 ASP C OD1 1 
ATOM   10862 O  OD2 . ASP C 1 237 ? 44.636  8.191   67.483  1.00 23.57 ? 268 ASP C OD2 1 
ATOM   10863 N  N   . THR C 1 238 ? 44.974  9.921   64.510  1.00 4.92  ? 269 THR C N   1 
ATOM   10864 C  CA  . THR C 1 238 ? 44.113  11.107  64.476  1.00 6.62  ? 269 THR C CA  1 
ATOM   10865 C  C   . THR C 1 238 ? 43.759  11.533  63.061  1.00 9.43  ? 269 THR C C   1 
ATOM   10866 O  O   . THR C 1 238 ? 42.768  12.232  62.840  1.00 11.78 ? 269 THR C O   1 
ATOM   10867 C  CB  . THR C 1 238 ? 44.784  12.308  65.117  1.00 2.05  ? 269 THR C CB  1 
ATOM   10868 O  OG1 . THR C 1 238 ? 45.897  12.653  64.309  1.00 2.00  ? 269 THR C OG1 1 
ATOM   10869 C  CG2 . THR C 1 238 ? 45.262  12.008  66.504  1.00 2.00  ? 269 THR C CG2 1 
ATOM   10870 N  N   . GLN C 1 239 ? 44.639  11.240  62.120  1.00 10.50 ? 270 GLN C N   1 
ATOM   10871 C  CA  . GLN C 1 239 ? 44.368  11.589  60.736  1.00 12.61 ? 270 GLN C CA  1 
ATOM   10872 C  C   . GLN C 1 239 ? 44.564  13.059  60.444  1.00 11.45 ? 270 GLN C C   1 
ATOM   10873 O  O   . GLN C 1 239 ? 44.285  13.497  59.313  1.00 12.44 ? 270 GLN C O   1 
ATOM   10874 C  CB  . GLN C 1 239 ? 42.929  11.231  60.353  1.00 18.08 ? 270 GLN C CB  1 
ATOM   10875 C  CG  . GLN C 1 239 ? 42.782  10.438  59.071  1.00 30.59 ? 270 GLN C CG  1 
ATOM   10876 C  CD  . GLN C 1 239 ? 42.973  8.944   59.305  1.00 40.03 ? 270 GLN C CD  1 
ATOM   10877 O  OE1 . GLN C 1 239 ? 42.108  8.275   59.901  1.00 44.89 ? 270 GLN C OE1 1 
ATOM   10878 N  NE2 . GLN C 1 239 ? 44.104  8.408   58.847  1.00 43.67 ? 270 GLN C NE2 1 
ATOM   10879 N  N   . VAL C 1 240 ? 45.015  13.839  61.429  1.00 8.52  ? 271 VAL C N   1 
ATOM   10880 C  CA  . VAL C 1 240 ? 45.221  15.276  61.185  1.00 7.09  ? 271 VAL C CA  1 
ATOM   10881 C  C   . VAL C 1 240 ? 46.444  15.462  60.285  1.00 8.03  ? 271 VAL C C   1 
ATOM   10882 O  O   . VAL C 1 240 ? 47.458  14.816  60.523  1.00 13.10 ? 271 VAL C O   1 
ATOM   10883 C  CB  . VAL C 1 240 ? 45.434  16.103  62.500  1.00 4.68  ? 271 VAL C CB  1 
ATOM   10884 C  CG1 . VAL C 1 240 ? 44.951  15.380  63.720  1.00 2.00  ? 271 VAL C CG1 1 
ATOM   10885 C  CG2 . VAL C 1 240 ? 46.863  16.492  62.664  1.00 4.13  ? 271 VAL C CG2 1 
ATOM   10886 N  N   . GLU C 1 241 ? 46.352  16.263  59.221  1.00 8.03  ? 272 GLU C N   1 
ATOM   10887 C  CA  . GLU C 1 241 ? 47.532  16.472  58.371  1.00 8.33  ? 272 GLU C CA  1 
ATOM   10888 C  C   . GLU C 1 241 ? 48.570  17.336  59.097  1.00 10.05 ? 272 GLU C C   1 
ATOM   10889 O  O   . GLU C 1 241 ? 48.243  18.325  59.761  1.00 8.68  ? 272 GLU C O   1 
ATOM   10890 C  CB  . GLU C 1 241 ? 47.208  17.118  57.050  1.00 4.39  ? 272 GLU C CB  1 
ATOM   10891 C  CG  . GLU C 1 241 ? 46.318  16.311  56.179  1.00 18.82 ? 272 GLU C CG  1 
ATOM   10892 C  CD  . GLU C 1 241 ? 46.219  16.876  54.752  1.00 27.52 ? 272 GLU C CD  1 
ATOM   10893 O  OE1 . GLU C 1 241 ? 46.436  18.100  54.567  1.00 34.94 ? 272 GLU C OE1 1 
ATOM   10894 O  OE2 . GLU C 1 241 ? 45.931  16.098  53.805  1.00 31.69 ? 272 GLU C OE2 1 
ATOM   10895 N  N   . MET C 1 242 ? 49.820  16.898  59.004  1.00 11.39 ? 273 MET C N   1 
ATOM   10896 C  CA  . MET C 1 242 ? 50.967  17.557  59.608  1.00 6.99  ? 273 MET C CA  1 
ATOM   10897 C  C   . MET C 1 242 ? 52.029  17.578  58.519  1.00 7.51  ? 273 MET C C   1 
ATOM   10898 O  O   . MET C 1 242 ? 51.925  16.826  57.545  1.00 10.90 ? 273 MET C O   1 
ATOM   10899 C  CB  . MET C 1 242 ? 51.449  16.727  60.789  1.00 4.69  ? 273 MET C CB  1 
ATOM   10900 C  CG  . MET C 1 242 ? 50.635  16.936  62.028  1.00 4.95  ? 273 MET C CG  1 
ATOM   10901 S  SD  . MET C 1 242 ? 50.727  18.683  62.523  1.00 7.64  ? 273 MET C SD  1 
ATOM   10902 C  CE  . MET C 1 242 ? 52.306  18.674  63.357  1.00 8.11  ? 273 MET C CE  1 
ATOM   10903 N  N   . ILE C 1 243 ? 53.029  18.439  58.643  1.00 8.62  ? 274 ILE C N   1 
ATOM   10904 C  CA  . ILE C 1 243 ? 54.106  18.487  57.635  1.00 12.85 ? 274 ILE C CA  1 
ATOM   10905 C  C   . ILE C 1 243 ? 55.350  17.684  58.087  1.00 12.68 ? 274 ILE C C   1 
ATOM   10906 O  O   . ILE C 1 243 ? 56.053  18.081  59.033  1.00 12.74 ? 274 ILE C O   1 
ATOM   10907 C  CB  . ILE C 1 243 ? 54.562  19.912  57.369  1.00 16.27 ? 274 ILE C CB  1 
ATOM   10908 C  CG1 . ILE C 1 243 ? 53.372  20.783  56.949  1.00 17.99 ? 274 ILE C CG1 1 
ATOM   10909 C  CG2 . ILE C 1 243 ? 55.633  19.908  56.279  1.00 15.29 ? 274 ILE C CG2 1 
ATOM   10910 C  CD1 . ILE C 1 243 ? 53.701  22.263  56.870  1.00 19.31 ? 274 ILE C CD1 1 
ATOM   10911 N  N   . TYR C 1 244 ? 55.638  16.599  57.370  1.00 10.65 ? 275 TYR C N   1 
ATOM   10912 C  CA  . TYR C 1 244 ? 56.735  15.702  57.692  1.00 9.30  ? 275 TYR C CA  1 
ATOM   10913 C  C   . TYR C 1 244 ? 57.395  15.132  56.423  1.00 14.32 ? 275 TYR C C   1 
ATOM   10914 O  O   . TYR C 1 244 ? 56.701  14.685  55.486  1.00 17.17 ? 275 TYR C O   1 
ATOM   10915 C  CB  . TYR C 1 244 ? 56.188  14.549  58.505  1.00 4.18  ? 275 TYR C CB  1 
ATOM   10916 C  CG  . TYR C 1 244 ? 55.962  14.835  59.949  1.00 2.00  ? 275 TYR C CG  1 
ATOM   10917 C  CD1 . TYR C 1 244 ? 57.012  15.205  60.763  1.00 3.79  ? 275 TYR C CD1 1 
ATOM   10918 C  CD2 . TYR C 1 244 ? 54.714  14.635  60.529  1.00 2.00  ? 275 TYR C CD2 1 
ATOM   10919 C  CE1 . TYR C 1 244 ? 56.829  15.359  62.119  1.00 5.05  ? 275 TYR C CE1 1 
ATOM   10920 C  CE2 . TYR C 1 244 ? 54.516  14.789  61.877  1.00 2.10  ? 275 TYR C CE2 1 
ATOM   10921 C  CZ  . TYR C 1 244 ? 55.577  15.148  62.670  1.00 5.30  ? 275 TYR C CZ  1 
ATOM   10922 O  OH  . TYR C 1 244 ? 55.402  15.285  64.025  1.00 10.32 ? 275 TYR C OH  1 
ATOM   10923 N  N   . PRO C 1 245 ? 58.745  15.099  56.393  1.00 15.60 ? 276 PRO C N   1 
ATOM   10924 C  CA  . PRO C 1 245 ? 59.518  14.587  55.252  1.00 13.95 ? 276 PRO C CA  1 
ATOM   10925 C  C   . PRO C 1 245 ? 59.193  13.120  55.038  1.00 13.19 ? 276 PRO C C   1 
ATOM   10926 O  O   . PRO C 1 245 ? 59.193  12.333  55.988  1.00 11.66 ? 276 PRO C O   1 
ATOM   10927 C  CB  . PRO C 1 245 ? 60.965  14.770  55.710  1.00 15.21 ? 276 PRO C CB  1 
ATOM   10928 C  CG  . PRO C 1 245 ? 60.882  15.906  56.690  1.00 16.15 ? 276 PRO C CG  1 
ATOM   10929 C  CD  . PRO C 1 245 ? 59.650  15.545  57.469  1.00 16.08 ? 276 PRO C CD  1 
ATOM   10930 N  N   . PRO C 1 246 ? 59.019  12.712  53.775  1.00 13.13 ? 277 PRO C N   1 
ATOM   10931 C  CA  . PRO C 1 246 ? 58.689  11.323  53.423  1.00 14.93 ? 277 PRO C CA  1 
ATOM   10932 C  C   . PRO C 1 246 ? 59.513  10.226  54.091  1.00 15.77 ? 277 PRO C C   1 
ATOM   10933 O  O   . PRO C 1 246 ? 59.024  9.135   54.330  1.00 14.88 ? 277 PRO C O   1 
ATOM   10934 C  CB  . PRO C 1 246 ? 58.818  11.311  51.897  1.00 14.48 ? 277 PRO C CB  1 
ATOM   10935 C  CG  . PRO C 1 246 ? 59.713  12.502  51.598  1.00 12.63 ? 277 PRO C CG  1 
ATOM   10936 C  CD  . PRO C 1 246 ? 59.256  13.523  52.572  1.00 11.33 ? 277 PRO C CD  1 
ATOM   10937 N  N   . HIS C 1 247 ? 60.764  10.521  54.407  1.00 20.97 ? 278 HIS C N   1 
ATOM   10938 C  CA  . HIS C 1 247 ? 61.597  9.514   55.058  1.00 25.59 ? 278 HIS C CA  1 
ATOM   10939 C  C   . HIS C 1 247 ? 61.166  9.230   56.516  1.00 27.49 ? 278 HIS C C   1 
ATOM   10940 O  O   . HIS C 1 247 ? 61.563  8.190   57.092  1.00 29.33 ? 278 HIS C O   1 
ATOM   10941 C  CB  . HIS C 1 247 ? 63.092  9.881   54.982  1.00 25.82 ? 278 HIS C CB  1 
ATOM   10942 C  CG  . HIS C 1 247 ? 63.432  11.184  55.635  1.00 29.88 ? 278 HIS C CG  1 
ATOM   10943 N  ND1 . HIS C 1 247 ? 63.668  12.335  54.911  1.00 33.49 ? 278 HIS C ND1 1 
ATOM   10944 C  CD2 . HIS C 1 247 ? 63.588  11.519  56.941  1.00 31.24 ? 278 HIS C CD2 1 
ATOM   10945 C  CE1 . HIS C 1 247 ? 63.956  13.323  55.744  1.00 34.74 ? 278 HIS C CE1 1 
ATOM   10946 N  NE2 . HIS C 1 247 ? 63.913  12.854  56.981  1.00 34.30 ? 278 HIS C NE2 1 
ATOM   10947 N  N   . ILE C 1 248 ? 60.382  10.140  57.117  1.00 25.32 ? 279 ILE C N   1 
ATOM   10948 C  CA  . ILE C 1 248 ? 59.939  9.947   58.498  1.00 25.36 ? 279 ILE C CA  1 
ATOM   10949 C  C   . ILE C 1 248 ? 59.169  8.636   58.431  1.00 26.05 ? 279 ILE C C   1 
ATOM   10950 O  O   . ILE C 1 248 ? 58.333  8.437   57.530  1.00 24.53 ? 279 ILE C O   1 
ATOM   10951 C  CB  . ILE C 1 248 ? 58.994  11.071  59.000  1.00 28.46 ? 279 ILE C CB  1 
ATOM   10952 C  CG1 . ILE C 1 248 ? 59.608  12.456  58.760  1.00 29.96 ? 279 ILE C CG1 1 
ATOM   10953 C  CG2 . ILE C 1 248 ? 58.673  10.870  60.503  1.00 27.19 ? 279 ILE C CG2 1 
ATOM   10954 C  CD1 . ILE C 1 248 ? 60.629  12.889  59.766  1.00 34.78 ? 279 ILE C CD1 1 
ATOM   10955 N  N   . PRO C 1 249 ? 59.412  7.734   59.397  1.00 26.45 ? 280 PRO C N   1 
ATOM   10956 C  CA  . PRO C 1 249 ? 58.736  6.425   59.422  1.00 26.48 ? 280 PRO C CA  1 
ATOM   10957 C  C   . PRO C 1 249 ? 57.264  6.399   59.812  1.00 24.96 ? 280 PRO C C   1 
ATOM   10958 O  O   . PRO C 1 249 ? 56.741  5.301   60.072  1.00 23.41 ? 280 PRO C O   1 
ATOM   10959 C  CB  . PRO C 1 249 ? 59.548  5.665   60.468  1.00 27.02 ? 280 PRO C CB  1 
ATOM   10960 C  CG  . PRO C 1 249 ? 59.859  6.775   61.480  1.00 24.38 ? 280 PRO C CG  1 
ATOM   10961 C  CD  . PRO C 1 249 ? 60.300  7.896   60.570  1.00 25.37 ? 280 PRO C CD  1 
ATOM   10962 N  N   . GLU C 1 250 ? 56.592  7.557   59.817  1.00 22.99 ? 281 GLU C N   1 
ATOM   10963 C  CA  . GLU C 1 250 ? 55.214  7.592   60.295  1.00 25.18 ? 281 GLU C CA  1 
ATOM   10964 C  C   . GLU C 1 250 ? 55.527  7.157   61.753  1.00 24.99 ? 281 GLU C C   1 
ATOM   10965 O  O   . GLU C 1 250 ? 56.652  7.402   62.210  1.00 23.81 ? 281 GLU C O   1 
ATOM   10966 C  CB  . GLU C 1 250 ? 54.407  6.562   59.499  1.00 28.14 ? 281 GLU C CB  1 
ATOM   10967 C  CG  . GLU C 1 250 ? 52.986  6.241   59.923  1.00 33.21 ? 281 GLU C CG  1 
ATOM   10968 C  CD  . GLU C 1 250 ? 52.497  4.906   59.286  1.00 36.50 ? 281 GLU C CD  1 
ATOM   10969 O  OE1 . GLU C 1 250 ? 52.508  4.777   58.023  1.00 38.01 ? 281 GLU C OE1 1 
ATOM   10970 O  OE2 . GLU C 1 250 ? 52.123  3.976   60.052  1.00 35.60 ? 281 GLU C OE2 1 
ATOM   10971 N  N   . ASN C 1 251 ? 54.573  6.652   62.532  1.00 24.90 ? 282 ASN C N   1 
ATOM   10972 C  CA  . ASN C 1 251 ? 54.910  6.165   63.886  1.00 24.26 ? 282 ASN C CA  1 
ATOM   10973 C  C   . ASN C 1 251 ? 55.606  7.175   64.812  1.00 22.25 ? 282 ASN C C   1 
ATOM   10974 O  O   . ASN C 1 251 ? 55.785  6.924   66.007  1.00 22.14 ? 282 ASN C O   1 
ATOM   10975 C  CB  . ASN C 1 251 ? 55.808  4.942   63.722  1.00 25.80 ? 282 ASN C CB  1 
ATOM   10976 C  CG  . ASN C 1 251 ? 55.453  4.152   62.470  1.00 32.70 ? 282 ASN C CG  1 
ATOM   10977 O  OD1 . ASN C 1 251 ? 54.344  4.302   61.934  1.00 34.86 ? 282 ASN C OD1 1 
ATOM   10978 N  ND2 . ASN C 1 251 ? 56.383  3.345   61.970  1.00 36.19 ? 282 ASN C ND2 1 
ATOM   10979 N  N   . LEU C 1 252 ? 55.967  8.324   64.258  1.00 18.98 ? 283 LEU C N   1 
ATOM   10980 C  CA  . LEU C 1 252 ? 56.674  9.373   64.973  1.00 19.39 ? 283 LEU C CA  1 
ATOM   10981 C  C   . LEU C 1 252 ? 56.164  10.664  64.398  1.00 19.09 ? 283 LEU C C   1 
ATOM   10982 O  O   . LEU C 1 252 ? 56.697  11.736  64.715  1.00 21.47 ? 283 LEU C O   1 
ATOM   10983 C  CB  . LEU C 1 252 ? 58.187  9.320   64.702  1.00 17.96 ? 283 LEU C CB  1 
ATOM   10984 C  CG  . LEU C 1 252 ? 58.984  8.115   65.175  1.00 17.70 ? 283 LEU C CG  1 
ATOM   10985 C  CD1 . LEU C 1 252 ? 60.305  8.044   64.410  1.00 13.69 ? 283 LEU C CD1 1 
ATOM   10986 C  CD2 . LEU C 1 252 ? 59.147  8.132   66.700  1.00 11.37 ? 283 LEU C CD2 1 
ATOM   10987 N  N   . GLN C 1 253 ? 55.233  10.555  63.452  1.00 15.74 ? 284 GLN C N   1 
ATOM   10988 C  CA  . GLN C 1 253 ? 54.644  11.746  62.881  1.00 11.00 ? 284 GLN C CA  1 
ATOM   10989 C  C   . GLN C 1 253 ? 53.627  12.235  63.923  1.00 10.06 ? 284 GLN C C   1 
ATOM   10990 O  O   . GLN C 1 253 ? 52.443  11.837  63.912  1.00 10.12 ? 284 GLN C O   1 
ATOM   10991 C  CB  . GLN C 1 253 ? 53.994  11.450  61.538  1.00 7.32  ? 284 GLN C CB  1 
ATOM   10992 C  CG  . GLN C 1 253 ? 54.999  11.120  60.472  1.00 9.98  ? 284 GLN C CG  1 
ATOM   10993 C  CD  . GLN C 1 253 ? 54.409  11.207  59.080  1.00 14.66 ? 284 GLN C CD  1 
ATOM   10994 O  OE1 . GLN C 1 253 ? 53.760  12.193  58.730  1.00 15.03 ? 284 GLN C OE1 1 
ATOM   10995 N  NE2 . GLN C 1 253 ? 54.624  10.169  58.275  1.00 20.75 ? 284 GLN C NE2 1 
ATOM   10996 N  N   . PHE C 1 254 ? 54.134  12.983  64.897  1.00 4.72  ? 285 PHE C N   1 
ATOM   10997 C  CA  . PHE C 1 254 ? 53.320  13.533  65.951  1.00 5.79  ? 285 PHE C CA  1 
ATOM   10998 C  C   . PHE C 1 254 ? 52.263  14.538  65.399  1.00 10.19 ? 285 PHE C C   1 
ATOM   10999 O  O   . PHE C 1 254 ? 52.549  15.310  64.467  1.00 12.07 ? 285 PHE C O   1 
ATOM   11000 C  CB  . PHE C 1 254 ? 54.237  14.154  66.986  1.00 2.34  ? 285 PHE C CB  1 
ATOM   11001 C  CG  . PHE C 1 254 ? 55.042  13.142  67.753  1.00 6.08  ? 285 PHE C CG  1 
ATOM   11002 C  CD1 . PHE C 1 254 ? 55.064  11.805  67.361  1.00 7.31  ? 285 PHE C CD1 1 
ATOM   11003 C  CD2 . PHE C 1 254 ? 55.714  13.495  68.926  1.00 7.72  ? 285 PHE C CD2 1 
ATOM   11004 C  CE1 . PHE C 1 254 ? 55.741  10.820  68.141  1.00 7.81  ? 285 PHE C CE1 1 
ATOM   11005 C  CE2 . PHE C 1 254 ? 56.393  12.519  69.715  1.00 7.80  ? 285 PHE C CE2 1 
ATOM   11006 C  CZ  . PHE C 1 254 ? 56.400  11.189  69.322  1.00 6.05  ? 285 PHE C CZ  1 
ATOM   11007 N  N   . ALA C 1 255 ? 51.027  14.467  65.923  1.00 10.85 ? 286 ALA C N   1 
ATOM   11008 C  CA  . ALA C 1 255 ? 49.894  15.311  65.497  1.00 6.20  ? 286 ALA C CA  1 
ATOM   11009 C  C   . ALA C 1 255 ? 49.905  16.801  65.969  1.00 6.38  ? 286 ALA C C   1 
ATOM   11010 O  O   . ALA C 1 255 ? 49.870  17.737  65.149  1.00 2.00  ? 286 ALA C O   1 
ATOM   11011 C  CB  . ALA C 1 255 ? 48.612  14.636  65.909  1.00 4.01  ? 286 ALA C CB  1 
ATOM   11012 N  N   . VAL C 1 256 ? 49.854  17.021  67.281  1.00 5.18  ? 287 VAL C N   1 
ATOM   11013 C  CA  . VAL C 1 256 ? 49.901  18.370  67.866  1.00 6.32  ? 287 VAL C CA  1 
ATOM   11014 C  C   . VAL C 1 256 ? 48.929  19.499  67.539  1.00 6.53  ? 287 VAL C C   1 
ATOM   11015 O  O   . VAL C 1 256 ? 48.438  20.144  68.467  1.00 8.77  ? 287 VAL C O   1 
ATOM   11016 C  CB  . VAL C 1 256 ? 51.302  18.987  67.812  1.00 8.75  ? 287 VAL C CB  1 
ATOM   11017 C  CG1 . VAL C 1 256 ? 52.330