data_5CP6
# 
_entry.id   5CP6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5CP6         
WWPDB D_1000211416 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5CP6 
_pdbx_database_status.recvd_initial_deposition_date   2015-07-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ma, Z.'         1 
'Adhireksan, Z.' 2 
'Murray, B.S.'   3 
'Dyson, P.J.'    4 
'Davey, C.A.'    5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   GE 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Angew.Chem.Int.Ed.Engl. 
_citation.journal_id_ASTM           ACIEAY 
_citation.journal_id_CSD            0179 
_citation.journal_id_ISSN           1521-3773 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            55 
_citation.language                  ? 
_citation.page_first                7441 
_citation.page_last                 7444 
_citation.title                     
'An Organometallic Compound which Exhibits a DNA Topology-Dependent One-Stranded Intercalation Mode.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/anie.201602145 
_citation.pdbx_database_id_PubMed   27184539 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ma, Z.'            1 
primary 'Palermo, G.'       2 
primary 'Adhireksan, Z.'    3 
primary 'Murray, B.S.'      4 
primary 'von Erlach, T.'    5 
primary 'Dyson, P.J.'       6 
primary 'Rothlisberger, U.' 7 
primary 'Davey, C.A.'       8 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5CP6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     106.570 
_cell.length_a_esd                 ? 
_cell.length_b                     109.570 
_cell.length_b_esd                 ? 
_cell.length_c                     182.610 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5CP6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn 'DNA (145-MER)'                                                     44749.664 1  ? ? ? ? 
2  polymer     syn 'DNA (145-MER)'                                                     44740.648 1  ? ? ? ? 
3  polymer     man 'Histone H3.2'                                                      15303.930 2  ? ? ? ? 
4  polymer     man 'Histone H4'                                                        11263.231 2  ? ? ? ? 
5  polymer     man 'Histone H2A'                                                       13907.163 2  ? ? ? ? 
6  polymer     man 'Histone H2B 1.1'                                                   13848.097 2  ? ? ? ? 
7  non-polymer syn '(ethane6-5,8,9,10-tetrahydroanthracene)Ru(II)(ethylene-diamine)Cl' 378.882   3  ? ? ? ? 
8  non-polymer syn 'SULFATE ION'                                                       96.063    3  ? ? ? ? 
9  non-polymer syn 'MAGNESIUM ION'                                                     24.305    1  ? ? ? ? 
10 water       nat water                                                               18.015    35 ? ? ? ? 
# 
_entity_name_com.entity_id   6 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
2 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
3 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
4 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
5 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
C,G ? 
6 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DA  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DT  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DC  n 
1 76  DA  n 
1 77  DG  n 
1 78  DC  n 
1 79  DT  n 
1 80  DG  n 
1 81  DA  n 
1 82  DA  n 
1 83  DC  n 
1 84  DA  n 
1 85  DT  n 
1 86  DG  n 
1 87  DC  n 
1 88  DC  n 
1 89  DT  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DG  n 
1 94  DA  n 
1 95  DT  n 
1 96  DG  n 
1 97  DG  n 
1 98  DA  n 
1 99  DG  n 
1 100 DC  n 
1 101 DA  n 
1 102 DG  n 
1 103 DT  n 
1 104 DT  n 
1 105 DT  n 
1 106 DC  n 
1 107 DC  n 
1 108 DA  n 
1 109 DA  n 
1 110 DA  n 
1 111 DT  n 
1 112 DA  n 
1 113 DC  n 
1 114 DA  n 
1 115 DC  n 
1 116 DT  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DG  n 
1 121 DG  n 
1 122 DT  n 
1 123 DA  n 
1 124 DG  n 
1 125 DT  n 
1 126 DA  n 
1 127 DT  n 
1 128 DC  n 
1 129 DT  n 
1 130 DG  n 
1 131 DC  n 
1 132 DA  n 
1 133 DG  n 
1 134 DG  n 
1 135 DT  n 
1 136 DG  n 
1 137 DG  n 
1 138 DA  n 
1 139 DT  n 
1 140 DA  n 
1 141 DT  n 
1 142 DT  n 
1 143 DG  n 
1 144 DA  n 
1 145 DT  n 
2 1   DA  n 
2 2   DT  n 
2 3   DC  n 
2 4   DA  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DA  n 
2 12  DC  n 
2 13  DC  n 
2 14  DT  n 
2 15  DG  n 
2 16  DC  n 
2 17  DA  n 
2 18  DG  n 
2 19  DA  n 
2 20  DT  n 
2 21  DA  n 
2 22  DC  n 
2 23  DT  n 
2 24  DA  n 
2 25  DC  n 
2 26  DC  n 
2 27  DA  n 
2 28  DA  n 
2 29  DA  n 
2 30  DA  n 
2 31  DG  n 
2 32  DT  n 
2 33  DG  n 
2 34  DT  n 
2 35  DA  n 
2 36  DT  n 
2 37  DT  n 
2 38  DT  n 
2 39  DG  n 
2 40  DG  n 
2 41  DA  n 
2 42  DA  n 
2 43  DA  n 
2 44  DC  n 
2 45  DT  n 
2 46  DG  n 
2 47  DC  n 
2 48  DT  n 
2 49  DC  n 
2 50  DC  n 
2 51  DA  n 
2 52  DT  n 
2 53  DC  n 
2 54  DA  n 
2 55  DA  n 
2 56  DA  n 
2 57  DA  n 
2 58  DG  n 
2 59  DG  n 
2 60  DC  n 
2 61  DA  n 
2 62  DT  n 
2 63  DG  n 
2 64  DT  n 
2 65  DT  n 
2 66  DC  n 
2 67  DA  n 
2 68  DG  n 
2 69  DC  n 
2 70  DT  n 
2 71  DG  n 
2 72  DA  n 
2 73  DT  n 
2 74  DT  n 
2 75  DC  n 
2 76  DA  n 
2 77  DG  n 
2 78  DC  n 
2 79  DT  n 
2 80  DG  n 
2 81  DA  n 
2 82  DA  n 
2 83  DC  n 
2 84  DA  n 
2 85  DT  n 
2 86  DG  n 
2 87  DC  n 
2 88  DC  n 
2 89  DT  n 
2 90  DT  n 
2 91  DT  n 
2 92  DT  n 
2 93  DG  n 
2 94  DA  n 
2 95  DT  n 
2 96  DG  n 
2 97  DG  n 
2 98  DA  n 
2 99  DG  n 
2 100 DC  n 
2 101 DA  n 
2 102 DG  n 
2 103 DT  n 
2 104 DT  n 
2 105 DT  n 
2 106 DC  n 
2 107 DC  n 
2 108 DA  n 
2 109 DA  n 
2 110 DA  n 
2 111 DT  n 
2 112 DA  n 
2 113 DC  n 
2 114 DA  n 
2 115 DC  n 
2 116 DT  n 
2 117 DT  n 
2 118 DT  n 
2 119 DT  n 
2 120 DG  n 
2 121 DG  n 
2 122 DT  n 
2 123 DA  n 
2 124 DG  n 
2 125 DT  n 
2 126 DA  n 
2 127 DT  n 
2 128 DC  n 
2 129 DT  n 
2 130 DG  n 
2 131 DC  n 
2 132 DA  n 
2 133 DG  n 
2 134 DG  n 
2 135 DT  n 
2 136 DG  n 
2 137 DG  n 
2 138 DA  n 
2 139 DT  n 
2 140 DA  n 
2 141 DT  n 
2 142 DT  n 
2 143 DG  n 
2 144 DA  n 
2 145 DT  n 
3 1   ALA n 
3 2   ARG n 
3 3   THR n 
3 4   LYS n 
3 5   GLN n 
3 6   THR n 
3 7   ALA n 
3 8   ARG n 
3 9   LYS n 
3 10  SER n 
3 11  THR n 
3 12  GLY n 
3 13  GLY n 
3 14  LYS n 
3 15  ALA n 
3 16  PRO n 
3 17  ARG n 
3 18  LYS n 
3 19  GLN n 
3 20  LEU n 
3 21  ALA n 
3 22  THR n 
3 23  LYS n 
3 24  ALA n 
3 25  ALA n 
3 26  ARG n 
3 27  LYS n 
3 28  SER n 
3 29  ALA n 
3 30  PRO n 
3 31  ALA n 
3 32  THR n 
3 33  GLY n 
3 34  GLY n 
3 35  VAL n 
3 36  LYS n 
3 37  LYS n 
3 38  PRO n 
3 39  HIS n 
3 40  ARG n 
3 41  TYR n 
3 42  ARG n 
3 43  PRO n 
3 44  GLY n 
3 45  THR n 
3 46  VAL n 
3 47  ALA n 
3 48  LEU n 
3 49  ARG n 
3 50  GLU n 
3 51  ILE n 
3 52  ARG n 
3 53  ARG n 
3 54  TYR n 
3 55  GLN n 
3 56  LYS n 
3 57  SER n 
3 58  THR n 
3 59  GLU n 
3 60  LEU n 
3 61  LEU n 
3 62  ILE n 
3 63  ARG n 
3 64  LYS n 
3 65  LEU n 
3 66  PRO n 
3 67  PHE n 
3 68  GLN n 
3 69  ARG n 
3 70  LEU n 
3 71  VAL n 
3 72  ARG n 
3 73  GLU n 
3 74  ILE n 
3 75  ALA n 
3 76  GLN n 
3 77  ASP n 
3 78  PHE n 
3 79  LYS n 
3 80  THR n 
3 81  ASP n 
3 82  LEU n 
3 83  ARG n 
3 84  PHE n 
3 85  GLN n 
3 86  SER n 
3 87  SER n 
3 88  ALA n 
3 89  VAL n 
3 90  MET n 
3 91  ALA n 
3 92  LEU n 
3 93  GLN n 
3 94  GLU n 
3 95  ALA n 
3 96  SER n 
3 97  GLU n 
3 98  ALA n 
3 99  TYR n 
3 100 LEU n 
3 101 VAL n 
3 102 ALA n 
3 103 LEU n 
3 104 PHE n 
3 105 GLU n 
3 106 ASP n 
3 107 THR n 
3 108 ASN n 
3 109 LEU n 
3 110 CYS n 
3 111 ALA n 
3 112 ILE n 
3 113 HIS n 
3 114 ALA n 
3 115 LYS n 
3 116 ARG n 
3 117 VAL n 
3 118 THR n 
3 119 ILE n 
3 120 MET n 
3 121 PRO n 
3 122 LYS n 
3 123 ASP n 
3 124 ILE n 
3 125 GLN n 
3 126 LEU n 
3 127 ALA n 
3 128 ARG n 
3 129 ARG n 
3 130 ILE n 
3 131 ARG n 
3 132 GLY n 
3 133 GLU n 
3 134 ARG n 
3 135 ALA n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLY n 
4 7   GLY n 
4 8   LYS n 
4 9   GLY n 
4 10  LEU n 
4 11  GLY n 
4 12  LYS n 
4 13  GLY n 
4 14  GLY n 
4 15  ALA n 
4 16  LYS n 
4 17  ARG n 
4 18  HIS n 
4 19  ARG n 
4 20  LYS n 
4 21  VAL n 
4 22  LEU n 
4 23  ARG n 
4 24  ASP n 
4 25  ASN n 
4 26  ILE n 
4 27  GLN n 
4 28  GLY n 
4 29  ILE n 
4 30  THR n 
4 31  LYS n 
4 32  PRO n 
4 33  ALA n 
4 34  ILE n 
4 35  ARG n 
4 36  ARG n 
4 37  LEU n 
4 38  ALA n 
4 39  ARG n 
4 40  ARG n 
4 41  GLY n 
4 42  GLY n 
4 43  VAL n 
4 44  LYS n 
4 45  ARG n 
4 46  ILE n 
4 47  SER n 
4 48  GLY n 
4 49  LEU n 
4 50  ILE n 
4 51  TYR n 
4 52  GLU n 
4 53  GLU n 
4 54  THR n 
4 55  ARG n 
4 56  GLY n 
4 57  VAL n 
4 58  LEU n 
4 59  LYS n 
4 60  VAL n 
4 61  PHE n 
4 62  LEU n 
4 63  GLU n 
4 64  ASN n 
4 65  VAL n 
4 66  ILE n 
4 67  ARG n 
4 68  ASP n 
4 69  ALA n 
4 70  VAL n 
4 71  THR n 
4 72  TYR n 
4 73  THR n 
4 74  GLU n 
4 75  HIS n 
4 76  ALA n 
4 77  LYS n 
4 78  ARG n 
4 79  LYS n 
4 80  THR n 
4 81  VAL n 
4 82  THR n 
4 83  ALA n 
4 84  MET n 
4 85  ASP n 
4 86  VAL n 
4 87  VAL n 
4 88  TYR n 
4 89  ALA n 
4 90  LEU n 
4 91  LYS n 
4 92  ARG n 
4 93  GLN n 
4 94  GLY n 
4 95  ARG n 
4 96  THR n 
4 97  LEU n 
4 98  TYR n 
4 99  GLY n 
4 100 PHE n 
4 101 GLY n 
4 102 GLY n 
5 1   SER n 
5 2   GLY n 
5 3   ARG n 
5 4   GLY n 
5 5   LYS n 
5 6   GLN n 
5 7   GLY n 
5 8   GLY n 
5 9   LYS n 
5 10  THR n 
5 11  ARG n 
5 12  ALA n 
5 13  LYS n 
5 14  ALA n 
5 15  LYS n 
5 16  THR n 
5 17  ARG n 
5 18  SER n 
5 19  SER n 
5 20  ARG n 
5 21  ALA n 
5 22  GLY n 
5 23  LEU n 
5 24  GLN n 
5 25  PHE n 
5 26  PRO n 
5 27  VAL n 
5 28  GLY n 
5 29  ARG n 
5 30  VAL n 
5 31  HIS n 
5 32  ARG n 
5 33  LEU n 
5 34  LEU n 
5 35  ARG n 
5 36  LYS n 
5 37  GLY n 
5 38  ASN n 
5 39  TYR n 
5 40  ALA n 
5 41  GLU n 
5 42  ARG n 
5 43  VAL n 
5 44  GLY n 
5 45  ALA n 
5 46  GLY n 
5 47  ALA n 
5 48  PRO n 
5 49  VAL n 
5 50  TYR n 
5 51  LEU n 
5 52  ALA n 
5 53  ALA n 
5 54  VAL n 
5 55  LEU n 
5 56  GLU n 
5 57  TYR n 
5 58  LEU n 
5 59  THR n 
5 60  ALA n 
5 61  GLU n 
5 62  ILE n 
5 63  LEU n 
5 64  GLU n 
5 65  LEU n 
5 66  ALA n 
5 67  GLY n 
5 68  ASN n 
5 69  ALA n 
5 70  ALA n 
5 71  ARG n 
5 72  ASP n 
5 73  ASN n 
5 74  LYS n 
5 75  LYS n 
5 76  THR n 
5 77  ARG n 
5 78  ILE n 
5 79  ILE n 
5 80  PRO n 
5 81  ARG n 
5 82  HIS n 
5 83  LEU n 
5 84  GLN n 
5 85  LEU n 
5 86  ALA n 
5 87  VAL n 
5 88  ARG n 
5 89  ASN n 
5 90  ASP n 
5 91  GLU n 
5 92  GLU n 
5 93  LEU n 
5 94  ASN n 
5 95  LYS n 
5 96  LEU n 
5 97  LEU n 
5 98  GLY n 
5 99  ARG n 
5 100 VAL n 
5 101 THR n 
5 102 ILE n 
5 103 ALA n 
5 104 GLN n 
5 105 GLY n 
5 106 GLY n 
5 107 VAL n 
5 108 LEU n 
5 109 PRO n 
5 110 ASN n 
5 111 ILE n 
5 112 GLN n 
5 113 SER n 
5 114 VAL n 
5 115 LEU n 
5 116 LEU n 
5 117 PRO n 
5 118 LYS n 
5 119 LYS n 
5 120 THR n 
5 121 GLU n 
5 122 SER n 
5 123 SER n 
5 124 LYS n 
5 125 SER n 
5 126 LYS n 
5 127 SER n 
5 128 LYS n 
6 1   PRO n 
6 2   GLU n 
6 3   PRO n 
6 4   ALA n 
6 5   LYS n 
6 6   SER n 
6 7   ALA n 
6 8   PRO n 
6 9   ALA n 
6 10  PRO n 
6 11  LYS n 
6 12  LYS n 
6 13  GLY n 
6 14  SER n 
6 15  LYS n 
6 16  LYS n 
6 17  ALA n 
6 18  VAL n 
6 19  THR n 
6 20  LYS n 
6 21  THR n 
6 22  GLN n 
6 23  LYS n 
6 24  LYS n 
6 25  ASP n 
6 26  GLY n 
6 27  LYS n 
6 28  LYS n 
6 29  ARG n 
6 30  ARG n 
6 31  LYS n 
6 32  THR n 
6 33  ARG n 
6 34  LYS n 
6 35  GLU n 
6 36  SER n 
6 37  TYR n 
6 38  ALA n 
6 39  ILE n 
6 40  TYR n 
6 41  VAL n 
6 42  TYR n 
6 43  LYS n 
6 44  VAL n 
6 45  LEU n 
6 46  LYS n 
6 47  GLN n 
6 48  VAL n 
6 49  HIS n 
6 50  PRO n 
6 51  ASP n 
6 52  THR n 
6 53  GLY n 
6 54  ILE n 
6 55  SER n 
6 56  SER n 
6 57  LYS n 
6 58  ALA n 
6 59  MET n 
6 60  SER n 
6 61  ILE n 
6 62  MET n 
6 63  ASN n 
6 64  SER n 
6 65  PHE n 
6 66  VAL n 
6 67  ASN n 
6 68  ASP n 
6 69  VAL n 
6 70  PHE n 
6 71  GLU n 
6 72  ARG n 
6 73  ILE n 
6 74  ALA n 
6 75  GLY n 
6 76  GLU n 
6 77  ALA n 
6 78  SER n 
6 79  ARG n 
6 80  LEU n 
6 81  ALA n 
6 82  HIS n 
6 83  TYR n 
6 84  ASN n 
6 85  LYS n 
6 86  ARG n 
6 87  SER n 
6 88  THR n 
6 89  ILE n 
6 90  THR n 
6 91  SER n 
6 92  ARG n 
6 93  GLU n 
6 94  ILE n 
6 95  GLN n 
6 96  THR n 
6 97  ALA n 
6 98  VAL n 
6 99  ARG n 
6 100 LEU n 
6 101 LEU n 
6 102 LEU n 
6 103 PRO n 
6 104 GLY n 
6 105 GLU n 
6 106 LEU n 
6 107 ALA n 
6 108 LYS n 
6 109 HIS n 
6 110 ALA n 
6 111 VAL n 
6 112 SER n 
6 113 GLU n 
6 114 GLY n 
6 115 THR n 
6 116 LYS n 
6 117 ALA n 
6 118 VAL n 
6 119 THR n 
6 120 LYS n 
6 121 TYR n 
6 122 THR n 
6 123 SER n 
6 124 ALA n 
6 125 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 128 'African clawed frog' ? 'hist1h2aj, LOC494591' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 125 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 145 'synthetic construct' ? 32630 ? 
2 1 sample 1 145 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 5CP6         5CP6   ? 1 ? 1 
2 PDB 5CP6         5CP6   ? 2 ? 1 
3 UNP H32_XENLA    P84233 ? 3 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 
4 UNP H4_XENLA     P62799 ? 4 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 
5 UNP Q6AZJ8_XENLA Q6AZJ8 ? 5 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2 
6 UNP H2B11_XENLA  P02281 ? 6 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5CP6 I 1 ? 145 ? 5CP6   -72 ? 72  ? -72 72  
2  2 5CP6 J 1 ? 145 ? 5CP6   -72 ? 72  ? -72 72  
3  3 5CP6 A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
4  4 5CP6 B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
5  5 5CP6 C 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
6  6 5CP6 D 1 ? 125 ? P02281 2   ? 126 ? -2  122 
7  3 5CP6 E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
8  4 5CP6 F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
9  5 5CP6 G 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
10 6 5CP6 H 1 ? 125 ? P02281 2   ? 126 ? -2  122 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3  5CP6 ALA A 102 ? UNP P84233 GLY 103 variant  102 1 
5  5CP6 ?   C ?   ? UNP Q6AZJ8 ALA 127 deletion ?   2 
6  5CP6 THR D 32  ? UNP P02281 SER 33  variant  29  3 
7  5CP6 ALA E 102 ? UNP P84233 GLY 103 variant  102 4 
9  5CP6 ?   G ?   ? UNP Q6AZJ8 ALA 127 deletion ?   5 
10 5CP6 THR H 32  ? UNP P02281 SER 33  variant  29  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                             ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                            ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                          ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                     ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                                            ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                 ? 'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                        ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                           ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                     ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                             ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                           ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                               ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                          ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                             ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                              ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                          ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                     ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                       ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                             ? 'C5 H9 N O2'       115.130 
RUH non-polymer         . '(ethane6-5,8,9,10-tetrahydroanthracene)Ru(II)(ethylene-diamine)Cl' ? 'C16 H22 Cl N2 Ru' 378.882 
SER 'L-peptide linking' y SERINE                                                              ? 'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                                                       ? 'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                                                           ? 'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                                                            ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                              ? 'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5CP6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.72 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.74 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'40 mM MnCl2, 30 mM KCl, 20 mM K-Cacodylate , pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           98.0 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-09-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.50 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.50 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5CP6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.60 
_reflns.d_resolution_low                 76.39 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       57728 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             86.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            4.31 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            -5.04 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            0.74 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               84.143 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.943 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5CP6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.60 
_refine.ls_d_res_low                             76.39 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     56191 
_refine.ls_number_reflns_R_free                  1159 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    86.32 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.21102 
_refine.ls_R_factor_R_free                       0.25064 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.21015 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4WU8 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.719 
_refine.pdbx_overall_ESU_R_Free                  0.320 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             12.742 
_refine.overall_SU_ML                            0.269 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        6064 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         59 
_refine_hist.number_atoms_solvent             35 
_refine_hist.number_atoms_total               12097 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        76.39 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  0.015  12878 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  9661  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.446  1.547  18673 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.365  3.000  22375 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.081  5.000  755   ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 34.743 21.338 269   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 18.790 15.000 1177  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 23.395 15.000 84    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.090  0.200  1838  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  10342 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  2847  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 4.527  5.830  3044  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 4.526  5.827  3043  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 6.683  8.719  3791  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 6.682  8.722  3792  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 6.664  10.018 9834  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 6.663  10.018 9835  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 9.801  14.994 14835 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 13.050 89.193 16943 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 13.049 89.193 16943 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.600 
_refine_ls_shell.d_res_low                        2.668 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             36 
_refine_ls_shell.number_reflns_R_work             1877 
_refine_ls_shell.percent_reflns_obs               39.38 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.414 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.329 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5CP6 
_struct.title                        
;Nucleosome Core Particle with Adducts from the Anticancer Compound, [(eta6-5,8,9,10-tetrahydroanthracene)Ru(ethylenediamine)Cl][PF6]
;
_struct.pdbx_descriptor              'Histone H3.2, Histone H4, Histone H2A type 1, Histone H2B 1.1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5CP6 
_struct_keywords.text            'nucleosome core particle, antitumour compound, STRUCTURAL PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 3  ? 
H N N 4  ? 
I N N 5  ? 
J N N 6  ? 
K N N 7  ? 
L N N 7  ? 
M N N 7  ? 
N N N 8  ? 
O N N 9  ? 
P N N 8  ? 
Q N N 8  ? 
R N N 10 ? 
S N N 10 ? 
T N N 10 ? 
U N N 10 ? 
V N N 10 ? 
W N N 10 ? 
X N N 10 ? 
Y N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY C 44  ? SER C 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG C 63  ? ASP C 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  AA3 GLN C 85  ? ALA C 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET C 120 ? GLY C 132 ? MET A 120 GLY A 132 1 ? 13 
HELX_P HELX_P5  AA5 ASN D 25  ? ILE D 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  AA6 THR D 30  ? GLY D 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU D 49  ? LYS D 77  ? LEU B 49  LYS B 77  1 ? 29 
HELX_P HELX_P8  AA8 THR D 82  ? GLN D 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 THR E 16  ? GLY E 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 AB1 PRO E 26  ? GLY E 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 AB2 ALA E 45  ? ASN E 73  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 AB3 ILE E 79  ? ASP E 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 AB4 ASP E 90  ? LEU E 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 AB5 GLN E 112 ? LEU E 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 AB6 TYR F 37  ? HIS F 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 AB7 SER F 55  ? ASN F 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 AB8 THR F 90  ? LEU F 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 AB9 PRO F 103 ? SER F 123 ? PRO D 100 SER D 120 1 ? 21 
HELX_P HELX_P19 AC1 GLY G 44  ? SER G 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 AC2 ARG G 63  ? LYS G 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 AC3 GLN G 85  ? ALA G 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 AC4 MET G 120 ? ARG G 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 AC5 ASP H 24  ? ILE H 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 AC6 THR H 30  ? GLY H 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 AC7 LEU H 49  ? ALA H 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 AC8 THR H 82  ? GLN H 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 AC9 THR I 16  ? GLY I 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 AD1 PRO I 26  ? LYS I 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 AD2 ALA I 45  ? ASP I 72  ? ALA G 45  ASP G 72  1 ? 28 
HELX_P HELX_P30 AD3 ILE I 79  ? ASN I 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 AD4 ASP I 90  ? LEU I 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 AD5 GLN I 112 ? LEU I 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 AD6 TYR J 37  ? HIS J 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 AD7 SER J 55  ? ASN J 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 AD8 THR J 90  ? LEU J 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 AD9 PRO J 103 ? SER J 123 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A DG  58  N7  ? ? ? 1_555 K RUH .   RU1 ? ? I DG  -15 I RUH 101 1_555 ? ? ? ? ? ? ?               2.026 ? 
metalc2   metalc ? ? B DG  58  N7  ? ? ? 1_555 L RUH .   RU1 ? ? J DG  -15 J RUH 101 1_555 ? ? ? ? ? ? ?               1.975 ? 
metalc3   metalc ? ? G ASP 77  OD1 ? ? ? 1_555 O MG  .   MG  ? ? E ASP 77  E MG  201 1_555 ? ? ? ? ? ? ?               1.921 ? 
metalc4   metalc ? ? O MG  .   MG  ? ? ? 1_555 W HOH .   O   ? ? E MG  201 E HOH 308 1_555 ? ? ? ? ? ? ?               2.142 ? 
metalc5   metalc ? ? O MG  .   MG  ? ? ? 1_555 W HOH .   O   ? ? E MG  201 E HOH 304 1_555 ? ? ? ? ? ? ?               2.124 ? 
metalc6   metalc ? ? F VAL 48  O   ? ? ? 1_555 O MG  .   MG  ? ? D VAL 45  E MG  201 3_555 ? ? ? ? ? ? ?               2.144 ? 
metalc7   metalc ? ? O MG  .   MG  ? ? ? 1_555 U HOH .   O   ? ? E MG  201 C HOH 206 3_545 ? ? ? ? ? ? ?               2.070 ? 
metalc8   metalc ? ? O MG  .   MG  ? ? ? 1_555 V HOH .   O   ? ? E MG  201 D HOH 301 3_545 ? ? ? ? ? ? ?               1.717 ? 
hydrog1   hydrog ? ? A DA  1   N1  ? ? ? 1_555 B DT  145 N3  ? ? I DA  -72 J DT  72  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog2   hydrog ? ? A DT  2   N3  ? ? ? 1_555 B DA  144 N1  ? ? I DT  -71 J DA  71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? A DT  2   O4  ? ? ? 1_555 B DA  144 N6  ? ? I DT  -71 J DA  71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? A DC  3   O2  ? ? ? 1_555 B DG  143 N2  ? ? I DC  -70 J DG  70  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog5   hydrog ? ? A DA  4   N1  ? ? ? 1_555 B DT  142 N3  ? ? I DA  -69 J DT  69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? A DA  4   N6  ? ? ? 1_555 B DT  142 O4  ? ? I DA  -69 J DT  69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? A DA  5   N1  ? ? ? 1_555 B DT  141 N3  ? ? I DA  -68 J DT  68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? A DA  5   N6  ? ? ? 1_555 B DT  141 O4  ? ? I DA  -68 J DT  68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? A DT  6   N3  ? ? ? 1_555 B DA  140 N1  ? ? I DT  -67 J DA  67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? A DT  6   O4  ? ? ? 1_555 B DA  140 N6  ? ? I DT  -67 J DA  67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? A DA  7   N1  ? ? ? 1_555 B DT  139 N3  ? ? I DA  -66 J DT  66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? A DA  7   N6  ? ? ? 1_555 B DT  139 O4  ? ? I DA  -66 J DT  66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? A DT  8   N3  ? ? ? 1_555 B DA  138 N1  ? ? I DT  -65 J DA  65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? A DT  8   O4  ? ? ? 1_555 B DA  138 N6  ? ? I DT  -65 J DA  65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? A DC  9   N3  ? ? ? 1_555 B DG  137 N1  ? ? I DC  -64 J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? A DC  9   N4  ? ? ? 1_555 B DG  137 O6  ? ? I DC  -64 J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? A DC  9   O2  ? ? ? 1_555 B DG  137 N2  ? ? I DC  -64 J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? A DC  10  N3  ? ? ? 1_555 B DG  136 N1  ? ? I DC  -63 J DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? A DC  10  N4  ? ? ? 1_555 B DG  136 O6  ? ? I DC  -63 J DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? A DC  10  O2  ? ? ? 1_555 B DG  136 N2  ? ? I DC  -63 J DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? A DC  10  O2  ? ? ? 1_555 B DG  137 N2  ? ? I DC  -63 J DG  64  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog22  hydrog ? ? A DA  11  N1  ? ? ? 1_555 B DT  135 N3  ? ? I DA  -62 J DT  62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? A DA  11  N6  ? ? ? 1_555 B DT  135 O4  ? ? I DA  -62 J DT  62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? A DC  12  N3  ? ? ? 1_555 B DG  134 N1  ? ? I DC  -61 J DG  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? A DC  12  N4  ? ? ? 1_555 B DG  134 O6  ? ? I DC  -61 J DG  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? A DC  12  O2  ? ? ? 1_555 B DG  134 N2  ? ? I DC  -61 J DG  61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? A DC  13  N3  ? ? ? 1_555 B DG  133 N1  ? ? I DC  -60 J DG  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? A DC  13  N4  ? ? ? 1_555 B DG  133 O6  ? ? I DC  -60 J DG  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? A DC  13  O2  ? ? ? 1_555 B DG  133 N2  ? ? I DC  -60 J DG  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? A DT  14  N3  ? ? ? 1_555 B DA  132 N1  ? ? I DT  -59 J DA  59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? A DT  14  O4  ? ? ? 1_555 B DA  132 N6  ? ? I DT  -59 J DA  59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? A DG  15  N1  ? ? ? 1_555 B DC  131 N3  ? ? I DG  -58 J DC  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? A DG  15  N2  ? ? ? 1_555 B DC  131 O2  ? ? I DG  -58 J DC  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? A DG  15  O6  ? ? ? 1_555 B DC  131 N4  ? ? I DG  -58 J DC  58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? A DC  16  N3  ? ? ? 1_555 B DG  130 N1  ? ? I DC  -57 J DG  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? A DC  16  N4  ? ? ? 1_555 B DG  130 O6  ? ? I DC  -57 J DG  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? A DC  16  O2  ? ? ? 1_555 B DG  130 N2  ? ? I DC  -57 J DG  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? A DA  17  N1  ? ? ? 1_555 B DT  129 N3  ? ? I DA  -56 J DT  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? A DA  17  N6  ? ? ? 1_555 B DT  129 O4  ? ? I DA  -56 J DT  56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? A DG  18  N1  ? ? ? 1_555 B DC  128 N3  ? ? I DG  -55 J DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? A DG  18  N2  ? ? ? 1_555 B DC  128 O2  ? ? I DG  -55 J DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? A DG  18  O6  ? ? ? 1_555 B DC  128 N4  ? ? I DG  -55 J DC  55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? A DA  19  N6  ? ? ? 1_555 B DT  127 O4  ? ? I DA  -54 J DT  54  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog44  hydrog ? ? A DT  20  N3  ? ? ? 1_555 B DA  126 N1  ? ? I DT  -53 J DA  53  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog45  hydrog ? ? A DA  21  N1  ? ? ? 1_555 B DT  125 N3  ? ? I DA  -52 J DT  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? A DA  21  N6  ? ? ? 1_555 B DT  125 O4  ? ? I DA  -52 J DT  52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? A DC  22  O2  ? ? ? 1_555 B DG  124 N1  ? ? I DC  -51 J DG  51  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog48  hydrog ? ? A DT  23  N3  ? ? ? 1_555 B DA  123 N1  ? ? I DT  -50 J DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? A DT  23  O4  ? ? ? 1_555 B DA  123 N6  ? ? I DT  -50 J DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? A DA  24  N1  ? ? ? 1_555 B DT  122 N3  ? ? I DA  -49 J DT  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? A DA  24  N6  ? ? ? 1_555 B DT  122 O4  ? ? I DA  -49 J DT  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? A DC  25  O2  ? ? ? 1_555 B DG  121 N2  ? ? I DC  -48 J DG  48  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog53  hydrog ? ? A DC  26  N3  ? ? ? 1_555 B DG  120 N1  ? ? I DC  -47 J DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? A DC  26  N4  ? ? ? 1_555 B DG  120 O6  ? ? I DC  -47 J DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? A DC  26  O2  ? ? ? 1_555 B DG  120 N2  ? ? I DC  -47 J DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? A DC  26  O2  ? ? ? 1_555 B DG  121 N2  ? ? I DC  -47 J DG  48  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog57  hydrog ? ? A DA  27  N1  ? ? ? 1_555 B DT  119 N3  ? ? I DA  -46 J DT  46  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog58  hydrog ? ? A DA  28  N1  ? ? ? 1_555 B DT  118 N3  ? ? I DA  -45 J DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? A DA  28  N6  ? ? ? 1_555 B DT  118 O4  ? ? I DA  -45 J DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? A DA  29  N1  ? ? ? 1_555 B DT  117 N3  ? ? I DA  -44 J DT  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? A DA  29  N6  ? ? ? 1_555 B DT  117 O4  ? ? I DA  -44 J DT  44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? A DA  30  N1  ? ? ? 1_555 B DT  116 N3  ? ? I DA  -43 J DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? A DA  30  N6  ? ? ? 1_555 B DT  116 O4  ? ? I DA  -43 J DT  43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? A DG  31  N1  ? ? ? 1_555 B DC  115 N3  ? ? I DG  -42 J DC  42  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog65  hydrog ? ? A DT  32  N3  ? ? ? 1_555 B DA  114 N1  ? ? I DT  -41 J DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? A DT  32  O4  ? ? ? 1_555 B DA  114 N6  ? ? I DT  -41 J DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? A DG  33  N1  ? ? ? 1_555 B DC  113 N3  ? ? I DG  -40 J DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? A DG  33  N2  ? ? ? 1_555 B DC  113 O2  ? ? I DG  -40 J DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? A DG  33  O6  ? ? ? 1_555 B DC  113 N4  ? ? I DG  -40 J DC  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? A DT  34  N3  ? ? ? 1_555 B DA  112 N1  ? ? I DT  -39 J DA  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? A DT  34  O4  ? ? ? 1_555 B DA  112 N6  ? ? I DT  -39 J DA  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? A DA  35  N1  ? ? ? 1_555 B DT  111 N3  ? ? I DA  -38 J DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? A DA  35  N6  ? ? ? 1_555 B DT  111 O4  ? ? I DA  -38 J DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? A DT  36  N3  ? ? ? 1_555 B DA  110 N1  ? ? I DT  -37 J DA  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? A DT  36  O4  ? ? ? 1_555 B DA  110 N6  ? ? I DT  -37 J DA  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? A DT  37  N3  ? ? ? 1_555 B DA  109 N1  ? ? I DT  -36 J DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? A DT  37  O4  ? ? ? 1_555 B DA  109 N6  ? ? I DT  -36 J DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? A DT  38  N3  ? ? ? 1_555 B DA  108 N1  ? ? I DT  -35 J DA  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? A DT  38  O4  ? ? ? 1_555 B DA  108 N6  ? ? I DT  -35 J DA  35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? A DG  39  O6  ? ? ? 1_555 B DC  106 N4  ? ? I DG  -34 J DC  33  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog81  hydrog ? ? A DG  39  N1  ? ? ? 1_555 B DC  107 N3  ? ? I DG  -34 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? A DG  39  N2  ? ? ? 1_555 B DC  107 O2  ? ? I DG  -34 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? A DG  39  O6  ? ? ? 1_555 B DC  107 N4  ? ? I DG  -34 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? A DG  40  N1  ? ? ? 1_555 B DC  106 N3  ? ? I DG  -33 J DC  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? A DG  40  N2  ? ? ? 1_555 B DC  106 O2  ? ? I DG  -33 J DC  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? A DG  40  O6  ? ? ? 1_555 B DC  106 N4  ? ? I DG  -33 J DC  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? A DA  41  N1  ? ? ? 1_555 B DT  105 N3  ? ? I DA  -32 J DT  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? A DA  41  N6  ? ? ? 1_555 B DT  105 O4  ? ? I DA  -32 J DT  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? A DA  42  N1  ? ? ? 1_555 B DT  104 N3  ? ? I DA  -31 J DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? A DA  42  N6  ? ? ? 1_555 B DT  104 O4  ? ? I DA  -31 J DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? A DA  43  N1  ? ? ? 1_555 B DT  103 N3  ? ? I DA  -30 J DT  30  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog92  hydrog ? ? A DC  44  O2  ? ? ? 1_555 B DG  102 N2  ? ? I DC  -29 J DG  29  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog93  hydrog ? ? A DT  45  N3  ? ? ? 1_555 B DA  101 N1  ? ? I DT  -28 J DA  28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? A DT  45  O4  ? ? ? 1_555 B DA  101 N6  ? ? I DT  -28 J DA  28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? A DG  46  N1  ? ? ? 1_555 B DC  100 N3  ? ? I DG  -27 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? A DG  46  N2  ? ? ? 1_555 B DC  100 O2  ? ? I DG  -27 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? A DG  46  O6  ? ? ? 1_555 B DC  100 N4  ? ? I DG  -27 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? A DC  47  N3  ? ? ? 1_555 B DG  99  N1  ? ? I DC  -26 J DG  26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? A DC  47  N4  ? ? ? 1_555 B DG  99  O6  ? ? I DC  -26 J DG  26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? A DC  47  O2  ? ? ? 1_555 B DG  99  N2  ? ? I DC  -26 J DG  26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? A DT  48  N3  ? ? ? 1_555 B DA  98  N1  ? ? I DT  -25 J DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? A DT  48  O4  ? ? ? 1_555 B DA  98  N6  ? ? I DT  -25 J DA  25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? A DC  49  N3  ? ? ? 1_555 B DG  97  N1  ? ? I DC  -24 J DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? A DC  49  N4  ? ? ? 1_555 B DG  97  O6  ? ? I DC  -24 J DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? A DC  49  O2  ? ? ? 1_555 B DG  97  N2  ? ? I DC  -24 J DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? A DC  50  N3  ? ? ? 1_555 B DG  96  N1  ? ? I DC  -23 J DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? A DC  50  N4  ? ? ? 1_555 B DG  96  O6  ? ? I DC  -23 J DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? A DC  50  O2  ? ? ? 1_555 B DG  96  N2  ? ? I DC  -23 J DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? A DA  51  N1  ? ? ? 1_555 B DT  95  N3  ? ? I DA  -22 J DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? A DA  51  N6  ? ? ? 1_555 B DT  95  O4  ? ? I DA  -22 J DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? A DT  52  N3  ? ? ? 1_555 B DA  94  N1  ? ? I DT  -21 J DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? A DT  52  O4  ? ? ? 1_555 B DA  94  N6  ? ? I DT  -21 J DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? A DC  53  N3  ? ? ? 1_555 B DG  93  N1  ? ? I DC  -20 J DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? A DC  53  N4  ? ? ? 1_555 B DG  93  O6  ? ? I DC  -20 J DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? A DC  53  O2  ? ? ? 1_555 B DG  93  N2  ? ? I DC  -20 J DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? A DA  54  N1  ? ? ? 1_555 B DT  92  N3  ? ? I DA  -19 J DT  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? A DA  54  N6  ? ? ? 1_555 B DT  92  O4  ? ? I DA  -19 J DT  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? A DA  55  N1  ? ? ? 1_555 B DT  91  N3  ? ? I DA  -18 J DT  18  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog119 hydrog ? ? A DA  56  N1  ? ? ? 1_555 B DT  90  N3  ? ? I DA  -17 J DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? A DA  56  N6  ? ? ? 1_555 B DT  90  O4  ? ? I DA  -17 J DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? A DA  57  N1  ? ? ? 1_555 B DT  89  N3  ? ? I DA  -16 J DT  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? A DA  57  N6  ? ? ? 1_555 B DT  89  O4  ? ? I DA  -16 J DT  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? A DG  58  N1  ? ? ? 1_555 B DC  88  N3  ? ? I DG  -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? A DG  58  N2  ? ? ? 1_555 B DC  88  O2  ? ? I DG  -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? A DG  58  O6  ? ? ? 1_555 B DC  88  N4  ? ? I DG  -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? A DG  59  N1  ? ? ? 1_555 B DC  87  N3  ? ? I DG  -14 J DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? A DG  59  N2  ? ? ? 1_555 B DC  87  O2  ? ? I DG  -14 J DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? A DG  59  O6  ? ? ? 1_555 B DC  87  N4  ? ? I DG  -14 J DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? A DC  60  N3  ? ? ? 1_555 B DG  86  N1  ? ? I DC  -13 J DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? A DC  60  N4  ? ? ? 1_555 B DG  86  O6  ? ? I DC  -13 J DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? A DC  60  O2  ? ? ? 1_555 B DG  86  N2  ? ? I DC  -13 J DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? A DA  61  N1  ? ? ? 1_555 B DT  85  N3  ? ? I DA  -12 J DT  12  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog133 hydrog ? ? A DT  62  N3  ? ? ? 1_555 B DA  84  N1  ? ? I DT  -11 J DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? A DT  62  O4  ? ? ? 1_555 B DA  84  N6  ? ? I DT  -11 J DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? A DG  63  N1  ? ? ? 1_555 B DC  83  N3  ? ? I DG  -10 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? A DG  63  N2  ? ? ? 1_555 B DC  83  O2  ? ? I DG  -10 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? A DG  63  O6  ? ? ? 1_555 B DC  83  N4  ? ? I DG  -10 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? A DT  64  N3  ? ? ? 1_555 B DA  82  N1  ? ? I DT  -9  J DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? A DT  64  O4  ? ? ? 1_555 B DA  82  N6  ? ? I DT  -9  J DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? A DT  65  N3  ? ? ? 1_555 B DA  81  N1  ? ? I DT  -8  J DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? A DT  65  O4  ? ? ? 1_555 B DA  81  N6  ? ? I DT  -8  J DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? A DC  66  N3  ? ? ? 1_555 B DG  80  N1  ? ? I DC  -7  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? A DC  66  N4  ? ? ? 1_555 B DG  80  O6  ? ? I DC  -7  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? A DC  66  O2  ? ? ? 1_555 B DG  80  N2  ? ? I DC  -7  J DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? A DA  67  N1  ? ? ? 1_555 B DT  79  N3  ? ? I DA  -6  J DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? A DA  67  N6  ? ? ? 1_555 B DT  79  O4  ? ? I DA  -6  J DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? A DG  68  N1  ? ? ? 1_555 B DC  78  N3  ? ? I DG  -5  J DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? A DG  68  N2  ? ? ? 1_555 B DC  78  O2  ? ? I DG  -5  J DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? A DG  68  O6  ? ? ? 1_555 B DC  78  N4  ? ? I DG  -5  J DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? A DC  69  N3  ? ? ? 1_555 B DG  77  N1  ? ? I DC  -4  J DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? A DC  69  N4  ? ? ? 1_555 B DG  77  O6  ? ? I DC  -4  J DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? A DC  69  O2  ? ? ? 1_555 B DG  77  N2  ? ? I DC  -4  J DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? A DT  70  N3  ? ? ? 1_555 B DA  76  N1  ? ? I DT  -3  J DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? A DT  70  O4  ? ? ? 1_555 B DA  76  N6  ? ? I DT  -3  J DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? A DG  71  N1  ? ? ? 1_555 B DC  75  N3  ? ? I DG  -2  J DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? A DG  71  N2  ? ? ? 1_555 B DC  75  O2  ? ? I DG  -2  J DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? A DG  71  O6  ? ? ? 1_555 B DC  75  N4  ? ? I DG  -2  J DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? A DA  72  N1  ? ? ? 1_555 B DT  74  N3  ? ? I DA  -1  J DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? A DA  72  N6  ? ? ? 1_555 B DT  74  O4  ? ? I DA  -1  J DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? A DA  73  N1  ? ? ? 1_555 B DT  73  N3  ? ? I DA  0   J DT  0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? A DA  73  N6  ? ? ? 1_555 B DT  73  O4  ? ? I DA  0   J DT  0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? A DT  74  N3  ? ? ? 1_555 B DA  72  N1  ? ? I DT  1   J DA  -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? A DT  74  O4  ? ? ? 1_555 B DA  72  N6  ? ? I DT  1   J DA  -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? A DC  75  N3  ? ? ? 1_555 B DG  71  N1  ? ? I DC  2   J DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? A DC  75  N4  ? ? ? 1_555 B DG  71  O6  ? ? I DC  2   J DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? A DC  75  O2  ? ? ? 1_555 B DG  71  N2  ? ? I DC  2   J DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? A DA  76  N1  ? ? ? 1_555 B DT  70  N3  ? ? I DA  3   J DT  -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? A DA  76  N6  ? ? ? 1_555 B DT  70  O4  ? ? I DA  3   J DT  -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? A DG  77  N1  ? ? ? 1_555 B DC  69  N3  ? ? I DG  4   J DC  -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? A DG  77  N2  ? ? ? 1_555 B DC  69  O2  ? ? I DG  4   J DC  -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? A DG  77  O6  ? ? ? 1_555 B DC  69  N4  ? ? I DG  4   J DC  -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? A DC  78  N3  ? ? ? 1_555 B DG  68  N1  ? ? I DC  5   J DG  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? A DC  78  N4  ? ? ? 1_555 B DG  68  O6  ? ? I DC  5   J DG  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? A DC  78  O2  ? ? ? 1_555 B DG  68  N2  ? ? I DC  5   J DG  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? A DT  79  N3  ? ? ? 1_555 B DA  67  N1  ? ? I DT  6   J DA  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? A DT  79  O4  ? ? ? 1_555 B DA  67  N6  ? ? I DT  6   J DA  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? A DG  80  N1  ? ? ? 1_555 B DC  66  N3  ? ? I DG  7   J DC  -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? A DG  80  N2  ? ? ? 1_555 B DC  66  O2  ? ? I DG  7   J DC  -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? A DG  80  O6  ? ? ? 1_555 B DC  66  N4  ? ? I DG  7   J DC  -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? A DA  81  N1  ? ? ? 1_555 B DT  65  N3  ? ? I DA  8   J DT  -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? A DA  81  N6  ? ? ? 1_555 B DT  65  O4  ? ? I DA  8   J DT  -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? A DA  82  N1  ? ? ? 1_555 B DT  64  N3  ? ? I DA  9   J DT  -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? A DA  82  N6  ? ? ? 1_555 B DT  64  O4  ? ? I DA  9   J DT  -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? A DC  83  N3  ? ? ? 1_555 B DG  63  N1  ? ? I DC  10  J DG  -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? A DC  83  N4  ? ? ? 1_555 B DG  63  O6  ? ? I DC  10  J DG  -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? A DC  83  O2  ? ? ? 1_555 B DG  63  N2  ? ? I DC  10  J DG  -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? A DA  84  N1  ? ? ? 1_555 B DT  62  N3  ? ? I DA  11  J DT  -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? A DA  84  N6  ? ? ? 1_555 B DT  62  O4  ? ? I DA  11  J DT  -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? A DT  85  N3  ? ? ? 1_555 B DA  61  N1  ? ? I DT  12  J DA  -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? A DT  85  O4  ? ? ? 1_555 B DA  61  N6  ? ? I DT  12  J DA  -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? A DG  86  N1  ? ? ? 1_555 B DC  60  N3  ? ? I DG  13  J DC  -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? A DG  86  N2  ? ? ? 1_555 B DC  60  O2  ? ? I DG  13  J DC  -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? A DG  86  O6  ? ? ? 1_555 B DC  60  N4  ? ? I DG  13  J DC  -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? A DC  87  N3  ? ? ? 1_555 B DG  59  N1  ? ? I DC  14  J DG  -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? A DC  87  N4  ? ? ? 1_555 B DG  59  O6  ? ? I DC  14  J DG  -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? A DC  87  O2  ? ? ? 1_555 B DG  59  N2  ? ? I DC  14  J DG  -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? A DC  88  N3  ? ? ? 1_555 B DG  58  N1  ? ? I DC  15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? A DC  88  N4  ? ? ? 1_555 B DG  58  O6  ? ? I DC  15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? A DC  88  O2  ? ? ? 1_555 B DG  58  N2  ? ? I DC  15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? A DT  89  N3  ? ? ? 1_555 B DA  57  N1  ? ? I DT  16  J DA  -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? A DT  89  O4  ? ? ? 1_555 B DA  57  N6  ? ? I DT  16  J DA  -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? A DT  90  N3  ? ? ? 1_555 B DA  56  N1  ? ? I DT  17  J DA  -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? A DT  90  O4  ? ? ? 1_555 B DA  56  N6  ? ? I DT  17  J DA  -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? A DT  91  N3  ? ? ? 1_555 B DA  55  N1  ? ? I DT  18  J DA  -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? A DT  91  O4  ? ? ? 1_555 B DA  55  N6  ? ? I DT  18  J DA  -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? A DT  92  N3  ? ? ? 1_555 B DA  54  N1  ? ? I DT  19  J DA  -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? A DT  92  O4  ? ? ? 1_555 B DA  54  N6  ? ? I DT  19  J DA  -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? A DG  93  N1  ? ? ? 1_555 B DC  53  N3  ? ? I DG  20  J DC  -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? A DG  93  N2  ? ? ? 1_555 B DC  53  O2  ? ? I DG  20  J DC  -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? A DG  93  O6  ? ? ? 1_555 B DC  53  N4  ? ? I DG  20  J DC  -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? A DA  94  N1  ? ? ? 1_555 B DT  52  N3  ? ? I DA  21  J DT  -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? A DA  94  N6  ? ? ? 1_555 B DT  52  O4  ? ? I DA  21  J DT  -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? A DT  95  N3  ? ? ? 1_555 B DA  51  N1  ? ? I DT  22  J DA  -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? A DT  95  O4  ? ? ? 1_555 B DA  51  N6  ? ? I DT  22  J DA  -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? A DG  96  N1  ? ? ? 1_555 B DC  50  N3  ? ? I DG  23  J DC  -23 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog216 hydrog ? ? A DG  97  N1  ? ? ? 1_555 B DC  49  N3  ? ? I DG  24  J DC  -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? A DG  97  N2  ? ? ? 1_555 B DC  49  O2  ? ? I DG  24  J DC  -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? A DG  97  O6  ? ? ? 1_555 B DC  49  N4  ? ? I DG  24  J DC  -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? A DA  98  N6  ? ? ? 1_555 B DC  47  N3  ? ? I DA  25  J DC  -26 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog220 hydrog ? ? A DA  98  N1  ? ? ? 1_555 B DT  48  N3  ? ? I DA  25  J DT  -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? A DA  98  N6  ? ? ? 1_555 B DT  48  O4  ? ? I DA  25  J DT  -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? A DG  99  N1  ? ? ? 1_555 B DC  47  N3  ? ? I DG  26  J DC  -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? A DG  99  N2  ? ? ? 1_555 B DC  47  O2  ? ? I DG  26  J DC  -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? A DG  99  O6  ? ? ? 1_555 B DC  47  N4  ? ? I DG  26  J DC  -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? A DC  100 N3  ? ? ? 1_555 B DG  46  N1  ? ? I DC  27  J DG  -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? A DC  100 N4  ? ? ? 1_555 B DG  46  O6  ? ? I DC  27  J DG  -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? A DC  100 O2  ? ? ? 1_555 B DG  46  N2  ? ? I DC  27  J DG  -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? A DA  101 N1  ? ? ? 1_555 B DT  45  N3  ? ? I DA  28  J DT  -28 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog229 hydrog ? ? A DG  102 N1  ? ? ? 1_555 B DC  44  N3  ? ? I DG  29  J DC  -29 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog230 hydrog ? ? A DG  102 N2  ? ? ? 1_555 B DT  45  O2  ? ? I DG  29  J DT  -28 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog231 hydrog ? ? A DT  103 N3  ? ? ? 1_555 B DA  43  N1  ? ? I DT  30  J DA  -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? A DT  103 O4  ? ? ? 1_555 B DA  43  N6  ? ? I DT  30  J DA  -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? A DT  104 N3  ? ? ? 1_555 B DA  42  N1  ? ? I DT  31  J DA  -31 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog234 hydrog ? ? A DT  105 N3  ? ? ? 1_555 B DA  41  N1  ? ? I DT  32  J DA  -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? A DT  105 O4  ? ? ? 1_555 B DA  41  N6  ? ? I DT  32  J DA  -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? A DC  106 N3  ? ? ? 1_555 B DG  40  N1  ? ? I DC  33  J DG  -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? A DC  106 N4  ? ? ? 1_555 B DG  40  O6  ? ? I DC  33  J DG  -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? A DC  106 O2  ? ? ? 1_555 B DG  40  N2  ? ? I DC  33  J DG  -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? A DC  107 N3  ? ? ? 1_555 B DG  39  N1  ? ? I DC  34  J DG  -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? A DC  107 N4  ? ? ? 1_555 B DG  39  O6  ? ? I DC  34  J DG  -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? A DC  107 O2  ? ? ? 1_555 B DG  39  N2  ? ? I DC  34  J DG  -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? A DA  108 N6  ? ? ? 1_555 B DT  37  O4  ? ? I DA  35  J DT  -36 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog243 hydrog ? ? A DA  108 N1  ? ? ? 1_555 B DT  38  N3  ? ? I DA  35  J DT  -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? A DA  108 N6  ? ? ? 1_555 B DT  38  O4  ? ? I DA  35  J DT  -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? A DA  109 N1  ? ? ? 1_555 B DT  37  N3  ? ? I DA  36  J DT  -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? A DA  109 N6  ? ? ? 1_555 B DT  37  O4  ? ? I DA  36  J DT  -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? A DA  110 N1  ? ? ? 1_555 B DT  36  N3  ? ? I DA  37  J DT  -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? A DA  110 N6  ? ? ? 1_555 B DT  36  O4  ? ? I DA  37  J DT  -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? A DT  111 N3  ? ? ? 1_555 B DA  35  N1  ? ? I DT  38  J DA  -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? A DT  111 O4  ? ? ? 1_555 B DA  35  N6  ? ? I DT  38  J DA  -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? A DA  112 N1  ? ? ? 1_555 B DT  34  N3  ? ? I DA  39  J DT  -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? A DA  112 N6  ? ? ? 1_555 B DT  34  O4  ? ? I DA  39  J DT  -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? A DC  113 N3  ? ? ? 1_555 B DG  33  N1  ? ? I DC  40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? A DC  113 N4  ? ? ? 1_555 B DG  33  O6  ? ? I DC  40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? A DC  113 O2  ? ? ? 1_555 B DG  33  N2  ? ? I DC  40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? A DA  114 N1  ? ? ? 1_555 B DT  32  N3  ? ? I DA  41  J DT  -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? A DA  114 N6  ? ? ? 1_555 B DT  32  O4  ? ? I DA  41  J DT  -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? A DC  115 N3  ? ? ? 1_555 B DG  31  N1  ? ? I DC  42  J DG  -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? A DC  115 N4  ? ? ? 1_555 B DG  31  O6  ? ? I DC  42  J DG  -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? A DC  115 O2  ? ? ? 1_555 B DG  31  N2  ? ? I DC  42  J DG  -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? A DT  116 N3  ? ? ? 1_555 B DA  30  N1  ? ? I DT  43  J DA  -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? A DT  116 O4  ? ? ? 1_555 B DA  30  N6  ? ? I DT  43  J DA  -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? A DT  117 N3  ? ? ? 1_555 B DA  29  N1  ? ? I DT  44  J DA  -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? A DT  117 O4  ? ? ? 1_555 B DA  29  N6  ? ? I DT  44  J DA  -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? A DT  118 N3  ? ? ? 1_555 B DA  28  N1  ? ? I DT  45  J DA  -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? A DT  118 O4  ? ? ? 1_555 B DA  28  N6  ? ? I DT  45  J DA  -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? A DT  119 N3  ? ? ? 1_555 B DA  27  N1  ? ? I DT  46  J DA  -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? A DT  119 O4  ? ? ? 1_555 B DA  27  N6  ? ? I DT  46  J DA  -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? A DG  120 N2  ? ? ? 1_555 B DC  26  O2  ? ? I DG  47  J DC  -47 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog270 hydrog ? ? A DG  121 N1  ? ? ? 1_555 B DC  25  N3  ? ? I DG  48  J DC  -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? A DG  121 N2  ? ? ? 1_555 B DC  25  O2  ? ? I DG  48  J DC  -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? A DG  121 O6  ? ? ? 1_555 B DC  25  N4  ? ? I DG  48  J DC  -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? A DG  121 N2  ? ? ? 1_555 B DC  26  O2  ? ? I DG  48  J DC  -47 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog274 hydrog ? ? A DT  122 N3  ? ? ? 1_555 B DA  24  N1  ? ? I DT  49  J DA  -49 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog275 hydrog ? ? A DA  123 N1  ? ? ? 1_555 B DT  23  N3  ? ? I DA  50  J DT  -50 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog276 hydrog ? ? A DG  124 N1  ? ? ? 1_555 B DC  22  O2  ? ? I DG  51  J DC  -51 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog277 hydrog ? ? A DG  124 N1  ? ? ? 1_555 B DT  23  O2  ? ? I DG  51  J DT  -50 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog278 hydrog ? ? A DT  125 N3  ? ? ? 1_555 B DA  21  N1  ? ? I DT  52  J DA  -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? A DT  125 O4  ? ? ? 1_555 B DA  21  N6  ? ? I DT  52  J DA  -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? A DA  126 N1  ? ? ? 1_555 B DT  20  N3  ? ? I DA  53  J DT  -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? A DA  126 N6  ? ? ? 1_555 B DT  20  O4  ? ? I DA  53  J DT  -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? A DT  127 N3  ? ? ? 1_555 B DA  19  N1  ? ? I DT  54  J DA  -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? A DT  127 O4  ? ? ? 1_555 B DA  19  N6  ? ? I DT  54  J DA  -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? A DC  128 N3  ? ? ? 1_555 B DG  18  N1  ? ? I DC  55  J DG  -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? A DC  128 N4  ? ? ? 1_555 B DG  18  O6  ? ? I DC  55  J DG  -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? A DC  128 O2  ? ? ? 1_555 B DG  18  N2  ? ? I DC  55  J DG  -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? A DT  129 N3  ? ? ? 1_555 B DA  17  N1  ? ? I DT  56  J DA  -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? A DT  129 O4  ? ? ? 1_555 B DA  17  N6  ? ? I DT  56  J DA  -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? A DG  130 N1  ? ? ? 1_555 B DC  16  N3  ? ? I DG  57  J DC  -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? A DG  130 N2  ? ? ? 1_555 B DC  16  O2  ? ? I DG  57  J DC  -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? A DG  130 O6  ? ? ? 1_555 B DC  16  N4  ? ? I DG  57  J DC  -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? A DC  131 N3  ? ? ? 1_555 B DG  15  N1  ? ? I DC  58  J DG  -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? A DC  131 N4  ? ? ? 1_555 B DG  15  O6  ? ? I DC  58  J DG  -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? A DC  131 O2  ? ? ? 1_555 B DG  15  N2  ? ? I DC  58  J DG  -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? A DA  132 N1  ? ? ? 1_555 B DT  14  N3  ? ? I DA  59  J DT  -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? A DA  132 N6  ? ? ? 1_555 B DT  14  O4  ? ? I DA  59  J DT  -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? A DG  133 N1  ? ? ? 1_555 B DC  13  N3  ? ? I DG  60  J DC  -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? A DG  133 N2  ? ? ? 1_555 B DC  13  O2  ? ? I DG  60  J DC  -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? A DG  133 O6  ? ? ? 1_555 B DC  13  N4  ? ? I DG  60  J DC  -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? A DG  134 N1  ? ? ? 1_555 B DC  12  N3  ? ? I DG  61  J DC  -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? A DG  134 N2  ? ? ? 1_555 B DC  12  O2  ? ? I DG  61  J DC  -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? A DG  134 O6  ? ? ? 1_555 B DC  12  N4  ? ? I DG  61  J DC  -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? A DT  135 N3  ? ? ? 1_555 B DA  11  N1  ? ? I DT  62  J DA  -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? A DT  135 O4  ? ? ? 1_555 B DA  11  N6  ? ? I DT  62  J DA  -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? A DG  136 N1  ? ? ? 1_555 B DC  10  N3  ? ? I DG  63  J DC  -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ? ? A DG  136 N2  ? ? ? 1_555 B DC  10  O2  ? ? I DG  63  J DC  -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ? ? A DG  136 O6  ? ? ? 1_555 B DC  10  N4  ? ? I DG  63  J DC  -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ? ? A DG  137 N1  ? ? ? 1_555 B DC  9   O2  ? ? I DG  64  J DC  -64 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog309 hydrog ? ? A DA  138 N1  ? ? ? 1_555 B DT  8   N3  ? ? I DA  65  J DT  -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog310 hydrog ? ? A DA  138 N6  ? ? ? 1_555 B DT  8   O4  ? ? I DA  65  J DT  -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog311 hydrog ? ? A DT  139 N3  ? ? ? 1_555 B DA  7   N1  ? ? I DT  66  J DA  -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog312 hydrog ? ? A DT  139 O4  ? ? ? 1_555 B DA  7   N6  ? ? I DT  66  J DA  -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog313 hydrog ? ? A DA  140 N1  ? ? ? 1_555 B DT  6   N3  ? ? I DA  67  J DT  -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog314 hydrog ? ? A DA  140 N6  ? ? ? 1_555 B DT  6   O4  ? ? I DA  67  J DT  -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog315 hydrog ? ? A DT  141 N3  ? ? ? 1_555 B DA  5   N1  ? ? I DT  68  J DA  -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog316 hydrog ? ? A DT  141 O4  ? ? ? 1_555 B DA  5   N6  ? ? I DT  68  J DA  -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog317 hydrog ? ? A DT  142 N3  ? ? ? 1_555 B DA  4   N1  ? ? I DT  69  J DA  -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog318 hydrog ? ? A DT  142 O4  ? ? ? 1_555 B DA  4   N6  ? ? I DT  69  J DA  -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog319 hydrog ? ? A DG  143 N1  ? ? ? 1_555 B DC  3   N3  ? ? I DG  70  J DC  -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog320 hydrog ? ? A DG  143 N2  ? ? ? 1_555 B DC  3   O2  ? ? I DG  70  J DC  -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog321 hydrog ? ? A DG  143 O6  ? ? ? 1_555 B DC  3   N4  ? ? I DG  70  J DC  -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog322 hydrog ? ? A DA  144 N1  ? ? ? 1_555 B DT  2   N3  ? ? I DA  71  J DT  -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog323 hydrog ? ? A DA  144 N6  ? ? ? 1_555 B DT  2   O4  ? ? I DA  71  J DT  -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog324 hydrog ? ? A DT  145 N3  ? ? ? 1_555 B DA  1   N1  ? ? I DT  72  J DA  -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog325 hydrog ? ? A DT  145 O4  ? ? ? 1_555 B DA  1   N6  ? ? I DT  72  J DA  -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG C 83  ? PHE C 84  ? ARG A 83  PHE A 84  
AA1 2 THR D 80  ? VAL D 81  ? THR B 80  VAL B 81  
AA2 1 THR C 118 ? ILE C 119 ? THR A 118 ILE A 119 
AA2 2 ARG D 45  ? ILE D 46  ? ARG B 45  ILE B 46  
AA3 1 THR D 96  ? TYR D 98  ? THR B 96  TYR B 98  
AA3 2 VAL I 100 ? ILE I 102 ? VAL G 100 ILE G 102 
AA4 1 ARG E 42  ? VAL E 43  ? ARG C 42  VAL C 43  
AA4 2 THR F 88  ? ILE F 89  ? THR D 85  ILE D 86  
AA5 1 ARG E 77  ? ILE E 78  ? ARG C 77  ILE C 78  
AA5 2 GLY F 53  ? ILE F 54  ? GLY D 50  ILE D 51  
AA6 1 VAL E 100 ? ILE E 102 ? VAL C 100 ILE C 102 
AA6 2 THR H 96  ? TYR H 98  ? THR F 96  TYR F 98  
AA7 1 ARG G 83  ? PHE G 84  ? ARG E 83  PHE E 84  
AA7 2 THR H 80  ? VAL H 81  ? THR F 80  VAL F 81  
AA8 1 THR G 118 ? ILE G 119 ? THR E 118 ILE E 119 
AA8 2 ARG H 45  ? ILE H 46  ? ARG F 45  ILE F 46  
AA9 1 ARG I 42  ? VAL I 43  ? ARG G 42  VAL G 43  
AA9 2 THR J 88  ? ILE J 89  ? THR H 85  ILE H 86  
AB1 1 ARG I 77  ? ILE I 78  ? ARG G 77  ILE G 78  
AB1 2 GLY J 53  ? ILE J 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG C 83  ? N ARG A 83  O VAL D 81  ? O VAL B 81  
AA2 1 2 N ILE C 119 ? N ILE A 119 O ARG D 45  ? O ARG B 45  
AA3 1 2 N TYR D 98  ? N TYR B 98  O THR I 101 ? O THR G 101 
AA4 1 2 N ARG E 42  ? N ARG C 42  O ILE F 89  ? O ILE D 86  
AA5 1 2 N ILE E 78  ? N ILE C 78  O GLY F 53  ? O GLY D 50  
AA6 1 2 N THR E 101 ? N THR C 101 O TYR H 98  ? O TYR F 98  
AA7 1 2 N ARG G 83  ? N ARG E 83  O VAL H 81  ? O VAL F 81  
AA8 1 2 N ILE G 119 ? N ILE E 119 O ARG H 45  ? O ARG F 45  
AA9 1 2 N ARG I 42  ? N ARG G 42  O ILE J 89  ? O ILE H 86  
AB1 1 2 N ILE I 78  ? N ILE G 78  O GLY J 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software I RUH 101 ? 3 'binding site for residue RUH I 101' 
AC2 Software J RUH 101 ? 4 'binding site for residue RUH J 101' 
AC3 Software J RUH 102 ? 4 'binding site for residue RUH J 102' 
AC4 Software D SO4 201 ? 7 'binding site for residue SO4 D 201' 
AC5 Software E MG  201 ? 6 'binding site for residue MG E 201'  
AC6 Software G SO4 201 ? 7 'binding site for residue SO4 G 201' 
AC7 Software H SO4 201 ? 4 'binding site for residue SO4 H 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 DG  A 58  ? DG  I -15 . ? 1_555 ? 
2  AC1 3 DG  A 59  ? DG  I -14 . ? 1_555 ? 
3  AC1 3 DA  A 57  ? DA  I -16 . ? 1_555 ? 
4  AC2 4 DC  A 88  ? DC  I 15  . ? 1_555 ? 
5  AC2 4 DG  B 59  ? DG  J -14 . ? 1_555 ? 
6  AC2 4 DA  B 57  ? DA  J -16 . ? 1_555 ? 
7  AC2 4 DG  B 58  ? DG  J -15 . ? 1_555 ? 
8  AC3 4 LYS F 125 ? LYS D 122 . ? 3_545 ? 
9  AC3 4 DT  A 85  ? DT  I 12  . ? 1_555 ? 
10 AC3 4 DG  B 63  ? DG  J -10 . ? 1_555 ? 
11 AC3 4 DT  B 62  ? DT  J -11 . ? 1_555 ? 
12 AC4 7 GLY E 44  ? GLY C 44  . ? 1_555 ? 
13 AC4 7 ALA E 45  ? ALA C 45  . ? 1_555 ? 
14 AC4 7 GLY E 46  ? GLY C 46  . ? 1_555 ? 
15 AC4 7 ALA E 47  ? ALA C 47  . ? 1_555 ? 
16 AC4 7 THR F 90  ? THR D 87  . ? 1_555 ? 
17 AC4 7 SER F 91  ? SER D 88  . ? 1_555 ? 
18 AC4 7 DA  B 110 ? DA  J 37  . ? 1_555 ? 
19 AC5 6 HOH U .   ? HOH C 206 . ? 3_545 ? 
20 AC5 6 VAL F 48  ? VAL D 45  . ? 3_545 ? 
21 AC5 6 HOH V .   ? HOH D 301 . ? 3_545 ? 
22 AC5 6 ASP G 77  ? ASP E 77  . ? 1_555 ? 
23 AC5 6 HOH W .   ? HOH E 304 . ? 1_555 ? 
24 AC5 6 HOH W .   ? HOH E 308 . ? 1_555 ? 
25 AC6 7 GLY I 44  ? GLY G 44  . ? 1_555 ? 
26 AC6 7 ALA I 45  ? ALA G 45  . ? 1_555 ? 
27 AC6 7 GLY I 46  ? GLY G 46  . ? 1_555 ? 
28 AC6 7 ALA I 47  ? ALA G 47  . ? 1_555 ? 
29 AC6 7 THR J 90  ? THR H 87  . ? 1_555 ? 
30 AC6 7 SER J 91  ? SER H 88  . ? 1_555 ? 
31 AC6 7 DA  A 110 ? DA  I 37  . ? 1_555 ? 
32 AC7 4 HIS J 49  ? HIS H 46  . ? 1_555 ? 
33 AC7 4 PRO J 50  ? PRO H 47  . ? 1_555 ? 
34 AC7 4 ASP J 51  ? ASP H 48  . ? 1_555 ? 
35 AC7 4 THR J 52  ? THR H 49  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5CP6 
_atom_sites.fract_transf_matrix[1][1]   0.009384 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009127 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005476 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
RU 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DA  A 1  1   ? 4.491   -0.138  92.334 1.00 144.35 ? -72 DA  I "O5'" 1 
ATOM   2     C  "C5'" . DA  A 1  1   ? 4.101   -0.260  93.711 1.00 145.26 ? -72 DA  I "C5'" 1 
ATOM   3     C  "C4'" . DA  A 1  1   ? 4.939   -1.313  94.403 1.00 150.79 ? -72 DA  I "C4'" 1 
ATOM   4     O  "O4'" . DA  A 1  1   ? 4.264   -2.310  95.206 1.00 153.83 ? -72 DA  I "O4'" 1 
ATOM   5     C  "C3'" . DA  A 1  1   ? 6.186   -1.951  93.787 1.00 158.63 ? -72 DA  I "C3'" 1 
ATOM   6     O  "O3'" . DA  A 1  1   ? 7.257   -0.986  93.785 1.00 162.46 ? -72 DA  I "O3'" 1 
ATOM   7     C  "C2'" . DA  A 1  1   ? 6.390   -3.186  94.653 1.00 160.15 ? -72 DA  I "C2'" 1 
ATOM   8     C  "C1'" . DA  A 1  1   ? 4.988   -3.532  95.150 1.00 160.09 ? -72 DA  I "C1'" 1 
ATOM   9     N  N9    . DA  A 1  1   ? 4.221   -4.475  94.328 1.00 168.44 ? -72 DA  I N9    1 
ATOM   10    C  C8    . DA  A 1  1   ? 3.088   -4.224  93.592 1.00 168.02 ? -72 DA  I C8    1 
ATOM   11    N  N7    . DA  A 1  1   ? 2.614   -5.280  92.975 1.00 158.00 ? -72 DA  I N7    1 
ATOM   12    C  C5    . DA  A 1  1   ? 3.489   -6.296  93.332 1.00 157.04 ? -72 DA  I C5    1 
ATOM   13    C  C6    . DA  A 1  1   ? 3.529   -7.665  93.014 1.00 145.86 ? -72 DA  I C6    1 
ATOM   14    N  N6    . DA  A 1  1   ? 2.639   -8.267  92.223 1.00 135.55 ? -72 DA  I N6    1 
ATOM   15    N  N1    . DA  A 1  1   ? 4.530   -8.404  93.542 1.00 142.64 ? -72 DA  I N1    1 
ATOM   16    C  C2    . DA  A 1  1   ? 5.423   -7.799  94.337 1.00 144.96 ? -72 DA  I C2    1 
ATOM   17    N  N3    . DA  A 1  1   ? 5.486   -6.523  94.715 1.00 158.42 ? -72 DA  I N3    1 
ATOM   18    C  C4    . DA  A 1  1   ? 4.479   -5.816  94.172 1.00 165.37 ? -72 DA  I C4    1 
ATOM   19    P  P     . DT  A 1  2   ? 8.806   -1.443  93.761 1.00 167.63 ? -71 DT  I P     1 
ATOM   20    O  OP1   . DT  A 1  2   ? 9.634   -0.272  94.137 1.00 162.39 ? -71 DT  I OP1   1 
ATOM   21    O  OP2   . DT  A 1  2   ? 9.073   -2.127  92.471 1.00 159.64 ? -71 DT  I OP2   1 
ATOM   22    O  "O5'" . DT  A 1  2   ? 8.882   -2.487  94.961 1.00 155.95 ? -71 DT  I "O5'" 1 
ATOM   23    C  "C5'" . DT  A 1  2   ? 10.117  -2.793  95.617 1.00 154.48 ? -71 DT  I "C5'" 1 
ATOM   24    C  "C4'" . DT  A 1  2   ? 10.573  -4.177  95.219 1.00 157.38 ? -71 DT  I "C4'" 1 
ATOM   25    O  "O4'" . DT  A 1  2   ? 9.465   -4.956  94.710 1.00 156.28 ? -71 DT  I "O4'" 1 
ATOM   26    C  "C3'" . DT  A 1  2   ? 11.650  -4.209  94.130 1.00 152.81 ? -71 DT  I "C3'" 1 
ATOM   27    O  "O3'" . DT  A 1  2   ? 12.798  -4.891  94.627 1.00 155.19 ? -71 DT  I "O3'" 1 
ATOM   28    C  "C2'" . DT  A 1  2   ? 11.028  -5.015  93.001 1.00 151.02 ? -71 DT  I "C2'" 1 
ATOM   29    C  "C1'" . DT  A 1  2   ? 9.986   -5.833  93.730 1.00 154.27 ? -71 DT  I "C1'" 1 
ATOM   30    N  N1    . DT  A 1  2   ? 8.869   -6.310  92.890 1.00 148.00 ? -71 DT  I N1    1 
ATOM   31    C  C2    . DT  A 1  2   ? 8.700   -7.668  92.743 1.00 141.56 ? -71 DT  I C2    1 
ATOM   32    O  O2    . DT  A 1  2   ? 9.419   -8.493  93.283 1.00 138.35 ? -71 DT  I O2    1 
ATOM   33    N  N3    . DT  A 1  2   ? 7.648   -8.030  91.938 1.00 139.81 ? -71 DT  I N3    1 
ATOM   34    C  C4    . DT  A 1  2   ? 6.775   -7.187  91.275 1.00 140.56 ? -71 DT  I C4    1 
ATOM   35    O  O4    . DT  A 1  2   ? 5.877   -7.658  90.584 1.00 137.14 ? -71 DT  I O4    1 
ATOM   36    C  C5    . DT  A 1  2   ? 7.015   -5.776  91.469 1.00 141.68 ? -71 DT  I C5    1 
ATOM   37    C  C7    . DT  A 1  2   ? 6.116   -4.788  90.795 1.00 133.75 ? -71 DT  I C7    1 
ATOM   38    C  C6    . DT  A 1  2   ? 8.040   -5.413  92.251 1.00 147.15 ? -71 DT  I C6    1 
ATOM   39    P  P     . DC  A 1  3   ? 14.210  -4.652  93.944 1.00 168.15 ? -70 DC  I P     1 
ATOM   40    O  OP1   . DC  A 1  3   ? 15.140  -4.169  94.990 1.00 168.15 ? -70 DC  I OP1   1 
ATOM   41    O  OP2   . DC  A 1  3   ? 13.996  -3.843  92.716 1.00 165.41 ? -70 DC  I OP2   1 
ATOM   42    O  "O5'" . DC  A 1  3   ? 14.669  -6.114  93.507 1.00 167.19 ? -70 DC  I "O5'" 1 
ATOM   43    C  "C5'" . DC  A 1  3   ? 14.197  -7.309  94.162 1.00 159.98 ? -70 DC  I "C5'" 1 
ATOM   44    C  "C4'" . DC  A 1  3   ? 14.276  -8.480  93.210 1.00 160.11 ? -70 DC  I "C4'" 1 
ATOM   45    O  "O4'" . DC  A 1  3   ? 13.020  -8.620  92.497 1.00 165.89 ? -70 DC  I "O4'" 1 
ATOM   46    C  "C3'" . DC  A 1  3   ? 15.356  -8.358  92.130 1.00 152.17 ? -70 DC  I "C3'" 1 
ATOM   47    O  "O3'" . DC  A 1  3   ? 15.986  -9.619  91.909 1.00 143.46 ? -70 DC  I "O3'" 1 
ATOM   48    C  "C2'" . DC  A 1  3   ? 14.575  -7.926  90.903 1.00 153.95 ? -70 DC  I "C2'" 1 
ATOM   49    C  "C1'" . DC  A 1  3   ? 13.282  -8.693  91.102 1.00 155.91 ? -70 DC  I "C1'" 1 
ATOM   50    N  N1    . DC  A 1  3   ? 12.102  -8.177  90.384 1.00 141.97 ? -70 DC  I N1    1 
ATOM   51    C  C2    . DC  A 1  3   ? 11.033  -9.046  90.142 1.00 122.72 ? -70 DC  I C2    1 
ATOM   52    O  O2    . DC  A 1  3   ? 11.112  -10.218 90.536 1.00 118.56 ? -70 DC  I O2    1 
ATOM   53    N  N3    . DC  A 1  3   ? 9.943   -8.586  89.486 1.00 115.87 ? -70 DC  I N3    1 
ATOM   54    C  C4    . DC  A 1  3   ? 9.900   -7.318  89.070 1.00 118.90 ? -70 DC  I C4    1 
ATOM   55    N  N4    . DC  A 1  3   ? 8.808   -6.907  88.423 1.00 110.18 ? -70 DC  I N4    1 
ATOM   56    C  C5    . DC  A 1  3   ? 10.975  -6.412  89.303 1.00 132.33 ? -70 DC  I C5    1 
ATOM   57    C  C6    . DC  A 1  3   ? 12.047  -6.879  89.956 1.00 138.84 ? -70 DC  I C6    1 
ATOM   58    P  P     . DA  A 1  4   ? 17.296  -9.699  91.002 1.00 150.07 ? -69 DA  I P     1 
ATOM   59    O  OP1   . DA  A 1  4   ? 18.467  -9.483  91.882 1.00 158.94 ? -69 DA  I OP1   1 
ATOM   60    O  OP2   . DA  A 1  4   ? 17.103  -8.819  89.817 1.00 137.75 ? -69 DA  I OP2   1 
ATOM   61    O  "O5'" . DA  A 1  4   ? 17.350  -11.228 90.554 1.00 144.51 ? -69 DA  I "O5'" 1 
ATOM   62    C  "C5'" . DA  A 1  4   ? 16.185  -12.082 90.543 1.00 131.20 ? -69 DA  I "C5'" 1 
ATOM   63    C  "C4'" . DA  A 1  4   ? 15.908  -12.560 89.137 1.00 118.11 ? -69 DA  I "C4'" 1 
ATOM   64    O  "O4'" . DA  A 1  4   ? 14.725  -11.889 88.640 1.00 114.27 ? -69 DA  I "O4'" 1 
ATOM   65    C  "C3'" . DA  A 1  4   ? 17.006  -12.240 88.118 1.00 117.91 ? -69 DA  I "C3'" 1 
ATOM   66    O  "O3'" . DA  A 1  4   ? 16.902  -13.106 87.001 1.00 122.73 ? -69 DA  I "O3'" 1 
ATOM   67    C  "C2'" . DA  A 1  4   ? 16.529  -10.946 87.504 1.00 118.00 ? -69 DA  I "C2'" 1 
ATOM   68    C  "C1'" . DA  A 1  4   ? 15.060  -11.289 87.399 1.00 118.44 ? -69 DA  I "C1'" 1 
ATOM   69    N  N9    . DA  A 1  4   ? 14.160  -10.169 87.172 1.00 120.90 ? -69 DA  I N9    1 
ATOM   70    C  C8    . DA  A 1  4   ? 14.379  -8.823  87.336 1.00 120.32 ? -69 DA  I C8    1 
ATOM   71    N  N7    . DA  A 1  4   ? 13.355  -8.078  87.002 1.00 113.74 ? -69 DA  I N7    1 
ATOM   72    C  C5    . DA  A 1  4   ? 12.405  -8.992  86.569 1.00 114.44 ? -69 DA  I C5    1 
ATOM   73    C  C6    . DA  A 1  4   ? 11.099  -8.838  86.078 1.00 108.84 ? -69 DA  I C6    1 
ATOM   74    N  N6    . DA  A 1  4   ? 10.496  -7.656  85.937 1.00 102.65 ? -69 DA  I N6    1 
ATOM   75    N  N1    . DA  A 1  4   ? 10.419  -9.956  85.739 1.00 115.36 ? -69 DA  I N1    1 
ATOM   76    C  C2    . DA  A 1  4   ? 11.021  -11.144 85.887 1.00 110.02 ? -69 DA  I C2    1 
ATOM   77    N  N3    . DA  A 1  4   ? 12.245  -11.415 86.334 1.00 106.44 ? -69 DA  I N3    1 
ATOM   78    C  C4    . DA  A 1  4   ? 12.891  -10.283 86.662 1.00 114.56 ? -69 DA  I C4    1 
ATOM   79    P  P     . DA  A 1  5   ? 17.794  -14.382 86.917 1.00 130.05 ? -68 DA  I P     1 
ATOM   80    O  OP1   . DA  A 1  5   ? 17.706  -15.078 88.232 1.00 114.51 ? -68 DA  I OP1   1 
ATOM   81    O  OP2   . DA  A 1  5   ? 19.106  -13.962 86.366 1.00 114.38 ? -68 DA  I OP2   1 
ATOM   82    O  "O5'" . DA  A 1  5   ? 17.067  -15.244 85.790 1.00 143.48 ? -68 DA  I "O5'" 1 
ATOM   83    C  "C5'" . DA  A 1  5   ? 15.920  -16.077 86.082 1.00 138.29 ? -68 DA  I "C5'" 1 
ATOM   84    C  "C4'" . DA  A 1  5   ? 15.084  -16.292 84.839 1.00 126.65 ? -68 DA  I "C4'" 1 
ATOM   85    O  "O4'" . DA  A 1  5   ? 14.267  -15.122 84.604 1.00 116.85 ? -68 DA  I "O4'" 1 
ATOM   86    C  "C3'" . DA  A 1  5   ? 15.875  -16.511 83.548 1.00 123.45 ? -68 DA  I "C3'" 1 
ATOM   87    O  "O3'" . DA  A 1  5   ? 15.196  -17.439 82.696 1.00 130.70 ? -68 DA  I "O3'" 1 
ATOM   88    C  "C2'" . DA  A 1  5   ? 15.925  -15.125 82.931 1.00 113.09 ? -68 DA  I "C2'" 1 
ATOM   89    C  "C1'" . DA  A 1  5   ? 14.578  -14.558 83.340 1.00 114.20 ? -68 DA  I "C1'" 1 
ATOM   90    N  N9    . DA  A 1  5   ? 14.554  -13.107 83.476 1.00 111.59 ? -68 DA  I N9    1 
ATOM   91    C  C8    . DA  A 1  5   ? 15.523  -12.284 83.992 1.00 115.10 ? -68 DA  I C8    1 
ATOM   92    N  N7    . DA  A 1  5   ? 15.211  -11.011 83.950 1.00 118.81 ? -68 DA  I N7    1 
ATOM   93    C  C5    . DA  A 1  5   ? 13.954  -10.995 83.361 1.00 112.93 ? -68 DA  I C5    1 
ATOM   94    C  C6    . DA  A 1  5   ? 13.075  -9.946  83.029 1.00 106.77 ? -68 DA  I C6    1 
ATOM   95    N  N6    . DA  A 1  5   ? 13.337  -8.658  83.257 1.00 95.23  ? -68 DA  I N6    1 
ATOM   96    N  N1    . DA  A 1  5   ? 11.897  -10.272 82.454 1.00 110.26 ? -68 DA  I N1    1 
ATOM   97    C  C2    . DA  A 1  5   ? 11.631  -11.565 82.225 1.00 113.83 ? -68 DA  I C2    1 
ATOM   98    N  N3    . DA  A 1  5   ? 12.377  -12.637 82.486 1.00 115.68 ? -68 DA  I N3    1 
ATOM   99    C  C4    . DA  A 1  5   ? 13.538  -12.279 83.063 1.00 117.25 ? -68 DA  I C4    1 
ATOM   100   P  P     . DT  A 1  6   ? 15.875  -17.925 81.319 1.00 136.30 ? -67 DT  I P     1 
ATOM   101   O  OP1   . DT  A 1  6   ? 15.723  -19.402 81.225 1.00 115.78 ? -67 DT  I OP1   1 
ATOM   102   O  OP2   . DT  A 1  6   ? 17.218  -17.288 81.199 1.00 115.13 ? -67 DT  I OP2   1 
ATOM   103   O  "O5'" . DT  A 1  6   ? 14.955  -17.268 80.199 1.00 130.87 ? -67 DT  I "O5'" 1 
ATOM   104   C  "C5'" . DT  A 1  6   ? 13.532  -17.138 80.364 1.00 121.18 ? -67 DT  I "C5'" 1 
ATOM   105   C  "C4'" . DT  A 1  6   ? 13.003  -16.170 79.334 1.00 116.33 ? -67 DT  I "C4'" 1 
ATOM   106   O  "O4'" . DT  A 1  6   ? 13.125  -14.803 79.810 1.00 114.10 ? -67 DT  I "O4'" 1 
ATOM   107   C  "C3'" . DT  A 1  6   ? 13.739  -16.213 77.991 1.00 111.36 ? -67 DT  I "C3'" 1 
ATOM   108   O  "O3'" . DT  A 1  6   ? 12.748  -16.221 76.963 1.00 117.58 ? -67 DT  I "O3'" 1 
ATOM   109   C  "C2'" . DT  A 1  6   ? 14.569  -14.942 78.009 1.00 108.23 ? -67 DT  I "C2'" 1 
ATOM   110   C  "C1'" . DT  A 1  6   ? 13.618  -14.020 78.738 1.00 111.22 ? -67 DT  I "C1'" 1 
ATOM   111   N  N1    . DT  A 1  6   ? 14.182  -12.767 79.287 1.00 112.16 ? -67 DT  I N1    1 
ATOM   112   C  C2    . DT  A 1  6   ? 13.396  -11.635 79.240 1.00 108.61 ? -67 DT  I C2    1 
ATOM   113   O  O2    . DT  A 1  6   ? 12.260  -11.627 78.796 1.00 108.10 ? -67 DT  I O2    1 
ATOM   114   N  N3    . DT  A 1  6   ? 13.988  -10.507 79.747 1.00 109.19 ? -67 DT  I N3    1 
ATOM   115   C  C4    . DT  A 1  6   ? 15.257  -10.398 80.280 1.00 113.06 ? -67 DT  I C4    1 
ATOM   116   O  O4    . DT  A 1  6   ? 15.651  -9.315  80.701 1.00 112.17 ? -67 DT  I O4    1 
ATOM   117   C  C5    . DT  A 1  6   ? 16.030  -11.619 80.286 1.00 113.14 ? -67 DT  I C5    1 
ATOM   118   C  C7    . DT  A 1  6   ? 17.419  -11.595 80.841 1.00 114.84 ? -67 DT  I C7    1 
ATOM   119   C  C6    . DT  A 1  6   ? 15.463  -12.727 79.794 1.00 115.74 ? -67 DT  I C6    1 
ATOM   120   P  P     . DA  A 1  7   ? 13.160  -16.388 75.426 1.00 118.96 ? -66 DA  I P     1 
ATOM   121   O  OP1   . DA  A 1  7   ? 13.074  -17.829 75.074 1.00 99.67  ? -66 DA  I OP1   1 
ATOM   122   O  OP2   . DA  A 1  7   ? 14.422  -15.650 75.198 1.00 118.27 ? -66 DA  I OP2   1 
ATOM   123   O  "O5'" . DA  A 1  7   ? 12.000  -15.603 74.676 1.00 97.78  ? -66 DA  I "O5'" 1 
ATOM   124   C  "C5'" . DA  A 1  7   ? 10.677  -15.616 75.219 1.00 101.00 ? -66 DA  I "C5'" 1 
ATOM   125   C  "C4'" . DA  A 1  7   ? 10.073  -14.245 75.064 1.00 99.98  ? -66 DA  I "C4'" 1 
ATOM   126   O  "O4'" . DA  A 1  7   ? 10.869  -13.284 75.795 1.00 95.12  ? -66 DA  I "O4'" 1 
ATOM   127   C  "C3'" . DA  A 1  7   ? 10.054  -13.761 73.618 1.00 104.09 ? -66 DA  I "C3'" 1 
ATOM   128   O  "O3'" . DA  A 1  7   ? 8.845   -13.048 73.363 1.00 95.42  ? -66 DA  I "O3'" 1 
ATOM   129   C  "C2'" . DA  A 1  7   ? 11.273  -12.863 73.538 1.00 108.89 ? -66 DA  I "C2'" 1 
ATOM   130   C  "C1'" . DA  A 1  7   ? 11.281  -12.250 74.923 1.00 103.11 ? -66 DA  I "C1'" 1 
ATOM   131   N  N9    . DA  A 1  7   ? 12.594  -11.788 75.362 1.00 107.19 ? -66 DA  I N9    1 
ATOM   132   C  C8    . DA  A 1  7   ? 13.733  -12.533 75.541 1.00 109.37 ? -66 DA  I C8    1 
ATOM   133   N  N7    . DA  A 1  7   ? 14.766  -11.831 75.941 1.00 112.32 ? -66 DA  I N7    1 
ATOM   134   C  C5    . DA  A 1  7   ? 14.278  -10.534 76.018 1.00 101.00 ? -66 DA  I C5    1 
ATOM   135   C  C6    . DA  A 1  7   ? 14.880  -9.315  76.377 1.00 103.91 ? -66 DA  I C6    1 
ATOM   136   N  N6    . DA  A 1  7   ? 16.158  -9.202  76.744 1.00 109.26 ? -66 DA  I N6    1 
ATOM   137   N  N1    . DA  A 1  7   ? 14.116  -8.200  76.344 1.00 94.10  ? -66 DA  I N1    1 
ATOM   138   C  C2    . DA  A 1  7   ? 12.833  -8.315  75.978 1.00 92.39  ? -66 DA  I C2    1 
ATOM   139   N  N3    . DA  A 1  7   ? 12.152  -9.405  75.624 1.00 95.05  ? -66 DA  I N3    1 
ATOM   140   C  C4    . DA  A 1  7   ? 12.941  -10.493 75.667 1.00 100.68 ? -66 DA  I C4    1 
ATOM   141   P  P     . DT  A 1  8   ? 8.550   -12.519 71.899 1.00 97.39  ? -65 DT  I P     1 
ATOM   142   O  OP1   . DT  A 1  8   ? 7.078   -12.454 71.727 1.00 94.01  ? -65 DT  I OP1   1 
ATOM   143   O  OP2   . DT  A 1  8   ? 9.385   -13.318 70.954 1.00 94.33  ? -65 DT  I OP2   1 
ATOM   144   O  "O5'" . DT  A 1  8   ? 9.071   -11.017 71.968 1.00 101.77 ? -65 DT  I "O5'" 1 
ATOM   145   C  "C5'" . DT  A 1  8   ? 8.715   -10.162 73.077 1.00 104.90 ? -65 DT  I "C5'" 1 
ATOM   146   C  "C4'" . DT  A 1  8   ? 9.023   -8.722  72.740 1.00 105.01 ? -65 DT  I "C4'" 1 
ATOM   147   O  "O4'" . DT  A 1  8   ? 10.363  -8.378  73.175 1.00 107.86 ? -65 DT  I "O4'" 1 
ATOM   148   C  "C3'" . DT  A 1  8   ? 8.981   -8.429  71.242 1.00 108.70 ? -65 DT  I "C3'" 1 
ATOM   149   O  "O3'" . DT  A 1  8   ? 8.355   -7.163  71.025 1.00 109.85 ? -65 DT  I "O3'" 1 
ATOM   150   C  "C2'" . DT  A 1  8   ? 10.441  -8.536  70.826 1.00 114.75 ? -65 DT  I "C2'" 1 
ATOM   151   C  "C1'" . DT  A 1  8   ? 11.160  -8.005  72.055 1.00 112.23 ? -65 DT  I "C1'" 1 
ATOM   152   N  N1    . DT  A 1  8   ? 12.548  -8.483  72.293 1.00 102.91 ? -65 DT  I N1    1 
ATOM   153   C  C2    . DT  A 1  8   ? 13.401  -7.575  72.876 1.00 102.50 ? -65 DT  I C2    1 
ATOM   154   O  O2    . DT  A 1  8   ? 13.061  -6.437  73.174 1.00 86.87  ? -65 DT  I O2    1 
ATOM   155   N  N3    . DT  A 1  8   ? 14.672  -8.048  73.104 1.00 100.85 ? -65 DT  I N3    1 
ATOM   156   C  C4    . DT  A 1  8   ? 15.163  -9.309  72.808 1.00 109.58 ? -65 DT  I C4    1 
ATOM   157   O  O4    . DT  A 1  8   ? 16.334  -9.585  73.063 1.00 101.26 ? -65 DT  I O4    1 
ATOM   158   C  C5    . DT  A 1  8   ? 14.212  -10.211 72.190 1.00 109.09 ? -65 DT  I C5    1 
ATOM   159   C  C7    . DT  A 1  8   ? 14.649  -11.600 71.836 1.00 103.63 ? -65 DT  I C7    1 
ATOM   160   C  C6    . DT  A 1  8   ? 12.967  -9.759  71.971 1.00 100.67 ? -65 DT  I C6    1 
ATOM   161   P  P     . DC  A 1  9   ? 8.086   -6.642  69.531 1.00 116.93 ? -64 DC  I P     1 
ATOM   162   O  OP1   . DC  A 1  9   ? 6.704   -6.110  69.468 1.00 98.15  ? -64 DC  I OP1   1 
ATOM   163   O  OP2   . DC  A 1  9   ? 8.518   -7.704  68.578 1.00 103.16 ? -64 DC  I OP2   1 
ATOM   164   O  "O5'" . DC  A 1  9   ? 9.078   -5.398  69.410 1.00 136.88 ? -64 DC  I "O5'" 1 
ATOM   165   C  "C5'" . DC  A 1  9   ? 9.265   -4.469  70.504 1.00 142.60 ? -64 DC  I "C5'" 1 
ATOM   166   C  "C4'" . DC  A 1  9   ? 10.526  -3.657  70.309 1.00 143.84 ? -64 DC  I "C4'" 1 
ATOM   167   O  "O4'" . DC  A 1  9   ? 11.681  -4.417  70.733 1.00 134.90 ? -64 DC  I "O4'" 1 
ATOM   168   C  "C3'" . DC  A 1  9   ? 10.800  -3.220  68.865 1.00 142.79 ? -64 DC  I "C3'" 1 
ATOM   169   O  "O3'" . DC  A 1  9   ? 10.946  -1.798  68.790 1.00 150.99 ? -64 DC  I "O3'" 1 
ATOM   170   C  "C2'" . DC  A 1  9   ? 12.099  -3.916  68.495 1.00 130.02 ? -64 DC  I "C2'" 1 
ATOM   171   C  "C1'" . DC  A 1  9   ? 12.743  -4.155  69.843 1.00 124.22 ? -64 DC  I "C1'" 1 
ATOM   172   N  N1    . DC  A 1  9   ? 13.648  -5.299  69.891 1.00 121.29 ? -64 DC  I N1    1 
ATOM   173   C  C2    . DC  A 1  9   ? 14.859  -5.163  70.569 1.00 131.53 ? -64 DC  I C2    1 
ATOM   174   O  O2    . DC  A 1  9   ? 15.141  -4.066  71.075 1.00 133.99 ? -64 DC  I O2    1 
ATOM   175   N  N3    . DC  A 1  9   ? 15.704  -6.218  70.632 1.00 136.27 ? -64 DC  I N3    1 
ATOM   176   C  C4    . DC  A 1  9   ? 15.361  -7.380  70.070 1.00 128.06 ? -64 DC  I C4    1 
ATOM   177   N  N4    . DC  A 1  9   ? 16.225  -8.395  70.153 1.00 128.32 ? -64 DC  I N4    1 
ATOM   178   C  C5    . DC  A 1  9   ? 14.125  -7.548  69.382 1.00 120.68 ? -64 DC  I C5    1 
ATOM   179   C  C6    . DC  A 1  9   ? 13.302  -6.494  69.327 1.00 114.41 ? -64 DC  I C6    1 
ATOM   180   P  P     . DC  A 1  10  ? 10.360  -0.993  67.538 1.00 147.30 ? -63 DC  I P     1 
ATOM   181   O  OP1   . DC  A 1  10  ? 9.299   -0.072  68.040 1.00 122.90 ? -63 DC  I OP1   1 
ATOM   182   O  OP2   . DC  A 1  10  ? 10.052  -1.976  66.459 1.00 128.96 ? -63 DC  I OP2   1 
ATOM   183   O  "O5'" . DC  A 1  10  ? 11.599  -0.120  67.043 1.00 138.21 ? -63 DC  I "O5'" 1 
ATOM   184   C  "C5'" . DC  A 1  10  ? 12.630  0.335   67.939 1.00 135.24 ? -63 DC  I "C5'" 1 
ATOM   185   C  "C4'" . DC  A 1  10  ? 13.974  0.225   67.259 1.00 133.23 ? -63 DC  I "C4'" 1 
ATOM   186   O  "O4'" . DC  A 1  10  ? 14.686  -0.941  67.753 1.00 119.63 ? -63 DC  I "O4'" 1 
ATOM   187   C  "C3'" . DC  A 1  10  ? 13.910  0.061   65.734 1.00 138.18 ? -63 DC  I "C3'" 1 
ATOM   188   O  "O3'" . DC  A 1  10  ? 14.924  0.851   65.091 1.00 154.83 ? -63 DC  I "O3'" 1 
ATOM   189   C  "C2'" . DC  A 1  10  ? 14.210  -1.414  65.542 1.00 131.15 ? -63 DC  I "C2'" 1 
ATOM   190   C  "C1'" . DC  A 1  10  ? 15.253  -1.583  66.628 1.00 134.07 ? -63 DC  I "C1'" 1 
ATOM   191   N  N1    . DC  A 1  10  ? 15.641  -2.954  67.009 1.00 147.94 ? -63 DC  I N1    1 
ATOM   192   C  C2    . DC  A 1  10  ? 16.747  -3.133  67.852 1.00 154.18 ? -63 DC  I C2    1 
ATOM   193   O  O2    . DC  A 1  10  ? 17.332  -2.134  68.299 1.00 150.98 ? -63 DC  I O2    1 
ATOM   194   N  N3    . DC  A 1  10  ? 17.135  -4.389  68.175 1.00 151.98 ? -63 DC  I N3    1 
ATOM   195   C  C4    . DC  A 1  10  ? 16.479  -5.439  67.672 1.00 148.14 ? -63 DC  I C4    1 
ATOM   196   N  N4    . DC  A 1  10  ? 16.889  -6.660  68.020 1.00 150.78 ? -63 DC  I N4    1 
ATOM   197   C  C5    . DC  A 1  10  ? 15.365  -5.284  66.797 1.00 144.13 ? -63 DC  I C5    1 
ATOM   198   C  C6    . DC  A 1  10  ? 14.993  -4.037  66.482 1.00 142.43 ? -63 DC  I C6    1 
ATOM   199   P  P     . DA  A 1  11  ? 14.672  2.407   64.724 1.00 155.67 ? -62 DA  I P     1 
ATOM   200   O  OP1   . DA  A 1  11  ? 13.622  2.968   65.629 1.00 127.46 ? -62 DA  I OP1   1 
ATOM   201   O  OP2   . DA  A 1  11  ? 14.530  2.503   63.250 1.00 143.75 ? -62 DA  I OP2   1 
ATOM   202   O  "O5'" . DA  A 1  11  ? 16.044  3.116   65.121 1.00 150.35 ? -62 DA  I "O5'" 1 
ATOM   203   C  "C5'" . DA  A 1  11  ? 16.975  2.509   66.040 1.00 161.41 ? -62 DA  I "C5'" 1 
ATOM   204   C  "C4'" . DA  A 1  11  ? 18.158  1.916   65.306 1.00 163.45 ? -62 DA  I "C4'" 1 
ATOM   205   O  "O4'" . DA  A 1  11  ? 18.259  0.506   65.592 1.00 171.06 ? -62 DA  I "O4'" 1 
ATOM   206   C  "C3'" . DA  A 1  11  ? 18.143  2.031   63.777 1.00 160.10 ? -62 DA  I "C3'" 1 
ATOM   207   O  "O3'" . DA  A 1  11  ? 18.909  3.194   63.421 1.00 154.75 ? -62 DA  I "O3'" 1 
ATOM   208   C  "C2'" . DA  A 1  11  ? 18.720  0.703   63.298 1.00 172.23 ? -62 DA  I "C2'" 1 
ATOM   209   C  "C1'" . DA  A 1  11  ? 19.019  -0.099  64.564 1.00 167.48 ? -62 DA  I "C1'" 1 
ATOM   210   N  N9    . DA  A 1  11  ? 18.637  -1.511  64.496 1.00 152.85 ? -62 DA  I N9    1 
ATOM   211   C  C8    . DA  A 1  11  ? 17.405  -2.014  64.156 1.00 138.64 ? -62 DA  I C8    1 
ATOM   212   N  N7    . DA  A 1  11  ? 17.341  -3.322  64.187 1.00 136.31 ? -62 DA  I N7    1 
ATOM   213   C  C5    . DA  A 1  11  ? 18.618  -3.710  64.568 1.00 144.43 ? -62 DA  I C5    1 
ATOM   214   C  C6    . DA  A 1  11  ? 19.201  -4.973  64.780 1.00 146.97 ? -62 DA  I C6    1 
ATOM   215   N  N6    . DA  A 1  11  ? 18.546  -6.126  64.629 1.00 151.80 ? -62 DA  I N6    1 
ATOM   216   N  N1    . DA  A 1  11  ? 20.500  -5.012  65.152 1.00 137.62 ? -62 DA  I N1    1 
ATOM   217   C  C2    . DA  A 1  11  ? 21.160  -3.855  65.297 1.00 121.47 ? -62 DA  I C2    1 
ATOM   218   N  N3    . DA  A 1  11  ? 20.720  -2.609  65.132 1.00 123.57 ? -62 DA  I N3    1 
ATOM   219   C  C4    . DA  A 1  11  ? 19.428  -2.605  64.762 1.00 141.33 ? -62 DA  I C4    1 
ATOM   220   P  P     . DC  A 1  12  ? 19.426  3.464   61.910 1.00 131.63 ? -61 DC  I P     1 
ATOM   221   O  OP1   . DC  A 1  12  ? 19.764  4.900   61.821 1.00 124.89 ? -61 DC  I OP1   1 
ATOM   222   O  OP2   . DC  A 1  12  ? 18.418  2.926   60.968 1.00 103.85 ? -61 DC  I OP2   1 
ATOM   223   O  "O5'" . DC  A 1  12  ? 20.802  2.650   61.853 1.00 124.45 ? -61 DC  I "O5'" 1 
ATOM   224   C  "C5'" . DC  A 1  12  ? 21.766  2.735   62.936 1.00 122.70 ? -61 DC  I "C5'" 1 
ATOM   225   C  "C4'" . DC  A 1  12  ? 22.766  1.602   62.886 1.00 129.30 ? -61 DC  I "C4'" 1 
ATOM   226   O  "O4'" . DC  A 1  12  ? 22.085  0.324   62.978 1.00 135.54 ? -61 DC  I "O4'" 1 
ATOM   227   C  "C3'" . DC  A 1  12  ? 23.615  1.528   61.612 1.00 133.99 ? -61 DC  I "C3'" 1 
ATOM   228   O  "O3'" . DC  A 1  12  ? 24.956  1.118   61.927 1.00 137.68 ? -61 DC  I "O3'" 1 
ATOM   229   C  "C2'" . DC  A 1  12  ? 22.924  0.443   60.810 1.00 131.95 ? -61 DC  I "C2'" 1 
ATOM   230   C  "C1'" . DC  A 1  12  ? 22.556  -0.514  61.929 1.00 134.45 ? -61 DC  I "C1'" 1 
ATOM   231   N  N1    . DC  A 1  12  ? 21.513  -1.516  61.624 1.00 123.36 ? -61 DC  I N1    1 
ATOM   232   C  C2    . DC  A 1  12  ? 21.713  -2.844  62.022 1.00 112.81 ? -61 DC  I C2    1 
ATOM   233   O  O2    . DC  A 1  12  ? 22.754  -3.140  62.625 1.00 112.94 ? -61 DC  I O2    1 
ATOM   234   N  N3    . DC  A 1  12  ? 20.770  -3.769  61.735 1.00 110.22 ? -61 DC  I N3    1 
ATOM   235   C  C4    . DC  A 1  12  ? 19.661  -3.411  61.082 1.00 108.53 ? -61 DC  I C4    1 
ATOM   236   N  N4    . DC  A 1  12  ? 18.754  -4.354  60.823 1.00 105.94 ? -61 DC  I N4    1 
ATOM   237   C  C5    . DC  A 1  12  ? 19.433  -2.068  60.664 1.00 113.28 ? -61 DC  I C5    1 
ATOM   238   C  C6    . DC  A 1  12  ? 20.378  -1.162  60.948 1.00 118.73 ? -61 DC  I C6    1 
ATOM   239   P  P     . DC  A 1  13  ? 26.095  1.095   60.785 1.00 139.16 ? -60 DC  I P     1 
ATOM   240   O  OP1   . DC  A 1  13  ? 27.373  1.531   61.408 1.00 148.49 ? -60 DC  I OP1   1 
ATOM   241   O  OP2   . DC  A 1  13  ? 25.567  1.827   59.602 1.00 105.47 ? -60 DC  I OP2   1 
ATOM   242   O  "O5'" . DC  A 1  13  ? 26.277  -0.457  60.455 1.00 132.17 ? -60 DC  I "O5'" 1 
ATOM   243   C  "C5'" . DC  A 1  13  ? 26.951  -1.346  61.375 1.00 133.78 ? -60 DC  I "C5'" 1 
ATOM   244   C  "C4'" . DC  A 1  13  ? 27.201  -2.696  60.741 1.00 142.92 ? -60 DC  I "C4'" 1 
ATOM   245   O  "O4'" . DC  A 1  13  ? 25.954  -3.425  60.598 1.00 149.44 ? -60 DC  I "O4'" 1 
ATOM   246   C  "C3'" . DC  A 1  13  ? 27.833  -2.662  59.347 1.00 143.05 ? -60 DC  I "C3'" 1 
ATOM   247   O  "O3'" . DC  A 1  13  ? 28.817  -3.695  59.250 1.00 132.74 ? -60 DC  I "O3'" 1 
ATOM   248   C  "C2'" . DC  A 1  13  ? 26.657  -2.927  58.425 1.00 148.86 ? -60 DC  I "C2'" 1 
ATOM   249   C  "C1'" . DC  A 1  13  ? 25.814  -3.876  59.254 1.00 146.23 ? -60 DC  I "C1'" 1 
ATOM   250   N  N1    . DC  A 1  13  ? 24.383  -3.843  58.909 1.00 133.28 ? -60 DC  I N1    1 
ATOM   251   C  C2    . DC  A 1  13  ? 23.737  -5.018  58.505 1.00 122.97 ? -60 DC  I C2    1 
ATOM   252   O  O2    . DC  A 1  13  ? 24.386  -6.074  58.451 1.00 115.69 ? -60 DC  I O2    1 
ATOM   253   N  N3    . DC  A 1  13  ? 22.422  -4.971  58.186 1.00 114.47 ? -60 DC  I N3    1 
ATOM   254   C  C4    . DC  A 1  13  ? 21.761  -3.812  58.247 1.00 113.77 ? -60 DC  I C4    1 
ATOM   255   N  N4    . DC  A 1  13  ? 20.468  -3.808  57.923 1.00 104.67 ? -60 DC  I N4    1 
ATOM   256   C  C5    . DC  A 1  13  ? 22.398  -2.602  58.645 1.00 121.47 ? -60 DC  I C5    1 
ATOM   257   C  C6    . DC  A 1  13  ? 23.696  -2.662  58.961 1.00 130.16 ? -60 DC  I C6    1 
ATOM   258   P  P     . DT  A 1  14  ? 29.493  -4.051  57.844 1.00 145.88 ? -59 DT  I P     1 
ATOM   259   O  OP1   . DT  A 1  14  ? 30.959  -3.997  58.032 1.00 168.54 ? -59 DT  I OP1   1 
ATOM   260   O  OP2   . DT  A 1  14  ? 28.872  -3.209  56.786 1.00 139.44 ? -59 DT  I OP2   1 
ATOM   261   O  "O5'" . DT  A 1  14  ? 29.074  -5.573  57.622 1.00 155.60 ? -59 DT  I "O5'" 1 
ATOM   262   C  "C5'" . DT  A 1  14  ? 30.062  -6.605  57.398 1.00 158.47 ? -59 DT  I "C5'" 1 
ATOM   263   C  "C4'" . DT  A 1  14  ? 29.549  -7.619  56.401 1.00 157.51 ? -59 DT  I "C4'" 1 
ATOM   264   O  "O4'" . DT  A 1  14  ? 28.099  -7.565  56.363 1.00 151.95 ? -59 DT  I "O4'" 1 
ATOM   265   C  "C3'" . DT  A 1  14  ? 30.016  -7.399  54.958 1.00 154.18 ? -59 DT  I "C3'" 1 
ATOM   266   O  "O3'" . DT  A 1  14  ? 30.321  -8.676  54.376 1.00 163.35 ? -59 DT  I "O3'" 1 
ATOM   267   C  "C2'" . DT  A 1  14  ? 28.841  -6.661  54.347 1.00 158.21 ? -59 DT  I "C2'" 1 
ATOM   268   C  "C1'" . DT  A 1  14  ? 27.695  -7.400  55.013 1.00 158.69 ? -59 DT  I "C1'" 1 
ATOM   269   N  N1    . DT  A 1  14  ? 26.376  -6.729  54.987 1.00 153.65 ? -59 DT  I N1    1 
ATOM   270   C  C2    . DT  A 1  14  ? 25.247  -7.516  55.069 1.00 144.79 ? -59 DT  I C2    1 
ATOM   271   O  O2    . DT  A 1  14  ? 25.286  -8.727  55.215 1.00 154.08 ? -59 DT  I O2    1 
ATOM   272   N  N3    . DT  A 1  14  ? 24.062  -6.826  54.994 1.00 125.30 ? -59 DT  I N3    1 
ATOM   273   C  C4    . DT  A 1  14  ? 23.899  -5.463  54.827 1.00 126.49 ? -59 DT  I C4    1 
ATOM   274   O  O4    . DT  A 1  14  ? 22.769  -4.983  54.775 1.00 111.73 ? -59 DT  I O4    1 
ATOM   275   C  C5    . DT  A 1  14  ? 25.124  -4.703  54.725 1.00 133.04 ? -59 DT  I C5    1 
ATOM   276   C  C7    . DT  A 1  14  ? 25.046  -3.221  54.543 1.00 128.60 ? -59 DT  I C7    1 
ATOM   277   C  C6    . DT  A 1  14  ? 26.285  -5.366  54.800 1.00 143.71 ? -59 DT  I C6    1 
ATOM   278   P  P     . DG  A 1  15  ? 29.850  -9.064  52.882 1.00 173.57 ? -58 DG  I P     1 
ATOM   279   O  OP1   . DG  A 1  15  ? 30.699  -10.186 52.407 1.00 180.48 ? -58 DG  I OP1   1 
ATOM   280   O  OP2   . DG  A 1  15  ? 29.772  -7.818  52.073 1.00 159.91 ? -58 DG  I OP2   1 
ATOM   281   O  "O5'" . DG  A 1  15  ? 28.402  -9.688  53.112 1.00 170.27 ? -58 DG  I "O5'" 1 
ATOM   282   C  "C5'" . DG  A 1  15  ? 28.231  -10.970 53.750 1.00 163.35 ? -58 DG  I "C5'" 1 
ATOM   283   C  "C4'" . DG  A 1  15  ? 27.580  -11.942 52.793 1.00 155.52 ? -58 DG  I "C4'" 1 
ATOM   284   O  "O4'" . DG  A 1  15  ? 26.338  -11.390 52.304 1.00 160.37 ? -58 DG  I "O4'" 1 
ATOM   285   C  "C3'" . DG  A 1  15  ? 28.398  -12.256 51.547 1.00 145.17 ? -58 DG  I "C3'" 1 
ATOM   286   O  "O3'" . DG  A 1  15  ? 28.151  -13.615 51.187 1.00 132.77 ? -58 DG  I "O3'" 1 
ATOM   287   C  "C2'" . DG  A 1  15  ? 27.934  -11.200 50.553 1.00 145.04 ? -58 DG  I "C2'" 1 
ATOM   288   C  "C1'" . DG  A 1  15  ? 26.499  -10.885 50.981 1.00 156.10 ? -58 DG  I "C1'" 1 
ATOM   289   N  N9    . DG  A 1  15  ? 26.131  -9.469  50.994 1.00 154.64 ? -58 DG  I N9    1 
ATOM   290   C  C8    . DG  A 1  15  ? 26.959  -8.389  50.798 1.00 146.02 ? -58 DG  I C8    1 
ATOM   291   N  N7    . DG  A 1  15  ? 26.336  -7.245  50.879 1.00 139.00 ? -58 DG  I N7    1 
ATOM   292   C  C5    . DG  A 1  15  ? 25.019  -7.587  51.147 1.00 134.27 ? -58 DG  I C5    1 
ATOM   293   C  C6    . DG  A 1  15  ? 23.875  -6.766  51.336 1.00 119.45 ? -58 DG  I C6    1 
ATOM   294   O  O6    . DG  A 1  15  ? 23.799  -5.533  51.309 1.00 108.19 ? -58 DG  I O6    1 
ATOM   295   N  N1    . DG  A 1  15  ? 22.738  -7.525  51.586 1.00 116.43 ? -58 DG  I N1    1 
ATOM   296   C  C2    . DG  A 1  15  ? 22.700  -8.897  51.638 1.00 122.84 ? -58 DG  I C2    1 
ATOM   297   N  N2    . DG  A 1  15  ? 21.505  -9.448  51.885 1.00 126.69 ? -58 DG  I N2    1 
ATOM   298   N  N3    . DG  A 1  15  ? 23.757  -9.674  51.463 1.00 135.68 ? -58 DG  I N3    1 
ATOM   299   C  C4    . DG  A 1  15  ? 24.874  -8.957  51.221 1.00 147.24 ? -58 DG  I C4    1 
ATOM   300   P  P     . DC  A 1  16  ? 28.337  -14.077 49.683 1.00 145.85 ? -57 DC  I P     1 
ATOM   301   O  OP1   . DC  A 1  16  ? 28.503  -15.555 49.666 1.00 138.31 ? -57 DC  I OP1   1 
ATOM   302   O  OP2   . DC  A 1  16  ? 29.350  -13.190 49.047 1.00 123.76 ? -57 DC  I OP2   1 
ATOM   303   O  "O5'" . DC  A 1  16  ? 26.926  -13.734 49.038 1.00 149.83 ? -57 DC  I "O5'" 1 
ATOM   304   C  "C5'" . DC  A 1  16  ? 25.695  -14.227 49.595 1.00 137.22 ? -57 DC  I "C5'" 1 
ATOM   305   C  "C4'" . DC  A 1  16  ? 24.568  -13.889 48.648 1.00 128.09 ? -57 DC  I "C4'" 1 
ATOM   306   O  "O4'" . DC  A 1  16  ? 24.227  -12.490 48.807 1.00 126.62 ? -57 DC  I "O4'" 1 
ATOM   307   C  "C3'" . DC  A 1  16  ? 24.925  -14.059 47.167 1.00 116.87 ? -57 DC  I "C3'" 1 
ATOM   308   O  "O3'" . DC  A 1  16  ? 23.781  -14.391 46.395 1.00 112.17 ? -57 DC  I "O3'" 1 
ATOM   309   C  "C2'" . DC  A 1  16  ? 25.315  -12.660 46.744 1.00 120.07 ? -57 DC  I "C2'" 1 
ATOM   310   C  "C1'" . DC  A 1  16  ? 24.290  -11.867 47.532 1.00 122.76 ? -57 DC  I "C1'" 1 
ATOM   311   N  N1    . DC  A 1  16  ? 24.578  -10.441 47.728 1.00 112.83 ? -57 DC  I N1    1 
ATOM   312   C  C2    . DC  A 1  16  ? 23.503  -9.563  47.879 1.00 107.39 ? -57 DC  I C2    1 
ATOM   313   O  O2    . DC  A 1  16  ? 22.352  -10.018 47.855 1.00 107.29 ? -57 DC  I O2    1 
ATOM   314   N  N3    . DC  A 1  16  ? 23.744  -8.244  48.042 1.00 103.52 ? -57 DC  I N3    1 
ATOM   315   C  C4    . DC  A 1  16  ? 24.998  -7.792  48.050 1.00 102.30 ? -57 DC  I C4    1 
ATOM   316   N  N4    . DC  A 1  16  ? 25.188  -6.482  48.216 1.00 106.38 ? -57 DC  I N4    1 
ATOM   317   C  C5    . DC  A 1  16  ? 26.114  -8.664  47.898 1.00 107.58 ? -57 DC  I C5    1 
ATOM   318   C  C6    . DC  A 1  16  ? 25.861  -9.968  47.738 1.00 112.53 ? -57 DC  I C6    1 
ATOM   319   P  P     . DA  A 1  17  ? 23.356  -15.887 46.269 1.00 108.97 ? -56 DA  I P     1 
ATOM   320   O  OP1   . DA  A 1  17  ? 23.445  -16.493 47.616 1.00 106.32 ? -56 DA  I OP1   1 
ATOM   321   O  OP2   . DA  A 1  17  ? 24.096  -16.460 45.117 1.00 120.13 ? -56 DA  I OP2   1 
ATOM   322   O  "O5'" . DA  A 1  17  ? 21.818  -15.803 45.871 1.00 132.26 ? -56 DA  I "O5'" 1 
ATOM   323   C  "C5'" . DA  A 1  17  ? 20.747  -15.765 46.840 1.00 123.48 ? -56 DA  I "C5'" 1 
ATOM   324   C  "C4'" . DA  A 1  17  ? 19.533  -15.136 46.198 1.00 119.97 ? -56 DA  I "C4'" 1 
ATOM   325   O  "O4'" . DA  A 1  17  ? 19.828  -13.741 45.979 1.00 116.33 ? -56 DA  I "O4'" 1 
ATOM   326   C  "C3'" . DA  A 1  17  ? 19.188  -15.683 44.811 1.00 120.55 ? -56 DA  I "C3'" 1 
ATOM   327   O  "O3'" . DA  A 1  17  ? 17.904  -15.314 44.312 1.00 116.62 ? -56 DA  I "O3'" 1 
ATOM   328   C  "C2'" . DA  A 1  17  ? 20.094  -14.875 43.907 1.00 120.50 ? -56 DA  I "C2'" 1 
ATOM   329   C  "C1'" . DA  A 1  17  ? 20.068  -13.514 44.592 1.00 121.08 ? -56 DA  I "C1'" 1 
ATOM   330   N  N9    . DA  A 1  17  ? 21.293  -12.734 44.471 1.00 120.57 ? -56 DA  I N9    1 
ATOM   331   C  C8    . DA  A 1  17  ? 22.552  -13.133 44.094 1.00 118.98 ? -56 DA  I C8    1 
ATOM   332   N  N7    . DA  A 1  17  ? 23.430  -12.160 44.078 1.00 121.26 ? -56 DA  I N7    1 
ATOM   333   C  C5    . DA  A 1  17  ? 22.700  -11.046 44.466 1.00 116.70 ? -56 DA  I C5    1 
ATOM   334   C  C6    . DA  A 1  17  ? 23.054  -9.701  44.645 1.00 121.66 ? -56 DA  I C6    1 
ATOM   335   N  N6    . DA  A 1  17  ? 24.287  -9.230  44.452 1.00 137.33 ? -56 DA  I N6    1 
ATOM   336   N  N1    . DA  A 1  17  ? 22.088  -8.843  45.043 1.00 113.15 ? -56 DA  I N1    1 
ATOM   337   C  C2    . DA  A 1  17  ? 20.854  -9.318  45.242 1.00 112.35 ? -56 DA  I C2    1 
ATOM   338   N  N3    . DA  A 1  17  ? 20.398  -10.561 45.105 1.00 111.52 ? -56 DA  I N3    1 
ATOM   339   C  C4    . DA  A 1  17  ? 21.384  -11.386 44.713 1.00 119.59 ? -56 DA  I C4    1 
ATOM   340   P  P     . DG  A 1  18  ? 16.574  -15.829 45.003 1.00 127.02 ? -55 DG  I P     1 
ATOM   341   O  OP1   . DG  A 1  18  ? 16.816  -15.962 46.465 1.00 113.49 ? -55 DG  I OP1   1 
ATOM   342   O  OP2   . DG  A 1  18  ? 16.081  -16.993 44.231 1.00 128.55 ? -55 DG  I OP2   1 
ATOM   343   O  "O5'" . DG  A 1  18  ? 15.599  -14.593 44.778 1.00 107.15 ? -55 DG  I "O5'" 1 
ATOM   344   C  "C5'" . DG  A 1  18  ? 15.873  -13.353 45.445 1.00 100.77 ? -55 DG  I "C5'" 1 
ATOM   345   C  "C4'" . DG  A 1  18  ? 15.729  -12.166 44.519 1.00 96.48  ? -55 DG  I "C4'" 1 
ATOM   346   O  "O4'" . DG  A 1  18  ? 17.022  -11.680 44.097 1.00 95.10  ? -55 DG  I "O4'" 1 
ATOM   347   C  "C3'" . DG  A 1  18  ? 14.903  -12.338 43.237 1.00 91.52  ? -55 DG  I "C3'" 1 
ATOM   348   O  "O3'" . DG  A 1  18  ? 14.045  -11.195 43.276 1.00 93.41  ? -55 DG  I "O3'" 1 
ATOM   349   C  "C2'" . DG  A 1  18  ? 15.938  -12.253 42.128 1.00 86.55  ? -55 DG  I "C2'" 1 
ATOM   350   C  "C1'" . DG  A 1  18  ? 16.934  -11.293 42.739 1.00 93.81  ? -55 DG  I "C1'" 1 
ATOM   351   N  N9    . DG  A 1  18  ? 18.283  -11.307 42.190 1.00 102.54 ? -55 DG  I N9    1 
ATOM   352   C  C8    . DG  A 1  18  ? 18.950  -12.367 41.625 1.00 104.48 ? -55 DG  I C8    1 
ATOM   353   N  N7    . DG  A 1  18  ? 20.172  -12.075 41.275 1.00 110.12 ? -55 DG  I N7    1 
ATOM   354   C  C5    . DG  A 1  18  ? 20.322  -10.742 41.633 1.00 116.80 ? -55 DG  I C5    1 
ATOM   355   C  C6    . DG  A 1  18  ? 21.434  -9.873  41.493 1.00 119.82 ? -55 DG  I C6    1 
ATOM   356   O  O6    . DG  A 1  18  ? 22.542  -10.114 41.006 1.00 131.42 ? -55 DG  I O6    1 
ATOM   357   N  N1    . DG  A 1  18  ? 21.158  -8.605  41.994 1.00 119.44 ? -55 DG  I N1    1 
ATOM   358   C  C2    . DG  A 1  18  ? 19.967  -8.221  42.559 1.00 111.89 ? -55 DG  I C2    1 
ATOM   359   N  N2    . DG  A 1  18  ? 19.895  -6.954  42.990 1.00 105.48 ? -55 DG  I N2    1 
ATOM   360   N  N3    . DG  A 1  18  ? 18.923  -9.022  42.694 1.00 116.48 ? -55 DG  I N3    1 
ATOM   361   C  C4    . DG  A 1  18  ? 19.169  -10.258 42.211 1.00 110.44 ? -55 DG  I C4    1 
ATOM   362   P  P     . DA  A 1  19  ? 12.863  -10.960 42.237 1.00 86.40  ? -54 DA  I P     1 
ATOM   363   O  OP1   . DA  A 1  19  ? 11.598  -10.996 43.005 1.00 85.01  ? -54 DA  I OP1   1 
ATOM   364   O  OP2   . DA  A 1  19  ? 13.054  -11.851 41.063 1.00 74.91  ? -54 DA  I OP2   1 
ATOM   365   O  "O5'" . DA  A 1  19  ? 13.135  -9.462  41.765 1.00 91.29  ? -54 DA  I "O5'" 1 
ATOM   366   C  "C5'" . DA  A 1  19  ? 13.592  -8.460  42.705 1.00 95.84  ? -54 DA  I "C5'" 1 
ATOM   367   C  "C4'" . DA  A 1  19  ? 14.365  -7.361  42.008 1.00 102.00 ? -54 DA  I "C4'" 1 
ATOM   368   O  "O4'" . DA  A 1  19  ? 15.684  -7.836  41.644 1.00 104.54 ? -54 DA  I "O4'" 1 
ATOM   369   C  "C3'" . DA  A 1  19  ? 13.725  -6.816  40.725 1.00 103.66 ? -54 DA  I "C3'" 1 
ATOM   370   O  "O3'" . DA  A 1  19  ? 13.393  -5.426  40.880 1.00 99.05  ? -54 DA  I "O3'" 1 
ATOM   371   C  "C2'" . DA  A 1  19  ? 14.745  -7.123  39.634 1.00 104.57 ? -54 DA  I "C2'" 1 
ATOM   372   C  "C1'" . DA  A 1  19  ? 16.046  -7.275  40.398 1.00 105.27 ? -54 DA  I "C1'" 1 
ATOM   373   N  N9    . DA  A 1  19  ? 17.034  -8.157  39.777 1.00 108.28 ? -54 DA  I N9    1 
ATOM   374   C  C8    . DA  A 1  19  ? 16.885  -9.469  39.398 1.00 111.41 ? -54 DA  I C8    1 
ATOM   375   N  N7    . DA  A 1  19  ? 17.966  -9.992  38.872 1.00 113.87 ? -54 DA  I N7    1 
ATOM   376   C  C5    . DA  A 1  19  ? 18.890  -8.956  38.910 1.00 123.96 ? -54 DA  I C5    1 
ATOM   377   C  C6    . DA  A 1  19  ? 20.231  -8.867  38.495 1.00 126.31 ? -54 DA  I C6    1 
ATOM   378   N  N6    . DA  A 1  19  ? 20.905  -9.878  37.942 1.00 122.02 ? -54 DA  I N6    1 
ATOM   379   N  N1    . DA  A 1  19  ? 20.866  -7.688  38.671 1.00 130.65 ? -54 DA  I N1    1 
ATOM   380   C  C2    . DA  A 1  19  ? 20.193  -6.674  39.230 1.00 123.55 ? -54 DA  I C2    1 
ATOM   381   N  N3    . DA  A 1  19  ? 18.933  -6.636  39.660 1.00 122.64 ? -54 DA  I N3    1 
ATOM   382   C  C4    . DA  A 1  19  ? 18.329  -7.822  39.467 1.00 120.60 ? -54 DA  I C4    1 
ATOM   383   P  P     . DT  A 1  20  ? 12.562  -4.645  39.732 1.00 110.62 ? -53 DT  I P     1 
ATOM   384   O  OP1   . DT  A 1  20  ? 11.330  -4.076  40.358 1.00 98.51  ? -53 DT  I OP1   1 
ATOM   385   O  OP2   . DT  A 1  20  ? 12.410  -5.548  38.563 1.00 94.01  ? -53 DT  I OP2   1 
ATOM   386   O  "O5'" . DT  A 1  20  ? 13.594  -3.519  39.248 1.00 114.41 ? -53 DT  I "O5'" 1 
ATOM   387   C  "C5'" . DT  A 1  20  ? 14.933  -3.406  39.800 1.00 106.21 ? -53 DT  I "C5'" 1 
ATOM   388   C  "C4'" . DT  A 1  20  ? 15.984  -3.032  38.773 1.00 108.78 ? -53 DT  I "C4'" 1 
ATOM   389   O  "O4'" . DT  A 1  20  ? 16.775  -4.195  38.418 1.00 107.69 ? -53 DT  I "O4'" 1 
ATOM   390   C  "C3'" . DT  A 1  20  ? 15.541  -2.390  37.444 1.00 108.36 ? -53 DT  I "C3'" 1 
ATOM   391   O  "O3'" . DT  A 1  20  ? 16.208  -1.116  37.300 1.00 108.10 ? -53 DT  I "O3'" 1 
ATOM   392   C  "C2'" . DT  A 1  20  ? 15.923  -3.433  36.403 1.00 107.34 ? -53 DT  I "C2'" 1 
ATOM   393   C  "C1'" . DT  A 1  20  ? 17.132  -4.077  37.054 1.00 109.97 ? -53 DT  I "C1'" 1 
ATOM   394   N  N1    . DT  A 1  20  ? 17.512  -5.419  36.560 1.00 114.26 ? -53 DT  I N1    1 
ATOM   395   C  C2    . DT  A 1  20  ? 18.849  -5.681  36.348 1.00 114.63 ? -53 DT  I C2    1 
ATOM   396   O  O2    . DT  A 1  20  ? 19.730  -4.856  36.536 1.00 106.68 ? -53 DT  I O2    1 
ATOM   397   N  N3    . DT  A 1  20  ? 19.118  -6.951  35.899 1.00 115.76 ? -53 DT  I N3    1 
ATOM   398   C  C4    . DT  A 1  20  ? 18.206  -7.960  35.650 1.00 117.03 ? -53 DT  I C4    1 
ATOM   399   O  O4    . DT  A 1  20  ? 18.599  -9.051  35.248 1.00 118.10 ? -53 DT  I O4    1 
ATOM   400   C  C5    . DT  A 1  20  ? 16.823  -7.617  35.897 1.00 117.93 ? -53 DT  I C5    1 
ATOM   401   C  C7    . DT  A 1  20  ? 15.765  -8.649  35.662 1.00 110.20 ? -53 DT  I C7    1 
ATOM   402   C  C6    . DT  A 1  20  ? 16.549  -6.381  36.334 1.00 117.44 ? -53 DT  I C6    1 
ATOM   403   P  P     . DA  A 1  21  ? 16.597  -0.490  35.851 1.00 116.77 ? -52 DA  I P     1 
ATOM   404   O  OP1   . DA  A 1  21  ? 17.081  0.894   36.070 1.00 102.42 ? -52 DA  I OP1   1 
ATOM   405   O  OP2   . DA  A 1  21  ? 15.473  -0.729  34.899 1.00 99.50  ? -52 DA  I OP2   1 
ATOM   406   O  "O5'" . DA  A 1  21  ? 17.869  -1.348  35.421 1.00 128.81 ? -52 DA  I "O5'" 1 
ATOM   407   C  "C5'" . DA  A 1  21  ? 19.216  -0.869  35.601 1.00 129.52 ? -52 DA  I "C5'" 1 
ATOM   408   C  "C4'" . DA  A 1  21  ? 19.960  -0.989  34.293 1.00 136.36 ? -52 DA  I "C4'" 1 
ATOM   409   O  "O4'" . DA  A 1  21  ? 20.127  -2.393  33.979 1.00 139.32 ? -52 DA  I "O4'" 1 
ATOM   410   C  "C3'" . DA  A 1  21  ? 19.236  -0.384  33.086 1.00 145.12 ? -52 DA  I "C3'" 1 
ATOM   411   O  "O3'" . DA  A 1  21  ? 20.225  0.138   32.185 1.00 147.56 ? -52 DA  I "O3'" 1 
ATOM   412   C  "C2'" . DA  A 1  21  ? 18.509  -1.579  32.495 1.00 140.59 ? -52 DA  I "C2'" 1 
ATOM   413   C  "C1'" . DA  A 1  21  ? 19.566  -2.646  32.697 1.00 139.92 ? -52 DA  I "C1'" 1 
ATOM   414   N  N9    . DA  A 1  21  ? 19.120  -4.035  32.663 1.00 124.06 ? -52 DA  I N9    1 
ATOM   415   C  C8    . DA  A 1  21  ? 17.923  -4.600  33.030 1.00 110.16 ? -52 DA  I C8    1 
ATOM   416   N  N7    . DA  A 1  21  ? 17.879  -5.900  32.861 1.00 106.59 ? -52 DA  I N7    1 
ATOM   417   C  C5    . DA  A 1  21  ? 19.130  -6.210  32.343 1.00 122.17 ? -52 DA  I C5    1 
ATOM   418   C  C6    . DA  A 1  21  ? 19.720  -7.426  31.944 1.00 124.23 ? -52 DA  I C6    1 
ATOM   419   N  N6    . DA  A 1  21  ? 19.102  -8.607  32.008 1.00 121.35 ? -52 DA  I N6    1 
ATOM   420   N  N1    . DA  A 1  21  ? 20.984  -7.384  31.468 1.00 134.52 ? -52 DA  I N1    1 
ATOM   421   C  C2    . DA  A 1  21  ? 21.603  -6.199  31.394 1.00 135.09 ? -52 DA  I C2    1 
ATOM   422   N  N3    . DA  A 1  21  ? 21.160  -4.994  31.746 1.00 122.49 ? -52 DA  I N3    1 
ATOM   423   C  C4    . DA  A 1  21  ? 19.903  -5.071  32.217 1.00 121.10 ? -52 DA  I C4    1 
ATOM   424   P  P     . DC  A 1  22  ? 19.817  1.088   30.955 1.00 134.79 ? -51 DC  I P     1 
ATOM   425   O  OP1   . DC  A 1  22  ? 20.381  2.437   31.222 1.00 117.89 ? -51 DC  I OP1   1 
ATOM   426   O  OP2   . DC  A 1  22  ? 18.358  0.932   30.697 1.00 113.03 ? -51 DC  I OP2   1 
ATOM   427   O  "O5'" . DC  A 1  22  ? 20.611  0.450   29.729 1.00 125.96 ? -51 DC  I "O5'" 1 
ATOM   428   C  "C5'" . DC  A 1  22  ? 21.852  -0.262  29.905 1.00 127.94 ? -51 DC  I "C5'" 1 
ATOM   429   C  "C4'" . DC  A 1  22  ? 22.031  -1.284  28.804 1.00 139.46 ? -51 DC  I "C4'" 1 
ATOM   430   O  "O4'" . DC  A 1  22  ? 21.549  -2.575  29.233 1.00 140.56 ? -51 DC  I "O4'" 1 
ATOM   431   C  "C3'" . DC  A 1  22  ? 21.268  -1.005  27.511 1.00 148.60 ? -51 DC  I "C3'" 1 
ATOM   432   O  "O3'" . DC  A 1  22  ? 22.002  -0.137  26.639 1.00 153.67 ? -51 DC  I "O3'" 1 
ATOM   433   C  "C2'" . DC  A 1  22  ? 21.108  -2.390  26.905 1.00 146.86 ? -51 DC  I "C2'" 1 
ATOM   434   C  "C1'" . DC  A 1  22  ? 21.263  -3.354  28.076 1.00 142.35 ? -51 DC  I "C1'" 1 
ATOM   435   N  N1    . DC  A 1  22  ? 20.050  -4.136  28.342 1.00 142.32 ? -51 DC  I N1    1 
ATOM   436   C  C2    . DC  A 1  22  ? 20.150  -5.526  28.423 1.00 134.73 ? -51 DC  I C2    1 
ATOM   437   O  O2    . DC  A 1  22  ? 21.261  -6.057  28.283 1.00 128.94 ? -51 DC  I O2    1 
ATOM   438   N  N3    . DC  A 1  22  ? 19.036  -6.257  28.657 1.00 129.28 ? -51 DC  I N3    1 
ATOM   439   C  C4    . DC  A 1  22  ? 17.857  -5.646  28.801 1.00 127.72 ? -51 DC  I C4    1 
ATOM   440   N  N4    . DC  A 1  22  ? 16.785  -6.404  29.031 1.00 123.68 ? -51 DC  I N4    1 
ATOM   441   C  C5    . DC  A 1  22  ? 17.725  -4.230  28.711 1.00 138.25 ? -51 DC  I C5    1 
ATOM   442   C  C6    . DC  A 1  22  ? 18.837  -3.520  28.480 1.00 143.47 ? -51 DC  I C6    1 
ATOM   443   P  P     . DT  A 1  23  ? 21.484  0.132   25.144 1.00 146.00 ? -50 DT  I P     1 
ATOM   444   O  OP1   . DT  A 1  23  ? 22.212  1.306   24.620 1.00 128.67 ? -50 DT  I OP1   1 
ATOM   445   O  OP2   . DT  A 1  23  ? 19.993  0.133   25.159 1.00 143.08 ? -50 DT  I OP2   1 
ATOM   446   O  "O5'" . DT  A 1  23  ? 22.003  -1.144  24.341 1.00 147.08 ? -50 DT  I "O5'" 1 
ATOM   447   C  "C5'" . DT  A 1  23  ? 23.375  -1.589  24.420 1.00 146.17 ? -50 DT  I "C5'" 1 
ATOM   448   C  "C4'" . DT  A 1  23  ? 23.556  -2.842  23.596 1.00 150.04 ? -50 DT  I "C4'" 1 
ATOM   449   O  "O4'" . DT  A 1  23  ? 22.694  -3.893  24.101 1.00 150.97 ? -50 DT  I "O4'" 1 
ATOM   450   C  "C3'" . DT  A 1  23  ? 23.184  -2.670  22.123 1.00 158.16 ? -50 DT  I "C3'" 1 
ATOM   451   O  "O3'" . DT  A 1  23  ? 24.062  -3.409  21.271 1.00 168.37 ? -50 DT  I "O3'" 1 
ATOM   452   C  "C2'" . DT  A 1  23  ? 21.768  -3.207  22.057 1.00 158.81 ? -50 DT  I "C2'" 1 
ATOM   453   C  "C1'" . DT  A 1  23  ? 21.823  -4.339  23.068 1.00 156.72 ? -50 DT  I "C1'" 1 
ATOM   454   N  N1    . DT  A 1  23  ? 20.525  -4.703  23.681 1.00 152.76 ? -50 DT  I N1    1 
ATOM   455   C  C2    . DT  A 1  23  ? 20.408  -5.949  24.256 1.00 146.41 ? -50 DT  I C2    1 
ATOM   456   O  O2    . DT  A 1  23  ? 21.322  -6.756  24.294 1.00 138.91 ? -50 DT  I O2    1 
ATOM   457   N  N3    . DT  A 1  23  ? 19.172  -6.218  24.790 1.00 146.57 ? -50 DT  I N3    1 
ATOM   458   C  C4    . DT  A 1  23  ? 18.069  -5.384  24.805 1.00 146.88 ? -50 DT  I C4    1 
ATOM   459   O  O4    . DT  A 1  23  ? 17.021  -5.766  25.322 1.00 141.76 ? -50 DT  I O4    1 
ATOM   460   C  C5    . DT  A 1  23  ? 18.261  -4.096  24.177 1.00 143.43 ? -50 DT  I C5    1 
ATOM   461   C  C7    . DT  A 1  23  ? 17.122  -3.127  24.138 1.00 136.24 ? -50 DT  I C7    1 
ATOM   462   C  C6    . DT  A 1  23  ? 19.462  -3.825  23.652 1.00 146.56 ? -50 DT  I C6    1 
ATOM   463   P  P     . DA  A 1  24  ? 23.839  -3.386  19.687 1.00 173.24 ? -49 DA  I P     1 
ATOM   464   O  OP1   . DA  A 1  24  ? 25.175  -3.414  19.037 1.00 162.47 ? -49 DA  I OP1   1 
ATOM   465   O  OP2   . DA  A 1  24  ? 22.890  -2.283  19.371 1.00 160.97 ? -49 DA  I OP2   1 
ATOM   466   O  "O5'" . DA  A 1  24  ? 23.119  -4.782  19.412 1.00 167.69 ? -49 DA  I "O5'" 1 
ATOM   467   C  "C5'" . DA  A 1  24  ? 23.718  -6.021  19.845 1.00 155.30 ? -49 DA  I "C5'" 1 
ATOM   468   C  "C4'" . DA  A 1  24  ? 22.947  -7.210  19.318 1.00 150.90 ? -49 DA  I "C4'" 1 
ATOM   469   O  "O4'" . DA  A 1  24  ? 21.795  -7.463  20.158 1.00 144.02 ? -49 DA  I "O4'" 1 
ATOM   470   C  "C3'" . DA  A 1  24  ? 22.404  -7.073  17.892 1.00 156.04 ? -49 DA  I "C3'" 1 
ATOM   471   O  "O3'" . DA  A 1  24  ? 22.591  -8.320  17.203 1.00 162.69 ? -49 DA  I "O3'" 1 
ATOM   472   C  "C2'" . DA  A 1  24  ? 20.950  -6.695  18.114 1.00 151.36 ? -49 DA  I "C2'" 1 
ATOM   473   C  "C1'" . DA  A 1  24  ? 20.621  -7.495  19.359 1.00 150.03 ? -49 DA  I "C1'" 1 
ATOM   474   N  N9    . DA  A 1  24  ? 19.514  -6.985  20.167 1.00 151.13 ? -49 DA  I N9    1 
ATOM   475   C  C8    . DA  A 1  24  ? 19.080  -5.689  20.315 1.00 150.47 ? -49 DA  I C8    1 
ATOM   476   N  N7    . DA  A 1  24  ? 18.055  -5.565  21.123 1.00 141.43 ? -49 DA  I N7    1 
ATOM   477   C  C5    . DA  A 1  24  ? 17.798  -6.865  21.538 1.00 144.37 ? -49 DA  I C5    1 
ATOM   478   C  C6    . DA  A 1  24  ? 16.833  -7.408  22.406 1.00 141.95 ? -49 DA  I C6    1 
ATOM   479   N  N6    . DA  A 1  24  ? 15.910  -6.679  23.036 1.00 135.94 ? -49 DA  I N6    1 
ATOM   480   N  N1    . DA  A 1  24  ? 16.848  -8.746  22.603 1.00 135.83 ? -49 DA  I N1    1 
ATOM   481   C  C2    . DA  A 1  24  ? 17.771  -9.478  21.965 1.00 132.21 ? -49 DA  I C2    1 
ATOM   482   N  N3    . DA  A 1  24  ? 18.730  -9.082  21.129 1.00 131.40 ? -49 DA  I N3    1 
ATOM   483   C  C4    . DA  A 1  24  ? 18.688  -7.749  20.956 1.00 143.09 ? -49 DA  I C4    1 
ATOM   484   P  P     . DC  A 1  25  ? 21.951  -8.565  15.748 1.00 163.62 ? -48 DC  I P     1 
ATOM   485   O  OP1   . DC  A 1  25  ? 22.732  -9.625  15.056 1.00 136.07 ? -48 DC  I OP1   1 
ATOM   486   O  OP2   . DC  A 1  25  ? 21.723  -7.245  15.100 1.00 153.76 ? -48 DC  I OP2   1 
ATOM   487   O  "O5'" . DC  A 1  25  ? 20.552  -9.223  16.100 1.00 159.90 ? -48 DC  I "O5'" 1 
ATOM   488   C  "C5'" . DC  A 1  25  ? 20.502  -10.488 16.763 1.00 148.76 ? -48 DC  I "C5'" 1 
ATOM   489   C  "C4'" . DC  A 1  25  ? 19.059  -10.914 16.808 1.00 145.44 ? -48 DC  I "C4'" 1 
ATOM   490   O  "O4'" . DC  A 1  25  ? 18.346  -10.050 17.723 1.00 146.65 ? -48 DC  I "O4'" 1 
ATOM   491   C  "C3'" . DC  A 1  25  ? 18.349  -10.787 15.455 1.00 140.93 ? -48 DC  I "C3'" 1 
ATOM   492   O  "O3'" . DC  A 1  25  ? 17.869  -12.094 15.116 1.00 140.33 ? -48 DC  I "O3'" 1 
ATOM   493   C  "C2'" . DC  A 1  25  ? 17.316  -9.688  15.681 1.00 142.78 ? -48 DC  I "C2'" 1 
ATOM   494   C  "C1'" . DC  A 1  25  ? 17.072  -9.805  17.173 1.00 142.18 ? -48 DC  I "C1'" 1 
ATOM   495   N  N1    . DC  A 1  25  ? 16.474  -8.658  17.887 1.00 131.05 ? -48 DC  I N1    1 
ATOM   496   C  C2    . DC  A 1  25  ? 15.634  -8.927  18.970 1.00 116.06 ? -48 DC  I C2    1 
ATOM   497   O  O2    . DC  A 1  25  ? 15.425  -10.107 19.286 1.00 108.74 ? -48 DC  I O2    1 
ATOM   498   N  N3    . DC  A 1  25  ? 15.068  -7.900  19.643 1.00 111.19 ? -48 DC  I N3    1 
ATOM   499   C  C4    . DC  A 1  25  ? 15.324  -6.643  19.277 1.00 124.72 ? -48 DC  I C4    1 
ATOM   500   N  N4    . DC  A 1  25  ? 14.748  -5.661  19.975 1.00 124.58 ? -48 DC  I N4    1 
ATOM   501   C  C5    . DC  A 1  25  ? 16.181  -6.338  18.179 1.00 131.75 ? -48 DC  I C5    1 
ATOM   502   C  C6    . DC  A 1  25  ? 16.734  -7.366  17.521 1.00 129.33 ? -48 DC  I C6    1 
ATOM   503   P  P     . DC  A 1  26  ? 16.920  -12.322 13.845 1.00 149.02 ? -47 DC  I P     1 
ATOM   504   O  OP1   . DC  A 1  26  ? 17.222  -13.663 13.273 1.00 128.68 ? -47 DC  I OP1   1 
ATOM   505   O  OP2   . DC  A 1  26  ? 16.993  -11.107 12.986 1.00 131.89 ? -47 DC  I OP2   1 
ATOM   506   O  "O5'" . DC  A 1  26  ? 15.468  -12.366 14.496 1.00 147.66 ? -47 DC  I "O5'" 1 
ATOM   507   C  "C5'" . DC  A 1  26  ? 14.902  -13.579 15.025 1.00 133.23 ? -47 DC  I "C5'" 1 
ATOM   508   C  "C4'" . DC  A 1  26  ? 13.403  -13.426 15.060 1.00 127.17 ? -47 DC  I "C4'" 1 
ATOM   509   O  "O4'" . DC  A 1  26  ? 13.043  -12.300 15.897 1.00 137.05 ? -47 DC  I "O4'" 1 
ATOM   510   C  "C3'" . DC  A 1  26  ? 12.798  -13.123 13.694 1.00 128.72 ? -47 DC  I "C3'" 1 
ATOM   511   O  "O3'" . DC  A 1  26  ? 11.575  -13.839 13.602 1.00 136.41 ? -47 DC  I "O3'" 1 
ATOM   512   C  "C2'" . DC  A 1  26  ? 12.604  -11.621 13.717 1.00 129.50 ? -47 DC  I "C2'" 1 
ATOM   513   C  "C1'" . DC  A 1  26  ? 12.210  -11.415 15.161 1.00 129.76 ? -47 DC  I "C1'" 1 
ATOM   514   N  N1    . DC  A 1  26  ? 12.393  -10.056 15.702 1.00 129.91 ? -47 DC  I N1    1 
ATOM   515   C  C2    . DC  A 1  26  ? 12.206  -9.863  17.071 1.00 125.77 ? -47 DC  I C2    1 
ATOM   516   O  O2    . DC  A 1  26  ? 11.899  -10.834 17.775 1.00 124.24 ? -47 DC  I O2    1 
ATOM   517   N  N3    . DC  A 1  26  ? 12.369  -8.626  17.595 1.00 120.39 ? -47 DC  I N3    1 
ATOM   518   C  C4    . DC  A 1  26  ? 12.692  -7.604  16.801 1.00 114.87 ? -47 DC  I C4    1 
ATOM   519   N  N4    . DC  A 1  26  ? 12.840  -6.402  17.361 1.00 102.57 ? -47 DC  I N4    1 
ATOM   520   C  C5    . DC  A 1  26  ? 12.883  -7.771  15.399 1.00 121.45 ? -47 DC  I C5    1 
ATOM   521   C  C6    . DC  A 1  26  ? 12.724  -9.003  14.895 1.00 123.59 ? -47 DC  I C6    1 
ATOM   522   P  P     . DA  A 1  27  ? 11.608  -15.248 12.921 1.00 135.78 ? -46 DA  I P     1 
ATOM   523   O  OP1   . DA  A 1  27  ? 12.949  -15.831 13.196 1.00 122.25 ? -46 DA  I OP1   1 
ATOM   524   O  OP2   . DA  A 1  27  ? 11.120  -15.071 11.525 1.00 119.33 ? -46 DA  I OP2   1 
ATOM   525   O  "O5'" . DA  A 1  27  ? 10.522  -16.103 13.715 1.00 136.70 ? -46 DA  I "O5'" 1 
ATOM   526   C  "C5'" . DA  A 1  27  ? 10.326  -16.013 15.140 1.00 122.10 ? -46 DA  I "C5'" 1 
ATOM   527   C  "C4'" . DA  A 1  27  ? 8.887   -15.653 15.420 1.00 112.48 ? -46 DA  I "C4'" 1 
ATOM   528   O  "O4'" . DA  A 1  27  ? 8.831   -14.238 15.704 1.00 113.60 ? -46 DA  I "O4'" 1 
ATOM   529   C  "C3'" . DA  A 1  27  ? 7.919   -15.929 14.260 1.00 108.10 ? -46 DA  I "C3'" 1 
ATOM   530   O  "O3'" . DA  A 1  27  ? 6.995   -16.988 14.604 1.00 104.66 ? -46 DA  I "O3'" 1 
ATOM   531   C  "C2'" . DA  A 1  27  ? 7.418   -14.554 13.825 1.00 110.15 ? -46 DA  I "C2'" 1 
ATOM   532   C  "C1'" . DA  A 1  27  ? 7.857   -13.575 14.916 1.00 118.29 ? -46 DA  I "C1'" 1 
ATOM   533   N  N9    . DA  A 1  27  ? 8.444   -12.309 14.463 1.00 121.86 ? -46 DA  I N9    1 
ATOM   534   C  C8    . DA  A 1  27  ? 9.084   -12.042 13.278 1.00 124.26 ? -46 DA  I C8    1 
ATOM   535   N  N7    . DA  A 1  27  ? 9.523   -10.811 13.180 1.00 123.31 ? -46 DA  I N7    1 
ATOM   536   C  C5    . DA  A 1  27  ? 9.164   -10.231 14.388 1.00 119.04 ? -46 DA  I C5    1 
ATOM   537   C  C6    . DA  A 1  27  ? 9.350   -8.937  14.911 1.00 114.14 ? -46 DA  I C6    1 
ATOM   538   N  N6    . DA  A 1  27  ? 9.962   -7.952  14.254 1.00 112.86 ? -46 DA  I N6    1 
ATOM   539   N  N1    . DA  A 1  27  ? 8.862   -8.682  16.143 1.00 114.43 ? -46 DA  I N1    1 
ATOM   540   C  C2    . DA  A 1  27  ? 8.243   -9.667  16.803 1.00 120.51 ? -46 DA  I C2    1 
ATOM   541   N  N3    . DA  A 1  27  ? 8.010   -10.921 16.420 1.00 122.98 ? -46 DA  I N3    1 
ATOM   542   C  C4    . DA  A 1  27  ? 8.503   -11.142 15.190 1.00 120.02 ? -46 DA  I C4    1 
ATOM   543   P  P     . DA  A 1  28  ? 5.450   -16.700 15.015 1.00 122.61 ? -45 DA  I P     1 
ATOM   544   O  OP1   . DA  A 1  28  ? 4.931   -17.879 15.768 1.00 97.39  ? -45 DA  I OP1   1 
ATOM   545   O  OP2   . DA  A 1  28  ? 4.730   -16.246 13.792 1.00 107.61 ? -45 DA  I OP2   1 
ATOM   546   O  "O5'" . DA  A 1  28  ? 5.578   -15.511 16.074 1.00 131.09 ? -45 DA  I "O5'" 1 
ATOM   547   C  "C5'" . DA  A 1  28  ? 4.742   -15.410 17.253 1.00 116.02 ? -45 DA  I "C5'" 1 
ATOM   548   C  "C4'" . DA  A 1  28  ? 3.786   -14.251 17.098 1.00 111.06 ? -45 DA  I "C4'" 1 
ATOM   549   O  "O4'" . DA  A 1  28  ? 4.511   -13.109 16.577 1.00 106.93 ? -45 DA  I "O4'" 1 
ATOM   550   C  "C3'" . DA  A 1  28  ? 2.642   -14.530 16.108 1.00 115.19 ? -45 DA  I "C3'" 1 
ATOM   551   O  "O3'" . DA  A 1  28  ? 1.279   -14.393 16.556 1.00 109.62 ? -45 DA  I "O3'" 1 
ATOM   552   C  "C2'" . DA  A 1  28  ? 2.887   -13.554 14.969 1.00 120.20 ? -45 DA  I "C2'" 1 
ATOM   553   C  "C1'" . DA  A 1  28  ? 3.694   -12.451 15.629 1.00 116.93 ? -45 DA  I "C1'" 1 
ATOM   554   N  N9    . DA  A 1  28  ? 4.557   -11.683 14.728 1.00 115.45 ? -45 DA  I N9    1 
ATOM   555   C  C8    . DA  A 1  28  ? 5.023   -12.041 13.486 1.00 117.03 ? -45 DA  I C8    1 
ATOM   556   N  N7    . DA  A 1  28  ? 5.767   -11.126 12.918 1.00 115.23 ? -45 DA  I N7    1 
ATOM   557   C  C5    . DA  A 1  28  ? 5.775   -10.087 13.836 1.00 115.42 ? -45 DA  I C5    1 
ATOM   558   C  C6    . DA  A 1  28  ? 6.387   -8.824  13.825 1.00 118.97 ? -45 DA  I C6    1 
ATOM   559   N  N6    . DA  A 1  28  ? 7.137   -8.377  12.817 1.00 115.05 ? -45 DA  I N6    1 
ATOM   560   N  N1    . DA  A 1  28  ? 6.210   -8.030  14.903 1.00 124.47 ? -45 DA  I N1    1 
ATOM   561   C  C2    . DA  A 1  28  ? 5.462   -8.484  15.917 1.00 127.90 ? -45 DA  I C2    1 
ATOM   562   N  N3    . DA  A 1  28  ? 4.833   -9.651  16.042 1.00 122.14 ? -45 DA  I N3    1 
ATOM   563   C  C4    . DA  A 1  28  ? 5.033   -10.415 14.954 1.00 116.15 ? -45 DA  I C4    1 
ATOM   564   P  P     . DA  A 1  29  ? 0.925   -14.104 18.080 1.00 108.23 ? -44 DA  I P     1 
ATOM   565   O  OP1   . DA  A 1  29  ? 1.811   -14.949 18.945 1.00 89.19  ? -44 DA  I OP1   1 
ATOM   566   O  OP2   . DA  A 1  29  ? -0.561  -14.133 18.227 1.00 83.03  ? -44 DA  I OP2   1 
ATOM   567   O  "O5'" . DA  A 1  29  ? 1.396   -12.602 18.251 1.00 93.89  ? -44 DA  I "O5'" 1 
ATOM   568   C  "C5'" . DA  A 1  29  ? 0.828   -11.789 19.260 1.00 86.51  ? -44 DA  I "C5'" 1 
ATOM   569   C  "C4'" . DA  A 1  29  ? 0.986   -10.348 18.854 1.00 90.77  ? -44 DA  I "C4'" 1 
ATOM   570   O  "O4'" . DA  A 1  29  ? 1.774   -10.221 17.644 1.00 95.15  ? -44 DA  I "O4'" 1 
ATOM   571   C  "C3'" . DA  A 1  29  ? -0.343  -9.657  18.572 1.00 97.35  ? -44 DA  I "C3'" 1 
ATOM   572   O  "O3'" . DA  A 1  29  ? -0.389  -8.501  19.395 1.00 102.57 ? -44 DA  I "O3'" 1 
ATOM   573   C  "C2'" . DA  A 1  29  ? -0.261  -9.258  17.112 1.00 99.76  ? -44 DA  I "C2'" 1 
ATOM   574   C  "C1'" . DA  A 1  29  ? 1.229   -9.157  16.890 1.00 95.93  ? -44 DA  I "C1'" 1 
ATOM   575   N  N9    . DA  A 1  29  ? 1.637   -9.319  15.497 1.00 98.28  ? -44 DA  I N9    1 
ATOM   576   C  C8    . DA  A 1  29  ? 1.356   -10.355 14.642 1.00 98.15  ? -44 DA  I C8    1 
ATOM   577   N  N7    . DA  A 1  29  ? 1.851   -10.196 13.440 1.00 100.02 ? -44 DA  I N7    1 
ATOM   578   C  C5    . DA  A 1  29  ? 2.472   -8.957  13.497 1.00 103.58 ? -44 DA  I C5    1 
ATOM   579   C  C6    . DA  A 1  29  ? 3.177   -8.210  12.543 1.00 109.76 ? -44 DA  I C6    1 
ATOM   580   N  N6    . DA  A 1  29  ? 3.385   -8.621  11.292 1.00 119.55 ? -44 DA  I N6    1 
ATOM   581   N  N1    . DA  A 1  29  ? 3.671   -7.011  12.921 1.00 111.38 ? -44 DA  I N1    1 
ATOM   582   C  C2    . DA  A 1  29  ? 3.461   -6.600  14.177 1.00 103.87 ? -44 DA  I C2    1 
ATOM   583   N  N3    . DA  A 1  29  ? 2.811   -7.211  15.164 1.00 100.02 ? -44 DA  I N3    1 
ATOM   584   C  C4    . DA  A 1  29  ? 2.335   -8.399  14.754 1.00 103.66 ? -44 DA  I C4    1 
ATOM   585   P  P     . DA  A 1  30  ? -1.769  -7.994  19.919 1.00 102.31 ? -43 DA  I P     1 
ATOM   586   O  OP1   . DA  A 1  30  ? -1.763  -8.177  21.391 1.00 105.48 ? -43 DA  I OP1   1 
ATOM   587   O  OP2   . DA  A 1  30  ? -2.819  -8.643  19.076 1.00 87.83  ? -43 DA  I OP2   1 
ATOM   588   O  "O5'" . DA  A 1  30  ? -1.728  -6.427  19.628 1.00 92.26  ? -43 DA  I "O5'" 1 
ATOM   589   C  "C5'" . DA  A 1  30  ? -0.498  -5.709  19.381 1.00 93.42  ? -43 DA  I "C5'" 1 
ATOM   590   C  "C4'" . DA  A 1  30  ? -0.628  -4.858  18.137 1.00 92.08  ? -43 DA  I "C4'" 1 
ATOM   591   O  "O4'" . DA  A 1  30  ? -0.242  -5.620  16.971 1.00 97.61  ? -43 DA  I "O4'" 1 
ATOM   592   C  "C3'" . DA  A 1  30  ? -2.041  -4.331  17.847 1.00 90.68  ? -43 DA  I "C3'" 1 
ATOM   593   O  "O3'" . DA  A 1  30  ? -2.097  -2.926  18.108 1.00 75.28  ? -43 DA  I "O3'" 1 
ATOM   594   C  "C2'" . DA  A 1  30  ? -2.308  -4.723  16.397 1.00 93.30  ? -43 DA  I "C2'" 1 
ATOM   595   C  "C1'" . DA  A 1  30  ? -0.930  -5.069  15.865 1.00 104.27 ? -43 DA  I "C1'" 1 
ATOM   596   N  N9    . DA  A 1  30  ? -0.881  -6.037  14.763 1.00 109.86 ? -43 DA  I N9    1 
ATOM   597   C  C8    . DA  A 1  30  ? -1.398  -7.309  14.724 1.00 106.17 ? -43 DA  I C8    1 
ATOM   598   N  N7    . DA  A 1  30  ? -1.173  -7.936  13.595 1.00 99.84  ? -43 DA  I N7    1 
ATOM   599   C  C5    . DA  A 1  30  ? -0.472  -7.011  12.834 1.00 104.73 ? -43 DA  I C5    1 
ATOM   600   C  C6    . DA  A 1  30  ? 0.052   -7.062  11.532 1.00 104.42 ? -43 DA  I C6    1 
ATOM   601   N  N6    . DA  A 1  30  ? -0.055  -8.124  10.733 1.00 105.42 ? -43 DA  I N6    1 
ATOM   602   N  N1    . DA  A 1  30  ? 0.692   -5.967  11.069 1.00 108.50 ? -43 DA  I N1    1 
ATOM   603   C  C2    . DA  A 1  30  ? 0.801   -4.900  11.871 1.00 115.01 ? -43 DA  I C2    1 
ATOM   604   N  N3    . DA  A 1  30  ? 0.349   -4.731  13.112 1.00 115.76 ? -43 DA  I N3    1 
ATOM   605   C  C4    . DA  A 1  30  ? -0.286  -5.837  13.540 1.00 112.82 ? -43 DA  I C4    1 
ATOM   606   P  P     . DG  A 1  31  ? -3.391  -2.079  17.700 1.00 90.66  ? -42 DG  I P     1 
ATOM   607   O  OP1   . DG  A 1  31  ? -3.538  -0.988  18.697 1.00 87.94  ? -42 DG  I OP1   1 
ATOM   608   O  OP2   . DG  A 1  31  ? -4.520  -3.016  17.451 1.00 80.53  ? -42 DG  I OP2   1 
ATOM   609   O  "O5'" . DG  A 1  31  ? -2.955  -1.417  16.315 1.00 101.86 ? -42 DG  I "O5'" 1 
ATOM   610   C  "C5'" . DG  A 1  31  ? -1.600  -0.929  16.123 1.00 105.11 ? -42 DG  I "C5'" 1 
ATOM   611   C  "C4'" . DG  A 1  31  ? -1.449  -0.205  14.802 1.00 101.67 ? -42 DG  I "C4'" 1 
ATOM   612   O  "O4'" . DG  A 1  31  ? -1.141  -1.153  13.753 1.00 99.17  ? -42 DG  I "O4'" 1 
ATOM   613   C  "C3'" . DG  A 1  31  ? -2.684  0.557   14.319 1.00 103.47 ? -42 DG  I "C3'" 1 
ATOM   614   O  "O3'" . DG  A 1  31  ? -2.277  1.754   13.646 1.00 102.42 ? -42 DG  I "O3'" 1 
ATOM   615   C  "C2'" . DG  A 1  31  ? -3.350  -0.433  13.381 1.00 98.36  ? -42 DG  I "C2'" 1 
ATOM   616   C  "C1'" . DG  A 1  31  ? -2.158  -1.141  12.762 1.00 93.35  ? -42 DG  I "C1'" 1 
ATOM   617   N  N9    . DG  A 1  31  ? -2.418  -2.519  12.373 1.00 99.28  ? -42 DG  I N9    1 
ATOM   618   C  C8    . DG  A 1  31  ? -3.043  -3.483  13.126 1.00 106.26 ? -42 DG  I C8    1 
ATOM   619   N  N7    . DG  A 1  31  ? -3.138  -4.630  12.512 1.00 106.83 ? -42 DG  I N7    1 
ATOM   620   C  C5    . DG  A 1  31  ? -2.545  -4.410  11.277 1.00 112.34 ? -42 DG  I C5    1 
ATOM   621   C  C6    . DG  A 1  31  ? -2.361  -5.286  10.178 1.00 110.91 ? -42 DG  I C6    1 
ATOM   622   O  O6    . DG  A 1  31  ? -2.685  -6.473  10.078 1.00 116.77 ? -42 DG  I O6    1 
ATOM   623   N  N1    . DG  A 1  31  ? -1.720  -4.652  9.120  1.00 122.04 ? -42 DG  I N1    1 
ATOM   624   C  C2    . DG  A 1  31  ? -1.311  -3.341  9.115  1.00 117.13 ? -42 DG  I C2    1 
ATOM   625   N  N2    . DG  A 1  31  ? -0.702  -2.915  7.998  1.00 110.57 ? -42 DG  I N2    1 
ATOM   626   N  N3    . DG  A 1  31  ? -1.477  -2.513  10.134 1.00 114.83 ? -42 DG  I N3    1 
ATOM   627   C  C4    . DG  A 1  31  ? -2.097  -3.110  11.175 1.00 112.88 ? -42 DG  I C4    1 
ATOM   628   P  P     . DT  A 1  32  ? -3.370  2.742   12.993 1.00 98.54  ? -41 DT  I P     1 
ATOM   629   O  OP1   . DT  A 1  32  ? -2.883  4.134   13.187 1.00 95.05  ? -41 DT  I OP1   1 
ATOM   630   O  OP2   . DT  A 1  32  ? -4.720  2.357   13.486 1.00 101.28 ? -41 DT  I OP2   1 
ATOM   631   O  "O5'" . DT  A 1  32  ? -3.342  2.333   11.450 1.00 104.59 ? -41 DT  I "O5'" 1 
ATOM   632   C  "C5'" . DT  A 1  32  ? -2.091  2.136   10.745 1.00 109.35 ? -41 DT  I "C5'" 1 
ATOM   633   C  "C4'" . DT  A 1  32  ? -2.336  1.920   9.269  1.00 111.87 ? -41 DT  I "C4'" 1 
ATOM   634   O  "O4'" . DT  A 1  32  ? -2.554  0.513   9.000  1.00 113.50 ? -41 DT  I "O4'" 1 
ATOM   635   C  "C3'" . DT  A 1  32  ? -3.558  2.659   8.714  1.00 120.00 ? -41 DT  I "C3'" 1 
ATOM   636   O  "O3'" . DT  A 1  32  ? -3.285  3.285   7.460  1.00 120.39 ? -41 DT  I "O3'" 1 
ATOM   637   C  "C2'" . DT  A 1  32  ? -4.593  1.567   8.530  1.00 118.73 ? -41 DT  I "C2'" 1 
ATOM   638   C  "C1'" . DT  A 1  32  ? -3.735  0.354   8.230  1.00 121.52 ? -41 DT  I "C1'" 1 
ATOM   639   N  N1    . DT  A 1  32  ? -4.359  -0.925  8.608  1.00 122.76 ? -41 DT  I N1    1 
ATOM   640   C  C2    . DT  A 1  32  ? -4.327  -1.957  7.700  1.00 124.55 ? -41 DT  I C2    1 
ATOM   641   O  O2    . DT  A 1  32  ? -3.793  -1.868  6.608  1.00 138.07 ? -41 DT  I O2    1 
ATOM   642   N  N3    . DT  A 1  32  ? -4.942  -3.108  8.121  1.00 129.27 ? -41 DT  I N3    1 
ATOM   643   C  C4    . DT  A 1  32  ? -5.576  -3.321  9.330  1.00 123.52 ? -41 DT  I C4    1 
ATOM   644   O  O4    . DT  A 1  32  ? -6.086  -4.410  9.568  1.00 120.30 ? -41 DT  I O4    1 
ATOM   645   C  C5    . DT  A 1  32  ? -5.583  -2.192  10.230 1.00 115.50 ? -41 DT  I C5    1 
ATOM   646   C  C7    . DT  A 1  32  ? -6.249  -2.329  11.562 1.00 112.95 ? -41 DT  I C7    1 
ATOM   647   C  C6    . DT  A 1  32  ? -4.983  -1.065  9.829  1.00 124.19 ? -41 DT  I C6    1 
ATOM   648   P  P     . DG  A 1  33  ? -4.338  4.314   6.840  1.00 124.13 ? -40 DG  I P     1 
ATOM   649   O  OP1   . DG  A 1  33  ? -3.596  5.548   6.461  1.00 109.47 ? -40 DG  I OP1   1 
ATOM   650   O  OP2   . DG  A 1  33  ? -5.505  4.415   7.762  1.00 119.13 ? -40 DG  I OP2   1 
ATOM   651   O  "O5'" . DG  A 1  33  ? -4.870  3.537   5.555  1.00 130.66 ? -40 DG  I "O5'" 1 
ATOM   652   C  "C5'" . DG  A 1  33  ? -4.002  2.751   4.715  1.00 132.25 ? -40 DG  I "C5'" 1 
ATOM   653   C  "C4'" . DG  A 1  33  ? -4.837  1.969   3.730  1.00 136.05 ? -40 DG  I "C4'" 1 
ATOM   654   O  "O4'" . DG  A 1  33  ? -5.179  0.691   4.321  1.00 135.62 ? -40 DG  I "O4'" 1 
ATOM   655   C  "C3'" . DG  A 1  33  ? -6.174  2.626   3.360  1.00 146.33 ? -40 DG  I "C3'" 1 
ATOM   656   O  "O3'" . DG  A 1  33  ? -6.517  2.364   1.989  1.00 159.36 ? -40 DG  I "O3'" 1 
ATOM   657   C  "C2'" . DG  A 1  33  ? -7.155  1.926   4.280  1.00 146.47 ? -40 DG  I "C2'" 1 
ATOM   658   C  "C1'" . DG  A 1  33  ? -6.587  0.522   4.230  1.00 151.71 ? -40 DG  I "C1'" 1 
ATOM   659   N  N9    . DG  A 1  33  ? -7.020  -0.390  5.287  1.00 163.27 ? -40 DG  I N9    1 
ATOM   660   C  C8    . DG  A 1  33  ? -7.273  -0.086  6.604  1.00 163.60 ? -40 DG  I C8    1 
ATOM   661   N  N7    . DG  A 1  33  ? -7.679  -1.116  7.297  1.00 160.96 ? -40 DG  I N7    1 
ATOM   662   C  C5    . DG  A 1  33  ? -7.713  -2.158  6.380  1.00 155.75 ? -40 DG  I C5    1 
ATOM   663   C  C6    . DG  A 1  33  ? -8.077  -3.522  6.547  1.00 146.20 ? -40 DG  I C6    1 
ATOM   664   O  O6    . DG  A 1  33  ? -8.455  -4.100  7.571  1.00 136.77 ? -40 DG  I O6    1 
ATOM   665   N  N1    . DG  A 1  33  ? -7.965  -4.231  5.356  1.00 138.45 ? -40 DG  I N1    1 
ATOM   666   C  C2    . DG  A 1  33  ? -7.554  -3.702  4.159  1.00 140.47 ? -40 DG  I C2    1 
ATOM   667   N  N2    . DG  A 1  33  ? -7.517  -4.549  3.122  1.00 143.10 ? -40 DG  I N2    1 
ATOM   668   N  N3    . DG  A 1  33  ? -7.216  -2.434  3.988  1.00 150.00 ? -40 DG  I N3    1 
ATOM   669   C  C4    . DG  A 1  33  ? -7.316  -1.725  5.133  1.00 158.98 ? -40 DG  I C4    1 
ATOM   670   P  P     . DT  A 1  34  ? -7.700  3.184   1.250  1.00 168.43 ? -39 DT  I P     1 
ATOM   671   O  OP1   . DT  A 1  34  ? -7.494  3.055   -0.217 1.00 167.59 ? -39 DT  I OP1   1 
ATOM   672   O  OP2   . DT  A 1  34  ? -7.792  4.531   1.870  1.00 171.44 ? -39 DT  I OP2   1 
ATOM   673   O  "O5'" . DT  A 1  34  ? -9.024  2.376   1.624  1.00 165.93 ? -39 DT  I "O5'" 1 
ATOM   674   C  "C5'" . DT  A 1  34  ? -9.985  1.984   0.617  1.00 160.08 ? -39 DT  I "C5'" 1 
ATOM   675   C  "C4'" . DT  A 1  34  ? -9.595  0.657   0.005  1.00 157.41 ? -39 DT  I "C4'" 1 
ATOM   676   O  "O4'" . DT  A 1  34  ? -8.767  -0.083  0.937  1.00 154.29 ? -39 DT  I "O4'" 1 
ATOM   677   C  "C3'" . DT  A 1  34  ? -10.763 -0.268  -0.342 1.00 156.99 ? -39 DT  I "C3'" 1 
ATOM   678   O  "O3'" . DT  A 1  34  ? -11.140 -0.162  -1.723 1.00 150.91 ? -39 DT  I "O3'" 1 
ATOM   679   C  "C2'" . DT  A 1  34  ? -10.219 -1.651  -0.031 1.00 156.15 ? -39 DT  I "C2'" 1 
ATOM   680   C  "C1'" . DT  A 1  34  ? -9.269  -1.401  1.122  1.00 156.25 ? -39 DT  I "C1'" 1 
ATOM   681   N  N1    . DT  A 1  34  ? -9.874  -1.486  2.478  1.00 165.83 ? -39 DT  I N1    1 
ATOM   682   C  C2    . DT  A 1  34  ? -10.271 -2.725  2.936  1.00 162.20 ? -39 DT  I C2    1 
ATOM   683   O  O2    . DT  A 1  34  ? -10.159 -3.748  2.280  1.00 155.93 ? -39 DT  I O2    1 
ATOM   684   N  N3    . DT  A 1  34  ? -10.803 -2.724  4.202  1.00 157.50 ? -39 DT  I N3    1 
ATOM   685   C  C4    . DT  A 1  34  ? -10.976 -1.633  5.035  1.00 160.64 ? -39 DT  I C4    1 
ATOM   686   O  O4    . DT  A 1  34  ? -11.472 -1.787  6.146  1.00 155.81 ? -39 DT  I O4    1 
ATOM   687   C  C5    . DT  A 1  34  ? -10.537 -0.366  4.492  1.00 163.17 ? -39 DT  I C5    1 
ATOM   688   C  C7    . DT  A 1  34  ? -10.680 0.871   5.322  1.00 159.36 ? -39 DT  I C7    1 
ATOM   689   C  C6    . DT  A 1  34  ? -10.014 -0.357  3.258  1.00 166.54 ? -39 DT  I C6    1 
ATOM   690   P  P     . DA  A 1  35  ? -12.249 -1.155  -2.330 1.00 144.03 ? -38 DA  I P     1 
ATOM   691   O  OP1   . DA  A 1  35  ? -12.211 -1.052  -3.807 1.00 131.47 ? -38 DA  I OP1   1 
ATOM   692   O  OP2   . DA  A 1  35  ? -13.522 -0.898  -1.613 1.00 139.53 ? -38 DA  I OP2   1 
ATOM   693   O  "O5'" . DA  A 1  35  ? -11.691 -2.595  -1.932 1.00 146.07 ? -38 DA  I "O5'" 1 
ATOM   694   C  "C5'" . DA  A 1  35  ? -11.786 -3.740  -2.800 1.00 143.02 ? -38 DA  I "C5'" 1 
ATOM   695   C  "C4'" . DA  A 1  35  ? -12.729 -4.766  -2.213 1.00 146.44 ? -38 DA  I "C4'" 1 
ATOM   696   O  "O4'" . DA  A 1  35  ? -12.685 -4.728  -0.760 1.00 149.36 ? -38 DA  I "O4'" 1 
ATOM   697   C  "C3'" . DA  A 1  35  ? -14.204 -4.583  -2.598 1.00 145.63 ? -38 DA  I "C3'" 1 
ATOM   698   O  "O3'" . DA  A 1  35  ? -14.733 -5.836  -3.066 1.00 134.88 ? -38 DA  I "O3'" 1 
ATOM   699   C  "C2'" . DA  A 1  35  ? -14.837 -4.069  -1.315 1.00 148.01 ? -38 DA  I "C2'" 1 
ATOM   700   C  "C1'" . DA  A 1  35  ? -14.017 -4.803  -0.277 1.00 145.08 ? -38 DA  I "C1'" 1 
ATOM   701   N  N9    . DA  A 1  35  ? -14.064 -4.242  1.079  1.00 138.00 ? -38 DA  I N9    1 
ATOM   702   C  C8    . DA  A 1  35  ? -13.718 -2.981  1.501  1.00 137.19 ? -38 DA  I C8    1 
ATOM   703   N  N7    . DA  A 1  35  ? -13.911 -2.781  2.782  1.00 126.75 ? -38 DA  I N7    1 
ATOM   704   C  C5    . DA  A 1  35  ? -14.432 -3.986  3.233  1.00 123.66 ? -38 DA  I C5    1 
ATOM   705   C  C6    . DA  A 1  35  ? -14.847 -4.421  4.504  1.00 119.59 ? -38 DA  I C6    1 
ATOM   706   N  N6    . DA  A 1  35  ? -14.796 -3.662  5.599  1.00 120.70 ? -38 DA  I N6    1 
ATOM   707   N  N1    . DA  A 1  35  ? -15.320 -5.682  4.614  1.00 120.97 ? -38 DA  I N1    1 
ATOM   708   C  C2    . DA  A 1  35  ? -15.366 -6.446  3.515  1.00 122.57 ? -38 DA  I C2    1 
ATOM   709   N  N3    . DA  A 1  35  ? -15.003 -6.151  2.268  1.00 124.56 ? -38 DA  I N3    1 
ATOM   710   C  C4    . DA  A 1  35  ? -14.540 -4.891  2.193  1.00 126.84 ? -38 DA  I C4    1 
ATOM   711   P  P     . DT  A 1  36  ? -16.323 -6.130  -3.051 1.00 140.27 ? -37 DT  I P     1 
ATOM   712   O  OP1   . DT  A 1  36  ? -16.584 -7.302  -3.930 1.00 110.46 ? -37 DT  I OP1   1 
ATOM   713   O  OP2   . DT  A 1  36  ? -17.049 -4.843  -3.271 1.00 112.14 ? -37 DT  I OP2   1 
ATOM   714   O  "O5'" . DT  A 1  36  ? -16.593 -6.584  -1.546 1.00 150.27 ? -37 DT  I "O5'" 1 
ATOM   715   C  "C5'" . DT  A 1  36  ? -16.240 -7.896  -1.052 1.00 144.10 ? -37 DT  I "C5'" 1 
ATOM   716   C  "C4'" . DT  A 1  36  ? -17.264 -8.345  -0.035 1.00 137.46 ? -37 DT  I "C4'" 1 
ATOM   717   O  "O4'" . DT  A 1  36  ? -17.129 -7.557  1.176  1.00 139.65 ? -37 DT  I "O4'" 1 
ATOM   718   C  "C3'" . DT  A 1  36  ? -18.717 -8.180  -0.497 1.00 134.47 ? -37 DT  I "C3'" 1 
ATOM   719   O  "O3'" . DT  A 1  36  ? -19.446 -9.389  -0.239 1.00 129.61 ? -37 DT  I "O3'" 1 
ATOM   720   C  "C2'" . DT  A 1  36  ? -19.193 -6.948  0.255  1.00 136.20 ? -37 DT  I "C2'" 1 
ATOM   721   C  "C1'" . DT  A 1  36  ? -18.398 -7.029  1.545  1.00 142.59 ? -37 DT  I "C1'" 1 
ATOM   722   N  N1    . DT  A 1  36  ? -18.186 -5.729  2.235  1.00 133.95 ? -37 DT  I N1    1 
ATOM   723   C  C2    . DT  A 1  36  ? -18.468 -5.650  3.582  1.00 121.22 ? -37 DT  I C2    1 
ATOM   724   O  O2    . DT  A 1  36  ? -18.853 -6.603  4.241  1.00 105.65 ? -37 DT  I O2    1 
ATOM   725   N  N3    . DT  A 1  36  ? -18.261 -4.409  4.138  1.00 117.84 ? -37 DT  I N3    1 
ATOM   726   C  C4    . DT  A 1  36  ? -17.825 -3.266  3.490  1.00 121.00 ? -37 DT  I C4    1 
ATOM   727   O  O4    . DT  A 1  36  ? -17.684 -2.221  4.121  1.00 105.14 ? -37 DT  I O4    1 
ATOM   728   C  C5    . DT  A 1  36  ? -17.571 -3.417  2.076  1.00 125.50 ? -37 DT  I C5    1 
ATOM   729   C  C7    . DT  A 1  36  ? -17.098 -2.233  1.292  1.00 124.94 ? -37 DT  I C7    1 
ATOM   730   C  C6    . DT  A 1  36  ? -17.766 -4.623  1.526  1.00 131.20 ? -37 DT  I C6    1 
ATOM   731   P  P     . DT  A 1  37  ? -21.052 -9.377  -0.056 1.00 131.92 ? -36 DT  I P     1 
ATOM   732   O  OP1   . DT  A 1  37  ? -21.577 -10.686 -0.510 1.00 110.48 ? -36 DT  I OP1   1 
ATOM   733   O  OP2   . DT  A 1  37  ? -21.600 -8.118  -0.631 1.00 106.92 ? -36 DT  I OP2   1 
ATOM   734   O  "O5'" . DT  A 1  37  ? -21.217 -9.384  1.528  1.00 145.04 ? -36 DT  I "O5'" 1 
ATOM   735   C  "C5'" . DT  A 1  37  ? -20.435 -10.300 2.320  1.00 134.96 ? -36 DT  I "C5'" 1 
ATOM   736   C  "C4'" . DT  A 1  37  ? -20.923 -10.315 3.748  1.00 123.09 ? -36 DT  I "C4'" 1 
ATOM   737   O  "O4'" . DT  A 1  37  ? -20.713 -9.016  4.351  1.00 113.38 ? -36 DT  I "O4'" 1 
ATOM   738   C  "C3'" . DT  A 1  37  ? -22.412 -10.628 3.923  1.00 110.42 ? -36 DT  I "C3'" 1 
ATOM   739   O  "O3'" . DT  A 1  37  ? -22.519 -11.479 5.069  1.00 108.37 ? -36 DT  I "O3'" 1 
ATOM   740   C  "C2'" . DT  A 1  37  ? -23.038 -9.259  4.120  1.00 106.82 ? -36 DT  I "C2'" 1 
ATOM   741   C  "C1'" . DT  A 1  37  ? -21.941 -8.539  4.885  1.00 114.11 ? -36 DT  I "C1'" 1 
ATOM   742   N  N1    . DT  A 1  37  ? -21.928 -7.077  4.777  1.00 110.96 ? -36 DT  I N1    1 
ATOM   743   C  C2    . DT  A 1  37  ? -21.760 -6.343  5.929  1.00 116.54 ? -36 DT  I C2    1 
ATOM   744   O  O2    . DT  A 1  37  ? -21.671 -6.847  7.037  1.00 123.20 ? -36 DT  I O2    1 
ATOM   745   N  N3    . DT  A 1  37  ? -21.712 -4.986  5.738  1.00 118.79 ? -36 DT  I N3    1 
ATOM   746   C  C4    . DT  A 1  37  ? -21.794 -4.310  4.537  1.00 109.77 ? -36 DT  I C4    1 
ATOM   747   O  O4    . DT  A 1  37  ? -21.737 -3.087  4.523  1.00 105.05 ? -36 DT  I O4    1 
ATOM   748   C  C5    . DT  A 1  37  ? -21.948 -5.142  3.368  1.00 111.60 ? -36 DT  I C5    1 
ATOM   749   C  C7    . DT  A 1  37  ? -22.058 -4.495  2.024  1.00 108.18 ? -36 DT  I C7    1 
ATOM   750   C  C6    . DT  A 1  37  ? -21.997 -6.468  3.543  1.00 111.96 ? -36 DT  I C6    1 
ATOM   751   P  P     . DT  A 1  38  ? -23.915 -12.141 5.495  1.00 111.83 ? -35 DT  I P     1 
ATOM   752   O  OP1   . DT  A 1  38  ? -23.618 -13.472 6.090  1.00 105.85 ? -35 DT  I OP1   1 
ATOM   753   O  OP2   . DT  A 1  38  ? -24.852 -12.044 4.344  1.00 99.68  ? -35 DT  I OP2   1 
ATOM   754   O  "O5'" . DT  A 1  38  ? -24.443 -11.170 6.649  1.00 114.11 ? -35 DT  I "O5'" 1 
ATOM   755   C  "C5'" . DT  A 1  38  ? -23.720 -10.979 7.886  1.00 101.84 ? -35 DT  I "C5'" 1 
ATOM   756   C  "C4'" . DT  A 1  38  ? -24.425 -9.971  8.767  1.00 102.50 ? -35 DT  I "C4'" 1 
ATOM   757   O  "O4'" . DT  A 1  38  ? -24.211 -8.626  8.271  1.00 99.60  ? -35 DT  I "O4'" 1 
ATOM   758   C  "C3'" . DT  A 1  38  ? -25.946 -10.141 8.897  1.00 102.97 ? -35 DT  I "C3'" 1 
ATOM   759   O  "O3'" . DT  A 1  38  ? -26.353 -10.092 10.268 1.00 101.25 ? -35 DT  I "O3'" 1 
ATOM   760   C  "C2'" . DT  A 1  38  ? -26.515 -8.909  8.212  1.00 103.22 ? -35 DT  I "C2'" 1 
ATOM   761   C  "C1'" . DT  A 1  38  ? -25.412 -7.900  8.458  1.00 107.46 ? -35 DT  I "C1'" 1 
ATOM   762   N  N1    . DT  A 1  38  ? -25.400 -6.754  7.539  1.00 113.33 ? -35 DT  I N1    1 
ATOM   763   C  C2    . DT  A 1  38  ? -25.469 -5.487  8.073  1.00 121.00 ? -35 DT  I C2    1 
ATOM   764   O  O2    . DT  A 1  38  ? -25.538 -5.272  9.271  1.00 133.17 ? -35 DT  I O2    1 
ATOM   765   N  N3    . DT  A 1  38  ? -25.458 -4.476  7.147  1.00 125.06 ? -35 DT  I N3    1 
ATOM   766   C  C4    . DT  A 1  38  ? -25.387 -4.604  5.773  1.00 125.18 ? -35 DT  I C4    1 
ATOM   767   O  O4    . DT  A 1  38  ? -25.385 -3.600  5.066  1.00 126.89 ? -35 DT  I O4    1 
ATOM   768   C  C5    . DT  A 1  38  ? -25.310 -5.962  5.283  1.00 120.07 ? -35 DT  I C5    1 
ATOM   769   C  C7    . DT  A 1  38  ? -25.237 -6.200  3.808  1.00 119.53 ? -35 DT  I C7    1 
ATOM   770   C  C6    . DT  A 1  38  ? -25.322 -6.955  6.179  1.00 117.00 ? -35 DT  I C6    1 
ATOM   771   P  P     . DG  A 1  39  ? -26.299 -11.409 11.192 1.00 93.14  ? -34 DG  I P     1 
ATOM   772   O  OP1   . DG  A 1  39  ? -25.139 -12.237 10.765 1.00 71.44  ? -34 DG  I OP1   1 
ATOM   773   O  OP2   . DG  A 1  39  ? -27.660 -11.994 11.250 1.00 74.52  ? -34 DG  I OP2   1 
ATOM   774   O  "O5'" . DG  A 1  39  ? -26.035 -10.803 12.639 1.00 84.94  ? -34 DG  I "O5'" 1 
ATOM   775   C  "C5'" . DG  A 1  39  ? -24.792 -10.162 12.942 1.00 82.64  ? -34 DG  I "C5'" 1 
ATOM   776   C  "C4'" . DG  A 1  39  ? -25.039 -8.989  13.858 1.00 81.26  ? -34 DG  I "C4'" 1 
ATOM   777   O  "O4'" . DG  A 1  39  ? -25.531 -7.869  13.092 1.00 83.90  ? -34 DG  I "O4'" 1 
ATOM   778   C  "C3'" . DG  A 1  39  ? -26.077 -9.253  14.944 1.00 76.39  ? -34 DG  I "C3'" 1 
ATOM   779   O  "O3'" . DG  A 1  39  ? -25.609 -8.675  16.165 1.00 70.51  ? -34 DG  I "O3'" 1 
ATOM   780   C  "C2'" . DG  A 1  39  ? -27.351 -8.667  14.364 1.00 84.51  ? -34 DG  I "C2'" 1 
ATOM   781   C  "C1'" . DG  A 1  39  ? -26.857 -7.539  13.475 1.00 86.45  ? -34 DG  I "C1'" 1 
ATOM   782   N  N9    . DG  A 1  39  ? -27.629 -7.330  12.256 1.00 91.02  ? -34 DG  I N9    1 
ATOM   783   C  C8    . DG  A 1  39  ? -28.377 -8.256  11.569 1.00 95.51  ? -34 DG  I C8    1 
ATOM   784   N  N7    . DG  A 1  39  ? -28.948 -7.764  10.503 1.00 102.67 ? -34 DG  I N7    1 
ATOM   785   C  C5    . DG  A 1  39  ? -28.540 -6.438  10.476 1.00 104.00 ? -34 DG  I C5    1 
ATOM   786   C  C6    . DG  A 1  39  ? -28.840 -5.403  9.554  1.00 111.03 ? -34 DG  I C6    1 
ATOM   787   O  O6    . DG  A 1  39  ? -29.546 -5.456  8.539  1.00 125.12 ? -34 DG  I O6    1 
ATOM   788   N  N1    . DG  A 1  39  ? -28.225 -4.208  9.909  1.00 108.85 ? -34 DG  I N1    1 
ATOM   789   C  C2    . DG  A 1  39  ? -27.430 -4.026  11.012 1.00 101.62 ? -34 DG  I C2    1 
ATOM   790   N  N2    . DG  A 1  39  ? -26.924 -2.798  11.181 1.00 102.84 ? -34 DG  I N2    1 
ATOM   791   N  N3    . DG  A 1  39  ? -27.143 -4.982  11.881 1.00 105.87 ? -34 DG  I N3    1 
ATOM   792   C  C4    . DG  A 1  39  ? -27.730 -6.153  11.554 1.00 103.42 ? -34 DG  I C4    1 
ATOM   793   P  P     . DG  A 1  40  ? -26.543 -8.634  17.462 1.00 75.82  ? -33 DG  I P     1 
ATOM   794   O  OP1   . DG  A 1  40  ? -25.657 -8.433  18.622 1.00 84.55  ? -33 DG  I OP1   1 
ATOM   795   O  OP2   . DG  A 1  40  ? -27.477 -9.808  17.443 1.00 65.00  ? -33 DG  I OP2   1 
ATOM   796   O  "O5'" . DG  A 1  40  ? -27.361 -7.289  17.243 1.00 71.98  ? -33 DG  I "O5'" 1 
ATOM   797   C  "C5'" . DG  A 1  40  ? -26.701 -6.010  17.271 1.00 72.39  ? -33 DG  I "C5'" 1 
ATOM   798   C  "C4'" . DG  A 1  40  ? -27.722 -4.907  17.125 1.00 77.78  ? -33 DG  I "C4'" 1 
ATOM   799   O  "O4'" . DG  A 1  40  ? -28.275 -4.966  15.789 1.00 88.02  ? -33 DG  I "O4'" 1 
ATOM   800   C  "C3'" . DG  A 1  40  ? -28.931 -5.008  18.059 1.00 78.42  ? -33 DG  I "C3'" 1 
ATOM   801   O  "O3'" . DG  A 1  40  ? -29.509 -3.720  18.232 1.00 81.68  ? -33 DG  I "O3'" 1 
ATOM   802   C  "C2'" . DG  A 1  40  ? -29.944 -5.750  17.217 1.00 79.50  ? -33 DG  I "C2'" 1 
ATOM   803   C  "C1'" . DG  A 1  40  ? -29.688 -5.038  15.907 1.00 88.10  ? -33 DG  I "C1'" 1 
ATOM   804   N  N9    . DG  A 1  40  ? -30.220 -5.660  14.703 1.00 96.63  ? -33 DG  I N9    1 
ATOM   805   C  C8    . DG  A 1  40  ? -30.530 -6.983  14.495 1.00 93.08  ? -33 DG  I C8    1 
ATOM   806   N  N7    . DG  A 1  40  ? -31.012 -7.213  13.304 1.00 91.64  ? -33 DG  I N7    1 
ATOM   807   C  C5    . DG  A 1  40  ? -31.029 -5.966  12.693 1.00 105.47 ? -33 DG  I C5    1 
ATOM   808   C  C6    . DG  A 1  40  ? -31.446 -5.585  11.389 1.00 106.99 ? -33 DG  I C6    1 
ATOM   809   O  O6    . DG  A 1  40  ? -31.898 -6.299  10.483 1.00 98.59  ? -33 DG  I O6    1 
ATOM   810   N  N1    . DG  A 1  40  ? -31.286 -4.217  11.181 1.00 106.69 ? -33 DG  I N1    1 
ATOM   811   C  C2    . DG  A 1  40  ? -30.792 -3.329  12.108 1.00 110.18 ? -33 DG  I C2    1 
ATOM   812   N  N2    . DG  A 1  40  ? -30.721 -2.047  11.723 1.00 115.77 ? -33 DG  I N2    1 
ATOM   813   N  N3    . DG  A 1  40  ? -30.400 -3.673  13.323 1.00 111.10 ? -33 DG  I N3    1 
ATOM   814   C  C4    . DG  A 1  40  ? -30.546 -4.997  13.546 1.00 104.65 ? -33 DG  I C4    1 
ATOM   815   P  P     . DA  A 1  41  ? -29.559 -3.064  19.658 1.00 91.76  ? -32 DA  I P     1 
ATOM   816   O  OP1   . DA  A 1  41  ? -28.169 -3.029  20.192 1.00 87.05  ? -32 DA  I OP1   1 
ATOM   817   O  OP2   . DA  A 1  41  ? -30.668 -3.710  20.409 1.00 80.20  ? -32 DA  I OP2   1 
ATOM   818   O  "O5'" . DA  A 1  41  ? -29.952 -1.553  19.358 1.00 93.89  ? -32 DA  I "O5'" 1 
ATOM   819   C  "C5'" . DA  A 1  41  ? -29.071 -0.647  18.661 1.00 96.78  ? -32 DA  I "C5'" 1 
ATOM   820   C  "C4'" . DA  A 1  41  ? -29.901 0.230   17.755 1.00 97.58  ? -32 DA  I "C4'" 1 
ATOM   821   O  "O4'" . DA  A 1  41  ? -30.332 -0.580  16.640 1.00 96.43  ? -32 DA  I "O4'" 1 
ATOM   822   C  "C3'" . DA  A 1  41  ? -31.169 0.781   18.422 1.00 107.81 ? -32 DA  I "C3'" 1 
ATOM   823   O  "O3'" . DA  A 1  41  ? -31.056 2.195   18.676 1.00 110.86 ? -32 DA  I "O3'" 1 
ATOM   824   C  "C2'" . DA  A 1  41  ? -32.319 0.315   17.538 1.00 101.46 ? -32 DA  I "C2'" 1 
ATOM   825   C  "C1'" . DA  A 1  41  ? -31.678 -0.306  16.312 1.00 105.89 ? -32 DA  I "C1'" 1 
ATOM   826   N  N9    . DA  A 1  41  ? -32.303 -1.563  15.913 1.00 111.41 ? -32 DA  I N9    1 
ATOM   827   C  C8    . DA  A 1  41  ? -32.445 -2.709  16.657 1.00 111.41 ? -32 DA  I C8    1 
ATOM   828   N  N7    . DA  A 1  41  ? -33.060 -3.677  16.022 1.00 108.18 ? -32 DA  I N7    1 
ATOM   829   C  C5    . DA  A 1  41  ? -33.346 -3.132  14.779 1.00 104.47 ? -32 DA  I C5    1 
ATOM   830   C  C6    . DA  A 1  41  ? -33.988 -3.653  13.643 1.00 103.72 ? -32 DA  I C6    1 
ATOM   831   N  N6    . DA  A 1  41  ? -34.483 -4.889  13.573 1.00 106.11 ? -32 DA  I N6    1 
ATOM   832   N  N1    . DA  A 1  41  ? -34.108 -2.848  12.565 1.00 105.37 ? -32 DA  I N1    1 
ATOM   833   C  C2    . DA  A 1  41  ? -33.612 -1.605  12.634 1.00 109.92 ? -32 DA  I C2    1 
ATOM   834   N  N3    . DA  A 1  41  ? -32.985 -1.004  13.642 1.00 102.53 ? -32 DA  I N3    1 
ATOM   835   C  C4    . DA  A 1  41  ? -32.887 -1.830  14.698 1.00 109.51 ? -32 DA  I C4    1 
ATOM   836   P  P     . DA  A 1  42  ? -32.247 3.201   18.320 1.00 107.07 ? -31 DA  I P     1 
ATOM   837   O  OP1   . DA  A 1  42  ? -31.799 4.563   18.666 1.00 102.01 ? -31 DA  I OP1   1 
ATOM   838   O  OP2   . DA  A 1  42  ? -33.507 2.671   18.915 1.00 98.55  ? -31 DA  I OP2   1 
ATOM   839   O  "O5'" . DA  A 1  42  ? -32.292 3.108   16.730 1.00 112.35 ? -31 DA  I "O5'" 1 
ATOM   840   C  "C5'" . DA  A 1  42  ? -32.762 4.195   15.923 1.00 119.13 ? -31 DA  I "C5'" 1 
ATOM   841   C  "C4'" . DA  A 1  42  ? -34.035 3.793   15.216 1.00 118.48 ? -31 DA  I "C4'" 1 
ATOM   842   O  "O4'" . DA  A 1  42  ? -34.161 2.354   15.158 1.00 110.51 ? -31 DA  I "O4'" 1 
ATOM   843   C  "C3'" . DA  A 1  42  ? -35.323 4.303   15.869 1.00 113.00 ? -31 DA  I "C3'" 1 
ATOM   844   O  "O3'" . DA  A 1  42  ? -36.014 5.134   14.939 1.00 114.29 ? -31 DA  I "O3'" 1 
ATOM   845   C  "C2'" . DA  A 1  42  ? -36.135 3.048   16.136 1.00 111.51 ? -31 DA  I "C2'" 1 
ATOM   846   C  "C1'" . DA  A 1  42  ? -35.541 2.075   15.146 1.00 107.49 ? -31 DA  I "C1'" 1 
ATOM   847   N  N9    . DA  A 1  42  ? -35.726 0.672   15.488 1.00 107.63 ? -31 DA  I N9    1 
ATOM   848   C  C8    . DA  A 1  42  ? -35.485 0.043   16.684 1.00 111.57 ? -31 DA  I C8    1 
ATOM   849   N  N7    . DA  A 1  42  ? -35.762 -1.238  16.671 1.00 108.05 ? -31 DA  I N7    1 
ATOM   850   C  C5    . DA  A 1  42  ? -36.233 -1.464  15.385 1.00 102.85 ? -31 DA  I C5    1 
ATOM   851   C  C6    . DA  A 1  42  ? -36.703 -2.620  14.739 1.00 100.74 ? -31 DA  I C6    1 
ATOM   852   N  N6    . DA  A 1  42  ? -36.784 -3.817  15.324 1.00 99.44  ? -31 DA  I N6    1 
ATOM   853   N  N1    . DA  A 1  42  ? -37.096 -2.504  13.452 1.00 100.96 ? -31 DA  I N1    1 
ATOM   854   C  C2    . DA  A 1  42  ? -37.024 -1.302  12.867 1.00 102.24 ? -31 DA  I C2    1 
ATOM   855   N  N3    . DA  A 1  42  ? -36.605 -0.144  13.370 1.00 104.53 ? -31 DA  I N3    1 
ATOM   856   C  C4    . DA  A 1  42  ? -36.221 -0.295  14.648 1.00 104.79 ? -31 DA  I C4    1 
ATOM   857   P  P     . DA  A 1  43  ? -37.139 6.131   15.454 1.00 117.15 ? -30 DA  I P     1 
ATOM   858   O  OP1   . DA  A 1  43  ? -36.722 7.507   15.074 1.00 110.47 ? -30 DA  I OP1   1 
ATOM   859   O  OP2   . DA  A 1  43  ? -37.423 5.819   16.881 1.00 103.56 ? -30 DA  I OP2   1 
ATOM   860   O  "O5'" . DA  A 1  43  ? -38.425 5.686   14.626 1.00 104.41 ? -30 DA  I "O5'" 1 
ATOM   861   C  "C5'" . DA  A 1  43  ? -38.346 4.837   13.465 1.00 103.37 ? -30 DA  I "C5'" 1 
ATOM   862   C  "C4'" . DA  A 1  43  ? -39.701 4.225   13.208 1.00 108.41 ? -30 DA  I "C4'" 1 
ATOM   863   O  "O4'" . DA  A 1  43  ? -39.630 2.814   13.516 1.00 105.02 ? -30 DA  I "O4'" 1 
ATOM   864   C  "C3'" . DA  A 1  43  ? -40.825 4.775   14.093 1.00 111.44 ? -30 DA  I "C3'" 1 
ATOM   865   O  "O3'" . DA  A 1  43  ? -42.097 4.656   13.435 1.00 122.04 ? -30 DA  I "O3'" 1 
ATOM   866   C  "C2'" . DA  A 1  43  ? -40.751 3.855   15.293 1.00 106.08 ? -30 DA  I "C2'" 1 
ATOM   867   C  "C1'" . DA  A 1  43  ? -40.525 2.536   14.585 1.00 105.47 ? -30 DA  I "C1'" 1 
ATOM   868   N  N9    . DA  A 1  43  ? -39.945 1.478   15.405 1.00 108.95 ? -30 DA  I N9    1 
ATOM   869   C  C8    . DA  A 1  43  ? -39.275 1.578   16.600 1.00 103.65 ? -30 DA  I C8    1 
ATOM   870   N  N7    . DA  A 1  43  ? -38.915 0.422   17.100 1.00 110.64 ? -30 DA  I N7    1 
ATOM   871   C  C5    . DA  A 1  43  ? -39.390 -0.503  16.181 1.00 107.91 ? -30 DA  I C5    1 
ATOM   872   C  C6    . DA  A 1  43  ? -39.333 -1.908  16.132 1.00 111.27 ? -30 DA  I C6    1 
ATOM   873   N  N6    . DA  A 1  43  ? -38.740 -2.656  17.064 1.00 117.18 ? -30 DA  I N6    1 
ATOM   874   N  N1    . DA  A 1  43  ? -39.901 -2.525  15.073 1.00 113.44 ? -30 DA  I N1    1 
ATOM   875   C  C2    . DA  A 1  43  ? -40.498 -1.775  14.139 1.00 108.48 ? -30 DA  I C2    1 
ATOM   876   N  N3    . DA  A 1  43  ? -40.621 -0.450  14.076 1.00 109.43 ? -30 DA  I N3    1 
ATOM   877   C  C4    . DA  A 1  43  ? -40.035 0.133   15.137 1.00 111.21 ? -30 DA  I C4    1 
ATOM   878   P  P     . DC  A 1  44  ? -43.432 5.349   14.048 1.00 121.13 ? -29 DC  I P     1 
ATOM   879   O  OP1   . DC  A 1  44  ? -43.348 6.815   13.800 1.00 115.49 ? -29 DC  I OP1   1 
ATOM   880   O  OP2   . DC  A 1  44  ? -43.654 4.842   15.429 1.00 110.37 ? -29 DC  I OP2   1 
ATOM   881   O  "O5'" . DC  A 1  44  ? -44.601 4.708   13.175 1.00 131.58 ? -29 DC  I "O5'" 1 
ATOM   882   C  "C5'" . DC  A 1  44  ? -44.329 3.690   12.190 1.00 138.11 ? -29 DC  I "C5'" 1 
ATOM   883   C  "C4'" . DC  A 1  44  ? -44.929 2.359   12.589 1.00 142.24 ? -29 DC  I "C4'" 1 
ATOM   884   O  "O4'" . DC  A 1  44  ? -44.043 1.613   13.463 1.00 143.14 ? -29 DC  I "O4'" 1 
ATOM   885   C  "C3'" . DC  A 1  44  ? -46.291 2.394   13.302 1.00 138.67 ? -29 DC  I "C3'" 1 
ATOM   886   O  "O3'" . DC  A 1  44  ? -47.166 1.540   12.545 1.00 137.99 ? -29 DC  I "O3'" 1 
ATOM   887   C  "C2'" . DC  A 1  44  ? -45.971 1.870   14.694 1.00 141.63 ? -29 DC  I "C2'" 1 
ATOM   888   C  "C1'" . DC  A 1  44  ? -44.877 0.888   14.345 1.00 139.06 ? -29 DC  I "C1'" 1 
ATOM   889   N  N1    . DC  A 1  44  ? -44.053 0.355   15.446 1.00 137.78 ? -29 DC  I N1    1 
ATOM   890   C  C2    . DC  A 1  44  ? -43.759 -1.013  15.452 1.00 134.77 ? -29 DC  I C2    1 
ATOM   891   O  O2    . DC  A 1  44  ? -44.193 -1.722  14.533 1.00 119.17 ? -29 DC  I O2    1 
ATOM   892   N  N3    . DC  A 1  44  ? -43.006 -1.525  16.452 1.00 133.37 ? -29 DC  I N3    1 
ATOM   893   C  C4    . DC  A 1  44  ? -42.555 -0.726  17.421 1.00 136.91 ? -29 DC  I C4    1 
ATOM   894   N  N4    . DC  A 1  44  ? -41.811 -1.272  18.385 1.00 141.37 ? -29 DC  I N4    1 
ATOM   895   C  C5    . DC  A 1  44  ? -42.841 0.671   17.441 1.00 138.22 ? -29 DC  I C5    1 
ATOM   896   C  C6    . DC  A 1  44  ? -43.588 1.164   16.444 1.00 138.09 ? -29 DC  I C6    1 
ATOM   897   P  P     . DT  A 1  45  ? -48.474 0.859   13.201 1.00 137.31 ? -28 DT  I P     1 
ATOM   898   O  OP1   . DT  A 1  45  ? -49.351 0.410   12.089 1.00 121.75 ? -28 DT  I OP1   1 
ATOM   899   O  OP2   . DT  A 1  45  ? -49.008 1.780   14.239 1.00 130.68 ? -28 DT  I OP2   1 
ATOM   900   O  "O5'" . DT  A 1  45  ? -47.896 -0.431  13.939 1.00 150.50 ? -28 DT  I "O5'" 1 
ATOM   901   C  "C5'" . DT  A 1  45  ? -47.931 -1.739  13.331 1.00 150.77 ? -28 DT  I "C5'" 1 
ATOM   902   C  "C4'" . DT  A 1  45  ? -48.522 -2.753  14.285 1.00 153.06 ? -28 DT  I "C4'" 1 
ATOM   903   O  "O4'" . DT  A 1  45  ? -47.710 -2.861  15.480 1.00 153.93 ? -28 DT  I "O4'" 1 
ATOM   904   C  "C3'" . DT  A 1  45  ? -49.937 -2.447  14.776 1.00 151.24 ? -28 DT  I "C3'" 1 
ATOM   905   O  "O3'" . DT  A 1  45  ? -50.627 -3.691  14.878 1.00 146.26 ? -28 DT  I "O3'" 1 
ATOM   906   C  "C2'" . DT  A 1  45  ? -49.704 -1.861  16.156 1.00 150.74 ? -28 DT  I "C2'" 1 
ATOM   907   C  "C1'" . DT  A 1  45  ? -48.546 -2.724  16.621 1.00 151.33 ? -28 DT  I "C1'" 1 
ATOM   908   N  N1    . DT  A 1  45  ? -47.715 -2.217  17.732 1.00 144.60 ? -28 DT  I N1    1 
ATOM   909   C  C2    . DT  A 1  45  ? -46.943 -3.137  18.404 1.00 139.16 ? -28 DT  I C2    1 
ATOM   910   O  O2    . DT  A 1  45  ? -46.940 -4.328  18.137 1.00 125.71 ? -28 DT  I O2    1 
ATOM   911   N  N3    . DT  A 1  45  ? -46.175 -2.611  19.413 1.00 136.73 ? -28 DT  I N3    1 
ATOM   912   C  C4    . DT  A 1  45  ? -46.101 -1.287  19.802 1.00 141.87 ? -28 DT  I C4    1 
ATOM   913   O  O4    . DT  A 1  45  ? -45.364 -0.963  20.727 1.00 146.91 ? -28 DT  I O4    1 
ATOM   914   C  C5    . DT  A 1  45  ? -46.933 -0.375  19.050 1.00 142.92 ? -28 DT  I C5    1 
ATOM   915   C  C7    . DT  A 1  45  ? -46.919 1.080   19.402 1.00 139.36 ? -28 DT  I C7    1 
ATOM   916   C  C6    . DT  A 1  45  ? -47.685 -0.878  18.063 1.00 142.63 ? -28 DT  I C6    1 
ATOM   917   P  P     . DG  A 1  46  ? -52.210 -3.729  14.924 1.00 139.41 ? -27 DG  I P     1 
ATOM   918   O  OP1   . DG  A 1  46  ? -52.711 -3.034  13.716 1.00 150.22 ? -27 DG  I OP1   1 
ATOM   919   O  OP2   . DG  A 1  46  ? -52.648 -3.279  16.267 1.00 124.55 ? -27 DG  I OP2   1 
ATOM   920   O  "O5'" . DG  A 1  46  ? -52.528 -5.282  14.773 1.00 139.71 ? -27 DG  I "O5'" 1 
ATOM   921   C  "C5'" . DG  A 1  46  ? -51.474 -6.260  14.645 1.00 141.57 ? -27 DG  I "C5'" 1 
ATOM   922   C  "C4'" . DG  A 1  46  ? -51.277 -7.011  15.944 1.00 139.17 ? -27 DG  I "C4'" 1 
ATOM   923   O  "O4'" . DG  A 1  46  ? -50.549 -6.209  16.908 1.00 142.42 ? -27 DG  I "O4'" 1 
ATOM   924   C  "C3'" . DG  A 1  46  ? -52.562 -7.459  16.654 1.00 134.89 ? -27 DG  I "C3'" 1 
ATOM   925   O  "O3'" . DG  A 1  46  ? -52.413 -8.849  16.969 1.00 120.10 ? -27 DG  I "O3'" 1 
ATOM   926   C  "C2'" . DG  A 1  46  ? -52.626 -6.559  17.879 1.00 133.73 ? -27 DG  I "C2'" 1 
ATOM   927   C  "C1'" . DG  A 1  46  ? -51.153 -6.407  18.175 1.00 136.64 ? -27 DG  I "C1'" 1 
ATOM   928   N  N9    . DG  A 1  46  ? -50.762 -5.304  19.046 1.00 129.34 ? -27 DG  I N9    1 
ATOM   929   C  C8    . DG  A 1  46  ? -51.267 -4.027  19.086 1.00 131.71 ? -27 DG  I C8    1 
ATOM   930   N  N7    . DG  A 1  46  ? -50.691 -3.277  19.986 1.00 129.70 ? -27 DG  I N7    1 
ATOM   931   C  C5    . DG  A 1  46  ? -49.753 -4.112  20.577 1.00 122.71 ? -27 DG  I C5    1 
ATOM   932   C  C6    . DG  A 1  46  ? -48.828 -3.862  21.623 1.00 116.10 ? -27 DG  I C6    1 
ATOM   933   O  O6    . DG  A 1  46  ? -48.642 -2.815  22.257 1.00 103.64 ? -27 DG  I O6    1 
ATOM   934   N  N1    . DG  A 1  46  ? -48.068 -4.990  21.913 1.00 121.73 ? -27 DG  I N1    1 
ATOM   935   C  C2    . DG  A 1  46  ? -48.185 -6.204  21.282 1.00 118.14 ? -27 DG  I C2    1 
ATOM   936   N  N2    . DG  A 1  46  ? -47.360 -7.172  21.701 1.00 118.05 ? -27 DG  I N2    1 
ATOM   937   N  N3    . DG  A 1  46  ? -49.040 -6.448  20.306 1.00 119.60 ? -27 DG  I N3    1 
ATOM   938   C  C4    . DG  A 1  46  ? -49.787 -5.366  20.008 1.00 120.36 ? -27 DG  I C4    1 
ATOM   939   P  P     . DC  A 1  47  ? -53.536 -9.637  17.807 1.00 127.39 ? -26 DC  I P     1 
ATOM   940   O  OP1   . DC  A 1  47  ? -53.664 -10.998 17.221 1.00 107.12 ? -26 DC  I OP1   1 
ATOM   941   O  OP2   . DC  A 1  47  ? -54.738 -8.767  17.946 1.00 117.99 ? -26 DC  I OP2   1 
ATOM   942   O  "O5'" . DC  A 1  47  ? -52.920 -9.693  19.274 1.00 129.13 ? -26 DC  I "O5'" 1 
ATOM   943   C  "C5'" . DC  A 1  47  ? -51.801 -10.533 19.605 1.00 123.46 ? -26 DC  I "C5'" 1 
ATOM   944   C  "C4'" . DC  A 1  47  ? -51.660 -10.592 21.107 1.00 123.93 ? -26 DC  I "C4'" 1 
ATOM   945   O  "O4'" . DC  A 1  47  ? -51.348 -9.269  21.610 1.00 125.85 ? -26 DC  I "O4'" 1 
ATOM   946   C  "C3'" . DC  A 1  47  ? -52.929 -11.035 21.840 1.00 119.54 ? -26 DC  I "C3'" 1 
ATOM   947   O  "O3'" . DC  A 1  47  ? -52.610 -11.902 22.932 1.00 124.65 ? -26 DC  I "O3'" 1 
ATOM   948   C  "C2'" . DC  A 1  47  ? -53.522 -9.732  22.341 1.00 121.22 ? -26 DC  I "C2'" 1 
ATOM   949   C  "C1'" . DC  A 1  47  ? -52.273 -8.919  22.627 1.00 123.32 ? -26 DC  I "C1'" 1 
ATOM   950   N  N1    . DC  A 1  47  ? -52.416 -7.453  22.624 1.00 124.74 ? -26 DC  I N1    1 
ATOM   951   C  C2    . DC  A 1  47  ? -51.397 -6.690  23.201 1.00 133.06 ? -26 DC  I C2    1 
ATOM   952   O  O2    . DC  A 1  47  ? -50.419 -7.272  23.697 1.00 125.53 ? -26 DC  I O2    1 
ATOM   953   N  N3    . DC  A 1  47  ? -51.506 -5.341  23.213 1.00 135.80 ? -26 DC  I N3    1 
ATOM   954   C  C4    . DC  A 1  47  ? -52.573 -4.754  22.667 1.00 126.96 ? -26 DC  I C4    1 
ATOM   955   N  N4    . DC  A 1  47  ? -52.637 -3.421  22.698 1.00 130.88 ? -26 DC  I N4    1 
ATOM   956   C  C5    . DC  A 1  47  ? -53.623 -5.507  22.067 1.00 121.57 ? -26 DC  I C5    1 
ATOM   957   C  C6    . DC  A 1  47  ? -53.505 -6.841  22.067 1.00 120.43 ? -26 DC  I C6    1 
ATOM   958   P  P     . DT  A 1  48  ? -52.987 -13.460 22.864 1.00 121.60 ? -25 DT  I P     1 
ATOM   959   O  OP1   . DT  A 1  48  ? -52.445 -14.026 21.602 1.00 115.65 ? -25 DT  I OP1   1 
ATOM   960   O  OP2   . DT  A 1  48  ? -54.423 -13.602 23.208 1.00 120.67 ? -25 DT  I OP2   1 
ATOM   961   O  "O5'" . DT  A 1  48  ? -52.147 -14.082 24.059 1.00 125.23 ? -25 DT  I "O5'" 1 
ATOM   962   C  "C5'" . DT  A 1  48  ? -52.259 -13.514 25.366 1.00 122.65 ? -25 DT  I "C5'" 1 
ATOM   963   C  "C4'" . DT  A 1  48  ? -50.952 -12.874 25.767 1.00 118.36 ? -25 DT  I "C4'" 1 
ATOM   964   O  "O4'" . DT  A 1  48  ? -50.992 -11.457 25.460 1.00 109.70 ? -25 DT  I "O4'" 1 
ATOM   965   C  "C3'" . DT  A 1  48  ? -50.672 -12.980 27.266 1.00 118.66 ? -25 DT  I "C3'" 1 
ATOM   966   O  "O3'" . DT  A 1  48  ? -49.308 -13.341 27.560 1.00 106.94 ? -25 DT  I "O3'" 1 
ATOM   967   C  "C2'" . DT  A 1  48  ? -51.150 -11.643 27.798 1.00 117.42 ? -25 DT  I "C2'" 1 
ATOM   968   C  "C1'" . DT  A 1  48  ? -50.866 -10.694 26.650 1.00 111.84 ? -25 DT  I "C1'" 1 
ATOM   969   N  N1    . DT  A 1  48  ? -51.794 -9.546  26.566 1.00 114.01 ? -25 DT  I N1    1 
ATOM   970   C  C2    . DT  A 1  48  ? -51.328 -8.333  27.011 1.00 117.60 ? -25 DT  I C2    1 
ATOM   971   O  O2    . DT  A 1  48  ? -50.205 -8.178  27.459 1.00 131.74 ? -25 DT  I O2    1 
ATOM   972   N  N3    . DT  A 1  48  ? -52.226 -7.301  26.910 1.00 124.70 ? -25 DT  I N3    1 
ATOM   973   C  C4    . DT  A 1  48  ? -53.519 -7.362  26.430 1.00 121.88 ? -25 DT  I C4    1 
ATOM   974   O  O4    . DT  A 1  48  ? -54.211 -6.347  26.408 1.00 122.64 ? -25 DT  I O4    1 
ATOM   975   C  C5    . DT  A 1  48  ? -53.949 -8.670  25.988 1.00 120.68 ? -25 DT  I C5    1 
ATOM   976   C  C7    . DT  A 1  48  ? -55.334 -8.834  25.449 1.00 121.55 ? -25 DT  I C7    1 
ATOM   977   C  C6    . DT  A 1  48  ? -53.078 -9.685  26.082 1.00 119.98 ? -25 DT  I C6    1 
ATOM   978   P  P     . DC  A 1  49  ? -48.972 -14.317 28.818 1.00 94.93  ? -24 DC  I P     1 
ATOM   979   O  OP1   . DC  A 1  49  ? -47.657 -14.955 28.580 1.00 81.40  ? -24 DC  I OP1   1 
ATOM   980   O  OP2   . DC  A 1  49  ? -50.164 -15.171 29.082 1.00 87.98  ? -24 DC  I OP2   1 
ATOM   981   O  "O5'" . DC  A 1  49  ? -48.792 -13.304 30.034 1.00 79.80  ? -24 DC  I "O5'" 1 
ATOM   982   C  "C5'" . DC  A 1  49  ? -48.159 -12.022 29.889 1.00 76.53  ? -24 DC  I "C5'" 1 
ATOM   983   C  "C4'" . DC  A 1  49  ? -48.710 -11.101 30.948 1.00 84.51  ? -24 DC  I "C4'" 1 
ATOM   984   O  "O4'" . DC  A 1  49  ? -49.866 -10.386 30.437 1.00 94.17  ? -24 DC  I "O4'" 1 
ATOM   985   C  "C3'" . DC  A 1  49  ? -49.199 -11.844 32.197 1.00 83.40  ? -24 DC  I "C3'" 1 
ATOM   986   O  "O3'" . DC  A 1  49  ? -48.953 -11.092 33.384 1.00 83.84  ? -24 DC  I "O3'" 1 
ATOM   987   C  "C2'" . DC  A 1  49  ? -50.698 -11.884 32.000 1.00 92.25  ? -24 DC  I "C2'" 1 
ATOM   988   C  "C1'" . DC  A 1  49  ? -50.902 -10.511 31.396 1.00 98.66  ? -24 DC  I "C1'" 1 
ATOM   989   N  N1    . DC  A 1  49  ? -52.194 -10.251 30.736 1.00 109.95 ? -24 DC  I N1    1 
ATOM   990   C  C2    . DC  A 1  49  ? -52.618 -8.925  30.608 1.00 112.48 ? -24 DC  I C2    1 
ATOM   991   O  O2    . DC  A 1  49  ? -51.880 -8.018  31.021 1.00 109.39 ? -24 DC  I O2    1 
ATOM   992   N  N3    . DC  A 1  49  ? -53.817 -8.665  30.036 1.00 121.69 ? -24 DC  I N3    1 
ATOM   993   C  C4    . DC  A 1  49  ? -54.582 -9.671  29.604 1.00 114.30 ? -24 DC  I C4    1 
ATOM   994   N  N4    . DC  A 1  49  ? -55.751 -9.370  29.036 1.00 109.94 ? -24 DC  I N4    1 
ATOM   995   C  C5    . DC  A 1  49  ? -54.180 -11.032 29.735 1.00 115.76 ? -24 DC  I C5    1 
ATOM   996   C  C6    . DC  A 1  49  ? -52.997 -11.275 30.316 1.00 113.01 ? -24 DC  I C6    1 
ATOM   997   P  P     . DC  A 1  50  ? -47.492 -11.058 34.024 1.00 80.71  ? -23 DC  I P     1 
ATOM   998   O  OP1   . DC  A 1  50  ? -46.473 -10.990 32.914 1.00 60.83  ? -23 DC  I OP1   1 
ATOM   999   O  OP2   . DC  A 1  50  ? -47.439 -12.126 35.044 1.00 75.69  ? -23 DC  I OP2   1 
ATOM   1000  O  "O5'" . DC  A 1  50  ? -47.461 -9.659  34.780 1.00 70.72  ? -23 DC  I "O5'" 1 
ATOM   1001  C  "C5'" . DC  A 1  50  ? -46.913 -8.498  34.124 1.00 71.40  ? -23 DC  I "C5'" 1 
ATOM   1002  C  "C4'" . DC  A 1  50  ? -47.636 -7.261  34.599 1.00 75.34  ? -23 DC  I "C4'" 1 
ATOM   1003  O  "O4'" . DC  A 1  50  ? -48.956 -7.212  34.001 1.00 81.54  ? -23 DC  I "O4'" 1 
ATOM   1004  C  "C3'" . DC  A 1  50  ? -47.851 -7.221  36.111 1.00 75.54  ? -23 DC  I "C3'" 1 
ATOM   1005  O  "O3'" . DC  A 1  50  ? -47.498 -5.926  36.602 1.00 68.97  ? -23 DC  I "O3'" 1 
ATOM   1006  C  "C2'" . DC  A 1  50  ? -49.314 -7.610  36.275 1.00 83.21  ? -23 DC  I "C2'" 1 
ATOM   1007  C  "C1'" . DC  A 1  50  ? -49.940 -7.047  35.011 1.00 87.54  ? -23 DC  I "C1'" 1 
ATOM   1008  N  N1    . DC  A 1  50  ? -51.192 -7.678  34.536 1.00 91.92  ? -23 DC  I N1    1 
ATOM   1009  C  C2    . DC  A 1  50  ? -52.202 -6.860  34.012 1.00 90.18  ? -23 DC  I C2    1 
ATOM   1010  O  O2    . DC  A 1  50  ? -52.030 -5.633  33.989 1.00 92.74  ? -23 DC  I O2    1 
ATOM   1011  N  N3    . DC  A 1  50  ? -53.341 -7.425  33.554 1.00 98.61  ? -23 DC  I N3    1 
ATOM   1012  C  C4    . DC  A 1  50  ? -53.492 -8.750  33.597 1.00 107.41 ? -23 DC  I C4    1 
ATOM   1013  N  N4    . DC  A 1  50  ? -54.632 -9.263  33.127 1.00 111.88 ? -23 DC  I N4    1 
ATOM   1014  C  C5    . DC  A 1  50  ? -52.474 -9.609  34.110 1.00 104.18 ? -23 DC  I C5    1 
ATOM   1015  C  C6    . DC  A 1  50  ? -51.348 -9.036  34.557 1.00 96.95  ? -23 DC  I C6    1 
ATOM   1016  P  P     . DA  A 1  51  ? -47.485 -5.680  38.168 1.00 78.16  ? -22 DA  I P     1 
ATOM   1017  O  OP1   . DA  A 1  51  ? -46.143 -5.162  38.566 1.00 66.56  ? -22 DA  I OP1   1 
ATOM   1018  O  OP2   . DA  A 1  51  ? -48.076 -6.880  38.808 1.00 62.17  ? -22 DA  I OP2   1 
ATOM   1019  O  "O5'" . DA  A 1  51  ? -48.521 -4.494  38.375 1.00 90.35  ? -22 DA  I "O5'" 1 
ATOM   1020  C  "C5'" . DA  A 1  51  ? -48.460 -3.316  37.563 1.00 93.73  ? -22 DA  I "C5'" 1 
ATOM   1021  C  "C4'" . DA  A 1  51  ? -49.689 -2.474  37.809 1.00 90.46  ? -22 DA  I "C4'" 1 
ATOM   1022  O  "O4'" . DA  A 1  51  ? -50.852 -3.157  37.300 1.00 88.59  ? -22 DA  I "O4'" 1 
ATOM   1023  C  "C3'" . DA  A 1  51  ? -49.990 -2.195  39.279 1.00 88.88  ? -22 DA  I "C3'" 1 
ATOM   1024  O  "O3'" . DA  A 1  51  ? -50.559 -0.897  39.285 1.00 100.31 ? -22 DA  I "O3'" 1 
ATOM   1025  C  "C2'" . DA  A 1  51  ? -50.979 -3.282  39.651 1.00 84.48  ? -22 DA  I "C2'" 1 
ATOM   1026  C  "C1'" . DA  A 1  51  ? -51.756 -3.445  38.359 1.00 95.54  ? -22 DA  I "C1'" 1 
ATOM   1027  N  N9    . DA  A 1  51  ? -52.310 -4.768  38.101 1.00 103.94 ? -22 DA  I N9    1 
ATOM   1028  C  C8    . DA  A 1  51  ? -51.771 -6.002  38.368 1.00 102.73 ? -22 DA  I C8    1 
ATOM   1029  N  N7    . DA  A 1  51  ? -52.509 -7.001  37.951 1.00 108.44 ? -22 DA  I N7    1 
ATOM   1030  C  C5    . DA  A 1  51  ? -53.600 -6.383  37.355 1.00 109.02 ? -22 DA  I C5    1 
ATOM   1031  C  C6    . DA  A 1  51  ? -54.744 -6.892  36.717 1.00 112.74 ? -22 DA  I C6    1 
ATOM   1032  N  N6    . DA  A 1  51  ? -54.992 -8.194  36.571 1.00 113.51 ? -22 DA  I N6    1 
ATOM   1033  N  N1    . DA  A 1  51  ? -55.637 -6.004  36.226 1.00 116.71 ? -22 DA  I N1    1 
ATOM   1034  C  C2    . DA  A 1  51  ? -55.390 -4.696  36.376 1.00 117.41 ? -22 DA  I C2    1 
ATOM   1035  N  N3    . DA  A 1  51  ? -54.352 -4.097  36.956 1.00 114.61 ? -22 DA  I N3    1 
ATOM   1036  C  C4    . DA  A 1  51  ? -53.482 -5.008  37.429 1.00 114.43 ? -22 DA  I C4    1 
ATOM   1037  P  P     . DT  A 1  52  ? -50.889 -0.185  40.643 1.00 114.40 ? -21 DT  I P     1 
ATOM   1038  O  OP1   . DT  A 1  52  ? -50.274 1.170   40.598 1.00 102.20 ? -21 DT  I OP1   1 
ATOM   1039  O  OP2   . DT  A 1  52  ? -50.532 -1.114  41.748 1.00 101.91 ? -21 DT  I OP2   1 
ATOM   1040  O  "O5'" . DT  A 1  52  ? -52.479 -0.071  40.578 1.00 106.98 ? -21 DT  I "O5'" 1 
ATOM   1041  C  "C5'" . DT  A 1  52  ? -53.196 0.027   39.331 1.00 100.34 ? -21 DT  I "C5'" 1 
ATOM   1042  C  "C4'" . DT  A 1  52  ? -54.625 -0.418  39.535 1.00 103.61 ? -21 DT  I "C4'" 1 
ATOM   1043  O  "O4'" . DT  A 1  52  ? -54.743 -1.826  39.232 1.00 103.71 ? -21 DT  I "O4'" 1 
ATOM   1044  C  "C3'" . DT  A 1  52  ? -55.142 -0.251  40.970 1.00 109.36 ? -21 DT  I "C3'" 1 
ATOM   1045  O  "O3'" . DT  A 1  52  ? -56.183 0.730   41.081 1.00 119.49 ? -21 DT  I "O3'" 1 
ATOM   1046  C  "C2'" . DT  A 1  52  ? -55.659 -1.628  41.356 1.00 107.68 ? -21 DT  I "C2'" 1 
ATOM   1047  C  "C1'" . DT  A 1  52  ? -55.787 -2.341  40.029 1.00 103.31 ? -21 DT  I "C1'" 1 
ATOM   1048  N  N1    . DT  A 1  52  ? -55.627 -3.800  40.107 1.00 103.19 ? -21 DT  I N1    1 
ATOM   1049  C  C2    . DT  A 1  52  ? -56.532 -4.586  39.433 1.00 105.17 ? -21 DT  I C2    1 
ATOM   1050  O  O2    . DT  A 1  52  ? -57.443 -4.130  38.765 1.00 102.47 ? -21 DT  I O2    1 
ATOM   1051  N  N3    . DT  A 1  52  ? -56.320 -5.936  39.557 1.00 111.98 ? -21 DT  I N3    1 
ATOM   1052  C  C4    . DT  A 1  52  ? -55.328 -6.561  40.288 1.00 109.22 ? -21 DT  I C4    1 
ATOM   1053  O  O4    . DT  A 1  52  ? -55.273 -7.785  40.319 1.00 107.44 ? -21 DT  I O4    1 
ATOM   1054  C  C5    . DT  A 1  52  ? -54.424 -5.676  40.983 1.00 111.54 ? -21 DT  I C5    1 
ATOM   1055  C  C7    . DT  A 1  52  ? -53.320 -6.264  41.802 1.00 110.09 ? -21 DT  I C7    1 
ATOM   1056  C  C6    . DT  A 1  52  ? -54.615 -4.357  40.858 1.00 109.81 ? -21 DT  I C6    1 
ATOM   1057  P  P     . DC  A 1  53  ? -56.705 1.202   42.539 1.00 118.78 ? -20 DC  I P     1 
ATOM   1058  O  OP1   . DC  A 1  53  ? -56.632 2.686   42.586 1.00 109.85 ? -20 DC  I OP1   1 
ATOM   1059  O  OP2   . DC  A 1  53  ? -55.985 0.424   43.580 1.00 114.69 ? -20 DC  I OP2   1 
ATOM   1060  O  "O5'" . DC  A 1  53  ? -58.201 0.646   42.596 1.00 108.30 ? -20 DC  I "O5'" 1 
ATOM   1061  C  "C5'" . DC  A 1  53  ? -58.895 0.120   41.444 1.00 110.30 ? -20 DC  I "C5'" 1 
ATOM   1062  C  "C4'" . DC  A 1  53  ? -60.011 -0.801  41.883 1.00 122.47 ? -20 DC  I "C4'" 1 
ATOM   1063  O  "O4'" . DC  A 1  53  ? -59.603 -2.187  41.739 1.00 126.86 ? -20 DC  I "O4'" 1 
ATOM   1064  C  "C3'" . DC  A 1  53  ? -60.440 -0.657  43.346 1.00 130.41 ? -20 DC  I "C3'" 1 
ATOM   1065  O  "O3'" . DC  A 1  53  ? -61.835 -0.955  43.475 1.00 140.69 ? -20 DC  I "O3'" 1 
ATOM   1066  C  "C2'" . DC  A 1  53  ? -59.641 -1.747  44.029 1.00 130.98 ? -20 DC  I "C2'" 1 
ATOM   1067  C  "C1'" . DC  A 1  53  ? -59.772 -2.842  42.990 1.00 128.65 ? -20 DC  I "C1'" 1 
ATOM   1068  N  N1    . DC  A 1  53  ? -58.805 -3.951  43.069 1.00 126.31 ? -20 DC  I N1    1 
ATOM   1069  C  C2    . DC  A 1  53  ? -59.068 -5.110  42.336 1.00 122.02 ? -20 DC  I C2    1 
ATOM   1070  O  O2    . DC  A 1  53  ? -60.084 -5.152  41.627 1.00 117.71 ? -20 DC  I O2    1 
ATOM   1071  N  N3    . DC  A 1  53  ? -58.206 -6.151  42.410 1.00 126.76 ? -20 DC  I N3    1 
ATOM   1072  C  C4    . DC  A 1  53  ? -57.119 -6.061  43.180 1.00 125.89 ? -20 DC  I C4    1 
ATOM   1073  N  N4    . DC  A 1  53  ? -56.291 -7.107  43.219 1.00 123.81 ? -20 DC  I N4    1 
ATOM   1074  C  C5    . DC  A 1  53  ? -56.836 -4.897  43.951 1.00 118.92 ? -20 DC  I C5    1 
ATOM   1075  C  C6    . DC  A 1  53  ? -57.700 -3.878  43.871 1.00 123.69 ? -20 DC  I C6    1 
ATOM   1076  P  P     . DA  A 1  54  ? -62.671 -0.448  44.752 1.00 135.19 ? -19 DA  I P     1 
ATOM   1077  O  OP1   . DA  A 1  54  ? -62.970 0.989   44.547 1.00 122.51 ? -19 DA  I OP1   1 
ATOM   1078  O  OP2   . DA  A 1  54  ? -61.973 -0.878  45.994 1.00 128.42 ? -19 DA  I OP2   1 
ATOM   1079  O  "O5'" . DA  A 1  54  ? -64.009 -1.307  44.659 1.00 113.37 ? -19 DA  I "O5'" 1 
ATOM   1080  C  "C5'" . DA  A 1  54  ? -64.471 -1.853  43.411 1.00 116.96 ? -19 DA  I "C5'" 1 
ATOM   1081  C  "C4'" . DA  A 1  54  ? -65.096 -3.206  43.654 1.00 129.79 ? -19 DA  I "C4'" 1 
ATOM   1082  O  "O4'" . DA  A 1  54  ? -64.052 -4.204  43.733 1.00 134.89 ? -19 DA  I "O4'" 1 
ATOM   1083  C  "C3'" . DA  A 1  54  ? -65.874 -3.336  44.963 1.00 134.58 ? -19 DA  I "C3'" 1 
ATOM   1084  O  "O3'" . DA  A 1  54  ? -66.909 -4.305  44.750 1.00 131.85 ? -19 DA  I "O3'" 1 
ATOM   1085  C  "C2'" . DA  A 1  54  ? -64.811 -3.828  45.928 1.00 135.08 ? -19 DA  I "C2'" 1 
ATOM   1086  C  "C1'" . DA  A 1  54  ? -64.043 -4.786  45.033 1.00 139.00 ? -19 DA  I "C1'" 1 
ATOM   1087  N  N9    . DA  A 1  54  ? -62.652 -5.040  45.396 1.00 137.82 ? -19 DA  I N9    1 
ATOM   1088  C  C8    . DA  A 1  54  ? -61.755 -4.210  46.023 1.00 130.86 ? -19 DA  I C8    1 
ATOM   1089  N  N7    . DA  A 1  54  ? -60.563 -4.735  46.168 1.00 128.12 ? -19 DA  I N7    1 
ATOM   1090  C  C5    . DA  A 1  54  ? -60.682 -5.993  45.593 1.00 127.25 ? -19 DA  I C5    1 
ATOM   1091  C  C6    . DA  A 1  54  ? -59.767 -7.045  45.424 1.00 129.01 ? -19 DA  I C6    1 
ATOM   1092  N  N6    . DA  A 1  54  ? -58.502 -6.999  45.845 1.00 134.79 ? -19 DA  I N6    1 
ATOM   1093  N  N1    . DA  A 1  54  ? -60.204 -8.166  44.808 1.00 124.71 ? -19 DA  I N1    1 
ATOM   1094  C  C2    . DA  A 1  54  ? -61.475 -8.215  44.394 1.00 119.34 ? -19 DA  I C2    1 
ATOM   1095  N  N3    . DA  A 1  54  ? -62.427 -7.291  44.492 1.00 128.11 ? -19 DA  I N3    1 
ATOM   1096  C  C4    . DA  A 1  54  ? -61.960 -6.191  45.109 1.00 130.88 ? -19 DA  I C4    1 
ATOM   1097  P  P     . DA  A 1  55  ? -67.983 -4.632  45.892 1.00 130.48 ? -18 DA  I P     1 
ATOM   1098  O  OP1   . DA  A 1  55  ? -69.324 -4.434  45.311 1.00 128.94 ? -18 DA  I OP1   1 
ATOM   1099  O  OP2   . DA  A 1  55  ? -67.600 -3.896  47.128 1.00 122.22 ? -18 DA  I OP2   1 
ATOM   1100  O  "O5'" . DA  A 1  55  ? -67.821 -6.205  46.104 1.00 129.07 ? -18 DA  I "O5'" 1 
ATOM   1101  C  "C5'" . DA  A 1  55  ? -68.077 -7.138  45.029 1.00 126.94 ? -18 DA  I "C5'" 1 
ATOM   1102  C  "C4'" . DA  A 1  55  ? -67.696 -8.544  45.436 1.00 131.41 ? -18 DA  I "C4'" 1 
ATOM   1103  O  "O4'" . DA  A 1  55  ? -66.276 -8.606  45.722 1.00 141.69 ? -18 DA  I "O4'" 1 
ATOM   1104  C  "C3'" . DA  A 1  55  ? -68.397 -9.059  46.693 1.00 134.25 ? -18 DA  I "C3'" 1 
ATOM   1105  O  "O3'" . DA  A 1  55  ? -68.686 -10.452 46.540 1.00 137.10 ? -18 DA  I "O3'" 1 
ATOM   1106  C  "C2'" . DA  A 1  55  ? -67.383 -8.788  47.790 1.00 135.30 ? -18 DA  I "C2'" 1 
ATOM   1107  C  "C1'" . DA  A 1  55  ? -66.069 -9.028  47.065 1.00 140.89 ? -18 DA  I "C1'" 1 
ATOM   1108  N  N9    . DA  A 1  55  ? -64.926 -8.290  47.607 1.00 136.96 ? -18 DA  I N9    1 
ATOM   1109  C  C8    . DA  A 1  55  ? -64.900 -7.030  48.155 1.00 132.78 ? -18 DA  I C8    1 
ATOM   1110  N  N7    . DA  A 1  55  ? -63.714 -6.661  48.575 1.00 118.84 ? -18 DA  I N7    1 
ATOM   1111  C  C5    . DA  A 1  55  ? -62.907 -7.755  48.295 1.00 125.36 ? -18 DA  I C5    1 
ATOM   1112  C  C6    . DA  A 1  55  ? -61.539 -8.000  48.505 1.00 113.84 ? -18 DA  I C6    1 
ATOM   1113  N  N6    . DA  A 1  55  ? -60.707 -7.120  49.066 1.00 101.91 ? -18 DA  I N6    1 
ATOM   1114  N  N1    . DA  A 1  55  ? -61.050 -9.199  48.122 1.00 116.11 ? -18 DA  I N1    1 
ATOM   1115  C  C2    . DA  A 1  55  ? -61.883 -10.080 47.554 1.00 119.37 ? -18 DA  I C2    1 
ATOM   1116  N  N3    . DA  A 1  55  ? -63.185 -9.965  47.301 1.00 126.76 ? -18 DA  I N3    1 
ATOM   1117  C  C4    . DA  A 1  55  ? -63.641 -8.766  47.702 1.00 131.75 ? -18 DA  I C4    1 
ATOM   1118  P  P     . DA  A 1  56  ? -69.297 -11.288 47.762 1.00 137.21 ? -17 DA  I P     1 
ATOM   1119  O  OP1   . DA  A 1  56  ? -70.345 -12.191 47.226 1.00 133.25 ? -17 DA  I OP1   1 
ATOM   1120  O  OP2   . DA  A 1  56  ? -69.616 -10.340 48.862 1.00 129.74 ? -17 DA  I OP2   1 
ATOM   1121  O  "O5'" . DA  A 1  56  ? -68.073 -12.194 48.228 1.00 146.40 ? -17 DA  I "O5'" 1 
ATOM   1122  C  "C5'" . DA  A 1  56  ? -67.681 -13.371 47.490 1.00 133.08 ? -17 DA  I "C5'" 1 
ATOM   1123  C  "C4'" . DA  A 1  56  ? -66.556 -14.076 48.210 1.00 121.95 ? -17 DA  I "C4'" 1 
ATOM   1124  O  "O4'" . DA  A 1  56  ? -65.486 -13.133 48.479 1.00 115.43 ? -17 DA  I "O4'" 1 
ATOM   1125  C  "C3'" . DA  A 1  56  ? -66.948 -14.670 49.568 1.00 117.04 ? -17 DA  I "C3'" 1 
ATOM   1126  O  "O3'" . DA  A 1  56  ? -66.353 -15.966 49.678 1.00 119.79 ? -17 DA  I "O3'" 1 
ATOM   1127  C  "C2'" . DA  A 1  56  ? -66.412 -13.653 50.559 1.00 111.20 ? -17 DA  I "C2'" 1 
ATOM   1128  C  "C1'" . DA  A 1  56  ? -65.149 -13.203 49.858 1.00 117.00 ? -17 DA  I "C1'" 1 
ATOM   1129  N  N9    . DA  A 1  56  ? -64.641 -11.896 50.274 1.00 113.23 ? -17 DA  I N9    1 
ATOM   1130  C  C8    . DA  A 1  56  ? -65.341 -10.734 50.489 1.00 110.32 ? -17 DA  I C8    1 
ATOM   1131  N  N7    . DA  A 1  56  ? -64.590 -9.730  50.872 1.00 108.41 ? -17 DA  I N7    1 
ATOM   1132  C  C5    . DA  A 1  56  ? -63.312 -10.269 50.921 1.00 115.56 ? -17 DA  I C5    1 
ATOM   1133  C  C6    . DA  A 1  56  ? -62.064 -9.717  51.263 1.00 114.67 ? -17 DA  I C6    1 
ATOM   1134  N  N6    . DA  A 1  56  ? -61.891 -8.447  51.630 1.00 118.62 ? -17 DA  I N6    1 
ATOM   1135  N  N1    . DA  A 1  56  ? -60.984 -10.527 51.216 1.00 113.53 ? -17 DA  I N1    1 
ATOM   1136  C  C2    . DA  A 1  56  ? -61.156 -11.803 50.845 1.00 120.99 ? -17 DA  I C2    1 
ATOM   1137  N  N3    . DA  A 1  56  ? -62.277 -12.437 50.504 1.00 117.64 ? -17 DA  I N3    1 
ATOM   1138  C  C4    . DA  A 1  56  ? -63.330 -11.603 50.560 1.00 117.10 ? -17 DA  I C4    1 
ATOM   1139  P  P     . DA  A 1  57  ? -66.496 -16.857 51.022 1.00 132.02 ? -16 DA  I P     1 
ATOM   1140  O  OP1   . DA  A 1  57  ? -67.587 -17.844 50.813 1.00 120.92 ? -16 DA  I OP1   1 
ATOM   1141  O  OP2   . DA  A 1  57  ? -66.524 -15.956 52.219 1.00 104.31 ? -16 DA  I OP2   1 
ATOM   1142  O  "O5'" . DA  A 1  57  ? -65.146 -17.705 51.008 1.00 134.31 ? -16 DA  I "O5'" 1 
ATOM   1143  C  "C5'" . DA  A 1  57  ? -63.999 -17.321 50.204 1.00 120.28 ? -16 DA  I "C5'" 1 
ATOM   1144  C  "C4'" . DA  A 1  57  ? -62.811 -17.040 51.095 1.00 107.99 ? -16 DA  I "C4'" 1 
ATOM   1145  O  "O4'" . DA  A 1  57  ? -62.718 -15.618 51.358 1.00 96.67  ? -16 DA  I "O4'" 1 
ATOM   1146  C  "C3'" . DA  A 1  57  ? -62.867 -17.723 52.470 1.00 108.63 ? -16 DA  I "C3'" 1 
ATOM   1147  O  "O3'" . DA  A 1  57  ? -61.688 -18.474 52.767 1.00 113.59 ? -16 DA  I "O3'" 1 
ATOM   1148  C  "C2'" . DA  A 1  57  ? -62.995 -16.570 53.447 1.00 99.60  ? -16 DA  I "C2'" 1 
ATOM   1149  C  "C1'" . DA  A 1  57  ? -62.288 -15.470 52.694 1.00 101.59 ? -16 DA  I "C1'" 1 
ATOM   1150  N  N9    . DA  A 1  57  ? -62.626 -14.126 53.140 1.00 103.15 ? -16 DA  I N9    1 
ATOM   1151  C  C8    . DA  A 1  57  ? -63.869 -13.558 53.255 1.00 104.89 ? -16 DA  I C8    1 
ATOM   1152  N  N7    . DA  A 1  57  ? -63.848 -12.330 53.713 1.00 109.99 ? -16 DA  I N7    1 
ATOM   1153  C  C5    . DA  A 1  57  ? -62.500 -12.078 53.928 1.00 111.65 ? -16 DA  I C5    1 
ATOM   1154  C  C6    . DA  A 1  57  ? -61.813 -10.950 54.409 1.00 105.88 ? -16 DA  I C6    1 
ATOM   1155  N  N6    . DA  A 1  57  ? -62.412 -9.818  54.774 1.00 107.97 ? -16 DA  I N6    1 
ATOM   1156  N  N1    . DA  A 1  57  ? -60.468 -11.024 54.498 1.00 110.55 ? -16 DA  I N1    1 
ATOM   1157  C  C2    . DA  A 1  57  ? -59.864 -12.157 54.126 1.00 115.21 ? -16 DA  I C2    1 
ATOM   1158  N  N3    . DA  A 1  57  ? -60.399 -13.282 53.656 1.00 118.04 ? -16 DA  I N3    1 
ATOM   1159  C  C4    . DA  A 1  57  ? -61.737 -13.175 53.580 1.00 112.70 ? -16 DA  I C4    1 
ATOM   1160  P  P     . DG  A 1  58  ? -61.686 -19.505 53.996 1.00 119.96 ? -15 DG  I P     1 
ATOM   1161  O  OP1   . DG  A 1  58  ? -60.835 -20.664 53.613 1.00 113.26 ? -15 DG  I OP1   1 
ATOM   1162  O  OP2   . DG  A 1  58  ? -63.094 -19.722 54.419 1.00 101.89 ? -15 DG  I OP2   1 
ATOM   1163  O  "O5'" . DG  A 1  58  ? -60.974 -18.688 55.166 1.00 119.42 ? -15 DG  I "O5'" 1 
ATOM   1164  C  "C5'" . DG  A 1  58  ? -60.000 -17.672 54.867 1.00 124.05 ? -15 DG  I "C5'" 1 
ATOM   1165  C  "C4'" . DG  A 1  58  ? -59.106 -17.408 56.056 1.00 122.98 ? -15 DG  I "C4'" 1 
ATOM   1166  O  "O4'" . DG  A 1  58  ? -59.729 -16.506 57.004 1.00 115.50 ? -15 DG  I "O4'" 1 
ATOM   1167  C  "C3'" . DG  A 1  58  ? -58.690 -18.644 56.861 1.00 122.86 ? -15 DG  I "C3'" 1 
ATOM   1168  O  "O3'" . DG  A 1  58  ? -57.292 -18.527 57.101 1.00 122.95 ? -15 DG  I "O3'" 1 
ATOM   1169  C  "C2'" . DG  A 1  58  ? -59.406 -18.468 58.185 1.00 119.99 ? -15 DG  I "C2'" 1 
ATOM   1170  C  "C1'" . DG  A 1  58  ? -59.377 -16.963 58.295 1.00 124.10 ? -15 DG  I "C1'" 1 
ATOM   1171  N  N9    . DG  A 1  58  ? -60.298 -16.381 59.263 1.00 136.35 ? -15 DG  I N9    1 
ATOM   1172  C  C8    . DG  A 1  58  ? -61.286 -17.024 59.968 1.00 151.63 ? -15 DG  I C8    1 
ATOM   1173  N  N7    . DG  A 1  58  ? -61.923 -16.236 60.791 1.00 162.33 ? -15 DG  I N7    1 
ATOM   1174  C  C5    . DG  A 1  58  ? -61.305 -15.003 60.633 1.00 150.16 ? -15 DG  I C5    1 
ATOM   1175  C  C6    . DG  A 1  58  ? -61.563 -13.754 61.261 1.00 144.20 ? -15 DG  I C6    1 
ATOM   1176  O  O6    . DG  A 1  58  ? -62.417 -13.478 62.112 1.00 131.87 ? -15 DG  I O6    1 
ATOM   1177  N  N1    . DG  A 1  58  ? -60.697 -12.766 60.805 1.00 139.41 ? -15 DG  I N1    1 
ATOM   1178  C  C2    . DG  A 1  58  ? -59.718 -12.948 59.860 1.00 139.17 ? -15 DG  I C2    1 
ATOM   1179  N  N2    . DG  A 1  58  ? -58.989 -11.870 59.546 1.00 136.14 ? -15 DG  I N2    1 
ATOM   1180  N  N3    . DG  A 1  58  ? -59.469 -14.103 59.266 1.00 133.44 ? -15 DG  I N3    1 
ATOM   1181  C  C4    . DG  A 1  58  ? -60.292 -15.080 59.700 1.00 138.67 ? -15 DG  I C4    1 
ATOM   1182  P  P     . DG  A 1  59  ? -56.409 -19.811 57.365 1.00 107.80 ? -14 DG  I P     1 
ATOM   1183  O  OP1   . DG  A 1  59  ? -56.316 -20.569 56.095 1.00 99.89  ? -14 DG  I OP1   1 
ATOM   1184  O  OP2   . DG  A 1  59  ? -56.908 -20.473 58.601 1.00 103.17 ? -14 DG  I OP2   1 
ATOM   1185  O  "O5'" . DG  A 1  59  ? -54.977 -19.170 57.603 1.00 96.73  ? -14 DG  I "O5'" 1 
ATOM   1186  C  "C5'" . DG  A 1  59  ? -54.624 -17.949 56.936 1.00 99.64  ? -14 DG  I "C5'" 1 
ATOM   1187  C  "C4'" . DG  A 1  59  ? -54.353 -16.876 57.962 1.00 99.65  ? -14 DG  I "C4'" 1 
ATOM   1188  O  "O4'" . DG  A 1  59  ? -55.577 -16.505 58.616 1.00 97.10  ? -14 DG  I "O4'" 1 
ATOM   1189  C  "C3'" . DG  A 1  59  ? -53.398 -17.298 59.083 1.00 101.82 ? -14 DG  I "C3'" 1 
ATOM   1190  O  "O3'" . DG  A 1  59  ? -52.076 -16.939 58.648 1.00 96.34  ? -14 DG  I "O3'" 1 
ATOM   1191  C  "C2'" . DG  A 1  59  ? -53.990 -16.663 60.335 1.00 100.66 ? -14 DG  I "C2'" 1 
ATOM   1192  C  "C1'" . DG  A 1  59  ? -55.223 -15.915 59.849 1.00 101.13 ? -14 DG  I "C1'" 1 
ATOM   1193  N  N9    . DG  A 1  59  ? -56.377 -16.001 60.734 1.00 102.87 ? -14 DG  I N9    1 
ATOM   1194  C  C8    . DG  A 1  59  ? -57.184 -17.091 60.956 1.00 104.51 ? -14 DG  I C8    1 
ATOM   1195  N  N7    . DG  A 1  59  ? -58.148 -16.851 61.803 1.00 106.20 ? -14 DG  I N7    1 
ATOM   1196  C  C5    . DG  A 1  59  ? -57.965 -15.523 62.162 1.00 104.03 ? -14 DG  I C5    1 
ATOM   1197  C  C6    . DG  A 1  59  ? -58.703 -14.702 63.053 1.00 104.56 ? -14 DG  I C6    1 
ATOM   1198  O  O6    . DG  A 1  59  ? -59.700 -14.995 63.725 1.00 105.18 ? -14 DG  I O6    1 
ATOM   1199  N  N1    . DG  A 1  59  ? -58.167 -13.420 63.129 1.00 107.20 ? -14 DG  I N1    1 
ATOM   1200  C  C2    . DG  A 1  59  ? -57.067 -12.980 62.431 1.00 109.57 ? -14 DG  I C2    1 
ATOM   1201  N  N2    . DG  A 1  59  ? -56.704 -11.705 62.634 1.00 108.61 ? -14 DG  I N2    1 
ATOM   1202  N  N3    . DG  A 1  59  ? -56.373 -13.735 61.596 1.00 102.54 ? -14 DG  I N3    1 
ATOM   1203  C  C4    . DG  A 1  59  ? -56.875 -14.985 61.512 1.00 103.38 ? -14 DG  I C4    1 
ATOM   1204  P  P     . DC  A 1  60  ? -50.980 -16.298 59.622 1.00 89.71  ? -13 DC  I P     1 
ATOM   1205  O  OP1   . DC  A 1  60  ? -49.815 -15.949 58.768 1.00 83.03  ? -13 DC  I OP1   1 
ATOM   1206  O  OP2   . DC  A 1  60  ? -50.818 -17.190 60.807 1.00 82.89  ? -13 DC  I OP2   1 
ATOM   1207  O  "O5'" . DC  A 1  60  ? -51.673 -14.964 60.148 1.00 83.11  ? -13 DC  I "O5'" 1 
ATOM   1208  C  "C5'" . DC  A 1  60  ? -51.149 -13.667 59.848 1.00 80.76  ? -13 DC  I "C5'" 1 
ATOM   1209  C  "C4'" . DC  A 1  60  ? -51.483 -12.721 60.974 1.00 80.34  ? -13 DC  I "C4'" 1 
ATOM   1210  O  "O4'" . DC  A 1  60  ? -52.717 -13.124 61.619 1.00 91.91  ? -13 DC  I "O4'" 1 
ATOM   1211  C  "C3'" . DC  A 1  60  ? -50.447 -12.661 62.093 1.00 83.50  ? -13 DC  I "C3'" 1 
ATOM   1212  O  "O3'" . DC  A 1  60  ? -50.478 -11.318 62.548 1.00 74.61  ? -13 DC  I "O3'" 1 
ATOM   1213  C  "C2'" . DC  A 1  60  ? -51.036 -13.570 63.156 1.00 89.97  ? -13 DC  I "C2'" 1 
ATOM   1214  C  "C1'" . DC  A 1  60  ? -52.493 -13.185 63.022 1.00 93.50  ? -13 DC  I "C1'" 1 
ATOM   1215  N  N1    . DC  A 1  60  ? -53.484 -14.103 63.598 1.00 96.26  ? -13 DC  I N1    1 
ATOM   1216  C  C2    . DC  A 1  60  ? -54.486 -13.581 64.425 1.00 97.39  ? -13 DC  I C2    1 
ATOM   1217  O  O2    . DC  A 1  60  ? -54.484 -12.365 64.676 1.00 86.30  ? -13 DC  I O2    1 
ATOM   1218  N  N3    . DC  A 1  60  ? -55.418 -14.416 64.942 1.00 95.16  ? -13 DC  I N3    1 
ATOM   1219  C  C4    . DC  A 1  60  ? -55.388 -15.717 64.640 1.00 101.24 ? -13 DC  I C4    1 
ATOM   1220  N  N4    . DC  A 1  60  ? -56.327 -16.503 65.167 1.00 109.86 ? -13 DC  I N4    1 
ATOM   1221  C  C5    . DC  A 1  60  ? -54.384 -16.272 63.794 1.00 101.62 ? -13 DC  I C5    1 
ATOM   1222  C  C6    . DC  A 1  60  ? -53.461 -15.437 63.299 1.00 100.52 ? -13 DC  I C6    1 
ATOM   1223  P  P     . DA  A 1  61  ? -49.232 -10.670 63.252 1.00 77.64  ? -12 DA  I P     1 
ATOM   1224  O  OP1   . DA  A 1  61  ? -48.702 -9.617  62.341 1.00 70.38  ? -12 DA  I OP1   1 
ATOM   1225  O  OP2   . DA  A 1  61  ? -48.388 -11.764 63.788 1.00 77.11  ? -12 DA  I OP2   1 
ATOM   1226  O  "O5'" . DA  A 1  61  ? -49.867 -9.891  64.492 1.00 89.68  ? -12 DA  I "O5'" 1 
ATOM   1227  C  "C5'" . DA  A 1  61  ? -50.667 -8.695  64.296 1.00 85.52  ? -12 DA  I "C5'" 1 
ATOM   1228  C  "C4'" . DA  A 1  61  ? -51.433 -8.366  65.556 1.00 79.60  ? -12 DA  I "C4'" 1 
ATOM   1229  O  "O4'" . DA  A 1  61  ? -52.386 -9.417  65.840 1.00 81.92  ? -12 DA  I "O4'" 1 
ATOM   1230  C  "C3'" . DA  A 1  61  ? -50.552 -8.223  66.797 1.00 80.35  ? -12 DA  I "C3'" 1 
ATOM   1231  O  "O3'" . DA  A 1  61  ? -50.775 -6.942  67.393 1.00 74.23  ? -12 DA  I "O3'" 1 
ATOM   1232  C  "C2'" . DA  A 1  61  ? -50.898 -9.427  67.667 1.00 77.41  ? -12 DA  I "C2'" 1 
ATOM   1233  C  "C1'" . DA  A 1  61  ? -52.265 -9.871  67.182 1.00 82.06  ? -12 DA  I "C1'" 1 
ATOM   1234  N  N9    . DA  A 1  61  ? -52.474 -11.313 67.168 1.00 87.96  ? -12 DA  I N9    1 
ATOM   1235  C  C8    . DA  A 1  61  ? -51.812 -12.232 66.395 1.00 97.62  ? -12 DA  I C8    1 
ATOM   1236  N  N7    . DA  A 1  61  ? -52.242 -13.460 66.550 1.00 101.43 ? -12 DA  I N7    1 
ATOM   1237  C  C5    . DA  A 1  61  ? -53.275 -13.338 67.467 1.00 103.43 ? -12 DA  I C5    1 
ATOM   1238  C  C6    . DA  A 1  61  ? -54.144 -14.279 68.042 1.00 108.86 ? -12 DA  I C6    1 
ATOM   1239  N  N6    . DA  A 1  61  ? -54.103 -15.584 67.773 1.00 119.12 ? -12 DA  I N6    1 
ATOM   1240  N  N1    . DA  A 1  61  ? -55.065 -13.829 68.922 1.00 101.44 ? -12 DA  I N1    1 
ATOM   1241  C  C2    . DA  A 1  61  ? -55.107 -12.517 69.189 1.00 98.40  ? -12 DA  I C2    1 
ATOM   1242  N  N3    . DA  A 1  61  ? -54.347 -11.535 68.710 1.00 98.65  ? -12 DA  I N3    1 
ATOM   1243  C  C4    . DA  A 1  61  ? -53.440 -12.018 67.844 1.00 100.42 ? -12 DA  I C4    1 
ATOM   1244  P  P     . DT  A 1  62  ? -49.766 -6.395  68.506 1.00 86.45  ? -11 DT  I P     1 
ATOM   1245  O  OP1   . DT  A 1  62  ? -49.589 -4.940  68.293 1.00 82.61  ? -11 DT  I OP1   1 
ATOM   1246  O  OP2   . DT  A 1  62  ? -48.569 -7.278  68.514 1.00 90.38  ? -11 DT  I OP2   1 
ATOM   1247  O  "O5'" . DT  A 1  62  ? -50.520 -6.675  69.888 1.00 86.32  ? -11 DT  I "O5'" 1 
ATOM   1248  C  "C5'" . DT  A 1  62  ? -51.954 -6.609  70.029 1.00 82.78  ? -11 DT  I "C5'" 1 
ATOM   1249  C  "C4'" . DT  A 1  62  ? -52.439 -7.469  71.176 1.00 89.01  ? -11 DT  I "C4'" 1 
ATOM   1250  O  "O4'" . DT  A 1  62  ? -52.645 -8.838  70.751 1.00 86.99  ? -11 DT  I "O4'" 1 
ATOM   1251  C  "C3'" . DT  A 1  62  ? -51.544 -7.546  72.421 1.00 85.03  ? -11 DT  I "C3'" 1 
ATOM   1252  O  "O3'" . DT  A 1  62  ? -52.163 -6.857  73.512 1.00 95.57  ? -11 DT  I "O3'" 1 
ATOM   1253  C  "C2'" . DT  A 1  62  ? -51.475 -9.032  72.745 1.00 85.13  ? -11 DT  I "C2'" 1 
ATOM   1254  C  "C1'" . DT  A 1  62  ? -52.593 -9.632  71.915 1.00 89.63  ? -11 DT  I "C1'" 1 
ATOM   1255  N  N1    . DT  A 1  62  ? -52.376 -11.021 71.502 1.00 94.98  ? -11 DT  I N1    1 
ATOM   1256  C  C2    . DT  A 1  62  ? -53.301 -11.968 71.874 1.00 109.36 ? -11 DT  I C2    1 
ATOM   1257  O  O2    . DT  A 1  62  ? -54.291 -11.708 72.538 1.00 114.16 ? -11 DT  I O2    1 
ATOM   1258  N  N3    . DT  A 1  62  ? -53.024 -13.240 71.438 1.00 123.34 ? -11 DT  I N3    1 
ATOM   1259  C  C4    . DT  A 1  62  ? -51.936 -13.646 70.687 1.00 119.22 ? -11 DT  I C4    1 
ATOM   1260  O  O4    . DT  A 1  62  ? -51.820 -14.825 70.371 1.00 119.71 ? -11 DT  I O4    1 
ATOM   1261  C  C5    . DT  A 1  62  ? -51.004 -12.599 70.337 1.00 112.46 ? -11 DT  I C5    1 
ATOM   1262  C  C7    . DT  A 1  62  ? -49.793 -12.942 69.530 1.00 114.49 ? -11 DT  I C7    1 
ATOM   1263  C  C6    . DT  A 1  62  ? -51.271 -11.355 70.751 1.00 109.59 ? -11 DT  I C6    1 
ATOM   1264  P  P     . DG  A 1  63  ? -51.354 -6.584  74.883 1.00 112.87 ? -10 DG  I P     1 
ATOM   1265  O  OP1   . DG  A 1  63  ? -51.293 -5.119  75.078 1.00 103.48 ? -10 DG  I OP1   1 
ATOM   1266  O  OP2   . DG  A 1  63  ? -50.094 -7.375  74.865 1.00 109.39 ? -10 DG  I OP2   1 
ATOM   1267  O  "O5'" . DG  A 1  63  ? -52.296 -7.197  76.016 1.00 98.43  ? -10 DG  I "O5'" 1 
ATOM   1268  C  "C5'" . DG  A 1  63  ? -53.506 -7.922  75.703 1.00 107.00 ? -10 DG  I "C5'" 1 
ATOM   1269  C  "C4'" . DG  A 1  63  ? -53.786 -8.939  76.784 1.00 108.83 ? -10 DG  I "C4'" 1 
ATOM   1270  O  "O4'" . DG  A 1  63  ? -53.613 -10.280 76.266 1.00 118.60 ? -10 DG  I "O4'" 1 
ATOM   1271  C  "C3'" . DG  A 1  63  ? -52.866 -8.843  77.999 1.00 115.42 ? -10 DG  I "C3'" 1 
ATOM   1272  O  "O3'" . DG  A 1  63  ? -53.650 -9.106  79.163 1.00 118.01 ? -10 DG  I "O3'" 1 
ATOM   1273  C  "C2'" . DG  A 1  63  ? -51.802 -9.888  77.713 1.00 117.39 ? -10 DG  I "C2'" 1 
ATOM   1274  C  "C1'" . DG  A 1  63  ? -52.594 -10.964 76.992 1.00 119.55 ? -10 DG  I "C1'" 1 
ATOM   1275  N  N9    . DG  A 1  63  ? -51.827 -11.762 76.040 1.00 118.63 ? -10 DG  I N9    1 
ATOM   1276  C  C8    . DG  A 1  63  ? -50.819 -11.321 75.218 1.00 114.01 ? -10 DG  I C8    1 
ATOM   1277  N  N7    . DG  A 1  63  ? -50.343 -12.257 74.444 1.00 114.61 ? -10 DG  I N7    1 
ATOM   1278  C  C5    . DG  A 1  63  ? -51.081 -13.384 74.774 1.00 114.54 ? -10 DG  I C5    1 
ATOM   1279  C  C6    . DG  A 1  63  ? -51.012 -14.704 74.269 1.00 113.84 ? -10 DG  I C6    1 
ATOM   1280  O  O6    . DG  A 1  63  ? -50.262 -15.155 73.397 1.00 106.17 ? -10 DG  I O6    1 
ATOM   1281  N  N1    . DG  A 1  63  ? -51.939 -15.537 74.885 1.00 118.19 ? -10 DG  I N1    1 
ATOM   1282  C  C2    . DG  A 1  63  ? -52.829 -15.146 75.855 1.00 109.46 ? -10 DG  I C2    1 
ATOM   1283  N  N2    . DG  A 1  63  ? -53.651 -16.094 76.319 1.00 112.88 ? -10 DG  I N2    1 
ATOM   1284  N  N3    . DG  A 1  63  ? -52.908 -13.915 76.331 1.00 102.59 ? -10 DG  I N3    1 
ATOM   1285  C  C4    . DG  A 1  63  ? -52.006 -13.094 75.754 1.00 115.19 ? -10 DG  I C4    1 
ATOM   1286  P  P     . DT  A 1  64  ? -52.979 -9.112  80.600 1.00 114.48 ? -9  DT  I P     1 
ATOM   1287  O  OP1   . DT  A 1  64  ? -53.851 -8.333  81.504 1.00 109.12 ? -9  DT  I OP1   1 
ATOM   1288  O  OP2   . DT  A 1  64  ? -51.555 -8.712  80.446 1.00 110.17 ? -9  DT  I OP2   1 
ATOM   1289  O  "O5'" . DT  A 1  64  ? -53.106 -10.644 81.016 1.00 108.63 ? -9  DT  I "O5'" 1 
ATOM   1290  C  "C5'" . DT  A 1  64  ? -54.267 -11.406 80.627 1.00 108.32 ? -9  DT  I "C5'" 1 
ATOM   1291  C  "C4'" . DT  A 1  64  ? -54.105 -12.844 81.059 1.00 115.95 ? -9  DT  I "C4'" 1 
ATOM   1292  O  "O4'" . DT  A 1  64  ? -53.366 -13.569 80.043 1.00 129.88 ? -9  DT  I "O4'" 1 
ATOM   1293  C  "C3'" . DT  A 1  64  ? -53.329 -13.029 82.365 1.00 114.15 ? -9  DT  I "C3'" 1 
ATOM   1294  O  "O3'" . DT  A 1  64  ? -53.982 -13.996 83.198 1.00 114.16 ? -9  DT  I "O3'" 1 
ATOM   1295  C  "C2'" . DT  A 1  64  ? -51.954 -13.476 81.896 1.00 121.13 ? -9  DT  I "C2'" 1 
ATOM   1296  C  "C1'" . DT  A 1  64  ? -52.294 -14.276 80.650 1.00 122.51 ? -9  DT  I "C1'" 1 
ATOM   1297  N  N1    . DT  A 1  64  ? -51.197 -14.402 79.657 1.00 117.49 ? -9  DT  I N1    1 
ATOM   1298  C  C2    . DT  A 1  64  ? -50.916 -15.642 79.124 1.00 111.50 ? -9  DT  I C2    1 
ATOM   1299  O  O2    . DT  A 1  64  ? -51.532 -16.654 79.419 1.00 107.67 ? -9  DT  I O2    1 
ATOM   1300  N  N3    . DT  A 1  64  ? -49.880 -15.654 78.223 1.00 107.20 ? -9  DT  I N3    1 
ATOM   1301  C  C4    . DT  A 1  64  ? -49.119 -14.576 77.810 1.00 107.28 ? -9  DT  I C4    1 
ATOM   1302  O  O4    . DT  A 1  64  ? -48.218 -14.742 76.993 1.00 105.20 ? -9  DT  I O4    1 
ATOM   1303  C  C5    . DT  A 1  64  ? -49.465 -13.310 78.412 1.00 100.62 ? -9  DT  I C5    1 
ATOM   1304  C  C7    . DT  A 1  64  ? -48.696 -12.087 78.026 1.00 96.81  ? -9  DT  I C7    1 
ATOM   1305  C  C6    . DT  A 1  64  ? -50.472 -13.287 79.292 1.00 111.05 ? -9  DT  I C6    1 
ATOM   1306  P  P     . DT  A 1  65  ? -53.258 -14.544 84.524 1.00 113.94 ? -8  DT  I P     1 
ATOM   1307  O  OP1   . DT  A 1  65  ? -54.295 -15.066 85.451 1.00 111.82 ? -8  DT  I OP1   1 
ATOM   1308  O  OP2   . DT  A 1  65  ? -52.297 -13.510 84.989 1.00 118.99 ? -8  DT  I OP2   1 
ATOM   1309  O  "O5'" . DT  A 1  65  ? -52.455 -15.806 83.989 1.00 110.78 ? -8  DT  I "O5'" 1 
ATOM   1310  C  "C5'" . DT  A 1  65  ? -53.156 -16.906 83.393 1.00 112.06 ? -8  DT  I "C5'" 1 
ATOM   1311  C  "C4'" . DT  A 1  65  ? -52.211 -18.073 83.254 1.00 111.84 ? -8  DT  I "C4'" 1 
ATOM   1312  O  "O4'" . DT  A 1  65  ? -51.305 -17.819 82.156 1.00 109.00 ? -8  DT  I "O4'" 1 
ATOM   1313  C  "C3'" . DT  A 1  65  ? -51.348 -18.309 84.495 1.00 106.55 ? -8  DT  I "C3'" 1 
ATOM   1314  O  "O3'" . DT  A 1  65  ? -51.538 -19.654 84.951 1.00 101.40 ? -8  DT  I "O3'" 1 
ATOM   1315  C  "C2'" . DT  A 1  65  ? -49.936 -17.955 84.046 1.00 109.11 ? -8  DT  I "C2'" 1 
ATOM   1316  C  "C1'" . DT  A 1  65  ? -49.985 -18.148 82.539 1.00 110.77 ? -8  DT  I "C1'" 1 
ATOM   1317  N  N1    . DT  A 1  65  ? -49.066 -17.311 81.736 1.00 114.21 ? -8  DT  I N1    1 
ATOM   1318  C  C2    . DT  A 1  65  ? -48.544 -17.844 80.577 1.00 104.22 ? -8  DT  I C2    1 
ATOM   1319  O  O2    . DT  A 1  65  ? -48.777 -18.981 80.200 1.00 100.74 ? -8  DT  I O2    1 
ATOM   1320  N  N3    . DT  A 1  65  ? -47.728 -16.995 79.875 1.00 100.84 ? -8  DT  I N3    1 
ATOM   1321  C  C4    . DT  A 1  65  ? -47.394 -15.696 80.204 1.00 107.19 ? -8  DT  I C4    1 
ATOM   1322  O  O4    . DT  A 1  65  ? -46.646 -15.054 79.475 1.00 105.28 ? -8  DT  I O4    1 
ATOM   1323  C  C5    . DT  A 1  65  ? -47.989 -15.196 81.420 1.00 117.49 ? -8  DT  I C5    1 
ATOM   1324  C  C7    . DT  A 1  65  ? -47.690 -13.795 81.852 1.00 119.24 ? -8  DT  I C7    1 
ATOM   1325  C  C6    . DT  A 1  65  ? -48.792 -16.014 82.112 1.00 117.41 ? -8  DT  I C6    1 
ATOM   1326  P  P     . DC  A 1  66  ? -50.748 -20.170 86.231 1.00 104.49 ? -7  DC  I P     1 
ATOM   1327  O  OP1   . DC  A 1  66  ? -51.571 -21.208 86.908 1.00 96.15  ? -7  DC  I OP1   1 
ATOM   1328  O  OP2   . DC  A 1  66  ? -50.245 -18.971 86.971 1.00 88.75  ? -7  DC  I OP2   1 
ATOM   1329  O  "O5'" . DC  A 1  66  ? -49.493 -20.923 85.601 1.00 112.28 ? -7  DC  I "O5'" 1 
ATOM   1330  C  "C5'" . DC  A 1  66  ? -49.637 -21.988 84.635 1.00 103.83 ? -7  DC  I "C5'" 1 
ATOM   1331  C  "C4'" . DC  A 1  66  ? -48.269 -22.427 84.167 1.00 95.50  ? -7  DC  I "C4'" 1 
ATOM   1332  O  "O4'" . DC  A 1  66  ? -47.648 -21.349 83.429 1.00 91.10  ? -7  DC  I "O4'" 1 
ATOM   1333  C  "C3'" . DC  A 1  66  ? -47.294 -22.754 85.299 1.00 89.54  ? -7  DC  I "C3'" 1 
ATOM   1334  O  "O3'" . DC  A 1  66  ? -46.385 -23.754 84.882 1.00 86.00  ? -7  DC  I "O3'" 1 
ATOM   1335  C  "C2'" . DC  A 1  66  ? -46.475 -21.491 85.431 1.00 87.22  ? -7  DC  I "C2'" 1 
ATOM   1336  C  "C1'" . DC  A 1  66  ? -46.357 -21.112 83.974 1.00 91.88  ? -7  DC  I "C1'" 1 
ATOM   1337  N  N1    . DC  A 1  66  ? -45.990 -19.721 83.684 1.00 100.40 ? -7  DC  I N1    1 
ATOM   1338  C  C2    . DC  A 1  66  ? -45.727 -19.373 82.357 1.00 102.12 ? -7  DC  I C2    1 
ATOM   1339  O  O2    . DC  A 1  66  ? -45.807 -20.246 81.482 1.00 106.86 ? -7  DC  I O2    1 
ATOM   1340  N  N3    . DC  A 1  66  ? -45.401 -18.095 82.062 1.00 100.89 ? -7  DC  I N3    1 
ATOM   1341  C  C4    . DC  A 1  66  ? -45.318 -17.186 83.035 1.00 100.66 ? -7  DC  I C4    1 
ATOM   1342  N  N4    . DC  A 1  66  ? -44.986 -15.939 82.699 1.00 104.08 ? -7  DC  I N4    1 
ATOM   1343  C  C5    . DC  A 1  66  ? -45.567 -17.518 84.399 1.00 96.27  ? -7  DC  I C5    1 
ATOM   1344  C  C6    . DC  A 1  66  ? -45.896 -18.785 84.676 1.00 97.45  ? -7  DC  I C6    1 
ATOM   1345  P  P     . DA  A 1  67  ? -46.493 -25.195 85.486 1.00 102.58 ? -6  DA  I P     1 
ATOM   1346  O  OP1   . DA  A 1  67  ? -47.931 -25.562 85.492 1.00 103.51 ? -6  DA  I OP1   1 
ATOM   1347  O  OP2   . DA  A 1  67  ? -45.704 -25.210 86.743 1.00 94.56  ? -6  DA  I OP2   1 
ATOM   1348  O  "O5'" . DA  A 1  67  ? -45.777 -26.096 84.381 1.00 107.42 ? -6  DA  I "O5'" 1 
ATOM   1349  C  "C5'" . DA  A 1  67  ? -46.315 -26.180 83.039 1.00 98.73  ? -6  DA  I "C5'" 1 
ATOM   1350  C  "C4'" . DA  A 1  67  ? -45.208 -26.316 82.021 1.00 83.13  ? -6  DA  I "C4'" 1 
ATOM   1351  O  "O4'" . DA  A 1  67  ? -44.520 -25.056 81.875 1.00 75.91  ? -6  DA  I "O4'" 1 
ATOM   1352  C  "C3'" . DA  A 1  67  ? -44.130 -27.324 82.396 1.00 78.93  ? -6  DA  I "C3'" 1 
ATOM   1353  O  "O3'" . DA  A 1  67  ? -43.647 -27.938 81.204 1.00 68.59  ? -6  DA  I "O3'" 1 
ATOM   1354  C  "C2'" . DA  A 1  67  ? -43.090 -26.472 83.103 1.00 75.69  ? -6  DA  I "C2'" 1 
ATOM   1355  C  "C1'" . DA  A 1  67  ? -43.176 -25.169 82.336 1.00 79.14  ? -6  DA  I "C1'" 1 
ATOM   1356  N  N9    . DA  A 1  67  ? -42.870 -23.954 83.082 1.00 77.15  ? -6  DA  I N9    1 
ATOM   1357  C  C8    . DA  A 1  67  ? -43.083 -23.668 84.406 1.00 76.73  ? -6  DA  I C8    1 
ATOM   1358  N  N7    . DA  A 1  67  ? -42.762 -22.441 84.739 1.00 74.82  ? -6  DA  I N7    1 
ATOM   1359  C  C5    . DA  A 1  67  ? -42.331 -21.875 83.549 1.00 84.89  ? -6  DA  I C5    1 
ATOM   1360  C  C6    . DA  A 1  67  ? -41.855 -20.591 83.228 1.00 91.27  ? -6  DA  I C6    1 
ATOM   1361  N  N6    . DA  A 1  67  ? -41.723 -19.606 84.118 1.00 89.79  ? -6  DA  I N6    1 
ATOM   1362  N  N1    . DA  A 1  67  ? -41.506 -20.352 81.945 1.00 91.15  ? -6  DA  I N1    1 
ATOM   1363  C  C2    . DA  A 1  67  ? -41.631 -21.342 81.052 1.00 93.07  ? -6  DA  I C2    1 
ATOM   1364  N  N3    . DA  A 1  67  ? -42.062 -22.590 81.234 1.00 92.99  ? -6  DA  I N3    1 
ATOM   1365  C  C4    . DA  A 1  67  ? -42.401 -22.793 82.518 1.00 87.66  ? -6  DA  I C4    1 
ATOM   1366  P  P     . DG  A 1  68  ? -42.610 -29.138 81.318 1.00 80.63  ? -5  DG  I P     1 
ATOM   1367  O  OP1   . DG  A 1  68  ? -43.139 -30.277 80.539 1.00 83.43  ? -5  DG  I OP1   1 
ATOM   1368  O  OP2   . DG  A 1  68  ? -42.260 -29.318 82.748 1.00 84.65  ? -5  DG  I OP2   1 
ATOM   1369  O  "O5'" . DG  A 1  68  ? -41.300 -28.554 80.626 1.00 76.77  ? -5  DG  I "O5'" 1 
ATOM   1370  C  "C5'" . DG  A 1  68  ? -41.338 -27.363 79.814 1.00 76.22  ? -5  DG  I "C5'" 1 
ATOM   1371  C  "C4'" . DG  A 1  68  ? -39.960 -26.751 79.767 1.00 76.14  ? -5  DG  I "C4'" 1 
ATOM   1372  O  "O4'" . DG  A 1  68  ? -39.918 -25.602 80.645 1.00 75.74  ? -5  DG  I "O4'" 1 
ATOM   1373  C  "C3'" . DG  A 1  68  ? -38.847 -27.677 80.266 1.00 78.94  ? -5  DG  I "C3'" 1 
ATOM   1374  O  "O3'" . DG  A 1  68  ? -37.581 -27.280 79.747 1.00 82.34  ? -5  DG  I "O3'" 1 
ATOM   1375  C  "C2'" . DG  A 1  68  ? -38.736 -27.311 81.726 1.00 74.96  ? -5  DG  I "C2'" 1 
ATOM   1376  C  "C1'" . DG  A 1  68  ? -38.861 -25.813 81.573 1.00 81.25  ? -5  DG  I "C1'" 1 
ATOM   1377  N  N9    . DG  A 1  68  ? -39.162 -25.074 82.784 1.00 88.42  ? -5  DG  I N9    1 
ATOM   1378  C  C8    . DG  A 1  68  ? -39.659 -25.553 83.972 1.00 95.87  ? -5  DG  I C8    1 
ATOM   1379  N  N7    . DG  A 1  68  ? -39.797 -24.625 84.878 1.00 99.93  ? -5  DG  I N7    1 
ATOM   1380  C  C5    . DG  A 1  68  ? -39.347 -23.470 84.255 1.00 98.04  ? -5  DG  I C5    1 
ATOM   1381  C  C6    . DG  A 1  68  ? -39.245 -22.146 84.742 1.00 99.43  ? -5  DG  I C6    1 
ATOM   1382  O  O6    . DG  A 1  68  ? -39.547 -21.712 85.859 1.00 104.17 ? -5  DG  I O6    1 
ATOM   1383  N  N1    . DG  A 1  68  ? -38.729 -21.285 83.779 1.00 103.80 ? -5  DG  I N1    1 
ATOM   1384  C  C2    . DG  A 1  68  ? -38.359 -21.652 82.510 1.00 103.44 ? -5  DG  I C2    1 
ATOM   1385  N  N2    . DG  A 1  68  ? -37.886 -20.676 81.725 1.00 108.27 ? -5  DG  I N2    1 
ATOM   1386  N  N3    . DG  A 1  68  ? -38.447 -22.885 82.044 1.00 100.34 ? -5  DG  I N3    1 
ATOM   1387  C  C4    . DG  A 1  68  ? -38.947 -23.735 82.964 1.00 95.45  ? -5  DG  I C4    1 
ATOM   1388  P  P     . DC  A 1  69  ? -36.862 -28.148 78.643 1.00 81.27  ? -4  DC  I P     1 
ATOM   1389  O  OP1   . DC  A 1  69  ? -37.908 -28.524 77.644 1.00 70.02  ? -4  DC  I OP1   1 
ATOM   1390  O  OP2   . DC  A 1  69  ? -36.055 -29.211 79.326 1.00 64.89  ? -4  DC  I OP2   1 
ATOM   1391  O  "O5'" . DC  A 1  69  ? -35.845 -27.085 78.039 1.00 73.66  ? -4  DC  I "O5'" 1 
ATOM   1392  C  "C5'" . DC  A 1  69  ? -36.334 -26.024 77.207 1.00 72.57  ? -4  DC  I "C5'" 1 
ATOM   1393  C  "C4'" . DC  A 1  69  ? -35.627 -24.739 77.561 1.00 76.13  ? -4  DC  I "C4'" 1 
ATOM   1394  O  "O4'" . DC  A 1  69  ? -35.966 -24.354 78.911 1.00 78.50  ? -4  DC  I "O4'" 1 
ATOM   1395  C  "C3'" . DC  A 1  69  ? -34.103 -24.838 77.508 1.00 74.32  ? -4  DC  I "C3'" 1 
ATOM   1396  O  "O3'" . DC  A 1  69  ? -33.568 -23.861 76.613 1.00 65.80  ? -4  DC  I "O3'" 1 
ATOM   1397  C  "C2'" . DC  A 1  69  ? -33.658 -24.616 78.941 1.00 72.74  ? -4  DC  I "C2'" 1 
ATOM   1398  C  "C1'" . DC  A 1  69  ? -34.815 -23.868 79.562 1.00 74.46  ? -4  DC  I "C1'" 1 
ATOM   1399  N  N1    . DC  A 1  69  ? -34.970 -24.159 80.980 1.00 74.23  ? -4  DC  I N1    1 
ATOM   1400  C  C2    . DC  A 1  69  ? -34.798 -23.139 81.917 1.00 78.67  ? -4  DC  I C2    1 
ATOM   1401  O  O2    . DC  A 1  69  ? -34.522 -21.999 81.520 1.00 79.50  ? -4  DC  I O2    1 
ATOM   1402  N  N3    . DC  A 1  69  ? -34.946 -23.418 83.229 1.00 83.29  ? -4  DC  I N3    1 
ATOM   1403  C  C4    . DC  A 1  69  ? -35.250 -24.658 83.617 1.00 87.25  ? -4  DC  I C4    1 
ATOM   1404  N  N4    . DC  A 1  69  ? -35.388 -24.888 84.923 1.00 97.63  ? -4  DC  I N4    1 
ATOM   1405  C  C5    . DC  A 1  69  ? -35.416 -25.720 82.683 1.00 86.36  ? -4  DC  I C5    1 
ATOM   1406  C  C6    . DC  A 1  69  ? -35.266 -25.429 81.387 1.00 79.20  ? -4  DC  I C6    1 
ATOM   1407  P  P     . DT  A 1  70  ? -32.030 -23.941 76.195 1.00 65.28  ? -3  DT  I P     1 
ATOM   1408  O  OP1   . DT  A 1  70  ? -32.005 -23.793 74.715 1.00 57.64  ? -3  DT  I OP1   1 
ATOM   1409  O  OP2   . DT  A 1  70  ? -31.412 -25.143 76.869 1.00 50.44  ? -3  DT  I OP2   1 
ATOM   1410  O  "O5'" . DT  A 1  70  ? -31.397 -22.677 76.935 1.00 57.85  ? -3  DT  I "O5'" 1 
ATOM   1411  C  "C5'" . DT  A 1  70  ? -32.095 -21.413 76.895 1.00 67.08  ? -3  DT  I "C5'" 1 
ATOM   1412  C  "C4'" . DT  A 1  70  ? -31.459 -20.400 77.819 1.00 68.21  ? -3  DT  I "C4'" 1 
ATOM   1413  O  "O4'" . DT  A 1  70  ? -31.762 -20.703 79.201 1.00 66.67  ? -3  DT  I "O4'" 1 
ATOM   1414  C  "C3'" . DT  A 1  70  ? -29.942 -20.332 77.743 1.00 68.18  ? -3  DT  I "C3'" 1 
ATOM   1415  O  "O3'" . DT  A 1  70  ? -29.597 -18.985 78.012 1.00 73.42  ? -3  DT  I "O3'" 1 
ATOM   1416  C  "C2'" . DT  A 1  70  ? -29.494 -21.234 78.875 1.00 70.12  ? -3  DT  I "C2'" 1 
ATOM   1417  C  "C1'" . DT  A 1  70  ? -30.569 -20.969 79.918 1.00 70.52  ? -3  DT  I "C1'" 1 
ATOM   1418  N  N1    . DT  A 1  70  ? -30.857 -22.053 80.879 1.00 72.32  ? -3  DT  I N1    1 
ATOM   1419  C  C2    . DT  A 1  70  ? -31.178 -21.681 82.165 1.00 71.31  ? -3  DT  I C2    1 
ATOM   1420  O  O2    . DT  A 1  70  ? -31.212 -20.516 82.531 1.00 63.36  ? -3  DT  I O2    1 
ATOM   1421  N  N3    . DT  A 1  70  ? -31.455 -22.727 83.011 1.00 67.59  ? -3  DT  I N3    1 
ATOM   1422  C  C4    . DT  A 1  70  ? -31.443 -24.074 82.704 1.00 74.37  ? -3  DT  I C4    1 
ATOM   1423  O  O4    . DT  A 1  70  ? -31.700 -24.902 83.571 1.00 77.21  ? -3  DT  I O4    1 
ATOM   1424  C  C5    . DT  A 1  70  ? -31.101 -24.391 81.336 1.00 74.42  ? -3  DT  I C5    1 
ATOM   1425  C  C7    . DT  A 1  70  ? -31.066 -25.824 80.913 1.00 76.37  ? -3  DT  I C7    1 
ATOM   1426  C  C6    . DT  A 1  70  ? -30.830 -23.378 80.503 1.00 72.17  ? -3  DT  I C6    1 
ATOM   1427  P  P     . DG  A 1  71  ? -28.218 -18.430 77.518 1.00 65.13  ? -2  DG  I P     1 
ATOM   1428  O  OP1   . DG  A 1  71  ? -28.501 -17.216 76.727 1.00 55.42  ? -2  DG  I OP1   1 
ATOM   1429  O  OP2   . DG  A 1  71  ? -27.444 -19.574 76.998 1.00 57.78  ? -2  DG  I OP2   1 
ATOM   1430  O  "O5'" . DG  A 1  71  ? -27.483 -17.961 78.847 1.00 70.34  ? -2  DG  I "O5'" 1 
ATOM   1431  C  "C5'" . DG  A 1  71  ? -28.167 -17.204 79.856 1.00 74.00  ? -2  DG  I "C5'" 1 
ATOM   1432  C  "C4'" . DG  A 1  71  ? -27.610 -17.571 81.208 1.00 72.15  ? -2  DG  I "C4'" 1 
ATOM   1433  O  "O4'" . DG  A 1  71  ? -28.058 -18.885 81.610 1.00 71.99  ? -2  DG  I "O4'" 1 
ATOM   1434  C  "C3'" . DG  A 1  71  ? -26.086 -17.625 81.257 1.00 70.20  ? -2  DG  I "C3'" 1 
ATOM   1435  O  "O3'" . DG  A 1  71  ? -25.769 -16.907 82.432 1.00 82.77  ? -2  DG  I "O3'" 1 
ATOM   1436  C  "C2'" . DG  A 1  71  ? -25.773 -19.099 81.447 1.00 66.29  ? -2  DG  I "C2'" 1 
ATOM   1437  C  "C1'" . DG  A 1  71  ? -26.974 -19.520 82.247 1.00 68.21  ? -2  DG  I "C1'" 1 
ATOM   1438  N  N9    . DG  A 1  71  ? -27.269 -20.943 82.324 1.00 75.12  ? -2  DG  I N9    1 
ATOM   1439  C  C8    . DG  A 1  71  ? -27.125 -21.901 81.349 1.00 80.63  ? -2  DG  I C8    1 
ATOM   1440  N  N7    . DG  A 1  71  ? -27.496 -23.089 81.743 1.00 76.27  ? -2  DG  I N7    1 
ATOM   1441  C  C5    . DG  A 1  71  ? -27.905 -22.902 83.055 1.00 81.87  ? -2  DG  I C5    1 
ATOM   1442  C  C6    . DG  A 1  71  ? -28.413 -23.827 83.998 1.00 82.39  ? -2  DG  I C6    1 
ATOM   1443  O  O6    . DG  A 1  71  ? -28.605 -25.039 83.860 1.00 86.55  ? -2  DG  I O6    1 
ATOM   1444  N  N1    . DG  A 1  71  ? -28.699 -23.213 85.214 1.00 79.63  ? -2  DG  I N1    1 
ATOM   1445  C  C2    . DG  A 1  71  ? -28.529 -21.876 85.482 1.00 82.87  ? -2  DG  I C2    1 
ATOM   1446  N  N2    . DG  A 1  71  ? -28.870 -21.464 86.711 1.00 83.25  ? -2  DG  I N2    1 
ATOM   1447  N  N3    . DG  A 1  71  ? -28.068 -21.003 84.607 1.00 82.77  ? -2  DG  I N3    1 
ATOM   1448  C  C4    . DG  A 1  71  ? -27.778 -21.581 83.423 1.00 81.16  ? -2  DG  I C4    1 
ATOM   1449  P  P     . DA  A 1  72  ? -24.398 -16.144 82.555 1.00 88.16  ? -1  DA  I P     1 
ATOM   1450  O  OP1   . DA  A 1  72  ? -24.546 -14.864 81.832 1.00 77.49  ? -1  DA  I OP1   1 
ATOM   1451  O  OP2   . DA  A 1  72  ? -23.292 -17.093 82.237 1.00 69.86  ? -1  DA  I OP2   1 
ATOM   1452  O  "O5'" . DA  A 1  72  ? -24.306 -15.878 84.121 1.00 91.30  ? -1  DA  I "O5'" 1 
ATOM   1453  C  "C5'" . DA  A 1  72  ? -25.485 -15.883 84.952 1.00 91.15  ? -1  DA  I "C5'" 1 
ATOM   1454  C  "C4'" . DA  A 1  72  ? -25.173 -16.528 86.280 1.00 85.90  ? -1  DA  I "C4'" 1 
ATOM   1455  O  "O4'" . DA  A 1  72  ? -25.602 -17.909 86.265 1.00 82.89  ? -1  DA  I "O4'" 1 
ATOM   1456  C  "C3'" . DA  A 1  72  ? -23.689 -16.539 86.652 1.00 84.51  ? -1  DA  I "C3'" 1 
ATOM   1457  O  "O3'" . DA  A 1  72  ? -23.549 -16.081 88.002 1.00 103.46 ? -1  DA  I "O3'" 1 
ATOM   1458  C  "C2'" . DA  A 1  72  ? -23.279 -17.990 86.483 1.00 81.51  ? -1  DA  I "C2'" 1 
ATOM   1459  C  "C1'" . DA  A 1  72  ? -24.564 -18.744 86.740 1.00 78.61  ? -1  DA  I "C1'" 1 
ATOM   1460  N  N9    . DA  A 1  72  ? -24.664 -20.006 86.025 1.00 82.67  ? -1  DA  I N9    1 
ATOM   1461  C  C8    . DA  A 1  72  ? -24.407 -20.247 84.699 1.00 87.02  ? -1  DA  I C8    1 
ATOM   1462  N  N7    . DA  A 1  72  ? -24.626 -21.486 84.336 1.00 89.81  ? -1  DA  I N7    1 
ATOM   1463  C  C5    . DA  A 1  72  ? -25.063 -22.101 85.500 1.00 87.69  ? -1  DA  I C5    1 
ATOM   1464  C  C6    . DA  A 1  72  ? -25.467 -23.415 85.781 1.00 84.90  ? -1  DA  I C6    1 
ATOM   1465  N  N6    . DA  A 1  72  ? -25.484 -24.392 84.876 1.00 88.80  ? -1  DA  I N6    1 
ATOM   1466  N  N1    . DA  A 1  72  ? -25.854 -23.697 87.043 1.00 90.39  ? -1  DA  I N1    1 
ATOM   1467  C  C2    . DA  A 1  72  ? -25.842 -22.714 87.952 1.00 88.74  ? -1  DA  I C2    1 
ATOM   1468  N  N3    . DA  A 1  72  ? -25.490 -21.439 87.807 1.00 83.00  ? -1  DA  I N3    1 
ATOM   1469  C  C4    . DA  A 1  72  ? -25.104 -21.197 86.544 1.00 85.29  ? -1  DA  I C4    1 
ATOM   1470  P  P     . DA  A 1  73  ? -22.099 -15.835 88.643 1.00 97.03  ? 0   DA  I P     1 
ATOM   1471  O  OP1   . DA  A 1  73  ? -22.070 -14.460 89.174 1.00 86.97  ? 0   DA  I OP1   1 
ATOM   1472  O  OP2   . DA  A 1  73  ? -21.069 -16.256 87.653 1.00 103.09 ? 0   DA  I OP2   1 
ATOM   1473  O  "O5'" . DA  A 1  73  ? -22.064 -16.860 89.861 1.00 88.60  ? 0   DA  I "O5'" 1 
ATOM   1474  C  "C5'" . DA  A 1  73  ? -23.200 -17.670 90.220 1.00 92.20  ? 0   DA  I "C5'" 1 
ATOM   1475  C  "C4'" . DA  A 1  73  ? -22.736 -18.812 91.092 1.00 97.86  ? 0   DA  I "C4'" 1 
ATOM   1476  O  "O4'" . DA  A 1  73  ? -22.920 -20.067 90.400 1.00 103.35 ? 0   DA  I "O4'" 1 
ATOM   1477  C  "C3'" . DA  A 1  73  ? -21.253 -18.774 91.446 1.00 97.07  ? 0   DA  I "C3'" 1 
ATOM   1478  O  "O3'" . DA  A 1  73  ? -21.095 -19.493 92.662 1.00 106.31 ? 0   DA  I "O3'" 1 
ATOM   1479  C  "C2'" . DA  A 1  73  ? -20.626 -19.551 90.309 1.00 102.56 ? 0   DA  I "C2'" 1 
ATOM   1480  C  "C1'" . DA  A 1  73  ? -21.652 -20.656 90.127 1.00 104.37 ? 0   DA  I "C1'" 1 
ATOM   1481  N  N9    . DA  A 1  73  ? -21.712 -21.249 88.793 1.00 110.15 ? 0   DA  I N9    1 
ATOM   1482  C  C8    . DA  A 1  73  ? -21.458 -20.676 87.571 1.00 104.28 ? 0   DA  I C8    1 
ATOM   1483  N  N7    . DA  A 1  73  ? -21.619 -21.495 86.560 1.00 111.18 ? 0   DA  I N7    1 
ATOM   1484  C  C5    . DA  A 1  73  ? -22.012 -22.686 87.157 1.00 113.59 ? 0   DA  I C5    1 
ATOM   1485  C  C6    . DA  A 1  73  ? -22.336 -23.946 86.630 1.00 114.66 ? 0   DA  I C6    1 
ATOM   1486  N  N6    . DA  A 1  73  ? -22.320 -24.228 85.327 1.00 110.71 ? 0   DA  I N6    1 
ATOM   1487  N  N1    . DA  A 1  73  ? -22.682 -24.921 87.499 1.00 123.81 ? 0   DA  I N1    1 
ATOM   1488  C  C2    . DA  A 1  73  ? -22.700 -24.637 88.808 1.00 114.17 ? 0   DA  I C2    1 
ATOM   1489  N  N3    . DA  A 1  73  ? -22.419 -23.491 89.422 1.00 108.76 ? 0   DA  I N3    1 
ATOM   1490  C  C4    . DA  A 1  73  ? -22.079 -22.546 88.530 1.00 107.61 ? 0   DA  I C4    1 
ATOM   1491  P  P     . DT  A 1  74  ? -19.747 -19.382 93.493 1.00 108.70 ? 1   DT  I P     1 
ATOM   1492  O  OP1   . DT  A 1  74  ? -20.061 -18.671 94.759 1.00 95.23  ? 1   DT  I OP1   1 
ATOM   1493  O  OP2   . DT  A 1  74  ? -18.674 -18.871 92.590 1.00 100.31 ? 1   DT  I OP2   1 
ATOM   1494  O  "O5'" . DT  A 1  74  ? -19.437 -20.902 93.838 1.00 87.47  ? 1   DT  I "O5'" 1 
ATOM   1495  C  "C5'" . DT  A 1  74  ? -20.502 -21.811 94.130 1.00 90.56  ? 1   DT  I "C5'" 1 
ATOM   1496  C  "C4'" . DT  A 1  74  ? -19.991 -23.214 93.935 1.00 97.24  ? 1   DT  I "C4'" 1 
ATOM   1497  O  "O4'" . DT  A 1  74  ? -20.209 -23.616 92.564 1.00 111.82 ? 1   DT  I "O4'" 1 
ATOM   1498  C  "C3'" . DT  A 1  74  ? -18.489 -23.345 94.193 1.00 97.33  ? 1   DT  I "C3'" 1 
ATOM   1499  O  "O3'" . DT  A 1  74  ? -18.309 -24.313 95.220 1.00 101.10 ? 1   DT  I "O3'" 1 
ATOM   1500  C  "C2'" . DT  A 1  74  ? -17.901 -23.734 92.844 1.00 99.86  ? 1   DT  I "C2'" 1 
ATOM   1501  C  "C1'" . DT  A 1  74  ? -19.086 -24.344 92.118 1.00 102.93 ? 1   DT  I "C1'" 1 
ATOM   1502  N  N1    . DT  A 1  74  ? -19.046 -24.247 90.651 1.00 97.92  ? 1   DT  I N1    1 
ATOM   1503  C  C2    . DT  A 1  74  ? -19.294 -25.384 89.916 1.00 99.29  ? 1   DT  I C2    1 
ATOM   1504  O  O2    . DT  A 1  74  ? -19.544 -26.466 90.425 1.00 91.45  ? 1   DT  I O2    1 
ATOM   1505  N  N3    . DT  A 1  74  ? -19.232 -25.209 88.555 1.00 101.08 ? 1   DT  I N3    1 
ATOM   1506  C  C4    . DT  A 1  74  ? -18.967 -24.034 87.875 1.00 100.28 ? 1   DT  I C4    1 
ATOM   1507  O  O4    . DT  A 1  74  ? -18.964 -24.023 86.646 1.00 96.29  ? 1   DT  I O4    1 
ATOM   1508  C  C5    . DT  A 1  74  ? -18.725 -22.880 88.710 1.00 100.98 ? 1   DT  I C5    1 
ATOM   1509  C  C7    . DT  A 1  74  ? -18.424 -21.566 88.062 1.00 99.17  ? 1   DT  I C7    1 
ATOM   1510  C  C6    . DT  A 1  74  ? -18.785 -23.040 90.038 1.00 97.08  ? 1   DT  I C6    1 
ATOM   1511  P  P     . DC  A 1  75  ? -16.856 -24.636 95.736 1.00 102.58 ? 2   DC  I P     1 
ATOM   1512  O  OP1   . DC  A 1  75  ? -16.964 -25.085 97.142 1.00 102.60 ? 2   DC  I OP1   1 
ATOM   1513  O  OP2   . DC  A 1  75  ? -15.985 -23.479 95.390 1.00 101.40 ? 2   DC  I OP2   1 
ATOM   1514  O  "O5'" . DC  A 1  75  ? -16.481 -25.929 94.889 1.00 97.60  ? 2   DC  I "O5'" 1 
ATOM   1515  C  "C5'" . DC  A 1  75  ? -17.356 -27.073 94.899 1.00 101.72 ? 2   DC  I "C5'" 1 
ATOM   1516  C  "C4'" . DC  A 1  75  ? -16.810 -28.127 93.968 1.00 105.50 ? 2   DC  I "C4'" 1 
ATOM   1517  O  "O4'" . DC  A 1  75  ? -17.049 -27.707 92.611 1.00 107.83 ? 2   DC  I "O4'" 1 
ATOM   1518  C  "C3'" . DC  A 1  75  ? -15.301 -28.319 94.094 1.00 102.00 ? 2   DC  I "C3'" 1 
ATOM   1519  O  "O3'" . DC  A 1  75  ? -15.066 -29.523 94.817 1.00 104.11 ? 2   DC  I "O3'" 1 
ATOM   1520  C  "C2'" . DC  A 1  75  ? -14.789 -28.371 92.661 1.00 101.03 ? 2   DC  I "C2'" 1 
ATOM   1521  C  "C1'" . DC  A 1  75  ? -16.010 -28.172 91.775 1.00 99.30  ? 2   DC  I "C1'" 1 
ATOM   1522  N  N1    . DC  A 1  75  ? -15.826 -27.181 90.708 1.00 94.01  ? 2   DC  I N1    1 
ATOM   1523  C  C2    . DC  A 1  75  ? -16.059 -27.565 89.387 1.00 91.56  ? 2   DC  I C2    1 
ATOM   1524  O  O2    . DC  A 1  75  ? -16.394 -28.733 89.155 1.00 89.33  ? 2   DC  I O2    1 
ATOM   1525  N  N3    . DC  A 1  75  ? -15.889 -26.661 88.395 1.00 94.42  ? 2   DC  I N3    1 
ATOM   1526  C  C4    . DC  A 1  75  ? -15.521 -25.411 88.688 1.00 86.92  ? 2   DC  I C4    1 
ATOM   1527  N  N4    . DC  A 1  75  ? -15.375 -24.550 87.681 1.00 76.67  ? 2   DC  I N4    1 
ATOM   1528  C  C5    . DC  A 1  75  ? -15.288 -24.989 90.029 1.00 84.71  ? 2   DC  I C5    1 
ATOM   1529  C  C6    . DC  A 1  75  ? -15.452 -25.898 90.999 1.00 92.59  ? 2   DC  I C6    1 
ATOM   1530  P  P     . DA  A 1  76  ? -13.578 -30.025 95.023 1.00 115.35 ? 3   DA  I P     1 
ATOM   1531  O  OP1   . DA  A 1  76  ? -13.460 -30.583 96.394 1.00 108.48 ? 3   DA  I OP1   1 
ATOM   1532  O  OP2   . DA  A 1  76  ? -12.661 -28.946 94.560 1.00 95.52  ? 3   DA  I OP2   1 
ATOM   1533  O  "O5'" . DA  A 1  76  ? -13.487 -31.268 94.039 1.00 113.32 ? 3   DA  I "O5'" 1 
ATOM   1534  C  "C5'" . DA  A 1  76  ? -14.670 -31.959 93.597 1.00 119.88 ? 3   DA  I "C5'" 1 
ATOM   1535  C  "C4'" . DA  A 1  76  ? -14.323 -32.826 92.410 1.00 122.11 ? 3   DA  I "C4'" 1 
ATOM   1536  O  "O4'" . DA  A 1  76  ? -14.265 -32.013 91.213 1.00 116.63 ? 3   DA  I "O4'" 1 
ATOM   1537  C  "C3'" . DA  A 1  76  ? -12.955 -33.499 92.507 1.00 119.04 ? 3   DA  I "C3'" 1 
ATOM   1538  O  "O3'" . DA  A 1  76  ? -13.022 -34.722 91.782 1.00 113.97 ? 3   DA  I "O3'" 1 
ATOM   1539  C  "C2'" . DA  A 1  76  ? -12.037 -32.506 91.819 1.00 111.22 ? 3   DA  I "C2'" 1 
ATOM   1540  C  "C1'" . DA  A 1  76  ? -12.938 -32.028 90.695 1.00 108.43 ? 3   DA  I "C1'" 1 
ATOM   1541  N  N9    . DA  A 1  76  ? -12.647 -30.698 90.181 1.00 96.08  ? 3   DA  I N9    1 
ATOM   1542  C  C8    . DA  A 1  76  ? -12.106 -29.605 90.812 1.00 93.25  ? 3   DA  I C8    1 
ATOM   1543  N  N7    . DA  A 1  76  ? -12.002 -28.550 90.042 1.00 87.27  ? 3   DA  I N7    1 
ATOM   1544  C  C5    . DA  A 1  76  ? -12.505 -28.978 88.821 1.00 91.71  ? 3   DA  I C5    1 
ATOM   1545  C  C6    . DA  A 1  76  ? -12.657 -28.335 87.583 1.00 78.92  ? 3   DA  I C6    1 
ATOM   1546  N  N6    . DA  A 1  76  ? -12.308 -27.069 87.358 1.00 76.76  ? 3   DA  I N6    1 
ATOM   1547  N  N1    . DA  A 1  76  ? -13.203 -29.042 86.572 1.00 83.81  ? 3   DA  I N1    1 
ATOM   1548  C  C2    . DA  A 1  76  ? -13.559 -30.314 86.796 1.00 88.59  ? 3   DA  I C2    1 
ATOM   1549  N  N3    . DA  A 1  76  ? -13.447 -31.035 87.908 1.00 89.16  ? 3   DA  I N3    1 
ATOM   1550  C  C4    . DA  A 1  76  ? -12.911 -30.297 88.896 1.00 98.89  ? 3   DA  I C4    1 
ATOM   1551  P  P     . DG  A 1  77  ? -11.959 -35.860 92.060 1.00 109.91 ? 4   DG  I P     1 
ATOM   1552  O  OP1   . DG  A 1  77  ? -12.512 -36.735 93.118 1.00 111.93 ? 4   DG  I OP1   1 
ATOM   1553  O  OP2   . DG  A 1  77  ? -10.618 -35.220 92.226 1.00 97.82  ? 4   DG  I OP2   1 
ATOM   1554  O  "O5'" . DG  A 1  77  ? -12.006 -36.732 90.729 1.00 109.88 ? 4   DG  I "O5'" 1 
ATOM   1555  C  "C5'" . DG  A 1  77  ? -13.047 -36.562 89.747 1.00 101.20 ? 4   DG  I "C5'" 1 
ATOM   1556  C  "C4'" . DG  A 1  77  ? -12.421 -36.295 88.400 1.00 90.35  ? 4   DG  I "C4'" 1 
ATOM   1557  O  "O4'" . DG  A 1  77  ? -12.032 -34.905 88.292 1.00 89.71  ? 4   DG  I "O4'" 1 
ATOM   1558  C  "C3'" . DG  A 1  77  ? -11.160 -37.115 88.113 1.00 75.58  ? 4   DG  I "C3'" 1 
ATOM   1559  O  "O3'" . DG  A 1  77  ? -11.406 -37.715 86.847 1.00 72.08  ? 4   DG  I "O3'" 1 
ATOM   1560  C  "C2'" . DG  A 1  77  ? -10.036 -36.092 88.170 1.00 72.52  ? 4   DG  I "C2'" 1 
ATOM   1561  C  "C1'" . DG  A 1  77  ? -10.751 -34.846 87.694 1.00 82.00  ? 4   DG  I "C1'" 1 
ATOM   1562  N  N9    . DG  A 1  77  ? -10.158 -33.553 88.020 1.00 84.19  ? 4   DG  I N9    1 
ATOM   1563  C  C8    . DG  A 1  77  ? -9.405  -33.221 89.121 1.00 88.90  ? 4   DG  I C8    1 
ATOM   1564  N  N7    . DG  A 1  77  ? -9.034  -31.968 89.129 1.00 84.86  ? 4   DG  I N7    1 
ATOM   1565  C  C5    . DG  A 1  77  ? -9.567  -31.444 87.959 1.00 87.73  ? 4   DG  I C5    1 
ATOM   1566  C  C6    . DG  A 1  77  ? -9.487  -30.134 87.419 1.00 90.64  ? 4   DG  I C6    1 
ATOM   1567  O  O6    . DG  A 1  77  ? -8.913  -29.141 87.882 1.00 85.09  ? 4   DG  I O6    1 
ATOM   1568  N  N1    . DG  A 1  77  ? -10.174 -30.036 86.214 1.00 91.40  ? 4   DG  I N1    1 
ATOM   1569  C  C2    . DG  A 1  77  ? -10.835 -31.068 85.596 1.00 88.84  ? 4   DG  I C2    1 
ATOM   1570  N  N2    . DG  A 1  77  ? -11.442 -30.770 84.436 1.00 91.33  ? 4   DG  I N2    1 
ATOM   1571  N  N3    . DG  A 1  77  ? -10.917 -32.293 86.088 1.00 83.40  ? 4   DG  I N3    1 
ATOM   1572  C  C4    . DG  A 1  77  ? -10.268 -32.408 87.266 1.00 88.64  ? 4   DG  I C4    1 
ATOM   1573  P  P     . DC  A 1  78  ? -10.306 -38.599 86.172 1.00 84.66  ? 5   DC  I P     1 
ATOM   1574  O  OP1   . DC  A 1  78  ? -10.821 -39.977 86.060 1.00 80.05  ? 5   DC  I OP1   1 
ATOM   1575  O  OP2   . DC  A 1  78  ? -9.019  -38.345 86.876 1.00 86.84  ? 5   DC  I OP2   1 
ATOM   1576  O  "O5'" . DC  A 1  78  ? -10.281 -38.052 84.672 1.00 96.05  ? 5   DC  I "O5'" 1 
ATOM   1577  C  "C5'" . DC  A 1  78  ? -10.852 -36.781 84.271 1.00 94.00  ? 5   DC  I "C5'" 1 
ATOM   1578  C  "C4'" . DC  A 1  78  ? -9.863  -36.013 83.421 1.00 96.15  ? 5   DC  I "C4'" 1 
ATOM   1579  O  "O4'" . DC  A 1  78  ? -9.305  -34.905 84.168 1.00 88.64  ? 5   DC  I "O4'" 1 
ATOM   1580  C  "C3'" . DC  A 1  78  ? -8.651  -36.813 82.931 1.00 98.06  ? 5   DC  I "C3'" 1 
ATOM   1581  O  "O3'" . DC  A 1  78  ? -8.221  -36.296 81.674 1.00 106.01 ? 5   DC  I "O3'" 1 
ATOM   1582  C  "C2'" . DC  A 1  78  ? -7.559  -36.414 83.899 1.00 92.82  ? 5   DC  I "C2'" 1 
ATOM   1583  C  "C1'" . DC  A 1  78  ? -7.891  -34.949 84.021 1.00 91.46  ? 5   DC  I "C1'" 1 
ATOM   1584  N  N1    . DC  A 1  78  ? -7.297  -34.228 85.144 1.00 92.73  ? 5   DC  I N1    1 
ATOM   1585  C  C2    . DC  A 1  78  ? -7.028  -32.868 84.983 1.00 94.52  ? 5   DC  I C2    1 
ATOM   1586  O  O2    . DC  A 1  78  ? -7.275  -32.334 83.888 1.00 90.23  ? 5   DC  I O2    1 
ATOM   1587  N  N3    . DC  A 1  78  ? -6.503  -32.173 86.017 1.00 92.78  ? 5   DC  I N3    1 
ATOM   1588  C  C4    . DC  A 1  78  ? -6.249  -32.788 87.174 1.00 96.14  ? 5   DC  I C4    1 
ATOM   1589  N  N4    . DC  A 1  78  ? -5.729  -32.065 88.167 1.00 98.14  ? 5   DC  I N4    1 
ATOM   1590  C  C5    . DC  A 1  78  ? -6.518  -34.173 87.365 1.00 95.34  ? 5   DC  I C5    1 
ATOM   1591  C  C6    . DC  A 1  78  ? -7.040  -34.848 86.335 1.00 96.45  ? 5   DC  I C6    1 
ATOM   1592  P  P     . DT  A 1  79  ? -8.031  -37.267 80.446 1.00 101.46 ? 6   DT  I P     1 
ATOM   1593  O  OP1   . DT  A 1  79  ? -9.193  -38.200 80.417 1.00 88.88  ? 6   DT  I OP1   1 
ATOM   1594  O  OP2   . DT  A 1  79  ? -6.597  -37.746 80.453 1.00 63.92  ? 6   DT  I OP2   1 
ATOM   1595  O  "O5'" . DT  A 1  79  ? -8.378  -36.348 79.192 1.00 96.07  ? 6   DT  I "O5'" 1 
ATOM   1596  C  "C5'" . DT  A 1  79  ? -9.245  -35.202 79.288 1.00 82.73  ? 6   DT  I "C5'" 1 
ATOM   1597  C  "C4'" . DT  A 1  79  ? -8.499  -33.967 78.824 1.00 75.99  ? 6   DT  I "C4'" 1 
ATOM   1598  O  "O4'" . DT  A 1  79  ? -7.706  -33.400 79.897 1.00 64.36  ? 6   DT  I "O4'" 1 
ATOM   1599  C  "C3'" . DT  A 1  79  ? -7.513  -34.173 77.668 1.00 68.69  ? 6   DT  I "C3'" 1 
ATOM   1600  O  "O3'" . DT  A 1  79  ? -7.424  -32.925 76.995 1.00 63.35  ? 6   DT  I "O3'" 1 
ATOM   1601  C  "C2'" . DT  A 1  79  ? -6.189  -34.333 78.380 1.00 64.11  ? 6   DT  I "C2'" 1 
ATOM   1602  C  "C1'" . DT  A 1  79  ? -6.368  -33.258 79.429 1.00 70.48  ? 6   DT  I "C1'" 1 
ATOM   1603  N  N1    . DT  A 1  79  ? -5.476  -33.303 80.586 1.00 73.52  ? 6   DT  I N1    1 
ATOM   1604  C  C2    . DT  A 1  79  ? -5.171  -32.107 81.189 1.00 79.40  ? 6   DT  I C2    1 
ATOM   1605  O  O2    . DT  A 1  79  ? -5.595  -31.034 80.794 1.00 83.87  ? 6   DT  I O2    1 
ATOM   1606  N  N3    . DT  A 1  79  ? -4.346  -32.210 82.277 1.00 87.77  ? 6   DT  I N3    1 
ATOM   1607  C  C4    . DT  A 1  79  ? -3.810  -33.363 82.810 1.00 86.29  ? 6   DT  I C4    1 
ATOM   1608  O  O4    . DT  A 1  79  ? -3.074  -33.295 83.789 1.00 97.20  ? 6   DT  I O4    1 
ATOM   1609  C  C5    . DT  A 1  79  ? -4.174  -34.584 82.127 1.00 82.08  ? 6   DT  I C5    1 
ATOM   1610  C  C7    . DT  A 1  79  ? -3.633  -35.887 82.625 1.00 73.11  ? 6   DT  I C7    1 
ATOM   1611  C  C6    . DT  A 1  79  ? -4.981  -34.494 81.065 1.00 79.31  ? 6   DT  I C6    1 
ATOM   1612  P  P     . DG  A 1  80  ? -7.326  -32.845 75.447 1.00 60.87  ? 7   DG  I P     1 
ATOM   1613  O  OP1   . DG  A 1  80  ? -8.675  -32.514 74.951 1.00 58.05  ? 7   DG  I OP1   1 
ATOM   1614  O  OP2   . DG  A 1  80  ? -6.526  -34.001 74.946 1.00 57.72  ? 7   DG  I OP2   1 
ATOM   1615  O  "O5'" . DG  A 1  80  ? -6.322  -31.634 75.213 1.00 55.93  ? 7   DG  I "O5'" 1 
ATOM   1616  C  "C5'" . DG  A 1  80  ? -6.549  -30.372 75.851 1.00 52.50  ? 7   DG  I "C5'" 1 
ATOM   1617  C  "C4'" . DG  A 1  80  ? -5.242  -29.728 76.246 1.00 49.57  ? 7   DG  I "C4'" 1 
ATOM   1618  O  "O4'" . DG  A 1  80  ? -4.722  -30.396 77.409 1.00 51.01  ? 7   DG  I "O4'" 1 
ATOM   1619  C  "C3'" . DG  A 1  80  ? -4.119  -29.745 75.195 1.00 51.53  ? 7   DG  I "C3'" 1 
ATOM   1620  O  "O3'" . DG  A 1  80  ? -3.617  -28.403 75.136 1.00 53.40  ? 7   DG  I "O3'" 1 
ATOM   1621  C  "C2'" . DG  A 1  80  ? -3.120  -30.744 75.746 1.00 47.87  ? 7   DG  I "C2'" 1 
ATOM   1622  C  "C1'" . DG  A 1  80  ? -3.327  -30.563 77.229 1.00 55.33  ? 7   DG  I "C1'" 1 
ATOM   1623  N  N9    . DG  A 1  80  ? -2.889  -31.666 78.070 1.00 58.84  ? 7   DG  I N9    1 
ATOM   1624  C  C8    . DG  A 1  80  ? -3.020  -33.015 77.844 1.00 62.53  ? 7   DG  I C8    1 
ATOM   1625  N  N7    . DG  A 1  80  ? -2.506  -33.746 78.794 1.00 54.43  ? 7   DG  I N7    1 
ATOM   1626  C  C5    . DG  A 1  80  ? -2.008  -32.822 79.702 1.00 67.28  ? 7   DG  I C5    1 
ATOM   1627  C  C6    . DG  A 1  80  ? -1.343  -33.014 80.938 1.00 71.52  ? 7   DG  I C6    1 
ATOM   1628  O  O6    . DG  A 1  80  ? -1.046  -34.076 81.497 1.00 78.11  ? 7   DG  I O6    1 
ATOM   1629  N  N1    . DG  A 1  80  ? -1.023  -31.802 81.539 1.00 73.51  ? 7   DG  I N1    1 
ATOM   1630  C  C2    . DG  A 1  80  ? -1.301  -30.567 81.018 1.00 68.92  ? 7   DG  I C2    1 
ATOM   1631  N  N2    . DG  A 1  80  ? -0.901  -29.518 81.744 1.00 70.47  ? 7   DG  I N2    1 
ATOM   1632  N  N3    . DG  A 1  80  ? -1.918  -30.373 79.868 1.00 74.80  ? 7   DG  I N3    1 
ATOM   1633  C  C4    . DG  A 1  80  ? -2.241  -31.536 79.268 1.00 65.35  ? 7   DG  I C4    1 
ATOM   1634  P  P     . DA  A 1  81  ? -2.474  -27.951 74.114 1.00 55.82  ? 8   DA  I P     1 
ATOM   1635  O  OP1   . DA  A 1  81  ? -3.049  -26.969 73.142 1.00 54.79  ? 8   DA  I OP1   1 
ATOM   1636  O  OP2   . DA  A 1  81  ? -1.711  -29.134 73.650 1.00 57.89  ? 8   DA  I OP2   1 
ATOM   1637  O  "O5'" . DA  A 1  81  ? -1.534  -27.100 75.060 1.00 58.39  ? 8   DA  I "O5'" 1 
ATOM   1638  C  "C5'" . DA  A 1  81  ? -2.126  -26.110 75.924 1.00 56.58  ? 8   DA  I "C5'" 1 
ATOM   1639  C  "C4'" . DA  A 1  81  ? -1.041  -25.528 76.793 1.00 54.90  ? 8   DA  I "C4'" 1 
ATOM   1640  O  "O4'" . DA  A 1  81  ? -0.584  -26.536 77.726 1.00 54.00  ? 8   DA  I "O4'" 1 
ATOM   1641  C  "C3'" . DA  A 1  81  ? 0.196   -25.093 76.013 1.00 54.98  ? 8   DA  I "C3'" 1 
ATOM   1642  O  "O3'" . DA  A 1  81  ? 0.740   -23.944 76.652 1.00 53.59  ? 8   DA  I "O3'" 1 
ATOM   1643  C  "C2'" . DA  A 1  81  ? 1.097   -26.315 76.069 1.00 56.14  ? 8   DA  I "C2'" 1 
ATOM   1644  C  "C1'" . DA  A 1  81  ? 0.746   -26.941 77.412 1.00 59.98  ? 8   DA  I "C1'" 1 
ATOM   1645  N  N9    . DA  A 1  81  ? 0.786   -28.402 77.470 1.00 66.31  ? 8   DA  I N9    1 
ATOM   1646  C  C8    . DA  A 1  81  ? 0.355   -29.313 76.540 1.00 70.84  ? 8   DA  I C8    1 
ATOM   1647  N  N7    . DA  A 1  81  ? 0.478   -30.560 76.926 1.00 66.12  ? 8   DA  I N7    1 
ATOM   1648  C  C5    . DA  A 1  81  ? 1.022   -30.463 78.197 1.00 73.38  ? 8   DA  I C5    1 
ATOM   1649  C  C6    . DA  A 1  81  ? 1.420   -31.432 79.130 1.00 72.00  ? 8   DA  I C6    1 
ATOM   1650  N  N6    . DA  A 1  81  ? 1.314   -32.742 78.925 1.00 77.65  ? 8   DA  I N6    1 
ATOM   1651  N  N1    . DA  A 1  81  ? 1.932   -31.002 80.302 1.00 71.15  ? 8   DA  I N1    1 
ATOM   1652  C  C2    . DA  A 1  81  ? 2.052   -29.685 80.505 1.00 72.45  ? 8   DA  I C2    1 
ATOM   1653  N  N3    . DA  A 1  81  ? 1.729   -28.678 79.700 1.00 77.64  ? 8   DA  I N3    1 
ATOM   1654  C  C4    . DA  A 1  81  ? 1.214   -29.139 78.547 1.00 78.70  ? 8   DA  I C4    1 
ATOM   1655  P  P     . DA  A 1  82  ? 1.920   -23.146 75.979 1.00 65.28  ? 9   DA  I P     1 
ATOM   1656  O  OP1   . DA  A 1  82  ? 1.709   -21.696 76.281 1.00 64.37  ? 9   DA  I OP1   1 
ATOM   1657  O  OP2   . DA  A 1  82  ? 2.089   -23.619 74.575 1.00 63.66  ? 9   DA  I OP2   1 
ATOM   1658  O  "O5'" . DA  A 1  82  ? 3.192   -23.667 76.773 1.00 64.43  ? 9   DA  I "O5'" 1 
ATOM   1659  C  "C5'" . DA  A 1  82  ? 3.236   -23.530 78.210 1.00 60.75  ? 9   DA  I "C5'" 1 
ATOM   1660  C  "C4'" . DA  A 1  82  ? 4.435   -24.258 78.770 1.00 58.51  ? 9   DA  I "C4'" 1 
ATOM   1661  O  "O4'" . DA  A 1  82  ? 4.211   -25.688 78.750 1.00 51.98  ? 9   DA  I "O4'" 1 
ATOM   1662  C  "C3'" . DA  A 1  82  ? 5.753   -24.014 78.028 1.00 59.47  ? 9   DA  I "C3'" 1 
ATOM   1663  O  "O3'" . DA  A 1  82  ? 6.673   -23.480 78.984 1.00 75.64  ? 9   DA  I "O3'" 1 
ATOM   1664  C  "C2'" . DA  A 1  82  ? 6.144   -25.386 77.499 1.00 58.11  ? 9   DA  I "C2'" 1 
ATOM   1665  C  "C1'" . DA  A 1  82  ? 5.407   -26.339 78.415 1.00 55.97  ? 9   DA  I "C1'" 1 
ATOM   1666  N  N9    . DA  A 1  82  ? 5.051   -27.632 77.856 1.00 59.47  ? 9   DA  I N9    1 
ATOM   1667  C  C8    . DA  A 1  82  ? 4.452   -27.911 76.656 1.00 74.63  ? 9   DA  I C8    1 
ATOM   1668  N  N7    . DA  A 1  82  ? 4.204   -29.185 76.473 1.00 77.87  ? 9   DA  I N7    1 
ATOM   1669  C  C5    . DA  A 1  82  ? 4.655   -29.783 77.640 1.00 76.98  ? 9   DA  I C5    1 
ATOM   1670  C  C6    . DA  A 1  82  ? 4.685   -31.121 78.068 1.00 79.18  ? 9   DA  I C6    1 
ATOM   1671  N  N6    . DA  A 1  82  ? 4.227   -32.142 77.343 1.00 79.46  ? 9   DA  I N6    1 
ATOM   1672  N  N1    . DA  A 1  82  ? 5.207   -31.380 79.286 1.00 77.30  ? 9   DA  I N1    1 
ATOM   1673  C  C2    . DA  A 1  82  ? 5.671   -30.359 80.013 1.00 74.16  ? 9   DA  I C2    1 
ATOM   1674  N  N3    . DA  A 1  82  ? 5.709   -29.062 79.715 1.00 82.02  ? 9   DA  I N3    1 
ATOM   1675  C  C4    . DA  A 1  82  ? 5.172   -28.837 78.504 1.00 79.81  ? 9   DA  I C4    1 
ATOM   1676  P  P     . DC  A 1  83  ? 8.112   -22.910 78.559 1.00 77.78  ? 10  DC  I P     1 
ATOM   1677  O  OP1   . DC  A 1  83  ? 8.435   -21.818 79.522 1.00 75.85  ? 10  DC  I OP1   1 
ATOM   1678  O  OP2   . DC  A 1  83  ? 8.112   -22.637 77.098 1.00 74.85  ? 10  DC  I OP2   1 
ATOM   1679  O  "O5'" . DC  A 1  83  ? 9.054   -24.174 78.760 1.00 71.07  ? 10  DC  I "O5'" 1 
ATOM   1680  C  "C5'" . DC  A 1  83  ? 8.853   -25.003 79.910 1.00 74.01  ? 10  DC  I "C5'" 1 
ATOM   1681  C  "C4'" . DC  A 1  83  ? 9.830   -26.153 79.913 1.00 76.99  ? 10  DC  I "C4'" 1 
ATOM   1682  O  "O4'" . DC  A 1  83  ? 9.169   -27.325 79.393 1.00 76.43  ? 10  DC  I "O4'" 1 
ATOM   1683  C  "C3'" . DC  A 1  83  ? 11.082  -25.980 79.052 1.00 78.40  ? 10  DC  I "C3'" 1 
ATOM   1684  O  "O3'" . DC  A 1  83  ? 12.109  -26.752 79.675 1.00 83.75  ? 10  DC  I "O3'" 1 
ATOM   1685  C  "C2'" . DC  A 1  83  ? 10.705  -26.689 77.769 1.00 79.35  ? 10  DC  I "C2'" 1 
ATOM   1686  C  "C1'" . DC  A 1  83  ? 9.986   -27.875 78.376 1.00 82.76  ? 10  DC  I "C1'" 1 
ATOM   1687  N  N1    . DC  A 1  83  ? 9.132   -28.686 77.503 1.00 89.88  ? 10  DC  I N1    1 
ATOM   1688  C  C2    . DC  A 1  83  ? 8.717   -29.932 77.974 1.00 84.78  ? 10  DC  I C2    1 
ATOM   1689  O  O2    . DC  A 1  83  ? 9.081   -30.297 79.097 1.00 79.71  ? 10  DC  I O2    1 
ATOM   1690  N  N3    . DC  A 1  83  ? 7.933   -30.707 77.195 1.00 87.17  ? 10  DC  I N3    1 
ATOM   1691  C  C4    . DC  A 1  83  ? 7.563   -30.278 75.989 1.00 84.37  ? 10  DC  I C4    1 
ATOM   1692  N  N4    . DC  A 1  83  ? 6.791   -31.078 75.255 1.00 77.42  ? 10  DC  I N4    1 
ATOM   1693  C  C5    . DC  A 1  83  ? 7.962   -29.006 75.486 1.00 88.65  ? 10  DC  I C5    1 
ATOM   1694  C  C6    . DC  A 1  83  ? 8.739   -28.248 76.269 1.00 90.32  ? 10  DC  I C6    1 
ATOM   1695  P  P     . DA  A 1  84  ? 13.627  -26.324 79.543 1.00 88.11  ? 11  DA  I P     1 
ATOM   1696  O  OP1   . DA  A 1  84  ? 13.802  -25.075 80.340 1.00 68.29  ? 11  DA  I OP1   1 
ATOM   1697  O  OP2   . DA  A 1  84  ? 13.987  -26.341 78.103 1.00 75.45  ? 11  DA  I OP2   1 
ATOM   1698  O  "O5'" . DA  A 1  84  ? 14.408  -27.585 80.131 1.00 84.52  ? 11  DA  I "O5'" 1 
ATOM   1699  C  "C5'" . DA  A 1  84  ? 13.790  -28.551 81.007 1.00 82.48  ? 11  DA  I "C5'" 1 
ATOM   1700  C  "C4'" . DA  A 1  84  ? 14.400  -29.923 80.810 1.00 93.22  ? 11  DA  I "C4'" 1 
ATOM   1701  O  "O4'" . DA  A 1  84  ? 13.549  -30.717 79.951 1.00 93.21  ? 11  DA  I "O4'" 1 
ATOM   1702  C  "C3'" . DA  A 1  84  ? 15.773  -29.972 80.145 1.00 98.70  ? 11  DA  I "C3'" 1 
ATOM   1703  O  "O3'" . DA  A 1  84  ? 16.438  -31.188 80.511 1.00 105.42 ? 11  DA  I "O3'" 1 
ATOM   1704  C  "C2'" . DA  A 1  84  ? 15.418  -30.055 78.676 1.00 99.19  ? 11  DA  I "C2'" 1 
ATOM   1705  C  "C1'" . DA  A 1  84  ? 14.216  -30.984 78.725 1.00 95.17  ? 11  DA  I "C1'" 1 
ATOM   1706  N  N9    . DA  A 1  84  ? 13.256  -30.793 77.644 1.00 97.24  ? 11  DA  I N9    1 
ATOM   1707  C  C8    . DA  A 1  84  ? 12.864  -29.627 77.035 1.00 101.83 ? 11  DA  I C8    1 
ATOM   1708  N  N7    . DA  A 1  84  ? 11.979  -29.801 76.084 1.00 102.91 ? 11  DA  I N7    1 
ATOM   1709  C  C5    . DA  A 1  84  ? 11.772  -31.173 76.069 1.00 101.93 ? 11  DA  I C5    1 
ATOM   1710  C  C6    . DA  A 1  84  ? 10.950  -31.997 75.282 1.00 96.91  ? 11  DA  I C6    1 
ATOM   1711  N  N6    . DA  A 1  84  ? 10.144  -31.537 74.327 1.00 90.24  ? 11  DA  I N6    1 
ATOM   1712  N  N1    . DA  A 1  84  ? 10.978  -33.327 75.521 1.00 96.89  ? 11  DA  I N1    1 
ATOM   1713  C  C2    . DA  A 1  84  ? 11.787  -33.789 76.485 1.00 99.04  ? 11  DA  I C2    1 
ATOM   1714  N  N3    . DA  A 1  84  ? 12.612  -33.114 77.284 1.00 100.24 ? 11  DA  I N3    1 
ATOM   1715  C  C4    . DA  A 1  84  ? 12.553  -31.796 77.024 1.00 101.55 ? 11  DA  I C4    1 
ATOM   1716  P  P     . DT  A 1  85  ? 18.011  -31.379 80.222 1.00 103.83 ? 12  DT  I P     1 
ATOM   1717  O  OP1   . DT  A 1  85  ? 18.686  -31.545 81.533 1.00 101.38 ? 12  DT  I OP1   1 
ATOM   1718  O  OP2   . DT  A 1  85  ? 18.456  -30.314 79.284 1.00 95.59  ? 12  DT  I OP2   1 
ATOM   1719  O  "O5'" . DT  A 1  85  ? 18.076  -32.742 79.404 1.00 98.83  ? 12  DT  I "O5'" 1 
ATOM   1720  C  "C5'" . DT  A 1  85  ? 17.211  -33.847 79.720 1.00 105.60 ? 12  DT  I "C5'" 1 
ATOM   1721  C  "C4'" . DT  A 1  85  ? 17.008  -34.677 78.476 1.00 111.97 ? 12  DT  I "C4'" 1 
ATOM   1722  O  "O4'" . DT  A 1  85  ? 16.004  -34.056 77.642 1.00 117.91 ? 12  DT  I "O4'" 1 
ATOM   1723  C  "C3'" . DT  A 1  85  ? 18.259  -34.823 77.600 1.00 115.65 ? 12  DT  I "C3'" 1 
ATOM   1724  O  "O3'" . DT  A 1  85  ? 18.647  -36.197 77.541 1.00 111.83 ? 12  DT  I "O3'" 1 
ATOM   1725  C  "C2'" . DT  A 1  85  ? 17.839  -34.291 76.236 1.00 113.58 ? 12  DT  I "C2'" 1 
ATOM   1726  C  "C1'" . DT  A 1  85  ? 16.323  -34.347 76.299 1.00 117.51 ? 12  DT  I "C1'" 1 
ATOM   1727  N  N1    . DT  A 1  85  ? 15.603  -33.386 75.435 1.00 113.58 ? 12  DT  I N1    1 
ATOM   1728  C  C2    . DT  A 1  85  ? 14.657  -33.882 74.567 1.00 103.78 ? 12  DT  I C2    1 
ATOM   1729  O  O2    . DT  A 1  85  ? 14.389  -35.068 74.481 1.00 96.14  ? 12  DT  I O2    1 
ATOM   1730  N  N3    . DT  A 1  85  ? 14.035  -32.935 73.794 1.00 105.09 ? 12  DT  I N3    1 
ATOM   1731  C  C4    . DT  A 1  85  ? 14.258  -31.574 73.803 1.00 106.25 ? 12  DT  I C4    1 
ATOM   1732  O  O4    . DT  A 1  85  ? 13.621  -30.847 73.047 1.00 103.53 ? 12  DT  I O4    1 
ATOM   1733  C  C5    . DT  A 1  85  ? 15.259  -31.119 74.743 1.00 110.90 ? 12  DT  I C5    1 
ATOM   1734  C  C7    . DT  A 1  85  ? 15.566  -29.657 74.829 1.00 111.93 ? 12  DT  I C7    1 
ATOM   1735  C  C6    . DT  A 1  85  ? 15.873  -32.036 75.501 1.00 112.36 ? 12  DT  I C6    1 
ATOM   1736  P  P     . DG  A 1  86  ? 20.123  -36.604 77.084 1.00 108.23 ? 13  DG  I P     1 
ATOM   1737  O  OP1   . DG  A 1  86  ? 20.752  -37.328 78.212 1.00 98.39  ? 13  DG  I OP1   1 
ATOM   1738  O  OP2   . DG  A 1  86  ? 20.785  -35.406 76.478 1.00 98.10  ? 13  DG  I OP2   1 
ATOM   1739  O  "O5'" . DG  A 1  86  ? 19.865  -37.668 75.929 1.00 100.62 ? 13  DG  I "O5'" 1 
ATOM   1740  C  "C5'" . DG  A 1  86  ? 18.547  -38.201 75.683 1.00 111.56 ? 13  DG  I "C5'" 1 
ATOM   1741  C  "C4'" . DG  A 1  86  ? 18.464  -38.776 74.288 1.00 113.06 ? 13  DG  I "C4'" 1 
ATOM   1742  O  "O4'" . DG  A 1  86  ? 17.622  -37.939 73.457 1.00 116.13 ? 13  DG  I "O4'" 1 
ATOM   1743  C  "C3'" . DG  A 1  86  ? 19.805  -38.899 73.562 1.00 110.87 ? 13  DG  I "C3'" 1 
ATOM   1744  O  "O3'" . DG  A 1  86  ? 19.911  -40.252 73.086 1.00 102.40 ? 13  DG  I "O3'" 1 
ATOM   1745  C  "C2'" . DG  A 1  86  ? 19.814  -37.697 72.624 1.00 114.11 ? 13  DG  I "C2'" 1 
ATOM   1746  C  "C1'" . DG  A 1  86  ? 18.340  -37.449 72.335 1.00 115.04 ? 13  DG  I "C1'" 1 
ATOM   1747  N  N9    . DG  A 1  86  ? 17.946  -36.057 72.127 1.00 113.99 ? 13  DG  I N9    1 
ATOM   1748  C  C8    . DG  A 1  86  ? 18.524  -34.925 72.652 1.00 117.68 ? 13  DG  I C8    1 
ATOM   1749  N  N7    . DG  A 1  86  ? 17.920  -33.826 72.287 1.00 116.25 ? 13  DG  I N7    1 
ATOM   1750  C  C5    . DG  A 1  86  ? 16.881  -34.258 71.474 1.00 108.04 ? 13  DG  I C5    1 
ATOM   1751  C  C6    . DG  A 1  86  ? 15.885  -33.520 70.782 1.00 103.20 ? 13  DG  I C6    1 
ATOM   1752  O  O6    . DG  A 1  86  ? 15.712  -32.297 70.753 1.00 95.28  ? 13  DG  I O6    1 
ATOM   1753  N  N1    . DG  A 1  86  ? 15.026  -34.357 70.080 1.00 115.25 ? 13  DG  I N1    1 
ATOM   1754  C  C2    . DG  A 1  86  ? 15.112  -35.728 70.044 1.00 111.47 ? 13  DG  I C2    1 
ATOM   1755  N  N2    . DG  A 1  86  ? 14.186  -36.362 69.311 1.00 106.60 ? 13  DG  I N2    1 
ATOM   1756  N  N3    . DG  A 1  86  ? 16.036  -36.427 70.680 1.00 104.83 ? 13  DG  I N3    1 
ATOM   1757  C  C4    . DG  A 1  86  ? 16.879  -35.634 71.373 1.00 111.76 ? 13  DG  I C4    1 
ATOM   1758  P  P     . DC  A 1  87  ? 20.347  -40.591 71.587 1.00 108.17 ? 14  DC  I P     1 
ATOM   1759  O  OP1   . DC  A 1  87  ? 20.593  -42.048 71.501 1.00 99.46  ? 14  DC  I OP1   1 
ATOM   1760  O  OP2   . DC  A 1  87  ? 21.409  -39.643 71.165 1.00 95.35  ? 14  DC  I OP2   1 
ATOM   1761  O  "O5'" . DC  A 1  87  ? 19.013  -40.289 70.780 1.00 131.53 ? 14  DC  I "O5'" 1 
ATOM   1762  C  "C5'" . DC  A 1  87  ? 18.250  -41.345 70.166 1.00 130.52 ? 14  DC  I "C5'" 1 
ATOM   1763  C  "C4'" . DC  A 1  87  ? 17.880  -40.927 68.765 1.00 117.67 ? 14  DC  I "C4'" 1 
ATOM   1764  O  "O4'" . DC  A 1  87  ? 17.540  -39.518 68.783 1.00 110.40 ? 14  DC  I "O4'" 1 
ATOM   1765  C  "C3'" . DC  A 1  87  ? 19.002  -41.099 67.733 1.00 101.19 ? 14  DC  I "C3'" 1 
ATOM   1766  O  "O3'" . DC  A 1  87  ? 18.470  -41.860 66.647 1.00 98.51  ? 14  DC  I "O3'" 1 
ATOM   1767  C  "C2'" . DC  A 1  87  ? 19.402  -39.676 67.380 1.00 108.49 ? 14  DC  I "C2'" 1 
ATOM   1768  C  "C1'" . DC  A 1  87  ? 18.145  -38.880 67.678 1.00 112.47 ? 14  DC  I "C1'" 1 
ATOM   1769  N  N1    . DC  A 1  87  ? 18.354  -37.461 68.022 1.00 111.10 ? 14  DC  I N1    1 
ATOM   1770  C  C2    . DC  A 1  87  ? 17.471  -36.514 67.495 1.00 106.49 ? 14  DC  I C2    1 
ATOM   1771  O  O2    . DC  A 1  87  ? 16.541  -36.899 66.774 1.00 105.65 ? 14  DC  I O2    1 
ATOM   1772  N  N3    . DC  A 1  87  ? 17.656  -35.205 67.780 1.00 106.73 ? 14  DC  I N3    1 
ATOM   1773  C  C4    . DC  A 1  87  ? 18.677  -34.829 68.555 1.00 99.20  ? 14  DC  I C4    1 
ATOM   1774  N  N4    . DC  A 1  87  ? 18.816  -33.528 68.816 1.00 86.84  ? 14  DC  I N4    1 
ATOM   1775  C  C5    . DC  A 1  87  ? 19.593  -35.774 69.106 1.00 99.56  ? 14  DC  I C5    1 
ATOM   1776  C  C6    . DC  A 1  87  ? 19.398  -37.067 68.813 1.00 103.56 ? 14  DC  I C6    1 
ATOM   1777  P  P     . DC  A 1  88  ? 19.299  -42.083 65.286 1.00 94.04  ? 15  DC  I P     1 
ATOM   1778  O  OP1   . DC  A 1  88  ? 19.623  -43.528 65.187 1.00 92.47  ? 15  DC  I OP1   1 
ATOM   1779  O  OP2   . DC  A 1  88  ? 20.380  -41.084 65.217 1.00 81.14  ? 15  DC  I OP2   1 
ATOM   1780  O  "O5'" . DC  A 1  88  ? 18.237  -41.700 64.159 1.00 106.12 ? 15  DC  I "O5'" 1 
ATOM   1781  C  "C5'" . DC  A 1  88  ? 17.058  -40.904 64.464 1.00 109.37 ? 15  DC  I "C5'" 1 
ATOM   1782  C  "C4'" . DC  A 1  88  ? 16.681  -40.013 63.302 1.00 106.42 ? 15  DC  I "C4'" 1 
ATOM   1783  O  "O4'" . DC  A 1  88  ? 17.093  -38.654 63.582 1.00 109.70 ? 15  DC  I "O4'" 1 
ATOM   1784  C  "C3'" . DC  A 1  88  ? 17.342  -40.353 61.967 1.00 105.45 ? 15  DC  I "C3'" 1 
ATOM   1785  O  "O3'" . DC  A 1  88  ? 16.574  -39.788 60.906 1.00 120.89 ? 15  DC  I "O3'" 1 
ATOM   1786  C  "C2'" . DC  A 1  88  ? 18.608  -39.528 62.010 1.00 97.33  ? 15  DC  I "C2'" 1 
ATOM   1787  C  "C1'" . DC  A 1  88  ? 18.063  -38.244 62.614 1.00 104.28 ? 15  DC  I "C1'" 1 
ATOM   1788  N  N1    . DC  A 1  88  ? 19.027  -37.366 63.290 1.00 102.73 ? 15  DC  I N1    1 
ATOM   1789  C  C2    . DC  A 1  88  ? 18.666  -36.035 63.510 1.00 107.81 ? 15  DC  I C2    1 
ATOM   1790  O  O2    . DC  A 1  88  ? 17.570  -35.633 63.093 1.00 106.15 ? 15  DC  I O2    1 
ATOM   1791  N  N3    . DC  A 1  88  ? 19.522  -35.218 64.164 1.00 118.77 ? 15  DC  I N3    1 
ATOM   1792  C  C4    . DC  A 1  88  ? 20.693  -35.688 64.595 1.00 119.47 ? 15  DC  I C4    1 
ATOM   1793  N  N4    . DC  A 1  88  ? 21.506  -34.845 65.232 1.00 127.30 ? 15  DC  I N4    1 
ATOM   1794  C  C5    . DC  A 1  88  ? 21.083  -37.043 64.391 1.00 115.91 ? 15  DC  I C5    1 
ATOM   1795  C  C6    . DC  A 1  88  ? 20.225  -37.842 63.745 1.00 108.04 ? 15  DC  I C6    1 
ATOM   1796  P  P     . DT  A 1  89  ? 15.768  -40.714 59.892 1.00 123.62 ? 16  DT  I P     1 
ATOM   1797  O  OP1   . DT  A 1  89  ? 15.087  -41.797 60.671 1.00 107.49 ? 16  DT  I OP1   1 
ATOM   1798  O  OP2   . DT  A 1  89  ? 16.667  -41.019 58.746 1.00 95.60  ? 16  DT  I OP2   1 
ATOM   1799  O  "O5'" . DT  A 1  89  ? 14.623  -39.747 59.361 1.00 119.42 ? 16  DT  I "O5'" 1 
ATOM   1800  C  "C5'" . DT  A 1  89  ? 13.871  -38.907 60.255 1.00 107.15 ? 16  DT  I "C5'" 1 
ATOM   1801  C  "C4'" . DT  A 1  89  ? 13.702  -37.542 59.631 1.00 103.16 ? 16  DT  I "C4'" 1 
ATOM   1802  O  "O4'" . DT  A 1  89  ? 14.916  -36.765 59.786 1.00 96.79  ? 16  DT  I "O4'" 1 
ATOM   1803  C  "C3'" . DT  A 1  89  ? 13.405  -37.566 58.130 1.00 99.34  ? 16  DT  I "C3'" 1 
ATOM   1804  O  "O3'" . DT  A 1  89  ? 12.434  -36.563 57.840 1.00 86.76  ? 16  DT  I "O3'" 1 
ATOM   1805  C  "C2'" . DT  A 1  89  ? 14.749  -37.258 57.500 1.00 95.51  ? 16  DT  I "C2'" 1 
ATOM   1806  C  "C1'" . DT  A 1  89  ? 15.370  -36.324 58.519 1.00 99.22  ? 16  DT  I "C1'" 1 
ATOM   1807  N  N1    . DT  A 1  89  ? 16.836  -36.327 58.543 1.00 102.54 ? 16  DT  I N1    1 
ATOM   1808  C  C2    . DT  A 1  89  ? 17.485  -35.126 58.709 1.00 106.10 ? 16  DT  I C2    1 
ATOM   1809  O  O2    . DT  A 1  89  ? 16.901  -34.063 58.835 1.00 100.27 ? 16  DT  I O2    1 
ATOM   1810  N  N3    . DT  A 1  89  ? 18.853  -35.215 58.724 1.00 113.90 ? 16  DT  I N3    1 
ATOM   1811  C  C4    . DT  A 1  89  ? 19.617  -36.360 58.595 1.00 116.78 ? 16  DT  I C4    1 
ATOM   1812  O  O4    . DT  A 1  89  ? 20.841  -36.284 58.629 1.00 117.36 ? 16  DT  I O4    1 
ATOM   1813  C  C5    . DT  A 1  89  ? 18.869  -37.584 58.428 1.00 109.38 ? 16  DT  I C5    1 
ATOM   1814  C  C7    . DT  A 1  89  ? 19.612  -38.874 58.278 1.00 100.24 ? 16  DT  I C7    1 
ATOM   1815  C  C6    . DT  A 1  89  ? 17.534  -37.508 58.413 1.00 107.18 ? 16  DT  I C6    1 
ATOM   1816  P  P     . DT  A 1  90  ? 11.799  -36.447 56.398 1.00 85.63  ? 17  DT  I P     1 
ATOM   1817  O  OP1   . DT  A 1  90  ? 10.342  -36.747 56.540 1.00 76.79  ? 17  DT  I OP1   1 
ATOM   1818  O  OP2   . DT  A 1  90  ? 12.660  -37.181 55.418 1.00 58.30  ? 17  DT  I OP2   1 
ATOM   1819  O  "O5'" . DT  A 1  90  ? 11.990  -34.904 56.053 1.00 82.18  ? 17  DT  I "O5'" 1 
ATOM   1820  C  "C5'" . DT  A 1  90  ? 11.821  -33.890 57.064 1.00 73.96  ? 17  DT  I "C5'" 1 
ATOM   1821  C  "C4'" . DT  A 1  90  ? 12.697  -32.706 56.734 1.00 73.97  ? 17  DT  I "C4'" 1 
ATOM   1822  O  "O4'" . DT  A 1  90  ? 14.087  -33.115 56.778 1.00 73.13  ? 17  DT  I "O4'" 1 
ATOM   1823  C  "C3'" . DT  A 1  90  ? 12.460  -32.116 55.339 1.00 68.23  ? 17  DT  I "C3'" 1 
ATOM   1824  O  "O3'" . DT  A 1  90  ? 12.276  -30.700 55.437 1.00 60.31  ? 17  DT  I "O3'" 1 
ATOM   1825  C  "C2'" . DT  A 1  90  ? 13.685  -32.552 54.549 1.00 71.34  ? 17  DT  I "C2'" 1 
ATOM   1826  C  "C1'" . DT  A 1  90  ? 14.753  -32.647 55.618 1.00 80.29  ? 17  DT  I "C1'" 1 
ATOM   1827  N  N1    . DT  A 1  90  ? 15.879  -33.569 55.337 1.00 94.63  ? 17  DT  I N1    1 
ATOM   1828  C  C2    . DT  A 1  90  ? 17.150  -33.040 55.331 1.00 99.22  ? 17  DT  I C2    1 
ATOM   1829  O  O2    . DT  A 1  90  ? 17.378  -31.854 55.511 1.00 92.21  ? 17  DT  I O2    1 
ATOM   1830  N  N3    . DT  A 1  90  ? 18.149  -33.950 55.087 1.00 103.48 ? 17  DT  I N3    1 
ATOM   1831  C  C4    . DT  A 1  90  ? 18.006  -35.306 54.865 1.00 102.09 ? 17  DT  I C4    1 
ATOM   1832  O  O4    . DT  A 1  90  ? 18.998  -35.998 54.660 1.00 97.57  ? 17  DT  I O4    1 
ATOM   1833  C  C5    . DT  A 1  90  ? 16.648  -35.798 54.898 1.00 108.40 ? 17  DT  I C5    1 
ATOM   1834  C  C7    . DT  A 1  90  ? 16.397  -37.252 54.652 1.00 109.84 ? 17  DT  I C7    1 
ATOM   1835  C  C6    . DT  A 1  90  ? 15.664  -34.916 55.129 1.00 105.21 ? 17  DT  I C6    1 
ATOM   1836  P  P     . DT  A 1  91  ? 11.971  -29.827 54.131 1.00 58.38  ? 18  DT  I P     1 
ATOM   1837  O  OP1   . DT  A 1  91  ? 10.902  -28.871 54.467 1.00 65.59  ? 18  DT  I OP1   1 
ATOM   1838  O  OP2   . DT  A 1  91  ? 11.883  -30.720 52.924 1.00 50.49  ? 18  DT  I OP2   1 
ATOM   1839  O  "O5'" . DT  A 1  91  ? 13.276  -28.932 53.917 1.00 66.91  ? 18  DT  I "O5'" 1 
ATOM   1840  C  "C5'" . DT  A 1  91  ? 14.253  -28.643 54.950 1.00 71.06  ? 18  DT  I "C5'" 1 
ATOM   1841  C  "C4'" . DT  A 1  91  ? 15.521  -28.080 54.342 1.00 71.20  ? 18  DT  I "C4'" 1 
ATOM   1842  O  "O4'" . DT  A 1  91  ? 16.493  -29.129 54.092 1.00 75.81  ? 18  DT  I "O4'" 1 
ATOM   1843  C  "C3'" . DT  A 1  91  ? 15.348  -27.354 53.007 1.00 73.46  ? 18  DT  I "C3'" 1 
ATOM   1844  O  "O3'" . DT  A 1  91  ? 16.292  -26.286 52.998 1.00 85.43  ? 18  DT  I "O3'" 1 
ATOM   1845  C  "C2'" . DT  A 1  91  ? 15.742  -28.404 51.987 1.00 73.44  ? 18  DT  I "C2'" 1 
ATOM   1846  C  "C1'" . DT  A 1  91  ? 16.881  -29.095 52.720 1.00 79.58  ? 18  DT  I "C1'" 1 
ATOM   1847  N  N1    . DT  A 1  91  ? 17.190  -30.477 52.296 1.00 87.28  ? 18  DT  I N1    1 
ATOM   1848  C  C2    . DT  A 1  91  ? 18.512  -30.855 52.240 1.00 98.82  ? 18  DT  I C2    1 
ATOM   1849  O  O2    . DT  A 1  91  ? 19.432  -30.101 52.509 1.00 111.83 ? 18  DT  I O2    1 
ATOM   1850  N  N3    . DT  A 1  91  ? 18.721  -32.154 51.846 1.00 98.27  ? 18  DT  I N3    1 
ATOM   1851  C  C4    . DT  A 1  91  ? 17.760  -33.093 51.526 1.00 94.61  ? 18  DT  I C4    1 
ATOM   1852  O  O4    . DT  A 1  91  ? 18.098  -34.223 51.190 1.00 85.79  ? 18  DT  I O4    1 
ATOM   1853  C  C5    . DT  A 1  91  ? 16.393  -32.627 51.606 1.00 96.87  ? 18  DT  I C5    1 
ATOM   1854  C  C7    . DT  A 1  91  ? 15.283  -33.566 51.258 1.00 100.25 ? 18  DT  I C7    1 
ATOM   1855  C  C6    . DT  A 1  91  ? 16.181  -31.360 51.984 1.00 93.48  ? 18  DT  I C6    1 
ATOM   1856  P  P     . DT  A 1  92  ? 16.264  -25.163 51.858 1.00 91.61  ? 19  DT  I P     1 
ATOM   1857  O  OP1   . DT  A 1  92  ? 16.374  -23.853 52.549 1.00 97.08  ? 19  DT  I OP1   1 
ATOM   1858  O  OP2   . DT  A 1  92  ? 15.114  -25.413 50.957 1.00 77.35  ? 19  DT  I OP2   1 
ATOM   1859  O  "O5'" . DT  A 1  92  ? 17.585  -25.461 51.013 1.00 92.81  ? 19  DT  I "O5'" 1 
ATOM   1860  C  "C5'" . DT  A 1  92  ? 18.870  -25.677 51.639 1.00 93.40  ? 19  DT  I "C5'" 1 
ATOM   1861  C  "C4'" . DT  A 1  92  ? 19.863  -26.188 50.621 1.00 96.96  ? 19  DT  I "C4'" 1 
ATOM   1862  O  "O4'" . DT  A 1  92  ? 19.763  -27.633 50.506 1.00 97.46  ? 19  DT  I "O4'" 1 
ATOM   1863  C  "C3'" . DT  A 1  92  ? 19.678  -25.651 49.194 1.00 97.17  ? 19  DT  I "C3'" 1 
ATOM   1864  O  "O3'" . DT  A 1  92  ? 20.941  -25.597 48.520 1.00 109.09 ? 19  DT  I "O3'" 1 
ATOM   1865  C  "C2'" . DT  A 1  92  ? 18.946  -26.783 48.508 1.00 93.95  ? 19  DT  I "C2'" 1 
ATOM   1866  C  "C1'" . DT  A 1  92  ? 19.705  -27.941 49.121 1.00 99.10  ? 19  DT  I "C1'" 1 
ATOM   1867  N  N1    . DT  A 1  92  ? 19.128  -29.284 48.960 1.00 106.30 ? 19  DT  I N1    1 
ATOM   1868  C  C2    . DT  A 1  92  ? 19.988  -30.355 49.008 1.00 105.72 ? 19  DT  I C2    1 
ATOM   1869  O  O2    . DT  A 1  92  ? 21.184  -30.239 49.201 1.00 114.06 ? 19  DT  I O2    1 
ATOM   1870  N  N3    . DT  A 1  92  ? 19.391  -31.576 48.831 1.00 109.65 ? 19  DT  I N3    1 
ATOM   1871  C  C4    . DT  A 1  92  ? 18.053  -31.823 48.595 1.00 115.15 ? 19  DT  I C4    1 
ATOM   1872  O  O4    . DT  A 1  92  ? 17.660  -32.977 48.454 1.00 117.93 ? 19  DT  I O4    1 
ATOM   1873  C  C5    . DT  A 1  92  ? 17.210  -30.652 48.540 1.00 117.21 ? 19  DT  I C5    1 
ATOM   1874  C  C7    . DT  A 1  92  ? 15.744  -30.822 48.298 1.00 119.95 ? 19  DT  I C7    1 
ATOM   1875  C  C6    . DT  A 1  92  ? 17.783  -29.456 48.718 1.00 112.95 ? 19  DT  I C6    1 
ATOM   1876  P  P     . DG  A 1  93  ? 21.412  -24.297 47.714 1.00 112.44 ? 20  DG  I P     1 
ATOM   1877  O  OP1   . DG  A 1  93  ? 21.820  -23.277 48.703 1.00 105.81 ? 20  DG  I OP1   1 
ATOM   1878  O  OP2   . DG  A 1  93  ? 20.387  -23.969 46.678 1.00 102.46 ? 20  DG  I OP2   1 
ATOM   1879  O  "O5'" . DG  A 1  93  ? 22.744  -24.801 46.999 1.00 123.30 ? 20  DG  I "O5'" 1 
ATOM   1880  C  "C5'" . DG  A 1  93  ? 23.549  -25.867 47.551 1.00 130.94 ? 20  DG  I "C5'" 1 
ATOM   1881  C  "C4'" . DG  A 1  93  ? 24.004  -26.808 46.458 1.00 135.92 ? 20  DG  I "C4'" 1 
ATOM   1882  O  "O4'" . DG  A 1  93  ? 23.249  -28.044 46.533 1.00 135.34 ? 20  DG  I "O4'" 1 
ATOM   1883  C  "C3'" . DG  A 1  93  ? 23.832  -26.287 45.021 1.00 140.50 ? 20  DG  I "C3'" 1 
ATOM   1884  O  "O3'" . DG  A 1  93  ? 25.078  -26.435 44.310 1.00 141.68 ? 20  DG  I "O3'" 1 
ATOM   1885  C  "C2'" . DG  A 1  93  ? 22.663  -27.103 44.493 1.00 141.17 ? 20  DG  I "C2'" 1 
ATOM   1886  C  "C1'" . DG  A 1  93  ? 22.852  -28.414 45.225 1.00 137.50 ? 20  DG  I "C1'" 1 
ATOM   1887  N  N9    . DG  A 1  93  ? 21.654  -29.241 45.328 1.00 135.25 ? 20  DG  I N9    1 
ATOM   1888  C  C8    . DG  A 1  93  ? 20.372  -28.809 45.565 1.00 129.81 ? 20  DG  I C8    1 
ATOM   1889  N  N7    . DG  A 1  93  ? 19.503  -29.781 45.598 1.00 130.18 ? 20  DG  I N7    1 
ATOM   1890  C  C5    . DG  A 1  93  ? 20.253  -30.923 45.355 1.00 132.62 ? 20  DG  I C5    1 
ATOM   1891  C  C6    . DG  A 1  93  ? 19.855  -32.278 45.265 1.00 137.50 ? 20  DG  I C6    1 
ATOM   1892  O  O6    . DG  A 1  93  ? 18.723  -32.756 45.388 1.00 148.12 ? 20  DG  I O6    1 
ATOM   1893  N  N1    . DG  A 1  93  ? 20.937  -33.114 45.005 1.00 144.40 ? 20  DG  I N1    1 
ATOM   1894  C  C2    . DG  A 1  93  ? 22.236  -32.697 44.848 1.00 138.28 ? 20  DG  I C2    1 
ATOM   1895  N  N2    . DG  A 1  93  ? 23.140  -33.657 44.605 1.00 144.61 ? 20  DG  I N2    1 
ATOM   1896  N  N3    . DG  A 1  93  ? 22.620  -31.435 44.933 1.00 133.25 ? 20  DG  I N3    1 
ATOM   1897  C  C4    . DG  A 1  93  ? 21.583  -30.607 45.184 1.00 135.76 ? 20  DG  I C4    1 
ATOM   1898  P  P     . DA  A 1  94  ? 25.211  -26.186 42.698 1.00 126.44 ? 21  DA  I P     1 
ATOM   1899  O  OP1   . DA  A 1  94  ? 26.314  -25.228 42.464 1.00 124.34 ? 21  DA  I OP1   1 
ATOM   1900  O  OP2   . DA  A 1  94  ? 23.874  -25.873 42.132 1.00 120.43 ? 21  DA  I OP2   1 
ATOM   1901  O  "O5'" . DA  A 1  94  ? 25.732  -27.601 42.183 1.00 126.91 ? 21  DA  I "O5'" 1 
ATOM   1902  C  "C5'" . DA  A 1  94  ? 26.626  -28.411 42.986 1.00 128.12 ? 21  DA  I "C5'" 1 
ATOM   1903  C  "C4'" . DA  A 1  94  ? 26.794  -29.774 42.355 1.00 138.36 ? 21  DA  I "C4'" 1 
ATOM   1904  O  "O4'" . DA  A 1  94  ? 25.626  -30.574 42.661 1.00 138.96 ? 21  DA  I "O4'" 1 
ATOM   1905  C  "C3'" . DA  A 1  94  ? 26.889  -29.748 40.826 1.00 145.26 ? 21  DA  I "C3'" 1 
ATOM   1906  O  "O3'" . DA  A 1  94  ? 27.683  -30.805 40.278 1.00 145.67 ? 21  DA  I "O3'" 1 
ATOM   1907  C  "C2'" . DA  A 1  94  ? 25.453  -29.968 40.402 1.00 148.89 ? 21  DA  I "C2'" 1 
ATOM   1908  C  "C1'" . DA  A 1  94  ? 24.986  -30.956 41.450 1.00 145.08 ? 21  DA  I "C1'" 1 
ATOM   1909  N  N9    . DA  A 1  94  ? 23.542  -30.913 41.655 1.00 139.63 ? 21  DA  I N9    1 
ATOM   1910  C  C8    . DA  A 1  94  ? 22.759  -29.812 41.895 1.00 128.43 ? 21  DA  I C8    1 
ATOM   1911  N  N7    . DA  A 1  94  ? 21.481  -30.084 41.987 1.00 124.58 ? 21  DA  I N7    1 
ATOM   1912  C  C5    . DA  A 1  94  ? 21.416  -31.452 41.770 1.00 132.49 ? 21  DA  I C5    1 
ATOM   1913  C  C6    . DA  A 1  94  ? 20.341  -32.353 41.743 1.00 137.64 ? 21  DA  I C6    1 
ATOM   1914  N  N6    . DA  A 1  94  ? 19.074  -31.991 41.942 1.00 144.07 ? 21  DA  I N6    1 
ATOM   1915  N  N1    . DA  A 1  94  ? 20.615  -33.654 41.499 1.00 130.96 ? 21  DA  I N1    1 
ATOM   1916  C  C2    . DA  A 1  94  ? 21.889  -34.013 41.299 1.00 136.97 ? 21  DA  I C2    1 
ATOM   1917  N  N3    . DA  A 1  94  ? 22.986  -33.259 41.303 1.00 145.24 ? 21  DA  I N3    1 
ATOM   1918  C  C4    . DA  A 1  94  ? 22.677  -31.973 41.547 1.00 138.45 ? 21  DA  I C4    1 
ATOM   1919  P  P     . DT  A 1  95  ? 27.872  -30.921 38.686 1.00 139.99 ? 22  DT  I P     1 
ATOM   1920  O  OP1   . DT  A 1  95  ? 29.327  -30.937 38.397 1.00 144.50 ? 22  DT  I OP1   1 
ATOM   1921  O  OP2   . DT  A 1  95  ? 27.001  -29.908 38.028 1.00 126.67 ? 22  DT  I OP2   1 
ATOM   1922  O  "O5'" . DT  A 1  95  ? 27.307  -32.370 38.347 1.00 142.45 ? 22  DT  I "O5'" 1 
ATOM   1923  C  "C5'" . DT  A 1  95  ? 27.630  -32.989 37.091 1.00 153.79 ? 22  DT  I "C5'" 1 
ATOM   1924  C  "C4'" . DT  A 1  95  ? 26.827  -34.255 36.923 1.00 162.17 ? 22  DT  I "C4'" 1 
ATOM   1925  O  "O4'" . DT  A 1  95  ? 25.556  -34.119 37.611 1.00 174.42 ? 22  DT  I "O4'" 1 
ATOM   1926  C  "C3'" . DT  A 1  95  ? 26.482  -34.605 35.473 1.00 166.68 ? 22  DT  I "C3'" 1 
ATOM   1927  O  "O3'" . DT  A 1  95  ? 26.643  -36.025 35.344 1.00 164.50 ? 22  DT  I "O3'" 1 
ATOM   1928  C  "C2'" . DT  A 1  95  ? 25.051  -34.111 35.343 1.00 177.84 ? 22  DT  I "C2'" 1 
ATOM   1929  C  "C1'" . DT  A 1  95  ? 24.513  -34.473 36.714 1.00 180.72 ? 22  DT  I "C1'" 1 
ATOM   1930  N  N1    . DT  A 1  95  ? 23.265  -33.788 37.145 1.00 163.27 ? 22  DT  I N1    1 
ATOM   1931  C  C2    . DT  A 1  95  ? 22.123  -34.547 37.297 1.00 147.48 ? 22  DT  I C2    1 
ATOM   1932  O  O2    . DT  A 1  95  ? 22.086  -35.748 37.086 1.00 150.33 ? 22  DT  I O2    1 
ATOM   1933  N  N3    . DT  A 1  95  ? 21.017  -33.841 37.701 1.00 134.05 ? 22  DT  I N3    1 
ATOM   1934  C  C4    . DT  A 1  95  ? 20.941  -32.487 37.966 1.00 127.96 ? 22  DT  I C4    1 
ATOM   1935  O  O4    . DT  A 1  95  ? 19.875  -31.993 38.324 1.00 107.00 ? 22  DT  I O4    1 
ATOM   1936  C  C5    . DT  A 1  95  ? 22.174  -31.753 37.790 1.00 133.06 ? 22  DT  I C5    1 
ATOM   1937  C  C7    . DT  A 1  95  ? 22.188  -30.281 38.056 1.00 133.66 ? 22  DT  I C7    1 
ATOM   1938  C  C6    . DT  A 1  95  ? 23.259  -32.431 37.390 1.00 145.81 ? 22  DT  I C6    1 
ATOM   1939  P  P     . DG  A 1  96  ? 26.068  -36.814 34.072 1.00 160.56 ? 23  DG  I P     1 
ATOM   1940  O  OP1   . DG  A 1  96  ? 27.083  -37.809 33.658 1.00 166.29 ? 23  DG  I OP1   1 
ATOM   1941  O  OP2   . DG  A 1  96  ? 25.598  -35.811 33.085 1.00 144.23 ? 23  DG  I OP2   1 
ATOM   1942  O  "O5'" . DG  A 1  96  ? 24.844  -37.638 34.681 1.00 158.32 ? 23  DG  I "O5'" 1 
ATOM   1943  C  "C5'" . DG  A 1  96  ? 24.857  -39.085 34.746 1.00 151.30 ? 23  DG  I "C5'" 1 
ATOM   1944  C  "C4'" . DG  A 1  96  ? 23.679  -39.658 33.992 1.00 148.61 ? 23  DG  I "C4'" 1 
ATOM   1945  O  "O4'" . DG  A 1  96  ? 22.504  -38.861 34.271 1.00 148.65 ? 23  DG  I "O4'" 1 
ATOM   1946  C  "C3'" . DG  A 1  96  ? 23.812  -39.673 32.466 1.00 140.58 ? 23  DG  I "C3'" 1 
ATOM   1947  O  "O3'" . DG  A 1  96  ? 23.213  -40.892 31.983 1.00 135.91 ? 23  DG  I "O3'" 1 
ATOM   1948  C  "C2'" . DG  A 1  96  ? 23.183  -38.348 32.069 1.00 133.48 ? 23  DG  I "C2'" 1 
ATOM   1949  C  "C1'" . DG  A 1  96  ? 22.048  -38.233 33.077 1.00 143.43 ? 23  DG  I "C1'" 1 
ATOM   1950  N  N9    . DG  A 1  96  ? 21.615  -36.882 33.419 1.00 142.68 ? 23  DG  I N9    1 
ATOM   1951  C  C8    . DG  A 1  96  ? 22.313  -35.707 33.272 1.00 131.81 ? 23  DG  I C8    1 
ATOM   1952  N  N7    . DG  A 1  96  ? 21.644  -34.661 33.673 1.00 129.63 ? 23  DG  I N7    1 
ATOM   1953  C  C5    . DG  A 1  96  ? 20.431  -35.175 34.114 1.00 138.31 ? 23  DG  I C5    1 
ATOM   1954  C  C6    . DG  A 1  96  ? 19.292  -34.519 34.659 1.00 124.70 ? 23  DG  I C6    1 
ATOM   1955  O  O6    . DG  A 1  96  ? 19.124  -33.312 34.875 1.00 108.87 ? 23  DG  I O6    1 
ATOM   1956  N  N1    . DG  A 1  96  ? 18.280  -35.422 34.962 1.00 124.42 ? 23  DG  I N1    1 
ATOM   1957  C  C2    . DG  A 1  96  ? 18.348  -36.781 34.766 1.00 139.56 ? 23  DG  I C2    1 
ATOM   1958  N  N2    . DG  A 1  96  ? 17.266  -37.488 35.128 1.00 145.39 ? 23  DG  I N2    1 
ATOM   1959  N  N3    . DG  A 1  96  ? 19.401  -37.403 34.265 1.00 146.99 ? 23  DG  I N3    1 
ATOM   1960  C  C4    . DG  A 1  96  ? 20.398  -36.545 33.961 1.00 146.13 ? 23  DG  I C4    1 
ATOM   1961  P  P     . DG  A 1  97  ? 22.060  -40.906 30.847 1.00 135.38 ? 24  DG  I P     1 
ATOM   1962  O  OP1   . DG  A 1  97  ? 21.953  -42.295 30.322 1.00 133.66 ? 24  DG  I OP1   1 
ATOM   1963  O  OP2   . DG  A 1  97  ? 22.318  -39.787 29.898 1.00 114.92 ? 24  DG  I OP2   1 
ATOM   1964  O  "O5'" . DG  A 1  97  ? 20.716  -40.689 31.681 1.00 138.89 ? 24  DG  I "O5'" 1 
ATOM   1965  C  "C5'" . DG  A 1  97  ? 19.620  -41.638 31.638 1.00 126.68 ? 24  DG  I "C5'" 1 
ATOM   1966  C  "C4'" . DG  A 1  97  ? 18.332  -40.947 31.248 1.00 119.96 ? 24  DG  I "C4'" 1 
ATOM   1967  O  "O4'" . DG  A 1  97  ? 18.401  -39.542 31.578 1.00 123.12 ? 24  DG  I "O4'" 1 
ATOM   1968  C  "C3'" . DG  A 1  97  ? 17.971  -41.002 29.760 1.00 115.10 ? 24  DG  I "C3'" 1 
ATOM   1969  O  "O3'" . DG  A 1  97  ? 16.559  -41.133 29.600 1.00 101.48 ? 24  DG  I "O3'" 1 
ATOM   1970  C  "C2'" . DG  A 1  97  ? 18.395  -39.638 29.247 1.00 117.93 ? 24  DG  I "C2'" 1 
ATOM   1971  C  "C1'" . DG  A 1  97  ? 18.032  -38.777 30.439 1.00 126.60 ? 24  DG  I "C1'" 1 
ATOM   1972  N  N9    . DG  A 1  97  ? 18.701  -37.487 30.544 1.00 129.68 ? 24  DG  I N9    1 
ATOM   1973  C  C8    . DG  A 1  97  ? 20.013  -37.201 30.251 1.00 126.89 ? 24  DG  I C8    1 
ATOM   1974  N  N7    . DG  A 1  97  ? 20.334  -35.961 30.503 1.00 129.71 ? 24  DG  I N7    1 
ATOM   1975  C  C5    . DG  A 1  97  ? 19.170  -35.399 31.007 1.00 133.24 ? 24  DG  I C5    1 
ATOM   1976  C  C6    . DG  A 1  97  ? 18.904  -34.077 31.457 1.00 129.92 ? 24  DG  I C6    1 
ATOM   1977  O  O6    . DG  A 1  97  ? 19.670  -33.109 31.501 1.00 118.85 ? 24  DG  I O6    1 
ATOM   1978  N  N1    . DG  A 1  97  ? 17.591  -33.940 31.895 1.00 127.86 ? 24  DG  I N1    1 
ATOM   1979  C  C2    . DG  A 1  97  ? 16.651  -34.939 31.892 1.00 130.49 ? 24  DG  I C2    1 
ATOM   1980  N  N2    . DG  A 1  97  ? 15.436  -34.606 32.348 1.00 126.61 ? 24  DG  I N2    1 
ATOM   1981  N  N3    . DG  A 1  97  ? 16.885  -36.174 31.478 1.00 141.97 ? 24  DG  I N3    1 
ATOM   1982  C  C4    . DG  A 1  97  ? 18.156  -36.332 31.052 1.00 138.08 ? 24  DG  I C4    1 
ATOM   1983  P  P     . DA  A 1  98  ? 15.846  -42.491 30.009 1.00 115.26 ? 25  DA  I P     1 
ATOM   1984  O  OP1   . DA  A 1  98  ? 16.481  -43.007 31.255 1.00 90.73  ? 25  DA  I OP1   1 
ATOM   1985  O  OP2   . DA  A 1  98  ? 15.737  -43.340 28.800 1.00 116.70 ? 25  DA  I OP2   1 
ATOM   1986  O  "O5'" . DA  A 1  98  ? 14.356  -42.044 30.327 1.00 131.27 ? 25  DA  I "O5'" 1 
ATOM   1987  C  "C5'" . DA  A 1  98  ? 13.861  -41.956 31.672 1.00 127.06 ? 25  DA  I "C5'" 1 
ATOM   1988  C  "C4'" . DA  A 1  98  ? 12.705  -40.987 31.693 1.00 117.52 ? 25  DA  I "C4'" 1 
ATOM   1989  O  "O4'" . DA  A 1  98  ? 13.184  -39.669 31.336 1.00 112.50 ? 25  DA  I "O4'" 1 
ATOM   1990  C  "C3'" . DA  A 1  98  ? 11.588  -41.307 30.699 1.00 111.21 ? 25  DA  I "C3'" 1 
ATOM   1991  O  "O3'" . DA  A 1  98  ? 10.362  -40.963 31.348 1.00 105.74 ? 25  DA  I "O3'" 1 
ATOM   1992  C  "C2'" . DA  A 1  98  ? 11.934  -40.454 29.489 1.00 109.31 ? 25  DA  I "C2'" 1 
ATOM   1993  C  "C1'" . DA  A 1  98  ? 12.583  -39.231 30.120 1.00 115.22 ? 25  DA  I "C1'" 1 
ATOM   1994  N  N9    . DA  A 1  98  ? 13.619  -38.571 29.326 1.00 126.19 ? 25  DA  I N9    1 
ATOM   1995  C  C8    . DA  A 1  98  ? 14.552  -39.118 28.478 1.00 133.03 ? 25  DA  I C8    1 
ATOM   1996  N  N7    . DA  A 1  98  ? 15.354  -38.234 27.936 1.00 126.83 ? 25  DA  I N7    1 
ATOM   1997  C  C5    . DA  A 1  98  ? 14.932  -37.026 28.475 1.00 124.70 ? 25  DA  I C5    1 
ATOM   1998  C  C6    . DA  A 1  98  ? 15.377  -35.704 28.302 1.00 120.16 ? 25  DA  I C6    1 
ATOM   1999  N  N6    . DA  A 1  98  ? 16.389  -35.361 27.504 1.00 116.15 ? 25  DA  I N6    1 
ATOM   2000  N  N1    . DA  A 1  98  ? 14.733  -34.730 28.981 1.00 119.72 ? 25  DA  I N1    1 
ATOM   2001  C  C2    . DA  A 1  98  ? 13.715  -35.072 29.781 1.00 115.93 ? 25  DA  I C2    1 
ATOM   2002  N  N3    . DA  A 1  98  ? 13.205  -36.276 30.025 1.00 119.33 ? 25  DA  I N3    1 
ATOM   2003  C  C4    . DA  A 1  98  ? 13.867  -37.220 29.335 1.00 122.63 ? 25  DA  I C4    1 
ATOM   2004  P  P     . DG  A 1  99  ? 8.965   -41.067 30.590 1.00 112.75 ? 26  DG  I P     1 
ATOM   2005  O  OP1   . DG  A 1  99  ? 7.932   -41.430 31.609 1.00 104.13 ? 26  DG  I OP1   1 
ATOM   2006  O  OP2   . DG  A 1  99  ? 9.153   -41.897 29.366 1.00 106.01 ? 26  DG  I OP2   1 
ATOM   2007  O  "O5'" . DG  A 1  99  ? 8.726   -39.578 30.069 1.00 101.59 ? 26  DG  I "O5'" 1 
ATOM   2008  C  "C5'" . DG  A 1  99  ? 8.676   -38.471 30.984 1.00 87.08  ? 26  DG  I "C5'" 1 
ATOM   2009  C  "C4'" . DG  A 1  99  ? 8.310   -37.207 30.249 1.00 78.07  ? 26  DG  I "C4'" 1 
ATOM   2010  O  "O4'" . DG  A 1  99  ? 9.441   -36.786 29.456 1.00 79.34  ? 26  DG  I "O4'" 1 
ATOM   2011  C  "C3'" . DG  A 1  99  ? 7.147   -37.330 29.264 1.00 82.76  ? 26  DG  I "C3'" 1 
ATOM   2012  O  "O3'" . DG  A 1  99  ? 6.598   -36.024 29.112 1.00 77.83  ? 26  DG  I "O3'" 1 
ATOM   2013  C  "C2'" . DG  A 1  99  ? 7.851   -37.613 27.952 1.00 90.07  ? 26  DG  I "C2'" 1 
ATOM   2014  C  "C1'" . DG  A 1  99  ? 9.047   -36.680 28.092 1.00 97.16  ? 26  DG  I "C1'" 1 
ATOM   2015  N  N9    . DG  A 1  99  ? 10.218  -36.960 27.262 1.00 111.47 ? 26  DG  I N9    1 
ATOM   2016  C  C8    . DG  A 1  99  ? 10.562  -38.151 26.668 1.00 111.99 ? 26  DG  I C8    1 
ATOM   2017  N  N7    . DG  A 1  99  ? 11.688  -38.089 26.013 1.00 111.37 ? 26  DG  I N7    1 
ATOM   2018  C  C5    . DG  A 1  99  ? 12.117  -36.780 26.188 1.00 109.90 ? 26  DG  I C5    1 
ATOM   2019  C  C6    . DG  A 1  99  ? 13.279  -36.123 25.710 1.00 106.33 ? 26  DG  I C6    1 
ATOM   2020  O  O6    . DG  A 1  99  ? 14.187  -36.579 25.009 1.00 111.10 ? 26  DG  I O6    1 
ATOM   2021  N  N1    . DG  A 1  99  ? 13.326  -34.797 26.127 1.00 111.45 ? 26  DG  I N1    1 
ATOM   2022  C  C2    . DG  A 1  99  ? 12.375  -34.179 26.901 1.00 111.46 ? 26  DG  I C2    1 
ATOM   2023  N  N2    . DG  A 1  99  ? 12.600  -32.890 27.198 1.00 99.59  ? 26  DG  I N2    1 
ATOM   2024  N  N3    . DG  A 1  99  ? 11.286  -34.781 27.354 1.00 114.53 ? 26  DG  I N3    1 
ATOM   2025  C  C4    . DG  A 1  99  ? 11.221  -36.071 26.959 1.00 111.80 ? 26  DG  I C4    1 
ATOM   2026  P  P     . DC  A 1  100 ? 5.079   -35.692 29.419 1.00 69.19  ? 27  DC  I P     1 
ATOM   2027  O  OP1   . DC  A 1  100 ? 4.743   -36.238 30.751 1.00 78.67  ? 27  DC  I OP1   1 
ATOM   2028  O  OP2   . DC  A 1  100 ? 4.262   -36.034 28.232 1.00 68.30  ? 27  DC  I OP2   1 
ATOM   2029  O  "O5'" . DC  A 1  100 ? 5.102   -34.110 29.488 1.00 74.77  ? 27  DC  I "O5'" 1 
ATOM   2030  C  "C5'" . DC  A 1  100 ? 6.318   -33.424 29.849 1.00 88.46  ? 27  DC  I "C5'" 1 
ATOM   2031  C  "C4'" . DC  A 1  100 ? 6.672   -32.388 28.809 1.00 88.66  ? 27  DC  I "C4'" 1 
ATOM   2032  O  "O4'" . DC  A 1  100 ? 7.657   -32.901 27.878 1.00 83.32  ? 27  DC  I "O4'" 1 
ATOM   2033  C  "C3'" . DC  A 1  100 ? 5.499   -31.910 27.950 1.00 94.44  ? 27  DC  I "C3'" 1 
ATOM   2034  O  "O3'" . DC  A 1  100 ? 5.674   -30.511 27.765 1.00 100.67 ? 27  DC  I "O3'" 1 
ATOM   2035  C  "C2'" . DC  A 1  100 ? 5.708   -32.647 26.641 1.00 96.46  ? 27  DC  I "C2'" 1 
ATOM   2036  C  "C1'" . DC  A 1  100 ? 7.220   -32.594 26.560 1.00 93.05  ? 27  DC  I "C1'" 1 
ATOM   2037  N  N1    . DC  A 1  100 ? 7.884   -33.525 25.641 1.00 98.02  ? 27  DC  I N1    1 
ATOM   2038  C  C2    . DC  A 1  100 ? 9.198   -33.245 25.256 1.00 105.09 ? 27  DC  I C2    1 
ATOM   2039  O  O2    . DC  A 1  100 ? 9.733   -32.204 25.664 1.00 99.99  ? 27  DC  I O2    1 
ATOM   2040  N  N3    . DC  A 1  100 ? 9.847   -34.109 24.442 1.00 110.70 ? 27  DC  I N3    1 
ATOM   2041  C  C4    . DC  A 1  100 ? 9.238   -35.222 24.030 1.00 110.84 ? 27  DC  I C4    1 
ATOM   2042  N  N4    . DC  A 1  100 ? 9.915   -36.043 23.225 1.00 117.03 ? 27  DC  I N4    1 
ATOM   2043  C  C5    . DC  A 1  100 ? 7.903   -35.538 24.418 1.00 106.00 ? 27  DC  I C5    1 
ATOM   2044  C  C6    . DC  A 1  100 ? 7.272   -34.674 25.224 1.00 98.74  ? 27  DC  I C6    1 
ATOM   2045  P  P     . DA  A 1  101 ? 4.448   -29.579 27.385 1.00 111.48 ? 28  DA  I P     1 
ATOM   2046  O  OP1   . DA  A 1  101 ? 3.878   -29.069 28.664 1.00 89.96  ? 28  DA  I OP1   1 
ATOM   2047  O  OP2   . DA  A 1  101 ? 3.582   -30.300 26.378 1.00 83.04  ? 28  DA  I OP2   1 
ATOM   2048  O  "O5'" . DA  A 1  101 ? 5.174   -28.360 26.660 1.00 112.47 ? 28  DA  I "O5'" 1 
ATOM   2049  C  "C5'" . DA  A 1  101 ? 6.614   -28.209 26.678 1.00 113.18 ? 28  DA  I "C5'" 1 
ATOM   2050  C  "C4'" . DA  A 1  101 ? 7.133   -28.033 25.270 1.00 114.32 ? 28  DA  I "C4'" 1 
ATOM   2051  O  "O4'" . DA  A 1  101 ? 7.494   -29.323 24.720 1.00 111.45 ? 28  DA  I "O4'" 1 
ATOM   2052  C  "C3'" . DA  A 1  101 ? 6.133   -27.428 24.277 1.00 114.08 ? 28  DA  I "C3'" 1 
ATOM   2053  O  "O3'" . DA  A 1  101 ? 6.806   -26.485 23.435 1.00 120.96 ? 28  DA  I "O3'" 1 
ATOM   2054  C  "C2'" . DA  A 1  101 ? 5.661   -28.634 23.485 1.00 102.64 ? 28  DA  I "C2'" 1 
ATOM   2055  C  "C1'" . DA  A 1  101 ? 6.956   -29.398 23.410 1.00 105.70 ? 28  DA  I "C1'" 1 
ATOM   2056  N  N9    . DA  A 1  101 ? 6.845   -30.804 23.051 1.00 104.50 ? 28  DA  I N9    1 
ATOM   2057  C  C8    . DA  A 1  101 ? 5.878   -31.702 23.424 1.00 108.92 ? 28  DA  I C8    1 
ATOM   2058  N  N7    . DA  A 1  101 ? 6.068   -32.909 22.950 1.00 108.24 ? 28  DA  I N7    1 
ATOM   2059  C  C5    . DA  A 1  101 ? 7.242   -32.799 22.217 1.00 112.51 ? 28  DA  I C5    1 
ATOM   2060  C  C6    . DA  A 1  101 ? 7.980   -33.730 21.465 1.00 110.48 ? 28  DA  I C6    1 
ATOM   2061  N  N6    . DA  A 1  101 ? 7.626   -35.007 21.318 1.00 115.49 ? 28  DA  I N6    1 
ATOM   2062  N  N1    . DA  A 1  101 ? 9.103   -33.295 20.853 1.00 115.25 ? 28  DA  I N1    1 
ATOM   2063  C  C2    . DA  A 1  101 ? 9.454   -32.011 20.996 1.00 117.00 ? 28  DA  I C2    1 
ATOM   2064  N  N3    . DA  A 1  101 ? 8.842   -31.040 21.674 1.00 110.38 ? 28  DA  I N3    1 
ATOM   2065  C  C4    . DA  A 1  101 ? 7.729   -31.506 22.269 1.00 108.97 ? 28  DA  I C4    1 
ATOM   2066  P  P     . DG  A 1  102 ? 5.974   -25.519 22.454 1.00 132.56 ? 29  DG  I P     1 
ATOM   2067  O  OP1   . DG  A 1  102 ? 5.718   -24.235 23.168 1.00 117.80 ? 29  DG  I OP1   1 
ATOM   2068  O  OP2   . DG  A 1  102 ? 4.839   -26.292 21.864 1.00 108.51 ? 29  DG  I OP2   1 
ATOM   2069  O  "O5'" . DG  A 1  102 ? 7.011   -25.233 21.281 1.00 133.57 ? 29  DG  I "O5'" 1 
ATOM   2070  C  "C5'" . DG  A 1  102 ? 8.438   -25.324 21.483 1.00 136.96 ? 29  DG  I "C5'" 1 
ATOM   2071  C  "C4'" . DG  A 1  102 ? 9.130   -25.602 20.169 1.00 137.48 ? 29  DG  I "C4'" 1 
ATOM   2072  O  "O4'" . DG  A 1  102 ? 9.110   -27.027 19.905 1.00 133.16 ? 29  DG  I "O4'" 1 
ATOM   2073  C  "C3'" . DG  A 1  102 ? 8.485   -24.942 18.950 1.00 139.28 ? 29  DG  I "C3'" 1 
ATOM   2074  O  "O3'" . DG  A 1  102 ? 9.501   -24.486 18.045 1.00 146.84 ? 29  DG  I "O3'" 1 
ATOM   2075  C  "C2'" . DG  A 1  102 ? 7.576   -26.035 18.410 1.00 137.08 ? 29  DG  I "C2'" 1 
ATOM   2076  C  "C1'" . DG  A 1  102 ? 8.331   -27.313 18.751 1.00 135.37 ? 29  DG  I "C1'" 1 
ATOM   2077  N  N9    . DG  A 1  102 ? 7.505   -28.482 19.045 1.00 143.20 ? 29  DG  I N9    1 
ATOM   2078  C  C8    . DG  A 1  102 ? 6.310   -28.518 19.725 1.00 148.00 ? 29  DG  I C8    1 
ATOM   2079  N  N7    . DG  A 1  102 ? 5.819   -29.723 19.835 1.00 142.00 ? 29  DG  I N7    1 
ATOM   2080  C  C5    . DG  A 1  102 ? 6.744   -30.531 19.188 1.00 143.57 ? 29  DG  I C5    1 
ATOM   2081  C  C6    . DG  A 1  102 ? 6.752   -31.937 18.980 1.00 136.43 ? 29  DG  I C6    1 
ATOM   2082  O  O6    . DG  A 1  102 ? 5.917   -32.774 19.339 1.00 125.69 ? 29  DG  I O6    1 
ATOM   2083  N  N1    . DG  A 1  102 ? 7.885   -32.344 18.282 1.00 137.39 ? 29  DG  I N1    1 
ATOM   2084  C  C2    . DG  A 1  102 ? 8.881   -31.508 17.837 1.00 137.27 ? 29  DG  I C2    1 
ATOM   2085  N  N2    . DG  A 1  102 ? 9.896   -32.091 17.185 1.00 136.53 ? 29  DG  I N2    1 
ATOM   2086  N  N3    . DG  A 1  102 ? 8.885   -30.199 18.024 1.00 142.83 ? 29  DG  I N3    1 
ATOM   2087  C  C4    . DG  A 1  102 ? 7.793   -29.781 18.700 1.00 146.96 ? 29  DG  I C4    1 
ATOM   2088  P  P     . DT  A 1  103 ? 9.103   -23.661 16.729 1.00 150.86 ? 30  DT  I P     1 
ATOM   2089  O  OP1   . DT  A 1  103 ? 10.365  -23.194 16.100 1.00 146.31 ? 30  DT  I OP1   1 
ATOM   2090  O  OP2   . DT  A 1  103 ? 8.071   -22.665 17.117 1.00 149.02 ? 30  DT  I OP2   1 
ATOM   2091  O  "O5'" . DT  A 1  103 ? 8.393   -24.769 15.825 1.00 136.44 ? 30  DT  I "O5'" 1 
ATOM   2092  C  "C5'" . DT  A 1  103 ? 8.505   -24.820 14.386 1.00 132.23 ? 30  DT  I "C5'" 1 
ATOM   2093  C  "C4'" . DT  A 1  103 ? 8.999   -26.177 13.931 1.00 137.98 ? 30  DT  I "C4'" 1 
ATOM   2094  O  "O4'" . DT  A 1  103 ? 8.573   -27.224 14.825 1.00 140.82 ? 30  DT  I "O4'" 1 
ATOM   2095  C  "C3'" . DT  A 1  103 ? 8.507   -26.631 12.559 1.00 146.14 ? 30  DT  I "C3'" 1 
ATOM   2096  O  "O3'" . DT  A 1  103 ? 9.386   -26.154 11.537 1.00 160.16 ? 30  DT  I "O3'" 1 
ATOM   2097  C  "C2'" . DT  A 1  103 ? 8.554   -28.151 12.645 1.00 141.08 ? 30  DT  I "C2'" 1 
ATOM   2098  C  "C1'" . DT  A 1  103 ? 8.651   -28.468 14.135 1.00 138.30 ? 30  DT  I "C1'" 1 
ATOM   2099  N  N1    . DT  A 1  103 ? 7.577   -29.347 14.647 1.00 147.40 ? 30  DT  I N1    1 
ATOM   2100  C  C2    . DT  A 1  103 ? 7.569   -30.674 14.274 1.00 146.30 ? 30  DT  I C2    1 
ATOM   2101  O  O2    . DT  A 1  103 ? 8.401   -31.165 13.531 1.00 143.77 ? 30  DT  I O2    1 
ATOM   2102  N  N3    . DT  A 1  103 ? 6.539   -31.410 14.805 1.00 151.10 ? 30  DT  I N3    1 
ATOM   2103  C  C4    . DT  A 1  103 ? 5.540   -30.961 15.647 1.00 152.92 ? 30  DT  I C4    1 
ATOM   2104  O  O4    . DT  A 1  103 ? 4.679   -31.741 16.042 1.00 168.73 ? 30  DT  I O4    1 
ATOM   2105  C  C5    . DT  A 1  103 ? 5.612   -29.561 16.000 1.00 141.44 ? 30  DT  I C5    1 
ATOM   2106  C  C7    . DT  A 1  103 ? 4.574   -28.986 16.910 1.00 128.83 ? 30  DT  I C7    1 
ATOM   2107  C  C6    . DT  A 1  103 ? 6.613   -28.834 15.488 1.00 151.75 ? 30  DT  I C6    1 
ATOM   2108  P  P     . DT  A 1  104 ? 8.807   -25.724 10.110 1.00 157.83 ? 31  DT  I P     1 
ATOM   2109  O  OP1   . DT  A 1  104 ? 9.952   -25.294 9.268  1.00 176.51 ? 31  DT  I OP1   1 
ATOM   2110  O  OP2   . DT  A 1  104 ? 7.667   -24.796 10.335 1.00 162.69 ? 31  DT  I OP2   1 
ATOM   2111  O  "O5'" . DT  A 1  104 ? 8.272   -27.098 9.512  1.00 153.68 ? 31  DT  I "O5'" 1 
ATOM   2112  C  "C5'" . DT  A 1  104 ? 9.191   -28.145 9.163  1.00 156.43 ? 31  DT  I "C5'" 1 
ATOM   2113  C  "C4'" . DT  A 1  104 ? 8.429   -29.393 8.788  1.00 161.26 ? 31  DT  I "C4'" 1 
ATOM   2114  O  "O4'" . DT  A 1  104 ? 7.631   -29.845 9.910  1.00 168.99 ? 31  DT  I "O4'" 1 
ATOM   2115  C  "C3'" . DT  A 1  104 ? 7.461   -29.215 7.613  1.00 161.22 ? 31  DT  I "C3'" 1 
ATOM   2116  O  "O3'" . DT  A 1  104 ? 7.715   -30.222 6.630  1.00 167.16 ? 31  DT  I "O3'" 1 
ATOM   2117  C  "C2'" . DT  A 1  104 ? 6.084   -29.365 8.241  1.00 168.28 ? 31  DT  I "C2'" 1 
ATOM   2118  C  "C1'" . DT  A 1  104 ? 6.364   -30.260 9.430  1.00 175.42 ? 31  DT  I "C1'" 1 
ATOM   2119  N  N1    . DT  A 1  104 ? 5.391   -30.140 10.537 1.00 178.30 ? 31  DT  I N1    1 
ATOM   2120  C  C2    . DT  A 1  104 ? 4.681   -31.256 10.923 1.00 167.88 ? 31  DT  I C2    1 
ATOM   2121  O  O2    . DT  A 1  104 ? 4.817   -32.349 10.400 1.00 150.82 ? 31  DT  I O2    1 
ATOM   2122  N  N3    . DT  A 1  104 ? 3.800   -31.044 11.954 1.00 171.18 ? 31  DT  I N3    1 
ATOM   2123  C  C4    . DT  A 1  104 ? 3.563   -29.855 12.619 1.00 180.65 ? 31  DT  I C4    1 
ATOM   2124  O  O4    . DT  A 1  104 ? 2.741   -29.819 13.529 1.00 187.51 ? 31  DT  I O4    1 
ATOM   2125  C  C5    . DT  A 1  104 ? 4.340   -28.725 12.159 1.00 184.03 ? 31  DT  I C5    1 
ATOM   2126  C  C7    . DT  A 1  104 ? 4.153   -27.395 12.822 1.00 173.41 ? 31  DT  I C7    1 
ATOM   2127  C  C6    . DT  A 1  104 ? 5.202   -28.922 11.154 1.00 188.10 ? 31  DT  I C6    1 
ATOM   2128  P  P     . DT  A 1  105 ? 6.876   -30.253 5.274  1.00 167.94 ? 32  DT  I P     1 
ATOM   2129  O  OP1   . DT  A 1  105 ? 7.803   -30.602 4.167  1.00 167.36 ? 32  DT  I OP1   1 
ATOM   2130  O  OP2   . DT  A 1  105 ? 6.084   -29.001 5.203  1.00 161.14 ? 32  DT  I OP2   1 
ATOM   2131  O  "O5'" . DT  A 1  105 ? 5.902   -31.497 5.484  1.00 164.27 ? 32  DT  I "O5'" 1 
ATOM   2132  C  "C5'" . DT  A 1  105 ? 6.431   -32.797 5.801  1.00 158.20 ? 32  DT  I "C5'" 1 
ATOM   2133  C  "C4'" . DT  A 1  105 ? 5.331   -33.831 5.781  1.00 159.42 ? 32  DT  I "C4'" 1 
ATOM   2134  O  "O4'" . DT  A 1  105 ? 4.548   -33.739 6.996  1.00 167.54 ? 32  DT  I "O4'" 1 
ATOM   2135  C  "C3'" . DT  A 1  105 ? 4.333   -33.694 4.631  1.00 159.19 ? 32  DT  I "C3'" 1 
ATOM   2136  O  "O3'" . DT  A 1  105 ? 4.026   -35.008 4.155  1.00 157.24 ? 32  DT  I "O3'" 1 
ATOM   2137  C  "C2'" . DT  A 1  105 ? 3.148   -32.994 5.276  1.00 160.83 ? 32  DT  I "C2'" 1 
ATOM   2138  C  "C1'" . DT  A 1  105 ? 3.173   -33.588 6.675  1.00 164.25 ? 32  DT  I "C1'" 1 
ATOM   2139  N  N1    . DT  A 1  105 ? 2.538   -32.800 7.757  1.00 159.82 ? 32  DT  I N1    1 
ATOM   2140  C  C2    . DT  A 1  105 ? 1.871   -33.488 8.747  1.00 154.89 ? 32  DT  I C2    1 
ATOM   2141  O  O2    . DT  A 1  105 ? 1.750   -34.702 8.750  1.00 150.14 ? 32  DT  I O2    1 
ATOM   2142  N  N3    . DT  A 1  105 ? 1.335   -32.697 9.732  1.00 155.48 ? 32  DT  I N3    1 
ATOM   2143  C  C4    . DT  A 1  105 ? 1.404   -31.320 9.828  1.00 155.87 ? 32  DT  I C4    1 
ATOM   2144  O  O4    . DT  A 1  105 ? 0.869   -30.745 10.773 1.00 147.06 ? 32  DT  I O4    1 
ATOM   2145  C  C5    . DT  A 1  105 ? 2.127   -30.664 8.762  1.00 158.07 ? 32  DT  I C5    1 
ATOM   2146  C  C7    . DT  A 1  105 ? 2.254   -29.173 8.781  1.00 160.48 ? 32  DT  I C7    1 
ATOM   2147  C  C6    . DT  A 1  105 ? 2.657   -31.427 7.798  1.00 157.15 ? 32  DT  I C6    1 
ATOM   2148  P  P     . DC  A 1  106 ? 3.067   -35.205 2.898  1.00 155.04 ? 33  DC  I P     1 
ATOM   2149  O  OP1   . DC  A 1  106 ? 3.388   -36.513 2.270  1.00 149.28 ? 33  DC  I OP1   1 
ATOM   2150  O  OP2   . DC  A 1  106 ? 3.105   -33.960 2.092  1.00 147.76 ? 33  DC  I OP2   1 
ATOM   2151  O  "O5'" . DC  A 1  106 ? 1.623   -35.309 3.560  1.00 167.06 ? 33  DC  I "O5'" 1 
ATOM   2152  C  "C5'" . DC  A 1  106 ? 1.333   -36.280 4.584  1.00 164.74 ? 33  DC  I "C5'" 1 
ATOM   2153  C  "C4'" . DC  A 1  106 ? -0.151  -36.305 4.863  1.00 157.21 ? 33  DC  I "C4'" 1 
ATOM   2154  O  "O4'" . DC  A 1  106 ? -0.509  -35.239 5.777  1.00 154.43 ? 33  DC  I "O4'" 1 
ATOM   2155  C  "C3'" . DC  A 1  106 ? -1.026  -36.106 3.625  1.00 149.15 ? 33  DC  I "C3'" 1 
ATOM   2156  O  "O3'" . DC  A 1  106 ? -2.175  -36.938 3.707  1.00 144.70 ? 33  DC  I "O3'" 1 
ATOM   2157  C  "C2'" . DC  A 1  106 ? -1.428  -34.648 3.702  1.00 150.04 ? 33  DC  I "C2'" 1 
ATOM   2158  C  "C1'" . DC  A 1  106 ? -1.528  -34.431 5.202  1.00 149.45 ? 33  DC  I "C1'" 1 
ATOM   2159  N  N1    . DC  A 1  106 ? -1.321  -33.050 5.666  1.00 147.99 ? 33  DC  I N1    1 
ATOM   2160  C  C2    . DC  A 1  106 ? -1.477  -32.782 7.027  1.00 142.73 ? 33  DC  I C2    1 
ATOM   2161  O  O2    . DC  A 1  106 ? -1.791  -33.711 7.786  1.00 135.40 ? 33  DC  I O2    1 
ATOM   2162  N  N3    . DC  A 1  106 ? -1.284  -31.521 7.480  1.00 147.25 ? 33  DC  I N3    1 
ATOM   2163  C  C4    . DC  A 1  106 ? -0.947  -30.550 6.628  1.00 138.23 ? 33  DC  I C4    1 
ATOM   2164  N  N4    . DC  A 1  106 ? -0.768  -29.321 7.117  1.00 120.64 ? 33  DC  I N4    1 
ATOM   2165  C  C5    . DC  A 1  106 ? -0.774  -30.797 5.235  1.00 147.29 ? 33  DC  I C5    1 
ATOM   2166  C  C6    . DC  A 1  106 ? -0.969  -32.049 4.801  1.00 152.84 ? 33  DC  I C6    1 
ATOM   2167  P  P     . DC  A 1  107 ? -2.204  -38.300 2.904  1.00 135.42 ? 34  DC  I P     1 
ATOM   2168  O  OP1   . DC  A 1  107 ? -1.068  -39.137 3.388  1.00 113.74 ? 34  DC  I OP1   1 
ATOM   2169  O  OP2   . DC  A 1  107 ? -2.301  -37.959 1.463  1.00 130.56 ? 34  DC  I OP2   1 
ATOM   2170  O  "O5'" . DC  A 1  107 ? -3.594  -38.938 3.360  1.00 140.36 ? 34  DC  I "O5'" 1 
ATOM   2171  C  "C5'" . DC  A 1  107 ? -3.838  -39.347 4.729  1.00 123.74 ? 34  DC  I "C5'" 1 
ATOM   2172  C  "C4'" . DC  A 1  107 ? -5.130  -38.758 5.248  1.00 114.81 ? 34  DC  I "C4'" 1 
ATOM   2173  O  "O4'" . DC  A 1  107 ? -4.925  -37.374 5.607  1.00 116.14 ? 34  DC  I "O4'" 1 
ATOM   2174  C  "C3'" . DC  A 1  107 ? -6.312  -38.772 4.267  1.00 117.25 ? 34  DC  I "C3'" 1 
ATOM   2175  O  "O3'" . DC  A 1  107 ? -7.502  -39.280 4.868  1.00 114.14 ? 34  DC  I "O3'" 1 
ATOM   2176  C  "C2'" . DC  A 1  107 ? -6.537  -37.308 3.941  1.00 117.29 ? 34  DC  I "C2'" 1 
ATOM   2177  C  "C1'" . DC  A 1  107 ? -6.073  -36.645 5.221  1.00 123.54 ? 34  DC  I "C1'" 1 
ATOM   2178  N  N1    . DC  A 1  107 ? -5.701  -35.224 5.137  1.00 134.19 ? 34  DC  I N1    1 
ATOM   2179  C  C2    . DC  A 1  107 ? -5.470  -34.531 6.328  1.00 137.22 ? 34  DC  I C2    1 
ATOM   2180  O  O2    . DC  A 1  107 ? -5.589  -35.137 7.405  1.00 135.02 ? 34  DC  I O2    1 
ATOM   2181  N  N3    . DC  A 1  107 ? -5.127  -33.223 6.277  1.00 143.86 ? 34  DC  I N3    1 
ATOM   2182  C  C4    . DC  A 1  107 ? -5.010  -32.610 5.096  1.00 140.43 ? 34  DC  I C4    1 
ATOM   2183  N  N4    . DC  A 1  107 ? -4.672  -31.318 5.092  1.00 134.42 ? 34  DC  I N4    1 
ATOM   2184  C  C5    . DC  A 1  107 ? -5.234  -33.294 3.867  1.00 140.16 ? 34  DC  I C5    1 
ATOM   2185  C  C6    . DC  A 1  107 ? -5.574  -34.588 3.932  1.00 135.66 ? 34  DC  I C6    1 
ATOM   2186  P  P     . DA  A 1  108 ? -7.602  -40.824 5.260  1.00 127.69 ? 35  DA  I P     1 
ATOM   2187  O  OP1   . DA  A 1  108 ? -6.233  -41.321 5.588  1.00 108.59 ? 35  DA  I OP1   1 
ATOM   2188  O  OP2   . DA  A 1  108 ? -8.423  -41.501 4.228  1.00 107.93 ? 35  DA  I OP2   1 
ATOM   2189  O  "O5'" . DA  A 1  108 ? -8.455  -40.800 6.605  1.00 132.47 ? 35  DA  I "O5'" 1 
ATOM   2190  C  "C5'" . DA  A 1  108 ? -7.866  -40.408 7.863  1.00 122.74 ? 35  DA  I "C5'" 1 
ATOM   2191  C  "C4'" . DA  A 1  108 ? -8.825  -39.540 8.644  1.00 110.48 ? 35  DA  I "C4'" 1 
ATOM   2192  O  "O4'" . DA  A 1  108 ? -8.770  -38.191 8.127  1.00 99.26  ? 35  DA  I "O4'" 1 
ATOM   2193  C  "C3'" . DA  A 1  108 ? -10.299 -39.953 8.575  1.00 105.82 ? 35  DA  I "C3'" 1 
ATOM   2194  O  "O3'" . DA  A 1  108 ? -10.884 -39.751 9.870  1.00 108.51 ? 35  DA  I "O3'" 1 
ATOM   2195  C  "C2'" . DA  A 1  108 ? -10.857 -39.023 7.512  1.00 101.39 ? 35  DA  I "C2'" 1 
ATOM   2196  C  "C1'" . DA  A 1  108 ? -10.089 -37.761 7.822  1.00 104.51 ? 35  DA  I "C1'" 1 
ATOM   2197  N  N9    . DA  A 1  108 ? -10.001 -36.801 6.731  1.00 108.68 ? 35  DA  I N9    1 
ATOM   2198  C  C8    . DA  A 1  108 ? -10.212 -37.013 5.393  1.00 114.87 ? 35  DA  I C8    1 
ATOM   2199  N  N7    . DA  A 1  108 ? -10.020 -35.948 4.655  1.00 118.49 ? 35  DA  I N7    1 
ATOM   2200  C  C5    . DA  A 1  108 ? -9.653  -34.971 5.568  1.00 115.73 ? 35  DA  I C5    1 
ATOM   2201  C  C6    . DA  A 1  108 ? -9.310  -33.618 5.417  1.00 125.35 ? 35  DA  I C6    1 
ATOM   2202  N  N6    . DA  A 1  108 ? -9.291  -32.987 4.241  1.00 131.68 ? 35  DA  I N6    1 
ATOM   2203  N  N1    . DA  A 1  108 ? -8.993  -32.921 6.530  1.00 122.60 ? 35  DA  I N1    1 
ATOM   2204  C  C2    . DA  A 1  108 ? -9.018  -33.554 7.709  1.00 124.49 ? 35  DA  I C2    1 
ATOM   2205  N  N3    . DA  A 1  108 ? -9.318  -34.824 7.976  1.00 123.22 ? 35  DA  I N3    1 
ATOM   2206  C  C4    . DA  A 1  108 ? -9.633  -35.484 6.850  1.00 110.30 ? 35  DA  I C4    1 
ATOM   2207  P  P     . DA  A 1  109 ? -12.463 -39.922 10.117 1.00 107.85 ? 36  DA  I P     1 
ATOM   2208  O  OP1   . DA  A 1  109 ? -12.645 -41.009 11.103 1.00 102.37 ? 36  DA  I OP1   1 
ATOM   2209  O  OP2   . DA  A 1  109 ? -13.172 -39.974 8.805  1.00 107.93 ? 36  DA  I OP2   1 
ATOM   2210  O  "O5'" . DA  A 1  109 ? -12.895 -38.537 10.770 1.00 105.67 ? 36  DA  I "O5'" 1 
ATOM   2211  C  "C5'" . DA  A 1  109 ? -11.927 -37.587 11.254 1.00 108.42 ? 36  DA  I "C5'" 1 
ATOM   2212  C  "C4'" . DA  A 1  109 ? -12.469 -36.184 11.119 1.00 107.63 ? 36  DA  I "C4'" 1 
ATOM   2213  O  "O4'" . DA  A 1  109 ? -12.096 -35.642 9.827  1.00 103.02 ? 36  DA  I "O4'" 1 
ATOM   2214  C  "C3'" . DA  A 1  109 ? -13.999 -36.049 11.208 1.00 105.71 ? 36  DA  I "C3'" 1 
ATOM   2215  O  "O3'" . DA  A 1  109 ? -14.339 -34.924 12.034 1.00 100.14 ? 36  DA  I "O3'" 1 
ATOM   2216  C  "C2'" . DA  A 1  109 ? -14.403 -35.780 9.771  1.00 108.48 ? 36  DA  I "C2'" 1 
ATOM   2217  C  "C1'" . DA  A 1  109 ? -13.222 -34.941 9.339  1.00 110.09 ? 36  DA  I "C1'" 1 
ATOM   2218  N  N9    . DA  A 1  109 ? -13.067 -34.753 7.901  1.00 111.13 ? 36  DA  I N9    1 
ATOM   2219  C  C8    . DA  A 1  109 ? -13.311 -35.651 6.893  1.00 113.26 ? 36  DA  I C8    1 
ATOM   2220  N  N7    . DA  A 1  109 ? -13.101 -35.167 5.694  1.00 113.15 ? 36  DA  I N7    1 
ATOM   2221  C  C5    . DA  A 1  109 ? -12.716 -33.854 5.928  1.00 119.26 ? 36  DA  I C5    1 
ATOM   2222  C  C6    . DA  A 1  109 ? -12.359 -32.806 5.064  1.00 122.63 ? 36  DA  I C6    1 
ATOM   2223  N  N6    . DA  A 1  109 ? -12.328 -32.924 3.734  1.00 116.94 ? 36  DA  I N6    1 
ATOM   2224  N  N1    . DA  A 1  109 ? -12.015 -31.623 5.619  1.00 125.86 ? 36  DA  I N1    1 
ATOM   2225  C  C2    . DA  A 1  109 ? -12.039 -31.510 6.953  1.00 117.34 ? 36  DA  I C2    1 
ATOM   2226  N  N3    . DA  A 1  109 ? -12.364 -32.421 7.868  1.00 117.57 ? 36  DA  I N3    1 
ATOM   2227  C  C4    . DA  A 1  109 ? -12.695 -33.585 7.283  1.00 114.74 ? 36  DA  I C4    1 
ATOM   2228  P  P     . DA  A 1  110 ? -15.858 -34.655 12.502 1.00 101.28 ? 37  DA  I P     1 
ATOM   2229  O  OP1   . DA  A 1  110 ? -15.944 -34.937 13.958 1.00 94.31  ? 37  DA  I OP1   1 
ATOM   2230  O  OP2   . DA  A 1  110 ? -16.776 -35.352 11.566 1.00 91.51  ? 37  DA  I OP2   1 
ATOM   2231  O  "O5'" . DA  A 1  110 ? -16.020 -33.084 12.297 1.00 98.99  ? 37  DA  I "O5'" 1 
ATOM   2232  C  "C5'" . DA  A 1  110 ? -15.124 -32.159 12.946 1.00 97.64  ? 37  DA  I "C5'" 1 
ATOM   2233  C  "C4'" . DA  A 1  110 ? -14.995 -30.904 12.118 1.00 95.93  ? 37  DA  I "C4'" 1 
ATOM   2234  O  "O4'" . DA  A 1  110 ? -14.418 -31.262 10.847 1.00 103.18 ? 37  DA  I "O4'" 1 
ATOM   2235  C  "C3'" . DA  A 1  110 ? -16.319 -30.232 11.778 1.00 93.42  ? 37  DA  I "C3'" 1 
ATOM   2236  O  "O3'" . DA  A 1  110 ? -16.638 -29.141 12.639 1.00 82.82  ? 37  DA  I "O3'" 1 
ATOM   2237  C  "C2'" . DA  A 1  110 ? -16.059 -29.611 10.421 1.00 107.89 ? 37  DA  I "C2'" 1 
ATOM   2238  C  "C1'" . DA  A 1  110 ? -14.945 -30.440 9.816  1.00 110.30 ? 37  DA  I "C1'" 1 
ATOM   2239  N  N9    . DA  A 1  110 ? -15.393 -31.304 8.728  1.00 124.91 ? 37  DA  I N9    1 
ATOM   2240  C  C8    . DA  A 1  110 ? -16.059 -32.503 8.798  1.00 126.69 ? 37  DA  I C8    1 
ATOM   2241  N  N7    . DA  A 1  110 ? -16.320 -33.030 7.626  1.00 123.45 ? 37  DA  I N7    1 
ATOM   2242  C  C5    . DA  A 1  110 ? -15.799 -32.113 6.725  1.00 125.13 ? 37  DA  I C5    1 
ATOM   2243  C  C6    . DA  A 1  110 ? -15.757 -32.087 5.323  1.00 123.53 ? 37  DA  I C6    1 
ATOM   2244  N  N6    . DA  A 1  110 ? -16.272 -33.045 4.552  1.00 125.06 ? 37  DA  I N6    1 
ATOM   2245  N  N1    . DA  A 1  110 ? -15.175 -31.021 4.731  1.00 128.95 ? 37  DA  I N1    1 
ATOM   2246  C  C2    . DA  A 1  110 ? -14.667 -30.054 5.507  1.00 133.87 ? 37  DA  I C2    1 
ATOM   2247  N  N3    . DA  A 1  110 ? -14.645 -29.967 6.835  1.00 133.29 ? 37  DA  I N3    1 
ATOM   2248  C  C4    . DA  A 1  110 ? -15.237 -31.039 7.390  1.00 130.95 ? 37  DA  I C4    1 
ATOM   2249  P  P     . DT  A 1  111 ? -18.054 -28.425 12.487 1.00 89.69  ? 38  DT  I P     1 
ATOM   2250  O  OP1   . DT  A 1  111 ? -18.244 -27.485 13.635 1.00 75.86  ? 38  DT  I OP1   1 
ATOM   2251  O  OP2   . DT  A 1  111 ? -19.065 -29.496 12.218 1.00 74.10  ? 38  DT  I OP2   1 
ATOM   2252  O  "O5'" . DT  A 1  111 ? -17.835 -27.467 11.237 1.00 82.19  ? 38  DT  I "O5'" 1 
ATOM   2253  C  "C5'" . DT  A 1  111 ? -16.910 -26.371 11.346 1.00 104.80 ? 38  DT  I "C5'" 1 
ATOM   2254  C  "C4'" . DT  A 1  111 ? -16.796 -25.631 10.034 1.00 113.04 ? 38  DT  I "C4'" 1 
ATOM   2255  O  "O4'" . DT  A 1  111 ? -16.543 -26.558 8.948  1.00 114.74 ? 38  DT  I "O4'" 1 
ATOM   2256  C  "C3'" . DT  A 1  111 ? -18.041 -24.833 9.646  1.00 113.51 ? 38  DT  I "C3'" 1 
ATOM   2257  O  "O3'" . DT  A 1  111 ? -17.634 -23.519 9.247  1.00 121.58 ? 38  DT  I "O3'" 1 
ATOM   2258  C  "C2'" . DT  A 1  111 ? -18.664 -25.659 8.534  1.00 115.93 ? 38  DT  I "C2'" 1 
ATOM   2259  C  "C1'" . DT  A 1  111 ? -17.461 -26.332 7.892  1.00 120.24 ? 38  DT  I "C1'" 1 
ATOM   2260  N  N1    . DT  A 1  111 ? -17.740 -27.636 7.250  1.00 124.86 ? 38  DT  I N1    1 
ATOM   2261  C  C2    . DT  A 1  111 ? -17.363 -27.841 5.938  1.00 125.46 ? 38  DT  I C2    1 
ATOM   2262  O  O2    . DT  A 1  111 ? -16.814 -26.989 5.257  1.00 116.94 ? 38  DT  I O2    1 
ATOM   2263  N  N3    . DT  A 1  111 ? -17.664 -29.088 5.446  1.00 121.04 ? 38  DT  I N3    1 
ATOM   2264  C  C4    . DT  A 1  111 ? -18.287 -30.123 6.119  1.00 119.39 ? 38  DT  I C4    1 
ATOM   2265  O  O4    . DT  A 1  111 ? -18.488 -31.189 5.546  1.00 109.71 ? 38  DT  I O4    1 
ATOM   2266  C  C5    . DT  A 1  111 ? -18.653 -29.838 7.488  1.00 119.45 ? 38  DT  I C5    1 
ATOM   2267  C  C7    . DT  A 1  111 ? -19.335 -30.898 8.293  1.00 121.42 ? 38  DT  I C7    1 
ATOM   2268  C  C6    . DT  A 1  111 ? -18.367 -28.626 7.977  1.00 116.56 ? 38  DT  I C6    1 
ATOM   2269  P  P     . DA  A 1  112 ? -18.718 -22.414 8.843  1.00 127.08 ? 39  DA  I P     1 
ATOM   2270  O  OP1   . DA  A 1  112 ? -18.031 -21.097 8.825  1.00 129.77 ? 39  DA  I OP1   1 
ATOM   2271  O  OP2   . DA  A 1  112 ? -19.914 -22.598 9.708  1.00 103.88 ? 39  DA  I OP2   1 
ATOM   2272  O  "O5'" . DA  A 1  112 ? -19.061 -22.780 7.325  1.00 148.13 ? 39  DA  I "O5'" 1 
ATOM   2273  C  "C5'" . DA  A 1  112 ? -18.044 -22.767 6.285  1.00 147.28 ? 39  DA  I "C5'" 1 
ATOM   2274  C  "C4'" . DA  A 1  112 ? -18.658 -22.708 4.902  1.00 141.42 ? 39  DA  I "C4'" 1 
ATOM   2275  O  "O4'" . DA  A 1  112 ? -18.878 -24.047 4.395  1.00 133.56 ? 39  DA  I "O4'" 1 
ATOM   2276  C  "C3'" . DA  A 1  112 ? -20.011 -21.998 4.802  1.00 140.24 ? 39  DA  I "C3'" 1 
ATOM   2277  O  "O3'" . DA  A 1  112 ? -20.112 -21.249 3.588  1.00 147.79 ? 39  DA  I "O3'" 1 
ATOM   2278  C  "C2'" . DA  A 1  112 ? -21.005 -23.141 4.808  1.00 132.70 ? 39  DA  I "C2'" 1 
ATOM   2279  C  "C1'" . DA  A 1  112 ? -20.250 -24.227 4.070  1.00 132.77 ? 39  DA  I "C1'" 1 
ATOM   2280  N  N9    . DA  A 1  112 ? -20.633 -25.572 4.484  1.00 139.07 ? 39  DA  I N9    1 
ATOM   2281  C  C8    . DA  A 1  112 ? -20.797 -26.035 5.766  1.00 144.32 ? 39  DA  I C8    1 
ATOM   2282  N  N7    . DA  A 1  112 ? -21.146 -27.296 5.831  1.00 143.68 ? 39  DA  I N7    1 
ATOM   2283  C  C5    . DA  A 1  112 ? -21.223 -27.689 4.503  1.00 143.28 ? 39  DA  I C5    1 
ATOM   2284  C  C6    . DA  A 1  112 ? -21.549 -28.914 3.898  1.00 146.58 ? 39  DA  I C6    1 
ATOM   2285  N  N6    . DA  A 1  112 ? -21.871 -30.014 4.582  1.00 146.89 ? 39  DA  I N6    1 
ATOM   2286  N  N1    . DA  A 1  112 ? -21.537 -28.971 2.549  1.00 156.88 ? 39  DA  I N1    1 
ATOM   2287  C  C2    . DA  A 1  112 ? -21.217 -27.865 1.863  1.00 160.77 ? 39  DA  I C2    1 
ATOM   2288  N  N3    . DA  A 1  112 ? -20.887 -26.658 2.319  1.00 154.23 ? 39  DA  I N3    1 
ATOM   2289  C  C4    . DA  A 1  112 ? -20.911 -26.636 3.663  1.00 145.76 ? 39  DA  I C4    1 
ATOM   2290  P  P     . DC  A 1  113 ? -21.276 -20.165 3.408  1.00 142.30 ? 40  DC  I P     1 
ATOM   2291  O  OP1   . DC  A 1  113 ? -21.396 -19.881 1.958  1.00 145.59 ? 40  DC  I OP1   1 
ATOM   2292  O  OP2   . DC  A 1  113 ? -21.027 -19.046 4.350  1.00 132.20 ? 40  DC  I OP2   1 
ATOM   2293  O  "O5'" . DC  A 1  113 ? -22.562 -20.931 3.949  1.00 135.56 ? 40  DC  I "O5'" 1 
ATOM   2294  C  "C5'" . DC  A 1  113 ? -23.808 -20.854 3.251  1.00 135.59 ? 40  DC  I "C5'" 1 
ATOM   2295  C  "C4'" . DC  A 1  113 ? -23.656 -21.327 1.824  1.00 132.57 ? 40  DC  I "C4'" 1 
ATOM   2296  O  "O4'" . DC  A 1  113 ? -23.133 -22.676 1.771  1.00 121.07 ? 40  DC  I "O4'" 1 
ATOM   2297  C  "C3'" . DC  A 1  113 ? -24.979 -21.355 1.072  1.00 136.48 ? 40  DC  I "C3'" 1 
ATOM   2298  O  "O3'" . DC  A 1  113 ? -24.859 -20.914 -0.273 1.00 138.34 ? 40  DC  I "O3'" 1 
ATOM   2299  C  "C2'" . DC  A 1  113 ? -25.399 -22.806 1.133  1.00 133.41 ? 40  DC  I "C2'" 1 
ATOM   2300  C  "C1'" . DC  A 1  113 ? -24.093 -23.566 1.216  1.00 127.29 ? 40  DC  I "C1'" 1 
ATOM   2301  N  N1    . DC  A 1  113 ? -24.229 -24.712 2.119  1.00 126.80 ? 40  DC  I N1    1 
ATOM   2302  C  C2    . DC  A 1  113 ? -24.204 -26.006 1.590  1.00 123.85 ? 40  DC  I C2    1 
ATOM   2303  O  O2    . DC  A 1  113 ? -24.001 -26.155 0.378  1.00 122.35 ? 40  DC  I O2    1 
ATOM   2304  N  N3    . DC  A 1  113 ? -24.372 -27.061 2.419  1.00 129.83 ? 40  DC  I N3    1 
ATOM   2305  C  C4    . DC  A 1  113 ? -24.585 -26.858 3.722  1.00 128.40 ? 40  DC  I C4    1 
ATOM   2306  N  N4    . DC  A 1  113 ? -24.742 -27.926 4.504  1.00 129.62 ? 40  DC  I N4    1 
ATOM   2307  C  C5    . DC  A 1  113 ? -24.648 -25.549 4.280  1.00 124.33 ? 40  DC  I C5    1 
ATOM   2308  C  C6    . DC  A 1  113 ? -24.480 -24.515 3.449  1.00 125.15 ? 40  DC  I C6    1 
ATOM   2309  P  P     . DA  A 1  114 ? -26.176 -20.529 -1.051 1.00 143.17 ? 41  DA  I P     1 
ATOM   2310  O  OP1   . DA  A 1  114 ? -25.781 -19.796 -2.274 1.00 166.50 ? 41  DA  I OP1   1 
ATOM   2311  O  OP2   . DA  A 1  114 ? -27.117 -19.913 -0.086 1.00 127.60 ? 41  DA  I OP2   1 
ATOM   2312  O  "O5'" . DA  A 1  114 ? -26.762 -21.944 -1.473 1.00 137.95 ? 41  DA  I "O5'" 1 
ATOM   2313  C  "C5'" . DA  A 1  114 ? -26.032 -22.790 -2.373 1.00 145.97 ? 41  DA  I "C5'" 1 
ATOM   2314  C  "C4'" . DA  A 1  114 ? -26.858 -24.013 -2.686 1.00 151.37 ? 41  DA  I "C4'" 1 
ATOM   2315  O  "O4'" . DA  A 1  114 ? -26.750 -24.954 -1.589 1.00 155.00 ? 41  DA  I "O4'" 1 
ATOM   2316  C  "C3'" . DA  A 1  114 ? -28.358 -23.753 -2.849 1.00 158.82 ? 41  DA  I "C3'" 1 
ATOM   2317  O  "O3'" . DA  A 1  114 ? -28.846 -24.708 -3.801 1.00 166.75 ? 41  DA  I "O3'" 1 
ATOM   2318  C  "C2'" . DA  A 1  114 ? -28.888 -24.042 -1.459 1.00 153.60 ? 41  DA  I "C2'" 1 
ATOM   2319  C  "C1'" . DA  A 1  114 ? -28.063 -25.270 -1.153 1.00 155.35 ? 41  DA  I "C1'" 1 
ATOM   2320  N  N9    . DA  A 1  114 ? -28.003 -25.668 0.249  1.00 151.25 ? 41  DA  I N9    1 
ATOM   2321  C  C8    . DA  A 1  114 ? -27.876 -24.887 1.371  1.00 147.69 ? 41  DA  I C8    1 
ATOM   2322  N  N7    . DA  A 1  114 ? -27.871 -25.569 2.490  1.00 139.69 ? 41  DA  I N7    1 
ATOM   2323  C  C5    . DA  A 1  114 ? -28.024 -26.885 2.077  1.00 144.66 ? 41  DA  I C5    1 
ATOM   2324  C  C6    . DA  A 1  114 ? -28.102 -28.094 2.786  1.00 142.79 ? 41  DA  I C6    1 
ATOM   2325  N  N6    . DA  A 1  114 ? -28.034 -28.174 4.115  1.00 137.53 ? 41  DA  I N6    1 
ATOM   2326  N  N1    . DA  A 1  114 ? -28.256 -29.233 2.073  1.00 141.65 ? 41  DA  I N1    1 
ATOM   2327  C  C2    . DA  A 1  114 ? -28.328 -29.149 0.738  1.00 133.81 ? 41  DA  I C2    1 
ATOM   2328  N  N3    . DA  A 1  114 ? -28.261 -28.072 -0.041 1.00 135.30 ? 41  DA  I N3    1 
ATOM   2329  C  C4    . DA  A 1  114 ? -28.113 -26.959 0.700  1.00 143.09 ? 41  DA  I C4    1 
ATOM   2330  P  P     . DC  A 1  115 ? -30.396 -24.770 -4.221 1.00 160.01 ? 42  DC  I P     1 
ATOM   2331  O  OP1   . DC  A 1  115 ? -30.556 -23.979 -5.462 1.00 144.87 ? 42  DC  I OP1   1 
ATOM   2332  O  OP2   . DC  A 1  115 ? -31.242 -24.460 -3.029 1.00 136.31 ? 42  DC  I OP2   1 
ATOM   2333  O  "O5'" . DC  A 1  115 ? -30.591 -26.298 -4.632 1.00 164.66 ? 42  DC  I "O5'" 1 
ATOM   2334  C  "C5'" . DC  A 1  115 ? -29.811 -27.362 -4.041 1.00 168.61 ? 42  DC  I "C5'" 1 
ATOM   2335  C  "C4'" . DC  A 1  115 ? -30.702 -28.358 -3.332 1.00 175.22 ? 42  DC  I "C4'" 1 
ATOM   2336  O  "O4'" . DC  A 1  115 ? -30.492 -28.291 -1.897 1.00 181.83 ? 42  DC  I "O4'" 1 
ATOM   2337  C  "C3'" . DC  A 1  115 ? -32.212 -28.182 -3.547 1.00 171.81 ? 42  DC  I "C3'" 1 
ATOM   2338  O  "O3'" . DC  A 1  115 ? -32.804 -29.460 -3.811 1.00 161.75 ? 42  DC  I "O3'" 1 
ATOM   2339  C  "C2'" . DC  A 1  115 ? -32.692 -27.615 -2.223 1.00 170.24 ? 42  DC  I "C2'" 1 
ATOM   2340  C  "C1'" . DC  A 1  115 ? -31.761 -28.332 -1.267 1.00 177.48 ? 42  DC  I "C1'" 1 
ATOM   2341  N  N1    . DC  A 1  115 ? -31.634 -27.765 0.091  1.00 175.65 ? 42  DC  I N1    1 
ATOM   2342  C  C2    . DC  A 1  115 ? -31.440 -28.645 1.161  1.00 159.35 ? 42  DC  I C2    1 
ATOM   2343  O  O2    . DC  A 1  115 ? -31.349 -29.861 0.930  1.00 139.21 ? 42  DC  I O2    1 
ATOM   2344  N  N3    . DC  A 1  115 ? -31.346 -28.149 2.417  1.00 154.99 ? 42  DC  I N3    1 
ATOM   2345  C  C4    . DC  A 1  115 ? -31.446 -26.834 2.624  1.00 153.91 ? 42  DC  I C4    1 
ATOM   2346  N  N4    . DC  A 1  115 ? -31.344 -26.390 3.877  1.00 143.46 ? 42  DC  I N4    1 
ATOM   2347  C  C5    . DC  A 1  115 ? -31.652 -25.916 1.553  1.00 166.19 ? 42  DC  I C5    1 
ATOM   2348  C  C6    . DC  A 1  115 ? -31.746 -26.420 0.315  1.00 175.72 ? 42  DC  I C6    1 
ATOM   2349  P  P     . DT  A 1  116 ? -34.356 -29.577 -4.194 1.00 149.57 ? 43  DT  I P     1 
ATOM   2350  O  OP1   . DT  A 1  116 ? -34.456 -30.218 -5.535 1.00 145.60 ? 43  DT  I OP1   1 
ATOM   2351  O  OP2   . DT  A 1  116 ? -34.991 -28.257 -3.947 1.00 143.59 ? 43  DT  I OP2   1 
ATOM   2352  O  "O5'" . DT  A 1  116 ? -34.917 -30.619 -3.127 1.00 149.96 ? 43  DT  I "O5'" 1 
ATOM   2353  C  "C5'" . DT  A 1  116 ? -34.257 -31.885 -2.931 1.00 158.32 ? 43  DT  I "C5'" 1 
ATOM   2354  C  "C4'" . DT  A 1  116 ? -34.833 -32.606 -1.735 1.00 154.71 ? 43  DT  I "C4'" 1 
ATOM   2355  O  "O4'" . DT  A 1  116 ? -34.439 -31.936 -0.509 1.00 158.04 ? 43  DT  I "O4'" 1 
ATOM   2356  C  "C3'" . DT  A 1  116 ? -36.362 -32.679 -1.714 1.00 144.87 ? 43  DT  I "C3'" 1 
ATOM   2357  O  "O3'" . DT  A 1  116 ? -36.746 -34.040 -1.460 1.00 139.19 ? 43  DT  I "O3'" 1 
ATOM   2358  C  "C2'" . DT  A 1  116 ? -36.747 -31.637 -0.675 1.00 145.48 ? 43  DT  I "C2'" 1 
ATOM   2359  C  "C1'" . DT  A 1  116 ? -35.584 -31.715 0.299  1.00 151.27 ? 43  DT  I "C1'" 1 
ATOM   2360  N  N1    . DT  A 1  116 ? -35.338 -30.511 1.140  1.00 142.88 ? 43  DT  I N1    1 
ATOM   2361  C  C2    . DT  A 1  116 ? -35.112 -30.695 2.487  1.00 122.30 ? 43  DT  I C2    1 
ATOM   2362  O  O2    . DT  A 1  116 ? -35.108 -31.792 3.020  1.00 116.52 ? 43  DT  I O2    1 
ATOM   2363  N  N3    . DT  A 1  116 ? -34.899 -29.538 3.195  1.00 118.04 ? 43  DT  I N3    1 
ATOM   2364  C  C4    . DT  A 1  116 ? -34.883 -28.247 2.701  1.00 132.73 ? 43  DT  I C4    1 
ATOM   2365  O  O4    . DT  A 1  116 ? -34.665 -27.305 3.459  1.00 124.74 ? 43  DT  I O4    1 
ATOM   2366  C  C5    . DT  A 1  116 ? -35.125 -28.128 1.281  1.00 142.04 ? 43  DT  I C5    1 
ATOM   2367  C  C7    . DT  A 1  116 ? -35.132 -26.768 0.656  1.00 140.60 ? 43  DT  I C7    1 
ATOM   2368  C  C6    . DT  A 1  116 ? -35.337 -29.250 0.581  1.00 143.08 ? 43  DT  I C6    1 
ATOM   2369  P  P     . DT  A 1  117 ? -38.088 -34.378 -0.647 1.00 148.19 ? 44  DT  I P     1 
ATOM   2370  O  OP1   . DT  A 1  117 ? -38.379 -35.827 -0.806 1.00 134.07 ? 44  DT  I OP1   1 
ATOM   2371  O  OP2   . DT  A 1  117 ? -39.129 -33.390 -1.028 1.00 142.27 ? 44  DT  I OP2   1 
ATOM   2372  O  "O5'" . DT  A 1  117 ? -37.653 -34.095 0.858  1.00 153.74 ? 44  DT  I "O5'" 1 
ATOM   2373  C  "C5'" . DT  A 1  117 ? -36.744 -34.969 1.557  1.00 145.05 ? 44  DT  I "C5'" 1 
ATOM   2374  C  "C4'" . DT  A 1  117 ? -37.243 -35.192 2.964  1.00 135.96 ? 44  DT  I "C4'" 1 
ATOM   2375  O  "O4'" . DT  A 1  117 ? -37.045 -33.981 3.726  1.00 130.48 ? 44  DT  I "O4'" 1 
ATOM   2376  C  "C3'" . DT  A 1  117 ? -38.731 -35.550 3.068  1.00 129.01 ? 44  DT  I "C3'" 1 
ATOM   2377  O  "O3'" . DT  A 1  117 ? -38.825 -36.862 3.659  1.00 119.32 ? 44  DT  I "O3'" 1 
ATOM   2378  C  "C2'" . DT  A 1  117 ? -39.381 -34.311 3.676  1.00 125.36 ? 44  DT  I "C2'" 1 
ATOM   2379  C  "C1'" . DT  A 1  117 ? -38.241 -33.577 4.369  1.00 129.49 ? 44  DT  I "C1'" 1 
ATOM   2380  N  N1    . DT  A 1  117 ? -38.287 -32.101 4.323  1.00 126.44 ? 44  DT  I N1    1 
ATOM   2381  C  C2    . DT  A 1  117 ? -38.200 -31.409 5.511  1.00 132.91 ? 44  DT  I C2    1 
ATOM   2382  O  O2    . DT  A 1  117 ? -38.138 -31.956 6.600  1.00 138.34 ? 44  DT  I O2    1 
ATOM   2383  N  N3    . DT  A 1  117 ? -38.209 -30.043 5.378  1.00 124.53 ? 44  DT  I N3    1 
ATOM   2384  C  C4    . DT  A 1  117 ? -38.261 -29.320 4.203  1.00 118.04 ? 44  DT  I C4    1 
ATOM   2385  O  O4    . DT  A 1  117 ? -38.248 -28.095 4.238  1.00 118.40 ? 44  DT  I O4    1 
ATOM   2386  C  C5    . DT  A 1  117 ? -38.329 -30.108 2.996  1.00 124.13 ? 44  DT  I C5    1 
ATOM   2387  C  C7    . DT  A 1  117 ? -38.407 -29.406 1.677  1.00 125.34 ? 44  DT  I C7    1 
ATOM   2388  C  C6    . DT  A 1  117 ? -38.327 -31.442 3.113  1.00 125.04 ? 44  DT  I C6    1 
ATOM   2389  P  P     . DT  A 1  118 ? -39.618 -37.152 5.027  1.00 124.03 ? 45  DT  I P     1 
ATOM   2390  O  OP1   . DT  A 1  118 ? -39.325 -38.556 5.417  1.00 120.31 ? 45  DT  I OP1   1 
ATOM   2391  O  OP2   . DT  A 1  118 ? -41.032 -36.714 4.851  1.00 98.19  ? 45  DT  I OP2   1 
ATOM   2392  O  "O5'" . DT  A 1  118 ? -38.880 -36.208 6.083  1.00 141.66 ? 45  DT  I "O5'" 1 
ATOM   2393  C  "C5'" . DT  A 1  118 ? -38.409 -36.684 7.369  1.00 130.72 ? 45  DT  I "C5'" 1 
ATOM   2394  C  "C4'" . DT  A 1  118 ? -38.969 -35.834 8.488  1.00 121.78 ? 45  DT  I "C4'" 1 
ATOM   2395  O  "O4'" . DT  A 1  118 ? -39.008 -34.450 8.080  1.00 118.23 ? 45  DT  I "O4'" 1 
ATOM   2396  C  "C3'" . DT  A 1  118 ? -40.411 -36.168 8.873  1.00 126.08 ? 45  DT  I "C3'" 1 
ATOM   2397  O  "O3'" . DT  A 1  118 ? -40.583 -37.223 9.848  1.00 129.62 ? 45  DT  I "O3'" 1 
ATOM   2398  C  "C2'" . DT  A 1  118 ? -41.026 -34.822 9.238  1.00 128.10 ? 45  DT  I "C2'" 1 
ATOM   2399  C  "C1'" . DT  A 1  118 ? -39.955 -33.788 8.902  1.00 128.28 ? 45  DT  I "C1'" 1 
ATOM   2400  N  N1    . DT  A 1  118 ? -40.456 -32.604 8.172  1.00 127.57 ? 45  DT  I N1    1 
ATOM   2401  C  C2    . DT  A 1  118 ? -40.444 -31.381 8.807  1.00 127.13 ? 45  DT  I C2    1 
ATOM   2402  O  O2    . DT  A 1  118 ? -40.032 -31.221 9.943  1.00 122.03 ? 45  DT  I O2    1 
ATOM   2403  N  N3    . DT  A 1  118 ? -40.932 -30.342 8.056  1.00 131.01 ? 45  DT  I N3    1 
ATOM   2404  C  C4    . DT  A 1  118 ? -41.423 -30.403 6.767  1.00 129.05 ? 45  DT  I C4    1 
ATOM   2405  O  O4    . DT  A 1  118 ? -41.827 -29.382 6.219  1.00 114.46 ? 45  DT  I O4    1 
ATOM   2406  C  C5    . DT  A 1  118 ? -41.413 -31.718 6.164  1.00 132.08 ? 45  DT  I C5    1 
ATOM   2407  C  C7    . DT  A 1  118 ? -41.925 -31.883 4.769  1.00 126.83 ? 45  DT  I C7    1 
ATOM   2408  C  C6    . DT  A 1  118 ? -40.941 -32.740 6.890  1.00 131.80 ? 45  DT  I C6    1 
ATOM   2409  P  P     . DT  A 1  119 ? -39.874 -37.228 11.314 1.00 127.41 ? 46  DT  I P     1 
ATOM   2410  O  OP1   . DT  A 1  119 ? -38.526 -37.859 11.171 1.00 107.40 ? 46  DT  I OP1   1 
ATOM   2411  O  OP2   . DT  A 1  119 ? -40.855 -37.794 12.285 1.00 100.10 ? 46  DT  I OP2   1 
ATOM   2412  O  "O5'" . DT  A 1  119 ? -39.729 -35.684 11.690 1.00 139.90 ? 46  DT  I "O5'" 1 
ATOM   2413  C  "C5'" . DT  A 1  119 ? -38.683 -35.214 12.570 1.00 129.06 ? 46  DT  I "C5'" 1 
ATOM   2414  C  "C4'" . DT  A 1  119 ? -39.188 -34.127 13.493 1.00 122.20 ? 46  DT  I "C4'" 1 
ATOM   2415  O  "O4'" . DT  A 1  119 ? -39.918 -33.105 12.765 1.00 121.47 ? 46  DT  I "O4'" 1 
ATOM   2416  C  "C3'" . DT  A 1  119 ? -40.123 -34.582 14.615 1.00 122.41 ? 46  DT  I "C3'" 1 
ATOM   2417  O  "O3'" . DT  A 1  119 ? -39.812 -33.744 15.722 1.00 118.54 ? 46  DT  I "O3'" 1 
ATOM   2418  C  "C2'" . DT  A 1  119 ? -41.499 -34.201 14.096 1.00 127.69 ? 46  DT  I "C2'" 1 
ATOM   2419  C  "C1'" . DT  A 1  119 ? -41.181 -32.887 13.394 1.00 129.12 ? 46  DT  I "C1'" 1 
ATOM   2420  N  N1    . DT  A 1  119 ? -42.132 -32.402 12.357 1.00 129.99 ? 46  DT  I N1    1 
ATOM   2421  C  C2    . DT  A 1  119 ? -42.221 -31.041 12.148 1.00 124.35 ? 46  DT  I C2    1 
ATOM   2422  O  O2    . DT  A 1  119 ? -41.592 -30.224 12.797 1.00 109.06 ? 46  DT  I O2    1 
ATOM   2423  N  N3    . DT  A 1  119 ? -43.089 -30.671 11.150 1.00 136.25 ? 46  DT  I N3    1 
ATOM   2424  C  C4    . DT  A 1  119 ? -43.856 -31.504 10.358 1.00 142.40 ? 46  DT  I C4    1 
ATOM   2425  O  O4    . DT  A 1  119 ? -44.595 -31.025 9.502  1.00 137.24 ? 46  DT  I O4    1 
ATOM   2426  C  C5    . DT  A 1  119 ? -43.711 -32.918 10.630 1.00 140.72 ? 46  DT  I C5    1 
ATOM   2427  C  C7    . DT  A 1  119 ? -44.503 -33.898 9.823  1.00 135.23 ? 46  DT  I C7    1 
ATOM   2428  C  C6    . DT  A 1  119 ? -42.868 -33.290 11.601 1.00 137.95 ? 46  DT  I C6    1 
ATOM   2429  P  P     . DG  A 1  120 ? -39.613 -34.316 17.185 1.00 111.80 ? 47  DG  I P     1 
ATOM   2430  O  OP1   . DG  A 1  120 ? -38.229 -34.844 17.310 1.00 82.71  ? 47  DG  I OP1   1 
ATOM   2431  O  OP2   . DG  A 1  120 ? -40.798 -35.161 17.522 1.00 98.37  ? 47  DG  I OP2   1 
ATOM   2432  O  "O5'" . DG  A 1  120 ? -39.575 -32.971 18.035 1.00 101.04 ? 47  DG  I "O5'" 1 
ATOM   2433  C  "C5'" . DG  A 1  120 ? -38.944 -31.785 17.505 1.00 92.23  ? 47  DG  I "C5'" 1 
ATOM   2434  C  "C4'" . DG  A 1  120 ? -39.820 -30.577 17.733 1.00 95.31  ? 47  DG  I "C4'" 1 
ATOM   2435  O  "O4'" . DG  A 1  120 ? -40.880 -30.538 16.747 1.00 105.49 ? 47  DG  I "O4'" 1 
ATOM   2436  C  "C3'" . DG  A 1  120 ? -40.507 -30.527 19.101 1.00 101.32 ? 47  DG  I "C3'" 1 
ATOM   2437  O  "O3'" . DG  A 1  120 ? -40.411 -29.205 19.628 1.00 90.47  ? 47  DG  I "O3'" 1 
ATOM   2438  C  "C2'" . DG  A 1  120 ? -41.945 -30.920 18.805 1.00 104.97 ? 47  DG  I "C2'" 1 
ATOM   2439  C  "C1'" . DG  A 1  120 ? -42.143 -30.406 17.391 1.00 113.01 ? 47  DG  I "C1'" 1 
ATOM   2440  N  N9    . DG  A 1  120 ? -43.128 -31.130 16.593 1.00 120.95 ? 47  DG  I N9    1 
ATOM   2441  C  C8    . DG  A 1  120 ? -43.551 -32.428 16.751 1.00 124.52 ? 47  DG  I C8    1 
ATOM   2442  N  N7    . DG  A 1  120 ? -44.429 -32.793 15.858 1.00 117.46 ? 47  DG  I N7    1 
ATOM   2443  C  C5    . DG  A 1  120 ? -44.591 -31.671 15.059 1.00 124.01 ? 47  DG  I C5    1 
ATOM   2444  C  C6    . DG  A 1  120 ? -45.413 -31.465 13.924 1.00 128.72 ? 47  DG  I C6    1 
ATOM   2445  O  O6    . DG  A 1  120 ? -46.193 -32.259 13.385 1.00 123.70 ? 47  DG  I O6    1 
ATOM   2446  N  N1    . DG  A 1  120 ? -45.270 -30.177 13.416 1.00 130.80 ? 47  DG  I N1    1 
ATOM   2447  C  C2    . DG  A 1  120 ? -44.440 -29.212 13.933 1.00 131.31 ? 47  DG  I C2    1 
ATOM   2448  N  N2    . DG  A 1  120 ? -44.439 -28.030 13.304 1.00 133.73 ? 47  DG  I N2    1 
ATOM   2449  N  N3    . DG  A 1  120 ? -43.665 -29.395 14.988 1.00 135.39 ? 47  DG  I N3    1 
ATOM   2450  C  C4    . DG  A 1  120 ? -43.792 -30.637 15.498 1.00 125.53 ? 47  DG  I C4    1 
ATOM   2451  P  P     . DG  A 1  121 ? -40.780 -28.908 21.143 1.00 85.15  ? 48  DG  I P     1 
ATOM   2452  O  OP1   . DG  A 1  121 ? -39.536 -28.447 21.809 1.00 84.82  ? 48  DG  I OP1   1 
ATOM   2453  O  OP2   . DG  A 1  121 ? -41.519 -30.076 21.694 1.00 76.08  ? 48  DG  I OP2   1 
ATOM   2454  O  "O5'" . DG  A 1  121 ? -41.796 -27.684 21.010 1.00 90.29  ? 48  DG  I "O5'" 1 
ATOM   2455  C  "C5'" . DG  A 1  121 ? -41.474 -26.558 20.158 1.00 97.33  ? 48  DG  I "C5'" 1 
ATOM   2456  C  "C4'" . DG  A 1  121 ? -42.722 -25.860 19.665 1.00 96.47  ? 48  DG  I "C4'" 1 
ATOM   2457  O  "O4'" . DG  A 1  121 ? -43.394 -26.647 18.649 1.00 94.96  ? 48  DG  I "O4'" 1 
ATOM   2458  C  "C3'" . DG  A 1  121 ? -43.772 -25.577 20.739 1.00 93.70  ? 48  DG  I "C3'" 1 
ATOM   2459  O  "O3'" . DG  A 1  121 ? -44.249 -24.246 20.567 1.00 91.24  ? 48  DG  I "O3'" 1 
ATOM   2460  C  "C2'" . DG  A 1  121 ? -44.870 -26.580 20.437 1.00 98.72  ? 48  DG  I "C2'" 1 
ATOM   2461  C  "C1'" . DG  A 1  121 ? -44.780 -26.615 18.929 1.00 103.22 ? 48  DG  I "C1'" 1 
ATOM   2462  N  N9    . DG  A 1  121 ? -45.414 -27.741 18.250 1.00 110.86 ? 48  DG  I N9    1 
ATOM   2463  C  C8    . DG  A 1  121 ? -45.435 -29.064 18.622 1.00 114.96 ? 48  DG  I C8    1 
ATOM   2464  N  N7    . DG  A 1  121 ? -46.108 -29.818 17.795 1.00 111.62 ? 48  DG  I N7    1 
ATOM   2465  C  C5    . DG  A 1  121 ? -46.557 -28.939 16.819 1.00 125.98 ? 48  DG  I C5    1 
ATOM   2466  C  C6    . DG  A 1  121 ? -47.342 -29.174 15.658 1.00 135.99 ? 48  DG  I C6    1 
ATOM   2467  O  O6    . DG  A 1  121 ? -47.808 -30.242 15.246 1.00 135.68 ? 48  DG  I O6    1 
ATOM   2468  N  N1    . DG  A 1  121 ? -47.568 -27.998 14.948 1.00 143.84 ? 48  DG  I N1    1 
ATOM   2469  C  C2    . DG  A 1  121 ? -47.104 -26.755 15.307 1.00 140.08 ? 48  DG  I C2    1 
ATOM   2470  N  N2    . DG  A 1  121 ? -47.430 -25.740 14.493 1.00 133.16 ? 48  DG  I N2    1 
ATOM   2471  N  N3    . DG  A 1  121 ? -46.374 -26.524 16.385 1.00 135.48 ? 48  DG  I N3    1 
ATOM   2472  C  C4    . DG  A 1  121 ? -46.140 -27.653 17.089 1.00 123.89 ? 48  DG  I C4    1 
ATOM   2473  P  P     . DT  A 1  122 ? -45.012 -23.533 21.767 1.00 101.51 ? 49  DT  I P     1 
ATOM   2474  O  OP1   . DT  A 1  122 ? -44.094 -22.513 22.338 1.00 86.89  ? 49  DT  I OP1   1 
ATOM   2475  O  OP2   . DT  A 1  122 ? -45.609 -24.590 22.633 1.00 85.43  ? 49  DT  I OP2   1 
ATOM   2476  O  "O5'" . DT  A 1  122 ? -46.234 -22.800 21.052 1.00 114.00 ? 49  DT  I "O5'" 1 
ATOM   2477  C  "C5'" . DT  A 1  122 ? -46.190 -22.373 19.671 1.00 112.43 ? 49  DT  I "C5'" 1 
ATOM   2478  C  "C4'" . DT  A 1  122 ? -47.571 -22.456 19.060 1.00 107.70 ? 49  DT  I "C4'" 1 
ATOM   2479  O  "O4'" . DT  A 1  122 ? -47.850 -23.815 18.642 1.00 104.68 ? 49  DT  I "O4'" 1 
ATOM   2480  C  "C3'" . DT  A 1  122 ? -48.715 -22.061 20.001 1.00 114.17 ? 49  DT  I "C3'" 1 
ATOM   2481  O  "O3'" . DT  A 1  122 ? -49.627 -21.214 19.299 1.00 133.69 ? 49  DT  I "O3'" 1 
ATOM   2482  C  "C2'" . DT  A 1  122 ? -49.344 -23.391 20.380 1.00 107.80 ? 49  DT  I "C2'" 1 
ATOM   2483  C  "C1'" . DT  A 1  122 ? -49.136 -24.194 19.110 1.00 106.21 ? 49  DT  I "C1'" 1 
ATOM   2484  N  N1    . DT  A 1  122 ? -49.170 -25.674 19.227 1.00 107.03 ? 49  DT  I N1    1 
ATOM   2485  C  C2    . DT  A 1  122 ? -49.547 -26.400 18.115 1.00 104.14 ? 49  DT  I C2    1 
ATOM   2486  O  O2    . DT  A 1  122 ? -49.842 -25.884 17.051 1.00 100.77 ? 49  DT  I O2    1 
ATOM   2487  N  N3    . DT  A 1  122 ? -49.557 -27.763 18.295 1.00 99.72  ? 49  DT  I N3    1 
ATOM   2488  C  C4    . DT  A 1  122 ? -49.226 -28.455 19.446 1.00 104.03 ? 49  DT  I C4    1 
ATOM   2489  O  O4    . DT  A 1  122 ? -49.277 -29.683 19.459 1.00 89.11  ? 49  DT  I O4    1 
ATOM   2490  C  C5    . DT  A 1  122 ? -48.852 -27.630 20.575 1.00 114.87 ? 49  DT  I C5    1 
ATOM   2491  C  C7    . DT  A 1  122 ? -48.490 -28.290 21.868 1.00 124.79 ? 49  DT  I C7    1 
ATOM   2492  C  C6    . DT  A 1  122 ? -48.838 -26.300 20.409 1.00 110.11 ? 49  DT  I C6    1 
ATOM   2493  P  P     . DA  A 1  123 ? -50.609 -20.233 20.098 1.00 145.47 ? 50  DA  I P     1 
ATOM   2494  O  OP1   . DA  A 1  123 ? -49.962 -18.896 20.170 1.00 133.51 ? 50  DA  I OP1   1 
ATOM   2495  O  OP2   . DA  A 1  123 ? -51.042 -20.925 21.345 1.00 135.58 ? 50  DA  I OP2   1 
ATOM   2496  O  "O5'" . DA  A 1  123 ? -51.868 -20.108 19.127 1.00 146.50 ? 50  DA  I "O5'" 1 
ATOM   2497  C  "C5'" . DA  A 1  123 ? -51.922 -20.777 17.846 1.00 149.02 ? 50  DA  I "C5'" 1 
ATOM   2498  C  "C4'" . DA  A 1  123 ? -53.210 -21.556 17.700 1.00 152.53 ? 50  DA  I "C4'" 1 
ATOM   2499  O  "O4'" . DA  A 1  123 ? -52.963 -22.974 17.870 1.00 147.86 ? 50  DA  I "O4'" 1 
ATOM   2500  C  "C3'" . DA  A 1  123 ? -54.307 -21.217 18.710 1.00 153.90 ? 50  DA  I "C3'" 1 
ATOM   2501  O  "O3'" . DA  A 1  123 ? -55.564 -21.333 18.041 1.00 158.30 ? 50  DA  I "O3'" 1 
ATOM   2502  C  "C2'" . DA  A 1  123 ? -54.148 -22.310 19.751 1.00 146.80 ? 50  DA  I "C2'" 1 
ATOM   2503  C  "C1'" . DA  A 1  123 ? -53.885 -23.476 18.828 1.00 145.64 ? 50  DA  I "C1'" 1 
ATOM   2504  N  N9    . DA  A 1  123 ? -53.307 -24.676 19.426 1.00 141.98 ? 50  DA  I N9    1 
ATOM   2505  C  C8    . DA  A 1  123 ? -52.604 -24.818 20.596 1.00 141.48 ? 50  DA  I C8    1 
ATOM   2506  N  N7    . DA  A 1  123 ? -52.220 -26.049 20.835 1.00 142.23 ? 50  DA  I N7    1 
ATOM   2507  C  C5    . DA  A 1  123 ? -52.699 -26.764 19.746 1.00 142.31 ? 50  DA  I C5    1 
ATOM   2508  C  C6    . DA  A 1  123 ? -52.622 -28.124 19.399 1.00 144.66 ? 50  DA  I C6    1 
ATOM   2509  N  N6    . DA  A 1  123 ? -52.015 -29.046 20.148 1.00 154.08 ? 50  DA  I N6    1 
ATOM   2510  N  N1    . DA  A 1  123 ? -53.215 -28.514 18.249 1.00 140.12 ? 50  DA  I N1    1 
ATOM   2511  C  C2    . DA  A 1  123 ? -53.841 -27.592 17.506 1.00 136.99 ? 50  DA  I C2    1 
ATOM   2512  N  N3    . DA  A 1  123 ? -53.975 -26.286 17.723 1.00 142.57 ? 50  DA  I N3    1 
ATOM   2513  C  C4    . DA  A 1  123 ? -53.374 -25.932 18.873 1.00 143.60 ? 50  DA  I C4    1 
ATOM   2514  P  P     . DG  A 1  124 ? -56.899 -20.964 18.808 1.00 164.93 ? 51  DG  I P     1 
ATOM   2515  O  OP1   . DG  A 1  124 ? -56.723 -19.609 19.382 1.00 160.50 ? 51  DG  I OP1   1 
ATOM   2516  O  OP2   . DG  A 1  124 ? -57.242 -22.089 19.704 1.00 151.00 ? 51  DG  I OP2   1 
ATOM   2517  O  "O5'" . DG  A 1  124 ? -57.977 -20.875 17.638 1.00 169.16 ? 51  DG  I "O5'" 1 
ATOM   2518  C  "C5'" . DG  A 1  124 ? -58.081 -21.873 16.603 1.00 168.63 ? 51  DG  I "C5'" 1 
ATOM   2519  C  "C4'" . DG  A 1  124 ? -58.802 -23.103 17.105 1.00 173.26 ? 51  DG  I "C4'" 1 
ATOM   2520  O  "O4'" . DG  A 1  124 ? -57.826 -24.036 17.611 1.00 170.66 ? 51  DG  I "O4'" 1 
ATOM   2521  C  "C3'" . DG  A 1  124 ? -59.813 -22.886 18.243 1.00 180.13 ? 51  DG  I "C3'" 1 
ATOM   2522  O  "O3'" . DG  A 1  124 ? -61.159 -23.169 17.840 1.00 179.41 ? 51  DG  I "O3'" 1 
ATOM   2523  C  "C2'" . DG  A 1  124 ? -59.385 -23.866 19.327 1.00 178.34 ? 51  DG  I "C2'" 1 
ATOM   2524  C  "C1'" . DG  A 1  124 ? -58.465 -24.813 18.594 1.00 170.63 ? 51  DG  I "C1'" 1 
ATOM   2525  N  N9    . DG  A 1  124 ? -57.440 -25.428 19.423 1.00 166.91 ? 51  DG  I N9    1 
ATOM   2526  C  C8    . DG  A 1  124 ? -56.689 -24.845 20.416 1.00 168.04 ? 51  DG  I C8    1 
ATOM   2527  N  N7    . DG  A 1  124 ? -55.866 -25.679 20.990 1.00 169.86 ? 51  DG  I N7    1 
ATOM   2528  C  C5    . DG  A 1  124 ? -56.088 -26.884 20.338 1.00 170.27 ? 51  DG  I C5    1 
ATOM   2529  C  C6    . DG  A 1  124 ? -55.492 -28.157 20.528 1.00 167.10 ? 51  DG  I C6    1 
ATOM   2530  O  O6    . DG  A 1  124 ? -54.611 -28.485 21.333 1.00 159.84 ? 51  DG  I O6    1 
ATOM   2531  N  N1    . DG  A 1  124 ? -56.012 -29.101 19.648 1.00 163.76 ? 51  DG  I N1    1 
ATOM   2532  C  C2    . DG  A 1  124 ? -56.991 -28.856 18.715 1.00 156.17 ? 51  DG  I C2    1 
ATOM   2533  N  N2    . DG  A 1  124 ? -57.368 -29.900 17.962 1.00 149.28 ? 51  DG  I N2    1 
ATOM   2534  N  N3    . DG  A 1  124 ? -57.556 -27.676 18.530 1.00 151.86 ? 51  DG  I N3    1 
ATOM   2535  C  C4    . DG  A 1  124 ? -57.061 -26.743 19.370 1.00 164.74 ? 51  DG  I C4    1 
ATOM   2536  P  P     . DT  A 1  125 ? -62.354 -23.142 18.925 1.00 173.05 ? 52  DT  I P     1 
ATOM   2537  O  OP1   . DT  A 1  125 ? -63.609 -22.778 18.226 1.00 172.09 ? 52  DT  I OP1   1 
ATOM   2538  O  OP2   . DT  A 1  125 ? -61.904 -22.358 20.107 1.00 174.32 ? 52  DT  I OP2   1 
ATOM   2539  O  "O5'" . DT  A 1  125 ? -62.488 -24.668 19.354 1.00 164.38 ? 52  DT  I "O5'" 1 
ATOM   2540  C  "C5'" . DT  A 1  125 ? -62.711 -25.684 18.366 1.00 157.44 ? 52  DT  I "C5'" 1 
ATOM   2541  C  "C4'" . DT  A 1  125 ? -62.606 -27.044 19.012 1.00 159.49 ? 52  DT  I "C4'" 1 
ATOM   2542  O  "O4'" . DT  A 1  125 ? -61.241 -27.270 19.416 1.00 150.44 ? 52  DT  I "O4'" 1 
ATOM   2543  C  "C3'" . DT  A 1  125 ? -63.447 -27.219 20.279 1.00 169.46 ? 52  DT  I "C3'" 1 
ATOM   2544  O  "O3'" . DT  A 1  125 ? -64.675 -27.893 19.959 1.00 195.82 ? 52  DT  I "O3'" 1 
ATOM   2545  C  "C2'" . DT  A 1  125 ? -62.542 -27.997 21.222 1.00 161.53 ? 52  DT  I "C2'" 1 
ATOM   2546  C  "C1'" . DT  A 1  125 ? -61.250 -28.220 20.458 1.00 153.18 ? 52  DT  I "C1'" 1 
ATOM   2547  N  N1    . DT  A 1  125 ? -60.057 -27.997 21.287 1.00 163.59 ? 52  DT  I N1    1 
ATOM   2548  C  C2    . DT  A 1  125 ? -59.260 -29.078 21.592 1.00 158.24 ? 52  DT  I C2    1 
ATOM   2549  O  O2    . DT  A 1  125 ? -59.480 -30.207 21.181 1.00 134.38 ? 52  DT  I O2    1 
ATOM   2550  N  N3    . DT  A 1  125 ? -58.181 -28.786 22.391 1.00 157.81 ? 52  DT  I N3    1 
ATOM   2551  C  C4    . DT  A 1  125 ? -57.838 -27.552 22.914 1.00 154.97 ? 52  DT  I C4    1 
ATOM   2552  O  O4    . DT  A 1  125 ? -56.833 -27.441 23.610 1.00 147.67 ? 52  DT  I O4    1 
ATOM   2553  C  C5    . DT  A 1  125 ? -58.726 -26.464 22.563 1.00 154.02 ? 52  DT  I C5    1 
ATOM   2554  C  C7    . DT  A 1  125 ? -58.436 -25.090 23.082 1.00 142.61 ? 52  DT  I C7    1 
ATOM   2555  C  C6    . DT  A 1  125 ? -59.781 -26.739 21.784 1.00 161.27 ? 52  DT  I C6    1 
ATOM   2556  P  P     . DA  A 1  126 ? -65.641 -28.508 21.108 1.00 202.68 ? 53  DA  I P     1 
ATOM   2557  O  OP1   . DA  A 1  126 ? -66.977 -27.863 20.986 1.00 187.10 ? 53  DA  I OP1   1 
ATOM   2558  O  OP2   . DA  A 1  126 ? -64.933 -28.459 22.413 1.00 202.72 ? 53  DA  I OP2   1 
ATOM   2559  O  "O5'" . DA  A 1  126 ? -65.791 -30.031 20.657 1.00 189.94 ? 53  DA  I "O5'" 1 
ATOM   2560  C  "C5'" . DA  A 1  126 ? -64.662 -30.801 20.178 1.00 179.82 ? 53  DA  I "C5'" 1 
ATOM   2561  C  "C4'" . DA  A 1  126 ? -64.186 -31.759 21.246 1.00 171.70 ? 53  DA  I "C4'" 1 
ATOM   2562  O  "O4'" . DA  A 1  126 ? -62.894 -31.349 21.757 1.00 178.26 ? 53  DA  I "O4'" 1 
ATOM   2563  C  "C3'" . DA  A 1  126 ? -65.116 -31.869 22.462 1.00 173.31 ? 53  DA  I "C3'" 1 
ATOM   2564  O  "O3'" . DA  A 1  126 ? -65.782 -33.141 22.451 1.00 184.38 ? 53  DA  I "O3'" 1 
ATOM   2565  C  "C2'" . DA  A 1  126 ? -64.223 -31.549 23.653 1.00 178.29 ? 53  DA  I "C2'" 1 
ATOM   2566  C  "C1'" . DA  A 1  126 ? -62.824 -31.755 23.109 1.00 183.23 ? 53  DA  I "C1'" 1 
ATOM   2567  N  N9    . DA  A 1  126 ? -61.794 -30.965 23.787 1.00 184.34 ? 53  DA  I N9    1 
ATOM   2568  C  C8    . DA  A 1  126 ? -61.767 -29.611 24.014 1.00 185.62 ? 53  DA  I C8    1 
ATOM   2569  N  N7    . DA  A 1  126 ? -60.720 -29.210 24.694 1.00 174.34 ? 53  DA  I N7    1 
ATOM   2570  C  C5    . DA  A 1  126 ? -60.023 -30.381 24.953 1.00 157.75 ? 53  DA  I C5    1 
ATOM   2571  C  C6    . DA  A 1  126 ? -58.821 -30.635 25.637 1.00 144.67 ? 53  DA  I C6    1 
ATOM   2572  N  N6    . DA  A 1  126 ? -58.079 -29.684 26.208 1.00 129.31 ? 53  DA  I N6    1 
ATOM   2573  N  N1    . DA  A 1  126 ? -58.402 -31.917 25.716 1.00 148.83 ? 53  DA  I N1    1 
ATOM   2574  C  C2    . DA  A 1  126 ? -59.144 -32.871 25.139 1.00 155.15 ? 53  DA  I C2    1 
ATOM   2575  N  N3    . DA  A 1  126 ? -60.289 -32.756 24.468 1.00 159.53 ? 53  DA  I N3    1 
ATOM   2576  C  C4    . DA  A 1  126 ? -60.679 -31.471 24.412 1.00 167.81 ? 53  DA  I C4    1 
ATOM   2577  P  P     . DT  A 1  127 ? -65.358 -34.331 23.448 1.00 201.30 ? 54  DT  I P     1 
ATOM   2578  O  OP1   . DT  A 1  127 ? -65.984 -35.581 22.949 1.00 194.30 ? 54  DT  I OP1   1 
ATOM   2579  O  OP2   . DT  A 1  127 ? -65.653 -33.893 24.838 1.00 198.20 ? 54  DT  I OP2   1 
ATOM   2580  O  "O5'" . DT  A 1  127 ? -63.781 -34.453 23.225 1.00 197.29 ? 54  DT  I "O5'" 1 
ATOM   2581  C  "C5'" . DT  A 1  127 ? -63.108 -35.725 23.076 1.00 177.94 ? 54  DT  I "C5'" 1 
ATOM   2582  C  "C4'" . DT  A 1  127 ? -62.610 -36.226 24.414 1.00 164.01 ? 54  DT  I "C4'" 1 
ATOM   2583  O  "O4'" . DT  A 1  127 ? -61.798 -35.209 25.048 1.00 161.57 ? 54  DT  I "O4'" 1 
ATOM   2584  C  "C3'" . DT  A 1  127 ? -63.713 -36.592 25.416 1.00 150.34 ? 54  DT  I "C3'" 1 
ATOM   2585  O  "O3'" . DT  A 1  127 ? -63.697 -38.004 25.664 1.00 139.90 ? 54  DT  I "O3'" 1 
ATOM   2586  C  "C2'" . DT  A 1  127 ? -63.447 -35.702 26.623 1.00 148.89 ? 54  DT  I "C2'" 1 
ATOM   2587  C  "C1'" . DT  A 1  127 ? -62.002 -35.268 26.447 1.00 154.35 ? 54  DT  I "C1'" 1 
ATOM   2588  N  N1    . DT  A 1  127 ? -61.658 -33.944 27.021 1.00 147.33 ? 54  DT  I N1    1 
ATOM   2589  C  C2    . DT  A 1  127 ? -60.423 -33.792 27.614 1.00 139.95 ? 54  DT  I C2    1 
ATOM   2590  O  O2    . DT  A 1  127 ? -59.596 -34.688 27.676 1.00 123.67 ? 54  DT  I O2    1 
ATOM   2591  N  N3    . DT  A 1  127 ? -60.184 -32.538 28.122 1.00 132.89 ? 54  DT  I N3    1 
ATOM   2592  C  C4    . DT  A 1  127 ? -61.040 -31.453 28.107 1.00 130.03 ? 54  DT  I C4    1 
ATOM   2593  O  O4    . DT  A 1  127 ? -60.688 -30.389 28.607 1.00 124.22 ? 54  DT  I O4    1 
ATOM   2594  C  C5    . DT  A 1  127 ? -62.320 -31.687 27.479 1.00 130.52 ? 54  DT  I C5    1 
ATOM   2595  C  C7    . DT  A 1  127 ? -63.312 -30.569 27.416 1.00 128.09 ? 54  DT  I C7    1 
ATOM   2596  C  C6    . DT  A 1  127 ? -62.561 -32.903 26.974 1.00 138.88 ? 54  DT  I C6    1 
ATOM   2597  P  P     . DC  A 1  128 ? -64.189 -38.591 27.072 1.00 147.41 ? 55  DC  I P     1 
ATOM   2598  O  OP1   . DC  A 1  128 ? -64.323 -40.065 26.940 1.00 143.10 ? 55  DC  I OP1   1 
ATOM   2599  O  OP2   . DC  A 1  128 ? -65.344 -37.777 27.543 1.00 129.22 ? 55  DC  I OP2   1 
ATOM   2600  O  "O5'" . DC  A 1  128 ? -62.910 -38.382 27.997 1.00 150.20 ? 55  DC  I "O5'" 1 
ATOM   2601  C  "C5'" . DC  A 1  128 ? -61.603 -38.786 27.535 1.00 138.83 ? 55  DC  I "C5'" 1 
ATOM   2602  C  "C4'" . DC  A 1  128 ? -60.612 -38.748 28.674 1.00 129.52 ? 55  DC  I "C4'" 1 
ATOM   2603  O  "O4'" . DC  A 1  128 ? -60.374 -37.375 29.067 1.00 126.32 ? 55  DC  I "O4'" 1 
ATOM   2604  C  "C3'" . DC  A 1  128 ? -61.071 -39.482 29.938 1.00 125.58 ? 55  DC  I "C3'" 1 
ATOM   2605  O  "O3'" . DC  A 1  128 ? -60.021 -40.309 30.453 1.00 120.93 ? 55  DC  I "O3'" 1 
ATOM   2606  C  "C2'" . DC  A 1  128 ? -61.440 -38.361 30.894 1.00 122.29 ? 55  DC  I "C2'" 1 
ATOM   2607  C  "C1'" . DC  A 1  128 ? -60.486 -37.264 30.477 1.00 125.52 ? 55  DC  I "C1'" 1 
ATOM   2608  N  N1    . DC  A 1  128 ? -60.936 -35.900 30.785 1.00 129.49 ? 55  DC  I N1    1 
ATOM   2609  C  C2    . DC  A 1  128 ? -60.157 -35.102 31.628 1.00 138.38 ? 55  DC  I C2    1 
ATOM   2610  O  O2    . DC  A 1  128 ? -59.120 -35.576 32.114 1.00 139.51 ? 55  DC  I O2    1 
ATOM   2611  N  N3    . DC  A 1  128 ? -60.556 -33.837 31.895 1.00 144.78 ? 55  DC  I N3    1 
ATOM   2612  C  C4    . DC  A 1  128 ? -61.679 -33.364 31.350 1.00 135.83 ? 55  DC  I C4    1 
ATOM   2613  N  N4    . DC  A 1  128 ? -62.037 -32.113 31.644 1.00 130.93 ? 55  DC  I N4    1 
ATOM   2614  C  C5    . DC  A 1  128 ? -62.487 -34.153 30.482 1.00 132.24 ? 55  DC  I C5    1 
ATOM   2615  C  C6    . DC  A 1  128 ? -62.079 -35.402 30.224 1.00 127.14 ? 55  DC  I C6    1 
ATOM   2616  P  P     . DT  A 1  129 ? -60.312 -41.364 31.632 1.00 119.84 ? 56  DT  I P     1 
ATOM   2617  O  OP1   . DT  A 1  129 ? -59.639 -42.646 31.290 1.00 104.53 ? 56  DT  I OP1   1 
ATOM   2618  O  OP2   . DT  A 1  129 ? -61.766 -41.341 31.940 1.00 112.09 ? 56  DT  I OP2   1 
ATOM   2619  O  "O5'" . DT  A 1  129 ? -59.573 -40.723 32.889 1.00 127.56 ? 56  DT  I "O5'" 1 
ATOM   2620  C  "C5'" . DT  A 1  129 ? -58.179 -40.354 32.849 1.00 111.82 ? 56  DT  I "C5'" 1 
ATOM   2621  C  "C4'" . DT  A 1  129 ? -57.749 -39.817 34.194 1.00 103.33 ? 56  DT  I "C4'" 1 
ATOM   2622  O  "O4'" . DT  A 1  129 ? -58.247 -38.468 34.363 1.00 99.34  ? 56  DT  I "O4'" 1 
ATOM   2623  C  "C3'" . DT  A 1  129 ? -58.279 -40.600 35.394 1.00 98.55  ? 56  DT  I "C3'" 1 
ATOM   2624  O  "O3'" . DT  A 1  129 ? -57.320 -40.522 36.444 1.00 96.44  ? 56  DT  I "O3'" 1 
ATOM   2625  C  "C2'" . DT  A 1  129 ? -59.516 -39.818 35.790 1.00 101.48 ? 56  DT  I "C2'" 1 
ATOM   2626  C  "C1'" . DT  A 1  129 ? -59.037 -38.401 35.539 1.00 99.76  ? 56  DT  I "C1'" 1 
ATOM   2627  N  N1    . DT  A 1  129 ? -60.086 -37.402 35.311 1.00 106.22 ? 56  DT  I N1    1 
ATOM   2628  C  C2    . DT  A 1  129 ? -59.947 -36.190 35.939 1.00 112.99 ? 56  DT  I C2    1 
ATOM   2629  O  O2    . DT  A 1  129 ? -59.022 -35.935 36.690 1.00 99.65  ? 56  DT  I O2    1 
ATOM   2630  N  N3    . DT  A 1  129 ? -60.947 -35.288 35.671 1.00 118.00 ? 56  DT  I N3    1 
ATOM   2631  C  C4    . DT  A 1  129 ? -62.037 -35.474 34.845 1.00 119.23 ? 56  DT  I C4    1 
ATOM   2632  O  O4    . DT  A 1  129 ? -62.855 -34.571 34.701 1.00 132.89 ? 56  DT  I O4    1 
ATOM   2633  C  C5    . DT  A 1  129 ? -62.110 -36.765 34.203 1.00 118.90 ? 56  DT  I C5    1 
ATOM   2634  C  C7    . DT  A 1  129 ? -63.257 -37.058 33.289 1.00 121.76 ? 56  DT  I C7    1 
ATOM   2635  C  C6    . DT  A 1  129 ? -61.140 -37.651 34.460 1.00 117.16 ? 56  DT  I C6    1 
ATOM   2636  P  P     . DG  A 1  130 ? -56.328 -41.740 36.722 1.00 94.23  ? 57  DG  I P     1 
ATOM   2637  O  OP1   . DG  A 1  130 ? -55.732 -42.153 35.425 1.00 95.87  ? 57  DG  I OP1   1 
ATOM   2638  O  OP2   . DG  A 1  130 ? -57.049 -42.722 37.560 1.00 93.51  ? 57  DG  I OP2   1 
ATOM   2639  O  "O5'" . DG  A 1  130 ? -55.209 -41.087 37.650 1.00 90.41  ? 57  DG  I "O5'" 1 
ATOM   2640  C  "C5'" . DG  A 1  130 ? -54.357 -40.020 37.180 1.00 81.09  ? 57  DG  I "C5'" 1 
ATOM   2641  C  "C4'" . DG  A 1  130 ? -54.168 -38.967 38.249 1.00 78.99  ? 57  DG  I "C4'" 1 
ATOM   2642  O  "O4'" . DG  A 1  130 ? -55.354 -38.146 38.344 1.00 74.00  ? 57  DG  I "O4'" 1 
ATOM   2643  C  "C3'" . DG  A 1  130 ? -53.905 -39.479 39.667 1.00 87.87  ? 57  DG  I "C3'" 1 
ATOM   2644  O  "O3'" . DG  A 1  130 ? -52.913 -38.619 40.265 1.00 89.69  ? 57  DG  I "O3'" 1 
ATOM   2645  C  "C2'" . DG  A 1  130 ? -55.289 -39.462 40.304 1.00 83.09  ? 57  DG  I "C2'" 1 
ATOM   2646  C  "C1'" . DG  A 1  130 ? -55.969 -38.285 39.620 1.00 78.09  ? 57  DG  I "C1'" 1 
ATOM   2647  N  N9    . DG  A 1  130 ? -57.403 -38.402 39.398 1.00 84.36  ? 57  DG  I N9    1 
ATOM   2648  C  C8    . DG  A 1  130 ? -58.099 -39.532 39.048 1.00 88.36  ? 57  DG  I C8    1 
ATOM   2649  N  N7    . DG  A 1  130 ? -59.371 -39.312 38.860 1.00 94.14  ? 57  DG  I N7    1 
ATOM   2650  C  C5    . DG  A 1  130 ? -59.520 -37.949 39.073 1.00 92.51  ? 57  DG  I C5    1 
ATOM   2651  C  C6    . DG  A 1  130 ? -60.680 -37.135 39.032 1.00 101.01 ? 57  DG  I C6    1 
ATOM   2652  O  O6    . DG  A 1  130 ? -61.841 -37.461 38.756 1.00 104.77 ? 57  DG  I O6    1 
ATOM   2653  N  N1    . DG  A 1  130 ? -60.385 -35.809 39.334 1.00 99.54  ? 57  DG  I N1    1 
ATOM   2654  C  C2    . DG  A 1  130 ? -59.136 -35.330 39.641 1.00 93.51  ? 57  DG  I C2    1 
ATOM   2655  N  N2    . DG  A 1  130 ? -59.052 -34.015 39.891 1.00 89.69  ? 57  DG  I N2    1 
ATOM   2656  N  N3    . DG  A 1  130 ? -58.049 -36.083 39.699 1.00 90.04  ? 57  DG  I N3    1 
ATOM   2657  C  C4    . DG  A 1  130 ? -58.313 -37.372 39.404 1.00 86.29  ? 57  DG  I C4    1 
ATOM   2658  P  P     . DC  A 1  131 ? -52.361 -38.879 41.755 1.00 88.46  ? 58  DC  I P     1 
ATOM   2659  O  OP1   . DC  A 1  131 ? -51.002 -38.290 41.857 1.00 82.73  ? 58  DC  I OP1   1 
ATOM   2660  O  OP2   . DC  A 1  131 ? -52.574 -40.317 42.080 1.00 87.50  ? 58  DC  I OP2   1 
ATOM   2661  O  "O5'" . DC  A 1  131 ? -53.284 -37.930 42.637 1.00 76.29  ? 58  DC  I "O5'" 1 
ATOM   2662  C  "C5'" . DC  A 1  131 ? -53.664 -36.628 42.153 1.00 78.74  ? 58  DC  I "C5'" 1 
ATOM   2663  C  "C4'" . DC  A 1  131 ? -54.448 -35.885 43.209 1.00 87.87  ? 58  DC  I "C4'" 1 
ATOM   2664  O  "O4'" . DC  A 1  131 ? -55.859 -35.964 42.898 1.00 96.17  ? 58  DC  I "O4'" 1 
ATOM   2665  C  "C3'" . DC  A 1  131 ? -54.326 -36.461 44.617 1.00 90.66  ? 58  DC  I "C3'" 1 
ATOM   2666  O  "O3'" . DC  A 1  131 ? -54.630 -35.454 45.581 1.00 93.79  ? 58  DC  I "O3'" 1 
ATOM   2667  C  "C2'" . DC  A 1  131 ? -55.429 -37.497 44.636 1.00 93.65  ? 58  DC  I "C2'" 1 
ATOM   2668  C  "C1'" . DC  A 1  131 ? -56.518 -36.714 43.914 1.00 99.77  ? 58  DC  I "C1'" 1 
ATOM   2669  N  N1    . DC  A 1  131 ? -57.586 -37.490 43.276 1.00 103.91 ? 58  DC  I N1    1 
ATOM   2670  C  C2    . DC  A 1  131 ? -58.709 -36.801 42.818 1.00 103.28 ? 58  DC  I C2    1 
ATOM   2671  O  O2    . DC  A 1  131 ? -58.760 -35.572 42.973 1.00 93.38  ? 58  DC  I O2    1 
ATOM   2672  N  N3    . DC  A 1  131 ? -59.708 -37.488 42.220 1.00 109.87 ? 58  DC  I N3    1 
ATOM   2673  C  C4    . DC  A 1  131 ? -59.612 -38.811 42.072 1.00 109.44 ? 58  DC  I C4    1 
ATOM   2674  N  N4    . DC  A 1  131 ? -60.622 -39.448 41.474 1.00 113.98 ? 58  DC  I N4    1 
ATOM   2675  C  C5    . DC  A 1  131 ? -58.474 -39.539 42.525 1.00 107.20 ? 58  DC  I C5    1 
ATOM   2676  C  C6    . DC  A 1  131 ? -57.494 -38.846 43.117 1.00 106.43 ? 58  DC  I C6    1 
ATOM   2677  P  P     . DA  A 1  132 ? -53.451 -34.677 46.307 1.00 88.18  ? 59  DA  I P     1 
ATOM   2678  O  OP1   . DA  A 1  132 ? -52.464 -34.315 45.262 1.00 88.01  ? 59  DA  I OP1   1 
ATOM   2679  O  OP2   . DA  A 1  132 ? -53.072 -35.441 47.533 1.00 71.73  ? 59  DA  I OP2   1 
ATOM   2680  O  "O5'" . DA  A 1  132 ? -54.107 -33.306 46.782 1.00 89.48  ? 59  DA  I "O5'" 1 
ATOM   2681  C  "C5'" . DA  A 1  132 ? -54.437 -32.292 45.821 1.00 97.10  ? 59  DA  I "C5'" 1 
ATOM   2682  C  "C4'" . DA  A 1  132 ? -55.713 -31.598 46.235 1.00 105.31 ? 59  DA  I "C4'" 1 
ATOM   2683  O  "O4'" . DA  A 1  132 ? -56.855 -32.466 46.046 1.00 108.85 ? 59  DA  I "O4'" 1 
ATOM   2684  C  "C3'" . DA  A 1  132 ? -55.769 -31.182 47.699 1.00 108.43 ? 59  DA  I "C3'" 1 
ATOM   2685  O  "O3'" . DA  A 1  132 ? -56.588 -30.015 47.739 1.00 110.81 ? 59  DA  I "O3'" 1 
ATOM   2686  C  "C2'" . DA  A 1  132 ? -56.431 -32.374 48.369 1.00 106.48 ? 59  DA  I "C2'" 1 
ATOM   2687  C  "C1'" . DA  A 1  132 ? -57.421 -32.831 47.305 1.00 107.99 ? 59  DA  I "C1'" 1 
ATOM   2688  N  N9    . DA  A 1  132 ? -57.696 -34.265 47.256 1.00 112.70 ? 59  DA  I N9    1 
ATOM   2689  C  C8    . DA  A 1  132 ? -56.868 -35.306 47.598 1.00 115.65 ? 59  DA  I C8    1 
ATOM   2690  N  N7    . DA  A 1  132 ? -57.390 -36.488 47.381 1.00 109.80 ? 59  DA  I N7    1 
ATOM   2691  C  C5    . DA  A 1  132 ? -58.636 -36.207 46.838 1.00 111.94 ? 59  DA  I C5    1 
ATOM   2692  C  C6    . DA  A 1  132 ? -59.675 -37.033 46.384 1.00 106.80 ? 59  DA  I C6    1 
ATOM   2693  N  N6    . DA  A 1  132 ? -59.622 -38.365 46.413 1.00 109.98 ? 59  DA  I N6    1 
ATOM   2694  N  N1    . DA  A 1  132 ? -60.788 -36.437 45.904 1.00 105.08 ? 59  DA  I N1    1 
ATOM   2695  C  C2    . DA  A 1  132 ? -60.843 -35.099 45.887 1.00 101.69 ? 59  DA  I C2    1 
ATOM   2696  N  N3    . DA  A 1  132 ? -59.927 -34.215 46.278 1.00 103.69 ? 59  DA  I N3    1 
ATOM   2697  C  C4    . DA  A 1  132 ? -58.834 -34.842 46.748 1.00 112.48 ? 59  DA  I C4    1 
ATOM   2698  P  P     . DG  A 1  133 ? -56.594 -29.078 49.022 1.00 110.27 ? 60  DG  I P     1 
ATOM   2699  O  OP1   . DG  A 1  133 ? -56.387 -27.685 48.555 1.00 94.06  ? 60  DG  I OP1   1 
ATOM   2700  O  OP2   . DG  A 1  133 ? -55.679 -29.671 50.040 1.00 87.22  ? 60  DG  I OP2   1 
ATOM   2701  O  "O5'" . DG  A 1  133 ? -58.091 -29.220 49.549 1.00 115.24 ? 60  DG  I "O5'" 1 
ATOM   2702  C  "C5'" . DG  A 1  133 ? -59.206 -29.342 48.638 1.00 110.56 ? 60  DG  I "C5'" 1 
ATOM   2703  C  "C4'" . DG  A 1  133 ? -60.384 -29.986 49.332 1.00 107.96 ? 60  DG  I "C4'" 1 
ATOM   2704  O  "O4'" . DG  A 1  133 ? -60.334 -31.426 49.173 1.00 107.86 ? 60  DG  I "O4'" 1 
ATOM   2705  C  "C3'" . DG  A 1  133 ? -60.480 -29.745 50.843 1.00 108.50 ? 60  DG  I "C3'" 1 
ATOM   2706  O  "O3'" . DG  A 1  133 ? -61.867 -29.591 51.161 1.00 117.75 ? 60  DG  I "O3'" 1 
ATOM   2707  C  "C2'" . DG  A 1  133 ? -59.947 -31.040 51.431 1.00 103.16 ? 60  DG  I "C2'" 1 
ATOM   2708  C  "C1'" . DG  A 1  133 ? -60.553 -32.015 50.447 1.00 106.60 ? 60  DG  I "C1'" 1 
ATOM   2709  N  N9    . DG  A 1  133 ? -60.025 -33.376 50.421 1.00 111.47 ? 60  DG  I N9    1 
ATOM   2710  C  C8    . DG  A 1  133 ? -58.777 -33.818 50.792 1.00 109.04 ? 60  DG  I C8    1 
ATOM   2711  N  N7    . DG  A 1  133 ? -58.627 -35.107 50.647 1.00 99.05  ? 60  DG  I N7    1 
ATOM   2712  C  C5    . DG  A 1  133 ? -59.848 -35.541 50.148 1.00 104.63 ? 60  DG  I C5    1 
ATOM   2713  C  C6    . DG  A 1  133 ? -60.288 -36.843 49.796 1.00 102.21 ? 60  DG  I C6    1 
ATOM   2714  O  O6    . DG  A 1  133 ? -59.663 -37.908 49.850 1.00 95.81  ? 60  DG  I O6    1 
ATOM   2715  N  N1    . DG  A 1  133 ? -61.604 -36.834 49.347 1.00 99.06  ? 60  DG  I N1    1 
ATOM   2716  C  C2    . DG  A 1  133 ? -62.395 -35.715 49.241 1.00 103.46 ? 60  DG  I C2    1 
ATOM   2717  N  N2    . DG  A 1  133 ? -63.638 -35.908 48.779 1.00 109.97 ? 60  DG  I N2    1 
ATOM   2718  N  N3    . DG  A 1  133 ? -61.997 -34.497 49.566 1.00 98.81  ? 60  DG  I N3    1 
ATOM   2719  C  C4    . DG  A 1  133 ? -60.722 -34.484 50.008 1.00 106.55 ? 60  DG  I C4    1 
ATOM   2720  P  P     . DG  A 1  134 ? -62.335 -28.886 52.522 1.00 125.02 ? 61  DG  I P     1 
ATOM   2721  O  OP1   . DG  A 1  134 ? -63.729 -28.411 52.318 1.00 119.82 ? 61  DG  I OP1   1 
ATOM   2722  O  OP2   . DG  A 1  134 ? -61.282 -27.922 52.941 1.00 102.67 ? 61  DG  I OP2   1 
ATOM   2723  O  "O5'" . DG  A 1  134 ? -62.370 -30.094 53.562 1.00 129.27 ? 61  DG  I "O5'" 1 
ATOM   2724  C  "C5'" . DG  A 1  134 ? -63.544 -30.364 54.360 1.00 137.03 ? 61  DG  I "C5'" 1 
ATOM   2725  C  "C4'" . DG  A 1  134 ? -64.599 -31.077 53.544 1.00 134.46 ? 61  DG  I "C4'" 1 
ATOM   2726  O  "O4'" . DG  A 1  134 ? -63.978 -31.769 52.436 1.00 134.14 ? 61  DG  I "O4'" 1 
ATOM   2727  C  "C3'" . DG  A 1  134 ? -65.382 -32.146 54.301 1.00 137.72 ? 61  DG  I "C3'" 1 
ATOM   2728  O  "O3'" . DG  A 1  134 ? -66.545 -31.595 54.932 1.00 135.57 ? 61  DG  I "O3'" 1 
ATOM   2729  C  "C2'" . DG  A 1  134 ? -65.731 -33.145 53.213 1.00 135.11 ? 61  DG  I "C2'" 1 
ATOM   2730  C  "C1'" . DG  A 1  134 ? -64.523 -33.077 52.296 1.00 129.26 ? 61  DG  I "C1'" 1 
ATOM   2731  N  N9    . DG  A 1  134 ? -63.464 -34.043 52.579 1.00 110.97 ? 61  DG  I N9    1 
ATOM   2732  C  C8    . DG  A 1  134 ? -62.197 -33.772 53.037 1.00 107.00 ? 61  DG  I C8    1 
ATOM   2733  N  N7    . DG  A 1  134 ? -61.459 -34.840 53.165 1.00 107.93 ? 61  DG  I N7    1 
ATOM   2734  C  C5    . DG  A 1  134 ? -62.285 -35.880 52.761 1.00 107.95 ? 61  DG  I C5    1 
ATOM   2735  C  C6    . DG  A 1  134 ? -62.033 -37.274 52.679 1.00 103.92 ? 61  DG  I C6    1 
ATOM   2736  O  O6    . DG  A 1  134 ? -61.002 -37.888 52.973 1.00 99.11  ? 61  DG  I O6    1 
ATOM   2737  N  N1    . DG  A 1  134 ? -63.145 -37.969 52.215 1.00 109.33 ? 61  DG  I N1    1 
ATOM   2738  C  C2    . DG  A 1  134 ? -64.348 -37.399 51.878 1.00 120.18 ? 61  DG  I C2    1 
ATOM   2739  N  N2    . DG  A 1  134 ? -65.303 -38.242 51.453 1.00 122.32 ? 61  DG  I N2    1 
ATOM   2740  N  N3    . DG  A 1  134 ? -64.596 -36.099 51.948 1.00 121.26 ? 61  DG  I N3    1 
ATOM   2741  C  C4    . DG  A 1  134 ? -63.526 -35.405 52.394 1.00 112.16 ? 61  DG  I C4    1 
ATOM   2742  P  P     . DT  A 1  135 ? -67.436 -32.511 55.902 1.00 136.82 ? 62  DT  I P     1 
ATOM   2743  O  OP1   . DT  A 1  135 ? -68.834 -32.013 55.841 1.00 119.17 ? 62  DT  I OP1   1 
ATOM   2744  O  OP2   . DT  A 1  135 ? -66.743 -32.606 57.213 1.00 124.58 ? 62  DT  I OP2   1 
ATOM   2745  O  "O5'" . DT  A 1  135 ? -67.316 -33.953 55.234 1.00 136.53 ? 62  DT  I "O5'" 1 
ATOM   2746  C  "C5'" . DT  A 1  135 ? -68.461 -34.712 54.821 1.00 144.36 ? 62  DT  I "C5'" 1 
ATOM   2747  C  "C4'" . DT  A 1  135 ? -68.299 -36.143 55.274 1.00 153.83 ? 62  DT  I "C4'" 1 
ATOM   2748  O  "O4'" . DT  A 1  135 ? -67.131 -36.732 54.663 1.00 158.44 ? 62  DT  I "O4'" 1 
ATOM   2749  C  "C3'" . DT  A 1  135 ? -68.067 -36.323 56.770 1.00 156.79 ? 62  DT  I "C3'" 1 
ATOM   2750  O  "O3'" . DT  A 1  135 ? -69.282 -36.060 57.502 1.00 160.85 ? 62  DT  I "O3'" 1 
ATOM   2751  C  "C2'" . DT  A 1  135 ? -67.429 -37.701 56.816 1.00 156.44 ? 62  DT  I "C2'" 1 
ATOM   2752  C  "C1'" . DT  A 1  135 ? -66.678 -37.803 55.489 1.00 155.18 ? 62  DT  I "C1'" 1 
ATOM   2753  N  N1    . DT  A 1  135 ? -65.213 -37.697 55.628 1.00 149.02 ? 62  DT  I N1    1 
ATOM   2754  C  C2    . DT  A 1  135 ? -64.440 -38.735 55.159 1.00 147.81 ? 62  DT  I C2    1 
ATOM   2755  O  O2    . DT  A 1  135 ? -64.906 -39.710 54.593 1.00 157.93 ? 62  DT  I O2    1 
ATOM   2756  N  N3    . DT  A 1  135 ? -63.091 -38.577 55.354 1.00 142.36 ? 62  DT  I N3    1 
ATOM   2757  C  C4    . DT  A 1  135 ? -62.455 -37.513 55.965 1.00 139.10 ? 62  DT  I C4    1 
ATOM   2758  O  O4    . DT  A 1  135 ? -61.232 -37.506 56.062 1.00 138.90 ? 62  DT  I O4    1 
ATOM   2759  C  C5    . DT  A 1  135 ? -63.328 -36.468 56.449 1.00 135.99 ? 62  DT  I C5    1 
ATOM   2760  C  C7    . DT  A 1  135 ? -62.729 -35.276 57.125 1.00 129.58 ? 62  DT  I C7    1 
ATOM   2761  C  C6    . DT  A 1  135 ? -64.645 -36.614 56.266 1.00 141.89 ? 62  DT  I C6    1 
ATOM   2762  P  P     . DG  A 1  136 ? -69.788 -37.018 58.702 1.00 160.08 ? 63  DG  I P     1 
ATOM   2763  O  OP1   . DG  A 1  136 ? -71.259 -37.164 58.573 1.00 165.56 ? 63  DG  I OP1   1 
ATOM   2764  O  OP2   . DG  A 1  136 ? -69.212 -36.516 59.981 1.00 147.90 ? 63  DG  I OP2   1 
ATOM   2765  O  "O5'" . DG  A 1  136 ? -69.108 -38.415 58.363 1.00 153.46 ? 63  DG  I "O5'" 1 
ATOM   2766  C  "C5'" . DG  A 1  136 ? -69.859 -39.576 57.980 1.00 146.62 ? 63  DG  I "C5'" 1 
ATOM   2767  C  "C4'" . DG  A 1  136 ? -69.206 -40.773 58.622 1.00 146.73 ? 63  DG  I "C4'" 1 
ATOM   2768  O  "O4'" . DG  A 1  136 ? -67.773 -40.687 58.422 1.00 141.51 ? 63  DG  I "O4'" 1 
ATOM   2769  C  "C3'" . DG  A 1  136 ? -69.434 -40.836 60.135 1.00 152.31 ? 63  DG  I "C3'" 1 
ATOM   2770  O  "O3'" . DG  A 1  136 ? -69.982 -42.134 60.437 1.00 160.25 ? 63  DG  I "O3'" 1 
ATOM   2771  C  "C2'" . DG  A 1  136 ? -68.115 -40.351 60.723 1.00 153.13 ? 63  DG  I "C2'" 1 
ATOM   2772  C  "C1'" . DG  A 1  136 ? -67.091 -40.735 59.668 1.00 150.88 ? 63  DG  I "C1'" 1 
ATOM   2773  N  N9    . DG  A 1  136 ? -65.906 -39.879 59.571 1.00 144.09 ? 63  DG  I N9    1 
ATOM   2774  C  C8    . DG  A 1  136 ? -65.812 -38.530 59.828 1.00 137.57 ? 63  DG  I C8    1 
ATOM   2775  N  N7    . DG  A 1  136 ? -64.611 -38.055 59.635 1.00 130.40 ? 63  DG  I N7    1 
ATOM   2776  C  C5    . DG  A 1  136 ? -63.867 -39.155 59.232 1.00 132.00 ? 63  DG  I C5    1 
ATOM   2777  C  C6    . DG  A 1  136 ? -62.497 -39.258 58.879 1.00 130.34 ? 63  DG  I C6    1 
ATOM   2778  O  O6    . DG  A 1  136 ? -61.637 -38.368 58.862 1.00 123.39 ? 63  DG  I O6    1 
ATOM   2779  N  N1    . DG  A 1  136 ? -62.154 -40.564 58.536 1.00 125.44 ? 63  DG  I N1    1 
ATOM   2780  C  C2    . DG  A 1  136 ? -63.019 -41.633 58.531 1.00 113.09 ? 63  DG  I C2    1 
ATOM   2781  N  N2    . DG  A 1  136 ? -62.500 -42.816 58.176 1.00 104.39 ? 63  DG  I N2    1 
ATOM   2782  N  N3    . DG  A 1  136 ? -64.299 -41.547 58.850 1.00 112.02 ? 63  DG  I N3    1 
ATOM   2783  C  C4    . DG  A 1  136 ? -64.651 -40.289 59.190 1.00 130.16 ? 63  DG  I C4    1 
ATOM   2784  P  P     . DG  A 1  137 ? -69.349 -43.102 61.556 1.00 167.02 ? 64  DG  I P     1 
ATOM   2785  O  OP1   . DG  A 1  137 ? -70.358 -44.132 61.894 1.00 151.92 ? 64  DG  I OP1   1 
ATOM   2786  O  OP2   . DG  A 1  137 ? -68.790 -42.258 62.647 1.00 157.37 ? 64  DG  I OP2   1 
ATOM   2787  O  "O5'" . DG  A 1  137 ? -68.241 -43.907 60.739 1.00 154.63 ? 64  DG  I "O5'" 1 
ATOM   2788  C  "C5'" . DG  A 1  137 ? -67.953 -45.287 61.037 1.00 142.51 ? 64  DG  I "C5'" 1 
ATOM   2789  C  "C4'" . DG  A 1  137 ? -66.933 -45.348 62.147 1.00 140.79 ? 64  DG  I "C4'" 1 
ATOM   2790  O  "O4'" . DG  A 1  137 ? -65.929 -44.341 61.888 1.00 138.16 ? 64  DG  I "O4'" 1 
ATOM   2791  C  "C3'" . DG  A 1  137 ? -67.496 -45.052 63.545 1.00 141.52 ? 64  DG  I "C3'" 1 
ATOM   2792  O  "O3'" . DG  A 1  137 ? -67.559 -46.243 64.346 1.00 138.56 ? 64  DG  I "O3'" 1 
ATOM   2793  C  "C2'" . DG  A 1  137 ? -66.641 -43.909 64.079 1.00 138.11 ? 64  DG  I "C2'" 1 
ATOM   2794  C  "C1'" . DG  A 1  137 ? -65.460 -43.844 63.122 1.00 133.72 ? 64  DG  I "C1'" 1 
ATOM   2795  N  N9    . DG  A 1  137 ? -64.896 -42.516 62.894 1.00 122.57 ? 64  DG  I N9    1 
ATOM   2796  C  C8    . DG  A 1  137 ? -65.490 -41.295 63.111 1.00 111.93 ? 64  DG  I C8    1 
ATOM   2797  N  N7    . DG  A 1  137 ? -64.707 -40.289 62.829 1.00 104.00 ? 64  DG  I N7    1 
ATOM   2798  C  C5    . DG  A 1  137 ? -63.522 -40.881 62.416 1.00 104.25 ? 64  DG  I C5    1 
ATOM   2799  C  C6    . DG  A 1  137 ? -62.303 -40.295 61.987 1.00 108.32 ? 64  DG  I C6    1 
ATOM   2800  O  O6    . DG  A 1  137 ? -62.020 -39.094 61.876 1.00 110.22 ? 64  DG  I O6    1 
ATOM   2801  N  N1    . DG  A 1  137 ? -61.360 -41.264 61.656 1.00 103.23 ? 64  DG  I N1    1 
ATOM   2802  C  C2    . DG  A 1  137 ? -61.564 -42.621 61.724 1.00 106.08 ? 64  DG  I C2    1 
ATOM   2803  N  N2    . DG  A 1  137 ? -60.532 -43.396 61.363 1.00 100.51 ? 64  DG  I N2    1 
ATOM   2804  N  N3    . DG  A 1  137 ? -62.696 -43.178 62.121 1.00 105.41 ? 64  DG  I N3    1 
ATOM   2805  C  C4    . DG  A 1  137 ? -63.624 -42.255 62.449 1.00 108.94 ? 64  DG  I C4    1 
ATOM   2806  P  P     . DA  A 1  138 ? -66.305 -46.742 65.234 1.00 137.87 ? 65  DA  I P     1 
ATOM   2807  O  OP1   . DA  A 1  138 ? -66.566 -48.148 65.627 1.00 132.78 ? 65  DA  I OP1   1 
ATOM   2808  O  OP2   . DA  A 1  138 ? -66.068 -45.733 66.299 1.00 129.97 ? 65  DA  I OP2   1 
ATOM   2809  O  "O5'" . DA  A 1  138 ? -65.083 -46.748 64.207 1.00 131.73 ? 65  DA  I "O5'" 1 
ATOM   2810  C  "C5'" . DA  A 1  138 ? -64.509 -47.976 63.701 1.00 119.44 ? 65  DA  I "C5'" 1 
ATOM   2811  C  "C4'" . DA  A 1  138 ? -63.040 -48.066 64.046 1.00 117.94 ? 65  DA  I "C4'" 1 
ATOM   2812  O  "O4'" . DA  A 1  138 ? -62.410 -46.778 63.838 1.00 123.45 ? 65  DA  I "O4'" 1 
ATOM   2813  C  "C3'" . DA  A 1  138 ? -62.730 -48.457 65.493 1.00 113.50 ? 65  DA  I "C3'" 1 
ATOM   2814  O  "O3'" . DA  A 1  138 ? -61.611 -49.353 65.519 1.00 116.33 ? 65  DA  I "O3'" 1 
ATOM   2815  C  "C2'" . DA  A 1  138 ? -62.450 -47.121 66.154 1.00 115.94 ? 65  DA  I "C2'" 1 
ATOM   2816  C  "C1'" . DA  A 1  138 ? -61.772 -46.355 65.033 1.00 120.74 ? 65  DA  I "C1'" 1 
ATOM   2817  N  N9    . DA  A 1  138 ? -61.924 -44.906 65.135 1.00 118.16 ? 65  DA  I N9    1 
ATOM   2818  C  C8    . DA  A 1  138 ? -63.060 -44.209 65.463 1.00 117.38 ? 65  DA  I C8    1 
ATOM   2819  N  N7    . DA  A 1  138 ? -62.893 -42.910 65.489 1.00 116.30 ? 65  DA  I N7    1 
ATOM   2820  C  C5    . DA  A 1  138 ? -61.554 -42.740 65.173 1.00 108.81 ? 65  DA  I C5    1 
ATOM   2821  C  C6    . DA  A 1  138 ? -60.755 -41.597 65.045 1.00 99.13  ? 65  DA  I C6    1 
ATOM   2822  N  N6    . DA  A 1  138 ? -61.210 -40.356 65.229 1.00 91.24  ? 65  DA  I N6    1 
ATOM   2823  N  N1    . DA  A 1  138 ? -59.457 -41.772 64.714 1.00 112.32 ? 65  DA  I N1    1 
ATOM   2824  C  C2    . DA  A 1  138 ? -59.003 -43.019 64.529 1.00 111.16 ? 65  DA  I C2    1 
ATOM   2825  N  N3    . DA  A 1  138 ? -59.658 -44.174 64.623 1.00 109.04 ? 65  DA  I N3    1 
ATOM   2826  C  C4    . DA  A 1  138 ? -60.943 -43.962 64.955 1.00 110.76 ? 65  DA  I C4    1 
ATOM   2827  P  P     . DT  A 1  139 ? -60.738 -49.557 66.859 1.00 128.63 ? 66  DT  I P     1 
ATOM   2828  O  OP1   . DT  A 1  139 ? -60.034 -50.870 66.777 1.00 108.94 ? 66  DT  I OP1   1 
ATOM   2829  O  OP2   . DT  A 1  139 ? -61.582 -49.217 68.040 1.00 101.25 ? 66  DT  I OP2   1 
ATOM   2830  O  "O5'" . DT  A 1  139 ? -59.591 -48.472 66.690 1.00 131.77 ? 66  DT  I "O5'" 1 
ATOM   2831  C  "C5'" . DT  A 1  139 ? -58.451 -48.759 65.873 1.00 121.98 ? 66  DT  I "C5'" 1 
ATOM   2832  C  "C4'" . DT  A 1  139 ? -57.316 -47.872 66.313 1.00 114.25 ? 66  DT  I "C4'" 1 
ATOM   2833  O  "O4'" . DT  A 1  139 ? -57.779 -46.501 66.362 1.00 116.56 ? 66  DT  I "O4'" 1 
ATOM   2834  C  "C3'" . DT  A 1  139 ? -56.772 -48.178 67.708 1.00 104.92 ? 66  DT  I "C3'" 1 
ATOM   2835  O  "O3'" . DT  A 1  139 ? -55.372 -47.990 67.555 1.00 106.10 ? 66  DT  I "O3'" 1 
ATOM   2836  C  "C2'" . DT  A 1  139 ? -57.432 -47.125 68.583 1.00 100.61 ? 66  DT  I "C2'" 1 
ATOM   2837  C  "C1'" . DT  A 1  139 ? -57.456 -45.948 67.627 1.00 106.67 ? 66  DT  I "C1'" 1 
ATOM   2838  N  N1    . DT  A 1  139 ? -58.416 -44.855 67.903 1.00 101.75 ? 66  DT  I N1    1 
ATOM   2839  C  C2    . DT  A 1  139 ? -57.941 -43.566 67.822 1.00 92.84  ? 66  DT  I C2    1 
ATOM   2840  O  O2    . DT  A 1  139 ? -56.779 -43.300 67.567 1.00 101.49 ? 66  DT  I O2    1 
ATOM   2841  N  N3    . DT  A 1  139 ? -58.877 -42.594 68.063 1.00 94.16  ? 66  DT  I N3    1 
ATOM   2842  C  C4    . DT  A 1  139 ? -60.215 -42.778 68.352 1.00 102.01 ? 66  DT  I C4    1 
ATOM   2843  O  O4    . DT  A 1  139 ? -60.937 -41.803 68.545 1.00 99.53  ? 66  DT  I O4    1 
ATOM   2844  C  C5    . DT  A 1  139 ? -60.652 -44.154 68.400 1.00 101.92 ? 66  DT  I C5    1 
ATOM   2845  C  C7    . DT  A 1  139 ? -62.085 -44.450 68.712 1.00 103.08 ? 66  DT  I C7    1 
ATOM   2846  C  C6    . DT  A 1  139 ? -59.744 -45.112 68.168 1.00 101.40 ? 66  DT  I C6    1 
ATOM   2847  P  P     . DA  A 1  140 ? -54.345 -48.570 68.615 1.00 118.30 ? 67  DA  I P     1 
ATOM   2848  O  OP1   . DA  A 1  140 ? -53.948 -49.926 68.169 1.00 98.97  ? 67  DA  I OP1   1 
ATOM   2849  O  OP2   . DA  A 1  140 ? -54.940 -48.377 69.968 1.00 102.99 ? 67  DA  I OP2   1 
ATOM   2850  O  "O5'" . DA  A 1  140 ? -53.064 -47.638 68.406 1.00 108.83 ? 67  DA  I "O5'" 1 
ATOM   2851  C  "C5'" . DA  A 1  140 ? -52.944 -46.779 67.244 1.00 109.83 ? 67  DA  I "C5'" 1 
ATOM   2852  C  "C4'" . DA  A 1  140 ? -52.561 -45.364 67.623 1.00 113.32 ? 67  DA  I "C4'" 1 
ATOM   2853  O  "O4'" . DA  A 1  140 ? -53.722 -44.559 67.958 1.00 101.73 ? 67  DA  I "O4'" 1 
ATOM   2854  C  "C3'" . DA  A 1  140 ? -51.582 -45.222 68.797 1.00 103.09 ? 67  DA  I "C3'" 1 
ATOM   2855  O  "O3'" . DA  A 1  140 ? -50.480 -44.423 68.363 1.00 94.23  ? 67  DA  I "O3'" 1 
ATOM   2856  C  "C2'" . DA  A 1  140 ? -52.399 -44.541 69.883 1.00 97.06  ? 67  DA  I "C2'" 1 
ATOM   2857  C  "C1'" . DA  A 1  140 ? -53.409 -43.748 69.079 1.00 97.62  ? 67  DA  I "C1'" 1 
ATOM   2858  N  N9    . DA  A 1  140 ? -54.656 -43.464 69.781 1.00 93.95  ? 67  DA  I N9    1 
ATOM   2859  C  C8    . DA  A 1  140 ? -55.589 -44.369 70.219 1.00 90.13  ? 67  DA  I C8    1 
ATOM   2860  N  N7    . DA  A 1  140 ? -56.635 -43.817 70.783 1.00 90.14  ? 67  DA  I N7    1 
ATOM   2861  C  C5    . DA  A 1  140 ? -56.373 -42.457 70.714 1.00 81.89  ? 67  DA  I C5    1 
ATOM   2862  C  C6    . DA  A 1  140 ? -57.093 -41.332 71.149 1.00 82.19  ? 67  DA  I C6    1 
ATOM   2863  N  N6    . DA  A 1  140 ? -58.273 -41.404 71.763 1.00 78.42  ? 67  DA  I N6    1 
ATOM   2864  N  N1    . DA  A 1  140 ? -56.550 -40.114 70.933 1.00 83.95  ? 67  DA  I N1    1 
ATOM   2865  C  C2    . DA  A 1  140 ? -55.359 -40.045 70.324 1.00 90.50  ? 67  DA  I C2    1 
ATOM   2866  N  N3    . DA  A 1  140 ? -54.589 -41.030 69.866 1.00 84.67  ? 67  DA  I N3    1 
ATOM   2867  C  C4    . DA  A 1  140 ? -55.158 -42.224 70.097 1.00 85.47  ? 67  DA  I C4    1 
ATOM   2868  P  P     . DT  A 1  141 ? -49.187 -44.257 69.280 1.00 102.33 ? 68  DT  I P     1 
ATOM   2869  O  OP1   . DT  A 1  141 ? -47.997 -44.187 68.387 1.00 94.66  ? 68  DT  I OP1   1 
ATOM   2870  O  OP2   . DT  A 1  141 ? -49.239 -45.292 70.344 1.00 92.64  ? 68  DT  I OP2   1 
ATOM   2871  O  "O5'" . DT  A 1  141 ? -49.408 -42.811 69.918 1.00 90.86  ? 68  DT  I "O5'" 1 
ATOM   2872  C  "C5'" . DT  A 1  141 ? -50.145 -41.803 69.196 1.00 85.77  ? 68  DT  I "C5'" 1 
ATOM   2873  C  "C4'" . DT  A 1  141 ? -50.051 -40.466 69.892 1.00 84.94  ? 68  DT  I "C4'" 1 
ATOM   2874  O  "O4'" . DT  A 1  141 ? -51.314 -40.126 70.514 1.00 86.15  ? 68  DT  I "O4'" 1 
ATOM   2875  C  "C3'" . DT  A 1  141 ? -49.007 -40.380 71.002 1.00 90.75  ? 68  DT  I "C3'" 1 
ATOM   2876  O  "O3'" . DT  A 1  141 ? -48.414 -39.075 70.909 1.00 94.06  ? 68  DT  I "O3'" 1 
ATOM   2877  C  "C2'" . DT  A 1  141 ? -49.817 -40.641 72.263 1.00 87.03  ? 68  DT  I "C2'" 1 
ATOM   2878  C  "C1'" . DT  A 1  141 ? -51.159 -40.002 71.927 1.00 89.91  ? 68  DT  I "C1'" 1 
ATOM   2879  N  N1    . DT  A 1  141 ? -52.358 -40.597 72.569 1.00 89.71  ? 68  DT  I N1    1 
ATOM   2880  C  C2    . DT  A 1  141 ? -53.405 -39.762 72.905 1.00 86.00  ? 68  DT  I C2    1 
ATOM   2881  O  O2    . DT  A 1  141 ? -53.381 -38.554 72.732 1.00 79.82  ? 68  DT  I O2    1 
ATOM   2882  N  N3    . DT  A 1  141 ? -54.483 -40.396 73.464 1.00 78.57  ? 68  DT  I N3    1 
ATOM   2883  C  C4    . DT  A 1  141 ? -54.619 -41.746 73.719 1.00 88.22  ? 68  DT  I C4    1 
ATOM   2884  O  O4    . DT  A 1  141 ? -55.651 -42.168 74.229 1.00 92.69  ? 68  DT  I O4    1 
ATOM   2885  C  C5    . DT  A 1  141 ? -53.491 -42.564 73.331 1.00 89.51  ? 68  DT  I C5    1 
ATOM   2886  C  C7    . DT  A 1  141 ? -53.553 -44.042 73.560 1.00 82.45  ? 68  DT  I C7    1 
ATOM   2887  C  C6    . DT  A 1  141 ? -52.434 -41.957 72.778 1.00 89.52  ? 68  DT  I C6    1 
ATOM   2888  P  P     . DT  A 1  142 ? -47.189 -38.647 71.867 1.00 91.17  ? 69  DT  I P     1 
ATOM   2889  O  OP1   . DT  A 1  142 ? -46.286 -37.773 71.087 1.00 94.07  ? 69  DT  I OP1   1 
ATOM   2890  O  OP2   . DT  A 1  142 ? -46.664 -39.865 72.542 1.00 89.72  ? 69  DT  I OP2   1 
ATOM   2891  O  "O5'" . DT  A 1  142 ? -47.892 -37.688 72.925 1.00 90.10  ? 69  DT  I "O5'" 1 
ATOM   2892  C  "C5'" . DT  A 1  142 ? -48.648 -36.543 72.473 1.00 85.62  ? 69  DT  I "C5'" 1 
ATOM   2893  C  "C4'" . DT  A 1  142 ? -49.532 -36.049 73.591 1.00 83.40  ? 69  DT  I "C4'" 1 
ATOM   2894  O  "O4'" . DT  A 1  142 ? -50.486 -37.078 73.933 1.00 90.30  ? 69  DT  I "O4'" 1 
ATOM   2895  C  "C3'" . DT  A 1  142 ? -48.778 -35.717 74.883 1.00 81.63  ? 69  DT  I "C3'" 1 
ATOM   2896  O  "O3'" . DT  A 1  142 ? -48.993 -34.336 75.184 1.00 79.41  ? 69  DT  I "O3'" 1 
ATOM   2897  C  "C2'" . DT  A 1  142 ? -49.339 -36.689 75.911 1.00 83.84  ? 69  DT  I "C2'" 1 
ATOM   2898  C  "C1'" . DT  A 1  142 ? -50.696 -37.037 75.327 1.00 91.74  ? 69  DT  I "C1'" 1 
ATOM   2899  N  N1    . DT  A 1  142 ? -51.304 -38.326 75.733 1.00 92.70  ? 69  DT  I N1    1 
ATOM   2900  C  C2    . DT  A 1  142 ? -52.609 -38.315 76.181 1.00 89.07  ? 69  DT  I C2    1 
ATOM   2901  O  O2    . DT  A 1  142 ? -53.268 -37.293 76.294 1.00 71.37  ? 69  DT  I O2    1 
ATOM   2902  N  N3    . DT  A 1  142 ? -53.113 -39.552 76.503 1.00 92.25  ? 69  DT  I N3    1 
ATOM   2903  C  C4    . DT  A 1  142 ? -52.459 -40.767 76.420 1.00 98.24  ? 69  DT  I C4    1 
ATOM   2904  O  O4    . DT  A 1  142 ? -53.042 -41.798 76.745 1.00 94.58  ? 69  DT  I O4    1 
ATOM   2905  C  C5    . DT  A 1  142 ? -51.096 -40.703 75.935 1.00 99.53  ? 69  DT  I C5    1 
ATOM   2906  C  C7    . DT  A 1  142 ? -50.309 -41.970 75.810 1.00 96.83  ? 69  DT  I C7    1 
ATOM   2907  C  C6    . DT  A 1  142 ? -50.599 -39.503 75.608 1.00 92.58  ? 69  DT  I C6    1 
ATOM   2908  P  P     . DG  A 1  143 ? -48.132 -33.615 76.319 1.00 76.91  ? 70  DG  I P     1 
ATOM   2909  O  OP1   . DG  A 1  143 ? -47.904 -32.211 75.909 1.00 73.81  ? 70  DG  I OP1   1 
ATOM   2910  O  OP2   . DG  A 1  143 ? -47.018 -34.500 76.711 1.00 68.08  ? 70  DG  I OP2   1 
ATOM   2911  O  "O5'" . DG  A 1  143 ? -49.125 -33.579 77.558 1.00 99.48  ? 70  DG  I "O5'" 1 
ATOM   2912  C  "C5'" . DG  A 1  143 ? -50.480 -33.099 77.429 1.00 104.92 ? 70  DG  I "C5'" 1 
ATOM   2913  C  "C4'" . DG  A 1  143 ? -51.233 -33.406 78.702 1.00 103.43 ? 70  DG  I "C4'" 1 
ATOM   2914  O  "O4'" . DG  A 1  143 ? -51.653 -34.794 78.708 1.00 100.93 ? 70  DG  I "O4'" 1 
ATOM   2915  C  "C3'" . DG  A 1  143 ? -50.400 -33.226 79.973 1.00 99.56  ? 70  DG  I "C3'" 1 
ATOM   2916  O  "O3'" . DG  A 1  143 ? -51.252 -32.692 80.975 1.00 94.21  ? 70  DG  I "O3'" 1 
ATOM   2917  C  "C2'" . DG  A 1  143 ? -49.989 -34.644 80.326 1.00 92.19  ? 70  DG  I "C2'" 1 
ATOM   2918  C  "C1'" . DG  A 1  143 ? -51.261 -35.360 79.946 1.00 94.01  ? 70  DG  I "C1'" 1 
ATOM   2919  N  N9    . DG  A 1  143 ? -51.199 -36.806 79.789 1.00 90.94  ? 70  DG  I N9    1 
ATOM   2920  C  C8    . DG  A 1  143 ? -50.112 -37.597 79.496 1.00 90.24  ? 70  DG  I C8    1 
ATOM   2921  N  N7    . DG  A 1  143 ? -50.401 -38.869 79.459 1.00 95.39  ? 70  DG  I N7    1 
ATOM   2922  C  C5    . DG  A 1  143 ? -51.755 -38.922 79.765 1.00 98.72  ? 70  DG  I C5    1 
ATOM   2923  C  C6    . DG  A 1  143 ? -52.628 -40.033 79.887 1.00 91.45  ? 70  DG  I C6    1 
ATOM   2924  O  O6    . DG  A 1  143 ? -52.373 -41.232 79.734 1.00 84.38  ? 70  DG  I O6    1 
ATOM   2925  N  N1    . DG  A 1  143 ? -53.921 -39.633 80.219 1.00 97.78  ? 70  DG  I N1    1 
ATOM   2926  C  C2    . DG  A 1  143 ? -54.322 -38.330 80.409 1.00 96.05  ? 70  DG  I C2    1 
ATOM   2927  N  N2    . DG  A 1  143 ? -55.612 -38.139 80.717 1.00 96.81  ? 70  DG  I N2    1 
ATOM   2928  N  N3    . DG  A 1  143 ? -53.515 -37.290 80.310 1.00 88.71  ? 70  DG  I N3    1 
ATOM   2929  C  C4    . DG  A 1  143 ? -52.258 -37.656 79.980 1.00 95.75  ? 70  DG  I C4    1 
ATOM   2930  P  P     . DA  A 1  144 ? -50.624 -31.943 82.223 1.00 109.20 ? 71  DA  I P     1 
ATOM   2931  O  OP1   . DA  A 1  144 ? -50.310 -30.556 81.786 1.00 108.97 ? 71  DA  I OP1   1 
ATOM   2932  O  OP2   . DA  A 1  144 ? -49.546 -32.809 82.797 1.00 76.25  ? 71  DA  I OP2   1 
ATOM   2933  O  "O5'" . DA  A 1  144 ? -51.857 -31.853 83.230 1.00 105.21 ? 71  DA  I "O5'" 1 
ATOM   2934  C  "C5'" . DA  A 1  144 ? -53.230 -31.872 82.760 1.00 108.31 ? 71  DA  I "C5'" 1 
ATOM   2935  C  "C4'" . DA  A 1  144 ? -54.036 -32.851 83.583 1.00 104.20 ? 71  DA  I "C4'" 1 
ATOM   2936  O  "O4'" . DA  A 1  144 ? -53.818 -34.199 83.089 1.00 88.42  ? 71  DA  I "O4'" 1 
ATOM   2937  C  "C3'" . DA  A 1  144 ? -53.651 -32.864 85.071 1.00 111.12 ? 71  DA  I "C3'" 1 
ATOM   2938  O  "O3'" . DA  A 1  144 ? -54.739 -32.533 85.955 1.00 122.63 ? 71  DA  I "O3'" 1 
ATOM   2939  C  "C2'" . DA  A 1  144 ? -53.090 -34.258 85.295 1.00 104.04 ? 71  DA  I "C2'" 1 
ATOM   2940  C  "C1'" . DA  A 1  144 ? -53.725 -35.071 84.190 1.00 89.42  ? 71  DA  I "C1'" 1 
ATOM   2941  N  N9    . DA  A 1  144 ? -52.897 -36.206 83.811 1.00 84.10  ? 71  DA  I N9    1 
ATOM   2942  C  C8    . DA  A 1  144 ? -51.538 -36.223 83.625 1.00 82.48  ? 71  DA  I C8    1 
ATOM   2943  N  N7    . DA  A 1  144 ? -51.058 -37.412 83.357 1.00 84.81  ? 71  DA  I N7    1 
ATOM   2944  C  C5    . DA  A 1  144 ? -52.169 -38.239 83.407 1.00 88.53  ? 71  DA  I C5    1 
ATOM   2945  C  C6    . DA  A 1  144 ? -52.329 -39.620 83.213 1.00 86.60  ? 71  DA  I C6    1 
ATOM   2946  N  N6    . DA  A 1  144 ? -51.325 -40.443 82.908 1.00 86.33  ? 71  DA  I N6    1 
ATOM   2947  N  N1    . DA  A 1  144 ? -53.570 -40.134 83.346 1.00 92.96  ? 71  DA  I N1    1 
ATOM   2948  C  C2    . DA  A 1  144 ? -54.578 -39.306 83.651 1.00 94.97  ? 71  DA  I C2    1 
ATOM   2949  N  N3    . DA  A 1  144 ? -54.553 -37.990 83.854 1.00 90.29  ? 71  DA  I N3    1 
ATOM   2950  C  C4    . DA  A 1  144 ? -53.306 -37.513 83.710 1.00 90.14  ? 71  DA  I C4    1 
ATOM   2951  P  P     . DT  A 1  145 ? -54.504 -32.426 87.568 1.00 118.08 ? 72  DT  I P     1 
ATOM   2952  O  OP1   . DT  A 1  145 ? -54.987 -31.092 88.017 1.00 100.50 ? 72  DT  I OP1   1 
ATOM   2953  O  OP2   . DT  A 1  145 ? -53.093 -32.825 87.877 1.00 107.70 ? 72  DT  I OP2   1 
ATOM   2954  O  "O5'" . DT  A 1  145 ? -55.518 -33.516 88.155 1.00 109.65 ? 72  DT  I "O5'" 1 
ATOM   2955  C  "C5'" . DT  A 1  145 ? -56.040 -34.622 87.371 1.00 107.22 ? 72  DT  I "C5'" 1 
ATOM   2956  C  "C4'" . DT  A 1  145 ? -55.972 -35.913 88.156 1.00 102.46 ? 72  DT  I "C4'" 1 
ATOM   2957  O  "O4'" . DT  A 1  145 ? -55.462 -36.992 87.342 1.00 103.22 ? 72  DT  I "O4'" 1 
ATOM   2958  C  "C3'" . DT  A 1  145 ? -55.057 -35.877 89.372 1.00 103.85 ? 72  DT  I "C3'" 1 
ATOM   2959  O  "O3'" . DT  A 1  145 ? -55.791 -35.358 90.482 1.00 112.84 ? 72  DT  I "O3'" 1 
ATOM   2960  C  "C2'" . DT  A 1  145 ? -54.692 -37.337 89.570 1.00 103.38 ? 72  DT  I "C2'" 1 
ATOM   2961  C  "C1'" . DT  A 1  145 ? -54.813 -37.949 88.174 1.00 103.46 ? 72  DT  I "C1'" 1 
ATOM   2962  N  N1    . DT  A 1  145 ? -53.513 -38.279 87.562 1.00 103.08 ? 72  DT  I N1    1 
ATOM   2963  C  C2    . DT  A 1  145 ? -53.329 -39.556 87.087 1.00 99.05  ? 72  DT  I C2    1 
ATOM   2964  O  O2    . DT  A 1  145 ? -54.193 -40.416 87.137 1.00 97.09  ? 72  DT  I O2    1 
ATOM   2965  N  N3    . DT  A 1  145 ? -52.087 -39.793 86.552 1.00 99.67  ? 72  DT  I N3    1 
ATOM   2966  C  C4    . DT  A 1  145 ? -51.037 -38.899 86.449 1.00 99.41  ? 72  DT  I C4    1 
ATOM   2967  O  O4    . DT  A 1  145 ? -49.974 -39.257 85.946 1.00 103.29 ? 72  DT  I O4    1 
ATOM   2968  C  C5    . DT  A 1  145 ? -51.300 -37.578 86.970 1.00 95.88  ? 72  DT  I C5    1 
ATOM   2969  C  C7    . DT  A 1  145 ? -50.223 -36.542 86.904 1.00 100.13 ? 72  DT  I C7    1 
ATOM   2970  C  C6    . DT  A 1  145 ? -52.505 -37.340 87.502 1.00 96.86  ? 72  DT  I C6    1 
ATOM   2971  O  "O5'" . DA  B 2  1   ? -49.793 -49.902 84.833 1.00 124.42 ? -72 DA  J "O5'" 1 
ATOM   2972  C  "C5'" . DA  B 2  1   ? -51.183 -50.166 84.563 1.00 123.07 ? -72 DA  J "C5'" 1 
ATOM   2973  C  "C4'" . DA  B 2  1   ? -52.058 -49.536 85.625 1.00 123.93 ? -72 DA  J "C4'" 1 
ATOM   2974  O  "O4'" . DA  B 2  1   ? -51.437 -48.911 86.772 1.00 128.17 ? -72 DA  J "O4'" 1 
ATOM   2975  C  "C3'" . DA  B 2  1   ? -53.356 -48.793 85.308 1.00 122.49 ? -72 DA  J "C3'" 1 
ATOM   2976  O  "O3'" . DA  B 2  1   ? -54.397 -49.763 85.136 1.00 115.39 ? -72 DA  J "O3'" 1 
ATOM   2977  C  "C2'" . DA  B 2  1   ? -53.546 -47.878 86.511 1.00 120.33 ? -72 DA  J "C2'" 1 
ATOM   2978  C  "C1'" . DA  B 2  1   ? -52.152 -47.731 87.119 1.00 122.17 ? -72 DA  J "C1'" 1 
ATOM   2979  N  N9    . DA  B 2  1   ? -51.382 -46.581 86.642 1.00 120.88 ? -72 DA  J N9    1 
ATOM   2980  C  C8    . DA  B 2  1   ? -50.197 -46.599 85.947 1.00 121.00 ? -72 DA  J C8    1 
ATOM   2981  N  N7    . DA  B 2  1   ? -49.741 -45.407 85.647 1.00 114.31 ? -72 DA  J N7    1 
ATOM   2982  C  C5    . DA  B 2  1   ? -50.687 -44.545 86.184 1.00 100.30 ? -72 DA  J C5    1 
ATOM   2983  C  C6    . DA  B 2  1   ? -50.779 -43.144 86.207 1.00 94.77  ? -72 DA  J C6    1 
ATOM   2984  N  N6    . DA  B 2  1   ? -49.874 -42.334 85.652 1.00 82.43  ? -72 DA  J N6    1 
ATOM   2985  N  N1    . DA  B 2  1   ? -51.849 -42.595 86.826 1.00 94.81  ? -72 DA  J N1    1 
ATOM   2986  C  C2    . DA  B 2  1   ? -52.754 -43.410 87.386 1.00 99.13  ? -72 DA  J C2    1 
ATOM   2987  N  N3    . DA  B 2  1   ? -52.774 -44.742 87.430 1.00 110.25 ? -72 DA  J N3    1 
ATOM   2988  C  C4    . DA  B 2  1   ? -51.699 -45.254 86.806 1.00 111.24 ? -72 DA  J C4    1 
ATOM   2989  P  P     . DT  B 2  2   ? -55.891 -49.301 84.772 1.00 129.67 ? -71 DT  J P     1 
ATOM   2990  O  OP1   . DT  B 2  2   ? -56.759 -50.504 84.809 1.00 131.21 ? -71 DT  J OP1   1 
ATOM   2991  O  OP2   . DT  B 2  2   ? -55.834 -48.502 83.519 1.00 119.46 ? -71 DT  J OP2   1 
ATOM   2992  O  "O5'" . DT  B 2  2   ? -56.280 -48.370 86.008 1.00 129.23 ? -71 DT  J "O5'" 1 
ATOM   2993  C  "C5'" . DT  B 2  2   ? -57.638 -48.224 86.467 1.00 122.61 ? -71 DT  J "C5'" 1 
ATOM   2994  C  "C4'" . DT  B 2  2   ? -58.191 -46.921 85.945 1.00 122.59 ? -71 DT  J "C4'" 1 
ATOM   2995  O  "O4'" . DT  B 2  2   ? -57.121 -45.947 85.979 1.00 119.59 ? -71 DT  J "O4'" 1 
ATOM   2996  C  "C3'" . DT  B 2  2   ? -58.674 -46.989 84.488 1.00 128.11 ? -71 DT  J "C3'" 1 
ATOM   2997  O  "O3'" . DT  B 2  2   ? -60.080 -46.781 84.261 1.00 127.35 ? -71 DT  J "O3'" 1 
ATOM   2998  C  "C2'" . DT  B 2  2   ? -57.828 -45.964 83.752 1.00 131.88 ? -71 DT  J "C2'" 1 
ATOM   2999  C  "C1'" . DT  B 2  2   ? -57.252 -45.096 84.860 1.00 127.51 ? -71 DT  J "C1'" 1 
ATOM   3000  N  N1    . DT  B 2  2   ? -55.925 -44.513 84.557 1.00 120.96 ? -71 DT  J N1    1 
ATOM   3001  C  C2    . DT  B 2  2   ? -55.765 -43.148 84.672 1.00 117.87 ? -71 DT  J C2    1 
ATOM   3002  O  O2    . DT  B 2  2   ? -56.653 -42.397 85.049 1.00 102.73 ? -71 DT  J O2    1 
ATOM   3003  N  N3    . DT  B 2  2   ? -54.512 -42.692 84.342 1.00 114.52 ? -71 DT  J N3    1 
ATOM   3004  C  C4    . DT  B 2  2   ? -53.438 -43.444 83.902 1.00 112.80 ? -71 DT  J C4    1 
ATOM   3005  O  O4    . DT  B 2  2   ? -52.372 -42.893 83.644 1.00 117.91 ? -71 DT  J O4    1 
ATOM   3006  C  C5    . DT  B 2  2   ? -53.681 -44.863 83.790 1.00 108.45 ? -71 DT  J C5    1 
ATOM   3007  C  C7    . DT  B 2  2   ? -52.574 -45.755 83.322 1.00 95.56  ? -71 DT  J C7    1 
ATOM   3008  C  C6    . DT  B 2  2   ? -54.896 -45.320 84.118 1.00 118.23 ? -71 DT  J C6    1 
ATOM   3009  P  P     . DC  B 2  3   ? -60.882 -45.540 84.916 1.00 137.10 ? -70 DC  J P     1 
ATOM   3010  O  OP1   . DC  B 2  3   ? -60.791 -45.651 86.393 1.00 127.14 ? -70 DC  J OP1   1 
ATOM   3011  O  OP2   . DC  B 2  3   ? -62.214 -45.457 84.258 1.00 132.67 ? -70 DC  J OP2   1 
ATOM   3012  O  "O5'" . DC  B 2  3   ? -60.084 -44.240 84.456 1.00 130.36 ? -70 DC  J "O5'" 1 
ATOM   3013  C  "C5'" . DC  B 2  3   ? -60.251 -43.000 85.177 1.00 125.45 ? -70 DC  J "C5'" 1 
ATOM   3014  C  "C4'" . DC  B 2  3   ? -60.494 -41.842 84.235 1.00 123.73 ? -70 DC  J "C4'" 1 
ATOM   3015  O  "O4'" . DC  B 2  3   ? -59.261 -41.475 83.572 1.00 118.44 ? -70 DC  J "O4'" 1 
ATOM   3016  C  "C3'" . DC  B 2  3   ? -61.497 -42.089 83.112 1.00 123.67 ? -70 DC  J "C3'" 1 
ATOM   3017  O  "O3'" . DC  B 2  3   ? -62.106 -40.833 82.801 1.00 125.33 ? -70 DC  J "O3'" 1 
ATOM   3018  C  "C2'" . DC  B 2  3   ? -60.609 -42.572 81.982 1.00 123.12 ? -70 DC  J "C2'" 1 
ATOM   3019  C  "C1'" . DC  B 2  3   ? -59.381 -41.686 82.169 1.00 119.32 ? -70 DC  J "C1'" 1 
ATOM   3020  N  N1    . DC  B 2  3   ? -58.096 -42.227 81.691 1.00 115.64 ? -70 DC  J N1    1 
ATOM   3021  C  C2    . DC  B 2  3   ? -56.993 -41.369 81.638 1.00 103.39 ? -70 DC  J C2    1 
ATOM   3022  O  O2    . DC  B 2  3   ? -57.142 -40.181 81.963 1.00 91.99  ? -70 DC  J O2    1 
ATOM   3023  N  N3    . DC  B 2  3   ? -55.799 -41.851 81.221 1.00 92.83  ? -70 DC  J N3    1 
ATOM   3024  C  C4    . DC  B 2  3   ? -55.682 -43.138 80.883 1.00 105.38 ? -70 DC  J C4    1 
ATOM   3025  N  N4    . DC  B 2  3   ? -54.487 -43.574 80.483 1.00 103.22 ? -70 DC  J N4    1 
ATOM   3026  C  C5    . DC  B 2  3   ? -56.789 -44.035 80.934 1.00 109.55 ? -70 DC  J C5    1 
ATOM   3027  C  C6    . DC  B 2  3   ? -57.964 -43.544 81.343 1.00 113.99 ? -70 DC  J C6    1 
ATOM   3028  P  P     . DA  B 2  4   ? -63.385 -40.762 81.848 1.00 134.67 ? -69 DA  J P     1 
ATOM   3029  O  OP1   . DA  B 2  4   ? -64.586 -40.992 82.683 1.00 139.89 ? -69 DA  J OP1   1 
ATOM   3030  O  OP2   . DA  B 2  4   ? -63.139 -41.642 80.671 1.00 128.56 ? -69 DA  J OP2   1 
ATOM   3031  O  "O5'" . DA  B 2  4   ? -63.417 -39.234 81.383 1.00 126.40 ? -69 DA  J "O5'" 1 
ATOM   3032  C  "C5'" . DA  B 2  4   ? -62.514 -38.232 81.917 1.00 118.67 ? -69 DA  J "C5'" 1 
ATOM   3033  C  "C4'" . DA  B 2  4   ? -61.838 -37.450 80.811 1.00 107.09 ? -69 DA  J "C4'" 1 
ATOM   3034  O  "O4'" . DA  B 2  4   ? -60.570 -38.069 80.471 1.00 105.10 ? -69 DA  J "O4'" 1 
ATOM   3035  C  "C3'" . DA  B 2  4   ? -62.607 -37.360 79.490 1.00 101.48 ? -69 DA  J "C3'" 1 
ATOM   3036  O  "O3'" . DA  B 2  4   ? -62.196 -36.183 78.811 1.00 92.76  ? -69 DA  J "O3'" 1 
ATOM   3037  C  "C2'" . DA  B 2  4   ? -61.997 -38.475 78.667 1.00 98.14  ? -69 DA  J "C2'" 1 
ATOM   3038  C  "C1'" . DA  B 2  4   ? -60.549 -38.284 79.063 1.00 100.98 ? -69 DA  J "C1'" 1 
ATOM   3039  N  N9    . DA  B 2  4   ? -59.641 -39.389 78.776 1.00 93.83  ? -69 DA  J N9    1 
ATOM   3040  C  C8    . DA  B 2  4   ? -59.859 -40.744 78.825 1.00 95.52  ? -69 DA  J C8    1 
ATOM   3041  N  N7    . DA  B 2  4   ? -58.816 -41.460 78.481 1.00 91.02  ? -69 DA  J N7    1 
ATOM   3042  C  C5    . DA  B 2  4   ? -57.851 -40.512 78.169 1.00 94.52  ? -69 DA  J C5    1 
ATOM   3043  C  C6    . DA  B 2  4   ? -56.521 -40.625 77.730 1.00 89.12  ? -69 DA  J C6    1 
ATOM   3044  N  N6    . DA  B 2  4   ? -55.906 -41.790 77.524 1.00 91.42  ? -69 DA  J N6    1 
ATOM   3045  N  N1    . DA  B 2  4   ? -55.830 -39.483 77.518 1.00 85.76  ? -69 DA  J N1    1 
ATOM   3046  C  C2    . DA  B 2  4   ? -56.445 -38.311 77.733 1.00 87.13  ? -69 DA  J C2    1 
ATOM   3047  N  N3    . DA  B 2  4   ? -57.690 -38.077 78.138 1.00 87.01  ? -69 DA  J N3    1 
ATOM   3048  C  C4    . DA  B 2  4   ? -58.347 -39.233 78.342 1.00 95.92  ? -69 DA  J C4    1 
ATOM   3049  P  P     . DA  B 2  5   ? -63.183 -34.968 78.645 1.00 100.02 ? -68 DA  J P     1 
ATOM   3050  O  OP1   . DA  B 2  5   ? -63.394 -34.371 79.994 1.00 93.65  ? -68 DA  J OP1   1 
ATOM   3051  O  OP2   . DA  B 2  5   ? -64.332 -35.433 77.837 1.00 99.81  ? -68 DA  J OP2   1 
ATOM   3052  O  "O5'" . DA  B 2  5   ? -62.352 -33.963 77.728 1.00 109.55 ? -68 DA  J "O5'" 1 
ATOM   3053  C  "C5'" . DA  B 2  5   ? -61.134 -33.349 78.221 1.00 116.58 ? -68 DA  J "C5'" 1 
ATOM   3054  C  "C4'" . DA  B 2  5   ? -60.076 -33.215 77.146 1.00 103.18 ? -68 DA  J "C4'" 1 
ATOM   3055  O  "O4'" . DA  B 2  5   ? -59.358 -34.457 76.943 1.00 98.47  ? -68 DA  J "O4'" 1 
ATOM   3056  C  "C3'" . DA  B 2  5   ? -60.567 -32.774 75.765 1.00 95.79  ? -68 DA  J "C3'" 1 
ATOM   3057  O  "O3'" . DA  B 2  5   ? -59.669 -31.745 75.359 1.00 94.11  ? -68 DA  J "O3'" 1 
ATOM   3058  C  "C2'" . DA  B 2  5   ? -60.456 -34.033 74.919 1.00 87.88  ? -68 DA  J "C2'" 1 
ATOM   3059  C  "C1'" . DA  B 2  5   ? -59.271 -34.737 75.555 1.00 92.98  ? -68 DA  J "C1'" 1 
ATOM   3060  N  N9    . DA  B 2  5   ? -59.248 -36.187 75.400 1.00 94.34  ? -68 DA  J N9    1 
ATOM   3061  C  C8    . DA  B 2  5   ? -60.266 -37.073 75.646 1.00 100.60 ? -68 DA  J C8    1 
ATOM   3062  N  N7    . DA  B 2  5   ? -59.937 -38.325 75.441 1.00 106.20 ? -68 DA  J N7    1 
ATOM   3063  C  C5    . DA  B 2  5   ? -58.610 -38.261 75.043 1.00 94.66  ? -68 DA  J C5    1 
ATOM   3064  C  C6    . DA  B 2  5   ? -57.683 -39.250 74.673 1.00 92.18  ? -68 DA  J C6    1 
ATOM   3065  N  N6    . DA  B 2  5   ? -57.961 -40.554 74.651 1.00 91.83  ? -68 DA  J N6    1 
ATOM   3066  N  N1    . DA  B 2  5   ? -56.442 -38.849 74.324 1.00 100.02 ? -68 DA  J N1    1 
ATOM   3067  C  C2    . DA  B 2  5   ? -56.158 -37.540 74.356 1.00 93.99  ? -68 DA  J C2    1 
ATOM   3068  N  N3    . DA  B 2  5   ? -56.943 -36.517 74.685 1.00 92.12  ? -68 DA  J N3    1 
ATOM   3069  C  C4    . DA  B 2  5   ? -58.169 -36.950 75.026 1.00 97.39  ? -68 DA  J C4    1 
ATOM   3070  P  P     . DT  B 2  6   ? -60.075 -30.697 74.238 1.00 98.24  ? -67 DT  J P     1 
ATOM   3071  O  OP1   . DT  B 2  6   ? -59.975 -29.337 74.846 1.00 86.56  ? -67 DT  J OP1   1 
ATOM   3072  O  OP2   . DT  B 2  6   ? -61.338 -31.157 73.606 1.00 83.78  ? -67 DT  J OP2   1 
ATOM   3073  O  "O5'" . DT  B 2  6   ? -58.949 -30.891 73.122 1.00 95.94  ? -67 DT  J "O5'" 1 
ATOM   3074  C  "C5'" . DT  B 2  6   ? -57.641 -31.409 73.444 1.00 98.39  ? -67 DT  J "C5'" 1 
ATOM   3075  C  "C4'" . DT  B 2  6   ? -57.149 -32.370 72.383 1.00 96.92  ? -67 DT  J "C4'" 1 
ATOM   3076  O  "O4'" . DT  B 2  6   ? -57.595 -33.725 72.622 1.00 89.34  ? -67 DT  J "O4'" 1 
ATOM   3077  C  "C3'" . DT  B 2  6   ? -57.542 -32.048 70.933 1.00 98.90  ? -67 DT  J "C3'" 1 
ATOM   3078  O  "O3'" . DT  B 2  6   ? -56.397 -31.449 70.293 1.00 101.77 ? -67 DT  J "O3'" 1 
ATOM   3079  C  "C2'" . DT  B 2  6   ? -57.959 -33.396 70.356 1.00 93.66  ? -67 DT  J "C2'" 1 
ATOM   3080  C  "C1'" . DT  B 2  6   ? -57.449 -34.388 71.385 1.00 94.19  ? -67 DT  J "C1'" 1 
ATOM   3081  N  N1    . DT  B 2  6   ? -58.159 -35.680 71.457 1.00 98.23  ? -67 DT  J N1    1 
ATOM   3082  C  C2    . DT  B 2  6   ? -57.407 -36.834 71.389 1.00 102.76 ? -67 DT  J C2    1 
ATOM   3083  O  O2    . DT  B 2  6   ? -56.192 -36.835 71.289 1.00 101.77 ? -67 DT  J O2    1 
ATOM   3084  N  N3    . DT  B 2  6   ? -58.136 -37.996 71.453 1.00 104.51 ? -67 DT  J N3    1 
ATOM   3085  C  C4    . DT  B 2  6   ? -59.507 -38.116 71.572 1.00 102.84 ? -67 DT  J C4    1 
ATOM   3086  O  O4    . DT  B 2  6   ? -60.019 -39.230 71.626 1.00 93.28  ? -67 DT  J O4    1 
ATOM   3087  C  C5    . DT  B 2  6   ? -60.234 -36.866 71.629 1.00 109.70 ? -67 DT  J C5    1 
ATOM   3088  C  C7    . DT  B 2  6   ? -61.724 -36.898 71.758 1.00 113.31 ? -67 DT  J C7    1 
ATOM   3089  C  C6    . DT  B 2  6   ? -59.532 -35.726 71.567 1.00 106.08 ? -67 DT  J C6    1 
ATOM   3090  P  P     . DA  B 2  7   ? -56.333 -31.197 68.688 1.00 98.31  ? -66 DA  J P     1 
ATOM   3091  O  OP1   . DA  B 2  7   ? -55.673 -29.883 68.481 1.00 87.30  ? -66 DA  J OP1   1 
ATOM   3092  O  OP2   . DA  B 2  7   ? -57.677 -31.454 68.105 1.00 90.07  ? -66 DA  J OP2   1 
ATOM   3093  O  "O5'" . DA  B 2  7   ? -55.361 -32.352 68.168 1.00 87.56  ? -66 DA  J "O5'" 1 
ATOM   3094  C  "C5'" . DA  B 2  7   ? -54.201 -32.707 68.942 1.00 85.80  ? -66 DA  J "C5'" 1 
ATOM   3095  C  "C4'" . DA  B 2  7   ? -53.581 -33.990 68.442 1.00 88.41  ? -66 DA  J "C4'" 1 
ATOM   3096  O  "O4'" . DA  B 2  7   ? -54.419 -35.128 68.772 1.00 89.04  ? -66 DA  J "O4'" 1 
ATOM   3097  C  "C3'" . DA  B 2  7   ? -53.365 -34.037 66.930 1.00 89.56  ? -66 DA  J "C3'" 1 
ATOM   3098  O  "O3'" . DA  B 2  7   ? -52.057 -34.580 66.680 1.00 84.32  ? -66 DA  J "O3'" 1 
ATOM   3099  C  "C2'" . DA  B 2  7   ? -54.537 -34.874 66.444 1.00 88.39  ? -66 DA  J "C2'" 1 
ATOM   3100  C  "C1'" . DA  B 2  7   ? -54.751 -35.846 67.594 1.00 85.68  ? -66 DA  J "C1'" 1 
ATOM   3101  N  N9    . DA  B 2  7   ? -56.123 -36.339 67.734 1.00 92.23  ? -66 DA  J N9    1 
ATOM   3102  C  C8    . DA  B 2  7   ? -57.279 -35.608 67.865 1.00 92.47  ? -66 DA  J C8    1 
ATOM   3103  N  N7    . DA  B 2  7   ? -58.361 -36.342 67.951 1.00 89.22  ? -66 DA  J N7    1 
ATOM   3104  C  C5    . DA  B 2  7   ? -57.888 -37.645 67.877 1.00 91.46  ? -66 DA  J C5    1 
ATOM   3105  C  C6    . DA  B 2  7   ? -58.536 -38.893 67.918 1.00 94.10  ? -66 DA  J C6    1 
ATOM   3106  N  N6    . DA  B 2  7   ? -59.856 -39.040 68.047 1.00 91.75  ? -66 DA  J N6    1 
ATOM   3107  N  N1    . DA  B 2  7   ? -57.770 -40.001 67.817 1.00 104.98 ? -66 DA  J N1    1 
ATOM   3108  C  C2    . DA  B 2  7   ? -56.445 -39.856 67.674 1.00 100.69 ? -66 DA  J C2    1 
ATOM   3109  N  N3    . DA  B 2  7   ? -55.721 -38.739 67.626 1.00 97.94  ? -66 DA  J N3    1 
ATOM   3110  C  C4    . DA  B 2  7   ? -56.511 -37.657 67.736 1.00 91.60  ? -66 DA  J C4    1 
ATOM   3111  P  P     . DT  B 2  8   ? -51.453 -34.625 65.201 1.00 76.61  ? -65 DT  J P     1 
ATOM   3112  O  OP1   . DT  B 2  8   ? -49.979 -34.709 65.327 1.00 85.12  ? -65 DT  J OP1   1 
ATOM   3113  O  OP2   . DT  B 2  8   ? -52.094 -33.540 64.413 1.00 73.24  ? -65 DT  J OP2   1 
ATOM   3114  O  "O5'" . DT  B 2  8   ? -51.864 -36.065 64.660 1.00 73.63  ? -65 DT  J "O5'" 1 
ATOM   3115  C  "C5'" . DT  B 2  8   ? -51.674 -37.219 65.502 1.00 82.65  ? -65 DT  J "C5'" 1 
ATOM   3116  C  "C4'" . DT  B 2  8   ? -52.143 -38.486 64.824 1.00 87.62  ? -65 DT  J "C4'" 1 
ATOM   3117  O  "O4'" . DT  B 2  8   ? -53.533 -38.758 65.136 1.00 93.48  ? -65 DT  J "O4'" 1 
ATOM   3118  C  "C3'" . DT  B 2  8   ? -52.043 -38.502 63.296 1.00 90.03  ? -65 DT  J "C3'" 1 
ATOM   3119  O  "O3'" . DT  B 2  8   ? -51.510 -39.785 62.944 1.00 101.81 ? -65 DT  J "O3'" 1 
ATOM   3120  C  "C2'" . DT  B 2  8   ? -53.481 -38.303 62.851 1.00 86.38  ? -65 DT  J "C2'" 1 
ATOM   3121  C  "C1'" . DT  B 2  8   ? -54.213 -39.081 63.931 1.00 89.80  ? -65 DT  J "C1'" 1 
ATOM   3122  N  N1    . DT  B 2  8   ? -55.656 -38.795 64.119 1.00 89.88  ? -65 DT  J N1    1 
ATOM   3123  C  C2    . DT  B 2  8   ? -56.492 -39.862 64.367 1.00 89.97  ? -65 DT  J C2    1 
ATOM   3124  O  O2    . DT  B 2  8   ? -56.100 -41.015 64.441 1.00 93.23  ? -65 DT  J O2    1 
ATOM   3125  N  N3    . DT  B 2  8   ? -57.816 -39.529 64.522 1.00 91.31  ? -65 DT  J N3    1 
ATOM   3126  C  C4    . DT  B 2  8   ? -58.372 -38.265 64.466 1.00 100.49 ? -65 DT  J C4    1 
ATOM   3127  O  O4    . DT  B 2  8   ? -59.581 -38.120 64.638 1.00 101.29 ? -65 DT  J O4    1 
ATOM   3128  C  C5    . DT  B 2  8   ? -57.439 -37.192 64.204 1.00 99.32  ? -65 DT  J C5    1 
ATOM   3129  C  C7    . DT  B 2  8   ? -57.952 -35.789 64.127 1.00 93.59  ? -65 DT  J C7    1 
ATOM   3130  C  C6    . DT  B 2  8   ? -56.145 -37.506 64.046 1.00 94.97  ? -65 DT  J C6    1 
ATOM   3131  P  P     . DC  B 2  9   ? -51.157 -40.148 61.421 1.00 111.40 ? -64 DC  J P     1 
ATOM   3132  O  OP1   . DC  B 2  9   ? -49.828 -40.828 61.408 1.00 99.63  ? -64 DC  J OP1   1 
ATOM   3133  O  OP2   . DC  B 2  9   ? -51.410 -38.941 60.588 1.00 89.87  ? -64 DC  J OP2   1 
ATOM   3134  O  "O5'" . DC  B 2  9   ? -52.240 -41.257 61.046 1.00 114.09 ? -64 DC  J "O5'" 1 
ATOM   3135  C  "C5'" . DC  B 2  9   ? -52.207 -42.558 61.668 1.00 116.11 ? -64 DC  J "C5'" 1 
ATOM   3136  C  "C4'" . DC  B 2  9   ? -53.466 -43.314 61.322 1.00 113.08 ? -64 DC  J "C4'" 1 
ATOM   3137  O  "O4'" . DC  B 2  9   ? -54.603 -42.590 61.832 1.00 112.50 ? -64 DC  J "O4'" 1 
ATOM   3138  C  "C3'" . DC  B 2  9   ? -53.687 -43.459 59.819 1.00 114.06 ? -64 DC  J "C3'" 1 
ATOM   3139  O  "O3'" . DC  B 2  9   ? -53.376 -44.805 59.469 1.00 117.51 ? -64 DC  J "O3'" 1 
ATOM   3140  C  "C2'" . DC  B 2  9   ? -55.155 -43.133 59.600 1.00 113.69 ? -64 DC  J "C2'" 1 
ATOM   3141  C  "C1'" . DC  B 2  9   ? -55.706 -42.731 60.959 1.00 108.56 ? -64 DC  J "C1'" 1 
ATOM   3142  N  N1    . DC  B 2  9   ? -56.427 -41.452 60.946 1.00 101.35 ? -64 DC  J N1    1 
ATOM   3143  C  C2    . DC  B 2  9   ? -57.819 -41.472 60.977 1.00 104.18 ? -64 DC  J C2    1 
ATOM   3144  O  O2    . DC  B 2  9   ? -58.399 -42.567 61.011 1.00 114.87 ? -64 DC  J O2    1 
ATOM   3145  N  N3    . DC  B 2  9   ? -58.499 -40.301 60.975 1.00 93.41  ? -64 DC  J N3    1 
ATOM   3146  C  C4    . DC  B 2  9   ? -57.835 -39.145 60.939 1.00 87.92  ? -64 DC  J C4    1 
ATOM   3147  N  N4    . DC  B 2  9   ? -58.545 -38.015 60.938 1.00 87.07  ? -64 DC  J N4    1 
ATOM   3148  C  C5    . DC  B 2  9   ? -56.412 -39.096 60.898 1.00 94.15  ? -64 DC  J C5    1 
ATOM   3149  C  C6    . DC  B 2  9   ? -55.754 -40.263 60.903 1.00 97.62  ? -64 DC  J C6    1 
ATOM   3150  P  P     . DC  B 2  10  ? -52.991 -45.183 57.972 1.00 110.80 ? -63 DC  J P     1 
ATOM   3151  O  OP1   . DC  B 2  10  ? -51.619 -45.752 57.994 1.00 92.00  ? -63 DC  J OP1   1 
ATOM   3152  O  OP2   . DC  B 2  10  ? -53.281 -44.006 57.111 1.00 101.16 ? -63 DC  J OP2   1 
ATOM   3153  O  "O5'" . DC  B 2  10  ? -54.020 -46.359 57.646 1.00 114.96 ? -63 DC  J "O5'" 1 
ATOM   3154  C  "C5'" . DC  B 2  10  ? -54.991 -46.818 58.623 1.00 119.61 ? -63 DC  J "C5'" 1 
ATOM   3155  C  "C4'" . DC  B 2  10  ? -56.385 -46.821 58.036 1.00 123.16 ? -63 DC  J "C4'" 1 
ATOM   3156  O  "O4'" . DC  B 2  10  ? -57.102 -45.617 58.408 1.00 112.02 ? -63 DC  J "O4'" 1 
ATOM   3157  C  "C3'" . DC  B 2  10  ? -56.443 -46.906 56.505 1.00 125.67 ? -63 DC  J "C3'" 1 
ATOM   3158  O  "O3'" . DC  B 2  10  ? -57.163 -48.075 56.102 1.00 130.53 ? -63 DC  J "O3'" 1 
ATOM   3159  C  "C2'" . DC  B 2  10  ? -57.110 -45.608 56.076 1.00 117.33 ? -63 DC  J "C2'" 1 
ATOM   3160  C  "C1'" . DC  B 2  10  ? -57.883 -45.191 57.308 1.00 108.11 ? -63 DC  J "C1'" 1 
ATOM   3161  N  N1    . DC  B 2  10  ? -58.090 -43.741 57.431 1.00 106.05 ? -63 DC  J N1    1 
ATOM   3162  C  C2    . DC  B 2  10  ? -59.334 -43.276 57.864 1.00 94.84  ? -63 DC  J C2    1 
ATOM   3163  O  O2    . DC  B 2  10  ? -60.221 -44.098 58.133 1.00 94.47  ? -63 DC  J O2    1 
ATOM   3164  N  N3    . DC  B 2  10  ? -59.539 -41.943 57.975 1.00 90.12  ? -63 DC  J N3    1 
ATOM   3165  C  C4    . DC  B 2  10  ? -58.553 -41.091 57.688 1.00 92.46  ? -63 DC  J C4    1 
ATOM   3166  N  N4    . DC  B 2  10  ? -58.794 -39.786 57.824 1.00 97.16  ? -63 DC  J N4    1 
ATOM   3167  C  C5    . DC  B 2  10  ? -57.277 -41.538 57.239 1.00 97.22  ? -63 DC  J C5    1 
ATOM   3168  C  C6    . DC  B 2  10  ? -57.092 -42.858 57.121 1.00 104.37 ? -63 DC  J C6    1 
ATOM   3169  P  P     . DA  B 2  11  ? -57.549 -48.298 54.565 1.00 127.70 ? -62 DA  J P     1 
ATOM   3170  O  OP1   . DA  B 2  11  ? -57.581 -49.760 54.316 1.00 122.91 ? -62 DA  J OP1   1 
ATOM   3171  O  OP2   . DA  B 2  11  ? -56.690 -47.419 53.729 1.00 115.11 ? -62 DA  J OP2   1 
ATOM   3172  O  "O5'" . DA  B 2  11  ? -59.042 -47.747 54.498 1.00 133.06 ? -62 DA  J "O5'" 1 
ATOM   3173  C  "C5'" . DA  B 2  11  ? -60.062 -48.288 55.361 1.00 131.80 ? -62 DA  J "C5'" 1 
ATOM   3174  C  "C4'" . DA  B 2  11  ? -61.424 -48.140 54.725 1.00 126.78 ? -62 DA  J "C4'" 1 
ATOM   3175  O  "O4'" . DA  B 2  11  ? -61.951 -46.833 55.040 1.00 118.16 ? -62 DA  J "O4'" 1 
ATOM   3176  C  "C3'" . DA  B 2  11  ? -61.453 -48.263 53.199 1.00 127.18 ? -62 DA  J "C3'" 1 
ATOM   3177  O  "O3'" . DA  B 2  11  ? -62.582 -49.014 52.728 1.00 133.87 ? -62 DA  J "O3'" 1 
ATOM   3178  C  "C2'" . DA  B 2  11  ? -61.447 -46.822 52.719 1.00 117.25 ? -62 DA  J "C2'" 1 
ATOM   3179  C  "C1'" . DA  B 2  11  ? -62.022 -46.023 53.877 1.00 112.01 ? -62 DA  J "C1'" 1 
ATOM   3180  N  N9    . DA  B 2  11  ? -61.296 -44.785 54.146 1.00 110.17 ? -62 DA  J N9    1 
ATOM   3181  C  C8    . DA  B 2  11  ? -59.948 -44.541 54.040 1.00 104.30 ? -62 DA  J C8    1 
ATOM   3182  N  N7    . DA  B 2  11  ? -59.611 -43.311 54.336 1.00 110.75 ? -62 DA  J N7    1 
ATOM   3183  C  C5    . DA  B 2  11  ? -60.818 -42.699 54.644 1.00 100.81 ? -62 DA  J C5    1 
ATOM   3184  C  C6    . DA  B 2  11  ? -61.142 -41.389 55.037 1.00 103.79 ? -62 DA  J C6    1 
ATOM   3185  N  N6    . DA  B 2  11  ? -60.240 -40.419 55.192 1.00 111.90 ? -62 DA  J N6    1 
ATOM   3186  N  N1    . DA  B 2  11  ? -62.443 -41.105 55.265 1.00 98.80  ? -62 DA  J N1    1 
ATOM   3187  C  C2    . DA  B 2  11  ? -63.348 -42.079 55.111 1.00 99.74  ? -62 DA  J C2    1 
ATOM   3188  N  N3    . DA  B 2  11  ? -63.166 -43.346 54.749 1.00 99.92  ? -62 DA  J N3    1 
ATOM   3189  C  C4    . DA  B 2  11  ? -61.864 -43.594 54.526 1.00 101.03 ? -62 DA  J C4    1 
ATOM   3190  P  P     . DC  B 2  12  ? -62.935 -49.055 51.156 1.00 134.66 ? -61 DC  J P     1 
ATOM   3191  O  OP1   . DC  B 2  12  ? -63.584 -50.358 50.854 1.00 117.09 ? -61 DC  J OP1   1 
ATOM   3192  O  OP2   . DC  B 2  12  ? -61.709 -48.681 50.400 1.00 127.43 ? -61 DC  J OP2   1 
ATOM   3193  O  "O5'" . DC  B 2  12  ? -64.038 -47.906 51.021 1.00 125.63 ? -61 DC  J "O5'" 1 
ATOM   3194  C  "C5'" . DC  B 2  12  ? -64.918 -47.541 52.116 1.00 106.86 ? -61 DC  J "C5'" 1 
ATOM   3195  C  "C4'" . DC  B 2  12  ? -65.733 -46.325 51.738 1.00 110.63 ? -61 DC  J "C4'" 1 
ATOM   3196  O  "O4'" . DC  B 2  12  ? -65.055 -45.122 52.189 1.00 126.37 ? -61 DC  J "O4'" 1 
ATOM   3197  C  "C3'" . DC  B 2  12  ? -65.942 -46.141 50.229 1.00 112.61 ? -61 DC  J "C3'" 1 
ATOM   3198  O  "O3'" . DC  B 2  12  ? -67.264 -45.657 49.959 1.00 117.19 ? -61 DC  J "O3'" 1 
ATOM   3199  C  "C2'" . DC  B 2  12  ? -64.898 -45.101 49.868 1.00 119.57 ? -61 DC  J "C2'" 1 
ATOM   3200  C  "C1'" . DC  B 2  12  ? -64.969 -44.215 51.093 1.00 123.50 ? -61 DC  J "C1'" 1 
ATOM   3201  N  N1    . DC  B 2  12  ? -63.806 -43.322 51.297 1.00 111.40 ? -61 DC  J N1    1 
ATOM   3202  C  C2    . DC  B 2  12  ? -64.030 -41.992 51.682 1.00 106.21 ? -61 DC  J C2    1 
ATOM   3203  O  O2    . DC  B 2  12  ? -65.193 -41.608 51.873 1.00 99.59  ? -61 DC  J O2    1 
ATOM   3204  N  N3    . DC  B 2  12  ? -62.972 -41.165 51.846 1.00 106.38 ? -61 DC  J N3    1 
ATOM   3205  C  C4    . DC  B 2  12  ? -61.734 -41.611 51.620 1.00 99.31  ? -61 DC  J C4    1 
ATOM   3206  N  N4    . DC  B 2  12  ? -60.722 -40.760 51.790 1.00 87.25  ? -61 DC  J N4    1 
ATOM   3207  C  C5    . DC  B 2  12  ? -61.479 -42.954 51.212 1.00 102.35 ? -61 DC  J C5    1 
ATOM   3208  C  C6    . DC  B 2  12  ? -62.534 -43.764 51.052 1.00 104.40 ? -61 DC  J C6    1 
ATOM   3209  P  P     . DC  B 2  13  ? -67.641 -45.003 48.521 1.00 122.26 ? -60 DC  J P     1 
ATOM   3210  O  OP1   . DC  B 2  13  ? -69.059 -45.319 48.231 1.00 117.68 ? -60 DC  J OP1   1 
ATOM   3211  O  OP2   . DC  B 2  13  ? -66.594 -45.369 47.530 1.00 105.61 ? -60 DC  J OP2   1 
ATOM   3212  O  "O5'" . DC  B 2  13  ? -67.568 -43.440 48.813 1.00 125.52 ? -60 DC  J "O5'" 1 
ATOM   3213  C  "C5'" . DC  B 2  13  ? -68.608 -42.766 49.543 1.00 118.35 ? -60 DC  J "C5'" 1 
ATOM   3214  C  "C4'" . DC  B 2  13  ? -68.796 -41.378 48.980 1.00 120.69 ? -60 DC  J "C4'" 1 
ATOM   3215  O  "O4'" . DC  B 2  13  ? -67.586 -40.610 49.186 1.00 128.64 ? -60 DC  J "O4'" 1 
ATOM   3216  C  "C3'" . DC  B 2  13  ? -69.072 -41.319 47.478 1.00 118.31 ? -60 DC  J "C3'" 1 
ATOM   3217  O  "O3'" . DC  B 2  13  ? -69.961 -40.222 47.250 1.00 120.74 ? -60 DC  J "O3'" 1 
ATOM   3218  C  "C2'" . DC  B 2  13  ? -67.697 -41.080 46.881 1.00 117.85 ? -60 DC  J "C2'" 1 
ATOM   3219  C  "C1'" . DC  B 2  13  ? -67.050 -40.192 47.934 1.00 123.83 ? -60 DC  J "C1'" 1 
ATOM   3220  N  N1    . DC  B 2  13  ? -65.579 -40.261 48.026 1.00 124.42 ? -60 DC  J N1    1 
ATOM   3221  C  C2    . DC  B 2  13  ? -64.864 -39.084 48.279 1.00 119.12 ? -60 DC  J C2    1 
ATOM   3222  O  O2    . DC  B 2  13  ? -65.485 -38.015 48.394 1.00 107.72 ? -60 DC  J O2    1 
ATOM   3223  N  N3    . DC  B 2  13  ? -63.514 -39.139 48.379 1.00 112.87 ? -60 DC  J N3    1 
ATOM   3224  C  C4    . DC  B 2  13  ? -62.882 -40.308 48.241 1.00 105.94 ? -60 DC  J C4    1 
ATOM   3225  N  N4    . DC  B 2  13  ? -61.553 -40.318 48.351 1.00 94.72  ? -60 DC  J N4    1 
ATOM   3226  C  C5    . DC  B 2  13  ? -63.587 -41.521 47.992 1.00 111.40 ? -60 DC  J C5    1 
ATOM   3227  C  C6    . DC  B 2  13  ? -64.921 -41.454 47.900 1.00 122.19 ? -60 DC  J C6    1 
ATOM   3228  P  P     . DT  B 2  14  ? -70.456 -39.856 45.772 1.00 121.72 ? -59 DT  J P     1 
ATOM   3229  O  OP1   . DT  B 2  14  ? -71.834 -39.304 45.877 1.00 116.66 ? -59 DT  J OP1   1 
ATOM   3230  O  OP2   . DT  B 2  14  ? -70.157 -41.008 44.865 1.00 92.42  ? -59 DT  J OP2   1 
ATOM   3231  O  "O5'" . DT  B 2  14  ? -69.528 -38.626 45.385 1.00 125.25 ? -59 DT  J "O5'" 1 
ATOM   3232  C  "C5'" . DT  B 2  14  ? -69.516 -37.441 46.197 1.00 133.44 ? -59 DT  J "C5'" 1 
ATOM   3233  C  "C4'" . DT  B 2  14  ? -68.671 -36.390 45.521 1.00 133.35 ? -59 DT  J "C4'" 1 
ATOM   3234  O  "O4'" . DT  B 2  14  ? -67.273 -36.736 45.672 1.00 142.56 ? -59 DT  J "O4'" 1 
ATOM   3235  C  "C3'" . DT  B 2  14  ? -68.906 -36.271 44.013 1.00 136.76 ? -59 DT  J "C3'" 1 
ATOM   3236  O  "O3'" . DT  B 2  14  ? -68.735 -34.909 43.634 1.00 141.14 ? -59 DT  J "O3'" 1 
ATOM   3237  C  "C2'" . DT  B 2  14  ? -67.758 -37.058 43.415 1.00 138.86 ? -59 DT  J "C2'" 1 
ATOM   3238  C  "C1'" . DT  B 2  14  ? -66.661 -36.685 44.392 1.00 142.68 ? -59 DT  J "C1'" 1 
ATOM   3239  N  N1    . DT  B 2  14  ? -65.460 -37.540 44.419 1.00 132.21 ? -59 DT  J N1    1 
ATOM   3240  C  C2    . DT  B 2  14  ? -64.265 -36.934 44.736 1.00 128.02 ? -59 DT  J C2    1 
ATOM   3241  O  O2    . DT  B 2  14  ? -64.166 -35.744 44.988 1.00 123.41 ? -59 DT  J O2    1 
ATOM   3242  N  N3    . DT  B 2  14  ? -63.182 -37.777 44.747 1.00 125.78 ? -59 DT  J N3    1 
ATOM   3243  C  C4    . DT  B 2  14  ? -63.176 -39.131 44.474 1.00 129.09 ? -59 DT  J C4    1 
ATOM   3244  O  O4    . DT  B 2  14  ? -62.121 -39.756 44.518 1.00 122.87 ? -59 DT  J O4    1 
ATOM   3245  C  C5    . DT  B 2  14  ? -64.465 -39.701 44.147 1.00 130.18 ? -59 DT  J C5    1 
ATOM   3246  C  C7    . DT  B 2  14  ? -64.558 -41.162 43.838 1.00 125.22 ? -59 DT  J C7    1 
ATOM   3247  C  C6    . DT  B 2  14  ? -65.528 -38.887 44.136 1.00 127.35 ? -59 DT  J C6    1 
ATOM   3248  P  P     . DG  B 2  15  ? -69.790 -34.202 42.690 1.00 142.63 ? -58 DG  J P     1 
ATOM   3249  O  OP1   . DG  B 2  15  ? -71.140 -34.580 43.178 1.00 145.32 ? -58 DG  J OP1   1 
ATOM   3250  O  OP2   . DG  B 2  15  ? -69.404 -34.482 41.273 1.00 116.70 ? -58 DG  J OP2   1 
ATOM   3251  O  "O5'" . DG  B 2  15  ? -69.580 -32.656 43.020 1.00 127.39 ? -58 DG  J "O5'" 1 
ATOM   3252  C  "C5'" . DG  B 2  15  ? -68.428 -32.178 43.754 1.00 128.09 ? -58 DG  J "C5'" 1 
ATOM   3253  C  "C4'" . DG  B 2  15  ? -67.448 -31.469 42.844 1.00 121.87 ? -58 DG  J "C4'" 1 
ATOM   3254  O  "O4'" . DG  B 2  15  ? -66.255 -32.270 42.680 1.00 121.10 ? -58 DG  J "O4'" 1 
ATOM   3255  C  "C3'" . DG  B 2  15  ? -67.969 -31.141 41.441 1.00 124.24 ? -58 DG  J "C3'" 1 
ATOM   3256  O  "O3'" . DG  B 2  15  ? -68.044 -29.710 41.299 1.00 126.38 ? -58 DG  J "O3'" 1 
ATOM   3257  C  "C2'" . DG  B 2  15  ? -67.133 -32.005 40.501 1.00 124.19 ? -58 DG  J "C2'" 1 
ATOM   3258  C  "C1'" . DG  B 2  15  ? -65.914 -32.430 41.310 1.00 127.25 ? -58 DG  J "C1'" 1 
ATOM   3259  N  N9    . DG  B 2  15  ? -65.484 -33.814 41.127 1.00 120.91 ? -58 DG  J N9    1 
ATOM   3260  C  C8    . DG  B 2  15  ? -66.204 -34.852 40.583 1.00 117.76 ? -58 DG  J C8    1 
ATOM   3261  N  N7    . DG  B 2  15  ? -65.560 -35.986 40.600 1.00 107.72 ? -58 DG  J N7    1 
ATOM   3262  C  C5    . DG  B 2  15  ? -64.347 -35.683 41.201 1.00 104.88 ? -58 DG  J C5    1 
ATOM   3263  C  C6    . DG  B 2  15  ? -63.237 -36.513 41.494 1.00 96.99  ? -58 DG  J C6    1 
ATOM   3264  O  O6    . DG  B 2  15  ? -63.101 -37.721 41.275 1.00 91.37  ? -58 DG  J O6    1 
ATOM   3265  N  N1    . DG  B 2  15  ? -62.213 -35.799 42.106 1.00 101.85 ? -58 DG  J N1    1 
ATOM   3266  C  C2    . DG  B 2  15  ? -62.253 -34.458 42.403 1.00 100.64 ? -58 DG  J C2    1 
ATOM   3267  N  N2    . DG  B 2  15  ? -61.165 -33.951 42.997 1.00 98.42  ? -58 DG  J N2    1 
ATOM   3268  N  N3    . DG  B 2  15  ? -63.283 -33.674 42.137 1.00 107.16 ? -58 DG  J N3    1 
ATOM   3269  C  C4    . DG  B 2  15  ? -64.287 -34.348 41.539 1.00 112.17 ? -58 DG  J C4    1 
ATOM   3270  P  P     . DC  B 2  16  ? -67.057 -28.893 40.340 1.00 131.43 ? -57 DC  J P     1 
ATOM   3271  O  OP1   . DC  B 2  16  ? -67.303 -27.447 40.571 1.00 125.60 ? -57 DC  J OP1   1 
ATOM   3272  O  OP2   . DC  B 2  16  ? -67.184 -29.446 38.964 1.00 114.75 ? -57 DC  J OP2   1 
ATOM   3273  O  "O5'" . DC  B 2  16  ? -65.616 -29.218 40.942 1.00 135.18 ? -57 DC  J "O5'" 1 
ATOM   3274  C  "C5'" . DC  B 2  16  ? -64.581 -28.214 40.993 1.00 122.92 ? -57 DC  J "C5'" 1 
ATOM   3275  C  "C4'" . DC  B 2  16  ? -63.460 -28.553 40.038 1.00 117.64 ? -57 DC  J "C4'" 1 
ATOM   3276  O  "O4'" . DC  B 2  16  ? -63.354 -29.987 39.870 1.00 105.59 ? -57 DC  J "O4'" 1 
ATOM   3277  C  "C3'" . DC  B 2  16  ? -63.583 -27.975 38.620 1.00 114.55 ? -57 DC  J "C3'" 1 
ATOM   3278  O  "O3'" . DC  B 2  16  ? -62.314 -27.464 38.213 1.00 110.13 ? -57 DC  J "O3'" 1 
ATOM   3279  C  "C2'" . DC  B 2  16  ? -63.860 -29.194 37.761 1.00 109.90 ? -57 DC  J "C2'" 1 
ATOM   3280  C  "C1'" . DC  B 2  16  ? -63.032 -30.207 38.514 1.00 106.24 ? -57 DC  J "C1'" 1 
ATOM   3281  N  N1    . DC  B 2  16  ? -63.242 -31.623 38.225 1.00 109.23 ? -57 DC  J N1    1 
ATOM   3282  C  C2    . DC  B 2  16  ? -62.323 -32.534 38.747 1.00 112.62 ? -57 DC  J C2    1 
ATOM   3283  O  O2    . DC  B 2  16  ? -61.381 -32.109 39.432 1.00 106.98 ? -57 DC  J O2    1 
ATOM   3284  N  N3    . DC  B 2  16  ? -62.481 -33.851 38.492 1.00 117.18 ? -57 DC  J N3    1 
ATOM   3285  C  C4    . DC  B 2  16  ? -63.503 -34.266 37.743 1.00 114.42 ? -57 DC  J C4    1 
ATOM   3286  N  N4    . DC  B 2  16  ? -63.617 -35.575 37.515 1.00 116.79 ? -57 DC  J N4    1 
ATOM   3287  C  C5    . DC  B 2  16  ? -64.456 -33.358 37.197 1.00 107.46 ? -57 DC  J C5    1 
ATOM   3288  C  C6    . DC  B 2  16  ? -64.287 -32.057 37.457 1.00 109.90 ? -57 DC  J C6    1 
ATOM   3289  P  P     . DA  B 2  17  ? -62.015 -25.909 38.304 1.00 118.36 ? -56 DA  J P     1 
ATOM   3290  O  OP1   . DA  B 2  17  ? -62.758 -25.350 39.470 1.00 103.71 ? -56 DA  J OP1   1 
ATOM   3291  O  OP2   . DA  B 2  17  ? -62.221 -25.345 36.946 1.00 110.01 ? -56 DA  J OP2   1 
ATOM   3292  O  "O5'" . DA  B 2  17  ? -60.473 -25.873 38.695 1.00 110.84 ? -56 DA  J "O5'" 1 
ATOM   3293  C  "C5'" . DA  B 2  17  ? -60.040 -26.268 40.008 1.00 111.35 ? -56 DA  J "C5'" 1 
ATOM   3294  C  "C4'" . DA  B 2  17  ? -58.730 -27.017 39.932 1.00 114.79 ? -56 DA  J "C4'" 1 
ATOM   3295  O  "O4'" . DA  B 2  17  ? -58.924 -28.319 39.336 1.00 112.09 ? -56 DA  J "O4'" 1 
ATOM   3296  C  "C3'" . DA  B 2  17  ? -57.650 -26.361 39.081 1.00 118.07 ? -56 DA  J "C3'" 1 
ATOM   3297  O  "O3'" . DA  B 2  17  ? -56.400 -26.822 39.600 1.00 124.77 ? -56 DA  J "O3'" 1 
ATOM   3298  C  "C2'" . DA  B 2  17  ? -57.921 -26.934 37.703 1.00 105.13 ? -56 DA  J "C2'" 1 
ATOM   3299  C  "C1'" . DA  B 2  17  ? -58.326 -28.357 38.042 1.00 102.33 ? -56 DA  J "C1'" 1 
ATOM   3300  N  N9    . DA  B 2  17  ? -59.299 -28.945 37.139 1.00 105.79 ? -56 DA  J N9    1 
ATOM   3301  C  C8    . DA  B 2  17  ? -60.287 -28.338 36.404 1.00 111.34 ? -56 DA  J C8    1 
ATOM   3302  N  N7    . DA  B 2  17  ? -61.030 -29.177 35.726 1.00 116.31 ? -56 DA  J N7    1 
ATOM   3303  C  C5    . DA  B 2  17  ? -60.509 -30.422 36.053 1.00 116.31 ? -56 DA  J C5    1 
ATOM   3304  C  C6    . DA  B 2  17  ? -60.858 -31.727 35.663 1.00 121.69 ? -56 DA  J C6    1 
ATOM   3305  N  N6    . DA  B 2  17  ? -61.854 -32.007 34.820 1.00 123.13 ? -56 DA  J N6    1 
ATOM   3306  N  N1    . DA  B 2  17  ? -60.128 -32.748 36.164 1.00 118.87 ? -56 DA  J N1    1 
ATOM   3307  C  C2    . DA  B 2  17  ? -59.127 -32.467 37.008 1.00 119.61 ? -56 DA  J C2    1 
ATOM   3308  N  N3    . DA  B 2  17  ? -58.710 -31.284 37.456 1.00 115.15 ? -56 DA  J N3    1 
ATOM   3309  C  C4    . DA  B 2  17  ? -59.450 -30.293 36.931 1.00 109.62 ? -56 DA  J C4    1 
ATOM   3310  P  P     . DG  B 2  18  ? -55.015 -26.353 38.955 1.00 120.65 ? -55 DG  J P     1 
ATOM   3311  O  OP1   . DG  B 2  18  ? -54.073 -26.146 40.075 1.00 107.67 ? -55 DG  J OP1   1 
ATOM   3312  O  OP2   . DG  B 2  18  ? -55.285 -25.242 38.002 1.00 113.33 ? -55 DG  J OP2   1 
ATOM   3313  O  "O5'" . DG  B 2  18  ? -54.568 -27.619 38.094 1.00 105.28 ? -55 DG  J "O5'" 1 
ATOM   3314  C  "C5'" . DG  B 2  18  ? -54.381 -28.892 38.731 1.00 103.61 ? -55 DG  J "C5'" 1 
ATOM   3315  C  "C4'" . DG  B 2  18  ? -53.880 -29.917 37.741 1.00 107.91 ? -55 DG  J "C4'" 1 
ATOM   3316  O  "O4'" . DG  B 2  18  ? -54.983 -30.397 36.936 1.00 116.27 ? -55 DG  J "O4'" 1 
ATOM   3317  C  "C3'" . DG  B 2  18  ? -52.835 -29.420 36.742 1.00 105.06 ? -55 DG  J "C3'" 1 
ATOM   3318  O  "O3'" . DG  B 2  18  ? -51.969 -30.544 36.515 1.00 101.80 ? -55 DG  J "O3'" 1 
ATOM   3319  C  "C2'" . DG  B 2  18  ? -53.697 -28.981 35.573 1.00 104.28 ? -55 DG  J "C2'" 1 
ATOM   3320  C  "C1'" . DG  B 2  18  ? -54.739 -30.085 35.570 1.00 112.22 ? -55 DG  J "C1'" 1 
ATOM   3321  N  N9    . DG  B 2  18  ? -56.018 -29.771 34.947 1.00 110.91 ? -55 DG  J N9    1 
ATOM   3322  C  C8    . DG  B 2  18  ? -56.588 -28.535 34.756 1.00 106.64 ? -55 DG  J C8    1 
ATOM   3323  N  N7    . DG  B 2  18  ? -57.753 -28.595 34.172 1.00 106.23 ? -55 DG  J N7    1 
ATOM   3324  C  C5    . DG  B 2  18  ? -57.964 -29.951 33.966 1.00 112.63 ? -55 DG  J C5    1 
ATOM   3325  C  C6    . DG  B 2  18  ? -59.055 -30.632 33.368 1.00 114.66 ? -55 DG  J C6    1 
ATOM   3326  O  O6    . DG  B 2  18  ? -60.092 -30.157 32.891 1.00 114.82 ? -55 DG  J O6    1 
ATOM   3327  N  N1    . DG  B 2  18  ? -58.861 -32.010 33.370 1.00 110.30 ? -55 DG  J N1    1 
ATOM   3328  C  C2    . DG  B 2  18  ? -57.762 -32.651 33.881 1.00 101.48 ? -55 DG  J C2    1 
ATOM   3329  N  N2    . DG  B 2  18  ? -57.758 -33.986 33.787 1.00 104.80 ? -55 DG  J N2    1 
ATOM   3330  N  N3    . DG  B 2  18  ? -56.737 -32.029 34.435 1.00 101.23 ? -55 DG  J N3    1 
ATOM   3331  C  C4    . DG  B 2  18  ? -56.905 -30.690 34.446 1.00 106.24 ? -55 DG  J C4    1 
ATOM   3332  P  P     . DA  B 2  19  ? -50.911 -30.575 35.313 1.00 99.07  ? -54 DA  J P     1 
ATOM   3333  O  OP1   . DA  B 2  19  ? -49.573 -30.360 35.896 1.00 104.57 ? -54 DA  J OP1   1 
ATOM   3334  O  OP2   . DA  B 2  19  ? -51.390 -29.698 34.219 1.00 99.88  ? -54 DA  J OP2   1 
ATOM   3335  O  "O5'" . DA  B 2  19  ? -51.010 -32.073 34.784 1.00 85.74  ? -54 DA  J "O5'" 1 
ATOM   3336  C  "C5'" . DA  B 2  19  ? -52.006 -32.951 35.312 1.00 93.17  ? -54 DA  J "C5'" 1 
ATOM   3337  C  "C4'" . DA  B 2  19  ? -52.442 -33.957 34.273 1.00 103.03 ? -54 DA  J "C4'" 1 
ATOM   3338  O  "O4'" . DA  B 2  19  ? -53.747 -33.613 33.745 1.00 103.71 ? -54 DA  J "O4'" 1 
ATOM   3339  C  "C3'" . DA  B 2  19  ? -51.522 -34.103 33.064 1.00 97.64  ? -54 DA  J "C3'" 1 
ATOM   3340  O  "O3'" . DA  B 2  19  ? -51.534 -35.475 32.690 1.00 102.04 ? -54 DA  J "O3'" 1 
ATOM   3341  C  "C2'" . DA  B 2  19  ? -52.211 -33.275 32.002 1.00 100.39 ? -54 DA  J "C2'" 1 
ATOM   3342  C  "C1'" . DA  B 2  19  ? -53.679 -33.498 32.333 1.00 102.53 ? -54 DA  J "C1'" 1 
ATOM   3343  N  N9    . DA  B 2  19  ? -54.565 -32.408 31.929 1.00 99.23  ? -54 DA  J N9    1 
ATOM   3344  C  C8    . DA  B 2  19  ? -54.376 -31.058 32.095 1.00 100.77 ? -54 DA  J C8    1 
ATOM   3345  N  N7    . DA  B 2  19  ? -55.353 -30.326 31.619 1.00 106.06 ? -54 DA  J N7    1 
ATOM   3346  C  C5    . DA  B 2  19  ? -56.246 -31.256 31.107 1.00 104.08 ? -54 DA  J C5    1 
ATOM   3347  C  C6    . DA  B 2  19  ? -57.487 -31.119 30.464 1.00 97.11  ? -54 DA  J C6    1 
ATOM   3348  N  N6    . DA  B 2  19  ? -58.067 -29.944 30.220 1.00 98.87  ? -54 DA  J N6    1 
ATOM   3349  N  N1    . DA  B 2  19  ? -58.124 -32.247 30.080 1.00 96.23  ? -54 DA  J N1    1 
ATOM   3350  C  C2    . DA  B 2  19  ? -57.544 -33.428 30.331 1.00 101.82 ? -54 DA  J C2    1 
ATOM   3351  N  N3    . DA  B 2  19  ? -56.379 -33.684 30.923 1.00 97.15  ? -54 DA  J N3    1 
ATOM   3352  C  C4    . DA  B 2  19  ? -55.773 -32.542 31.290 1.00 97.68  ? -54 DA  J C4    1 
ATOM   3353  P  P     . DT  B 2  20  ? -50.323 -36.089 31.870 1.00 120.03 ? -53 DT  J P     1 
ATOM   3354  O  OP1   . DT  B 2  20  ? -49.750 -37.210 32.661 1.00 112.90 ? -53 DT  J OP1   1 
ATOM   3355  O  OP2   . DT  B 2  20  ? -49.443 -34.979 31.452 1.00 96.65  ? -53 DT  J OP2   1 
ATOM   3356  O  "O5'" . DT  B 2  20  ? -51.067 -36.697 30.600 1.00 124.52 ? -53 DT  J "O5'" 1 
ATOM   3357  C  "C5'" . DT  B 2  20  ? -52.084 -37.696 30.786 1.00 124.88 ? -53 DT  J "C5'" 1 
ATOM   3358  C  "C4'" . DT  B 2  20  ? -53.171 -37.571 29.744 1.00 130.86 ? -53 DT  J "C4'" 1 
ATOM   3359  O  "O4'" . DT  B 2  20  ? -53.742 -36.244 29.724 1.00 134.48 ? -53 DT  J "O4'" 1 
ATOM   3360  C  "C3'" . DT  B 2  20  ? -52.748 -37.876 28.300 1.00 136.58 ? -53 DT  J "C3'" 1 
ATOM   3361  O  "O3'" . DT  B 2  20  ? -53.469 -39.050 27.891 1.00 142.05 ? -53 DT  J "O3'" 1 
ATOM   3362  C  "C2'" . DT  B 2  20  ? -53.115 -36.610 27.533 1.00 137.39 ? -53 DT  J "C2'" 1 
ATOM   3363  C  "C1'" . DT  B 2  20  ? -54.202 -36.021 28.406 1.00 134.33 ? -53 DT  J "C1'" 1 
ATOM   3364  N  N1    . DT  B 2  20  ? -54.483 -34.577 28.257 1.00 135.02 ? -53 DT  J N1    1 
ATOM   3365  C  C2    . DT  B 2  20  ? -55.736 -34.203 27.825 1.00 136.13 ? -53 DT  J C2    1 
ATOM   3366  O  O2    . DT  B 2  20  ? -56.607 -35.004 27.531 1.00 154.15 ? -53 DT  J O2    1 
ATOM   3367  N  N3    . DT  B 2  20  ? -55.935 -32.847 27.751 1.00 134.78 ? -53 DT  J N3    1 
ATOM   3368  C  C4    . DT  B 2  20  ? -55.028 -31.853 28.063 1.00 132.74 ? -53 DT  J C4    1 
ATOM   3369  O  O4    . DT  B 2  20  ? -55.351 -30.675 27.948 1.00 130.20 ? -53 DT  J O4    1 
ATOM   3370  C  C5    . DT  B 2  20  ? -53.737 -32.317 28.517 1.00 130.75 ? -53 DT  J C5    1 
ATOM   3371  C  C7    . DT  B 2  20  ? -52.691 -31.312 28.881 1.00 130.53 ? -53 DT  J C7    1 
ATOM   3372  C  C6    . DT  B 2  20  ? -53.534 -33.638 28.595 1.00 136.57 ? -53 DT  J C6    1 
ATOM   3373  P  P     . DA  B 2  21  ? -53.076 -39.861 26.555 1.00 142.16 ? -52 DA  J P     1 
ATOM   3374  O  OP1   . DA  B 2  21  ? -53.632 -41.237 26.668 1.00 124.14 ? -52 DA  J OP1   1 
ATOM   3375  O  OP2   . DA  B 2  21  ? -51.622 -39.674 26.299 1.00 133.77 ? -52 DA  J OP2   1 
ATOM   3376  O  "O5'" . DA  B 2  21  ? -53.938 -39.126 25.436 1.00 146.84 ? -52 DA  J "O5'" 1 
ATOM   3377  C  "C5'" . DA  B 2  21  ? -55.335 -38.862 25.669 1.00 148.95 ? -52 DA  J "C5'" 1 
ATOM   3378  C  "C4'" . DA  B 2  21  ? -55.963 -38.163 24.485 1.00 146.06 ? -52 DA  J "C4'" 1 
ATOM   3379  O  "O4'" . DA  B 2  21  ? -55.991 -36.733 24.717 1.00 143.93 ? -52 DA  J "O4'" 1 
ATOM   3380  C  "C3'" . DA  B 2  21  ? -55.260 -38.362 23.137 1.00 141.17 ? -52 DA  J "C3'" 1 
ATOM   3381  O  "O3'" . DA  B 2  21  ? -56.276 -38.611 22.156 1.00 148.68 ? -52 DA  J "O3'" 1 
ATOM   3382  C  "C2'" . DA  B 2  21  ? -54.574 -37.026 22.907 1.00 138.53 ? -52 DA  J "C2'" 1 
ATOM   3383  C  "C1'" . DA  B 2  21  ? -55.591 -36.089 23.524 1.00 140.60 ? -52 DA  J "C1'" 1 
ATOM   3384  N  N9    . DA  B 2  21  ? -55.121 -34.747 23.864 1.00 140.56 ? -52 DA  J N9    1 
ATOM   3385  C  C8    . DA  B 2  21  ? -53.951 -34.374 24.479 1.00 135.27 ? -52 DA  J C8    1 
ATOM   3386  N  N7    . DA  B 2  21  ? -53.826 -33.078 24.632 1.00 135.40 ? -52 DA  J N7    1 
ATOM   3387  C  C5    . DA  B 2  21  ? -54.990 -32.562 24.077 1.00 140.83 ? -52 DA  J C5    1 
ATOM   3388  C  C6    . DA  B 2  21  ? -55.466 -31.246 23.926 1.00 143.23 ? -52 DA  J C6    1 
ATOM   3389  N  N6    . DA  B 2  21  ? -54.798 -30.165 24.335 1.00 141.04 ? -52 DA  J N6    1 
ATOM   3390  N  N1    . DA  B 2  21  ? -56.669 -31.077 23.333 1.00 144.77 ? -52 DA  J N1    1 
ATOM   3391  C  C2    . DA  B 2  21  ? -57.337 -32.162 22.917 1.00 139.08 ? -52 DA  J C2    1 
ATOM   3392  N  N3    . DA  B 2  21  ? -56.996 -33.446 23.005 1.00 144.24 ? -52 DA  J N3    1 
ATOM   3393  C  C4    . DA  B 2  21  ? -55.797 -33.579 23.602 1.00 143.68 ? -52 DA  J C4    1 
ATOM   3394  P  P     . DC  B 2  22  ? -55.926 -39.230 20.711 1.00 146.93 ? -51 DC  J P     1 
ATOM   3395  O  OP1   . DC  B 2  22  ? -56.814 -40.401 20.506 1.00 132.02 ? -51 DC  J OP1   1 
ATOM   3396  O  OP2   . DC  B 2  22  ? -54.449 -39.396 20.602 1.00 130.38 ? -51 DC  J OP2   1 
ATOM   3397  O  "O5'" . DC  B 2  22  ? -56.402 -38.079 19.715 1.00 147.21 ? -51 DC  J "O5'" 1 
ATOM   3398  C  "C5'" . DC  B 2  22  ? -57.793 -37.700 19.662 1.00 156.68 ? -51 DC  J "C5'" 1 
ATOM   3399  C  "C4'" . DC  B 2  22  ? -57.967 -36.284 19.161 1.00 162.35 ? -51 DC  J "C4'" 1 
ATOM   3400  O  "O4'" . DC  B 2  22  ? -57.437 -35.326 20.103 1.00 160.55 ? -51 DC  J "O4'" 1 
ATOM   3401  C  "C3'" . DC  B 2  22  ? -57.267 -35.947 17.852 1.00 165.81 ? -51 DC  J "C3'" 1 
ATOM   3402  O  "O3'" . DC  B 2  22  ? -58.009 -36.376 16.708 1.00 168.26 ? -51 DC  J "O3'" 1 
ATOM   3403  C  "C2'" . DC  B 2  22  ? -57.197 -34.434 17.911 1.00 163.67 ? -51 DC  J "C2'" 1 
ATOM   3404  C  "C1'" . DC  B 2  22  ? -57.042 -34.147 19.399 1.00 161.62 ? -51 DC  J "C1'" 1 
ATOM   3405  N  N1    . DC  B 2  22  ? -55.657 -33.829 19.778 1.00 160.65 ? -51 DC  J N1    1 
ATOM   3406  C  C2    . DC  B 2  22  ? -55.314 -32.495 20.012 1.00 154.72 ? -51 DC  J C2    1 
ATOM   3407  O  O2    . DC  B 2  22  ? -56.192 -31.625 19.915 1.00 157.82 ? -51 DC  J O2    1 
ATOM   3408  N  N3    . DC  B 2  22  ? -54.040 -32.189 20.351 1.00 151.72 ? -51 DC  J N3    1 
ATOM   3409  C  C4    . DC  B 2  22  ? -53.126 -33.157 20.449 1.00 155.53 ? -51 DC  J C4    1 
ATOM   3410  N  N4    . DC  B 2  22  ? -51.881 -32.811 20.784 1.00 152.08 ? -51 DC  J N4    1 
ATOM   3411  C  C5    . DC  B 2  22  ? -53.445 -34.523 20.197 1.00 157.30 ? -51 DC  J C5    1 
ATOM   3412  C  C6    . DC  B 2  22  ? -54.709 -34.811 19.860 1.00 161.89 ? -51 DC  J C6    1 
ATOM   3413  P  P     . DT  B 2  23  ? -57.251 -36.627 15.322 1.00 162.24 ? -50 DT  J P     1 
ATOM   3414  O  OP1   . DT  B 2  23  ? -57.380 -38.067 14.989 1.00 151.41 ? -50 DT  J OP1   1 
ATOM   3415  O  OP2   . DT  B 2  23  ? -55.898 -36.026 15.418 1.00 169.53 ? -50 DT  J OP2   1 
ATOM   3416  O  "O5'" . DT  B 2  23  ? -58.097 -35.768 14.277 1.00 162.98 ? -50 DT  J "O5'" 1 
ATOM   3417  C  "C5'" . DT  B 2  23  ? -58.623 -34.459 14.596 1.00 167.13 ? -50 DT  J "C5'" 1 
ATOM   3418  C  "C4'" . DT  B 2  23  ? -57.708 -33.357 14.110 1.00 172.29 ? -50 DT  J "C4'" 1 
ATOM   3419  O  "O4'" . DT  B 2  23  ? -56.854 -32.913 15.184 1.00 164.31 ? -50 DT  J "O4'" 1 
ATOM   3420  C  "C3'" . DT  B 2  23  ? -56.751 -33.715 12.967 1.00 175.92 ? -50 DT  J "C3'" 1 
ATOM   3421  O  "O3'" . DT  B 2  23  ? -57.395 -33.622 11.674 1.00 186.34 ? -50 DT  J "O3'" 1 
ATOM   3422  C  "C2'" . DT  B 2  23  ? -55.533 -32.833 13.228 1.00 170.85 ? -50 DT  J "C2'" 1 
ATOM   3423  C  "C1'" . DT  B 2  23  ? -55.790 -32.191 14.595 1.00 161.58 ? -50 DT  J "C1'" 1 
ATOM   3424  N  N1    . DT  B 2  23  ? -54.652 -32.192 15.541 1.00 154.53 ? -50 DT  J N1    1 
ATOM   3425  C  C2    . DT  B 2  23  ? -54.532 -31.122 16.399 1.00 165.01 ? -50 DT  J C2    1 
ATOM   3426  O  O2    . DT  B 2  23  ? -55.322 -30.193 16.421 1.00 176.79 ? -50 DT  J O2    1 
ATOM   3427  N  N3    . DT  B 2  23  ? -53.446 -31.180 17.238 1.00 164.25 ? -50 DT  J N3    1 
ATOM   3428  C  C4    . DT  B 2  23  ? -52.495 -32.181 17.305 1.00 152.68 ? -50 DT  J C4    1 
ATOM   3429  O  O4    . DT  B 2  23  ? -51.567 -32.089 18.103 1.00 154.60 ? -50 DT  J O4    1 
ATOM   3430  C  C5    . DT  B 2  23  ? -52.678 -33.269 16.369 1.00 137.18 ? -50 DT  J C5    1 
ATOM   3431  C  C7    . DT  B 2  23  ? -51.695 -34.396 16.362 1.00 120.32 ? -50 DT  J C7    1 
ATOM   3432  C  C6    . DT  B 2  23  ? -53.733 -33.220 15.546 1.00 145.32 ? -50 DT  J C6    1 
ATOM   3433  P  P     . DA  B 2  24  ? -57.139 -32.381 10.660 1.00 184.06 ? -49 DA  J P     1 
ATOM   3434  O  OP1   . DA  B 2  24  ? -58.230 -32.382 9.651  1.00 171.16 ? -49 DA  J OP1   1 
ATOM   3435  O  OP2   . DA  B 2  24  ? -55.724 -32.433 10.197 1.00 169.58 ? -49 DA  J OP2   1 
ATOM   3436  O  "O5'" . DA  B 2  24  ? -57.367 -31.106 11.590 1.00 193.79 ? -49 DA  J "O5'" 1 
ATOM   3437  C  "C5'" . DA  B 2  24  ? -57.635 -29.802 11.041 1.00 190.97 ? -49 DA  J "C5'" 1 
ATOM   3438  C  "C4'" . DA  B 2  24  ? -56.358 -29.000 10.937 1.00 189.11 ? -49 DA  J "C4'" 1 
ATOM   3439  O  "O4'" . DA  B 2  24  ? -55.472 -29.302 12.037 1.00 189.98 ? -49 DA  J "O4'" 1 
ATOM   3440  C  "C3'" . DA  B 2  24  ? -55.551 -29.258 9.662  1.00 182.60 ? -49 DA  J "C3'" 1 
ATOM   3441  O  "O3'" . DA  B 2  24  ? -55.887 -28.212 8.742  1.00 178.48 ? -49 DA  J "O3'" 1 
ATOM   3442  C  "C2'" . DA  B 2  24  ? -54.112 -29.436 10.144 1.00 179.95 ? -49 DA  J "C2'" 1 
ATOM   3443  C  "C1'" . DA  B 2  24  ? -54.149 -29.045 11.616 1.00 180.48 ? -49 DA  J "C1'" 1 
ATOM   3444  N  N9    . DA  B 2  24  ? -53.246 -29.791 12.497 1.00 173.38 ? -49 DA  J N9    1 
ATOM   3445  C  C8    . DA  B 2  24  ? -52.853 -31.103 12.390 1.00 172.29 ? -49 DA  J C8    1 
ATOM   3446  N  N7    . DA  B 2  24  ? -52.042 -31.491 13.343 1.00 168.57 ? -49 DA  J N7    1 
ATOM   3447  C  C5    . DA  B 2  24  ? -51.896 -30.362 14.138 1.00 168.58 ? -49 DA  J C5    1 
ATOM   3448  C  C6    . DA  B 2  24  ? -51.150 -30.115 15.306 1.00 165.34 ? -49 DA  J C6    1 
ATOM   3449  N  N6    . DA  B 2  24  ? -50.390 -31.032 15.909 1.00 162.04 ? -49 DA  J N6    1 
ATOM   3450  N  N1    . DA  B 2  24  ? -51.221 -28.879 15.846 1.00 155.33 ? -49 DA  J N1    1 
ATOM   3451  C  C2    . DA  B 2  24  ? -51.977 -27.956 15.238 1.00 151.90 ? -49 DA  J C2    1 
ATOM   3452  N  N3    . DA  B 2  24  ? -52.719 -28.066 14.137 1.00 151.74 ? -49 DA  J N3    1 
ATOM   3453  C  C4    . DA  B 2  24  ? -52.630 -29.307 13.627 1.00 162.81 ? -49 DA  J C4    1 
ATOM   3454  P  P     . DC  B 2  25  ? -54.831 -27.094 8.327  1.00 182.66 ? -48 DC  J P     1 
ATOM   3455  O  OP1   . DC  B 2  25  ? -55.571 -26.023 7.618  1.00 186.60 ? -48 DC  J OP1   1 
ATOM   3456  O  OP2   . DC  B 2  25  ? -53.703 -27.773 7.647  1.00 170.95 ? -48 DC  J OP2   1 
ATOM   3457  O  "O5'" . DC  B 2  25  ? -54.356 -26.481 9.720  1.00 178.06 ? -48 DC  J "O5'" 1 
ATOM   3458  C  "C5'" . DC  B 2  25  ? -53.999 -25.086 9.837  1.00 178.47 ? -48 DC  J "C5'" 1 
ATOM   3459  C  "C4'" . DC  B 2  25  ? -52.499 -24.912 9.765  1.00 185.20 ? -48 DC  J "C4'" 1 
ATOM   3460  O  "O4'" . DC  B 2  25  ? -51.863 -25.825 10.694 1.00 188.56 ? -48 DC  J "O4'" 1 
ATOM   3461  C  "C3'" . DC  B 2  25  ? -51.863 -25.193 8.396  1.00 183.75 ? -48 DC  J "C3'" 1 
ATOM   3462  O  "O3'" . DC  B 2  25  ? -50.769 -24.317 8.103  1.00 178.53 ? -48 DC  J "O3'" 1 
ATOM   3463  C  "C2'" . DC  B 2  25  ? -51.211 -26.548 8.588  1.00 186.29 ? -48 DC  J "C2'" 1 
ATOM   3464  C  "C1'" . DC  B 2  25  ? -50.765 -26.425 10.031 1.00 186.64 ? -48 DC  J "C1'" 1 
ATOM   3465  N  N1    . DC  B 2  25  ? -50.421 -27.674 10.732 1.00 175.58 ? -48 DC  J N1    1 
ATOM   3466  C  C2    . DC  B 2  25  ? -49.854 -27.588 12.007 1.00 158.55 ? -48 DC  J C2    1 
ATOM   3467  O  O2    . DC  B 2  25  ? -49.694 -26.470 12.517 1.00 146.99 ? -48 DC  J O2    1 
ATOM   3468  N  N3    . DC  B 2  25  ? -49.507 -28.724 12.654 1.00 149.12 ? -48 DC  J N3    1 
ATOM   3469  C  C4    . DC  B 2  25  ? -49.692 -29.909 12.067 1.00 145.47 ? -48 DC  J C4    1 
ATOM   3470  N  N4    . DC  B 2  25  ? -49.339 -31.004 12.742 1.00 139.59 ? -48 DC  J N4    1 
ATOM   3471  C  C5    . DC  B 2  25  ? -50.261 -30.025 10.767 1.00 159.59 ? -48 DC  J C5    1 
ATOM   3472  C  C6    . DC  B 2  25  ? -50.598 -28.893 10.136 1.00 173.64 ? -48 DC  J C6    1 
ATOM   3473  P  P     . DC  B 2  26  ? -51.014 -22.869 7.484  1.00 170.26 ? -47 DC  J P     1 
ATOM   3474  O  OP1   . DC  B 2  26  ? -52.370 -22.412 7.891  1.00 154.90 ? -47 DC  J OP1   1 
ATOM   3475  O  OP2   . DC  B 2  26  ? -50.650 -22.926 6.047  1.00 161.15 ? -47 DC  J OP2   1 
ATOM   3476  O  "O5'" . DC  B 2  26  ? -49.917 -21.974 8.219  1.00 164.06 ? -47 DC  J "O5'" 1 
ATOM   3477  C  "C5'" . DC  B 2  26  ? -49.413 -22.310 9.530  1.00 152.74 ? -47 DC  J "C5'" 1 
ATOM   3478  C  "C4'" . DC  B 2  26  ? -47.966 -22.744 9.466  1.00 149.64 ? -47 DC  J "C4'" 1 
ATOM   3479  O  "O4'" . DC  B 2  26  ? -47.805 -24.081 10.002 1.00 159.13 ? -47 DC  J "O4'" 1 
ATOM   3480  C  "C3'" . DC  B 2  26  ? -47.324 -22.781 8.074  1.00 143.83 ? -47 DC  J "C3'" 1 
ATOM   3481  O  "O3'" . DC  B 2  26  ? -46.009 -22.248 8.176  1.00 146.41 ? -47 DC  J "O3'" 1 
ATOM   3482  C  "C2'" . DC  B 2  26  ? -47.182 -24.262 7.787  1.00 144.04 ? -47 DC  J "C2'" 1 
ATOM   3483  C  "C1'" . DC  B 2  26  ? -46.869 -24.756 9.182  1.00 153.87 ? -47 DC  J "C1'" 1 
ATOM   3484  N  N1    . DC  B 2  26  ? -46.996 -26.204 9.422  1.00 158.47 ? -47 DC  J N1    1 
ATOM   3485  C  C2    . DC  B 2  26  ? -46.662 -26.709 10.684 1.00 158.53 ? -47 DC  J C2    1 
ATOM   3486  O  O2    . DC  B 2  26  ? -46.286 -25.921 11.566 1.00 154.26 ? -47 DC  J O2    1 
ATOM   3487  N  N3    . DC  B 2  26  ? -46.762 -28.040 10.912 1.00 154.86 ? -47 DC  J N3    1 
ATOM   3488  C  C4    . DC  B 2  26  ? -47.164 -28.855 9.933  1.00 150.99 ? -47 DC  J C4    1 
ATOM   3489  N  N4    . DC  B 2  26  ? -47.249 -30.161 10.199 1.00 141.05 ? -47 DC  J N4    1 
ATOM   3490  C  C5    . DC  B 2  26  ? -47.500 -28.367 8.637  1.00 159.50 ? -47 DC  J C5    1 
ATOM   3491  C  C6    . DC  B 2  26  ? -47.396 -27.049 8.425  1.00 156.31 ? -47 DC  J C6    1 
ATOM   3492  P  P     . DA  B 2  27  ? -45.768 -20.709 7.902  1.00 149.48 ? -46 DA  J P     1 
ATOM   3493  O  OP1   . DA  B 2  27  ? -46.870 -19.952 8.556  1.00 149.17 ? -46 DA  J OP1   1 
ATOM   3494  O  OP2   . DA  B 2  27  ? -45.521 -20.553 6.450  1.00 139.56 ? -46 DA  J OP2   1 
ATOM   3495  O  "O5'" . DA  B 2  27  ? -44.389 -20.415 8.643  1.00 150.29 ? -46 DA  J "O5'" 1 
ATOM   3496  C  "C5'" . DA  B 2  27  ? -44.343 -19.878 9.978  1.00 135.77 ? -46 DA  J "C5'" 1 
ATOM   3497  C  "C4'" . DA  B 2  27  ? -43.156 -20.448 10.718 1.00 121.37 ? -46 DA  J "C4'" 1 
ATOM   3498  O  "O4'" . DA  B 2  27  ? -43.288 -21.885 10.819 1.00 121.48 ? -46 DA  J "O4'" 1 
ATOM   3499  C  "C3'" . DA  B 2  27  ? -41.812 -20.228 10.040 1.00 111.22 ? -46 DA  J "C3'" 1 
ATOM   3500  O  "O3'" . DA  B 2  27  ? -40.851 -20.350 11.076 1.00 124.88 ? -46 DA  J "O3'" 1 
ATOM   3501  C  "C2'" . DA  B 2  27  ? -41.689 -21.447 9.153  1.00 109.76 ? -46 DA  J "C2'" 1 
ATOM   3502  C  "C1'" . DA  B 2  27  ? -42.260 -22.519 10.067 1.00 119.26 ? -46 DA  J "C1'" 1 
ATOM   3503  N  N9    . DA  B 2  27  ? -42.844 -23.684 9.409  1.00 134.81 ? -46 DA  J N9    1 
ATOM   3504  C  C8    . DA  B 2  27  ? -43.488 -23.759 8.199  1.00 142.51 ? -46 DA  J C8    1 
ATOM   3505  N  N7    . DA  B 2  27  ? -43.908 -24.964 7.897  1.00 146.66 ? -46 DA  J N7    1 
ATOM   3506  C  C5    . DA  B 2  27  ? -43.521 -25.733 8.985  1.00 143.60 ? -46 DA  J C5    1 
ATOM   3507  C  C6    . DA  B 2  27  ? -43.670 -27.100 9.279  1.00 144.18 ? -46 DA  J C6    1 
ATOM   3508  N  N6    . DA  B 2  27  ? -44.278 -27.971 8.472  1.00 139.45 ? -46 DA  J N6    1 
ATOM   3509  N  N1    . DA  B 2  27  ? -43.168 -27.549 10.450 1.00 155.37 ? -46 DA  J N1    1 
ATOM   3510  C  C2    . DA  B 2  27  ? -42.561 -26.674 11.265 1.00 164.06 ? -46 DA  J C2    1 
ATOM   3511  N  N3    . DA  B 2  27  ? -42.358 -25.369 11.098 1.00 158.29 ? -46 DA  J N3    1 
ATOM   3512  C  C4    . DA  B 2  27  ? -42.870 -24.956 9.926  1.00 144.71 ? -46 DA  J C4    1 
ATOM   3513  P  P     . DA  B 2  28  ? -39.545 -19.445 11.099 1.00 147.99 ? -45 DA  J P     1 
ATOM   3514  O  OP1   . DA  B 2  28  ? -39.975 -18.027 11.198 1.00 150.00 ? -45 DA  J OP1   1 
ATOM   3515  O  OP2   . DA  B 2  28  ? -38.663 -19.870 9.977  1.00 129.17 ? -45 DA  J OP2   1 
ATOM   3516  O  "O5'" . DA  B 2  28  ? -38.872 -19.876 12.479 1.00 154.12 ? -45 DA  J "O5'" 1 
ATOM   3517  C  "C5'" . DA  B 2  28  ? -39.331 -21.042 13.210 1.00 149.22 ? -45 DA  J "C5'" 1 
ATOM   3518  C  "C4'" . DA  B 2  28  ? -38.414 -22.222 12.977 1.00 144.65 ? -45 DA  J "C4'" 1 
ATOM   3519  O  "O4'" . DA  B 2  28  ? -39.039 -23.199 12.107 1.00 131.62 ? -45 DA  J "O4'" 1 
ATOM   3520  C  "C3'" . DA  B 2  28  ? -37.063 -21.881 12.331 1.00 145.24 ? -45 DA  J "C3'" 1 
ATOM   3521  O  "O3'" . DA  B 2  28  ? -35.940 -22.541 12.918 1.00 145.60 ? -45 DA  J "O3'" 1 
ATOM   3522  C  "C2'" . DA  B 2  28  ? -37.184 -22.436 10.924 1.00 141.76 ? -45 DA  J "C2'" 1 
ATOM   3523  C  "C1'" . DA  B 2  28  ? -38.078 -23.633 11.158 1.00 137.48 ? -45 DA  J "C1'" 1 
ATOM   3524  N  N9    . DA  B 2  28  ? -38.790 -24.108 9.975  1.00 138.06 ? -45 DA  J N9    1 
ATOM   3525  C  C8    . DA  B 2  28  ? -39.085 -23.431 8.818  1.00 135.48 ? -45 DA  J C8    1 
ATOM   3526  N  N7    . DA  B 2  28  ? -39.750 -24.146 7.944  1.00 135.33 ? -45 DA  J N7    1 
ATOM   3527  C  C5    . DA  B 2  28  ? -39.888 -25.381 8.560  1.00 131.02 ? -45 DA  J C5    1 
ATOM   3528  C  C6    . DA  B 2  28  ? -40.493 -26.579 8.150  1.00 135.26 ? -45 DA  J C6    1 
ATOM   3529  N  N6    . DA  B 2  28  ? -41.101 -26.735 6.974  1.00 135.51 ? -45 DA  J N6    1 
ATOM   3530  N  N1    . DA  B 2  28  ? -40.458 -27.625 9.005  1.00 138.68 ? -45 DA  J N1    1 
ATOM   3531  C  C2    . DA  B 2  28  ? -39.851 -27.466 10.188 1.00 133.46 ? -45 DA  J C2    1 
ATOM   3532  N  N3    . DA  B 2  28  ? -39.246 -26.390 10.685 1.00 130.77 ? -45 DA  J N3    1 
ATOM   3533  C  C4    . DA  B 2  28  ? -39.302 -25.371 9.812  1.00 131.94 ? -45 DA  J C4    1 
ATOM   3534  P  P     . DA  B 2  29  ? -35.958 -22.995 14.442 1.00 132.99 ? -44 DA  J P     1 
ATOM   3535  O  OP1   . DA  B 2  29  ? -36.805 -24.207 14.549 1.00 136.73 ? -44 DA  J OP1   1 
ATOM   3536  O  OP2   . DA  B 2  29  ? -36.281 -21.805 15.270 1.00 136.68 ? -44 DA  J OP2   1 
ATOM   3537  O  "O5'" . DA  B 2  29  ? -34.449 -23.454 14.659 1.00 127.55 ? -44 DA  J "O5'" 1 
ATOM   3538  C  "C5'" . DA  B 2  29  ? -33.884 -24.455 13.792 1.00 119.29 ? -44 DA  J "C5'" 1 
ATOM   3539  C  "C4'" . DA  B 2  29  ? -34.499 -25.804 14.094 1.00 113.25 ? -44 DA  J "C4'" 1 
ATOM   3540  O  "O4'" . DA  B 2  29  ? -35.655 -26.059 13.262 1.00 107.36 ? -44 DA  J "O4'" 1 
ATOM   3541  C  "C3'" . DA  B 2  29  ? -33.565 -26.980 13.851 1.00 111.94 ? -44 DA  J "C3'" 1 
ATOM   3542  O  "O3'" . DA  B 2  29  ? -33.903 -28.082 14.679 1.00 109.09 ? -44 DA  J "O3'" 1 
ATOM   3543  C  "C2'" . DA  B 2  29  ? -33.890 -27.393 12.436 1.00 114.50 ? -44 DA  J "C2'" 1 
ATOM   3544  C  "C1'" . DA  B 2  29  ? -35.364 -27.073 12.306 1.00 114.66 ? -44 DA  J "C1'" 1 
ATOM   3545  N  N9    . DA  B 2  29  ? -35.683 -26.554 10.978 1.00 126.83 ? -44 DA  J N9    1 
ATOM   3546  C  C8    . DA  B 2  29  ? -35.348 -25.340 10.432 1.00 126.57 ? -44 DA  J C8    1 
ATOM   3547  N  N7    . DA  B 2  29  ? -35.753 -25.188 9.196  1.00 127.89 ? -44 DA  J N7    1 
ATOM   3548  C  C5    . DA  B 2  29  ? -36.363 -26.398 8.895  1.00 124.94 ? -44 DA  J C5    1 
ATOM   3549  C  C6    . DA  B 2  29  ? -36.998 -26.874 7.736  1.00 124.46 ? -44 DA  J C6    1 
ATOM   3550  N  N6    . DA  B 2  29  ? -37.121 -26.164 6.615  1.00 134.62 ? -44 DA  J N6    1 
ATOM   3551  N  N1    . DA  B 2  29  ? -37.505 -28.125 7.767  1.00 117.43 ? -44 DA  J N1    1 
ATOM   3552  C  C2    . DA  B 2  29  ? -37.377 -28.840 8.890  1.00 122.38 ? -44 DA  J C2    1 
ATOM   3553  N  N3    . DA  B 2  29  ? -36.808 -28.500 10.044 1.00 121.26 ? -44 DA  J N3    1 
ATOM   3554  C  C4    . DA  B 2  29  ? -36.315 -27.252 9.979  1.00 121.99 ? -44 DA  J C4    1 
ATOM   3555  P  P     . DA  B 2  30  ? -32.755 -28.890 15.400 1.00 112.13 ? -43 DA  J P     1 
ATOM   3556  O  OP1   . DA  B 2  30  ? -33.187 -29.129 16.800 1.00 117.40 ? -43 DA  J OP1   1 
ATOM   3557  O  OP2   . DA  B 2  30  ? -31.464 -28.208 15.118 1.00 107.31 ? -43 DA  J OP2   1 
ATOM   3558  O  "O5'" . DA  B 2  30  ? -32.738 -30.286 14.632 1.00 113.10 ? -43 DA  J "O5'" 1 
ATOM   3559  C  "C5'" . DA  B 2  30  ? -33.918 -31.100 14.500 1.00 107.27 ? -43 DA  J "C5'" 1 
ATOM   3560  C  "C4'" . DA  B 2  30  ? -33.803 -31.935 13.246 1.00 105.59 ? -43 DA  J "C4'" 1 
ATOM   3561  O  "O4'" . DA  B 2  30  ? -34.149 -31.126 12.091 1.00 107.27 ? -43 DA  J "O4'" 1 
ATOM   3562  C  "C3'" . DA  B 2  30  ? -32.393 -32.480 12.987 1.00 101.49 ? -43 DA  J "C3'" 1 
ATOM   3563  O  "O3'" . DA  B 2  30  ? -32.412 -33.898 12.763 1.00 103.43 ? -43 DA  J "O3'" 1 
ATOM   3564  C  "C2'" . DA  B 2  30  ? -31.908 -31.673 11.794 1.00 104.16 ? -43 DA  J "C2'" 1 
ATOM   3565  C  "C1'" . DA  B 2  30  ? -33.200 -31.360 11.066 1.00 110.47 ? -43 DA  J "C1'" 1 
ATOM   3566  N  N9    . DA  B 2  30  ? -33.168 -30.184 10.189 1.00 116.13 ? -43 DA  J N9    1 
ATOM   3567  C  C8    . DA  B 2  30  ? -32.493 -29.003 10.376 1.00 121.06 ? -43 DA  J C8    1 
ATOM   3568  N  N7    . DA  B 2  30  ? -32.656 -28.141 9.402  1.00 121.82 ? -43 DA  J N7    1 
ATOM   3569  C  C5    . DA  B 2  30  ? -33.473 -28.807 8.501  1.00 126.96 ? -43 DA  J C5    1 
ATOM   3570  C  C6    . DA  B 2  30  ? -34.007 -28.436 7.254  1.00 125.38 ? -43 DA  J C6    1 
ATOM   3571  N  N6    . DA  B 2  30  ? -33.788 -27.254 6.676  1.00 118.94 ? -43 DA  J N6    1 
ATOM   3572  N  N1    . DA  B 2  30  ? -34.785 -29.334 6.612  1.00 127.20 ? -43 DA  J N1    1 
ATOM   3573  C  C2    . DA  B 2  30  ? -35.004 -30.522 7.191  1.00 126.84 ? -43 DA  J C2    1 
ATOM   3574  N  N3    . DA  B 2  30  ? -34.561 -30.985 8.357  1.00 126.89 ? -43 DA  J N3    1 
ATOM   3575  C  C4    . DA  B 2  30  ? -33.792 -30.068 8.970  1.00 125.43 ? -43 DA  J C4    1 
ATOM   3576  P  P     . DG  B 2  31  ? -31.044 -34.695 12.423 1.00 112.35 ? -42 DG  J P     1 
ATOM   3577  O  OP1   . DG  B 2  31  ? -30.993 -35.955 13.226 1.00 92.51  ? -42 DG  J OP1   1 
ATOM   3578  O  OP2   . DG  B 2  31  ? -29.914 -33.734 12.482 1.00 97.99  ? -42 DG  J OP2   1 
ATOM   3579  O  "O5'" . DG  B 2  31  ? -31.242 -35.101 10.895 1.00 125.92 ? -42 DG  J "O5'" 1 
ATOM   3580  C  "C5'" . DG  B 2  31  ? -32.474 -35.687 10.427 1.00 121.21 ? -42 DG  J "C5'" 1 
ATOM   3581  C  "C4'" . DG  B 2  31  ? -32.451 -35.830 8.922  1.00 119.89 ? -42 DG  J "C4'" 1 
ATOM   3582  O  "O4'" . DG  B 2  31  ? -32.609 -34.535 8.294  1.00 117.90 ? -42 DG  J "O4'" 1 
ATOM   3583  C  "C3'" . DG  B 2  31  ? -31.173 -36.436 8.335  1.00 116.66 ? -42 DG  J "C3'" 1 
ATOM   3584  O  "O3'" . DG  B 2  31  ? -31.569 -37.426 7.376  1.00 112.33 ? -42 DG  J "O3'" 1 
ATOM   3585  C  "C2'" . DG  B 2  31  ? -30.447 -35.234 7.747  1.00 115.54 ? -42 DG  J "C2'" 1 
ATOM   3586  C  "C1'" . DG  B 2  31  ? -31.594 -34.337 7.322  1.00 115.97 ? -42 DG  J "C1'" 1 
ATOM   3587  N  N9    . DG  B 2  31  ? -31.313 -32.905 7.262  1.00 118.56 ? -42 DG  J N9    1 
ATOM   3588  C  C8    . DG  B 2  31  ? -30.963 -32.081 8.305  1.00 117.33 ? -42 DG  J C8    1 
ATOM   3589  N  N7    . DG  B 2  31  ? -30.820 -30.835 7.948  1.00 112.25 ? -42 DG  J N7    1 
ATOM   3590  C  C5    . DG  B 2  31  ? -31.108 -30.832 6.591  1.00 117.96 ? -42 DG  J C5    1 
ATOM   3591  C  C6    . DG  B 2  31  ? -31.116 -29.767 5.656  1.00 122.64 ? -42 DG  J C6    1 
ATOM   3592  O  O6    . DG  B 2  31  ? -30.865 -28.574 5.847  1.00 123.03 ? -42 DG  J O6    1 
ATOM   3593  N  N1    . DG  B 2  31  ? -31.459 -30.207 4.382  1.00 135.00 ? -42 DG  J N1    1 
ATOM   3594  C  C2    . DG  B 2  31  ? -31.759 -31.505 4.050  1.00 139.13 ? -42 DG  J C2    1 
ATOM   3595  N  N2    . DG  B 2  31  ? -32.072 -31.731 2.766  1.00 143.71 ? -42 DG  J N2    1 
ATOM   3596  N  N3    . DG  B 2  31  ? -31.755 -32.507 4.912  1.00 130.27 ? -42 DG  J N3    1 
ATOM   3597  C  C4    . DG  B 2  31  ? -31.423 -32.101 6.155  1.00 119.43 ? -42 DG  J C4    1 
ATOM   3598  P  P     . DT  B 2  32  ? -30.491 -38.380 6.672  1.00 119.90 ? -41 DT  J P     1 
ATOM   3599  O  OP1   . DT  B 2  32  ? -31.177 -39.647 6.325  1.00 118.29 ? -41 DT  J OP1   1 
ATOM   3600  O  OP2   . DT  B 2  32  ? -29.264 -38.420 7.507  1.00 106.01 ? -41 DT  J OP2   1 
ATOM   3601  O  "O5'" . DT  B 2  32  ? -30.138 -37.596 5.328  1.00 129.94 ? -41 DT  J "O5'" 1 
ATOM   3602  C  "C5'" . DT  B 2  32  ? -31.149 -37.287 4.341  1.00 127.98 ? -41 DT  J "C5'" 1 
ATOM   3603  C  "C4'" . DT  B 2  32  ? -30.549 -36.561 3.156  1.00 131.99 ? -41 DT  J "C4'" 1 
ATOM   3604  O  "O4'" . DT  B 2  32  ? -30.279 -35.183 3.511  1.00 135.10 ? -41 DT  J "O4'" 1 
ATOM   3605  C  "C3'" . DT  B 2  32  ? -29.230 -37.137 2.612  1.00 139.03 ? -41 DT  J "C3'" 1 
ATOM   3606  O  "O3'" . DT  B 2  32  ? -29.382 -37.612 1.258  1.00 142.53 ? -41 DT  J "O3'" 1 
ATOM   3607  C  "C2'" . DT  B 2  32  ? -28.238 -35.987 2.739  1.00 138.59 ? -41 DT  J "C2'" 1 
ATOM   3608  C  "C1'" . DT  B 2  32  ? -29.134 -34.765 2.798  1.00 142.64 ? -41 DT  J "C1'" 1 
ATOM   3609  N  N1    . DT  B 2  32  ? -28.550 -33.611 3.504  1.00 148.29 ? -41 DT  J N1    1 
ATOM   3610  C  C2    . DT  B 2  32  ? -28.355 -32.440 2.808  1.00 152.61 ? -41 DT  J C2    1 
ATOM   3611  O  O2    . DT  B 2  32  ? -28.654 -32.302 1.634  1.00 156.58 ? -41 DT  J O2    1 
ATOM   3612  N  N3    . DT  B 2  32  ? -27.795 -31.426 3.541  1.00 158.48 ? -41 DT  J N3    1 
ATOM   3613  C  C4    . DT  B 2  32  ? -27.414 -31.468 4.868  1.00 163.84 ? -41 DT  J C4    1 
ATOM   3614  O  O4    . DT  B 2  32  ? -26.923 -30.474 5.393  1.00 182.72 ? -41 DT  J O4    1 
ATOM   3615  C  C5    . DT  B 2  32  ? -27.643 -32.728 5.536  1.00 159.78 ? -41 DT  J C5    1 
ATOM   3616  C  C7    . DT  B 2  32  ? -27.265 -32.865 6.977  1.00 155.82 ? -41 DT  J C7    1 
ATOM   3617  C  C6    . DT  B 2  32  ? -28.189 -33.724 4.829  1.00 153.89 ? -41 DT  J C6    1 
ATOM   3618  P  P     . DG  B 2  33  ? -28.191 -38.442 0.512  1.00 142.80 ? -40 DG  J P     1 
ATOM   3619  O  OP1   . DG  B 2  33  ? -28.719 -39.778 0.124  1.00 118.59 ? -40 DG  J OP1   1 
ATOM   3620  O  OP2   . DG  B 2  33  ? -26.952 -38.346 1.334  1.00 140.58 ? -40 DG  J OP2   1 
ATOM   3621  O  "O5'" . DG  B 2  33  ? -27.959 -37.623 -0.834 1.00 134.00 ? -40 DG  J "O5'" 1 
ATOM   3622  C  "C5'" . DG  B 2  33  ? -28.467 -36.283 -1.005 1.00 144.79 ? -40 DG  J "C5'" 1 
ATOM   3623  C  "C4'" . DG  B 2  33  ? -27.470 -35.425 -1.750 1.00 154.73 ? -40 DG  J "C4'" 1 
ATOM   3624  O  "O4'" . DG  B 2  33  ? -27.097 -34.277 -0.947 1.00 161.18 ? -40 DG  J "O4'" 1 
ATOM   3625  C  "C3'" . DG  B 2  33  ? -26.159 -36.119 -2.131 1.00 159.59 ? -40 DG  J "C3'" 1 
ATOM   3626  O  "O3'" . DG  B 2  33  ? -25.884 -35.802 -3.501 1.00 152.39 ? -40 DG  J "O3'" 1 
ATOM   3627  C  "C2'" . DG  B 2  33  ? -25.164 -35.575 -1.117 1.00 161.94 ? -40 DG  J "C2'" 1 
ATOM   3628  C  "C1'" . DG  B 2  33  ? -25.683 -34.169 -0.897 1.00 157.49 ? -40 DG  J "C1'" 1 
ATOM   3629  N  N9    . DG  B 2  33  ? -25.324 -33.546 0.373  1.00 151.25 ? -40 DG  J N9    1 
ATOM   3630  C  C8    . DG  B 2  33  ? -24.965 -34.169 1.544  1.00 144.89 ? -40 DG  J C8    1 
ATOM   3631  N  N7    . DG  B 2  33  ? -24.713 -33.331 2.512  1.00 146.79 ? -40 DG  J N7    1 
ATOM   3632  C  C5    . DG  B 2  33  ? -24.919 -32.080 1.947  1.00 150.27 ? -40 DG  J C5    1 
ATOM   3633  C  C6    . DG  B 2  33  ? -24.798 -30.786 2.512  1.00 153.71 ? -40 DG  J C6    1 
ATOM   3634  O  O6    . DG  B 2  33  ? -24.471 -30.476 3.663  1.00 154.26 ? -40 DG  J O6    1 
ATOM   3635  N  N1    . DG  B 2  33  ? -25.103 -29.792 1.587  1.00 155.07 ? -40 DG  J N1    1 
ATOM   3636  C  C2    . DG  B 2  33  ? -25.476 -30.014 0.285  1.00 149.37 ? -40 DG  J C2    1 
ATOM   3637  N  N2    . DG  B 2  33  ? -25.728 -28.924 -0.454 1.00 147.53 ? -40 DG  J N2    1 
ATOM   3638  N  N3    . DG  B 2  33  ? -25.590 -31.217 -0.255 1.00 145.71 ? -40 DG  J N3    1 
ATOM   3639  C  C4    . DG  B 2  33  ? -25.296 -32.196 0.627  1.00 148.83 ? -40 DG  J C4    1 
ATOM   3640  P  P     . DT  B 2  34  ? -24.441 -36.069 -4.128 1.00 145.00 ? -39 DT  J P     1 
ATOM   3641  O  OP1   . DT  B 2  34  ? -24.621 -36.371 -5.566 1.00 137.14 ? -39 DT  J OP1   1 
ATOM   3642  O  OP2   . DT  B 2  34  ? -23.724 -37.042 -3.256 1.00 136.43 ? -39 DT  J OP2   1 
ATOM   3643  O  "O5'" . DT  B 2  34  ? -23.757 -34.633 -4.048 1.00 144.06 ? -39 DT  J "O5'" 1 
ATOM   3644  C  "C5'" . DT  B 2  34  ? -24.446 -33.455 -4.520 1.00 143.18 ? -39 DT  J "C5'" 1 
ATOM   3645  C  "C4'" . DT  B 2  34  ? -23.502 -32.276 -4.585 1.00 147.97 ? -39 DT  J "C4'" 1 
ATOM   3646  O  "O4'" . DT  B 2  34  ? -23.364 -31.681 -3.269 1.00 151.21 ? -39 DT  J "O4'" 1 
ATOM   3647  C  "C3'" . DT  B 2  34  ? -22.081 -32.611 -5.047 1.00 148.75 ? -39 DT  J "C3'" 1 
ATOM   3648  O  "O3'" . DT  B 2  34  ? -21.622 -31.584 -5.937 1.00 142.36 ? -39 DT  J "O3'" 1 
ATOM   3649  C  "C2'" . DT  B 2  34  ? -21.318 -32.724 -3.739 1.00 156.57 ? -39 DT  J "C2'" 1 
ATOM   3650  C  "C1'" . DT  B 2  34  ? -21.989 -31.647 -2.902 1.00 160.46 ? -39 DT  J "C1'" 1 
ATOM   3651  N  N1    . DT  B 2  34  ? -21.894 -31.799 -1.425 1.00 161.36 ? -39 DT  J N1    1 
ATOM   3652  C  C2    . DT  B 2  34  ? -22.331 -30.746 -0.652 1.00 155.49 ? -39 DT  J C2    1 
ATOM   3653  O  O2    . DT  B 2  34  ? -22.801 -29.723 -1.123 1.00 158.78 ? -39 DT  J O2    1 
ATOM   3654  N  N3    . DT  B 2  34  ? -22.207 -30.940 0.701  1.00 142.97 ? -39 DT  J N3    1 
ATOM   3655  C  C4    . DT  B 2  34  ? -21.691 -32.050 1.342  1.00 137.51 ? -39 DT  J C4    1 
ATOM   3656  O  O4    . DT  B 2  34  ? -21.644 -32.081 2.566  1.00 128.42 ? -39 DT  J O4    1 
ATOM   3657  C  C5    . DT  B 2  34  ? -21.241 -33.111 0.471  1.00 137.11 ? -39 DT  J C5    1 
ATOM   3658  C  C7    . DT  B 2  34  ? -20.669 -34.352 1.078  1.00 129.67 ? -39 DT  J C7    1 
ATOM   3659  C  C6    . DT  B 2  34  ? -21.358 -32.933 -0.851 1.00 148.33 ? -39 DT  J C6    1 
ATOM   3660  P  P     . DA  B 2  35  ? -20.058 -31.281 -6.106 1.00 151.79 ? -38 DA  J P     1 
ATOM   3661  O  OP1   . DA  B 2  35  ? -19.849 -30.658 -7.437 1.00 147.95 ? -38 DA  J OP1   1 
ATOM   3662  O  OP2   . DA  B 2  35  ? -19.294 -32.510 -5.744 1.00 141.10 ? -38 DA  J OP2   1 
ATOM   3663  O  "O5'" . DA  B 2  35  ? -19.814 -30.143 -5.021 1.00 155.50 ? -38 DA  J "O5'" 1 
ATOM   3664  C  "C5'" . DA  B 2  35  ? -20.101 -28.758 -5.299 1.00 148.41 ? -38 DA  J "C5'" 1 
ATOM   3665  C  "C4'" . DA  B 2  35  ? -19.073 -27.891 -4.614 1.00 148.68 ? -38 DA  J "C4'" 1 
ATOM   3666  O  "O4'" . DA  B 2  35  ? -19.178 -28.080 -3.182 1.00 148.15 ? -38 DA  J "O4'" 1 
ATOM   3667  C  "C3'" . DA  B 2  35  ? -17.620 -28.223 -4.969 1.00 152.14 ? -38 DA  J "C3'" 1 
ATOM   3668  O  "O3'" . DA  B 2  35  ? -16.890 -26.988 -5.069 1.00 147.46 ? -38 DA  J "O3'" 1 
ATOM   3669  C  "C2'" . DA  B 2  35  ? -17.207 -29.166 -3.851 1.00 145.57 ? -38 DA  J "C2'" 1 
ATOM   3670  C  "C1'" . DA  B 2  35  ? -17.936 -28.550 -2.671 1.00 152.31 ? -38 DA  J "C1'" 1 
ATOM   3671  N  N9    . DA  B 2  35  ? -18.209 -29.442 -1.543 1.00 154.81 ? -38 DA  J N9    1 
ATOM   3672  C  C8    . DA  B 2  35  ? -18.474 -30.790 -1.557 1.00 150.98 ? -38 DA  J C8    1 
ATOM   3673  N  N7    . DA  B 2  35  ? -18.664 -31.303 -0.365 1.00 142.89 ? -38 DA  J N7    1 
ATOM   3674  C  C5    . DA  B 2  35  ? -18.503 -30.224 0.492  1.00 144.35 ? -38 DA  J C5    1 
ATOM   3675  C  C6    . DA  B 2  35  ? -18.575 -30.109 1.890  1.00 143.71 ? -38 DA  J C6    1 
ATOM   3676  N  N6    . DA  B 2  35  ? -18.844 -31.134 2.701  1.00 137.79 ? -38 DA  J N6    1 
ATOM   3677  N  N1    . DA  B 2  35  ? -18.364 -28.889 2.433  1.00 147.39 ? -38 DA  J N1    1 
ATOM   3678  C  C2    . DA  B 2  35  ? -18.095 -27.861 1.616  1.00 140.84 ? -38 DA  J C2    1 
ATOM   3679  N  N3    . DA  B 2  35  ? -18.002 -27.844 0.288  1.00 139.35 ? -38 DA  J N3    1 
ATOM   3680  C  C4    . DA  B 2  35  ? -18.218 -29.072 -0.219 1.00 148.18 ? -38 DA  J C4    1 
ATOM   3681  P  P     . DT  B 2  36  ? -15.312 -26.914 -4.765 1.00 146.51 ? -37 DT  J P     1 
ATOM   3682  O  OP1   . DT  B 2  36  ? -14.779 -25.691 -5.422 1.00 128.98 ? -37 DT  J OP1   1 
ATOM   3683  O  OP2   . DT  B 2  36  ? -14.702 -28.241 -5.077 1.00 125.15 ? -37 DT  J OP2   1 
ATOM   3684  O  "O5'" . DT  B 2  36  ? -15.276 -26.671 -3.190 1.00 145.60 ? -37 DT  J "O5'" 1 
ATOM   3685  C  "C5'" . DT  B 2  36  ? -15.915 -25.524 -2.582 1.00 135.70 ? -37 DT  J "C5'" 1 
ATOM   3686  C  "C4'" . DT  B 2  36  ? -15.217 -25.168 -1.289 1.00 135.23 ? -37 DT  J "C4'" 1 
ATOM   3687  O  "O4'" . DT  B 2  36  ? -15.522 -26.157 -0.274 1.00 131.43 ? -37 DT  J "O4'" 1 
ATOM   3688  C  "C3'" . DT  B 2  36  ? -13.689 -25.122 -1.394 1.00 142.21 ? -37 DT  J "C3'" 1 
ATOM   3689  O  "O3'" . DT  B 2  36  ? -13.186 -23.957 -0.725 1.00 151.54 ? -37 DT  J "O3'" 1 
ATOM   3690  C  "C2'" . DT  B 2  36  ? -13.254 -26.445 -0.791 1.00 135.09 ? -37 DT  J "C2'" 1 
ATOM   3691  C  "C1'" . DT  B 2  36  ? -14.314 -26.672 0.269  1.00 137.50 ? -37 DT  J "C1'" 1 
ATOM   3692  N  N1    . DT  B 2  36  ? -14.533 -28.087 0.629  1.00 139.62 ? -37 DT  J N1    1 
ATOM   3693  C  C2    . DT  B 2  36  ? -14.598 -28.425 1.964  1.00 143.28 ? -37 DT  J C2    1 
ATOM   3694  O  O2    . DT  B 2  36  ? -14.498 -27.609 2.867  1.00 143.16 ? -37 DT  J O2    1 
ATOM   3695  N  N3    . DT  B 2  36  ? -14.790 -29.763 2.205  1.00 136.73 ? -37 DT  J N3    1 
ATOM   3696  C  C4    . DT  B 2  36  ? -14.917 -30.770 1.269  1.00 132.47 ? -37 DT  J C4    1 
ATOM   3697  O  O4    . DT  B 2  36  ? -15.090 -31.926 1.638  1.00 121.37 ? -37 DT  J O4    1 
ATOM   3698  C  C5    . DT  B 2  36  ? -14.827 -30.347 -0.109 1.00 139.84 ? -37 DT  J C5    1 
ATOM   3699  C  C7    . DT  B 2  36  ? -14.954 -31.370 -1.193 1.00 141.40 ? -37 DT  J C7    1 
ATOM   3700  C  C6    . DT  B 2  36  ? -14.639 -29.045 -0.357 1.00 139.55 ? -37 DT  J C6    1 
ATOM   3701  P  P     . DT  B 2  37  ? -11.625 -23.817 -0.351 1.00 150.67 ? -36 DT  J P     1 
ATOM   3702  O  OP1   . DT  B 2  37  ? -11.220 -22.401 -0.578 1.00 125.93 ? -36 DT  J OP1   1 
ATOM   3703  O  OP2   . DT  B 2  37  ? -10.866 -24.914 -1.029 1.00 127.16 ? -36 DT  J OP2   1 
ATOM   3704  O  "O5'" . DT  B 2  37  ? -11.640 -24.073 1.223  1.00 153.64 ? -36 DT  J "O5'" 1 
ATOM   3705  C  "C5'" . DT  B 2  37  ? -12.756 -23.659 2.053  1.00 132.81 ? -36 DT  J "C5'" 1 
ATOM   3706  C  "C4'" . DT  B 2  37  ? -12.481 -24.000 3.500  1.00 120.06 ? -36 DT  J "C4'" 1 
ATOM   3707  O  "O4'" . DT  B 2  37  ? -12.715 -25.410 3.733  1.00 107.31 ? -36 DT  J "O4'" 1 
ATOM   3708  C  "C3'" . DT  B 2  37  ? -11.041 -23.741 3.945  1.00 115.57 ? -36 DT  J "C3'" 1 
ATOM   3709  O  "O3'" . DT  B 2  37  ? -11.022 -23.299 5.299  1.00 116.13 ? -36 DT  J "O3'" 1 
ATOM   3710  C  "C2'" . DT  B 2  37  ? -10.383 -25.101 3.824  1.00 110.29 ? -36 DT  J "C2'" 1 
ATOM   3711  C  "C1'" . DT  B 2  37  ? -11.523 -26.025 4.207  1.00 113.53 ? -36 DT  J "C1'" 1 
ATOM   3712  N  N1    . DT  B 2  37  ? -11.439 -27.370 3.618  1.00 118.21 ? -36 DT  J N1    1 
ATOM   3713  C  C2    . DT  B 2  37  ? -11.470 -28.456 4.464  1.00 124.77 ? -36 DT  J C2    1 
ATOM   3714  O  O2    . DT  B 2  37  ? -11.566 -28.357 5.676  1.00 132.68 ? -36 DT  J O2    1 
ATOM   3715  N  N3    . DT  B 2  37  ? -11.383 -29.671 3.836  1.00 127.40 ? -36 DT  J N3    1 
ATOM   3716  C  C4    . DT  B 2  37  ? -11.275 -29.903 2.479  1.00 132.64 ? -36 DT  J C4    1 
ATOM   3717  O  O4    . DT  B 2  37  ? -11.213 -31.055 2.061  1.00 130.84 ? -36 DT  J O4    1 
ATOM   3718  C  C5    . DT  B 2  37  ? -11.246 -28.720 1.650  1.00 135.96 ? -36 DT  J C5    1 
ATOM   3719  C  C7    . DT  B 2  37  ? -11.122 -28.874 0.166  1.00 131.99 ? -36 DT  J C7    1 
ATOM   3720  C  C6    . DT  B 2  37  ? -11.323 -27.527 2.254  1.00 128.99 ? -36 DT  J C6    1 
ATOM   3721  P  P     . DT  B 2  38  ? -9.713  -22.612 5.888  1.00 123.83 ? -35 DT  J P     1 
ATOM   3722  O  OP1   . DT  B 2  38  ? -10.048 -21.195 6.211  1.00 109.27 ? -35 DT  J OP1   1 
ATOM   3723  O  OP2   . DT  B 2  38  ? -8.565  -22.934 4.993  1.00 97.50  ? -35 DT  J OP2   1 
ATOM   3724  O  "O5'" . DT  B 2  38  ? -9.438  -23.430 7.230  1.00 134.51 ? -35 DT  J "O5'" 1 
ATOM   3725  C  "C5'" . DT  B 2  38  ? -10.454 -24.204 7.905  1.00 127.95 ? -35 DT  J "C5'" 1 
ATOM   3726  C  "C4'" . DT  B 2  38  ? -9.820  -25.242 8.805  1.00 126.50 ? -35 DT  J "C4'" 1 
ATOM   3727  O  "O4'" . DT  B 2  38  ? -9.852  -26.538 8.152  1.00 119.83 ? -35 DT  J "O4'" 1 
ATOM   3728  C  "C3'" . DT  B 2  38  ? -8.348  -25.008 9.162  1.00 125.39 ? -35 DT  J "C3'" 1 
ATOM   3729  O  "O3'" . DT  B 2  38  ? -7.991  -25.671 10.374 1.00 117.59 ? -35 DT  J "O3'" 1 
ATOM   3730  C  "C2'" . DT  B 2  38  ? -7.626  -25.842 8.128  1.00 125.36 ? -35 DT  J "C2'" 1 
ATOM   3731  C  "C1'" . DT  B 2  38  ? -8.531  -27.062 8.150  1.00 124.23 ? -35 DT  J "C1'" 1 
ATOM   3732  N  N1    . DT  B 2  38  ? -8.394  -27.968 7.007  1.00 124.72 ? -35 DT  J N1    1 
ATOM   3733  C  C2    . DT  B 2  38  ? -8.540  -29.321 7.219  1.00 122.55 ? -35 DT  J C2    1 
ATOM   3734  O  O2    . DT  B 2  38  ? -8.798  -29.803 8.309  1.00 119.78 ? -35 DT  J O2    1 
ATOM   3735  N  N3    . DT  B 2  38  ? -8.376  -30.095 6.099  1.00 123.15 ? -35 DT  J N3    1 
ATOM   3736  C  C4    . DT  B 2  38  ? -8.084  -29.660 4.820  1.00 115.14 ? -35 DT  J C4    1 
ATOM   3737  O  O4    . DT  B 2  38  ? -7.966  -30.475 3.912  1.00 115.79 ? -35 DT  J O4    1 
ATOM   3738  C  C5    . DT  B 2  38  ? -7.940  -28.229 4.673  1.00 107.19 ? -35 DT  J C5    1 
ATOM   3739  C  C7    . DT  B 2  38  ? -7.626  -27.663 3.325  1.00 104.84 ? -35 DT  J C7    1 
ATOM   3740  C  C6    . DT  B 2  38  ? -8.092  -27.467 5.760  1.00 120.72 ? -35 DT  J C6    1 
ATOM   3741  P  P     . DG  B 2  39  ? -7.939  -24.889 11.748 1.00 108.90 ? -34 DG  J P     1 
ATOM   3742  O  OP1   . DG  B 2  39  ? -8.966  -23.812 11.696 1.00 101.33 ? -34 DG  J OP1   1 
ATOM   3743  O  OP2   . DG  B 2  39  ? -6.516  -24.556 12.020 1.00 85.33  ? -34 DG  J OP2   1 
ATOM   3744  O  "O5'" . DG  B 2  39  ? -8.378  -26.006 12.797 1.00 87.48  ? -34 DG  J "O5'" 1 
ATOM   3745  C  "C5'" . DG  B 2  39  ? -9.480  -26.884 12.530 1.00 93.44  ? -34 DG  J "C5'" 1 
ATOM   3746  C  "C4'" . DG  B 2  39  ? -9.312  -28.183 13.282 1.00 101.19 ? -34 DG  J "C4'" 1 
ATOM   3747  O  "O4'" . DG  B 2  39  ? -8.638  -29.156 12.460 1.00 102.34 ? -34 DG  J "O4'" 1 
ATOM   3748  C  "C3'" . DG  B 2  39  ? -8.438  -28.091 14.521 1.00 112.67 ? -34 DG  J "C3'" 1 
ATOM   3749  O  "O3'" . DG  B 2  39  ? -8.777  -29.221 15.327 1.00 107.81 ? -34 DG  J "O3'" 1 
ATOM   3750  C  "C2'" . DG  B 2  39  ? -7.040  -28.186 13.935 1.00 113.52 ? -34 DG  J "C2'" 1 
ATOM   3751  C  "C1'" . DG  B 2  39  ? -7.244  -29.170 12.785 1.00 118.92 ? -34 DG  J "C1'" 1 
ATOM   3752  N  N9    . DG  B 2  39  ? -6.511  -28.925 11.548 1.00 128.28 ? -34 DG  J N9    1 
ATOM   3753  C  C8    . DG  B 2  39  ? -6.018  -27.742 11.049 1.00 132.23 ? -34 DG  J C8    1 
ATOM   3754  N  N7    . DG  B 2  39  ? -5.469  -27.873 9.871  1.00 132.36 ? -34 DG  J N7    1 
ATOM   3755  C  C5    . DG  B 2  39  ? -5.635  -29.217 9.565  1.00 127.79 ? -34 DG  J C5    1 
ATOM   3756  C  C6    . DG  B 2  39  ? -5.249  -29.955 8.415  1.00 115.08 ? -34 DG  J C6    1 
ATOM   3757  O  O6    . DG  B 2  39  ? -4.669  -29.555 7.400  1.00 116.55 ? -34 DG  J O6    1 
ATOM   3758  N  N1    . DG  B 2  39  ? -5.610  -31.295 8.524  1.00 109.81 ? -34 DG  J N1    1 
ATOM   3759  C  C2    . DG  B 2  39  ? -6.261  -31.853 9.598  1.00 103.37 ? -34 DG  J C2    1 
ATOM   3760  N  N2    . DG  B 2  39  ? -6.520  -33.163 9.523  1.00 98.15  ? -34 DG  J N2    1 
ATOM   3761  N  N3    . DG  B 2  39  ? -6.627  -31.177 10.669 1.00 107.80 ? -34 DG  J N3    1 
ATOM   3762  C  C4    . DG  B 2  39  ? -6.283  -29.875 10.587 1.00 124.17 ? -34 DG  J C4    1 
ATOM   3763  P  P     . DG  B 2  40  ? -8.220  -29.343 16.802 1.00 91.41  ? -33 DG  J P     1 
ATOM   3764  O  OP1   . DG  B 2  40  ? -9.384  -29.582 17.701 1.00 97.95  ? -33 DG  J OP1   1 
ATOM   3765  O  OP2   . DG  B 2  40  ? -7.310  -28.191 17.047 1.00 80.33  ? -33 DG  J OP2   1 
ATOM   3766  O  "O5'" . DG  B 2  40  ? -7.362  -30.676 16.732 1.00 87.08  ? -33 DG  J "O5'" 1 
ATOM   3767  C  "C5'" . DG  B 2  40  ? -7.782  -31.768 15.890 1.00 95.13  ? -33 DG  J "C5'" 1 
ATOM   3768  C  "C4'" . DG  B 2  40  ? -6.630  -32.725 15.712 1.00 97.63  ? -33 DG  J "C4'" 1 
ATOM   3769  O  "O4'" . DG  B 2  40  ? -5.861  -32.353 14.542 1.00 96.99  ? -33 DG  J "O4'" 1 
ATOM   3770  C  "C3'" . DG  B 2  40  ? -5.628  -32.698 16.864 1.00 97.27  ? -33 DG  J "C3'" 1 
ATOM   3771  O  "O3'" . DG  B 2  40  ? -4.935  -33.940 16.862 1.00 105.32 ? -33 DG  J "O3'" 1 
ATOM   3772  C  "C2'" . DG  B 2  40  ? -4.643  -31.641 16.414 1.00 100.75 ? -33 DG  J "C2'" 1 
ATOM   3773  C  "C1'" . DG  B 2  40  ? -4.533  -32.042 14.956 1.00 102.00 ? -33 DG  J "C1'" 1 
ATOM   3774  N  N9    . DG  B 2  40  ? -3.988  -31.062 14.026 1.00 105.96 ? -33 DG  J N9    1 
ATOM   3775  C  C8    . DG  B 2  40  ? -3.640  -29.750 14.249 1.00 104.55 ? -33 DG  J C8    1 
ATOM   3776  N  N7    . DG  B 2  40  ? -3.165  -29.160 13.186 1.00 95.80  ? -33 DG  J N7    1 
ATOM   3777  C  C5    . DG  B 2  40  ? -3.200  -30.143 12.206 1.00 107.46 ? -33 DG  J C5    1 
ATOM   3778  C  C6    . DG  B 2  40  ? -2.809  -30.098 10.843 1.00 110.99 ? -33 DG  J C6    1 
ATOM   3779  O  O6    . DG  B 2  40  ? -2.354  -29.142 10.203 1.00 107.41 ? -33 DG  J O6    1 
ATOM   3780  N  N1    . DG  B 2  40  ? -3.008  -31.324 10.214 1.00 108.00 ? -33 DG  J N1    1 
ATOM   3781  C  C2    . DG  B 2  40  ? -3.513  -32.451 10.819 1.00 108.95 ? -33 DG  J C2    1 
ATOM   3782  N  N2    . DG  B 2  40  ? -3.628  -33.544 10.048 1.00 106.44 ? -33 DG  J N2    1 
ATOM   3783  N  N3    . DG  B 2  40  ? -3.879  -32.504 12.087 1.00 110.81 ? -33 DG  J N3    1 
ATOM   3784  C  C4    . DG  B 2  40  ? -3.696  -31.324 12.715 1.00 107.94 ? -33 DG  J C4    1 
ATOM   3785  P  P     . DA  B 2  41  ? -5.158  -34.972 18.030 1.00 103.17 ? -32 DA  J P     1 
ATOM   3786  O  OP1   . DA  B 2  41  ? -6.628  -35.199 18.159 1.00 105.02 ? -32 DA  J OP1   1 
ATOM   3787  O  OP2   . DA  B 2  41  ? -4.382  -34.472 19.196 1.00 96.98  ? -32 DA  J OP2   1 
ATOM   3788  O  "O5'" . DA  B 2  41  ? -4.497  -36.307 17.451 1.00 96.53  ? -32 DA  J "O5'" 1 
ATOM   3789  C  "C5'" . DA  B 2  41  ? -5.233  -37.201 16.584 1.00 102.80 ? -32 DA  J "C5'" 1 
ATOM   3790  C  "C4'" . DA  B 2  41  ? -4.294  -38.073 15.779 1.00 111.66 ? -32 DA  J "C4'" 1 
ATOM   3791  O  "O4'" . DA  B 2  41  ? -3.644  -37.288 14.749 1.00 106.13 ? -32 DA  J "O4'" 1 
ATOM   3792  C  "C3'" . DA  B 2  41  ? -3.168  -38.740 16.573 1.00 119.17 ? -32 DA  J "C3'" 1 
ATOM   3793  O  "O3'" . DA  B 2  41  ? -3.055  -40.111 16.129 1.00 125.02 ? -32 DA  J "O3'" 1 
ATOM   3794  C  "C2'" . DA  B 2  41  ? -2.001  -37.784 16.379 1.00 117.09 ? -32 DA  J "C2'" 1 
ATOM   3795  C  "C1'" . DA  B 2  41  ? -2.245  -37.209 14.988 1.00 113.64 ? -32 DA  J "C1'" 1 
ATOM   3796  N  N9    . DA  B 2  41  ? -1.838  -35.818 14.787 1.00 114.07 ? -32 DA  J N9    1 
ATOM   3797  C  C8    . DA  B 2  41  ? -1.704  -34.789 15.690 1.00 111.07 ? -32 DA  J C8    1 
ATOM   3798  N  N7    . DA  B 2  41  ? -1.321  -33.658 15.148 1.00 99.59  ? -32 DA  J N7    1 
ATOM   3799  C  C5    . DA  B 2  41  ? -1.191  -33.963 13.799 1.00 112.68 ? -32 DA  J C5    1 
ATOM   3800  C  C6    . DA  B 2  41  ? -0.812  -33.194 12.686 1.00 113.80 ? -32 DA  J C6    1 
ATOM   3801  N  N6    . DA  B 2  41  ? -0.483  -31.902 12.756 1.00 117.10 ? -32 DA  J N6    1 
ATOM   3802  N  N1    . DA  B 2  41  ? -0.787  -33.804 11.480 1.00 113.03 ? -32 DA  J N1    1 
ATOM   3803  C  C2    . DA  B 2  41  ? -1.120  -35.099 11.408 1.00 110.08 ? -32 DA  J C2    1 
ATOM   3804  N  N3    . DA  B 2  41  ? -1.491  -35.927 12.380 1.00 111.95 ? -32 DA  J N3    1 
ATOM   3805  C  C4    . DA  B 2  41  ? -1.510  -35.289 13.564 1.00 114.37 ? -32 DA  J C4    1 
ATOM   3806  P  P     . DA  B 2  42  ? -1.628  -40.851 15.934 1.00 124.00 ? -31 DA  J P     1 
ATOM   3807  O  OP1   . DA  B 2  42  ? -1.880  -42.315 15.952 1.00 111.66 ? -31 DA  J OP1   1 
ATOM   3808  O  OP2   . DA  B 2  42  ? -0.662  -40.286 16.909 1.00 111.06 ? -31 DA  J OP2   1 
ATOM   3809  O  "O5'" . DA  B 2  42  ? -1.199  -40.384 14.470 1.00 121.76 ? -31 DA  J "O5'" 1 
ATOM   3810  C  "C5'" . DA  B 2  42  ? -0.684  -41.301 13.481 1.00 116.94 ? -31 DA  J "C5'" 1 
ATOM   3811  C  "C4'" . DA  B 2  42  ? 0.735   -40.924 13.128 1.00 115.36 ? -31 DA  J "C4'" 1 
ATOM   3812  O  "O4'" . DA  B 2  42  ? 0.791   -39.500 12.905 1.00 111.26 ? -31 DA  J "O4'" 1 
ATOM   3813  C  "C3'" . DA  B 2  42  ? 1.740   -41.209 14.245 1.00 118.56 ? -31 DA  J "C3'" 1 
ATOM   3814  O  "O3'" . DA  B 2  42  ? 2.386   -42.494 14.154 1.00 123.87 ? -31 DA  J "O3'" 1 
ATOM   3815  C  "C2'" . DA  B 2  42  ? 2.675   -40.010 14.243 1.00 118.33 ? -31 DA  J "C2'" 1 
ATOM   3816  C  "C1'" . DA  B 2  42  ? 2.077   -39.020 13.252 1.00 114.91 ? -31 DA  J "C1'" 1 
ATOM   3817  N  N9    . DA  B 2  42  ? 1.917   -37.678 13.804 1.00 118.01 ? -31 DA  J N9    1 
ATOM   3818  C  C8    . DA  B 2  42  ? 1.313   -37.310 14.981 1.00 119.03 ? -31 DA  J C8    1 
ATOM   3819  N  N7    . DA  B 2  42  ? 1.332   -36.019 15.203 1.00 112.25 ? -31 DA  J N7    1 
ATOM   3820  C  C5    . DA  B 2  42  ? 1.997   -35.503 14.100 1.00 117.46 ? -31 DA  J C5    1 
ATOM   3821  C  C6    . DA  B 2  42  ? 2.339   -34.192 13.732 1.00 120.02 ? -31 DA  J C6    1 
ATOM   3822  N  N6    . DA  B 2  42  ? 2.052   -33.119 14.471 1.00 121.10 ? -31 DA  J N6    1 
ATOM   3823  N  N1    . DA  B 2  42  ? 3.001   -34.019 12.567 1.00 119.45 ? -31 DA  J N1    1 
ATOM   3824  C  C2    . DA  B 2  42  ? 3.295   -35.099 11.830 1.00 112.14 ? -31 DA  J C2    1 
ATOM   3825  N  N3    . DA  B 2  42  ? 3.028   -36.380 12.072 1.00 110.77 ? -31 DA  J N3    1 
ATOM   3826  C  C4    . DA  B 2  42  ? 2.368   -36.514 13.234 1.00 115.99 ? -31 DA  J C4    1 
ATOM   3827  P  P     . DA  B 2  43  ? 3.390   -42.915 12.937 1.00 126.78 ? -30 DA  J P     1 
ATOM   3828  O  OP1   . DA  B 2  43  ? 2.576   -43.490 11.832 1.00 122.63 ? -30 DA  J OP1   1 
ATOM   3829  O  OP2   . DA  B 2  43  ? 4.512   -43.698 13.515 1.00 115.22 ? -30 DA  J OP2   1 
ATOM   3830  O  "O5'" . DA  B 2  43  ? 4.055   -41.562 12.421 1.00 133.48 ? -30 DA  J "O5'" 1 
ATOM   3831  C  "C5'" . DA  B 2  43  ? 4.954   -41.615 11.289 1.00 136.25 ? -30 DA  J "C5'" 1 
ATOM   3832  C  "C4'" . DA  B 2  43  ? 6.116   -40.658 11.443 1.00 139.43 ? -30 DA  J "C4'" 1 
ATOM   3833  O  "O4'" . DA  B 2  43  ? 5.685   -39.430 12.076 1.00 139.02 ? -30 DA  J "O4'" 1 
ATOM   3834  C  "C3'" . DA  B 2  43  ? 7.310   -41.170 12.260 1.00 140.68 ? -30 DA  J "C3'" 1 
ATOM   3835  O  "O3'" . DA  B 2  43  ? 8.505   -41.092 11.469 1.00 148.59 ? -30 DA  J "O3'" 1 
ATOM   3836  C  "C2'" . DA  B 2  43  ? 7.366   -40.233 13.457 1.00 137.50 ? -30 DA  J "C2'" 1 
ATOM   3837  C  "C1'" . DA  B 2  43  ? 6.728   -38.975 12.908 1.00 136.09 ? -30 DA  J "C1'" 1 
ATOM   3838  N  N9    . DA  B 2  43  ? 6.150   -38.085 13.911 1.00 137.84 ? -30 DA  J N9    1 
ATOM   3839  C  C8    . DA  B 2  43  ? 5.565   -38.414 15.108 1.00 135.03 ? -30 DA  J C8    1 
ATOM   3840  N  N7    . DA  B 2  43  ? 5.151   -37.379 15.795 1.00 137.54 ? -30 DA  J N7    1 
ATOM   3841  C  C5    . DA  B 2  43  ? 5.487   -36.294 14.998 1.00 137.53 ? -30 DA  J C5    1 
ATOM   3842  C  C6    . DA  B 2  43  ? 5.322   -34.910 15.167 1.00 142.39 ? -30 DA  J C6    1 
ATOM   3843  N  N6    . DA  B 2  43  ? 4.743   -34.361 16.236 1.00 155.13 ? -30 DA  J N6    1 
ATOM   3844  N  N1    . DA  B 2  43  ? 5.773   -34.099 14.186 1.00 139.45 ? -30 DA  J N1    1 
ATOM   3845  C  C2    . DA  B 2  43  ? 6.348   -34.652 13.111 1.00 141.04 ? -30 DA  J C2    1 
ATOM   3846  N  N3    . DA  B 2  43  ? 6.561   -35.938 12.839 1.00 139.02 ? -30 DA  J N3    1 
ATOM   3847  C  C4    . DA  B 2  43  ? 6.103   -36.715 13.835 1.00 135.24 ? -30 DA  J C4    1 
ATOM   3848  P  P     . DC  B 2  44  ? 9.938   -41.510 12.079 1.00 143.59 ? -29 DC  J P     1 
ATOM   3849  O  OP1   . DC  B 2  44  ? 10.760  -42.067 10.981 1.00 126.77 ? -29 DC  J OP1   1 
ATOM   3850  O  OP2   . DC  B 2  44  ? 9.719   -42.296 13.327 1.00 125.19 ? -29 DC  J OP2   1 
ATOM   3851  O  "O5'" . DC  B 2  44  ? 10.593  -40.113 12.455 1.00 132.63 ? -29 DC  J "O5'" 1 
ATOM   3852  C  "C5'" . DC  B 2  44  ? 10.768  -39.086 11.467 1.00 125.94 ? -29 DC  J "C5'" 1 
ATOM   3853  C  "C4'" . DC  B 2  44  ? 11.386  -37.878 12.129 1.00 126.26 ? -29 DC  J "C4'" 1 
ATOM   3854  O  "O4'" . DC  B 2  44  ? 10.402  -37.228 12.971 1.00 130.32 ? -29 DC  J "O4'" 1 
ATOM   3855  C  "C3'" . DC  B 2  44  ? 12.570  -38.204 13.046 1.00 124.78 ? -29 DC  J "C3'" 1 
ATOM   3856  O  "O3'" . DC  B 2  44  ? 13.616  -37.254 12.850 1.00 122.10 ? -29 DC  J "O3'" 1 
ATOM   3857  C  "C2'" . DC  B 2  44  ? 11.998  -38.054 14.445 1.00 127.34 ? -29 DC  J "C2'" 1 
ATOM   3858  C  "C1'" . DC  B 2  44  ? 11.019  -36.921 14.212 1.00 134.16 ? -29 DC  J "C1'" 1 
ATOM   3859  N  N1    . DC  B 2  44  ? 9.962   -36.724 15.224 1.00 130.55 ? -29 DC  J N1    1 
ATOM   3860  C  C2    . DC  B 2  44  ? 9.624   -35.418 15.591 1.00 130.99 ? -29 DC  J C2    1 
ATOM   3861  O  O2    . DC  B 2  44  ? 10.219  -34.472 15.057 1.00 132.35 ? -29 DC  J O2    1 
ATOM   3862  N  N3    . DC  B 2  44  ? 8.659   -35.219 16.517 1.00 133.89 ? -29 DC  J N3    1 
ATOM   3863  C  C4    . DC  B 2  44  ? 8.043   -36.264 17.071 1.00 133.39 ? -29 DC  J C4    1 
ATOM   3864  N  N4    . DC  B 2  44  ? 7.097   -36.022 17.980 1.00 132.02 ? -29 DC  J N4    1 
ATOM   3865  C  C5    . DC  B 2  44  ? 8.366   -37.605 16.715 1.00 133.67 ? -29 DC  J C5    1 
ATOM   3866  C  C6    . DC  B 2  44  ? 9.324   -37.788 15.798 1.00 131.79 ? -29 DC  J C6    1 
ATOM   3867  P  P     . DT  B 2  45  ? 15.058  -37.536 13.457 1.00 131.67 ? -28 DT  J P     1 
ATOM   3868  O  OP1   . DT  B 2  45  ? 16.050  -37.299 12.381 1.00 114.95 ? -28 DT  J OP1   1 
ATOM   3869  O  OP2   . DT  B 2  45  ? 15.012  -38.850 14.152 1.00 124.02 ? -28 DT  J OP2   1 
ATOM   3870  O  "O5'" . DT  B 2  45  ? 15.226  -36.416 14.582 1.00 133.93 ? -28 DT  J "O5'" 1 
ATOM   3871  C  "C5'" . DT  B 2  45  ? 14.715  -35.079 14.403 1.00 135.31 ? -28 DT  J "C5'" 1 
ATOM   3872  C  "C4'" . DT  B 2  45  ? 14.758  -34.310 15.704 1.00 133.32 ? -28 DT  J "C4'" 1 
ATOM   3873  O  "O4'" . DT  B 2  45  ? 13.602  -34.630 16.517 1.00 136.77 ? -28 DT  J "O4'" 1 
ATOM   3874  C  "C3'" . DT  B 2  45  ? 15.976  -34.576 16.593 1.00 139.67 ? -28 DT  J "C3'" 1 
ATOM   3875  O  "O3'" . DT  B 2  45  ? 16.379  -33.339 17.178 1.00 146.82 ? -28 DT  J "O3'" 1 
ATOM   3876  C  "C2'" . DT  B 2  45  ? 15.423  -35.469 17.689 1.00 141.69 ? -28 DT  J "C2'" 1 
ATOM   3877  C  "C1'" . DT  B 2  45  ? 14.035  -34.877 17.846 1.00 140.68 ? -28 DT  J "C1'" 1 
ATOM   3878  N  N1    . DT  B 2  45  ? 13.016  -35.712 18.507 1.00 141.95 ? -28 DT  J N1    1 
ATOM   3879  C  C2    . DT  B 2  45  ? 11.877  -35.086 18.966 1.00 139.89 ? -28 DT  J C2    1 
ATOM   3880  O  O2    . DT  B 2  45  ? 11.693  -33.883 18.872 1.00 126.16 ? -28 DT  J O2    1 
ATOM   3881  N  N3    . DT  B 2  45  ? 10.958  -35.924 19.547 1.00 143.80 ? -28 DT  J N3    1 
ATOM   3882  C  C4    . DT  B 2  45  ? 11.063  -37.294 19.709 1.00 145.20 ? -28 DT  J C4    1 
ATOM   3883  O  O4    . DT  B 2  45  ? 10.154  -37.917 20.251 1.00 138.33 ? -28 DT  J O4    1 
ATOM   3884  C  C5    . DT  B 2  45  ? 12.282  -37.884 19.202 1.00 144.34 ? -28 DT  J C5    1 
ATOM   3885  C  C7    . DT  B 2  45  ? 12.485  -39.360 19.333 1.00 131.47 ? -28 DT  J C7    1 
ATOM   3886  C  C6    . DT  B 2  45  ? 13.183  -37.075 18.631 1.00 144.13 ? -28 DT  J C6    1 
ATOM   3887  P  P     . DG  B 2  46  ? 17.921  -33.007 17.398 1.00 140.89 ? -27 DG  J P     1 
ATOM   3888  O  OP1   . DG  B 2  46  ? 18.596  -33.175 16.090 1.00 140.71 ? -27 DG  J OP1   1 
ATOM   3889  O  OP2   . DG  B 2  46  ? 18.400  -33.774 18.586 1.00 119.43 ? -27 DG  J OP2   1 
ATOM   3890  O  "O5'" . DG  B 2  46  ? 17.894  -31.452 17.755 1.00 139.88 ? -27 DG  J "O5'" 1 
ATOM   3891  C  "C5'" . DG  B 2  46  ? 16.970  -30.541 17.107 1.00 138.43 ? -27 DG  J "C5'" 1 
ATOM   3892  C  "C4'" . DG  B 2  46  ? 16.380  -29.564 18.100 1.00 132.69 ? -27 DG  J "C4'" 1 
ATOM   3893  O  "O4'" . DG  B 2  46  ? 15.294  -30.174 18.839 1.00 135.20 ? -27 DG  J "O4'" 1 
ATOM   3894  C  "C3'" . DG  B 2  46  ? 17.350  -29.057 19.160 1.00 133.82 ? -27 DG  J "C3'" 1 
ATOM   3895  O  "O3'" . DG  B 2  46  ? 16.961  -27.727 19.502 1.00 134.52 ? -27 DG  J "O3'" 1 
ATOM   3896  C  "C2'" . DG  B 2  46  ? 17.137  -30.030 20.305 1.00 133.20 ? -27 DG  J "C2'" 1 
ATOM   3897  C  "C1'" . DG  B 2  46  ? 15.638  -30.279 20.221 1.00 137.71 ? -27 DG  J "C1'" 1 
ATOM   3898  N  N9    . DG  B 2  46  ? 15.209  -31.594 20.688 1.00 136.76 ? -27 DG  J N9    1 
ATOM   3899  C  C8    . DG  B 2  46  ? 15.744  -32.811 20.340 1.00 142.31 ? -27 DG  J C8    1 
ATOM   3900  N  N7    . DG  B 2  46  ? 15.141  -33.819 20.909 1.00 136.06 ? -27 DG  J N7    1 
ATOM   3901  C  C5    . DG  B 2  46  ? 14.148  -33.232 21.680 1.00 135.83 ? -27 DG  J C5    1 
ATOM   3902  C  C6    . DG  B 2  46  ? 13.176  -33.822 22.526 1.00 131.20 ? -27 DG  J C6    1 
ATOM   3903  O  O6    . DG  B 2  46  ? 12.989  -35.019 22.767 1.00 134.68 ? -27 DG  J O6    1 
ATOM   3904  N  N1    . DG  B 2  46  ? 12.368  -32.861 23.123 1.00 127.73 ? -27 DG  J N1    1 
ATOM   3905  C  C2    . DG  B 2  46  ? 12.479  -31.505 22.929 1.00 130.01 ? -27 DG  J C2    1 
ATOM   3906  N  N2    . DG  B 2  46  ? 11.603  -30.740 23.592 1.00 136.82 ? -27 DG  J N2    1 
ATOM   3907  N  N3    . DG  B 2  46  ? 13.381  -30.943 22.142 1.00 127.49 ? -27 DG  J N3    1 
ATOM   3908  C  C4    . DG  B 2  46  ? 14.177  -31.859 21.554 1.00 131.75 ? -27 DG  J C4    1 
ATOM   3909  P  P     . DC  B 2  47  ? 17.716  -26.949 20.666 1.00 139.28 ? -26 DC  J P     1 
ATOM   3910  O  OP1   . DC  B 2  47  ? 17.488  -25.496 20.457 1.00 123.70 ? -26 DC  J OP1   1 
ATOM   3911  O  OP2   . DC  B 2  47  ? 19.104  -27.477 20.747 1.00 122.46 ? -26 DC  J OP2   1 
ATOM   3912  O  "O5'" . DC  B 2  47  ? 16.963  -27.458 21.977 1.00 142.97 ? -26 DC  J "O5'" 1 
ATOM   3913  C  "C5'" . DC  B 2  47  ? 15.742  -26.860 22.452 1.00 125.12 ? -26 DC  J "C5'" 1 
ATOM   3914  C  "C4'" . DC  B 2  47  ? 15.494  -27.309 23.870 1.00 114.03 ? -26 DC  J "C4'" 1 
ATOM   3915  O  "O4'" . DC  B 2  47  ? 15.360  -28.753 23.892 1.00 116.64 ? -26 DC  J "O4'" 1 
ATOM   3916  C  "C3'" . DC  B 2  47  ? 16.629  -26.985 24.847 1.00 113.40 ? -26 DC  J "C3'" 1 
ATOM   3917  O  "O3'" . DC  B 2  47  ? 16.068  -26.651 26.121 1.00 126.03 ? -26 DC  J "O3'" 1 
ATOM   3918  C  "C2'" . DC  B 2  47  ? 17.346  -28.315 24.995 1.00 115.33 ? -26 DC  J "C2'" 1 
ATOM   3919  C  "C1'" . DC  B 2  47  ? 16.154  -29.248 24.960 1.00 119.07 ? -26 DC  J "C1'" 1 
ATOM   3920  N  N1    . DC  B 2  47  ? 16.396  -30.692 24.739 1.00 121.11 ? -26 DC  J N1    1 
ATOM   3921  C  C2    . DC  B 2  47  ? 15.681  -31.620 25.510 1.00 125.88 ? -26 DC  J C2    1 
ATOM   3922  O  O2    . DC  B 2  47  ? 14.871  -31.206 26.355 1.00 121.70 ? -26 DC  J O2    1 
ATOM   3923  N  N3    . DC  B 2  47  ? 15.883  -32.942 25.308 1.00 127.31 ? -26 DC  J N3    1 
ATOM   3924  C  C4    . DC  B 2  47  ? 16.755  -33.349 24.383 1.00 129.42 ? -26 DC  J C4    1 
ATOM   3925  N  N4    . DC  B 2  47  ? 16.924  -34.663 24.219 1.00 143.02 ? -26 DC  J N4    1 
ATOM   3926  C  C5    . DC  B 2  47  ? 17.501  -32.427 23.590 1.00 121.46 ? -26 DC  J C5    1 
ATOM   3927  C  C6    . DC  B 2  47  ? 17.290  -31.121 23.797 1.00 118.59 ? -26 DC  J C6    1 
ATOM   3928  P  P     . DT  B 2  48  ? 16.405  -25.261 26.859 1.00 122.61 ? -25 DT  J P     1 
ATOM   3929  O  OP1   . DT  B 2  48  ? 16.153  -24.149 25.896 1.00 99.40  ? -25 DT  J OP1   1 
ATOM   3930  O  OP2   . DT  B 2  48  ? 17.713  -25.399 27.556 1.00 104.86 ? -25 DT  J OP2   1 
ATOM   3931  O  "O5'" . DT  B 2  48  ? 15.312  -25.208 28.018 1.00 129.74 ? -25 DT  J "O5'" 1 
ATOM   3932  C  "C5'" . DT  B 2  48  ? 13.907  -25.311 27.710 1.00 122.53 ? -25 DT  J "C5'" 1 
ATOM   3933  C  "C4'" . DT  B 2  48  ? 13.242  -26.354 28.578 1.00 112.44 ? -25 DT  J "C4'" 1 
ATOM   3934  O  "O4'" . DT  B 2  48  ? 13.740  -27.681 28.285 1.00 105.31 ? -25 DT  J "O4'" 1 
ATOM   3935  C  "C3'" . DT  B 2  48  ? 13.429  -26.164 30.086 1.00 109.31 ? -25 DT  J "C3'" 1 
ATOM   3936  O  "O3'" . DT  B 2  48  ? 12.130  -26.310 30.662 1.00 105.53 ? -25 DT  J "O3'" 1 
ATOM   3937  C  "C2'" . DT  B 2  48  ? 14.343  -27.311 30.487 1.00 107.06 ? -25 DT  J "C2'" 1 
ATOM   3938  C  "C1'" . DT  B 2  48  ? 13.863  -28.367 29.517 1.00 112.61 ? -25 DT  J "C1'" 1 
ATOM   3939  N  N1    . DT  B 2  48  ? 14.713  -29.555 29.297 1.00 121.18 ? -25 DT  J N1    1 
ATOM   3940  C  C2    . DT  B 2  48  ? 14.138  -30.794 29.480 1.00 131.22 ? -25 DT  J C2    1 
ATOM   3941  O  O2    . DT  B 2  48  ? 12.987  -30.947 29.857 1.00 138.47 ? -25 DT  J O2    1 
ATOM   3942  N  N3    . DT  B 2  48  ? 14.971  -31.854 29.223 1.00 132.06 ? -25 DT  J N3    1 
ATOM   3943  C  C4    . DT  B 2  48  ? 16.286  -31.800 28.803 1.00 129.44 ? -25 DT  J C4    1 
ATOM   3944  O  O4    . DT  B 2  48  ? 16.908  -32.840 28.607 1.00 124.23 ? -25 DT  J O4    1 
ATOM   3945  C  C5    . DT  B 2  48  ? 16.819  -30.468 28.618 1.00 127.15 ? -25 DT  J C5    1 
ATOM   3946  C  C7    . DT  B 2  48  ? 18.235  -30.311 28.161 1.00 129.70 ? -25 DT  J C7    1 
ATOM   3947  C  C6    . DT  B 2  48  ? 16.015  -29.426 28.867 1.00 122.12 ? -25 DT  J C6    1 
ATOM   3948  P  P     . DC  B 2  49  ? 11.797  -25.624 32.049 1.00 105.13 ? -24 DC  J P     1 
ATOM   3949  O  OP1   . DC  B 2  49  ? 10.594  -24.771 31.852 1.00 85.42  ? -24 DC  J OP1   1 
ATOM   3950  O  OP2   . DC  B 2  49  ? 13.065  -25.046 32.593 1.00 94.69  ? -24 DC  J OP2   1 
ATOM   3951  O  "O5'" . DC  B 2  49  ? 11.415  -26.850 32.995 1.00 95.14  ? -24 DC  J "O5'" 1 
ATOM   3952  C  "C5'" . DC  B 2  49  ? 10.869  -28.089 32.500 1.00 93.98  ? -24 DC  J "C5'" 1 
ATOM   3953  C  "C4'" . DC  B 2  49  ? 11.243  -29.213 33.437 1.00 92.43  ? -24 DC  J "C4'" 1 
ATOM   3954  O  "O4'" . DC  B 2  49  ? 12.416  -29.896 32.932 1.00 100.30 ? -24 DC  J "O4'" 1 
ATOM   3955  C  "C3'" . DC  B 2  49  ? 11.617  -28.766 34.854 1.00 91.50  ? -24 DC  J "C3'" 1 
ATOM   3956  O  "O3'" . DC  B 2  49  ? 11.252  -29.775 35.799 1.00 77.81  ? -24 DC  J "O3'" 1 
ATOM   3957  C  "C2'" . DC  B 2  49  ? 13.128  -28.665 34.784 1.00 93.25  ? -24 DC  J "C2'" 1 
ATOM   3958  C  "C1'" . DC  B 2  49  ? 13.415  -29.896 33.946 1.00 102.94 ? -24 DC  J "C1'" 1 
ATOM   3959  N  N1    . DC  B 2  49  ? 14.727  -29.999 33.292 1.00 114.77 ? -24 DC  J N1    1 
ATOM   3960  C  C2    . DC  B 2  49  ? 15.055  -31.207 32.670 1.00 125.06 ? -24 DC  J C2    1 
ATOM   3961  O  O2    . DC  B 2  49  ? 14.236  -32.139 32.701 1.00 128.40 ? -24 DC  J O2    1 
ATOM   3962  N  N3    . DC  B 2  49  ? 16.249  -31.328 32.047 1.00 122.42 ? -24 DC  J N3    1 
ATOM   3963  C  C4    . DC  B 2  49  ? 17.097  -30.298 32.026 1.00 116.93 ? -24 DC  J C4    1 
ATOM   3964  N  N4    . DC  B 2  49  ? 18.264  -30.463 31.402 1.00 119.91 ? -24 DC  J N4    1 
ATOM   3965  C  C5    . DC  B 2  49  ? 16.788  -29.054 32.649 1.00 109.58 ? -24 DC  J C5    1 
ATOM   3966  C  C6    . DC  B 2  49  ? 15.605  -28.950 33.268 1.00 113.28 ? -24 DC  J C6    1 
ATOM   3967  P  P     . DC  B 2  50  ? 9.740   -29.901 36.260 1.00 80.34  ? -23 DC  J P     1 
ATOM   3968  O  OP1   . DC  B 2  50  ? 8.871   -29.580 35.079 1.00 57.84  ? -23 DC  J OP1   1 
ATOM   3969  O  OP2   . DC  B 2  50  ? 9.610   -29.162 37.557 1.00 62.60  ? -23 DC  J OP2   1 
ATOM   3970  O  "O5'" . DC  B 2  50  ? 9.584   -31.443 36.642 1.00 65.83  ? -23 DC  J "O5'" 1 
ATOM   3971  C  "C5'" . DC  B 2  50  ? 9.308   -32.434 35.644 1.00 67.71  ? -23 DC  J "C5'" 1 
ATOM   3972  C  "C4'" . DC  B 2  50  ? 10.045  -33.704 35.994 1.00 69.87  ? -23 DC  J "C4'" 1 
ATOM   3973  O  "O4'" . DC  B 2  50  ? 11.429  -33.539 35.619 1.00 71.98  ? -23 DC  J "O4'" 1 
ATOM   3974  C  "C3'" . DC  B 2  50  ? 10.036  -34.064 37.485 1.00 70.28  ? -23 DC  J "C3'" 1 
ATOM   3975  O  "O3'" . DC  B 2  50  ? 9.507   -35.372 37.725 1.00 60.73  ? -23 DC  J "O3'" 1 
ATOM   3976  C  "C2'" . DC  B 2  50  ? 11.493  -33.963 37.922 1.00 73.79  ? -23 DC  J "C2'" 1 
ATOM   3977  C  "C1'" . DC  B 2  50  ? 12.273  -34.066 36.626 1.00 79.50  ? -23 DC  J "C1'" 1 
ATOM   3978  N  N1    . DC  B 2  50  ? 13.535  -33.316 36.569 1.00 96.48  ? -23 DC  J N1    1 
ATOM   3979  C  C2    . DC  B 2  50  ? 14.627  -33.904 35.927 1.00 103.70 ? -23 DC  J C2    1 
ATOM   3980  O  O2    . DC  B 2  50  ? 14.513  -35.058 35.492 1.00 100.74 ? -23 DC  J O2    1 
ATOM   3981  N  N3    . DC  B 2  50  ? 15.781  -33.207 35.809 1.00 114.08 ? -23 DC  J N3    1 
ATOM   3982  C  C4    . DC  B 2  50  ? 15.858  -31.961 36.283 1.00 111.05 ? -23 DC  J C4    1 
ATOM   3983  N  N4    . DC  B 2  50  ? 17.016  -31.314 36.150 1.00 114.42 ? -23 DC  J N4    1 
ATOM   3984  C  C5    . DC  B 2  50  ? 14.753  -31.329 36.923 1.00 109.37 ? -23 DC  J C5    1 
ATOM   3985  C  C6    . DC  B 2  50  ? 13.616  -32.030 37.030 1.00 107.59 ? -23 DC  J C6    1 
ATOM   3986  P  P     . DA  B 2  51  ? 9.396   -35.898 39.238 1.00 69.03  ? -22 DA  J P     1 
ATOM   3987  O  OP1   . DA  B 2  51  ? 8.004   -36.361 39.446 1.00 72.51  ? -22 DA  J OP1   1 
ATOM   3988  O  OP2   . DA  B 2  51  ? 9.990   -34.874 40.150 1.00 63.93  ? -22 DA  J OP2   1 
ATOM   3989  O  "O5'" . DA  B 2  51  ? 10.425  -37.114 39.307 1.00 69.68  ? -22 DA  J "O5'" 1 
ATOM   3990  C  "C5'" . DA  B 2  51  ? 10.715  -37.931 38.156 1.00 77.70  ? -22 DA  J "C5'" 1 
ATOM   3991  C  "C4'" . DA  B 2  51  ? 11.897  -38.841 38.414 1.00 82.48  ? -22 DA  J "C4'" 1 
ATOM   3992  O  "O4'" . DA  B 2  51  ? 13.126  -38.123 38.162 1.00 78.16  ? -22 DA  J "O4'" 1 
ATOM   3993  C  "C3'" . DA  B 2  51  ? 12.031  -39.426 39.823 1.00 87.94  ? -22 DA  J "C3'" 1 
ATOM   3994  O  "O3'" . DA  B 2  51  ? 12.462  -40.788 39.682 1.00 97.59  ? -22 DA  J "O3'" 1 
ATOM   3995  C  "C2'" . DA  B 2  51  ? 13.031  -38.499 40.497 1.00 83.75  ? -22 DA  J "C2'" 1 
ATOM   3996  C  "C1'" . DA  B 2  51  ? 13.913  -38.043 39.342 1.00 85.98  ? -22 DA  J "C1'" 1 
ATOM   3997  N  N9    . DA  B 2  51  ? 14.444  -36.682 39.432 1.00 93.62  ? -22 DA  J N9    1 
ATOM   3998  C  C8    . DA  B 2  51  ? 13.868  -35.562 39.980 1.00 95.96  ? -22 DA  J C8    1 
ATOM   3999  N  N7    . DA  B 2  51  ? 14.612  -34.487 39.888 1.00 91.40  ? -22 DA  J N7    1 
ATOM   4000  C  C5    . DA  B 2  51  ? 15.747  -34.924 39.221 1.00 98.69  ? -22 DA  J C5    1 
ATOM   4001  C  C6    . DA  B 2  51  ? 16.924  -34.266 38.827 1.00 104.68 ? -22 DA  J C6    1 
ATOM   4002  N  N6    . DA  B 2  51  ? 17.155  -32.969 39.043 1.00 107.71 ? -22 DA  J N6    1 
ATOM   4003  N  N1    . DA  B 2  51  ? 17.871  -34.995 38.195 1.00 103.37 ? -22 DA  J N1    1 
ATOM   4004  C  C2    . DA  B 2  51  ? 17.641  -36.297 37.982 1.00 101.54 ? -22 DA  J C2    1 
ATOM   4005  N  N3    . DA  B 2  51  ? 16.576  -37.028 38.305 1.00 99.42  ? -22 DA  J N3    1 
ATOM   4006  C  C4    . DA  B 2  51  ? 15.657  -36.274 38.933 1.00 98.96  ? -22 DA  J C4    1 
ATOM   4007  P  P     . DT  B 2  52  ? 12.951  -41.643 40.942 1.00 102.62 ? -21 DT  J P     1 
ATOM   4008  O  OP1   . DT  B 2  52  ? 12.930  -43.078 40.555 1.00 102.93 ? -21 DT  J OP1   1 
ATOM   4009  O  OP2   . DT  B 2  52  ? 12.216  -41.182 42.141 1.00 96.44  ? -21 DT  J OP2   1 
ATOM   4010  O  "O5'" . DT  B 2  52  ? 14.470  -41.213 41.072 1.00 98.94  ? -21 DT  J "O5'" 1 
ATOM   4011  C  "C5'" . DT  B 2  52  ? 15.350  -41.338 39.948 1.00 105.85 ? -21 DT  J "C5'" 1 
ATOM   4012  C  "C4'" . DT  B 2  52  ? 16.763  -41.120 40.425 1.00 112.30 ? -21 DT  J "C4'" 1 
ATOM   4013  O  "O4'" . DT  B 2  52  ? 17.127  -39.722 40.316 1.00 106.78 ? -21 DT  J "O4'" 1 
ATOM   4014  C  "C3'" . DT  B 2  52  ? 16.973  -41.490 41.897 1.00 120.35 ? -21 DT  J "C3'" 1 
ATOM   4015  O  "O3'" . DT  B 2  52  ? 18.249  -42.117 41.987 1.00 130.62 ? -21 DT  J "O3'" 1 
ATOM   4016  C  "C2'" . DT  B 2  52  ? 16.966  -40.144 42.595 1.00 114.39 ? -21 DT  J "C2'" 1 
ATOM   4017  C  "C1'" . DT  B 2  52  ? 17.698  -39.329 41.552 1.00 116.56 ? -21 DT  J "C1'" 1 
ATOM   4018  N  N1    . DT  B 2  52  ? 17.611  -37.863 41.660 1.00 124.96 ? -21 DT  J N1    1 
ATOM   4019  C  C2    . DT  B 2  52  ? 18.690  -37.129 41.218 1.00 132.89 ? -21 DT  J C2    1 
ATOM   4020  O  O2    . DT  B 2  52  ? 19.690  -37.637 40.739 1.00 149.39 ? -21 DT  J O2    1 
ATOM   4021  N  N3    . DT  B 2  52  ? 18.551  -35.771 41.351 1.00 127.07 ? -21 DT  J N3    1 
ATOM   4022  C  C4    . DT  B 2  52  ? 17.471  -35.090 41.879 1.00 128.98 ? -21 DT  J C4    1 
ATOM   4023  O  O4    . DT  B 2  52  ? 17.486  -33.864 41.928 1.00 121.08 ? -21 DT  J O4    1 
ATOM   4024  C  C5    . DT  B 2  52  ? 16.377  -35.923 42.329 1.00 128.70 ? -21 DT  J C5    1 
ATOM   4025  C  C7    . DT  B 2  52  ? 15.163  -35.274 42.915 1.00 120.14 ? -21 DT  J C7    1 
ATOM   4026  C  C6    . DT  B 2  52  ? 16.501  -37.250 42.201 1.00 126.44 ? -21 DT  J C6    1 
ATOM   4027  P  P     . DC  B 2  53  ? 18.651  -42.991 43.254 1.00 127.16 ? -20 DC  J P     1 
ATOM   4028  O  OP1   . DC  B 2  53  ? 18.594  -44.416 42.847 1.00 129.94 ? -20 DC  J OP1   1 
ATOM   4029  O  OP2   . DC  B 2  53  ? 17.866  -42.532 44.433 1.00 115.73 ? -20 DC  J OP2   1 
ATOM   4030  O  "O5'" . DC  B 2  53  ? 20.176  -42.588 43.449 1.00 119.60 ? -20 DC  J "O5'" 1 
ATOM   4031  C  "C5'" . DC  B 2  53  ? 20.876  -41.814 42.454 1.00 121.12 ? -20 DC  J "C5'" 1 
ATOM   4032  C  "C4'" . DC  B 2  53  ? 21.874  -40.926 43.154 1.00 129.60 ? -20 DC  J "C4'" 1 
ATOM   4033  O  "O4'" . DC  B 2  53  ? 21.395  -39.557 43.179 1.00 129.12 ? -20 DC  J "O4'" 1 
ATOM   4034  C  "C3'" . DC  B 2  53  ? 22.095  -41.313 44.617 1.00 134.41 ? -20 DC  J "C3'" 1 
ATOM   4035  O  "O3'" . DC  B 2  53  ? 23.470  -41.113 44.937 1.00 143.53 ? -20 DC  J "O3'" 1 
ATOM   4036  C  "C2'" . DC  B 2  53  ? 21.173  -40.362 45.353 1.00 131.39 ? -20 DC  J "C2'" 1 
ATOM   4037  C  "C1'" . DC  B 2  53  ? 21.391  -39.107 44.528 1.00 132.73 ? -20 DC  J "C1'" 1 
ATOM   4038  N  N1    . DC  B 2  53  ? 20.371  -38.053 44.667 1.00 135.74 ? -20 DC  J N1    1 
ATOM   4039  C  C2    . DC  B 2  53  ? 20.726  -36.727 44.392 1.00 128.37 ? -20 DC  J C2    1 
ATOM   4040  O  O2    . DC  B 2  53  ? 21.879  -36.481 44.012 1.00 130.20 ? -20 DC  J O2    1 
ATOM   4041  N  N3    . DC  B 2  53  ? 19.799  -35.752 44.535 1.00 130.10 ? -20 DC  J N3    1 
ATOM   4042  C  C4    . DC  B 2  53  ? 18.565  -36.059 44.941 1.00 139.56 ? -20 DC  J C4    1 
ATOM   4043  N  N4    . DC  B 2  53  ? 17.680  -35.067 45.064 1.00 138.81 ? -20 DC  J N4    1 
ATOM   4044  C  C5    . DC  B 2  53  ? 18.180  -37.399 45.238 1.00 141.52 ? -20 DC  J C5    1 
ATOM   4045  C  C6    . DC  B 2  53  ? 19.107  -38.354 45.095 1.00 138.93 ? -20 DC  J C6    1 
ATOM   4046  P  P     . DA  B 2  54  ? 24.003  -41.430 46.402 1.00 147.40 ? -19 DA  J P     1 
ATOM   4047  O  OP1   . DA  B 2  54  ? 24.052  -42.904 46.552 1.00 152.46 ? -19 DA  J OP1   1 
ATOM   4048  O  OP2   . DA  B 2  54  ? 23.206  -40.642 47.368 1.00 149.96 ? -19 DA  J OP2   1 
ATOM   4049  O  "O5'" . DA  B 2  54  ? 25.463  -40.794 46.369 1.00 149.99 ? -19 DA  J "O5'" 1 
ATOM   4050  C  "C5'" . DA  B 2  54  ? 26.176  -40.495 47.583 1.00 156.41 ? -19 DA  J "C5'" 1 
ATOM   4051  C  "C4'" . DA  B 2  54  ? 26.782  -39.111 47.524 1.00 157.50 ? -19 DA  J "C4'" 1 
ATOM   4052  O  "O4'" . DA  B 2  54  ? 25.783  -38.144 47.109 1.00 152.10 ? -19 DA  J "O4'" 1 
ATOM   4053  C  "C3'" . DA  B 2  54  ? 27.296  -38.613 48.874 1.00 157.58 ? -19 DA  J "C3'" 1 
ATOM   4054  O  "O3'" . DA  B 2  54  ? 28.447  -37.779 48.685 1.00 161.99 ? -19 DA  J "O3'" 1 
ATOM   4055  C  "C2'" . DA  B 2  54  ? 26.098  -37.862 49.420 1.00 157.69 ? -19 DA  J "C2'" 1 
ATOM   4056  C  "C1'" . DA  B 2  54  ? 25.556  -37.209 48.161 1.00 154.67 ? -19 DA  J "C1'" 1 
ATOM   4057  N  N9    . DA  B 2  54  ? 24.123  -36.919 48.214 1.00 147.75 ? -19 DA  J N9    1 
ATOM   4058  C  C8    . DA  B 2  54  ? 23.101  -37.792 48.498 1.00 139.97 ? -19 DA  J C8    1 
ATOM   4059  N  N7    . DA  B 2  54  ? 21.914  -37.237 48.485 1.00 129.88 ? -19 DA  J N7    1 
ATOM   4060  C  C5    . DA  B 2  54  ? 22.171  -35.907 48.186 1.00 125.16 ? -19 DA  J C5    1 
ATOM   4061  C  C6    . DA  B 2  54  ? 21.329  -34.796 48.029 1.00 116.74 ? -19 DA  J C6    1 
ATOM   4062  N  N6    . DA  B 2  54  ? 20.002  -34.856 48.157 1.00 115.91 ? -19 DA  J N6    1 
ATOM   4063  N  N1    . DA  B 2  54  ? 21.901  -33.607 47.737 1.00 117.40 ? -19 DA  J N1    1 
ATOM   4064  C  C2    . DA  B 2  54  ? 23.234  -33.552 47.608 1.00 121.50 ? -19 DA  J C2    1 
ATOM   4065  N  N3    . DA  B 2  54  ? 24.131  -34.530 47.726 1.00 131.23 ? -19 DA  J N3    1 
ATOM   4066  C  C4    . DA  B 2  54  ? 23.528  -35.695 48.022 1.00 136.34 ? -19 DA  J C4    1 
ATOM   4067  P  P     . DA  B 2  55  ? 29.041  -36.901 49.899 1.00 154.92 ? -18 DA  J P     1 
ATOM   4068  O  OP1   . DA  B 2  55  ? 30.513  -36.829 49.736 1.00 166.69 ? -18 DA  J OP1   1 
ATOM   4069  O  OP2   . DA  B 2  55  ? 28.474  -37.413 51.177 1.00 132.39 ? -18 DA  J OP2   1 
ATOM   4070  O  "O5'" . DA  B 2  55  ? 28.468  -35.448 49.586 1.00 156.68 ? -18 DA  J "O5'" 1 
ATOM   4071  C  "C5'" . DA  B 2  55  ? 29.318  -34.384 49.115 1.00 153.69 ? -18 DA  J "C5'" 1 
ATOM   4072  C  "C4'" . DA  B 2  55  ? 28.871  -33.074 49.721 1.00 160.32 ? -18 DA  J "C4'" 1 
ATOM   4073  O  "O4'" . DA  B 2  55  ? 27.426  -33.079 49.823 1.00 168.04 ? -18 DA  J "O4'" 1 
ATOM   4074  C  "C3'" . DA  B 2  55  ? 29.377  -32.803 51.142 1.00 158.74 ? -18 DA  J "C3'" 1 
ATOM   4075  O  "O3'" . DA  B 2  55  ? 29.581  -31.382 51.288 1.00 153.75 ? -18 DA  J "O3'" 1 
ATOM   4076  C  "C2'" . DA  B 2  55  ? 28.266  -33.390 51.994 1.00 156.98 ? -18 DA  J "C2'" 1 
ATOM   4077  C  "C1'" . DA  B 2  55  ? 27.048  -32.966 51.193 1.00 165.52 ? -18 DA  J "C1'" 1 
ATOM   4078  N  N9    . DA  B 2  55  ? 25.825  -33.746 51.403 1.00 157.19 ? -18 DA  J N9    1 
ATOM   4079  C  C8    . DA  B 2  55  ? 25.682  -35.058 51.786 1.00 143.09 ? -18 DA  J C8    1 
ATOM   4080  N  N7    . DA  B 2  55  ? 24.433  -35.444 51.890 1.00 125.41 ? -18 DA  J N7    1 
ATOM   4081  C  C5    . DA  B 2  55  ? 23.705  -34.308 51.566 1.00 136.28 ? -18 DA  J C5    1 
ATOM   4082  C  C6    . DA  B 2  55  ? 22.323  -34.058 51.492 1.00 133.20 ? -18 DA  J C6    1 
ATOM   4083  N  N6    . DA  B 2  55  ? 21.389  -34.975 51.754 1.00 123.05 ? -18 DA  J N6    1 
ATOM   4084  N  N1    . DA  B 2  55  ? 21.929  -32.816 51.132 1.00 141.24 ? -18 DA  J N1    1 
ATOM   4085  C  C2    . DA  B 2  55  ? 22.866  -31.894 50.875 1.00 141.89 ? -18 DA  J C2    1 
ATOM   4086  N  N3    . DA  B 2  55  ? 24.190  -32.008 50.911 1.00 143.14 ? -18 DA  J N3    1 
ATOM   4087  C  C4    . DA  B 2  55  ? 24.549  -33.254 51.267 1.00 147.10 ? -18 DA  J C4    1 
ATOM   4088  P  P     . DA  B 2  56  ? 29.657  -30.672 52.744 1.00 153.33 ? -17 DA  J P     1 
ATOM   4089  O  OP1   . DA  B 2  56  ? 30.739  -29.654 52.713 1.00 132.24 ? -17 DA  J OP1   1 
ATOM   4090  O  OP2   . DA  B 2  56  ? 29.677  -31.733 53.791 1.00 135.50 ? -17 DA  J OP2   1 
ATOM   4091  O  "O5'" . DA  B 2  56  ? 28.292  -29.849 52.812 1.00 156.49 ? -17 DA  J "O5'" 1 
ATOM   4092  C  "C5'" . DA  B 2  56  ? 28.219  -28.550 53.439 1.00 141.53 ? -17 DA  J "C5'" 1 
ATOM   4093  C  "C4'" . DA  B 2  56  ? 26.788  -28.211 53.795 1.00 136.34 ? -17 DA  J "C4'" 1 
ATOM   4094  O  "O4'" . DA  B 2  56  ? 25.921  -29.353 53.569 1.00 133.81 ? -17 DA  J "O4'" 1 
ATOM   4095  C  "C3'" . DA  B 2  56  ? 26.562  -27.792 55.252 1.00 125.28 ? -17 DA  J "C3'" 1 
ATOM   4096  O  "O3'" . DA  B 2  56  ? 25.768  -26.600 55.308 1.00 115.91 ? -17 DA  J "O3'" 1 
ATOM   4097  C  "C2'" . DA  B 2  56  ? 25.841  -28.983 55.862 1.00 120.32 ? -17 DA  J "C2'" 1 
ATOM   4098  C  "C1'" . DA  B 2  56  ? 25.045  -29.478 54.675 1.00 126.23 ? -17 DA  J "C1'" 1 
ATOM   4099  N  N9    . DA  B 2  56  ? 24.578  -30.865 54.742 1.00 121.47 ? -17 DA  J N9    1 
ATOM   4100  C  C8    . DA  B 2  56  ? 25.304  -32.031 54.740 1.00 118.60 ? -17 DA  J C8    1 
ATOM   4101  N  N7    . DA  B 2  56  ? 24.566  -33.113 54.808 1.00 119.42 ? -17 DA  J N7    1 
ATOM   4102  C  C5    . DA  B 2  56  ? 23.266  -32.627 54.864 1.00 117.89 ? -17 DA  J C5    1 
ATOM   4103  C  C6    . DA  B 2  56  ? 22.017  -33.269 54.957 1.00 107.80 ? -17 DA  J C6    1 
ATOM   4104  N  N6    . DA  B 2  56  ? 21.865  -34.593 55.003 1.00 102.27 ? -17 DA  J N6    1 
ATOM   4105  N  N1    . DA  B 2  56  ? 20.912  -32.490 54.993 1.00 114.20 ? -17 DA  J N1    1 
ATOM   4106  C  C2    . DA  B 2  56  ? 21.062  -31.160 54.947 1.00 113.75 ? -17 DA  J C2    1 
ATOM   4107  N  N3    . DA  B 2  56  ? 22.181  -30.441 54.867 1.00 124.52 ? -17 DA  J N3    1 
ATOM   4108  C  C4    . DA  B 2  56  ? 23.259  -31.245 54.825 1.00 125.80 ? -17 DA  J C4    1 
ATOM   4109  P  P     . DA  B 2  57  ? 25.708  -25.735 56.664 1.00 128.18 ? -16 DA  J P     1 
ATOM   4110  O  OP1   . DA  B 2  57  ? 26.293  -24.396 56.394 1.00 124.64 ? -16 DA  J OP1   1 
ATOM   4111  O  OP2   . DA  B 2  57  ? 26.239  -26.573 57.774 1.00 117.24 ? -16 DA  J OP2   1 
ATOM   4112  O  "O5'" . DA  B 2  57  ? 24.149  -25.496 56.905 1.00 133.70 ? -16 DA  J "O5'" 1 
ATOM   4113  C  "C5'" . DA  B 2  57  ? 23.138  -26.155 56.112 1.00 132.47 ? -16 DA  J "C5'" 1 
ATOM   4114  C  "C4'" . DA  B 2  57  ? 21.972  -26.598 56.968 1.00 125.19 ? -16 DA  J "C4'" 1 
ATOM   4115  O  "O4'" . DA  B 2  57  ? 21.926  -28.049 56.990 1.00 118.22 ? -16 DA  J "O4'" 1 
ATOM   4116  C  "C3'" . DA  B 2  57  ? 21.994  -26.158 58.439 1.00 119.95 ? -16 DA  J "C3'" 1 
ATOM   4117  O  "O3'" . DA  B 2  57  ? 20.659  -25.912 58.891 1.00 114.29 ? -16 DA  J "O3'" 1 
ATOM   4118  C  "C2'" . DA  B 2  57  ? 22.487  -27.401 59.158 1.00 123.78 ? -16 DA  J "C2'" 1 
ATOM   4119  C  "C1'" . DA  B 2  57  ? 21.802  -28.479 58.337 1.00 117.13 ? -16 DA  J "C1'" 1 
ATOM   4120  N  N9    . DA  B 2  57  ? 22.336  -29.838 58.435 1.00 118.08 ? -16 DA  J N9    1 
ATOM   4121  C  C8    . DA  B 2  57  ? 23.622  -30.260 58.670 1.00 110.69 ? -16 DA  J C8    1 
ATOM   4122  N  N7    . DA  B 2  57  ? 23.753  -31.565 58.692 1.00 122.89 ? -16 DA  J N7    1 
ATOM   4123  C  C5    . DA  B 2  57  ? 22.466  -32.033 58.466 1.00 127.21 ? -16 DA  J C5    1 
ATOM   4124  C  C6    . DA  B 2  57  ? 21.932  -33.332 58.372 1.00 129.17 ? -16 DA  J C6    1 
ATOM   4125  N  N6    . DA  B 2  57  ? 22.659  -34.443 58.503 1.00 137.13 ? -16 DA  J N6    1 
ATOM   4126  N  N1    . DA  B 2  57  ? 20.607  -33.449 58.132 1.00 132.84 ? -16 DA  J N1    1 
ATOM   4127  C  C2    . DA  B 2  57  ? 19.877  -32.334 57.999 1.00 122.50 ? -16 DA  J C2    1 
ATOM   4128  N  N3    . DA  B 2  57  ? 20.264  -31.063 58.065 1.00 118.09 ? -16 DA  J N3    1 
ATOM   4129  C  C4    . DA  B 2  57  ? 21.584  -30.980 58.303 1.00 127.02 ? -16 DA  J C4    1 
ATOM   4130  P  P     . DG  B 2  58  ? 20.241  -24.511 59.539 1.00 108.25 ? -15 DG  J P     1 
ATOM   4131  O  OP1   . DG  B 2  58  ? 19.952  -23.569 58.432 1.00 103.42 ? -15 DG  J OP1   1 
ATOM   4132  O  OP2   . DG  B 2  58  ? 21.241  -24.167 60.578 1.00 108.47 ? -15 DG  J OP2   1 
ATOM   4133  O  "O5'" . DG  B 2  58  ? 18.871  -24.841 60.292 1.00 107.31 ? -15 DG  J "O5'" 1 
ATOM   4134  C  "C5'" . DG  B 2  58  ? 17.982  -25.916 59.870 1.00 99.40  ? -15 DG  J "C5'" 1 
ATOM   4135  C  "C4'" . DG  B 2  58  ? 17.088  -26.357 61.009 1.00 90.81  ? -15 DG  J "C4'" 1 
ATOM   4136  O  "O4'" . DG  B 2  58  ? 17.618  -27.563 61.623 1.00 90.97  ? -15 DG  J "O4'" 1 
ATOM   4137  C  "C3'" . DG  B 2  58  ? 16.962  -25.338 62.151 1.00 90.60  ? -15 DG  J "C3'" 1 
ATOM   4138  O  "O3'" . DG  B 2  58  ? 15.733  -25.294 62.881 1.00 87.15  ? -15 DG  J "O3'" 1 
ATOM   4139  C  "C2'" . DG  B 2  58  ? 17.851  -25.928 63.222 1.00 93.68  ? -15 DG  J "C2'" 1 
ATOM   4140  C  "C1'" . DG  B 2  58  ? 17.512  -27.386 63.025 1.00 94.45  ? -15 DG  J "C1'" 1 
ATOM   4141  N  N9    . DG  B 2  58  ? 18.404  -28.321 63.708 1.00 105.90 ? -15 DG  J N9    1 
ATOM   4142  C  C8    . DG  B 2  58  ? 19.511  -27.974 64.443 1.00 120.50 ? -15 DG  J C8    1 
ATOM   4143  N  N7    . DG  B 2  58  ? 20.084  -28.995 65.020 1.00 124.93 ? -15 DG  J N7    1 
ATOM   4144  C  C5    . DG  B 2  58  ? 19.297  -30.081 64.662 1.00 118.38 ? -15 DG  J C5    1 
ATOM   4145  C  C6    . DG  B 2  58  ? 19.426  -31.459 64.989 1.00 106.53 ? -15 DG  J C6    1 
ATOM   4146  O  O6    . DG  B 2  58  ? 20.293  -32.012 65.673 1.00 107.37 ? -15 DG  J O6    1 
ATOM   4147  N  N1    . DG  B 2  58  ? 18.412  -32.217 64.419 1.00 102.28 ? -15 DG  J N1    1 
ATOM   4148  C  C2    . DG  B 2  58  ? 17.401  -31.720 63.639 1.00 113.26 ? -15 DG  J C2    1 
ATOM   4149  N  N2    . DG  B 2  58  ? 16.512  -32.618 63.189 1.00 118.53 ? -15 DG  J N2    1 
ATOM   4150  N  N3    . DG  B 2  58  ? 17.263  -30.438 63.330 1.00 124.34 ? -15 DG  J N3    1 
ATOM   4151  C  C4    . DG  B 2  58  ? 18.241  -29.680 63.872 1.00 114.54 ? -15 DG  J C4    1 
ATOM   4152  P  P     . DG  B 2  59  ? 14.325  -25.222 62.156 1.00 92.78  ? -14 DG  J P     1 
ATOM   4153  O  OP1   . DG  B 2  59  ? 14.473  -24.489 60.863 1.00 89.13  ? -14 DG  J OP1   1 
ATOM   4154  O  OP2   . DG  B 2  59  ? 13.328  -24.809 63.162 1.00 87.08  ? -14 DG  J OP2   1 
ATOM   4155  O  "O5'" . DG  B 2  59  ? 14.030  -26.745 61.824 1.00 93.99  ? -14 DG  J "O5'" 1 
ATOM   4156  C  "C5'" . DG  B 2  59  ? 12.732  -27.145 61.403 1.00 82.60  ? -14 DG  J "C5'" 1 
ATOM   4157  C  "C4'" . DG  B 2  59  ? 12.454  -28.534 61.919 1.00 80.90  ? -14 DG  J "C4'" 1 
ATOM   4158  O  "O4'" . DG  B 2  59  ? 13.598  -29.082 62.627 1.00 69.95  ? -14 DG  J "O4'" 1 
ATOM   4159  C  "C3'" . DG  B 2  59  ? 11.278  -28.614 62.891 1.00 76.00  ? -14 DG  J "C3'" 1 
ATOM   4160  O  "O3'" . DG  B 2  59  ? 10.548  -29.766 62.508 1.00 67.67  ? -14 DG  J "O3'" 1 
ATOM   4161  C  "C2'" . DG  B 2  59  ? 11.936  -28.858 64.231 1.00 75.67  ? -14 DG  J "C2'" 1 
ATOM   4162  C  "C1'" . DG  B 2  59  ? 13.131  -29.691 63.817 1.00 72.64  ? -14 DG  J "C1'" 1 
ATOM   4163  N  N9    . DG  B 2  59  ? 14.219  -29.700 64.790 1.00 76.59  ? -14 DG  J N9    1 
ATOM   4164  C  C8    . DG  B 2  59  ? 14.886  -28.617 65.307 1.00 76.46  ? -14 DG  J C8    1 
ATOM   4165  N  N7    . DG  B 2  59  ? 15.793  -28.947 66.185 1.00 85.27  ? -14 DG  J N7    1 
ATOM   4166  C  C5    . DG  B 2  59  ? 15.700  -30.329 66.271 1.00 86.44  ? -14 DG  J C5    1 
ATOM   4167  C  C6    . DG  B 2  59  ? 16.440  -31.257 67.054 1.00 90.70  ? -14 DG  J C6    1 
ATOM   4168  O  O6    . DG  B 2  59  ? 17.347  -31.035 67.867 1.00 93.26  ? -14 DG  J O6    1 
ATOM   4169  N  N1    . DG  B 2  59  ? 16.014  -32.562 66.834 1.00 92.67  ? -14 DG  J N1    1 
ATOM   4170  C  C2    . DG  B 2  59  ? 15.018  -32.931 65.965 1.00 92.46  ? -14 DG  J C2    1 
ATOM   4171  N  N2    . DG  B 2  59  ? 14.756  -34.242 65.883 1.00 94.19  ? -14 DG  J N2    1 
ATOM   4172  N  N3    . DG  B 2  59  ? 14.331  -32.080 65.225 1.00 87.79  ? -14 DG  J N3    1 
ATOM   4173  C  C4    . DG  B 2  59  ? 14.720  -30.806 65.429 1.00 78.07  ? -14 DG  J C4    1 
ATOM   4174  P  P     . DC  B 2  60  ? 9.110   -29.984 63.024 1.00 64.10  ? -13 DC  J P     1 
ATOM   4175  O  OP1   . DC  B 2  60  ? 8.226   -29.989 61.825 1.00 57.92  ? -13 DC  J OP1   1 
ATOM   4176  O  OP2   . DC  B 2  60  ? 8.886   -29.050 64.169 1.00 56.41  ? -13 DC  J OP2   1 
ATOM   4177  O  "O5'" . DC  B 2  60  ? 9.193   -31.453 63.615 1.00 63.32  ? -13 DC  J "O5'" 1 
ATOM   4178  C  "C5'" . DC  B 2  60  ? 9.728   -32.523 62.806 1.00 69.80  ? -13 DC  J "C5'" 1 
ATOM   4179  C  "C4'" . DC  B 2  60  ? 9.901   -33.768 63.640 1.00 65.27  ? -13 DC  J "C4'" 1 
ATOM   4180  O  "O4'" . DC  B 2  60  ? 11.040  -33.578 64.508 1.00 71.01  ? -13 DC  J "O4'" 1 
ATOM   4181  C  "C3'" . DC  B 2  60  ? 8.706   -34.080 64.547 1.00 65.25  ? -13 DC  J "C3'" 1 
ATOM   4182  O  "O3'" . DC  B 2  60  ? 8.300   -35.413 64.290 1.00 56.35  ? -13 DC  J "O3'" 1 
ATOM   4183  C  "C2'" . DC  B 2  60  ? 9.207   -33.812 65.955 1.00 66.54  ? -13 DC  J "C2'" 1 
ATOM   4184  C  "C1'" . DC  B 2  60  ? 10.717  -33.946 65.834 1.00 73.32  ? -13 DC  J "C1'" 1 
ATOM   4185  N  N1    . DC  B 2  60  ? 11.466  -33.059 66.738 1.00 74.02  ? -13 DC  J N1    1 
ATOM   4186  C  C2    . DC  B 2  60  ? 12.143  -33.610 67.831 1.00 73.82  ? -13 DC  J C2    1 
ATOM   4187  O  O2    . DC  B 2  60  ? 12.114  -34.836 67.999 1.00 71.40  ? -13 DC  J O2    1 
ATOM   4188  N  N3    . DC  B 2  60  ? 12.805  -32.793 68.679 1.00 79.41  ? -13 DC  J N3    1 
ATOM   4189  C  C4    . DC  B 2  60  ? 12.817  -31.477 68.462 1.00 79.62  ? -13 DC  J C4    1 
ATOM   4190  N  N4    . DC  B 2  60  ? 13.488  -30.709 69.323 1.00 76.30  ? -13 DC  J N4    1 
ATOM   4191  C  C5    . DC  B 2  60  ? 12.132  -30.889 67.360 1.00 80.72  ? -13 DC  J C5    1 
ATOM   4192  C  C6    . DC  B 2  60  ? 11.464  -31.708 66.538 1.00 72.77  ? -13 DC  J C6    1 
ATOM   4193  P  P     . DA  B 2  61  ? 7.099   -36.074 65.097 1.00 59.78  ? -12 DA  J P     1 
ATOM   4194  O  OP1   . DA  B 2  61  ? 6.411   -37.021 64.186 1.00 58.86  ? -12 DA  J OP1   1 
ATOM   4195  O  OP2   . DA  B 2  61  ? 6.354   -35.048 65.878 1.00 50.65  ? -12 DA  J OP2   1 
ATOM   4196  O  "O5'" . DA  B 2  61  ? 7.872   -36.864 66.235 1.00 66.75  ? -12 DA  J "O5'" 1 
ATOM   4197  C  "C5'" . DA  B 2  61  ? 8.734   -37.974 65.948 1.00 60.06  ? -12 DA  J "C5'" 1 
ATOM   4198  C  "C4'" . DA  B 2  61  ? 9.132   -38.605 67.262 1.00 63.75  ? -12 DA  J "C4'" 1 
ATOM   4199  O  "O4'" . DA  B 2  61  ? 9.919   -37.657 68.030 1.00 61.67  ? -12 DA  J "O4'" 1 
ATOM   4200  C  "C3'" . DA  B 2  61  ? 7.947   -39.009 68.144 1.00 57.10  ? -12 DA  J "C3'" 1 
ATOM   4201  O  "O3'" . DA  B 2  61  ? 8.099   -40.366 68.573 1.00 54.11  ? -12 DA  J "O3'" 1 
ATOM   4202  C  "C2'" . DA  B 2  61  ? 7.937   -37.965 69.254 1.00 62.06  ? -12 DA  J "C2'" 1 
ATOM   4203  C  "C1'" . DA  B 2  61  ? 9.378   -37.480 69.324 1.00 62.57  ? -12 DA  J "C1'" 1 
ATOM   4204  N  N9    . DA  B 2  61  ? 9.591   -36.083 69.691 1.00 66.59  ? -12 DA  J N9    1 
ATOM   4205  C  C8    . DA  B 2  61  ? 8.929   -34.968 69.243 1.00 74.92  ? -12 DA  J C8    1 
ATOM   4206  N  N7    . DA  B 2  61  ? 9.399   -33.844 69.730 1.00 77.92  ? -12 DA  J N7    1 
ATOM   4207  C  C5    . DA  B 2  61  ? 10.455  -34.246 70.535 1.00 75.58  ? -12 DA  J C5    1 
ATOM   4208  C  C6    . DA  B 2  61  ? 11.365  -33.531 71.327 1.00 74.90  ? -12 DA  J C6    1 
ATOM   4209  N  N6    . DA  B 2  61  ? 11.357  -32.206 71.450 1.00 80.80  ? -12 DA  J N6    1 
ATOM   4210  N  N1    . DA  B 2  61  ? 12.301  -34.234 71.997 1.00 82.63  ? -12 DA  J N1    1 
ATOM   4211  C  C2    . DA  B 2  61  ? 12.311  -35.566 71.876 1.00 84.73  ? -12 DA  J C2    1 
ATOM   4212  N  N3    . DA  B 2  61  ? 11.501  -36.353 71.176 1.00 77.15  ? -12 DA  J N3    1 
ATOM   4213  C  C4    . DA  B 2  61  ? 10.589  -35.622 70.514 1.00 77.61  ? -12 DA  J C4    1 
ATOM   4214  P  P     . DT  B 2  62  ? 6.906   -41.125 69.349 1.00 64.89  ? -11 DT  J P     1 
ATOM   4215  O  OP1   . DT  B 2  62  ? 6.786   -42.492 68.764 1.00 69.27  ? -11 DT  J OP1   1 
ATOM   4216  O  OP2   . DT  B 2  62  ? 5.703   -40.253 69.341 1.00 66.77  ? -11 DT  J OP2   1 
ATOM   4217  O  "O5'" . DT  B 2  62  ? 7.439   -41.164 70.853 1.00 59.58  ? -11 DT  J "O5'" 1 
ATOM   4218  C  "C5'" . DT  B 2  62  ? 8.841   -40.963 71.134 1.00 68.00  ? -11 DT  J "C5'" 1 
ATOM   4219  C  "C4'" . DT  B 2  62  ? 9.082   -40.670 72.599 1.00 73.60  ? -11 DT  J "C4'" 1 
ATOM   4220  O  "O4'" . DT  B 2  62  ? 9.449   -39.282 72.757 1.00 78.39  ? -11 DT  J "O4'" 1 
ATOM   4221  C  "C3'" . DT  B 2  62  ? 7.903   -40.924 73.544 1.00 77.72  ? -11 DT  J "C3'" 1 
ATOM   4222  O  "O3'" . DT  B 2  62  ? 8.272   -41.858 74.566 1.00 82.50  ? -11 DT  J "O3'" 1 
ATOM   4223  C  "C2'" . DT  B 2  62  ? 7.572   -39.554 74.114 1.00 81.23  ? -11 DT  J "C2'" 1 
ATOM   4224  C  "C1'" . DT  B 2  62  ? 8.845   -38.757 73.924 1.00 80.12  ? -11 DT  J "C1'" 1 
ATOM   4225  N  N1    . DT  B 2  62  ? 8.632   -37.313 73.708 1.00 89.85  ? -11 DT  J N1    1 
ATOM   4226  C  C2    . DT  B 2  62  ? 9.340   -36.419 74.476 1.00 88.09  ? -11 DT  J C2    1 
ATOM   4227  O  O2    . DT  B 2  62  ? 10.113  -36.761 75.352 1.00 93.26  ? -11 DT  J O2    1 
ATOM   4228  N  N3    . DT  B 2  62  ? 9.093   -35.101 74.193 1.00 96.97  ? -11 DT  J N3    1 
ATOM   4229  C  C4    . DT  B 2  62  ? 8.238   -34.600 73.231 1.00 88.22  ? -11 DT  J C4    1 
ATOM   4230  O  O4    . DT  B 2  62  ? 8.121   -33.389 73.090 1.00 86.80  ? -11 DT  J O4    1 
ATOM   4231  C  C5    . DT  B 2  62  ? 7.532   -35.593 72.457 1.00 84.01  ? -11 DT  J C5    1 
ATOM   4232  C  C7    . DT  B 2  62  ? 6.580   -35.145 71.394 1.00 78.96  ? -11 DT  J C7    1 
ATOM   4233  C  C6    . DT  B 2  62  ? 7.766   -36.882 72.726 1.00 92.70  ? -11 DT  J C6    1 
ATOM   4234  P  P     . DG  B 2  63  ? 7.231   -42.271 75.737 1.00 87.02  ? -10 DG  J P     1 
ATOM   4235  O  OP1   . DG  B 2  63  ? 7.503   -43.687 76.101 1.00 91.64  ? -10 DG  J OP1   1 
ATOM   4236  O  OP2   . DG  B 2  63  ? 5.864   -41.883 75.294 1.00 75.47  ? -10 DG  J OP2   1 
ATOM   4237  O  "O5'" . DG  B 2  63  ? 7.715   -41.409 76.993 1.00 73.96  ? -10 DG  J "O5'" 1 
ATOM   4238  C  "C5'" . DG  B 2  63  ? 9.121   -41.327 77.313 1.00 80.64  ? -10 DG  J "C5'" 1 
ATOM   4239  C  "C4'" . DG  B 2  63  ? 9.354   -40.573 78.602 1.00 88.85  ? -10 DG  J "C4'" 1 
ATOM   4240  O  "O4'" . DG  B 2  63  ? 9.355   -39.140 78.375 1.00 95.84  ? -10 DG  J "O4'" 1 
ATOM   4241  C  "C3'" . DG  B 2  63  ? 8.316   -40.801 79.695 1.00 89.72  ? -10 DG  J "C3'" 1 
ATOM   4242  O  "O3'" . DG  B 2  63  ? 9.042   -40.655 80.920 1.00 92.92  ? -10 DG  J "O3'" 1 
ATOM   4243  C  "C2'" . DG  B 2  63  ? 7.320   -39.683 79.440 1.00 89.23  ? -10 DG  J "C2'" 1 
ATOM   4244  C  "C1'" . DG  B 2  63  ? 8.232   -38.535 79.019 1.00 86.97  ? -10 DG  J "C1'" 1 
ATOM   4245  N  N9    . DG  B 2  63  ? 7.650   -37.574 78.086 1.00 81.63  ? -10 DG  J N9    1 
ATOM   4246  C  C8    . DG  B 2  63  ? 6.796   -37.845 77.044 1.00 79.81  ? -10 DG  J C8    1 
ATOM   4247  N  N7    . DG  B 2  63  ? 6.474   -36.784 76.358 1.00 81.23  ? -10 DG  J N7    1 
ATOM   4248  C  C5    . DG  B 2  63  ? 7.154   -35.750 76.984 1.00 78.60  ? -10 DG  J C5    1 
ATOM   4249  C  C6    . DG  B 2  63  ? 7.189   -34.365 76.690 1.00 82.85  ? -10 DG  J C6    1 
ATOM   4250  O  O6    . DG  B 2  63  ? 6.607   -33.754 75.790 1.00 77.23  ? -10 DG  J O6    1 
ATOM   4251  N  N1    . DG  B 2  63  ? 8.014   -33.677 77.570 1.00 93.24  ? -10 DG  J N1    1 
ATOM   4252  C  C2    . DG  B 2  63  ? 8.713   -34.246 78.605 1.00 88.59  ? -10 DG  J C2    1 
ATOM   4253  N  N2    . DG  B 2  63  ? 9.455   -33.416 79.342 1.00 89.86  ? -10 DG  J N2    1 
ATOM   4254  N  N3    . DG  B 2  63  ? 8.686   -35.536 78.893 1.00 88.53  ? -10 DG  J N3    1 
ATOM   4255  C  C4    . DG  B 2  63  ? 7.891   -36.223 78.047 1.00 82.72  ? -10 DG  J C4    1 
ATOM   4256  P  P     . DT  B 2  64  ? 8.329   -40.803 82.353 1.00 94.88  ? -9  DT  J P     1 
ATOM   4257  O  OP1   . DT  B 2  64  ? 9.268   -41.552 83.224 1.00 99.26  ? -9  DT  J OP1   1 
ATOM   4258  O  OP2   . DT  B 2  64  ? 6.924   -41.300 82.156 1.00 70.61  ? -9  DT  J OP2   1 
ATOM   4259  O  "O5'" . DT  B 2  64  ? 8.355   -39.311 82.909 1.00 85.61  ? -9  DT  J "O5'" 1 
ATOM   4260  C  "C5'" . DT  B 2  64  ? 9.562   -38.524 82.854 1.00 87.02  ? -9  DT  J "C5'" 1 
ATOM   4261  C  "C4'" . DT  B 2  64  ? 9.290   -37.139 83.393 1.00 90.99  ? -9  DT  J "C4'" 1 
ATOM   4262  O  "O4'" . DT  B 2  64  ? 8.698   -36.305 82.367 1.00 100.35 ? -9  DT  J "O4'" 1 
ATOM   4263  C  "C3'" . DT  B 2  64  ? 8.310   -37.098 84.566 1.00 91.39  ? -9  DT  J "C3'" 1 
ATOM   4264  O  "O3'" . DT  B 2  64  ? 8.678   -36.064 85.472 1.00 91.93  ? -9  DT  J "O3'" 1 
ATOM   4265  C  "C2'" . DT  B 2  64  ? 7.002   -36.682 83.924 1.00 96.78  ? -9  DT  J "C2'" 1 
ATOM   4266  C  "C1'" . DT  B 2  64  ? 7.511   -35.711 82.879 1.00 96.30  ? -9  DT  J "C1'" 1 
ATOM   4267  N  N1    . DT  B 2  64  ? 6.596   -35.464 81.747 1.00 90.11  ? -9  DT  J N1    1 
ATOM   4268  C  C2    . DT  B 2  64  ? 6.393   -34.164 81.341 1.00 82.07  ? -9  DT  J C2    1 
ATOM   4269  O  O2    . DT  B 2  64  ? 6.923   -33.208 81.878 1.00 80.25  ? -9  DT  J O2    1 
ATOM   4270  N  N3    . DT  B 2  64  ? 5.529   -34.024 80.287 1.00 81.66  ? -9  DT  J N3    1 
ATOM   4271  C  C4    . DT  B 2  64  ? 4.865   -35.029 79.612 1.00 81.83  ? -9  DT  J C4    1 
ATOM   4272  O  O4    . DT  B 2  64  ? 4.119   -34.749 78.680 1.00 91.14  ? -9  DT  J O4    1 
ATOM   4273  C  C5    . DT  B 2  64  ? 5.122   -36.366 80.090 1.00 78.14  ? -9  DT  J C5    1 
ATOM   4274  C  C7    . DT  B 2  64  ? 4.433   -37.519 79.429 1.00 71.39  ? -9  DT  J C7    1 
ATOM   4275  C  C6    . DT  B 2  64  ? 5.968   -36.516 81.116 1.00 82.23  ? -9  DT  J C6    1 
ATOM   4276  P  P     . DT  B 2  65  ? 8.155   -36.121 86.968 1.00 94.64  ? -8  DT  J P     1 
ATOM   4277  O  OP1   . DT  B 2  65  ? 9.342   -36.108 87.858 1.00 89.22  ? -8  DT  J OP1   1 
ATOM   4278  O  OP2   . DT  B 2  65  ? 7.105   -37.175 87.061 1.00 82.53  ? -8  DT  J OP2   1 
ATOM   4279  O  "O5'" . DT  B 2  65  ? 7.377   -34.754 87.150 1.00 80.60  ? -8  DT  J "O5'" 1 
ATOM   4280  C  "C5'" . DT  B 2  65  ? 8.048   -33.519 86.942 1.00 87.39  ? -8  DT  J "C5'" 1 
ATOM   4281  C  "C4'" . DT  B 2  65  ? 6.996   -32.485 86.639 1.00 89.58  ? -8  DT  J "C4'" 1 
ATOM   4282  O  "O4'" . DT  B 2  65  ? 6.348   -32.818 85.391 1.00 97.39  ? -8  DT  J "O4'" 1 
ATOM   4283  C  "C3'" . DT  B 2  65  ? 5.881   -32.426 87.686 1.00 82.44  ? -8  DT  J "C3'" 1 
ATOM   4284  O  "O3'" . DT  B 2  65  ? 5.896   -31.137 88.298 1.00 75.81  ? -8  DT  J "O3'" 1 
ATOM   4285  C  "C2'" . DT  B 2  65  ? 4.607   -32.724 86.902 1.00 85.41  ? -8  DT  J "C2'" 1 
ATOM   4286  C  "C1'" . DT  B 2  65  ? 5.023   -32.352 85.494 1.00 89.32  ? -8  DT  J "C1'" 1 
ATOM   4287  N  N1    . DT  B 2  65  ? 4.258   -32.923 84.377 1.00 84.85  ? -8  DT  J N1    1 
ATOM   4288  C  C2    . DT  B 2  65  ? 3.860   -32.073 83.370 1.00 84.30  ? -8  DT  J C2    1 
ATOM   4289  O  O2    . DT  B 2  65  ? 4.072   -30.872 83.388 1.00 81.56  ? -8  DT  J O2    1 
ATOM   4290  N  N3    . DT  B 2  65  ? 3.178   -32.679 82.347 1.00 87.70  ? -8  DT  J N3    1 
ATOM   4291  C  C4    . DT  B 2  65  ? 2.885   -34.022 82.221 1.00 83.96  ? -8  DT  J C4    1 
ATOM   4292  O  O4    . DT  B 2  65  ? 2.264   -34.423 81.242 1.00 80.84  ? -8  DT  J O4    1 
ATOM   4293  C  C5    . DT  B 2  65  ? 3.352   -34.858 83.301 1.00 83.31  ? -8  DT  J C5    1 
ATOM   4294  C  C7    . DT  B 2  65  ? 3.073   -36.326 83.253 1.00 87.05  ? -8  DT  J C7    1 
ATOM   4295  C  C6    . DT  B 2  65  ? 4.017   -34.276 84.307 1.00 84.21  ? -8  DT  J C6    1 
ATOM   4296  P  P     . DC  B 2  66  ? 5.036   -30.911 89.605 1.00 87.69  ? -7  DC  J P     1 
ATOM   4297  O  OP1   . DC  B 2  66  ? 5.818   -30.076 90.548 1.00 94.50  ? -7  DC  J OP1   1 
ATOM   4298  O  OP2   . DC  B 2  66  ? 4.494   -32.229 90.018 1.00 80.26  ? -7  DC  J OP2   1 
ATOM   4299  O  "O5'" . DC  B 2  66  ? 3.783   -30.066 89.094 1.00 103.92 ? -7  DC  J "O5'" 1 
ATOM   4300  C  "C5'" . DC  B 2  66  ? 3.898   -28.709 88.612 1.00 96.38  ? -7  DC  J "C5'" 1 
ATOM   4301  C  "C4'" . DC  B 2  66  ? 2.597   -28.278 87.975 1.00 86.32  ? -7  DC  J "C4'" 1 
ATOM   4302  O  "O4'" . DC  B 2  66  ? 2.260   -29.192 86.907 1.00 87.06  ? -7  DC  J "O4'" 1 
ATOM   4303  C  "C3'" . DC  B 2  66  ? 1.381   -28.277 88.905 1.00 85.18  ? -7  DC  J "C3'" 1 
ATOM   4304  O  "O3'" . DC  B 2  66  ? 0.568   -27.158 88.583 1.00 83.18  ? -7  DC  J "O3'" 1 
ATOM   4305  C  "C2'" . DC  B 2  66  ? 0.640   -29.547 88.529 1.00 83.15  ? -7  DC  J "C2'" 1 
ATOM   4306  C  "C1'" . DC  B 2  66  ? 0.900   -29.560 87.040 1.00 84.12  ? -7  DC  J "C1'" 1 
ATOM   4307  N  N1    . DC  B 2  66  ? 0.709   -30.823 86.317 1.00 91.74  ? -7  DC  J N1    1 
ATOM   4308  C  C2    . DC  B 2  66  ? 0.441   -30.761 84.945 1.00 88.67  ? -7  DC  J C2    1 
ATOM   4309  O  O2    . DC  B 2  66  ? 0.340   -29.651 84.404 1.00 89.30  ? -7  DC  J O2    1 
ATOM   4310  N  N3    . DC  B 2  66  ? 0.284   -31.908 84.250 1.00 87.05  ? -7  DC  J N3    1 
ATOM   4311  C  C4    . DC  B 2  66  ? 0.395   -33.084 84.871 1.00 91.40  ? -7  DC  J C4    1 
ATOM   4312  N  N4    . DC  B 2  66  ? 0.231   -34.190 84.145 1.00 92.58  ? -7  DC  J N4    1 
ATOM   4313  C  C5    . DC  B 2  66  ? 0.686   -33.176 86.264 1.00 90.28  ? -7  DC  J C5    1 
ATOM   4314  C  C6    . DC  B 2  66  ? 0.838   -32.032 86.941 1.00 90.45  ? -7  DC  J C6    1 
ATOM   4315  P  P     . DA  B 2  67  ? 0.912   -25.762 89.207 1.00 79.62  ? -6  DA  J P     1 
ATOM   4316  O  OP1   . DA  B 2  67  ? 2.393   -25.640 89.215 1.00 76.64  ? -6  DA  J OP1   1 
ATOM   4317  O  OP2   . DA  B 2  67  ? 0.102   -25.621 90.436 1.00 84.10  ? -6  DA  J OP2   1 
ATOM   4318  O  "O5'" . DA  B 2  67  ? 0.292   -24.708 88.190 1.00 86.38  ? -6  DA  J "O5'" 1 
ATOM   4319  C  "C5'" . DA  B 2  67  ? 0.998   -24.311 86.995 1.00 81.44  ? -6  DA  J "C5'" 1 
ATOM   4320  C  "C4'" . DA  B 2  67  ? 0.014   -24.016 85.885 1.00 76.77  ? -6  DA  J "C4'" 1 
ATOM   4321  O  "O4'" . DA  B 2  67  ? -0.536  -25.255 85.384 1.00 74.94  ? -6  DA  J "O4'" 1 
ATOM   4322  C  "C3'" . DA  B 2  67  ? -1.189  -23.158 86.282 1.00 69.08  ? -6  DA  J "C3'" 1 
ATOM   4323  O  "O3'" . DA  B 2  67  ? -1.425  -22.229 85.208 1.00 60.18  ? -6  DA  J "O3'" 1 
ATOM   4324  C  "C2'" . DA  B 2  67  ? -2.259  -24.192 86.605 1.00 62.95  ? -6  DA  J "C2'" 1 
ATOM   4325  C  "C1'" . DA  B 2  67  ? -1.937  -25.310 85.625 1.00 73.33  ? -6  DA  J "C1'" 1 
ATOM   4326  N  N9    . DA  B 2  67  ? -2.251  -26.681 86.017 1.00 79.74  ? -6  DA  J N9    1 
ATOM   4327  C  C8    . DA  B 2  67  ? -2.110  -27.293 87.235 1.00 86.72  ? -6  DA  J C8    1 
ATOM   4328  N  N7    . DA  B 2  67  ? -2.423  -28.567 87.225 1.00 90.74  ? -6  DA  J N7    1 
ATOM   4329  C  C5    . DA  B 2  67  ? -2.763  -28.815 85.904 1.00 84.08  ? -6  DA  J C5    1 
ATOM   4330  C  C6    . DA  B 2  67  ? -3.186  -29.977 85.237 1.00 82.77  ? -6  DA  J C6    1 
ATOM   4331  N  N6    . DA  B 2  67  ? -3.343  -31.158 85.835 1.00 80.91  ? -6  DA  J N6    1 
ATOM   4332  N  N1    . DA  B 2  67  ? -3.459  -29.881 83.918 1.00 81.70  ? -6  DA  J N1    1 
ATOM   4333  C  C2    . DA  B 2  67  ? -3.302  -28.698 83.316 1.00 80.40  ? -6  DA  J C2    1 
ATOM   4334  N  N3    . DA  B 2  67  ? -2.903  -27.538 83.832 1.00 88.70  ? -6  DA  J N3    1 
ATOM   4335  C  C4    . DA  B 2  67  ? -2.643  -27.667 85.145 1.00 87.86  ? -6  DA  J C4    1 
ATOM   4336  P  P     . DG  B 2  68  ? -2.589  -21.116 85.308 1.00 69.43  ? -5  DG  J P     1 
ATOM   4337  O  OP1   . DG  B 2  68  ? -2.185  -19.924 84.507 1.00 53.17  ? -5  DG  J OP1   1 
ATOM   4338  O  OP2   . DG  B 2  68  ? -2.994  -20.968 86.725 1.00 70.53  ? -5  DG  J OP2   1 
ATOM   4339  O  "O5'" . DG  B 2  68  ? -3.847  -21.844 84.658 1.00 71.42  ? -5  DG  J "O5'" 1 
ATOM   4340  C  "C5'" . DG  B 2  68  ? -3.798  -22.418 83.338 1.00 75.97  ? -5  DG  J "C5'" 1 
ATOM   4341  C  "C4'" . DG  B 2  68  ? -5.088  -23.151 83.071 1.00 71.57  ? -5  DG  J "C4'" 1 
ATOM   4342  O  "O4'" . DG  B 2  68  ? -5.055  -24.407 83.785 1.00 72.97  ? -5  DG  J "O4'" 1 
ATOM   4343  C  "C3'" . DG  B 2  68  ? -6.336  -22.425 83.580 1.00 73.95  ? -5  DG  J "C3'" 1 
ATOM   4344  O  "O3'" . DG  B 2  68  ? -7.425  -22.689 82.701 1.00 74.78  ? -5  DG  J "O3'" 1 
ATOM   4345  C  "C2'" . DG  B 2  68  ? -6.619  -23.106 84.904 1.00 72.11  ? -5  DG  J "C2'" 1 
ATOM   4346  C  "C1'" . DG  B 2  68  ? -6.259  -24.519 84.518 1.00 76.28  ? -5  DG  J "C1'" 1 
ATOM   4347  N  N9    . DG  B 2  68  ? -6.046  -25.479 85.590 1.00 83.66  ? -5  DG  J N9    1 
ATOM   4348  C  C8    . DG  B 2  68  ? -5.610  -25.250 86.873 1.00 85.95  ? -5  DG  J C8    1 
ATOM   4349  N  N7    . DG  B 2  68  ? -5.517  -26.341 87.582 1.00 87.24  ? -5  DG  J N7    1 
ATOM   4350  C  C5    . DG  B 2  68  ? -5.911  -27.349 86.712 1.00 101.46 ? -5  DG  J C5    1 
ATOM   4351  C  C6    . DG  B 2  68  ? -6.013  -28.749 86.911 1.00 105.82 ? -5  DG  J C6    1 
ATOM   4352  O  O6    . DG  B 2  68  ? -5.770  -29.402 87.931 1.00 111.56 ? -5  DG  J O6    1 
ATOM   4353  N  N1    . DG  B 2  68  ? -6.452  -29.398 85.762 1.00 106.78 ? -5  DG  J N1    1 
ATOM   4354  C  C2    . DG  B 2  68  ? -6.749  -28.782 84.572 1.00 99.16  ? -5  DG  J C2    1 
ATOM   4355  N  N2    . DG  B 2  68  ? -7.159  -29.580 83.576 1.00 106.72 ? -5  DG  J N2    1 
ATOM   4356  N  N3    . DG  B 2  68  ? -6.663  -27.480 84.376 1.00 92.87  ? -5  DG  J N3    1 
ATOM   4357  C  C4    . DG  B 2  68  ? -6.237  -26.830 85.479 1.00 91.60  ? -5  DG  J C4    1 
ATOM   4358  P  P     . DC  B 2  69  ? -7.788  -21.648 81.559 1.00 76.10  ? -4  DC  J P     1 
ATOM   4359  O  OP1   . DC  B 2  69  ? -6.513  -21.168 80.954 1.00 59.51  ? -4  DC  J OP1   1 
ATOM   4360  O  OP2   . DC  B 2  69  ? -8.784  -20.698 82.112 1.00 65.02  ? -4  DC  J OP2   1 
ATOM   4361  O  "O5'" . DC  B 2  69  ? -8.538  -22.562 80.498 1.00 65.45  ? -4  DC  J "O5'" 1 
ATOM   4362  C  "C5'" . DC  B 2  69  ? -7.843  -23.638 79.864 1.00 63.11  ? -4  DC  J "C5'" 1 
ATOM   4363  C  "C4'" . DC  B 2  69  ? -8.758  -24.830 79.724 1.00 65.27  ? -4  DC  J "C4'" 1 
ATOM   4364  O  "O4'" . DC  B 2  69  ? -8.688  -25.648 80.915 1.00 60.54  ? -4  DC  J "O4'" 1 
ATOM   4365  C  "C3'" . DC  B 2  69  ? -10.236 -24.498 79.498 1.00 60.70  ? -4  DC  J "C3'" 1 
ATOM   4366  O  "O3'" . DC  B 2  69  ? -10.655 -25.162 78.300 1.00 50.84  ? -4  DC  J "O3'" 1 
ATOM   4367  C  "C2'" . DC  B 2  69  ? -10.919 -24.923 80.792 1.00 65.62  ? -4  DC  J "C2'" 1 
ATOM   4368  C  "C1'" . DC  B 2  69  ? -9.987  -25.983 81.367 1.00 70.42  ? -4  DC  J "C1'" 1 
ATOM   4369  N  N1    . DC  B 2  69  ? -9.914  -26.084 82.833 1.00 74.75  ? -4  DC  J N1    1 
ATOM   4370  C  C2    . DC  B 2  69  ? -9.944  -27.349 83.422 1.00 76.64  ? -4  DC  J C2    1 
ATOM   4371  O  O2    . DC  B 2  69  ? -10.153 -28.338 82.707 1.00 80.98  ? -4  DC  J O2    1 
ATOM   4372  N  N3    . DC  B 2  69  ? -9.785  -27.458 84.759 1.00 81.69  ? -4  DC  J N3    1 
ATOM   4373  C  C4    . DC  B 2  69  ? -9.571  -26.367 85.496 1.00 78.45  ? -4  DC  J C4    1 
ATOM   4374  N  N4    . DC  B 2  69  ? -9.432  -26.521 86.812 1.00 89.92  ? -4  DC  J N4    1 
ATOM   4375  C  C5    . DC  B 2  69  ? -9.501  -25.071 84.917 1.00 71.76  ? -4  DC  J C5    1 
ATOM   4376  C  C6    . DC  B 2  69  ? -9.661  -24.977 83.592 1.00 74.17  ? -4  DC  J C6    1 
ATOM   4377  P  P     . DT  B 2  70  ? -12.109 -24.932 77.735 1.00 54.21  ? -3  DT  J P     1 
ATOM   4378  O  OP1   . DT  B 2  70  ? -12.024 -24.860 76.258 1.00 55.98  ? -3  DT  J OP1   1 
ATOM   4379  O  OP2   . DT  B 2  70  ? -12.729 -23.812 78.490 1.00 51.40  ? -3  DT  J OP2   1 
ATOM   4380  O  "O5'" . DT  B 2  70  ? -12.803 -26.323 78.072 1.00 55.71  ? -3  DT  J "O5'" 1 
ATOM   4381  C  "C5'" . DT  B 2  70  ? -12.014 -27.520 78.006 1.00 54.98  ? -3  DT  J "C5'" 1 
ATOM   4382  C  "C4'" . DT  B 2  70  ? -12.798 -28.710 78.507 1.00 59.04  ? -3  DT  J "C4'" 1 
ATOM   4383  O  "O4'" . DT  B 2  70  ? -12.690 -28.852 79.946 1.00 60.71  ? -3  DT  J "O4'" 1 
ATOM   4384  C  "C3'" . DT  B 2  70  ? -14.291 -28.742 78.176 1.00 53.40  ? -3  DT  J "C3'" 1 
ATOM   4385  O  "O3'" . DT  B 2  70  ? -14.502 -30.107 77.862 1.00 53.86  ? -3  DT  J "O3'" 1 
ATOM   4386  C  "C2'" . DT  B 2  70  ? -14.962 -28.385 79.486 1.00 59.90  ? -3  DT  J "C2'" 1 
ATOM   4387  C  "C1'" . DT  B 2  70  ? -13.979 -28.889 80.540 1.00 64.10  ? -3  DT  J "C1'" 1 
ATOM   4388  N  N1    . DT  B 2  70  ? -13.908 -28.086 81.763 1.00 65.23  ? -3  DT  J N1    1 
ATOM   4389  C  C2    . DT  B 2  70  ? -13.726 -28.730 82.965 1.00 68.92  ? -3  DT  J C2    1 
ATOM   4390  O  O2    . DT  B 2  70  ? -13.698 -29.944 83.074 1.00 67.60  ? -3  DT  J O2    1 
ATOM   4391  N  N3    . DT  B 2  70  ? -13.606 -27.896 84.047 1.00 67.91  ? -3  DT  J N3    1 
ATOM   4392  C  C4    . DT  B 2  70  ? -13.608 -26.514 84.037 1.00 72.31  ? -3  DT  J C4    1 
ATOM   4393  O  O4    . DT  B 2  70  ? -13.482 -25.898 85.089 1.00 74.70  ? -3  DT  J O4    1 
ATOM   4394  C  C5    . DT  B 2  70  ? -13.775 -25.906 82.736 1.00 72.08  ? -3  DT  J C5    1 
ATOM   4395  C  C7    . DT  B 2  70  ? -13.774 -24.414 82.625 1.00 65.41  ? -3  DT  J C7    1 
ATOM   4396  C  C6    . DT  B 2  70  ? -13.909 -26.712 81.679 1.00 65.70  ? -3  DT  J C6    1 
ATOM   4397  P  P     . DG  B 2  71  ? -15.843 -30.642 77.267 1.00 57.30  ? -2  DG  J P     1 
ATOM   4398  O  OP1   . DG  B 2  71  ? -15.458 -31.810 76.420 1.00 54.05  ? -2  DG  J OP1   1 
ATOM   4399  O  OP2   . DG  B 2  71  ? -16.687 -29.499 76.776 1.00 51.60  ? -2  DG  J OP2   1 
ATOM   4400  O  "O5'" . DG  B 2  71  ? -16.626 -31.171 78.541 1.00 61.82  ? -2  DG  J "O5'" 1 
ATOM   4401  C  "C5'" . DG  B 2  71  ? -16.117 -32.252 79.347 1.00 66.12  ? -2  DG  J "C5'" 1 
ATOM   4402  C  "C4'" . DG  B 2  71  ? -16.980 -32.401 80.578 1.00 66.20  ? -2  DG  J "C4'" 1 
ATOM   4403  O  "O4'" . DG  B 2  71  ? -16.707 -31.321 81.507 1.00 65.24  ? -2  DG  J "O4'" 1 
ATOM   4404  C  "C3'" . DG  B 2  71  ? -18.480 -32.314 80.297 1.00 65.14  ? -2  DG  J "C3'" 1 
ATOM   4405  O  "O3'" . DG  B 2  71  ? -19.126 -33.092 81.296 1.00 74.91  ? -2  DG  J "O3'" 1 
ATOM   4406  C  "C2'" . DG  B 2  71  ? -18.781 -30.854 80.556 1.00 64.16  ? -2  DG  J "C2'" 1 
ATOM   4407  C  "C1'" . DG  B 2  71  ? -17.936 -30.676 81.789 1.00 67.01  ? -2  DG  J "C1'" 1 
ATOM   4408  N  N9    . DG  B 2  71  ? -17.651 -29.322 82.226 1.00 67.33  ? -2  DG  J N9    1 
ATOM   4409  C  C8    . DG  B 2  71  ? -17.709 -28.156 81.504 1.00 71.08  ? -2  DG  J C8    1 
ATOM   4410  N  N7    . DG  B 2  71  ? -17.408 -27.102 82.212 1.00 75.59  ? -2  DG  J N7    1 
ATOM   4411  C  C5    . DG  B 2  71  ? -17.177 -27.600 83.487 1.00 79.22  ? -2  DG  J C5    1 
ATOM   4412  C  C6    . DG  B 2  71  ? -16.826 -26.929 84.689 1.00 81.05  ? -2  DG  J C6    1 
ATOM   4413  O  O6    . DG  B 2  71  ? -16.638 -25.717 84.871 1.00 73.18  ? -2  DG  J O6    1 
ATOM   4414  N  N1    . DG  B 2  71  ? -16.690 -27.820 85.750 1.00 79.87  ? -2  DG  J N1    1 
ATOM   4415  C  C2    . DG  B 2  71  ? -16.869 -29.181 85.667 1.00 86.56  ? -2  DG  J C2    1 
ATOM   4416  N  N2    . DG  B 2  71  ? -16.695 -29.876 86.798 1.00 91.41  ? -2  DG  J N2    1 
ATOM   4417  N  N3    . DG  B 2  71  ? -17.185 -29.816 84.552 1.00 83.15  ? -2  DG  J N3    1 
ATOM   4418  C  C4    . DG  B 2  71  ? -17.328 -28.968 83.511 1.00 78.55  ? -2  DG  J C4    1 
ATOM   4419  P  P     . DA  B 2  72  ? -20.501 -33.837 80.993 1.00 77.92  ? -1  DA  J P     1 
ATOM   4420  O  OP1   . DA  B 2  72  ? -20.197 -35.028 80.143 1.00 69.53  ? -1  DA  J OP1   1 
ATOM   4421  O  OP2   . DA  B 2  72  ? -21.500 -32.825 80.606 1.00 52.49  ? -1  DA  J OP2   1 
ATOM   4422  O  "O5'" . DA  B 2  72  ? -20.876 -34.430 82.416 1.00 82.08  ? -1  DA  J "O5'" 1 
ATOM   4423  C  "C5'" . DA  B 2  72  ? -19.834 -34.933 83.280 1.00 84.50  ? -1  DA  J "C5'" 1 
ATOM   4424  C  "C4'" . DA  B 2  72  ? -20.161 -34.560 84.705 1.00 83.83  ? -1  DA  J "C4'" 1 
ATOM   4425  O  "O4'" . DA  B 2  72  ? -19.734 -33.201 84.972 1.00 79.01  ? -1  DA  J "O4'" 1 
ATOM   4426  C  "C3'" . DA  B 2  72  ? -21.662 -34.595 84.996 1.00 82.09  ? -1  DA  J "C3'" 1 
ATOM   4427  O  "O3'" . DA  B 2  72  ? -21.871 -35.197 86.272 1.00 93.58  ? -1  DA  J "O3'" 1 
ATOM   4428  C  "C2'" . DA  B 2  72  ? -22.065 -33.135 84.940 1.00 75.25  ? -1  DA  J "C2'" 1 
ATOM   4429  C  "C1'" . DA  B 2  72  ? -20.826 -32.475 85.502 1.00 76.89  ? -1  DA  J "C1'" 1 
ATOM   4430  N  N9    . DA  B 2  72  ? -20.661 -31.073 85.137 1.00 79.77  ? -1  DA  J N9    1 
ATOM   4431  C  C8    . DA  B 2  72  ? -20.822 -30.486 83.907 1.00 80.86  ? -1  DA  J C8    1 
ATOM   4432  N  N7    . DA  B 2  72  ? -20.625 -29.189 83.912 1.00 75.61  ? -1  DA  J N7    1 
ATOM   4433  C  C5    . DA  B 2  72  ? -20.321 -28.903 85.235 1.00 74.20  ? -1  DA  J C5    1 
ATOM   4434  C  C6    . DA  B 2  72  ? -19.999 -27.704 85.896 1.00 69.73  ? -1  DA  J C6    1 
ATOM   4435  N  N6    . DA  B 2  72  ? -19.932 -26.519 85.291 1.00 67.90  ? -1  DA  J N6    1 
ATOM   4436  N  N1    . DA  B 2  72  ? -19.726 -27.769 87.215 1.00 71.29  ? -1  DA  J N1    1 
ATOM   4437  C  C2    . DA  B 2  72  ? -19.777 -28.959 87.823 1.00 79.05  ? -1  DA  J C2    1 
ATOM   4438  N  N3    . DA  B 2  72  ? -20.071 -30.153 87.313 1.00 81.39  ? -1  DA  J N3    1 
ATOM   4439  C  C4    . DA  B 2  72  ? -20.339 -30.054 86.000 1.00 82.21  ? -1  DA  J C4    1 
ATOM   4440  P  P     . DT  B 2  73  ? -23.353 -35.496 86.780 1.00 98.15  ? 0   DT  J P     1 
ATOM   4441  O  OP1   . DT  B 2  73  ? -23.315 -36.774 87.531 1.00 79.43  ? 0   DT  J OP1   1 
ATOM   4442  O  OP2   . DT  B 2  73  ? -24.289 -35.320 85.643 1.00 79.35  ? 0   DT  J OP2   1 
ATOM   4443  O  "O5'" . DT  B 2  73  ? -23.618 -34.290 87.778 1.00 88.25  ? 0   DT  J "O5'" 1 
ATOM   4444  C  "C5'" . DT  B 2  73  ? -22.666 -34.003 88.806 1.00 89.95  ? 0   DT  J "C5'" 1 
ATOM   4445  C  "C4'" . DT  B 2  73  ? -23.244 -32.937 89.701 1.00 96.59  ? 0   DT  J "C4'" 1 
ATOM   4446  O  "O4'" . DT  B 2  73  ? -22.896 -31.631 89.177 1.00 107.77 ? 0   DT  J "O4'" 1 
ATOM   4447  C  "C3'" . DT  B 2  73  ? -24.772 -32.970 89.797 1.00 99.36  ? 0   DT  J "C3'" 1 
ATOM   4448  O  "O3'" . DT  B 2  73  ? -25.138 -32.864 91.178 1.00 111.73 ? 0   DT  J "O3'" 1 
ATOM   4449  C  "C2'" . DT  B 2  73  ? -25.213 -31.780 88.960 1.00 101.46 ? 0   DT  J "C2'" 1 
ATOM   4450  C  "C1'" . DT  B 2  73  ? -24.054 -30.814 89.141 1.00 99.10  ? 0   DT  J "C1'" 1 
ATOM   4451  N  N1    . DT  B 2  73  ? -23.865 -29.793 88.082 1.00 93.21  ? 0   DT  J N1    1 
ATOM   4452  C  C2    . DT  B 2  73  ? -23.437 -28.541 88.465 1.00 91.54  ? 0   DT  J C2    1 
ATOM   4453  O  O2    . DT  B 2  73  ? -23.210 -28.238 89.623 1.00 88.99  ? 0   DT  J O2    1 
ATOM   4454  N  N3    . DT  B 2  73  ? -23.279 -27.650 87.435 1.00 90.51  ? 0   DT  J N3    1 
ATOM   4455  C  C4    . DT  B 2  73  ? -23.501 -27.880 86.092 1.00 92.13  ? 0   DT  J C4    1 
ATOM   4456  O  O4    . DT  B 2  73  ? -23.321 -26.977 85.284 1.00 92.58  ? 0   DT  J O4    1 
ATOM   4457  C  C5    . DT  B 2  73  ? -23.941 -29.216 85.757 1.00 102.16 ? 0   DT  J C5    1 
ATOM   4458  C  C7    . DT  B 2  73  ? -24.206 -29.556 84.323 1.00 101.46 ? 0   DT  J C7    1 
ATOM   4459  C  C6    . DT  B 2  73  ? -24.094 -30.096 86.756 1.00 97.87  ? 0   DT  J C6    1 
ATOM   4460  P  P     . DT  B 2  74  ? -26.670 -33.017 91.649 1.00 106.41 ? 1   DT  J P     1 
ATOM   4461  O  OP1   . DT  B 2  74  ? -26.668 -33.815 92.900 1.00 103.95 ? 1   DT  J OP1   1 
ATOM   4462  O  OP2   . DT  B 2  74  ? -27.485 -33.455 90.480 1.00 99.31  ? 1   DT  J OP2   1 
ATOM   4463  O  "O5'" . DT  B 2  74  ? -27.068 -31.526 92.038 1.00 89.73  ? 1   DT  J "O5'" 1 
ATOM   4464  C  "C5'" . DT  B 2  74  ? -26.193 -30.752 92.878 1.00 93.78  ? 1   DT  J "C5'" 1 
ATOM   4465  C  "C4'" . DT  B 2  74  ? -26.550 -29.287 92.792 1.00 101.13 ? 1   DT  J "C4'" 1 
ATOM   4466  O  "O4'" . DT  B 2  74  ? -26.127 -28.759 91.511 1.00 107.87 ? 1   DT  J "O4'" 1 
ATOM   4467  C  "C3'" . DT  B 2  74  ? -28.049 -28.973 92.918 1.00 104.78 ? 1   DT  J "C3'" 1 
ATOM   4468  O  "O3'" . DT  B 2  74  ? -28.289 -28.109 94.040 1.00 108.54 ? 1   DT  J "O3'" 1 
ATOM   4469  C  "C2'" . DT  B 2  74  ? -28.401 -28.298 91.601 1.00 102.36 ? 1   DT  J "C2'" 1 
ATOM   4470  C  "C1'" . DT  B 2  74  ? -27.059 -27.769 91.127 1.00 102.31 ? 1   DT  J "C1'" 1 
ATOM   4471  N  N1    . DT  B 2  74  ? -26.946 -27.557 89.662 1.00 98.53  ? 1   DT  J N1    1 
ATOM   4472  C  C2    . DT  B 2  74  ? -26.577 -26.308 89.211 1.00 94.39  ? 1   DT  J C2    1 
ATOM   4473  O  O2    . DT  B 2  74  ? -26.305 -25.382 89.957 1.00 88.70  ? 1   DT  J O2    1 
ATOM   4474  N  N3    . DT  B 2  74  ? -26.526 -26.186 87.845 1.00 98.46  ? 1   DT  J N3    1 
ATOM   4475  C  C4    . DT  B 2  74  ? -26.804 -27.161 86.906 1.00 96.30  ? 1   DT  J C4    1 
ATOM   4476  O  O4    . DT  B 2  74  ? -26.713 -26.901 85.709 1.00 89.12  ? 1   DT  J O4    1 
ATOM   4477  C  C5    . DT  B 2  74  ? -27.196 -28.442 87.447 1.00 99.55  ? 1   DT  J C5    1 
ATOM   4478  C  C7    . DT  B 2  74  ? -27.521 -29.560 86.506 1.00 96.38  ? 1   DT  J C7    1 
ATOM   4479  C  C6    . DT  B 2  74  ? -27.247 -28.574 88.780 1.00 104.55 ? 1   DT  J C6    1 
ATOM   4480  P  P     . DC  B 2  75  ? -29.792 -27.807 94.558 1.00 108.78 ? 2   DC  J P     1 
ATOM   4481  O  OP1   . DC  B 2  75  ? -29.861 -28.190 95.994 1.00 106.08 ? 2   DC  J OP1   1 
ATOM   4482  O  OP2   . DC  B 2  75  ? -30.779 -28.348 93.572 1.00 86.97  ? 2   DC  J OP2   1 
ATOM   4483  O  "O5'" . DC  B 2  75  ? -29.899 -26.219 94.511 1.00 100.05 ? 2   DC  J "O5'" 1 
ATOM   4484  C  "C5'" . DC  B 2  75  ? -28.932 -25.402 93.827 1.00 109.61 ? 2   DC  J "C5'" 1 
ATOM   4485  C  "C4'" . DC  B 2  75  ? -29.604 -24.200 93.203 1.00 111.94 ? 2   DC  J "C4'" 1 
ATOM   4486  O  "O4'" . DC  B 2  75  ? -29.358 -24.173 91.774 1.00 114.09 ? 2   DC  J "O4'" 1 
ATOM   4487  C  "C3'" . DC  B 2  75  ? -31.123 -24.125 93.373 1.00 114.52 ? 2   DC  J "C3'" 1 
ATOM   4488  O  "O3'" . DC  B 2  75  ? -31.475 -22.766 93.635 1.00 129.59 ? 2   DC  J "O3'" 1 
ATOM   4489  C  "C2'" . DC  B 2  75  ? -31.655 -24.586 92.029 1.00 112.27 ? 2   DC  J "C2'" 1 
ATOM   4490  C  "C1'" . DC  B 2  75  ? -30.585 -24.088 91.065 1.00 108.99 ? 2   DC  J "C1'" 1 
ATOM   4491  N  N1    . DC  B 2  75  ? -30.443 -24.862 89.812 1.00 108.74 ? 2   DC  J N1    1 
ATOM   4492  C  C2    . DC  B 2  75  ? -30.104 -24.189 88.633 1.00 99.31  ? 2   DC  J C2    1 
ATOM   4493  O  O2    . DC  B 2  75  ? -29.923 -22.962 88.673 1.00 94.76  ? 2   DC  J O2    1 
ATOM   4494  N  N3    . DC  B 2  75  ? -29.992 -24.890 87.480 1.00 95.12  ? 2   DC  J N3    1 
ATOM   4495  C  C4    . DC  B 2  75  ? -30.188 -26.210 87.481 1.00 92.35  ? 2   DC  J C4    1 
ATOM   4496  N  N4    . DC  B 2  75  ? -30.054 -26.864 86.327 1.00 94.75  ? 2   DC  J N4    1 
ATOM   4497  C  C5    . DC  B 2  75  ? -30.532 -26.920 88.666 1.00 103.07 ? 2   DC  J C5    1 
ATOM   4498  C  C6    . DC  B 2  75  ? -30.649 -26.215 89.798 1.00 110.47 ? 2   DC  J C6    1 
ATOM   4499  P  P     . DA  B 2  76  ? -32.859 -22.408 94.344 1.00 128.13 ? 3   DA  J P     1 
ATOM   4500  O  OP1   . DA  B 2  76  ? -32.616 -22.346 95.808 1.00 129.46 ? 3   DA  J OP1   1 
ATOM   4501  O  OP2   . DA  B 2  76  ? -33.910 -23.315 93.798 1.00 112.68 ? 3   DA  J OP2   1 
ATOM   4502  O  "O5'" . DA  B 2  76  ? -33.127 -20.917 93.853 1.00 113.65 ? 3   DA  J "O5'" 1 
ATOM   4503  C  "C5'" . DA  B 2  76  ? -32.042 -19.991 93.666 1.00 111.44 ? 3   DA  J "C5'" 1 
ATOM   4504  C  "C4'" . DA  B 2  76  ? -32.353 -19.062 92.516 1.00 116.12 ? 3   DA  J "C4'" 1 
ATOM   4505  O  "O4'" . DA  B 2  76  ? -32.120 -19.726 91.248 1.00 119.75 ? 3   DA  J "O4'" 1 
ATOM   4506  C  "C3'" . DA  B 2  76  ? -33.801 -18.591 92.452 1.00 114.60 ? 3   DA  J "C3'" 1 
ATOM   4507  O  "O3'" . DA  B 2  76  ? -33.757 -17.341 91.771 1.00 121.97 ? 3   DA  J "O3'" 1 
ATOM   4508  C  "C2'" . DA  B 2  76  ? -34.445 -19.626 91.552 1.00 116.18 ? 3   DA  J "C2'" 1 
ATOM   4509  C  "C1'" . DA  B 2  76  ? -33.343 -19.785 90.513 1.00 121.05 ? 3   DA  J "C1'" 1 
ATOM   4510  N  N9    . DA  B 2  76  ? -33.338 -21.024 89.736 1.00 121.12 ? 3   DA  J N9    1 
ATOM   4511  C  C8    . DA  B 2  76  ? -33.735 -22.280 90.123 1.00 129.99 ? 3   DA  J C8    1 
ATOM   4512  N  N7    . DA  B 2  76  ? -33.570 -23.195 89.199 1.00 118.62 ? 3   DA  J N7    1 
ATOM   4513  C  C5    . DA  B 2  76  ? -33.019 -22.496 88.134 1.00 113.73 ? 3   DA  J C5    1 
ATOM   4514  C  C6    . DA  B 2  76  ? -32.605 -22.897 86.853 1.00 103.44 ? 3   DA  J C6    1 
ATOM   4515  N  N6    . DA  B 2  76  ? -32.693 -24.152 86.408 1.00 104.57 ? 3   DA  J N6    1 
ATOM   4516  N  N1    . DA  B 2  76  ? -32.100 -21.951 86.030 1.00 97.26  ? 3   DA  J N1    1 
ATOM   4517  C  C2    . DA  B 2  76  ? -32.013 -20.692 86.477 1.00 92.46  ? 3   DA  J C2    1 
ATOM   4518  N  N3    . DA  B 2  76  ? -32.362 -20.195 87.662 1.00 102.13 ? 3   DA  J N3    1 
ATOM   4519  C  C4    . DA  B 2  76  ? -32.866 -21.159 88.452 1.00 113.46 ? 3   DA  J C4    1 
ATOM   4520  P  P     . DG  B 2  77  ? -34.818 -16.230 92.091 1.00 118.01 ? 4   DG  J P     1 
ATOM   4521  O  OP1   . DG  B 2  77  ? -34.430 -15.614 93.385 1.00 105.38 ? 4   DG  J OP1   1 
ATOM   4522  O  OP2   . DG  B 2  77  ? -36.167 -16.836 91.914 1.00 101.11 ? 4   DG  J OP2   1 
ATOM   4523  O  "O5'" . DG  B 2  77  ? -34.570 -15.130 90.958 1.00 109.68 ? 4   DG  J "O5'" 1 
ATOM   4524  C  "C5'" . DG  B 2  77  ? -33.430 -15.154 90.063 1.00 105.09 ? 4   DG  J "C5'" 1 
ATOM   4525  C  "C4'" . DG  B 2  77  ? -33.892 -15.173 88.623 1.00 100.97 ? 4   DG  J "C4'" 1 
ATOM   4526  O  "O4'" . DG  B 2  77  ? -33.992 -16.544 88.159 1.00 97.00  ? 4   DG  J "O4'" 1 
ATOM   4527  C  "C3'" . DG  B 2  77  ? -35.277 -14.560 88.382 1.00 96.64  ? 4   DG  J "C3'" 1 
ATOM   4528  O  "O3'" . DG  B 2  77  ? -35.400 -13.981 87.089 1.00 88.98  ? 4   DG  J "O3'" 1 
ATOM   4529  C  "C2'" . DG  B 2  77  ? -36.183 -15.773 88.330 1.00 99.62  ? 4   DG  J "C2'" 1 
ATOM   4530  C  "C1'" . DG  B 2  77  ? -35.278 -16.723 87.583 1.00 100.47 ? 4   DG  J "C1'" 1 
ATOM   4531  N  N9    . DG  B 2  77  ? -35.629 -18.131 87.681 1.00 106.96 ? 4   DG  J N9    1 
ATOM   4532  C  C8    . DG  B 2  77  ? -36.213 -18.784 88.739 1.00 111.56 ? 4   DG  J C8    1 
ATOM   4533  N  N7    . DG  B 2  77  ? -36.404 -20.055 88.512 1.00 119.11 ? 4   DG  J N7    1 
ATOM   4534  C  C5    . DG  B 2  77  ? -35.929 -20.248 87.222 1.00 119.19 ? 4   DG  J C5    1 
ATOM   4535  C  C6    . DG  B 2  77  ? -35.881 -21.420 86.427 1.00 117.64 ? 4   DG  J C6    1 
ATOM   4536  O  O6    . DG  B 2  77  ? -36.263 -22.560 86.713 1.00 120.68 ? 4   DG  J O6    1 
ATOM   4537  N  N1    . DG  B 2  77  ? -35.319 -21.169 85.178 1.00 120.44 ? 4   DG  J N1    1 
ATOM   4538  C  C2    . DG  B 2  77  ? -34.862 -19.946 84.750 1.00 114.10 ? 4   DG  J C2    1 
ATOM   4539  N  N2    . DG  B 2  77  ? -34.352 -19.903 83.509 1.00 108.75 ? 4   DG  J N2    1 
ATOM   4540  N  N3    . DG  B 2  77  ? -34.904 -18.846 85.481 1.00 109.99 ? 4   DG  J N3    1 
ATOM   4541  C  C4    . DG  B 2  77  ? -35.448 -19.069 86.696 1.00 113.48 ? 4   DG  J C4    1 
ATOM   4542  P  P     . DC  B 2  78  ? -34.917 -12.506 86.830 1.00 99.83  ? 5   DC  J P     1 
ATOM   4543  O  OP1   . DC  B 2  78  ? -33.534 -12.372 87.369 1.00 92.64  ? 5   DC  J OP1   1 
ATOM   4544  O  OP2   . DC  B 2  78  ? -35.993 -11.597 87.282 1.00 93.12  ? 5   DC  J OP2   1 
ATOM   4545  O  "O5'" . DC  B 2  78  ? -34.908 -12.401 85.238 1.00 109.86 ? 5   DC  J "O5'" 1 
ATOM   4546  C  "C5'" . DC  B 2  78  ? -34.259 -13.385 84.397 1.00 111.33 ? 5   DC  J "C5'" 1 
ATOM   4547  C  "C4'" . DC  B 2  78  ? -35.125 -13.741 83.207 1.00 111.00 ? 5   DC  J "C4'" 1 
ATOM   4548  O  "O4'" . DC  B 2  78  ? -35.703 -15.049 83.425 1.00 111.26 ? 5   DC  J "O4'" 1 
ATOM   4549  C  "C3'" . DC  B 2  78  ? -36.306 -12.797 82.921 1.00 113.55 ? 5   DC  J "C3'" 1 
ATOM   4550  O  "O3'" . DC  B 2  78  ? -36.571 -12.376 81.564 1.00 110.48 ? 5   DC  J "O3'" 1 
ATOM   4551  C  "C2'" . DC  B 2  78  ? -37.516 -13.583 83.394 1.00 111.27 ? 5   DC  J "C2'" 1 
ATOM   4552  C  "C1'" . DC  B 2  78  ? -37.088 -15.012 83.123 1.00 109.99 ? 5   DC  J "C1'" 1 
ATOM   4553  N  N1    . DC  B 2  78  ? -37.742 -16.046 83.931 1.00 107.64 ? 5   DC  J N1    1 
ATOM   4554  C  C2    . DC  B 2  78  ? -37.428 -17.382 83.673 1.00 112.19 ? 5   DC  J C2    1 
ATOM   4555  O  O2    . DC  B 2  78  ? -36.639 -17.643 82.753 1.00 122.15 ? 5   DC  J O2    1 
ATOM   4556  N  N3    . DC  B 2  78  ? -37.997 -18.352 84.423 1.00 114.95 ? 5   DC  J N3    1 
ATOM   4557  C  C4    . DC  B 2  78  ? -38.840 -18.024 85.406 1.00 114.88 ? 5   DC  J C4    1 
ATOM   4558  N  N4    . DC  B 2  78  ? -39.381 -19.011 86.122 1.00 118.39 ? 5   DC  J N4    1 
ATOM   4559  C  C5    . DC  B 2  78  ? -39.167 -16.670 85.697 1.00 107.64 ? 5   DC  J C5    1 
ATOM   4560  C  C6    . DC  B 2  78  ? -38.599 -15.722 84.945 1.00 108.75 ? 5   DC  J C6    1 
ATOM   4561  P  P     . DT  B 2  79  ? -35.641 -12.801 80.307 1.00 123.28 ? 6   DT  J P     1 
ATOM   4562  O  OP1   . DT  B 2  79  ? -34.199 -12.598 80.645 1.00 104.24 ? 6   DT  J OP1   1 
ATOM   4563  O  OP2   . DT  B 2  79  ? -36.214 -12.156 79.100 1.00 114.87 ? 6   DT  J OP2   1 
ATOM   4564  O  "O5'" . DT  B 2  79  ? -35.851 -14.375 80.211 1.00 121.63 ? 6   DT  J "O5'" 1 
ATOM   4565  C  "C5'" . DT  B 2  79  ? -35.142 -15.158 79.237 1.00 99.07  ? 6   DT  J "C5'" 1 
ATOM   4566  C  "C4'" . DT  B 2  79  ? -36.128 -15.842 78.321 1.00 84.86  ? 6   DT  J "C4'" 1 
ATOM   4567  O  "O4'" . DT  B 2  79  ? -37.118 -16.540 79.114 1.00 85.92  ? 6   DT  J "O4'" 1 
ATOM   4568  C  "C3'" . DT  B 2  79  ? -36.920 -14.895 77.425 1.00 76.15  ? 6   DT  J "C3'" 1 
ATOM   4569  O  "O3'" . DT  B 2  79  ? -37.312 -15.571 76.234 1.00 78.02  ? 6   DT  J "O3'" 1 
ATOM   4570  C  "C2'" . DT  B 2  79  ? -38.206 -14.700 78.200 1.00 82.94  ? 6   DT  J "C2'" 1 
ATOM   4571  C  "C1'" . DT  B 2  79  ? -38.409 -16.111 78.717 1.00 85.73  ? 6   DT  J "C1'" 1 
ATOM   4572  N  N1    . DT  B 2  79  ? -39.307 -16.286 79.864 1.00 92.99  ? 6   DT  J N1    1 
ATOM   4573  C  C2    . DT  B 2  79  ? -39.542 -17.575 80.274 1.00 94.79  ? 6   DT  J C2    1 
ATOM   4574  O  O2    . DT  B 2  79  ? -39.060 -18.545 79.720 1.00 87.91  ? 6   DT  J O2    1 
ATOM   4575  N  N3    . DT  B 2  79  ? -40.362 -17.689 81.366 1.00 108.59 ? 6   DT  J N3    1 
ATOM   4576  C  C4    . DT  B 2  79  ? -40.949 -16.662 82.077 1.00 117.74 ? 6   DT  J C4    1 
ATOM   4577  O  O4    . DT  B 2  79  ? -41.671 -16.918 83.035 1.00 137.49 ? 6   DT  J O4    1 
ATOM   4578  C  C5    . DT  B 2  79  ? -40.650 -15.332 81.599 1.00 113.23 ? 6   DT  J C5    1 
ATOM   4579  C  C7    . DT  B 2  79  ? -41.244 -14.155 82.304 1.00 113.89 ? 6   DT  J C7    1 
ATOM   4580  C  C6    . DT  B 2  79  ? -39.850 -15.212 80.532 1.00 108.13 ? 6   DT  J C6    1 
ATOM   4581  P  P     . DG  B 2  80  ? -36.310 -15.751 74.993 1.00 69.57  ? 7   DG  J P     1 
ATOM   4582  O  OP1   . DG  B 2  80  ? -34.935 -16.023 75.476 1.00 71.94  ? 7   DG  J OP1   1 
ATOM   4583  O  OP2   . DG  B 2  80  ? -36.623 -14.701 73.993 1.00 56.20  ? 7   DG  J OP2   1 
ATOM   4584  O  "O5'" . DG  B 2  80  ? -36.735 -17.170 74.453 1.00 64.42  ? 7   DG  J "O5'" 1 
ATOM   4585  C  "C5'" . DG  B 2  80  ? -38.032 -17.221 73.952 1.00 62.67  ? 7   DG  J "C5'" 1 
ATOM   4586  C  "C4'" . DG  B 2  80  ? -38.638 -18.568 74.222 1.00 63.99  ? 7   DG  J "C4'" 1 
ATOM   4587  O  "O4'" . DG  B 2  80  ? -39.207 -18.572 75.550 1.00 66.61  ? 7   DG  J "O4'" 1 
ATOM   4588  C  "C3'" . DG  B 2  80  ? -39.818 -18.752 73.290 1.00 65.67  ? 7   DG  J "C3'" 1 
ATOM   4589  O  "O3'" . DG  B 2  80  ? -40.076 -20.129 73.130 1.00 63.00  ? 7   DG  J "O3'" 1 
ATOM   4590  C  "C2'" . DG  B 2  80  ? -40.907 -17.995 74.013 1.00 65.20  ? 7   DG  J "C2'" 1 
ATOM   4591  C  "C1'" . DG  B 2  80  ? -40.627 -18.451 75.435 1.00 77.27  ? 7   DG  J "C1'" 1 
ATOM   4592  N  N9    . DG  B 2  80  ? -41.106 -17.534 76.464 1.00 85.56  ? 7   DG  J N9    1 
ATOM   4593  C  C8    . DG  B 2  80  ? -40.811 -16.199 76.599 1.00 89.75  ? 7   DG  J C8    1 
ATOM   4594  N  N7    . DG  B 2  80  ? -41.419 -15.642 77.611 1.00 93.93  ? 7   DG  J N7    1 
ATOM   4595  C  C5    . DG  B 2  80  ? -42.189 -16.662 78.154 1.00 94.55  ? 7   DG  J C5    1 
ATOM   4596  C  C6    . DG  B 2  80  ? -43.079 -16.654 79.260 1.00 92.50  ? 7   DG  J C6    1 
ATOM   4597  O  O6    . DG  B 2  80  ? -43.366 -15.715 80.011 1.00 99.92  ? 7   DG  J O6    1 
ATOM   4598  N  N1    . DG  B 2  80  ? -43.661 -17.901 79.456 1.00 80.79  ? 7   DG  J N1    1 
ATOM   4599  C  C2    . DG  B 2  80  ? -43.409 -19.016 78.701 1.00 80.83  ? 7   DG  J C2    1 
ATOM   4600  N  N2    . DG  B 2  80  ? -44.067 -20.127 79.053 1.00 79.86  ? 7   DG  J N2    1 
ATOM   4601  N  N3    . DG  B 2  80  ? -42.588 -19.036 77.663 1.00 79.59  ? 7   DG  J N3    1 
ATOM   4602  C  C4    . DG  B 2  80  ? -42.015 -17.833 77.450 1.00 87.33  ? 7   DG  J C4    1 
ATOM   4603  P  P     . DA  B 2  81  ? -40.943 -20.558 71.920 1.00 65.12  ? 8   DA  J P     1 
ATOM   4604  O  OP1   . DA  B 2  81  ? -40.116 -21.407 71.016 1.00 67.97  ? 8   DA  J OP1   1 
ATOM   4605  O  OP2   . DA  B 2  81  ? -41.621 -19.352 71.402 1.00 51.38  ? 8   DA  J OP2   1 
ATOM   4606  O  "O5'" . DA  B 2  81  ? -42.010 -21.496 72.622 1.00 63.65  ? 8   DA  J "O5'" 1 
ATOM   4607  C  "C5'" . DA  B 2  81  ? -41.587 -22.638 73.373 1.00 66.36  ? 8   DA  J "C5'" 1 
ATOM   4608  C  "C4'" . DA  B 2  81  ? -42.812 -23.364 73.875 1.00 70.33  ? 8   DA  J "C4'" 1 
ATOM   4609  O  "O4'" . DA  B 2  81  ? -43.428 -22.602 74.943 1.00 74.58  ? 8   DA  J "O4'" 1 
ATOM   4610  C  "C3'" . DA  B 2  81  ? -43.901 -23.544 72.823 1.00 70.45  ? 8   DA  J "C3'" 1 
ATOM   4611  O  "O3'" . DA  B 2  81  ? -44.605 -24.730 73.144 1.00 66.94  ? 8   DA  J "O3'" 1 
ATOM   4612  C  "C2'" . DA  B 2  81  ? -44.782 -22.325 73.012 1.00 69.20  ? 8   DA  J "C2'" 1 
ATOM   4613  C  "C1'" . DA  B 2  81  ? -44.667 -22.055 74.511 1.00 76.10  ? 8   DA  J "C1'" 1 
ATOM   4614  N  N9    . DA  B 2  81  ? -44.692 -20.642 74.889 1.00 80.41  ? 8   DA  J N9    1 
ATOM   4615  C  C8    . DA  B 2  81  ? -44.090 -19.582 74.260 1.00 86.71  ? 8   DA  J C8    1 
ATOM   4616  N  N7    . DA  B 2  81  ? -44.317 -18.427 74.835 1.00 81.04  ? 8   DA  J N7    1 
ATOM   4617  C  C5    . DA  B 2  81  ? -45.140 -18.745 75.905 1.00 85.36  ? 8   DA  J C5    1 
ATOM   4618  C  C6    . DA  B 2  81  ? -45.741 -17.960 76.898 1.00 79.18  ? 8   DA  J C6    1 
ATOM   4619  N  N6    . DA  B 2  81  ? -45.597 -16.638 76.981 1.00 77.17  ? 8   DA  J N6    1 
ATOM   4620  N  N1    . DA  B 2  81  ? -46.500 -18.587 77.821 1.00 81.52  ? 8   DA  J N1    1 
ATOM   4621  C  C2    . DA  B 2  81  ? -46.646 -19.915 77.737 1.00 86.85  ? 8   DA  J C2    1 
ATOM   4622  N  N3    . DA  B 2  81  ? -46.136 -20.762 76.848 1.00 96.61  ? 8   DA  J N3    1 
ATOM   4623  C  C4    . DA  B 2  81  ? -45.379 -20.106 75.950 1.00 89.98  ? 8   DA  J C4    1 
ATOM   4624  P  P     . DA  B 2  82  ? -45.656 -25.298 72.144 1.00 67.68  ? 9   DA  J P     1 
ATOM   4625  O  OP1   . DA  B 2  82  ? -45.419 -26.781 72.055 1.00 61.75  ? 9   DA  J OP1   1 
ATOM   4626  O  OP2   . DA  B 2  82  ? -45.654 -24.443 70.930 1.00 67.26  ? 9   DA  J OP2   1 
ATOM   4627  O  "O5'" . DA  B 2  82  ? -47.028 -24.946 72.867 1.00 84.13  ? 9   DA  J "O5'" 1 
ATOM   4628  C  "C5'" . DA  B 2  82  ? -47.322 -25.412 74.208 1.00 79.19  ? 9   DA  J "C5'" 1 
ATOM   4629  C  "C4'" . DA  B 2  82  ? -48.539 -24.695 74.742 1.00 71.89  ? 9   DA  J "C4'" 1 
ATOM   4630  O  "O4'" . DA  B 2  82  ? -48.205 -23.313 74.997 1.00 62.03  ? 9   DA  J "O4'" 1 
ATOM   4631  C  "C3'" . DA  B 2  82  ? -49.741 -24.684 73.791 1.00 71.79  ? 9   DA  J "C3'" 1 
ATOM   4632  O  "O3'" . DA  B 2  82  ? -50.806 -25.399 74.426 1.00 85.59  ? 9   DA  J "O3'" 1 
ATOM   4633  C  "C2'" . DA  B 2  82  ? -50.026 -23.208 73.558 1.00 74.46  ? 9   DA  J "C2'" 1 
ATOM   4634  C  "C1'" . DA  B 2  82  ? -49.333 -22.527 74.726 1.00 73.10  ? 9   DA  J "C1'" 1 
ATOM   4635  N  N9    . DA  B 2  82  ? -48.872 -21.165 74.485 1.00 78.80  ? 9   DA  J N9    1 
ATOM   4636  C  C8    . DA  B 2  82  ? -48.154 -20.682 73.422 1.00 91.51  ? 9   DA  J C8    1 
ATOM   4637  N  N7    . DA  B 2  82  ? -47.876 -19.404 73.509 1.00 98.90  ? 9   DA  J N7    1 
ATOM   4638  C  C5    . DA  B 2  82  ? -48.455 -19.019 74.709 1.00 96.03  ? 9   DA  J C5    1 
ATOM   4639  C  C6    . DA  B 2  82  ? -48.518 -17.783 75.375 1.00 96.79  ? 9   DA  J C6    1 
ATOM   4640  N  N6    . DA  B 2  82  ? -47.967 -16.662 74.907 1.00 103.40 ? 9   DA  J N6    1 
ATOM   4641  N  N1    . DA  B 2  82  ? -49.163 -17.740 76.561 1.00 99.31  ? 9   DA  J N1    1 
ATOM   4642  C  C2    . DA  B 2  82  ? -49.707 -18.868 77.036 1.00 100.85 ? 9   DA  J C2    1 
ATOM   4643  N  N3    . DA  B 2  82  ? -49.714 -20.088 76.503 1.00 103.18 ? 9   DA  J N3    1 
ATOM   4644  C  C4    . DA  B 2  82  ? -49.065 -20.095 75.325 1.00 98.80  ? 9   DA  J C4    1 
ATOM   4645  P  P     . DC  B 2  83  ? -52.128 -25.852 73.612 1.00 86.00  ? 10  DC  J P     1 
ATOM   4646  O  OP1   . DC  B 2  83  ? -52.534 -27.176 74.155 1.00 80.37  ? 10  DC  J OP1   1 
ATOM   4647  O  OP2   . DC  B 2  83  ? -51.891 -25.701 72.160 1.00 79.21  ? 10  DC  J OP2   1 
ATOM   4648  O  "O5'" . DC  B 2  83  ? -53.158 -24.679 73.941 1.00 77.67  ? 10  DC  J "O5'" 1 
ATOM   4649  C  "C5'" . DC  B 2  83  ? -53.250 -24.127 75.269 1.00 75.39  ? 10  DC  J "C5'" 1 
ATOM   4650  C  "C4'" . DC  B 2  83  ? -54.100 -22.879 75.275 1.00 75.14  ? 10  DC  J "C4'" 1 
ATOM   4651  O  "O4'" . DC  B 2  83  ? -53.264 -21.702 75.147 1.00 79.73  ? 10  DC  J "O4'" 1 
ATOM   4652  C  "C3'" . DC  B 2  83  ? -55.132 -22.777 74.147 1.00 84.24  ? 10  DC  J "C3'" 1 
ATOM   4653  O  "O3'" . DC  B 2  83  ? -56.304 -22.078 74.585 1.00 97.51  ? 10  DC  J "O3'" 1 
ATOM   4654  C  "C2'" . DC  B 2  83  ? -54.466 -21.842 73.166 1.00 83.83  ? 10  DC  J "C2'" 1 
ATOM   4655  C  "C1'" . DC  B 2  83  ? -53.838 -20.875 74.148 1.00 80.54  ? 10  DC  J "C1'" 1 
ATOM   4656  N  N1    . DC  B 2  83  ? -52.792 -19.993 73.612 1.00 82.38  ? 10  DC  J N1    1 
ATOM   4657  C  C2    . DC  B 2  83  ? -52.453 -18.842 74.326 1.00 85.06  ? 10  DC  J C2    1 
ATOM   4658  O  O2    . DC  B 2  83  ? -53.014 -18.620 75.406 1.00 88.70  ? 10  DC  J O2    1 
ATOM   4659  N  N3    . DC  B 2  83  ? -51.506 -18.013 73.833 1.00 89.84  ? 10  DC  J N3    1 
ATOM   4660  C  C4    . DC  B 2  83  ? -50.924 -18.288 72.664 1.00 86.92  ? 10  DC  J C4    1 
ATOM   4661  N  N4    . DC  B 2  83  ? -49.999 -17.442 72.214 1.00 94.77  ? 10  DC  J N4    1 
ATOM   4662  C  C5    . DC  B 2  83  ? -51.262 -19.445 71.908 1.00 87.48  ? 10  DC  J C5    1 
ATOM   4663  C  C6    . DC  B 2  83  ? -52.195 -20.261 72.411 1.00 87.81  ? 10  DC  J C6    1 
ATOM   4664  P  P     . DA  B 2  84  ? -57.761 -22.589 74.176 1.00 98.93  ? 11  DA  J P     1 
ATOM   4665  O  OP1   . DA  B 2  84  ? -58.087 -23.748 75.049 1.00 91.84  ? 11  DA  J OP1   1 
ATOM   4666  O  OP2   . DA  B 2  84  ? -57.828 -22.725 72.698 1.00 83.63  ? 11  DA  J OP2   1 
ATOM   4667  O  "O5'" . DA  B 2  84  ? -58.672 -21.334 74.520 1.00 103.77 ? 11  DA  J "O5'" 1 
ATOM   4668  C  "C5'" . DA  B 2  84  ? -59.051 -21.039 75.871 1.00 112.50 ? 11  DA  J "C5'" 1 
ATOM   4669  C  "C4'" . DA  B 2  84  ? -59.325 -19.560 76.002 1.00 111.37 ? 11  DA  J "C4'" 1 
ATOM   4670  O  "O4'" . DA  B 2  84  ? -58.058 -18.878 75.926 1.00 107.32 ? 11  DA  J "O4'" 1 
ATOM   4671  C  "C3'" . DA  B 2  84  ? -60.185 -18.968 74.884 1.00 122.75 ? 11  DA  J "C3'" 1 
ATOM   4672  O  "O3'" . DA  B 2  84  ? -61.579 -18.968 75.227 1.00 123.60 ? 11  DA  J "O3'" 1 
ATOM   4673  C  "C2'" . DA  B 2  84  ? -59.589 -17.592 74.680 1.00 127.75 ? 11  DA  J "C2'" 1 
ATOM   4674  C  "C1'" . DA  B 2  84  ? -58.140 -17.757 75.062 1.00 121.85 ? 11  DA  J "C1'" 1 
ATOM   4675  N  N9    . DA  B 2  84  ? -57.267 -17.992 73.916 1.00 128.42 ? 11  DA  J N9    1 
ATOM   4676  C  C8    . DA  B 2  84  ? -57.153 -19.091 73.099 1.00 129.35 ? 11  DA  J C8    1 
ATOM   4677  N  N7    . DA  B 2  84  ? -56.271 -18.945 72.141 1.00 126.61 ? 11  DA  J N7    1 
ATOM   4678  C  C5    . DA  B 2  84  ? -55.785 -17.659 72.329 1.00 124.94 ? 11  DA  J C5    1 
ATOM   4679  C  C6    . DA  B 2  84  ? -54.825 -16.899 71.641 1.00 136.35 ? 11  DA  J C6    1 
ATOM   4680  N  N6    . DA  B 2  84  ? -54.151 -17.345 70.579 1.00 146.88 ? 11  DA  J N6    1 
ATOM   4681  N  N1    . DA  B 2  84  ? -54.574 -15.649 72.089 1.00 134.60 ? 11  DA  J N1    1 
ATOM   4682  C  C2    . DA  B 2  84  ? -55.249 -15.202 73.156 1.00 122.58 ? 11  DA  J C2    1 
ATOM   4683  N  N3    . DA  B 2  84  ? -56.177 -15.818 73.881 1.00 124.01 ? 11  DA  J N3    1 
ATOM   4684  C  C4    . DA  B 2  84  ? -56.398 -17.058 73.412 1.00 122.64 ? 11  DA  J C4    1 
ATOM   4685  P  P     . DT  B 2  85  ? -62.381 -17.618 75.596 1.00 115.57 ? 12  DT  J P     1 
ATOM   4686  O  OP1   . DT  B 2  85  ? -62.472 -17.533 77.078 1.00 104.74 ? 12  DT  J OP1   1 
ATOM   4687  O  OP2   . DT  B 2  85  ? -63.606 -17.596 74.753 1.00 121.95 ? 12  DT  J OP2   1 
ATOM   4688  O  "O5'" . DT  B 2  85  ? -61.445 -16.407 75.147 1.00 108.60 ? 12  DT  J "O5'" 1 
ATOM   4689  C  "C5'" . DT  B 2  85  ? -61.169 -15.306 76.044 1.00 109.56 ? 12  DT  J "C5'" 1 
ATOM   4690  C  "C4'" . DT  B 2  85  ? -60.691 -14.094 75.277 1.00 125.10 ? 12  DT  J "C4'" 1 
ATOM   4691  O  "O4'" . DT  B 2  85  ? -59.616 -14.427 74.363 1.00 135.18 ? 12  DT  J "O4'" 1 
ATOM   4692  C  "C3'" . DT  B 2  85  ? -61.759 -13.409 74.419 1.00 135.56 ? 12  DT  J "C3'" 1 
ATOM   4693  O  "O3'" . DT  B 2  85  ? -61.533 -11.999 74.488 1.00 147.15 ? 12  DT  J "O3'" 1 
ATOM   4694  C  "C2'" . DT  B 2  85  ? -61.436 -13.897 73.022 1.00 135.62 ? 12  DT  J "C2'" 1 
ATOM   4695  C  "C1'" . DT  B 2  85  ? -59.928 -13.851 73.101 1.00 136.82 ? 12  DT  J "C1'" 1 
ATOM   4696  N  N1    . DT  B 2  85  ? -59.207 -14.595 72.058 1.00 135.54 ? 12  DT  J N1    1 
ATOM   4697  C  C2    . DT  B 2  85  ? -58.134 -13.979 71.458 1.00 129.45 ? 12  DT  J C2    1 
ATOM   4698  O  O2    . DT  B 2  85  ? -57.763 -12.853 71.750 1.00 121.23 ? 12  DT  J O2    1 
ATOM   4699  N  N3    . DT  B 2  85  ? -57.507 -14.732 70.497 1.00 126.61 ? 12  DT  J N3    1 
ATOM   4700  C  C4    . DT  B 2  85  ? -57.843 -16.006 70.084 1.00 130.38 ? 12  DT  J C4    1 
ATOM   4701  O  O4    . DT  B 2  85  ? -57.188 -16.555 69.204 1.00 130.70 ? 12  DT  J O4    1 
ATOM   4702  C  C5    . DT  B 2  85  ? -58.984 -16.591 70.753 1.00 138.56 ? 12  DT  J C5    1 
ATOM   4703  C  C7    . DT  B 2  85  ? -59.422 -17.971 70.377 1.00 140.85 ? 12  DT  J C7    1 
ATOM   4704  C  C6    . DT  B 2  85  ? -59.605 -15.862 71.689 1.00 136.98 ? 12  DT  J C6    1 
ATOM   4705  P  P     . DG  B 2  86  ? -62.652 -10.966 74.012 1.00 145.57 ? 13  DG  J P     1 
ATOM   4706  O  OP1   . DG  B 2  86  ? -62.015 -9.628  73.948 1.00 143.37 ? 13  DG  J OP1   1 
ATOM   4707  O  OP2   . DG  B 2  86  ? -63.844 -11.154 74.868 1.00 158.60 ? 13  DG  J OP2   1 
ATOM   4708  O  "O5'" . DG  B 2  86  ? -63.054 -11.494 72.563 1.00 146.58 ? 13  DG  J "O5'" 1 
ATOM   4709  C  "C5'" . DG  B 2  86  ? -63.442 -10.576 71.530 1.00 153.92 ? 13  DG  J "C5'" 1 
ATOM   4710  C  "C4'" . DG  B 2  86  ? -62.350 -9.554  71.308 1.00 159.00 ? 13  DG  J "C4'" 1 
ATOM   4711  O  "O4'" . DG  B 2  86  ? -61.090 -10.233 71.077 1.00 151.14 ? 13  DG  J "O4'" 1 
ATOM   4712  C  "C3'" . DG  B 2  86  ? -62.560 -8.654  70.095 1.00 157.61 ? 13  DG  J "C3'" 1 
ATOM   4713  O  "O3'" . DG  B 2  86  ? -61.933 -7.382  70.289 1.00 162.92 ? 13  DG  J "O3'" 1 
ATOM   4714  C  "C2'" . DG  B 2  86  ? -61.860 -9.425  69.001 1.00 151.46 ? 13  DG  J "C2'" 1 
ATOM   4715  C  "C1'" . DG  B 2  86  ? -60.674 -10.021 69.736 1.00 146.24 ? 13  DG  J "C1'" 1 
ATOM   4716  N  N9    . DG  B 2  86  ? -60.299 -11.306 69.166 1.00 140.75 ? 13  DG  J N9    1 
ATOM   4717  C  C8    . DG  B 2  86  ? -61.027 -12.472 69.185 1.00 132.24 ? 13  DG  J C8    1 
ATOM   4718  N  N7    . DG  B 2  86  ? -60.459 -13.439 68.519 1.00 130.72 ? 13  DG  J N7    1 
ATOM   4719  C  C5    . DG  B 2  86  ? -59.304 -12.869 68.003 1.00 132.47 ? 13  DG  J C5    1 
ATOM   4720  C  C6    . DG  B 2  86  ? -58.283 -13.430 67.196 1.00 115.95 ? 13  DG  J C6    1 
ATOM   4721  O  O6    . DG  B 2  86  ? -58.191 -14.585 66.767 1.00 107.09 ? 13  DG  J O6    1 
ATOM   4722  N  N1    . DG  B 2  86  ? -57.296 -12.497 66.896 1.00 109.38 ? 13  DG  J N1    1 
ATOM   4723  C  C2    . DG  B 2  86  ? -57.289 -11.191 67.320 1.00 111.97 ? 13  DG  J C2    1 
ATOM   4724  N  N2    . DG  B 2  86  ? -56.246 -10.448 66.933 1.00 115.73 ? 13  DG  J N2    1 
ATOM   4725  N  N3    . DG  B 2  86  ? -58.232 -10.656 68.076 1.00 126.04 ? 13  DG  J N3    1 
ATOM   4726  C  C4    . DG  B 2  86  ? -59.201 -11.546 68.378 1.00 137.49 ? 13  DG  J C4    1 
ATOM   4727  P  P     . DC  B 2  87  ? -61.832 -6.332  69.079 1.00 160.53 ? 14  DC  J P     1 
ATOM   4728  O  OP1   . DC  B 2  87  ? -61.891 -4.965  69.654 1.00 155.11 ? 14  DC  J OP1   1 
ATOM   4729  O  OP2   . DC  B 2  87  ? -62.801 -6.739  68.020 1.00 139.54 ? 14  DC  J OP2   1 
ATOM   4730  O  "O5'" . DC  B 2  87  ? -60.342 -6.541  68.556 1.00 160.64 ? 14  DC  J "O5'" 1 
ATOM   4731  C  "C5'" . DC  B 2  87  ? -59.485 -5.421  68.253 1.00 144.76 ? 14  DC  J "C5'" 1 
ATOM   4732  C  "C4'" . DC  B 2  87  ? -58.638 -5.742  67.044 1.00 128.55 ? 14  DC  J "C4'" 1 
ATOM   4733  O  "O4'" . DC  B 2  87  ? -58.641 -7.174  66.824 1.00 121.05 ? 14  DC  J "O4'" 1 
ATOM   4734  C  "C3'" . DC  B 2  87  ? -59.121 -5.102  65.740 1.00 122.75 ? 14  DC  J "C3'" 1 
ATOM   4735  O  "O3'" . DC  B 2  87  ? -58.042 -4.410  65.101 1.00 114.20 ? 14  DC  J "O3'" 1 
ATOM   4736  C  "C2'" . DC  B 2  87  ? -59.634 -6.270  64.915 1.00 120.93 ? 14  DC  J "C2'" 1 
ATOM   4737  C  "C1'" . DC  B 2  87  ? -58.829 -7.443  65.446 1.00 129.34 ? 14  DC  J "C1'" 1 
ATOM   4738  N  N1    . DC  B 2  87  ? -59.452 -8.779  65.324 1.00 129.40 ? 14  DC  J N1    1 
ATOM   4739  C  C2    . DC  B 2  87  ? -58.787 -9.777  64.598 1.00 127.45 ? 14  DC  J C2    1 
ATOM   4740  O  O2    . DC  B 2  87  ? -57.708 -9.504  64.052 1.00 122.90 ? 14  DC  J O2    1 
ATOM   4741  N  N3    . DC  B 2  87  ? -59.344 -11.008 64.502 1.00 123.33 ? 14  DC  J N3    1 
ATOM   4742  C  C4    . DC  B 2  87  ? -60.513 -11.259 65.095 1.00 116.72 ? 14  DC  J C4    1 
ATOM   4743  N  N4    . DC  B 2  87  ? -61.029 -12.484 64.969 1.00 115.24 ? 14  DC  J N4    1 
ATOM   4744  C  C5    . DC  B 2  87  ? -61.207 -10.264 65.844 1.00 119.50 ? 14  DC  J C5    1 
ATOM   4745  C  C6    . DC  B 2  87  ? -60.644 -9.050  65.933 1.00 126.03 ? 14  DC  J C6    1 
ATOM   4746  P  P     . DC  B 2  88  ? -58.352 -3.173  64.124 1.00 124.90 ? 15  DC  J P     1 
ATOM   4747  O  OP1   . DC  B 2  88  ? -57.810 -1.929  64.749 1.00 105.86 ? 15  DC  J OP1   1 
ATOM   4748  O  OP2   . DC  B 2  88  ? -59.788 -3.253  63.719 1.00 108.59 ? 15  DC  J OP2   1 
ATOM   4749  O  "O5'" . DC  B 2  88  ? -57.509 -3.498  62.809 1.00 124.05 ? 15  DC  J "O5'" 1 
ATOM   4750  C  "C5'" . DC  B 2  88  ? -56.443 -4.471  62.781 1.00 114.31 ? 15  DC  J "C5'" 1 
ATOM   4751  C  "C4'" . DC  B 2  88  ? -56.573 -5.387  61.584 1.00 101.89 ? 15  DC  J "C4'" 1 
ATOM   4752  O  "O4'" . DC  B 2  88  ? -57.417 -6.518  61.906 1.00 95.78  ? 15  DC  J "O4'" 1 
ATOM   4753  C  "C3'" . DC  B 2  88  ? -57.168 -4.768  60.311 1.00 98.37  ? 15  DC  J "C3'" 1 
ATOM   4754  O  "O3'" . DC  B 2  88  ? -56.370 -5.088  59.164 1.00 101.66 ? 15  DC  J "O3'" 1 
ATOM   4755  C  "C2'" . DC  B 2  88  ? -58.497 -5.485  60.152 1.00 100.06 ? 15  DC  J "C2'" 1 
ATOM   4756  C  "C1'" . DC  B 2  88  ? -58.156 -6.831  60.744 1.00 102.78 ? 15  DC  J "C1'" 1 
ATOM   4757  N  N1    . DC  B 2  88  ? -59.282 -7.687  61.140 1.00 116.39 ? 15  DC  J N1    1 
ATOM   4758  C  C2    . DC  B 2  88  ? -59.412 -8.947  60.547 1.00 119.27 ? 15  DC  J C2    1 
ATOM   4759  O  O2    . DC  B 2  88  ? -58.592 -9.291  59.684 1.00 118.69 ? 15  DC  J O2    1 
ATOM   4760  N  N3    . DC  B 2  88  ? -60.430 -9.754  60.924 1.00 124.62 ? 15  DC  J N3    1 
ATOM   4761  C  C4    . DC  B 2  88  ? -61.295 -9.344  61.855 1.00 118.01 ? 15  DC  J C4    1 
ATOM   4762  N  N4    . DC  B 2  88  ? -62.285 -10.171 62.197 1.00 120.53 ? 15  DC  J N4    1 
ATOM   4763  C  C5    . DC  B 2  88  ? -61.187 -8.065  62.474 1.00 114.91 ? 15  DC  J C5    1 
ATOM   4764  C  C6    . DC  B 2  88  ? -60.174 -7.277  62.091 1.00 120.11 ? 15  DC  J C6    1 
ATOM   4765  P  P     . DT  B 2  89  ? -55.220 -4.078  58.640 1.00 99.71  ? 16  DT  J P     1 
ATOM   4766  O  OP1   . DT  B 2  89  ? -54.641 -3.357  59.816 1.00 81.57  ? 16  DT  J OP1   1 
ATOM   4767  O  OP2   . DT  B 2  89  ? -55.761 -3.337  57.466 1.00 90.48  ? 16  DT  J OP2   1 
ATOM   4768  O  "O5'" . DT  B 2  89  ? -54.119 -5.048  58.017 1.00 97.59  ? 16  DT  J "O5'" 1 
ATOM   4769  C  "C5'" . DT  B 2  89  ? -53.624 -6.208  58.708 1.00 94.26  ? 16  DT  J "C5'" 1 
ATOM   4770  C  "C4'" . DT  B 2  89  ? -53.711 -7.422  57.813 1.00 95.18  ? 16  DT  J "C4'" 1 
ATOM   4771  O  "O4'" . DT  B 2  89  ? -55.086 -7.857  57.716 1.00 100.18 ? 16  DT  J "O4'" 1 
ATOM   4772  C  "C3'" . DT  B 2  89  ? -53.209 -7.222  56.378 1.00 97.22  ? 16  DT  J "C3'" 1 
ATOM   4773  O  "O3'" . DT  B 2  89  ? -52.165 -8.172  56.143 1.00 94.46  ? 16  DT  J "O3'" 1 
ATOM   4774  C  "C2'" . DT  B 2  89  ? -54.437 -7.447  55.507 1.00 102.42 ? 16  DT  J "C2'" 1 
ATOM   4775  C  "C1'" . DT  B 2  89  ? -55.365 -8.262  56.389 1.00 107.00 ? 16  DT  J "C1'" 1 
ATOM   4776  N  N1    . DT  B 2  89  ? -56.812 -8.055  56.147 1.00 114.55 ? 16  DT  J N1    1 
ATOM   4777  C  C2    . DT  B 2  89  ? -57.542 -9.109  55.643 1.00 121.88 ? 16  DT  J C2    1 
ATOM   4778  O  O2    . DT  B 2  89  ? -57.050 -10.191 55.370 1.00 132.14 ? 16  DT  J O2    1 
ATOM   4779  N  N3    . DT  B 2  89  ? -58.877 -8.845  55.463 1.00 117.82 ? 16  DT  J N3    1 
ATOM   4780  C  C4    . DT  B 2  89  ? -59.538 -7.661  55.732 1.00 117.55 ? 16  DT  J C4    1 
ATOM   4781  O  O4    . DT  B 2  89  ? -60.741 -7.573  55.516 1.00 113.75 ? 16  DT  J O4    1 
ATOM   4782  C  C5    . DT  B 2  89  ? -58.712 -6.599  56.262 1.00 109.72 ? 16  DT  J C5    1 
ATOM   4783  C  C7    . DT  B 2  89  ? -59.342 -5.281  56.581 1.00 102.17 ? 16  DT  J C7    1 
ATOM   4784  C  C6    . DT  B 2  89  ? -57.408 -6.847  56.443 1.00 114.44 ? 16  DT  J C6    1 
ATOM   4785  P  P     . DT  B 2  90  ? -51.281 -8.146  54.802 1.00 89.95  ? 17  DT  J P     1 
ATOM   4786  O  OP1   . DT  B 2  90  ? -49.878 -8.407  55.219 1.00 88.26  ? 17  DT  J OP1   1 
ATOM   4787  O  OP2   . DT  B 2  90  ? -51.584 -6.909  54.028 1.00 79.86  ? 17  DT  J OP2   1 
ATOM   4788  O  "O5'" . DT  B 2  90  ? -51.887 -9.377  53.990 1.00 76.93  ? 17  DT  J "O5'" 1 
ATOM   4789  C  "C5'" . DT  B 2  90  ? -52.163 -10.603 54.696 1.00 85.37  ? 17  DT  J "C5'" 1 
ATOM   4790  C  "C4'" . DT  B 2  90  ? -53.032 -11.539 53.888 1.00 88.59  ? 17  DT  J "C4'" 1 
ATOM   4791  O  "O4'" . DT  B 2  90  ? -54.397 -11.058 53.857 1.00 92.22  ? 17  DT  J "O4'" 1 
ATOM   4792  C  "C3'" . DT  B 2  90  ? -52.628 -11.789 52.428 1.00 83.94  ? 17  DT  J "C3'" 1 
ATOM   4793  O  "O3'" . DT  B 2  90  ? -52.702 -13.206 52.177 1.00 83.09  ? 17  DT  J "O3'" 1 
ATOM   4794  C  "C2'" . DT  B 2  90  ? -53.692 -11.049 51.643 1.00 84.01  ? 17  DT  J "C2'" 1 
ATOM   4795  C  "C1'" . DT  B 2  90  ? -54.902 -11.224 52.544 1.00 95.00  ? 17  DT  J "C1'" 1 
ATOM   4796  N  N1    . DT  B 2  90  ? -56.003 -10.254 52.359 1.00 102.38 ? 17  DT  J N1    1 
ATOM   4797  C  C2    . DT  B 2  90  ? -57.269 -10.719 52.074 1.00 97.96  ? 17  DT  J C2    1 
ATOM   4798  O  O2    . DT  B 2  90  ? -57.533 -11.903 51.936 1.00 90.87  ? 17  DT  J O2    1 
ATOM   4799  N  N3    . DT  B 2  90  ? -58.221 -9.739  51.946 1.00 104.65 ? 17  DT  J N3    1 
ATOM   4800  C  C4    . DT  B 2  90  ? -58.038 -8.376  52.068 1.00 105.68 ? 17  DT  J C4    1 
ATOM   4801  O  O4    . DT  B 2  90  ? -58.990 -7.618  51.925 1.00 119.72 ? 17  DT  J O4    1 
ATOM   4802  C  C5    . DT  B 2  90  ? -56.688 -7.959  52.373 1.00 104.52 ? 17  DT  J C5    1 
ATOM   4803  C  C7    . DT  B 2  90  ? -56.397 -6.501  52.539 1.00 98.60  ? 17  DT  J C7    1 
ATOM   4804  C  C6    . DT  B 2  90  ? -55.753 -8.907  52.509 1.00 106.10 ? 17  DT  J C6    1 
ATOM   4805  P  P     . DT  B 2  91  ? -52.140 -13.861 50.818 1.00 70.52  ? 18  DT  J P     1 
ATOM   4806  O  OP1   . DT  B 2  91  ? -51.250 -14.986 51.183 1.00 79.67  ? 18  DT  J OP1   1 
ATOM   4807  O  OP2   . DT  B 2  91  ? -51.691 -12.777 49.895 1.00 64.60  ? 18  DT  J OP2   1 
ATOM   4808  O  "O5'" . DT  B 2  91  ? -53.412 -14.530 50.148 1.00 79.17  ? 18  DT  J "O5'" 1 
ATOM   4809  C  "C5'" . DT  B 2  91  ? -54.429 -15.177 50.928 1.00 86.96  ? 18  DT  J "C5'" 1 
ATOM   4810  C  "C4'" . DT  B 2  91  ? -55.668 -15.335 50.082 1.00 85.56  ? 18  DT  J "C4'" 1 
ATOM   4811  O  "O4'" . DT  B 2  91  ? -56.398 -14.086 50.032 1.00 85.90  ? 18  DT  J "O4'" 1 
ATOM   4812  C  "C3'" . DT  B 2  91  ? -55.385 -15.729 48.629 1.00 85.68  ? 18  DT  J "C3'" 1 
ATOM   4813  O  "O3'" . DT  B 2  91  ? -56.103 -16.943 48.403 1.00 83.89  ? 18  DT  J "O3'" 1 
ATOM   4814  C  "C2'" . DT  B 2  91  ? -55.800 -14.506 47.816 1.00 86.36  ? 18  DT  J "C2'" 1 
ATOM   4815  C  "C1'" . DT  B 2  91  ? -56.834 -13.840 48.706 1.00 91.27  ? 18  DT  J "C1'" 1 
ATOM   4816  N  N1    . DT  B 2  91  ? -56.983 -12.383 48.558 1.00 99.59  ? 18  DT  J N1    1 
ATOM   4817  C  C2    . DT  B 2  91  ? -58.233 -11.843 48.333 1.00 106.29 ? 18  DT  J C2    1 
ATOM   4818  O  O2    . DT  B 2  91  ? -59.238 -12.520 48.172 1.00 107.61 ? 18  DT  J O2    1 
ATOM   4819  N  N3    . DT  B 2  91  ? -58.258 -10.471 48.271 1.00 102.21 ? 18  DT  J N3    1 
ATOM   4820  C  C4    . DT  B 2  91  ? -57.188 -9.609  48.426 1.00 100.46 ? 18  DT  J C4    1 
ATOM   4821  O  O4    . DT  B 2  91  ? -57.360 -8.398  48.340 1.00 94.23  ? 18  DT  J O4    1 
ATOM   4822  C  C5    . DT  B 2  91  ? -55.917 -10.243 48.678 1.00 101.39 ? 18  DT  J C5    1 
ATOM   4823  C  C7    . DT  B 2  91  ? -54.705 -9.388  48.859 1.00 103.44 ? 18  DT  J C7    1 
ATOM   4824  C  C6    . DT  B 2  91  ? -55.880 -11.579 48.742 1.00 100.97 ? 18  DT  J C6    1 
ATOM   4825  P  P     . DT  B 2  92  ? -56.190 -17.566 46.944 1.00 92.55  ? 19  DT  J P     1 
ATOM   4826  O  OP1   . DT  B 2  92  ? -56.410 -19.029 47.086 1.00 78.34  ? 19  DT  J OP1   1 
ATOM   4827  O  OP2   . DT  B 2  92  ? -55.042 -17.046 46.154 1.00 85.84  ? 19  DT  J OP2   1 
ATOM   4828  O  "O5'" . DT  B 2  92  ? -57.508 -16.896 46.339 1.00 105.42 ? 19  DT  J "O5'" 1 
ATOM   4829  C  "C5'" . DT  B 2  92  ? -58.774 -16.894 47.039 1.00 97.07  ? 19  DT  J "C5'" 1 
ATOM   4830  C  "C4'" . DT  B 2  92  ? -59.834 -16.245 46.179 1.00 95.94  ? 19  DT  J "C4'" 1 
ATOM   4831  O  "O4'" . DT  B 2  92  ? -59.738 -14.801 46.281 1.00 91.84  ? 19  DT  J "O4'" 1 
ATOM   4832  C  "C3'" . DT  B 2  92  ? -59.724 -16.571 44.685 1.00 97.34  ? 19  DT  J "C3'" 1 
ATOM   4833  O  "O3'" . DT  B 2  92  ? -61.011 -16.779 44.083 1.00 114.67 ? 19  DT  J "O3'" 1 
ATOM   4834  C  "C2'" . DT  B 2  92  ? -59.074 -15.330 44.109 1.00 94.26  ? 19  DT  J "C2'" 1 
ATOM   4835  C  "C1'" . DT  B 2  92  ? -59.691 -14.253 44.975 1.00 95.90  ? 19  DT  J "C1'" 1 
ATOM   4836  N  N1    . DT  B 2  92  ? -58.950 -12.987 45.038 1.00 99.28  ? 19  DT  J N1    1 
ATOM   4837  C  C2    . DT  B 2  92  ? -59.677 -11.822 45.115 1.00 105.50 ? 19  DT  J C2    1 
ATOM   4838  O  O2    . DT  B 2  92  ? -60.895 -11.796 45.131 1.00 112.90 ? 19  DT  J O2    1 
ATOM   4839  N  N3    . DT  B 2  92  ? -58.921 -10.679 45.167 1.00 111.42 ? 19  DT  J N3    1 
ATOM   4840  C  C4    . DT  B 2  92  ? -57.542 -10.589 45.159 1.00 109.33 ? 19  DT  J C4    1 
ATOM   4841  O  O4    . DT  B 2  92  ? -57.003 -9.488  45.216 1.00 92.42  ? 19  DT  J O4    1 
ATOM   4842  C  C5    . DT  B 2  92  ? -56.842 -11.851 45.077 1.00 109.77 ? 19  DT  J C5    1 
ATOM   4843  C  C7    . DT  B 2  92  ? -55.346 -11.854 45.057 1.00 110.11 ? 19  DT  J C7    1 
ATOM   4844  C  C6    . DT  B 2  92  ? -57.572 -12.972 45.022 1.00 107.75 ? 19  DT  J C6    1 
ATOM   4845  P  P     . DG  B 2  93  ? -61.137 -17.353 42.571 1.00 125.05 ? 20  DG  J P     1 
ATOM   4846  O  OP1   . DG  B 2  93  ? -62.104 -18.481 42.590 1.00 111.68 ? 20  DG  J OP1   1 
ATOM   4847  O  OP2   . DG  B 2  93  ? -59.775 -17.575 42.033 1.00 111.39 ? 20  DG  J OP2   1 
ATOM   4848  O  "O5'" . DG  B 2  93  ? -61.768 -16.132 41.763 1.00 122.18 ? 20  DG  J "O5'" 1 
ATOM   4849  C  "C5'" . DG  B 2  93  ? -63.071 -15.617 42.096 1.00 121.21 ? 20  DG  J "C5'" 1 
ATOM   4850  C  "C4'" . DG  B 2  93  ? -63.340 -14.321 41.364 1.00 122.17 ? 20  DG  J "C4'" 1 
ATOM   4851  O  "O4'" . DG  B 2  93  ? -62.431 -13.291 41.824 1.00 114.98 ? 20  DG  J "O4'" 1 
ATOM   4852  C  "C3'" . DG  B 2  93  ? -63.174 -14.374 39.844 1.00 125.00 ? 20  DG  J "C3'" 1 
ATOM   4853  O  "O3'" . DG  B 2  93  ? -64.222 -13.578 39.271 1.00 136.68 ? 20  DG  J "O3'" 1 
ATOM   4854  C  "C2'" . DG  B 2  93  ? -61.790 -13.787 39.636 1.00 118.66 ? 20  DG  J "C2'" 1 
ATOM   4855  C  "C1'" . DG  B 2  93  ? -61.767 -12.721 40.711 1.00 113.37 ? 20  DG  J "C1'" 1 
ATOM   4856  N  N9    . DG  B 2  93  ? -60.444 -12.293 41.149 1.00 114.47 ? 20  DG  J N9    1 
ATOM   4857  C  C8    . DG  B 2  93  ? -59.370 -13.079 41.491 1.00 109.06 ? 20  DG  J C8    1 
ATOM   4858  N  N7    . DG  B 2  93  ? -58.327 -12.387 41.861 1.00 109.06 ? 20  DG  J N7    1 
ATOM   4859  C  C5    . DG  B 2  93  ? -58.737 -11.065 41.755 1.00 109.12 ? 20  DG  J C5    1 
ATOM   4860  C  C6    . DG  B 2  93  ? -58.038 -9.860  42.022 1.00 111.17 ? 20  DG  J C6    1 
ATOM   4861  O  O6    . DG  B 2  93  ? -56.875 -9.715  42.412 1.00 115.74 ? 20  DG  J O6    1 
ATOM   4862  N  N1    . DG  B 2  93  ? -58.834 -8.743  41.788 1.00 111.33 ? 20  DG  J N1    1 
ATOM   4863  C  C2    . DG  B 2  93  ? -60.136 -8.779  41.353 1.00 104.83 ? 20  DG  J C2    1 
ATOM   4864  N  N2    . DG  B 2  93  ? -60.736 -7.595  41.182 1.00 96.73  ? 20  DG  J N2    1 
ATOM   4865  N  N3    . DG  B 2  93  ? -60.800 -9.895  41.103 1.00 101.02 ? 20  DG  J N3    1 
ATOM   4866  C  C4    . DG  B 2  93  ? -60.043 -10.992 41.320 1.00 111.93 ? 20  DG  J C4    1 
ATOM   4867  P  P     . DA  B 2  94  ? -64.504 -13.557 37.681 1.00 131.70 ? 21  DA  J P     1 
ATOM   4868  O  OP1   . DA  B 2  94  ? -65.468 -14.644 37.361 1.00 125.08 ? 21  DA  J OP1   1 
ATOM   4869  O  OP2   . DA  B 2  94  ? -63.208 -13.500 36.966 1.00 126.61 ? 21  DA  J OP2   1 
ATOM   4870  O  "O5'" . DA  B 2  94  ? -65.221 -12.148 37.483 1.00 131.96 ? 21  DA  J "O5'" 1 
ATOM   4871  C  "C5'" . DA  B 2  94  ? -65.189 -11.124 38.506 1.00 136.84 ? 21  DA  J "C5'" 1 
ATOM   4872  C  "C4'" . DA  B 2  94  ? -65.032 -9.760  37.876 1.00 140.68 ? 21  DA  J "C4'" 1 
ATOM   4873  O  "O4'" . DA  B 2  94  ? -63.758 -9.199  38.273 1.00 136.62 ? 21  DA  J "O4'" 1 
ATOM   4874  C  "C3'" . DA  B 2  94  ? -65.003 -9.757  36.347 1.00 147.50 ? 21  DA  J "C3'" 1 
ATOM   4875  O  "O3'" . DA  B 2  94  ? -65.406 -8.474  35.860 1.00 141.52 ? 21  DA  J "O3'" 1 
ATOM   4876  C  "C2'" . DA  B 2  94  ? -63.533 -9.970  36.060 1.00 145.23 ? 21  DA  J "C2'" 1 
ATOM   4877  C  "C1'" . DA  B 2  94  ? -62.923 -9.077  37.123 1.00 141.61 ? 21  DA  J "C1'" 1 
ATOM   4878  N  N9    . DA  B 2  94  ? -61.566 -9.442  37.509 1.00 135.49 ? 21  DA  J N9    1 
ATOM   4879  C  C8    . DA  B 2  94  ? -60.998 -10.690 37.578 1.00 127.90 ? 21  DA  J C8    1 
ATOM   4880  N  N7    . DA  B 2  94  ? -59.746 -10.679 37.962 1.00 126.88 ? 21  DA  J N7    1 
ATOM   4881  C  C5    . DA  B 2  94  ? -59.467 -9.332  38.148 1.00 127.96 ? 21  DA  J C5    1 
ATOM   4882  C  C6    . DA  B 2  94  ? -58.308 -8.656  38.561 1.00 125.08 ? 21  DA  J C6    1 
ATOM   4883  N  N6    . DA  B 2  94  ? -57.163 -9.269  38.864 1.00 119.91 ? 21  DA  J N6    1 
ATOM   4884  N  N1    . DA  B 2  94  ? -58.366 -7.309  38.653 1.00 123.62 ? 21  DA  J N1    1 
ATOM   4885  C  C2    . DA  B 2  94  ? -59.515 -6.694  38.347 1.00 123.07 ? 21  DA  J C2    1 
ATOM   4886  N  N3    . DA  B 2  94  ? -60.670 -7.221  37.948 1.00 125.81 ? 21  DA  J N3    1 
ATOM   4887  C  C4    . DA  B 2  94  ? -60.578 -8.560  37.871 1.00 129.31 ? 21  DA  J C4    1 
ATOM   4888  P  P     . DT  B 2  95  ? -65.632 -8.216  34.291 1.00 133.82 ? 22  DT  J P     1 
ATOM   4889  O  OP1   . DT  B 2  95  ? -66.927 -8.837  33.905 1.00 128.32 ? 22  DT  J OP1   1 
ATOM   4890  O  OP2   . DT  B 2  95  ? -64.390 -8.573  33.555 1.00 117.64 ? 22  DT  J OP2   1 
ATOM   4891  O  "O5'" . DT  B 2  95  ? -65.759 -6.632  34.234 1.00 136.52 ? 22  DT  J "O5'" 1 
ATOM   4892  C  "C5'" . DT  B 2  95  ? -65.089 -5.812  35.209 1.00 132.56 ? 22  DT  J "C5'" 1 
ATOM   4893  C  "C4'" . DT  B 2  95  ? -63.806 -5.254  34.640 1.00 133.45 ? 22  DT  J "C4'" 1 
ATOM   4894  O  "O4'" . DT  B 2  95  ? -62.647 -5.975  35.124 1.00 137.06 ? 22  DT  J "O4'" 1 
ATOM   4895  C  "C3'" . DT  B 2  95  ? -63.688 -5.253  33.109 1.00 133.26 ? 22  DT  J "C3'" 1 
ATOM   4896  O  "O3'" . DT  B 2  95  ? -63.390 -3.922  32.708 1.00 127.56 ? 22  DT  J "O3'" 1 
ATOM   4897  C  "C2'" . DT  B 2  95  ? -62.455 -6.093  32.831 1.00 133.99 ? 22  DT  J "C2'" 1 
ATOM   4898  C  "C1'" . DT  B 2  95  ? -61.678 -5.850  34.103 1.00 137.48 ? 22  DT  J "C1'" 1 
ATOM   4899  N  N1    . DT  B 2  95  ? -60.569 -6.779  34.380 1.00 133.15 ? 22  DT  J N1    1 
ATOM   4900  C  C2    . DT  B 2  95  ? -59.413 -6.256  34.914 1.00 123.89 ? 22  DT  J C2    1 
ATOM   4901  O  O2    . DT  B 2  95  ? -59.284 -5.075  35.198 1.00 113.05 ? 22  DT  J O2    1 
ATOM   4902  N  N3    . DT  B 2  95  ? -58.411 -7.172  35.115 1.00 123.64 ? 22  DT  J N3    1 
ATOM   4903  C  C4    . DT  B 2  95  ? -58.448 -8.524  34.831 1.00 123.44 ? 22  DT  J C4    1 
ATOM   4904  O  O4    . DT  B 2  95  ? -57.469 -9.224  35.067 1.00 124.60 ? 22  DT  J O4    1 
ATOM   4905  C  C5    . DT  B 2  95  ? -59.685 -9.002  34.260 1.00 127.46 ? 22  DT  J C5    1 
ATOM   4906  C  C7    . DT  B 2  95  ? -59.818 -10.454 33.925 1.00 117.58 ? 22  DT  J C7    1 
ATOM   4907  C  C6    . DT  B 2  95  ? -60.668 -8.116  34.059 1.00 135.46 ? 22  DT  J C6    1 
ATOM   4908  P  P     . DG  B 2  96  ? -63.526 -3.486  31.192 1.00 127.97 ? 23  DG  J P     1 
ATOM   4909  O  OP1   . DG  B 2  96  ? -64.973 -3.451  30.872 1.00 134.90 ? 23  DG  J OP1   1 
ATOM   4910  O  OP2   . DG  B 2  96  ? -62.631 -4.346  30.367 1.00 123.44 ? 23  DG  J OP2   1 
ATOM   4911  O  "O5'" . DG  B 2  96  ? -63.000 -1.983  31.250 1.00 125.71 ? 23  DG  J "O5'" 1 
ATOM   4912  C  "C5'" . DG  B 2  96  ? -62.148 -1.433  30.237 1.00 129.28 ? 23  DG  J "C5'" 1 
ATOM   4913  C  "C4'" . DG  B 2  96  ? -61.024 -0.653  30.875 1.00 130.01 ? 23  DG  J "C4'" 1 
ATOM   4914  O  "O4'" . DG  B 2  96  ? -60.279 -1.507  31.778 1.00 127.44 ? 23  DG  J "O4'" 1 
ATOM   4915  C  "C3'" . DG  B 2  96  ? -60.010 -0.128  29.866 1.00 129.04 ? 23  DG  J "C3'" 1 
ATOM   4916  O  "O3'" . DG  B 2  96  ? -59.516 1.156   30.253 1.00 127.00 ? 23  DG  J "O3'" 1 
ATOM   4917  C  "C2'" . DG  B 2  96  ? -58.963 -1.226  29.832 1.00 130.56 ? 23  DG  J "C2'" 1 
ATOM   4918  C  "C1'" . DG  B 2  96  ? -58.999 -1.813  31.237 1.00 131.84 ? 23  DG  J "C1'" 1 
ATOM   4919  N  N9    . DG  B 2  96  ? -58.839 -3.264  31.244 1.00 132.62 ? 23  DG  J N9    1 
ATOM   4920  C  C8    . DG  B 2  96  ? -59.667 -4.184  30.648 1.00 128.35 ? 23  DG  J C8    1 
ATOM   4921  N  N7    . DG  B 2  96  ? -59.253 -5.414  30.789 1.00 117.13 ? 23  DG  J N7    1 
ATOM   4922  C  C5    . DG  B 2  96  ? -58.070 -5.299  31.506 1.00 122.58 ? 23  DG  J C5    1 
ATOM   4923  C  C6    . DG  B 2  96  ? -57.163 -6.299  31.957 1.00 120.70 ? 23  DG  J C6    1 
ATOM   4924  O  O6    . DG  B 2  96  ? -57.229 -7.527  31.809 1.00 110.04 ? 23  DG  J O6    1 
ATOM   4925  N  N1    . DG  B 2  96  ? -56.093 -5.743  32.648 1.00 120.90 ? 23  DG  J N1    1 
ATOM   4926  C  C2    . DG  B 2  96  ? -55.912 -4.399  32.875 1.00 126.70 ? 23  DG  J C2    1 
ATOM   4927  N  N2    . DG  B 2  96  ? -54.809 -4.059  33.559 1.00 122.60 ? 23  DG  J N2    1 
ATOM   4928  N  N3    . DG  B 2  96  ? -56.746 -3.458  32.459 1.00 127.53 ? 23  DG  J N3    1 
ATOM   4929  C  C4    . DG  B 2  96  ? -57.796 -3.976  31.788 1.00 128.16 ? 23  DG  J C4    1 
ATOM   4930  P  P     . DG  B 2  97  ? -58.248 1.765   29.503 1.00 140.27 ? 24  DG  J P     1 
ATOM   4931  O  OP1   . DG  B 2  97  ? -58.275 3.244   29.664 1.00 132.13 ? 24  DG  J OP1   1 
ATOM   4932  O  OP2   . DG  B 2  97  ? -58.204 1.166   28.138 1.00 123.70 ? 24  DG  J OP2   1 
ATOM   4933  O  "O5'" . DG  B 2  97  ? -57.038 1.167   30.353 1.00 148.18 ? 24  DG  J "O5'" 1 
ATOM   4934  C  "C5'" . DG  B 2  97  ? -55.902 1.954   30.777 1.00 131.93 ? 24  DG  J "C5'" 1 
ATOM   4935  C  "C4'" . DG  B 2  97  ? -54.622 1.259   30.372 1.00 118.62 ? 24  DG  J "C4'" 1 
ATOM   4936  O  "O4'" . DG  B 2  97  ? -54.826 -0.178  30.345 1.00 113.08 ? 24  DG  J "O4'" 1 
ATOM   4937  C  "C3'" . DG  B 2  97  ? -54.124 1.641   28.974 1.00 108.88 ? 24  DG  J "C3'" 1 
ATOM   4938  O  "O3'" . DG  B 2  97  ? -52.703 1.745   28.902 1.00 102.59 ? 24  DG  J "O3'" 1 
ATOM   4939  C  "C2'" . DG  B 2  97  ? -54.561 0.471   28.116 1.00 109.40 ? 24  DG  J "C2'" 1 
ATOM   4940  C  "C1'" . DG  B 2  97  ? -54.411 -0.685  29.086 1.00 116.06 ? 24  DG  J "C1'" 1 
ATOM   4941  N  N9    . DG  B 2  97  ? -55.212 -1.868  28.783 1.00 123.84 ? 24  DG  J N9    1 
ATOM   4942  C  C8    . DG  B 2  97  ? -56.336 -1.939  27.996 1.00 132.10 ? 24  DG  J C8    1 
ATOM   4943  N  N7    . DG  B 2  97  ? -56.820 -3.147  27.902 1.00 134.98 ? 24  DG  J N7    1 
ATOM   4944  C  C5    . DG  B 2  97  ? -55.956 -3.923  28.661 1.00 130.98 ? 24  DG  J C5    1 
ATOM   4945  C  C6    . DG  B 2  97  ? -55.969 -5.317  28.932 1.00 134.04 ? 24  DG  J C6    1 
ATOM   4946  O  O6    . DG  B 2  97  ? -56.776 -6.171  28.544 1.00 129.61 ? 24  DG  J O6    1 
ATOM   4947  N  N1    . DG  B 2  97  ? -54.909 -5.688  29.752 1.00 134.87 ? 24  DG  J N1    1 
ATOM   4948  C  C2    . DG  B 2  97  ? -53.955 -4.832  30.246 1.00 136.15 ? 24  DG  J C2    1 
ATOM   4949  N  N2    . DG  B 2  97  ? -53.010 -5.382  31.023 1.00 134.64 ? 24  DG  J N2    1 
ATOM   4950  N  N3    . DG  B 2  97  ? -53.933 -3.531  30.002 1.00 129.40 ? 24  DG  J N3    1 
ATOM   4951  C  C4    . DG  B 2  97  ? -54.956 -3.149  29.209 1.00 125.32 ? 24  DG  J C4    1 
ATOM   4952  P  P     . DA  B 2  98  ? -51.938 2.990   29.550 1.00 106.92 ? 25  DA  J P     1 
ATOM   4953  O  OP1   . DA  B 2  98  ? -52.646 3.381   30.802 1.00 89.30  ? 25  DA  J OP1   1 
ATOM   4954  O  OP2   . DA  B 2  98  ? -51.715 4.006   28.490 1.00 100.31 ? 25  DA  J OP2   1 
ATOM   4955  O  "O5'" . DA  B 2  98  ? -50.549 2.335   29.970 1.00 101.80 ? 25  DA  J "O5'" 1 
ATOM   4956  C  "C5'" . DA  B 2  98  ? -50.428 1.731   31.274 1.00 110.33 ? 25  DA  J "C5'" 1 
ATOM   4957  C  "C4'" . DA  B 2  98  ? -49.322 0.701   31.340 1.00 109.48 ? 25  DA  J "C4'" 1 
ATOM   4958  O  "O4'" . DA  B 2  98  ? -49.745 -0.554  30.765 1.00 108.45 ? 25  DA  J "O4'" 1 
ATOM   4959  C  "C3'" . DA  B 2  98  ? -48.016 1.055   30.637 1.00 110.56 ? 25  DA  J "C3'" 1 
ATOM   4960  O  "O3'" . DA  B 2  98  ? -46.966 0.507   31.431 1.00 102.77 ? 25  DA  J "O3'" 1 
ATOM   4961  C  "C2'" . DA  B 2  98  ? -48.147 0.382   29.281 1.00 107.73 ? 25  DA  J "C2'" 1 
ATOM   4962  C  "C1'" . DA  B 2  98  ? -49.041 -0.821  29.557 1.00 111.35 ? 25  DA  J "C1'" 1 
ATOM   4963  N  N9    . DA  B 2  98  ? -50.043 -1.123  28.541 1.00 114.28 ? 25  DA  J N9    1 
ATOM   4964  C  C8    . DA  B 2  98  ? -50.768 -0.263  27.753 1.00 124.63 ? 25  DA  J C8    1 
ATOM   4965  N  N7    . DA  B 2  98  ? -51.652 -0.863  26.992 1.00 131.52 ? 25  DA  J N7    1 
ATOM   4966  C  C5    . DA  B 2  98  ? -51.522 -2.204  27.326 1.00 127.44 ? 25  DA  J C5    1 
ATOM   4967  C  C6    . DA  B 2  98  ? -52.179 -3.362  26.871 1.00 128.68 ? 25  DA  J C6    1 
ATOM   4968  N  N6    . DA  B 2  98  ? -53.138 -3.355  25.942 1.00 134.10 ? 25  DA  J N6    1 
ATOM   4969  N  N1    . DA  B 2  98  ? -51.807 -4.545  27.406 1.00 125.40 ? 25  DA  J N1    1 
ATOM   4970  C  C2    . DA  B 2  98  ? -50.844 -4.553  28.339 1.00 119.46 ? 25  DA  J C2    1 
ATOM   4971  N  N3    . DA  B 2  98  ? -50.154 -3.534  28.845 1.00 108.80 ? 25  DA  J N3    1 
ATOM   4972  C  C4    . DA  B 2  98  ? -50.545 -2.375  28.290 1.00 116.90 ? 25  DA  J C4    1 
ATOM   4973  P  P     . DG  B 2  99  ? -45.463 0.913   31.163 1.00 102.94 ? 26  DG  J P     1 
ATOM   4974  O  OP1   . DG  B 2  99  ? -44.770 0.953   32.479 1.00 105.56 ? 26  DG  J OP1   1 
ATOM   4975  O  OP2   . DG  B 2  99  ? -45.465 2.122   30.307 1.00 101.32 ? 26  DG  J OP2   1 
ATOM   4976  O  "O5'" . DG  B 2  99  ? -44.921 -0.341  30.337 1.00 101.76 ? 26  DG  J "O5'" 1 
ATOM   4977  C  "C5'" . DG  B 2  99  ? -44.976 -1.659  30.920 1.00 92.95  ? 26  DG  J "C5'" 1 
ATOM   4978  C  "C4'" . DG  B 2  99  ? -44.821 -2.738  29.875 1.00 88.08  ? 26  DG  J "C4'" 1 
ATOM   4979  O  "O4'" . DG  B 2  99  ? -46.003 -2.801  29.041 1.00 86.43  ? 26  DG  J "O4'" 1 
ATOM   4980  C  "C3'" . DG  B 2  99  ? -43.650 -2.556  28.910 1.00 94.09  ? 26  DG  J "C3'" 1 
ATOM   4981  O  "O3'" . DG  B 2  99  ? -43.111 -3.838  28.550 1.00 96.42  ? 26  DG  J "O3'" 1 
ATOM   4982  C  "C2'" . DG  B 2  99  ? -44.324 -1.980  27.683 1.00 94.25  ? 26  DG  J "C2'" 1 
ATOM   4983  C  "C1'" . DG  B 2  99  ? -45.590 -2.813  27.687 1.00 95.84  ? 26  DG  J "C1'" 1 
ATOM   4984  N  N9    . DG  B 2  99  ? -46.696 -2.334  26.860 1.00 105.74 ? 26  DG  J N9    1 
ATOM   4985  C  C8    . DG  B 2  99  ? -46.968 -1.036  26.501 1.00 111.98 ? 26  DG  J C8    1 
ATOM   4986  N  N7    . DG  B 2  99  ? -48.018 -0.926  25.733 1.00 114.08 ? 26  DG  J N7    1 
ATOM   4987  C  C5    . DG  B 2  99  ? -48.458 -2.231  25.563 1.00 107.45 ? 26  DG  J C5    1 
ATOM   4988  C  C6    . DG  B 2  99  ? -49.557 -2.740  24.827 1.00 109.00 ? 26  DG  J C6    1 
ATOM   4989  O  O6    . DG  B 2  99  ? -50.386 -2.119  24.153 1.00 109.62 ? 26  DG  J O6    1 
ATOM   4990  N  N1    . DG  B 2  99  ? -49.645 -4.125  24.929 1.00 115.05 ? 26  DG  J N1    1 
ATOM   4991  C  C2    . DG  B 2  99  ? -48.779 -4.920  25.639 1.00 106.72 ? 26  DG  J C2    1 
ATOM   4992  N  N2    . DG  B 2  99  ? -49.026 -6.238  25.608 1.00 93.25  ? 26  DG  J N2    1 
ATOM   4993  N  N3    . DG  B 2  99  ? -47.748 -4.457  26.330 1.00 104.12 ? 26  DG  J N3    1 
ATOM   4994  C  C4    . DG  B 2  99  ? -47.652 -3.113  26.252 1.00 104.80 ? 26  DG  J C4    1 
ATOM   4995  P  P     . DC  B 2  100 ? -41.617 -4.251  28.959 1.00 81.91  ? 27  DC  J P     1 
ATOM   4996  O  OP1   . DC  B 2  100 ? -41.389 -3.816  30.347 1.00 73.46  ? 27  DC  J OP1   1 
ATOM   4997  O  OP2   . DC  B 2  100 ? -40.695 -3.832  27.872 1.00 79.64  ? 27  DC  J OP2   1 
ATOM   4998  O  "O5'" . DC  B 2  100 ? -41.632 -5.838  28.876 1.00 87.80  ? 27  DC  J "O5'" 1 
ATOM   4999  C  "C5'" . DC  B 2  100 ? -42.826 -6.601  29.106 1.00 99.64  ? 27  DC  J "C5'" 1 
ATOM   5000  C  "C4'" . DC  B 2  100 ? -43.098 -7.532  27.945 1.00 99.89  ? 27  DC  J "C4'" 1 
ATOM   5001  O  "O4'" . DC  B 2  100 ? -44.039 -6.927  27.026 1.00 101.03 ? 27  DC  J "O4'" 1 
ATOM   5002  C  "C3'" . DC  B 2  100 ? -41.892 -7.896  27.083 1.00 100.47 ? 27  DC  J "C3'" 1 
ATOM   5003  O  "O3'" . DC  B 2  100 ? -42.198 -9.185  26.535 1.00 99.32  ? 27  DC  J "O3'" 1 
ATOM   5004  C  "C2'" . DC  B 2  100 ? -41.929 -6.823  26.009 1.00 97.72  ? 27  DC  J "C2'" 1 
ATOM   5005  C  "C1'" . DC  B 2  100 ? -43.426 -6.799  25.744 1.00 97.37  ? 27  DC  J "C1'" 1 
ATOM   5006  N  N1    . DC  B 2  100 ? -44.011 -5.621  25.091 1.00 97.42  ? 27  DC  J N1    1 
ATOM   5007  C  C2    . DC  B 2  100 ? -45.207 -5.788  24.389 1.00 96.76  ? 27  DC  J C2    1 
ATOM   5008  O  O2    . DC  B 2  100 ? -45.687 -6.926  24.285 1.00 81.86  ? 27  DC  J O2    1 
ATOM   5009  N  N3    . DC  B 2  100 ? -45.803 -4.710  23.829 1.00 100.19 ? 27  DC  J N3    1 
ATOM   5010  C  C4    . DC  B 2  100 ? -45.260 -3.500  23.972 1.00 103.96 ? 27  DC  J C4    1 
ATOM   5011  N  N4    . DC  B 2  100 ? -45.880 -2.465  23.402 1.00 111.38 ? 27  DC  J N4    1 
ATOM   5012  C  C5    . DC  B 2  100 ? -44.050 -3.298  24.698 1.00 101.46 ? 27  DC  J C5    1 
ATOM   5013  C  C6    . DC  B 2  100 ? -43.475 -4.373  25.252 1.00 103.39 ? 27  DC  J C6    1 
ATOM   5014  P  P     . DA  B 2  101 ? -41.033 -10.211 26.128 1.00 106.92 ? 28  DA  J P     1 
ATOM   5015  O  OP1   . DA  B 2  101 ? -40.919 -11.215 27.204 1.00 92.56  ? 28  DA  J OP1   1 
ATOM   5016  O  OP2   . DA  B 2  101 ? -39.849 -9.433  25.634 1.00 83.99  ? 28  DA  J OP2   1 
ATOM   5017  O  "O5'" . DA  B 2  101 ? -41.655 -11.068 24.939 1.00 104.91 ? 28  DA  J "O5'" 1 
ATOM   5018  C  "C5'" . DA  B 2  101 ? -43.068 -11.142 24.713 1.00 108.08 ? 28  DA  J "C5'" 1 
ATOM   5019  C  "C4'" . DA  B 2  101 ? -43.346 -10.940 23.243 1.00 111.71 ? 28  DA  J "C4'" 1 
ATOM   5020  O  "O4'" . DA  B 2  101 ? -43.520 -9.531  22.952 1.00 110.45 ? 28  DA  J "O4'" 1 
ATOM   5021  C  "C3'" . DA  B 2  101 ? -42.235 -11.421 22.305 1.00 110.79 ? 28  DA  J "C3'" 1 
ATOM   5022  O  "O3'" . DA  B 2  101 ? -42.876 -11.997 21.167 1.00 120.96 ? 28  DA  J "O3'" 1 
ATOM   5023  C  "C2'" . DA  B 2  101 ? -41.523 -10.136 21.930 1.00 106.55 ? 28  DA  J "C2'" 1 
ATOM   5024  C  "C1'" . DA  B 2  101 ? -42.710 -9.202  21.838 1.00 107.80 ? 28  DA  J "C1'" 1 
ATOM   5025  N  N9    . DA  B 2  101 ? -42.428 -7.770  21.889 1.00 113.70 ? 28  DA  J N9    1 
ATOM   5026  C  C8    . DA  B 2  101 ? -41.352 -7.110  22.429 1.00 113.63 ? 28  DA  J C8    1 
ATOM   5027  N  N7    . DA  B 2  101 ? -41.409 -5.807  22.293 1.00 112.91 ? 28  DA  J N7    1 
ATOM   5028  C  C5    . DA  B 2  101 ? -42.601 -5.596  21.614 1.00 118.86 ? 28  DA  J C5    1 
ATOM   5029  C  C6    . DA  B 2  101 ? -43.236 -4.428  21.157 1.00 114.14 ? 28  DA  J C6    1 
ATOM   5030  N  N6    . DA  B 2  101 ? -42.743 -3.201  21.331 1.00 113.29 ? 28  DA  J N6    1 
ATOM   5031  N  N1    . DA  B 2  101 ? -44.415 -4.566  20.512 1.00 114.93 ? 28  DA  J N1    1 
ATOM   5032  C  C2    . DA  B 2  101 ? -44.910 -5.798  20.335 1.00 110.36 ? 28  DA  J C2    1 
ATOM   5033  N  N3    . DA  B 2  101 ? -44.407 -6.968  20.716 1.00 112.76 ? 28  DA  J N3    1 
ATOM   5034  C  C4    . DA  B 2  101 ? -43.239 -6.796  21.359 1.00 119.71 ? 28  DA  J C4    1 
ATOM   5035  P  P     . DG  B 2  102 ? -42.126 -13.056 20.247 1.00 124.01 ? 29  DG  J P     1 
ATOM   5036  O  OP1   . DG  B 2  102 ? -42.635 -14.399 20.606 1.00 119.42 ? 29  DG  J OP1   1 
ATOM   5037  O  OP2   . DG  B 2  102 ? -40.671 -12.756 20.269 1.00 116.09 ? 29  DG  J OP2   1 
ATOM   5038  O  "O5'" . DG  B 2  102 ? -42.707 -12.728 18.803 1.00 126.99 ? 29  DG  J "O5'" 1 
ATOM   5039  C  "C5'" . DG  B 2  102 ? -44.130 -12.617 18.598 1.00 122.29 ? 29  DG  J "C5'" 1 
ATOM   5040  C  "C4'" . DG  B 2  102 ? -44.418 -11.726 17.413 1.00 122.08 ? 29  DG  J "C4'" 1 
ATOM   5041  O  "O4'" . DG  B 2  102 ? -44.208 -10.343 17.791 1.00 122.74 ? 29  DG  J "O4'" 1 
ATOM   5042  C  "C3'" . DG  B 2  102 ? -43.535 -11.978 16.186 1.00 127.15 ? 29  DG  J "C3'" 1 
ATOM   5043  O  "O3'" . DG  B 2  102 ? -44.343 -12.056 15.001 1.00 137.59 ? 29  DG  J "O3'" 1 
ATOM   5044  C  "C2'" . DG  B 2  102 ? -42.564 -10.807 16.191 1.00 120.51 ? 29  DG  J "C2'" 1 
ATOM   5045  C  "C1'" . DG  B 2  102 ? -43.359 -9.697  16.857 1.00 118.35 ? 29  DG  J "C1'" 1 
ATOM   5046  N  N9    . DG  B 2  102 ? -42.558 -8.718  17.587 1.00 117.01 ? 29  DG  J N9    1 
ATOM   5047  C  C8    . DG  B 2  102 ? -41.638 -8.979  18.575 1.00 126.94 ? 29  DG  J C8    1 
ATOM   5048  N  N7    . DG  B 2  102 ? -41.078 -7.900  19.050 1.00 131.52 ? 29  DG  J N7    1 
ATOM   5049  C  C5    . DG  B 2  102 ? -41.670 -6.865  18.341 1.00 121.63 ? 29  DG  J C5    1 
ATOM   5050  C  C6    . DG  B 2  102 ? -41.465 -5.463  18.420 1.00 124.98 ? 29  DG  J C6    1 
ATOM   5051  O  O6    . DG  B 2  102 ? -40.694 -4.836  19.157 1.00 136.79 ? 29  DG  J O6    1 
ATOM   5052  N  N1    . DG  B 2  102 ? -42.272 -4.778  17.519 1.00 115.43 ? 29  DG  J N1    1 
ATOM   5053  C  C2    . DG  B 2  102 ? -43.164 -5.364  16.655 1.00 116.53 ? 29  DG  J C2    1 
ATOM   5054  N  N2    . DG  B 2  102 ? -43.852 -4.530  15.866 1.00 118.59 ? 29  DG  J N2    1 
ATOM   5055  N  N3    . DG  B 2  102 ? -43.367 -6.668  16.574 1.00 108.51 ? 29  DG  J N3    1 
ATOM   5056  C  C4    . DG  B 2  102 ? -42.590 -7.353  17.439 1.00 110.58 ? 29  DG  J C4    1 
ATOM   5057  P  P     . DT  B 2  103 ? -43.760 -12.678 13.627 1.00 144.14 ? 30  DT  J P     1 
ATOM   5058  O  OP1   . DT  B 2  103 ? -44.826 -13.525 13.037 1.00 130.18 ? 30  DT  J OP1   1 
ATOM   5059  O  OP2   . DT  B 2  103 ? -42.416 -13.262 13.892 1.00 145.21 ? 30  DT  J OP2   1 
ATOM   5060  O  "O5'" . DT  B 2  103 ? -43.489 -11.396 12.715 1.00 126.46 ? 30  DT  J "O5'" 1 
ATOM   5061  C  "C5'" . DT  B 2  103 ? -44.322 -10.218 12.796 1.00 125.20 ? 30  DT  J "C5'" 1 
ATOM   5062  C  "C4'" . DT  B 2  103 ? -43.758 -9.088  11.964 1.00 125.17 ? 30  DT  J "C4'" 1 
ATOM   5063  O  "O4'" . DT  B 2  103 ? -43.117 -8.117  12.829 1.00 124.58 ? 30  DT  J "O4'" 1 
ATOM   5064  C  "C3'" . DT  B 2  103 ? -42.702 -9.488  10.931 1.00 129.22 ? 30  DT  J "C3'" 1 
ATOM   5065  O  "O3'" . DT  B 2  103 ? -42.879 -8.750  9.716  1.00 131.00 ? 30  DT  J "O3'" 1 
ATOM   5066  C  "C2'" . DT  B 2  103 ? -41.396 -9.119  11.609 1.00 129.37 ? 30  DT  J "C2'" 1 
ATOM   5067  C  "C1'" . DT  B 2  103 ? -41.801 -7.861  12.361 1.00 129.59 ? 30  DT  J "C1'" 1 
ATOM   5068  N  N1    . DT  B 2  103 ? -40.968 -7.470  13.527 1.00 128.99 ? 30  DT  J N1    1 
ATOM   5069  C  C2    . DT  B 2  103 ? -40.818 -6.125  13.787 1.00 120.82 ? 30  DT  J C2    1 
ATOM   5070  O  O2    . DT  B 2  103 ? -41.313 -5.253  13.096 1.00 113.95 ? 30  DT  J O2    1 
ATOM   5071  N  N3    . DT  B 2  103 ? -40.047 -5.836  14.885 1.00 127.24 ? 30  DT  J N3    1 
ATOM   5072  C  C4    . DT  B 2  103 ? -39.434 -6.737  15.735 1.00 134.92 ? 30  DT  J C4    1 
ATOM   5073  O  O4    . DT  B 2  103 ? -38.774 -6.329  16.685 1.00 141.93 ? 30  DT  J O4    1 
ATOM   5074  C  C5    . DT  B 2  103 ? -39.640 -8.131  15.409 1.00 135.40 ? 30  DT  J C5    1 
ATOM   5075  C  C7    . DT  B 2  103 ? -39.012 -9.179  16.272 1.00 135.77 ? 30  DT  J C7    1 
ATOM   5076  C  C6    . DT  B 2  103 ? -40.390 -8.423  14.338 1.00 133.88 ? 30  DT  J C6    1 
ATOM   5077  P  P     . DT  B 2  104 ? -42.426 -9.397  8.325  1.00 140.70 ? 31  DT  J P     1 
ATOM   5078  O  OP1   . DT  B 2  104 ? -43.484 -10.355 7.909  1.00 124.57 ? 31  DT  J OP1   1 
ATOM   5079  O  OP2   . DT  B 2  104 ? -41.020 -9.862  8.474  1.00 136.03 ? 31  DT  J OP2   1 
ATOM   5080  O  "O5'" . DT  B 2  104 ? -42.381 -8.166  7.314  1.00 133.97 ? 31  DT  J "O5'" 1 
ATOM   5081  C  "C5'" . DT  B 2  104 ? -42.889 -6.866  7.663  1.00 134.37 ? 31  DT  J "C5'" 1 
ATOM   5082  C  "C4'" . DT  B 2  104 ? -41.781 -5.837  7.660  1.00 132.89 ? 31  DT  J "C4'" 1 
ATOM   5083  O  "O4'" . DT  B 2  104 ? -41.193 -5.715  8.978  1.00 132.28 ? 31  DT  J "O4'" 1 
ATOM   5084  C  "C3'" . DT  B 2  104 ? -40.610 -6.082  6.695  1.00 127.74 ? 31  DT  J "C3'" 1 
ATOM   5085  O  "O3'" . DT  B 2  104 ? -40.518 -4.947  5.820  1.00 136.14 ? 31  DT  J "O3'" 1 
ATOM   5086  C  "C2'" . DT  B 2  104 ? -39.403 -6.196  7.614  1.00 127.92 ? 31  DT  J "C2'" 1 
ATOM   5087  C  "C1'" . DT  B 2  104 ? -39.843 -5.350  8.789  1.00 130.99 ? 31  DT  J "C1'" 1 
ATOM   5088  N  N1    . DT  B 2  104 ? -39.121 -5.521  10.077 1.00 134.11 ? 31  DT  J N1    1 
ATOM   5089  C  C2    . DT  B 2  104 ? -38.753 -4.384  10.765 1.00 134.78 ? 31  DT  J C2    1 
ATOM   5090  O  O2    . DT  B 2  104 ? -38.989 -3.255  10.366 1.00 134.95 ? 31  DT  J O2    1 
ATOM   5091  N  N3    . DT  B 2  104 ? -38.094 -4.617  11.947 1.00 135.69 ? 31  DT  J N3    1 
ATOM   5092  C  C4    . DT  B 2  104 ? -37.769 -5.843  12.493 1.00 136.05 ? 31  DT  J C4    1 
ATOM   5093  O  O4    . DT  B 2  104 ? -37.175 -5.895  13.565 1.00 137.15 ? 31  DT  J O4    1 
ATOM   5094  C  C5    . DT  B 2  104 ? -38.186 -6.992  11.721 1.00 130.47 ? 31  DT  J C5    1 
ATOM   5095  C  C7    . DT  B 2  104 ? -37.876 -8.362  12.236 1.00 128.59 ? 31  DT  J C7    1 
ATOM   5096  C  C6    . DT  B 2  104 ? -38.831 -6.776  10.567 1.00 132.10 ? 31  DT  J C6    1 
ATOM   5097  P  P     . DT  B 2  105 ? -39.349 -4.823  4.717  1.00 138.26 ? 32  DT  J P     1 
ATOM   5098  O  OP1   . DT  B 2  105 ? -39.975 -4.855  3.374  1.00 137.27 ? 32  DT  J OP1   1 
ATOM   5099  O  OP2   . DT  B 2  105 ? -38.251 -5.764  5.058  1.00 127.36 ? 32  DT  J OP2   1 
ATOM   5100  O  "O5'" . DT  B 2  105 ? -38.785 -3.349  4.922  1.00 137.63 ? 32  DT  J "O5'" 1 
ATOM   5101  C  "C5'" . DT  B 2  105 ? -39.390 -2.407  5.827  1.00 138.10 ? 32  DT  J "C5'" 1 
ATOM   5102  C  "C4'" . DT  B 2  105 ? -38.389 -1.323  6.150  1.00 142.75 ? 32  DT  J "C4'" 1 
ATOM   5103  O  "O4'" . DT  B 2  105 ? -37.734 -1.606  7.411  1.00 143.96 ? 32  DT  J "O4'" 1 
ATOM   5104  C  "C3'" . DT  B 2  105 ? -37.266 -1.176  5.123  1.00 141.82 ? 32  DT  J "C3'" 1 
ATOM   5105  O  "O3'" . DT  B 2  105 ? -37.024 0.222   4.946  1.00 132.02 ? 32  DT  J "O3'" 1 
ATOM   5106  C  "C2'" . DT  B 2  105 ? -36.138 -2.011  5.715  1.00 140.13 ? 32  DT  J "C2'" 1 
ATOM   5107  C  "C1'" . DT  B 2  105 ? -36.345 -1.860  7.217  1.00 138.95 ? 32  DT  J "C1'" 1 
ATOM   5108  N  N1    . DT  B 2  105 ? -35.976 -3.026  8.062  1.00 137.16 ? 32  DT  J N1    1 
ATOM   5109  C  C2    . DT  B 2  105 ? -35.410 -2.771  9.292  1.00 130.49 ? 32  DT  J C2    1 
ATOM   5110  O  O2    . DT  B 2  105 ? -35.167 -1.644  9.691  1.00 120.23 ? 32  DT  J O2    1 
ATOM   5111  N  N3    . DT  B 2  105 ? -35.125 -3.891  10.035 1.00 128.31 ? 32  DT  J N3    1 
ATOM   5112  C  C4    . DT  B 2  105 ? -35.352 -5.209  9.682  1.00 129.11 ? 32  DT  J C4    1 
ATOM   5113  O  O4    . DT  B 2  105 ? -35.036 -6.114  10.451 1.00 122.77 ? 32  DT  J O4    1 
ATOM   5114  C  C5    . DT  B 2  105 ? -35.958 -5.402  8.384  1.00 133.63 ? 32  DT  J C5    1 
ATOM   5115  C  C7    . DT  B 2  105 ? -36.231 -6.795  7.914  1.00 138.29 ? 32  DT  J C7    1 
ATOM   5116  C  C6    . DT  B 2  105 ? -36.239 -4.316  7.650  1.00 133.92 ? 32  DT  J C6    1 
ATOM   5117  P  P     . DC  B 2  106 ? -35.702 0.734   4.230  1.00 142.76 ? 33  DC  J P     1 
ATOM   5118  O  OP1   . DC  B 2  106 ? -36.000 2.062   3.638  1.00 133.51 ? 33  DC  J OP1   1 
ATOM   5119  O  OP2   . DC  B 2  106 ? -35.184 -0.366  3.361  1.00 134.38 ? 33  DC  J OP2   1 
ATOM   5120  O  "O5'" . DC  B 2  106 ? -34.710 0.938   5.462  1.00 139.87 ? 33  DC  J "O5'" 1 
ATOM   5121  C  "C5'" . DC  B 2  106 ? -34.010 2.176   5.685  1.00 128.76 ? 33  DC  J "C5'" 1 
ATOM   5122  C  "C4'" . DC  B 2  106 ? -32.554 1.893   5.972  1.00 129.71 ? 33  DC  J "C4'" 1 
ATOM   5123  O  "O4'" . DC  B 2  106 ? -32.429 0.670   6.733  1.00 125.48 ? 33  DC  J "O4'" 1 
ATOM   5124  C  "C3'" . DC  B 2  106 ? -31.670 1.695   4.738  1.00 127.91 ? 33  DC  J "C3'" 1 
ATOM   5125  O  "O3'" . DC  B 2  106 ? -30.371 2.211   5.016  1.00 128.65 ? 33  DC  J "O3'" 1 
ATOM   5126  C  "C2'" . DC  B 2  106 ? -31.600 0.189   4.600  1.00 122.67 ? 33  DC  J "C2'" 1 
ATOM   5127  C  "C1'" . DC  B 2  106 ? -31.526 -0.196  6.064  1.00 124.07 ? 33  DC  J "C1'" 1 
ATOM   5128  N  N1    . DC  B 2  106 ? -31.892 -1.570  6.407  1.00 121.74 ? 33  DC  J N1    1 
ATOM   5129  C  C2    . DC  B 2  106 ? -31.498 -2.060  7.653  1.00 124.38 ? 33  DC  J C2    1 
ATOM   5130  O  O2    . DC  B 2  106 ? -30.845 -1.322  8.407  1.00 112.71 ? 33  DC  J O2    1 
ATOM   5131  N  N3    . DC  B 2  106 ? -31.827 -3.325  8.001  1.00 126.18 ? 33  DC  J N3    1 
ATOM   5132  C  C4    . DC  B 2  106 ? -32.536 -4.083  7.162  1.00 126.65 ? 33  DC  J C4    1 
ATOM   5133  N  N4    . DC  B 2  106 ? -32.840 -5.324  7.547  1.00 124.53 ? 33  DC  J N4    1 
ATOM   5134  C  C5    . DC  B 2  106 ? -32.960 -3.604  5.888  1.00 125.25 ? 33  DC  J C5    1 
ATOM   5135  C  C6    . DC  B 2  106 ? -32.619 -2.353  5.554  1.00 122.06 ? 33  DC  J C6    1 
ATOM   5136  P  P     . DC  B 2  107 ? -30.115 3.761   4.851  1.00 136.31 ? 34  DC  J P     1 
ATOM   5137  O  OP1   . DC  B 2  107 ? -31.383 4.476   5.156  1.00 128.42 ? 34  DC  J OP1   1 
ATOM   5138  O  OP2   . DC  B 2  107 ? -29.425 3.957   3.551  1.00 135.02 ? 34  DC  J OP2   1 
ATOM   5139  O  "O5'" . DC  B 2  107 ? -29.086 4.118   6.011  1.00 138.67 ? 34  DC  J "O5'" 1 
ATOM   5140  C  "C5'" . DC  B 2  107 ? -29.367 3.923   7.408  1.00 129.14 ? 34  DC  J "C5'" 1 
ATOM   5141  C  "C4'" . DC  B 2  107 ? -28.108 3.449   8.096  1.00 125.31 ? 34  DC  J "C4'" 1 
ATOM   5142  O  "O4'" . DC  B 2  107 ? -28.205 2.017   8.279  1.00 130.13 ? 34  DC  J "O4'" 1 
ATOM   5143  C  "C3'" . DC  B 2  107 ? -26.821 3.658   7.293  1.00 114.76 ? 34  DC  J "C3'" 1 
ATOM   5144  O  "O3'" . DC  B 2  107 ? -25.681 3.687   8.152  1.00 110.23 ? 34  DC  J "O3'" 1 
ATOM   5145  C  "C2'" . DC  B 2  107 ? -26.720 2.371   6.500  1.00 111.54 ? 34  DC  J "C2'" 1 
ATOM   5146  C  "C1'" . DC  B 2  107 ? -27.136 1.388   7.579  1.00 123.69 ? 34  DC  J "C1'" 1 
ATOM   5147  N  N1    . DC  B 2  107 ? -27.596 0.062   7.147  1.00 124.65 ? 34  DC  J N1    1 
ATOM   5148  C  C2    . DC  B 2  107 ? -27.824 -0.911  8.128  1.00 123.98 ? 34  DC  J C2    1 
ATOM   5149  O  O2    . DC  B 2  107 ? -27.637 -0.620  9.319  1.00 118.05 ? 34  DC  J O2    1 
ATOM   5150  N  N3    . DC  B 2  107 ? -28.244 -2.139  7.754  1.00 117.36 ? 34  DC  J N3    1 
ATOM   5151  C  C4    . DC  B 2  107 ? -28.439 -2.412  6.463  1.00 115.54 ? 34  DC  J C4    1 
ATOM   5152  N  N4    . DC  B 2  107 ? -28.858 -3.636  6.143  1.00 115.64 ? 34  DC  J N4    1 
ATOM   5153  C  C5    . DC  B 2  107 ? -28.211 -1.442  5.444  1.00 115.67 ? 34  DC  J C5    1 
ATOM   5154  C  C6    . DC  B 2  107 ? -27.790 -0.231  5.826  1.00 115.15 ? 34  DC  J C6    1 
ATOM   5155  P  P     . DA  B 2  108 ? -24.935 5.055   8.471  1.00 115.23 ? 35  DA  J P     1 
ATOM   5156  O  OP1   . DA  B 2  108 ? -25.922 6.160   8.378  1.00 113.63 ? 35  DA  J OP1   1 
ATOM   5157  O  OP2   . DA  B 2  108 ? -23.668 5.089   7.699  1.00 94.97  ? 35  DA  J OP2   1 
ATOM   5158  O  "O5'" . DA  B 2  108 ? -24.501 4.900   9.996  1.00 126.33 ? 35  DA  J "O5'" 1 
ATOM   5159  C  "C5'" . DA  B 2  108 ? -25.410 4.485   11.035 1.00 116.02 ? 35  DA  J "C5'" 1 
ATOM   5160  C  "C4'" . DA  B 2  108 ? -24.705 3.519   11.958 1.00 106.75 ? 35  DA  J "C4'" 1 
ATOM   5161  O  "O4'" . DA  B 2  108 ? -24.708 2.221   11.331 1.00 96.07  ? 35  DA  J "O4'" 1 
ATOM   5162  C  "C3'" . DA  B 2  108 ? -23.231 3.823   12.220 1.00 105.21 ? 35  DA  J "C3'" 1 
ATOM   5163  O  "O3'" . DA  B 2  108 ? -22.848 3.226   13.465 1.00 107.61 ? 35  DA  J "O3'" 1 
ATOM   5164  C  "C2'" . DA  B 2  108 ? -22.550 3.133   11.056 1.00 98.44  ? 35  DA  J "C2'" 1 
ATOM   5165  C  "C1'" . DA  B 2  108 ? -23.385 1.874   10.938 1.00 98.25  ? 35  DA  J "C1'" 1 
ATOM   5166  N  N9    . DA  B 2  108 ? -23.458 1.326   9.593  1.00 105.53 ? 35  DA  J N9    1 
ATOM   5167  C  C8    . DA  B 2  108 ? -23.227 1.960   8.398  1.00 116.23 ? 35  DA  J C8    1 
ATOM   5168  N  N7    . DA  B 2  108 ? -23.408 1.192   7.351  1.00 116.81 ? 35  DA  J N7    1 
ATOM   5169  C  C5    . DA  B 2  108 ? -23.780 -0.029  7.895  1.00 113.87 ? 35  DA  J C5    1 
ATOM   5170  C  C6    . DA  B 2  108 ? -24.110 -1.263  7.310  1.00 114.59 ? 35  DA  J C6    1 
ATOM   5171  N  N6    . DA  B 2  108 ? -24.112 -1.481  5.995  1.00 110.95 ? 35  DA  J N6    1 
ATOM   5172  N  N1    . DA  B 2  108 ? -24.435 -2.283  8.135  1.00 112.68 ? 35  DA  J N1    1 
ATOM   5173  C  C2    . DA  B 2  108 ? -24.431 -2.064  9.455  1.00 113.67 ? 35  DA  J C2    1 
ATOM   5174  N  N3    . DA  B 2  108 ? -24.143 -0.949  10.123 1.00 106.87 ? 35  DA  J N3    1 
ATOM   5175  C  C4    . DA  B 2  108 ? -23.823 0.042   9.274  1.00 104.13 ? 35  DA  J C4    1 
ATOM   5176  P  P     . DA  B 2  109 ? -21.306 3.158   13.928 1.00 103.93 ? 36  DA  J P     1 
ATOM   5177  O  OP1   . DA  B 2  109 ? -21.181 3.944   15.166 1.00 103.82 ? 36  DA  J OP1   1 
ATOM   5178  O  OP2   . DA  B 2  109 ? -20.411 3.434   12.767 1.00 98.70  ? 36  DA  J OP2   1 
ATOM   5179  O  "O5'" . DA  B 2  109 ? -21.099 1.624   14.287 1.00 97.49  ? 36  DA  J "O5'" 1 
ATOM   5180  C  "C5'" . DA  B 2  109 ? -22.193 0.746   14.606 1.00 90.98  ? 36  DA  J "C5'" 1 
ATOM   5181  C  "C4'" . DA  B 2  109 ? -21.729 -0.670  14.378 1.00 89.84  ? 36  DA  J "C4'" 1 
ATOM   5182  O  "O4'" . DA  B 2  109 ? -21.889 -0.982  12.973 1.00 90.96  ? 36  DA  J "O4'" 1 
ATOM   5183  C  "C3'" . DA  B 2  109 ? -20.239 -0.880  14.667 1.00 92.45  ? 36  DA  J "C3'" 1 
ATOM   5184  O  "O3'" . DA  B 2  109 ? -19.975 -2.243  15.014 1.00 98.73  ? 36  DA  J "O3'" 1 
ATOM   5185  C  "C2'" . DA  B 2  109 ? -19.611 -0.630  13.313 1.00 90.10  ? 36  DA  J "C2'" 1 
ATOM   5186  C  "C1'" . DA  B 2  109 ? -20.619 -1.370  12.470 1.00 94.81  ? 36  DA  J "C1'" 1 
ATOM   5187  N  N9    . DA  B 2  109 ? -20.570 -1.087  11.042 1.00 100.96 ? 36  DA  J N9    1 
ATOM   5188  C  C8    . DA  B 2  109 ? -20.091 0.022   10.387 1.00 103.55 ? 36  DA  J C8    1 
ATOM   5189  N  N7    . DA  B 2  109 ? -20.149 -0.073  9.081  1.00 96.96  ? 36  DA  J N7    1 
ATOM   5190  C  C5    . DA  B 2  109 ? -20.679 -1.337  8.862  1.00 103.94 ? 36  DA  J C5    1 
ATOM   5191  C  C6    . DA  B 2  109 ? -20.986 -2.043  7.688  1.00 103.95 ? 36  DA  J C6    1 
ATOM   5192  N  N6    . DA  B 2  109 ? -20.797 -1.555  6.464  1.00 102.89 ? 36  DA  J N6    1 
ATOM   5193  N  N1    . DA  B 2  109 ? -21.502 -3.286  7.818  1.00 101.49 ? 36  DA  J N1    1 
ATOM   5194  C  C2    . DA  B 2  109 ? -21.694 -3.776  9.048  1.00 99.27  ? 36  DA  J C2    1 
ATOM   5195  N  N3    . DA  B 2  109 ? -21.445 -3.208  10.226 1.00 108.12 ? 36  DA  J N3    1 
ATOM   5196  C  C4    . DA  B 2  109 ? -20.935 -1.975  10.061 1.00 102.55 ? 36  DA  J C4    1 
ATOM   5197  P  P     . DA  B 2  110 ? -18.562 -2.676  15.659 1.00 92.40  ? 37  DA  J P     1 
ATOM   5198  O  OP1   . DA  B 2  110 ? -18.751 -2.724  17.139 1.00 69.77  ? 37  DA  J OP1   1 
ATOM   5199  O  OP2   . DA  B 2  110 ? -17.477 -1.865  15.051 1.00 76.22  ? 37  DA  J OP2   1 
ATOM   5200  O  "O5'" . DA  B 2  110 ? -18.321 -4.132  15.061 1.00 86.07  ? 37  DA  J "O5'" 1 
ATOM   5201  C  "C5'" . DA  B 2  110 ? -19.254 -5.177  15.352 1.00 89.31  ? 37  DA  J "C5'" 1 
ATOM   5202  C  "C4'" . DA  B 2  110 ? -19.295 -6.147  14.198 1.00 92.27  ? 37  DA  J "C4'" 1 
ATOM   5203  O  "O4'" . DA  B 2  110 ? -19.854 -5.494  13.042 1.00 95.57  ? 37  DA  J "O4'" 1 
ATOM   5204  C  "C3'" . DA  B 2  110 ? -17.931 -6.657  13.759 1.00 85.95  ? 37  DA  J "C3'" 1 
ATOM   5205  O  "O3'" . DA  B 2  110 ? -17.677 -7.862  14.477 1.00 79.70  ? 37  DA  J "O3'" 1 
ATOM   5206  C  "C2'" . DA  B 2  110 ? -18.131 -6.935  12.282 1.00 97.04  ? 37  DA  J "C2'" 1 
ATOM   5207  C  "C1'" . DA  B 2  110 ? -19.233 -5.974  11.861 1.00 102.44 ? 37  DA  J "C1'" 1 
ATOM   5208  N  N9    . DA  B 2  110 ? -18.773 -4.820  11.092 1.00 113.81 ? 37  DA  J N9    1 
ATOM   5209  C  C8    . DA  B 2  110 ? -18.334 -3.593  11.530 1.00 114.68 ? 37  DA  J C8    1 
ATOM   5210  N  N7    . DA  B 2  110 ? -18.004 -2.775  10.561 1.00 101.72 ? 37  DA  J N7    1 
ATOM   5211  C  C5    . DA  B 2  110 ? -18.237 -3.512  9.409  1.00 118.17 ? 37  DA  J C5    1 
ATOM   5212  C  C6    . DA  B 2  110 ? -18.083 -3.212  8.046  1.00 125.96 ? 37  DA  J C6    1 
ATOM   5213  N  N6    . DA  B 2  110 ? -17.642 -2.038  7.593  1.00 133.13 ? 37  DA  J N6    1 
ATOM   5214  N  N1    . DA  B 2  110 ? -18.405 -4.171  7.150  1.00 131.11 ? 37  DA  J N1    1 
ATOM   5215  C  C2    . DA  B 2  110 ? -18.855 -5.348  7.604  1.00 128.68 ? 37  DA  J C2    1 
ATOM   5216  N  N3    . DA  B 2  110 ? -19.043 -5.749  8.859  1.00 121.83 ? 37  DA  J N3    1 
ATOM   5217  C  C4    . DA  B 2  110 ? -18.710 -4.773  9.722  1.00 120.52 ? 37  DA  J C4    1 
ATOM   5218  P  P     . DT  B 2  111 ? -16.302 -8.608  14.312 1.00 80.13  ? 38  DT  J P     1 
ATOM   5219  O  OP1   . DT  B 2  111 ? -16.264 -9.736  15.272 1.00 86.29  ? 38  DT  J OP1   1 
ATOM   5220  O  OP2   . DT  B 2  111 ? -15.232 -7.597  14.310 1.00 90.54  ? 38  DT  J OP2   1 
ATOM   5221  O  "O5'" . DT  B 2  111 ? -16.408 -9.245  12.862 1.00 87.10  ? 38  DT  J "O5'" 1 
ATOM   5222  C  "C5'" . DT  B 2  111 ? -17.366 -10.277 12.591 1.00 92.25  ? 38  DT  J "C5'" 1 
ATOM   5223  C  "C4'" . DT  B 2  111 ? -17.219 -10.715 11.155 1.00 95.28  ? 38  DT  J "C4'" 1 
ATOM   5224  O  "O4'" . DT  B 2  111 ? -17.222 -9.545  10.302 1.00 104.31 ? 38  DT  J "O4'" 1 
ATOM   5225  C  "C3'" . DT  B 2  111 ? -15.910 -11.444 10.852 1.00 98.66  ? 38  DT  J "C3'" 1 
ATOM   5226  O  "O3'" . DT  B 2  111 ? -16.150 -12.411 9.825  1.00 108.66 ? 38  DT  J "O3'" 1 
ATOM   5227  C  "C2'" . DT  B 2  111 ? -15.010 -10.332 10.348 1.00 98.80  ? 38  DT  J "C2'" 1 
ATOM   5228  C  "C1'" . DT  B 2  111 ? -16.007 -9.491  9.566  1.00 104.24 ? 38  DT  J "C1'" 1 
ATOM   5229  N  N1    . DT  B 2  111 ? -15.660 -8.071  9.369  1.00 109.79 ? 38  DT  J N1    1 
ATOM   5230  C  C2    . DT  B 2  111 ? -15.978 -7.495  8.159  1.00 114.80 ? 38  DT  J C2    1 
ATOM   5231  O  O2    . DT  B 2  111 ? -16.507 -8.107  7.247  1.00 137.62 ? 38  DT  J O2    1 
ATOM   5232  N  N3    . DT  B 2  111 ? -15.645 -6.169  8.051  1.00 109.73 ? 38  DT  J N3    1 
ATOM   5233  C  C4    . DT  B 2  111 ? -15.042 -5.382  9.012  1.00 109.39 ? 38  DT  J C4    1 
ATOM   5234  O  O4    . DT  B 2  111 ? -14.804 -4.204  8.772  1.00 109.18 ? 38  DT  J O4    1 
ATOM   5235  C  C5    . DT  B 2  111 ? -14.741 -6.048  10.258 1.00 110.89 ? 38  DT  J C5    1 
ATOM   5236  C  C7    . DT  B 2  111 ? -14.094 -5.271  11.360 1.00 107.90 ? 38  DT  J C7    1 
ATOM   5237  C  C6    . DT  B 2  111 ? -15.062 -7.342  10.373 1.00 110.53 ? 38  DT  J C6    1 
ATOM   5238  P  P     . DA  B 2  112 ? -15.083 -13.572 9.511  1.00 116.13 ? 39  DA  J P     1 
ATOM   5239  O  OP1   . DA  B 2  112 ? -15.853 -14.812 9.216  1.00 105.29 ? 39  DA  J OP1   1 
ATOM   5240  O  OP2   . DA  B 2  112 ? -14.048 -13.568 10.580 1.00 90.45  ? 39  DA  J OP2   1 
ATOM   5241  O  "O5'" . DA  B 2  112 ? -14.398 -13.077 8.159  1.00 111.36 ? 39  DA  J "O5'" 1 
ATOM   5242  C  "C5'" . DA  B 2  112 ? -15.189 -12.703 7.009  1.00 113.84 ? 39  DA  J "C5'" 1 
ATOM   5243  C  "C4'" . DA  B 2  112 ? -14.292 -12.326 5.851  1.00 116.64 ? 39  DA  J "C4'" 1 
ATOM   5244  O  "O4'" . DA  B 2  112 ? -14.145 -10.884 5.786  1.00 121.64 ? 39  DA  J "O4'" 1 
ATOM   5245  C  "C3'" . DA  B 2  112 ? -12.873 -12.905 5.906  1.00 118.57 ? 39  DA  J "C3'" 1 
ATOM   5246  O  "O3'" . DA  B 2  112 ? -12.547 -13.506 4.646  1.00 132.93 ? 39  DA  J "O3'" 1 
ATOM   5247  C  "C2'" . DA  B 2  112 ? -11.997 -11.711 6.248  1.00 115.85 ? 39  DA  J "C2'" 1 
ATOM   5248  C  "C1'" . DA  B 2  112 ? -12.773 -10.529 5.692  1.00 118.48 ? 39  DA  J "C1'" 1 
ATOM   5249  N  N9    . DA  B 2  112 ? -12.580 -9.277  6.427  1.00 117.60 ? 39  DA  J N9    1 
ATOM   5250  C  C8    . DA  B 2  112 ? -12.537 -9.108  7.790  1.00 121.70 ? 39  DA  J C8    1 
ATOM   5251  N  N7    . DA  B 2  112 ? -12.355 -7.865  8.162  1.00 123.32 ? 39  DA  J N7    1 
ATOM   5252  C  C5    . DA  B 2  112 ? -12.266 -7.168  6.966  1.00 120.33 ? 39  DA  J C5    1 
ATOM   5253  C  C6    . DA  B 2  112 ? -12.068 -5.807  6.677  1.00 115.62 ? 39  DA  J C6    1 
ATOM   5254  N  N6    . DA  B 2  112 ? -11.917 -4.868  7.612  1.00 113.12 ? 39  DA  J N6    1 
ATOM   5255  N  N1    . DA  B 2  112 ? -12.031 -5.440  5.377  1.00 115.51 ? 39  DA  J N1    1 
ATOM   5256  C  C2    . DA  B 2  112 ? -12.181 -6.384  4.439  1.00 113.29 ? 39  DA  J C2    1 
ATOM   5257  N  N3    . DA  B 2  112 ? -12.372 -7.694  4.586  1.00 113.99 ? 39  DA  J N3    1 
ATOM   5258  C  C4    . DA  B 2  112 ? -12.403 -8.025  5.889  1.00 118.74 ? 39  DA  J C4    1 
ATOM   5259  P  P     . DC  B 2  113 ? -11.176 -14.330 4.449  1.00 130.82 ? 40  DC  J P     1 
ATOM   5260  O  OP1   . DC  B 2  113 ? -11.422 -15.399 3.452  1.00 115.96 ? 40  DC  J OP1   1 
ATOM   5261  O  OP2   . DC  B 2  113 ? -10.629 -14.680 5.785  1.00 127.00 ? 40  DC  J OP2   1 
ATOM   5262  O  "O5'" . DC  B 2  113 ? -10.210 -13.247 3.801  1.00 128.42 ? 40  DC  J "O5'" 1 
ATOM   5263  C  "C5'" . DC  B 2  113 ? -10.707 -12.258 2.882  1.00 135.41 ? 40  DC  J "C5'" 1 
ATOM   5264  C  "C4'" . DC  B 2  113 ? -9.578  -11.334 2.495  1.00 141.30 ? 40  DC  J "C4'" 1 
ATOM   5265  O  "O4'" . DC  B 2  113 ? -9.608  -10.147 3.329  1.00 140.91 ? 40  DC  J "O4'" 1 
ATOM   5266  C  "C3'" . DC  B 2  113 ? -8.183  -11.938 2.686  1.00 147.74 ? 40  DC  J "C3'" 1 
ATOM   5267  O  "O3'" . DC  B 2  113 ? -7.336  -11.513 1.617  1.00 156.26 ? 40  DC  J "O3'" 1 
ATOM   5268  C  "C2'" . DC  B 2  113 ? -7.740  -11.351 4.013  1.00 146.30 ? 40  DC  J "C2'" 1 
ATOM   5269  C  "C1'" . DC  B 2  113 ? -8.316  -9.955  3.886  1.00 140.52 ? 40  DC  J "C1'" 1 
ATOM   5270  N  N1    . DC  B 2  113 ? -8.460  -9.181  5.128  1.00 131.05 ? 40  DC  J N1    1 
ATOM   5271  C  C2    . DC  B 2  113 ? -8.842  -7.839  5.037  1.00 136.79 ? 40  DC  J C2    1 
ATOM   5272  O  O2    . DC  B 2  113 ? -9.055  -7.350  3.919  1.00 143.14 ? 40  DC  J O2    1 
ATOM   5273  N  N3    . DC  B 2  113 ? -8.977  -7.112  6.167  1.00 146.06 ? 40  DC  J N3    1 
ATOM   5274  C  C4    . DC  B 2  113 ? -8.742  -7.675  7.354  1.00 144.19 ? 40  DC  J C4    1 
ATOM   5275  N  N4    . DC  B 2  113 ? -8.889  -6.920  8.442  1.00 145.93 ? 40  DC  J N4    1 
ATOM   5276  C  C5    . DC  B 2  113 ? -8.345  -9.039  7.475  1.00 135.23 ? 40  DC  J C5    1 
ATOM   5277  C  C6    . DC  B 2  113 ? -8.215  -9.747  6.348  1.00 129.47 ? 40  DC  J C6    1 
ATOM   5278  P  P     . DA  B 2  114 ? -5.901  -12.190 1.385  1.00 161.14 ? 41  DA  J P     1 
ATOM   5279  O  OP1   . DA  B 2  114 ? -6.129  -13.582 0.918  1.00 151.21 ? 41  DA  J OP1   1 
ATOM   5280  O  OP2   . DA  B 2  114 ? -5.066  -11.971 2.594  1.00 149.19 ? 41  DA  J OP2   1 
ATOM   5281  O  "O5'" . DA  B 2  114 ? -5.296  -11.298 0.208  1.00 149.82 ? 41  DA  J "O5'" 1 
ATOM   5282  C  "C5'" . DA  B 2  114 ? -5.611  -9.891  0.068  1.00 137.16 ? 41  DA  J "C5'" 1 
ATOM   5283  C  "C4'" . DA  B 2  114 ? -4.359  -9.051  0.178  1.00 143.68 ? 41  DA  J "C4'" 1 
ATOM   5284  O  "O4'" . DA  B 2  114 ? -4.462  -8.177  1.328  1.00 145.56 ? 41  DA  J "O4'" 1 
ATOM   5285  C  "C3'" . DA  B 2  114 ? -3.053  -9.836  0.347  1.00 151.00 ? 41  DA  J "C3'" 1 
ATOM   5286  O  "O3'" . DA  B 2  114 ? -2.106  -9.463  -0.682 1.00 153.57 ? 41  DA  J "O3'" 1 
ATOM   5287  C  "C2'" . DA  B 2  114 ? -2.727  -9.701  1.830  1.00 146.57 ? 41  DA  J "C2'" 1 
ATOM   5288  C  "C1'" . DA  B 2  114 ? -3.381  -8.385  2.233  1.00 145.23 ? 41  DA  J "C1'" 1 
ATOM   5289  N  N9    . DA  B 2  114 ? -3.918  -8.302  3.596  1.00 137.51 ? 41  DA  J N9    1 
ATOM   5290  C  C8    . DA  B 2  114 ? -4.463  -9.296  4.373  1.00 132.98 ? 41  DA  J C8    1 
ATOM   5291  N  N7    . DA  B 2  114 ? -4.890  -8.879  5.540  1.00 132.78 ? 41  DA  J N7    1 
ATOM   5292  C  C5    . DA  B 2  114 ? -4.613  -7.519  5.530  1.00 141.35 ? 41  DA  J C5    1 
ATOM   5293  C  C6    . DA  B 2  114 ? -4.820  -6.504  6.481  1.00 145.66 ? 41  DA  J C6    1 
ATOM   5294  N  N6    . DA  B 2  114 ? -5.376  -6.713  7.675  1.00 146.64 ? 41  DA  J N6    1 
ATOM   5295  N  N1    . DA  B 2  114 ? -4.428  -5.251  6.160  1.00 137.82 ? 41  DA  J N1    1 
ATOM   5296  C  C2    . DA  B 2  114 ? -3.866  -5.043  4.963  1.00 131.93 ? 41  DA  J C2    1 
ATOM   5297  N  N3    . DA  B 2  114 ? -3.616  -5.915  3.987  1.00 133.15 ? 41  DA  J N3    1 
ATOM   5298  C  C4    . DA  B 2  114 ? -4.018  -7.149  4.338  1.00 135.12 ? 41  DA  J C4    1 
ATOM   5299  P  P     . DC  B 2  115 ? -0.904  -8.398  -0.448 1.00 160.34 ? 42  DC  J P     1 
ATOM   5300  O  OP1   . DC  B 2  115 ? -0.330  -8.071  -1.776 1.00 154.30 ? 42  DC  J OP1   1 
ATOM   5301  O  OP2   . DC  B 2  115 ? -0.007  -8.915  0.624  1.00 151.41 ? 42  DC  J OP2   1 
ATOM   5302  O  "O5'" . DC  B 2  115 ? -1.646  -7.066  0.015  1.00 159.59 ? 42  DC  J "O5'" 1 
ATOM   5303  C  "C5'" . DC  B 2  115 ? -1.056  -5.767  -0.212 1.00 153.54 ? 42  DC  J "C5'" 1 
ATOM   5304  C  "C4'" . DC  B 2  115 ? -0.259  -5.317  0.991  1.00 156.62 ? 42  DC  J "C4'" 1 
ATOM   5305  O  "O4'" . DC  B 2  115 ? -0.892  -5.760  2.213  1.00 164.07 ? 42  DC  J "O4'" 1 
ATOM   5306  C  "C3'" . DC  B 2  115 ? 1.193   -5.816  1.056  1.00 157.27 ? 42  DC  J "C3'" 1 
ATOM   5307  O  "O3'" . DC  B 2  115 ? 2.075   -4.721  0.729  1.00 161.97 ? 42  DC  J "O3'" 1 
ATOM   5308  C  "C2'" . DC  B 2  115 ? 1.310   -6.464  2.433  1.00 162.93 ? 42  DC  J "C2'" 1 
ATOM   5309  C  "C1'" . DC  B 2  115 ? 0.120   -5.895  3.188  1.00 164.74 ? 42  DC  J "C1'" 1 
ATOM   5310  N  N1    . DC  B 2  115 ? -0.411  -6.717  4.297  1.00 160.24 ? 42  DC  J N1    1 
ATOM   5311  C  C2    . DC  B 2  115 ? -0.672  -6.102  5.527  1.00 149.06 ? 42  DC  J C2    1 
ATOM   5312  O  O2    . DC  B 2  115 ? -0.451  -4.887  5.651  1.00 141.19 ? 42  DC  J O2    1 
ATOM   5313  N  N3    . DC  B 2  115 ? -1.152  -6.846  6.549  1.00 142.62 ? 42  DC  J N3    1 
ATOM   5314  C  C4    . DC  B 2  115 ? -1.372  -8.151  6.378  1.00 141.92 ? 42  DC  J C4    1 
ATOM   5315  N  N4    . DC  B 2  115 ? -1.848  -8.845  7.412  1.00 144.45 ? 42  DC  J N4    1 
ATOM   5316  C  C5    . DC  B 2  115 ? -1.116  -8.803  5.137  1.00 141.96 ? 42  DC  J C5    1 
ATOM   5317  C  C6    . DC  B 2  115 ? -0.638  -8.056  4.133  1.00 152.21 ? 42  DC  J C6    1 
ATOM   5318  P  P     . DT  B 2  116 ? 3.143   -4.106  1.785  1.00 157.55 ? 43  DT  J P     1 
ATOM   5319  O  OP1   . DT  B 2  116 ? 3.917   -3.047  1.087  1.00 158.25 ? 43  DT  J OP1   1 
ATOM   5320  O  OP2   . DT  B 2  116 ? 3.881   -5.238  2.412  1.00 131.66 ? 43  DT  J OP2   1 
ATOM   5321  O  "O5'" . DT  B 2  116 ? 2.218   -3.346  2.842  1.00 163.27 ? 43  DT  J "O5'" 1 
ATOM   5322  C  "C5'" . DT  B 2  116 ? 2.216   -1.901  2.975  1.00 145.59 ? 43  DT  J "C5'" 1 
ATOM   5323  C  "C4'" . DT  B 2  116 ? 2.797   -1.498  4.311  1.00 141.37 ? 43  DT  J "C4'" 1 
ATOM   5324  O  "O4'" . DT  B 2  116 ? 2.227   -2.335  5.353  1.00 140.87 ? 43  DT  J "O4'" 1 
ATOM   5325  C  "C3'" . DT  B 2  116 ? 4.323   -1.638  4.427  1.00 131.52 ? 43  DT  J "C3'" 1 
ATOM   5326  O  "O3'" . DT  B 2  116 ? 4.902   -0.417  4.929  1.00 129.46 ? 43  DT  J "O3'" 1 
ATOM   5327  C  "C2'" . DT  B 2  116 ? 4.501   -2.872  5.297  1.00 131.60 ? 43  DT  J "C2'" 1 
ATOM   5328  C  "C1'" . DT  B 2  116 ? 3.270   -2.816  6.184  1.00 135.01 ? 43  DT  J "C1'" 1 
ATOM   5329  N  N1    . DT  B 2  116 ? 2.847   -4.111  6.772  1.00 131.73 ? 43  DT  J N1    1 
ATOM   5330  C  C2    . DT  B 2  116 ? 2.450   -4.121  8.092  1.00 128.99 ? 43  DT  J C2    1 
ATOM   5331  O  O2    . DT  B 2  116 ? 2.406   -3.118  8.784  1.00 132.96 ? 43  DT  J O2    1 
ATOM   5332  N  N3    . DT  B 2  116 ? 2.105   -5.358  8.575  1.00 120.93 ? 43  DT  J N3    1 
ATOM   5333  C  C4    . DT  B 2  116 ? 2.118   -6.556  7.889  1.00 114.38 ? 43  DT  J C4    1 
ATOM   5334  O  O4    . DT  B 2  116 ? 1.768   -7.585  8.453  1.00 107.56 ? 43  DT  J O4    1 
ATOM   5335  C  C5    . DT  B 2  116 ? 2.553   -6.475  6.514  1.00 118.06 ? 43  DT  J C5    1 
ATOM   5336  C  C7    . DT  B 2  116 ? 2.598   -7.725  5.693  1.00 111.49 ? 43  DT  J C7    1 
ATOM   5337  C  C6    . DT  B 2  116 ? 2.894   -5.273  6.031  1.00 122.59 ? 43  DT  J C6    1 
ATOM   5338  P  P     . DT  B 2  117 ? 6.079   -0.420  6.048  1.00 126.33 ? 44  DT  J P     1 
ATOM   5339  O  OP1   . DT  B 2  117 ? 6.649   0.949   6.130  1.00 97.16  ? 44  DT  J OP1   1 
ATOM   5340  O  OP2   . DT  B 2  117 ? 6.974   -1.590  5.799  1.00 106.24 ? 44  DT  J OP2   1 
ATOM   5341  O  "O5'" . DT  B 2  117 ? 5.282   -0.581  7.419  1.00 132.97 ? 44  DT  J "O5'" 1 
ATOM   5342  C  "C5'" . DT  B 2  117 ? 4.347   0.432   7.859  1.00 131.06 ? 44  DT  J "C5'" 1 
ATOM   5343  C  "C4'" . DT  B 2  117 ? 4.160   0.380   9.358  1.00 125.72 ? 44  DT  J "C4'" 1 
ATOM   5344  O  "O4'" . DT  B 2  117 ? 3.780   -0.958  9.760  1.00 124.50 ? 44  DT  J "O4'" 1 
ATOM   5345  C  "C3'" . DT  B 2  117 ? 5.405   0.716   10.177 1.00 123.91 ? 44  DT  J "C3'" 1 
ATOM   5346  O  "O3'" . DT  B 2  117 ? 5.015   1.398   11.370 1.00 120.63 ? 44  DT  J "O3'" 1 
ATOM   5347  C  "C2'" . DT  B 2  117 ? 5.993   -0.648  10.482 1.00 122.37 ? 44  DT  J "C2'" 1 
ATOM   5348  C  "C1'" . DT  B 2  117 ? 4.734   -1.478  10.680 1.00 127.00 ? 44  DT  J "C1'" 1 
ATOM   5349  N  N1    . DT  B 2  117 ? 4.875   -2.921  10.412 1.00 124.30 ? 44  DT  J N1    1 
ATOM   5350  C  C2    . DT  B 2  117 ? 4.416   -3.823  11.348 1.00 122.59 ? 44  DT  J C2    1 
ATOM   5351  O  O2    . DT  B 2  117 ? 3.924   -3.491  12.415 1.00 116.87 ? 44  DT  J O2    1 
ATOM   5352  N  N3    . DT  B 2  117 ? 4.578   -5.140  10.997 1.00 118.62 ? 44  DT  J N3    1 
ATOM   5353  C  C4    . DT  B 2  117 ? 5.123   -5.631  9.826  1.00 116.11 ? 44  DT  J C4    1 
ATOM   5354  O  O4    . DT  B 2  117 ? 5.199   -6.843  9.648  1.00 105.66 ? 44  DT  J O4    1 
ATOM   5355  C  C5    . DT  B 2  117 ? 5.574   -4.631  8.889  1.00 122.45 ? 44  DT  J C5    1 
ATOM   5356  C  C7    . DT  B 2  117 ? 6.183   -5.070  7.595  1.00 124.22 ? 44  DT  J C7    1 
ATOM   5357  C  C6    . DT  B 2  117 ? 5.423   -3.344  9.220  1.00 123.21 ? 44  DT  J C6    1 
ATOM   5358  P  P     . DT  B 2  118 ? 6.121   2.102   12.290 1.00 123.58 ? 45  DT  J P     1 
ATOM   5359  O  OP1   . DT  B 2  118 ? 5.879   3.568   12.259 1.00 121.65 ? 45  DT  J OP1   1 
ATOM   5360  O  OP2   . DT  B 2  118 ? 7.450   1.531   11.945 1.00 104.12 ? 45  DT  J OP2   1 
ATOM   5361  O  "O5'" . DT  B 2  118 ? 5.780   1.599   13.761 1.00 125.84 ? 45  DT  J "O5'" 1 
ATOM   5362  C  "C5'" . DT  B 2  118 ? 4.443   1.237   14.154 1.00 119.73 ? 45  DT  J "C5'" 1 
ATOM   5363  C  "C4'" . DT  B 2  118 ? 4.496   0.097   15.144 1.00 100.51 ? 45  DT  J "C4'" 1 
ATOM   5364  O  "O4'" . DT  B 2  118 ? 4.777   -1.144  14.468 1.00 88.85  ? 45  DT  J "O4'" 1 
ATOM   5365  C  "C3'" . DT  B 2  118 ? 5.563   0.241   16.232 1.00 90.17  ? 45  DT  J "C3'" 1 
ATOM   5366  O  "O3'" . DT  B 2  118 ? 4.818   0.437   17.428 1.00 93.57  ? 45  DT  J "O3'" 1 
ATOM   5367  C  "C2'" . DT  B 2  118 ? 6.351   -1.059  16.176 1.00 84.45  ? 45  DT  J "C2'" 1 
ATOM   5368  C  "C1'" . DT  B 2  118 ? 5.450   -1.981  15.380 1.00 94.58  ? 45  DT  J "C1'" 1 
ATOM   5369  N  N1    . DT  B 2  118 ? 6.126   -3.036  14.608 1.00 104.09 ? 45  DT  J N1    1 
ATOM   5370  C  C2    . DT  B 2  118 ? 6.113   -4.319  15.105 1.00 111.75 ? 45  DT  J C2    1 
ATOM   5371  O  O2    . DT  B 2  118 ? 5.587   -4.619  16.164 1.00 126.66 ? 45  DT  J O2    1 
ATOM   5372  N  N3    . DT  B 2  118 ? 6.748   -5.245  14.316 1.00 113.08 ? 45  DT  J N3    1 
ATOM   5373  C  C4    . DT  B 2  118 ? 7.375   -5.019  13.107 1.00 114.76 ? 45  DT  J C4    1 
ATOM   5374  O  O4    . DT  B 2  118 ? 7.904   -5.951  12.513 1.00 108.85 ? 45  DT  J O4    1 
ATOM   5375  C  C5    . DT  B 2  118 ? 7.347   -3.651  12.642 1.00 116.95 ? 45  DT  J C5    1 
ATOM   5376  C  C7    . DT  B 2  118 ? 8.015   -3.309  11.347 1.00 110.77 ? 45  DT  J C7    1 
ATOM   5377  C  C6    . DT  B 2  118 ? 6.731   -2.740  13.406 1.00 116.43 ? 45  DT  J C6    1 
ATOM   5378  P  P     . DT  B 2  119 ? 5.537   0.698   18.803 1.00 98.48  ? 46  DT  J P     1 
ATOM   5379  O  OP1   . DT  B 2  119 ? 4.945   1.924   19.387 1.00 92.49  ? 46  DT  J OP1   1 
ATOM   5380  O  OP2   . DT  B 2  119 ? 7.008   0.566   18.612 1.00 96.13  ? 46  DT  J OP2   1 
ATOM   5381  O  "O5'" . DT  B 2  119 ? 5.034   -0.532  19.668 1.00 112.14 ? 46  DT  J "O5'" 1 
ATOM   5382  C  "C5'" . DT  B 2  119 ? 4.096   -1.478  19.122 1.00 104.79 ? 46  DT  J "C5'" 1 
ATOM   5383  C  "C4'" . DT  B 2  119 ? 4.291   -2.813  19.797 1.00 99.41  ? 46  DT  J "C4'" 1 
ATOM   5384  O  "O4'" . DT  B 2  119 ? 5.056   -3.690  18.943 1.00 96.19  ? 46  DT  J "O4'" 1 
ATOM   5385  C  "C3'" . DT  B 2  119 ? 5.028   -2.741  21.135 1.00 97.93  ? 46  DT  J "C3'" 1 
ATOM   5386  O  "O3'" . DT  B 2  119 ? 4.099   -3.280  22.076 1.00 102.32 ? 46  DT  J "O3'" 1 
ATOM   5387  C  "C2'" . DT  B 2  119 ? 6.346   -3.471  20.895 1.00 94.05  ? 46  DT  J "C2'" 1 
ATOM   5388  C  "C1'" . DT  B 2  119 ? 6.096   -4.325  19.664 1.00 96.33  ? 46  DT  J "C1'" 1 
ATOM   5389  N  N1    . DT  B 2  119 ? 7.238   -4.461  18.746 1.00 96.07  ? 46  DT  J N1    1 
ATOM   5390  C  C2    . DT  B 2  119 ? 7.609   -5.714  18.312 1.00 97.63  ? 46  DT  J C2    1 
ATOM   5391  O  O2    . DT  B 2  119 ? 7.081   -6.740  18.702 1.00 85.00  ? 46  DT  J O2    1 
ATOM   5392  N  N3    . DT  B 2  119 ? 8.652   -5.725  17.422 1.00 112.18 ? 46  DT  J N3    1 
ATOM   5393  C  C4    . DT  B 2  119 ? 9.331   -4.631  16.919 1.00 119.36 ? 46  DT  J C4    1 
ATOM   5394  O  O4    . DT  B 2  119 ? 10.251  -4.798  16.126 1.00 128.41 ? 46  DT  J O4    1 
ATOM   5395  C  C5    . DT  B 2  119 ? 8.871   -3.346  17.397 1.00 114.46 ? 46  DT  J C5    1 
ATOM   5396  C  C7    . DT  B 2  119 ? 9.543   -2.104  16.904 1.00 111.82 ? 46  DT  J C7    1 
ATOM   5397  C  C6    . DT  B 2  119 ? 7.856   -3.326  18.268 1.00 108.13 ? 46  DT  J C6    1 
ATOM   5398  P  P     . DG  B 2  120 ? 4.439   -3.363  23.634 1.00 110.18 ? 47  DG  J P     1 
ATOM   5399  O  OP1   . DG  B 2  120 ? 3.504   -2.449  24.348 1.00 98.23  ? 47  DG  J OP1   1 
ATOM   5400  O  OP2   . DG  B 2  120 ? 5.920   -3.249  23.820 1.00 83.41  ? 47  DG  J OP2   1 
ATOM   5401  O  "O5'" . DG  B 2  120 ? 4.036   -4.865  23.977 1.00 99.42  ? 47  DG  J "O5'" 1 
ATOM   5402  C  "C5'" . DG  B 2  120 ? 4.037   -5.874  22.948 1.00 92.74  ? 47  DG  J "C5'" 1 
ATOM   5403  C  "C4'" . DG  B 2  120 ? 4.670   -7.150  23.449 1.00 87.94  ? 47  DG  J "C4'" 1 
ATOM   5404  O  "O4'" . DG  B 2  120 ? 5.888   -7.425  22.727 1.00 97.67  ? 47  DG  J "O4'" 1 
ATOM   5405  C  "C3'" . DG  B 2  120 ? 5.021   -7.190  24.937 1.00 90.11  ? 47  DG  J "C3'" 1 
ATOM   5406  O  "O3'" . DG  B 2  120 ? 4.277   -8.306  25.467 1.00 85.91  ? 47  DG  J "O3'" 1 
ATOM   5407  C  "C2'" . DG  B 2  120 ? 6.541   -7.085  24.980 1.00 91.25  ? 47  DG  J "C2'" 1 
ATOM   5408  C  "C1'" . DG  B 2  120 ? 7.018   -7.464  23.588 1.00 99.87  ? 47  DG  J "C1'" 1 
ATOM   5409  N  N9    . DG  B 2  120 ? 8.053   -6.630  22.981 1.00 109.96 ? 47  DG  J N9    1 
ATOM   5410  C  C8    . DG  B 2  120 ? 8.378   -5.321  23.247 1.00 114.43 ? 47  DG  J C8    1 
ATOM   5411  N  N7    . DG  B 2  120 ? 9.321   -4.861  22.469 1.00 114.77 ? 47  DG  J N7    1 
ATOM   5412  C  C5    . DG  B 2  120 ? 9.617   -5.922  21.626 1.00 115.81 ? 47  DG  J C5    1 
ATOM   5413  C  C6    . DG  B 2  120 ? 10.559  -6.026  20.567 1.00 119.22 ? 47  DG  J C6    1 
ATOM   5414  O  O6    . DG  B 2  120 ? 11.351  -5.171  20.153 1.00 116.16 ? 47  DG  J O6    1 
ATOM   5415  N  N1    . DG  B 2  120 ? 10.526  -7.285  19.975 1.00 118.60 ? 47  DG  J N1    1 
ATOM   5416  C  C2    . DG  B 2  120 ? 9.692   -8.312  20.349 1.00 111.48 ? 47  DG  J C2    1 
ATOM   5417  N  N2    . DG  B 2  120 ? 9.800   -9.452  19.656 1.00 107.89 ? 47  DG  J N2    1 
ATOM   5418  N  N3    . DG  B 2  120 ? 8.818   -8.229  21.334 1.00 118.16 ? 47  DG  J N3    1 
ATOM   5419  C  C4    . DG  B 2  120 ? 8.833   -7.016  21.923 1.00 113.62 ? 47  DG  J C4    1 
ATOM   5420  P  P     . DG  B 2  121 ? 4.938   -9.480  26.333 1.00 82.64  ? 48  DG  J P     1 
ATOM   5421  O  OP1   . DG  B 2  121 ? 3.823   -10.359 26.776 1.00 78.82  ? 48  DG  J OP1   1 
ATOM   5422  O  OP2   . DG  B 2  121 ? 5.883   -8.893  27.317 1.00 65.26  ? 48  DG  J OP2   1 
ATOM   5423  O  "O5'" . DG  B 2  121 ? 5.804   -10.282 25.264 1.00 83.75  ? 48  DG  J "O5'" 1 
ATOM   5424  C  "C5'" . DG  B 2  121 ? 6.025   -11.688 25.409 1.00 76.58  ? 48  DG  J "C5'" 1 
ATOM   5425  C  "C4'" . DG  B 2  121 ? 7.397   -12.058 24.902 1.00 73.31  ? 48  DG  J "C4'" 1 
ATOM   5426  O  "O4'" . DG  B 2  121 ? 8.070   -10.908 24.344 1.00 79.14  ? 48  DG  J "O4'" 1 
ATOM   5427  C  "C3'" . DG  B 2  121 ? 8.330   -12.618 25.979 1.00 75.77  ? 48  DG  J "C3'" 1 
ATOM   5428  O  "O3'" . DG  B 2  121 ? 8.458   -14.021 25.751 1.00 72.41  ? 48  DG  J "O3'" 1 
ATOM   5429  C  "C2'" . DG  B 2  121 ? 9.621   -11.826 25.821 1.00 82.66  ? 48  DG  J "C2'" 1 
ATOM   5430  C  "C1'" . DG  B 2  121 ? 9.459   -11.123 24.482 1.00 87.48  ? 48  DG  J "C1'" 1 
ATOM   5431  N  N9    . DG  B 2  121 ? 10.140  -9.836  24.343 1.00 101.75 ? 48  DG  J N9    1 
ATOM   5432  C  C8    . DG  B 2  121 ? 9.957   -8.699  25.093 1.00 113.92 ? 48  DG  J C8    1 
ATOM   5433  N  N7    . DG  B 2  121 ? 10.721  -7.708  24.717 1.00 111.73 ? 48  DG  J N7    1 
ATOM   5434  C  C5    . DG  B 2  121 ? 11.449  -8.222  23.653 1.00 115.73 ? 48  DG  J C5    1 
ATOM   5435  C  C6    . DG  B 2  121 ? 12.438  -7.614  22.834 1.00 113.50 ? 48  DG  J C6    1 
ATOM   5436  O  O6    . DG  B 2  121 ? 12.883  -6.459  22.887 1.00 98.18  ? 48  DG  J O6    1 
ATOM   5437  N  N1    . DG  B 2  121 ? 12.914  -8.496  21.870 1.00 116.93 ? 48  DG  J N1    1 
ATOM   5438  C  C2    . DG  B 2  121 ? 12.498  -9.797  21.715 1.00 114.75 ? 48  DG  J C2    1 
ATOM   5439  N  N2    . DG  B 2  121 ? 13.083  -10.493 20.733 1.00 128.89 ? 48  DG  J N2    1 
ATOM   5440  N  N3    . DG  B 2  121 ? 11.586  -10.376 22.474 1.00 112.39 ? 48  DG  J N3    1 
ATOM   5441  C  C4    . DG  B 2  121 ? 11.103  -9.535  23.412 1.00 112.50 ? 48  DG  J C4    1 
ATOM   5442  P  P     . DT  B 2  122 ? 9.222   -14.950 26.798 1.00 88.34  ? 49  DT  J P     1 
ATOM   5443  O  OP1   . DT  B 2  122 ? 8.468   -16.233 26.890 1.00 75.96  ? 49  DT  J OP1   1 
ATOM   5444  O  OP2   . DT  B 2  122 ? 9.559   -14.155 28.001 1.00 77.20  ? 49  DT  J OP2   1 
ATOM   5445  O  "O5'" . DT  B 2  122 ? 10.658  -15.149 26.142 1.00 98.93  ? 49  DT  J "O5'" 1 
ATOM   5446  C  "C5'" . DT  B 2  122 ? 10.827  -15.127 24.713 1.00 107.44 ? 49  DT  J "C5'" 1 
ATOM   5447  C  "C4'" . DT  B 2  122 ? 12.294  -15.180 24.358 1.00 107.11 ? 49  DT  J "C4'" 1 
ATOM   5448  O  "O4'" . DT  B 2  122 ? 12.771  -13.844 24.068 1.00 98.76  ? 49  DT  J "O4'" 1 
ATOM   5449  C  "C3'" . DT  B 2  122 ? 13.218  -15.726 25.449 1.00 111.37 ? 49  DT  J "C3'" 1 
ATOM   5450  O  "O3'" . DT  B 2  122 ? 14.264  -16.424 24.767 1.00 127.87 ? 49  DT  J "O3'" 1 
ATOM   5451  C  "C2'" . DT  B 2  122 ? 13.735  -14.459 26.105 1.00 104.56 ? 49  DT  J "C2'" 1 
ATOM   5452  C  "C1'" . DT  B 2  122 ? 13.899  -13.574 24.879 1.00 100.59 ? 49  DT  J "C1'" 1 
ATOM   5453  N  N1    . DT  B 2  122 ? 13.971  -12.115 25.084 1.00 105.23 ? 49  DT  J N1    1 
ATOM   5454  C  C2    . DT  B 2  122 ? 14.359  -11.350 24.008 1.00 112.78 ? 49  DT  J C2    1 
ATOM   5455  O  O2    . DT  B 2  122 ? 14.615  -11.823 22.914 1.00 107.66 ? 49  DT  J O2    1 
ATOM   5456  N  N3    . DT  B 2  122 ? 14.430  -10.001 24.259 1.00 112.61 ? 49  DT  J N3    1 
ATOM   5457  C  C4    . DT  B 2  122 ? 14.158  -9.360  25.453 1.00 107.02 ? 49  DT  J C4    1 
ATOM   5458  O  O4    . DT  B 2  122 ? 14.265  -8.140  25.531 1.00 105.06 ? 49  DT  J O4    1 
ATOM   5459  C  C5    . DT  B 2  122 ? 13.760  -10.225 26.540 1.00 108.31 ? 49  DT  J C5    1 
ATOM   5460  C  C7    . DT  B 2  122 ? 13.453  -9.622  27.873 1.00 109.90 ? 49  DT  J C7    1 
ATOM   5461  C  C6    . DT  B 2  122 ? 13.687  -11.541 26.305 1.00 108.08 ? 49  DT  J C6    1 
ATOM   5462  P  P     . DA  B 2  123 ? 14.906  -17.790 25.331 1.00 131.80 ? 50  DA  J P     1 
ATOM   5463  O  OP1   . DA  B 2  123 ? 14.143  -18.940 24.761 1.00 116.14 ? 50  DA  J OP1   1 
ATOM   5464  O  OP2   . DA  B 2  123 ? 15.103  -17.657 26.805 1.00 105.88 ? 50  DA  J OP2   1 
ATOM   5465  O  "O5'" . DA  B 2  123 ? 16.330  -17.778 24.618 1.00 130.26 ? 50  DA  J "O5'" 1 
ATOM   5466  C  "C5'" . DA  B 2  123 ? 16.592  -16.860 23.528 1.00 126.22 ? 50  DA  J "C5'" 1 
ATOM   5467  C  "C4'" . DA  B 2  123 ? 17.823  -16.025 23.799 1.00 125.94 ? 50  DA  J "C4'" 1 
ATOM   5468  O  "O4'" . DA  B 2  123 ? 17.491  -14.653 24.120 1.00 122.50 ? 50  DA  J "O4'" 1 
ATOM   5469  C  "C3'" . DA  B 2  123 ? 18.736  -16.515 24.930 1.00 133.70 ? 50  DA  J "C3'" 1 
ATOM   5470  O  "O3'" . DA  B 2  123 ? 19.979  -16.827 24.292 1.00 149.26 ? 50  DA  J "O3'" 1 
ATOM   5471  C  "C2'" . DA  B 2  123 ? 18.798  -15.337 25.893 1.00 131.12 ? 50  DA  J "C2'" 1 
ATOM   5472  C  "C1'" . DA  B 2  123 ? 18.517  -14.176 24.968 1.00 125.88 ? 50  DA  J "C1'" 1 
ATOM   5473  N  N9    . DA  B 2  123 ? 18.057  -12.938 25.595 1.00 120.02 ? 50  DA  J N9    1 
ATOM   5474  C  C8    . DA  B 2  123 ? 17.089  -12.773 26.555 1.00 118.25 ? 50  DA  J C8    1 
ATOM   5475  N  N7    . DA  B 2  123 ? 16.896  -11.524 26.900 1.00 117.04 ? 50  DA  J N7    1 
ATOM   5476  C  C5    . DA  B 2  123 ? 17.792  -10.818 26.110 1.00 120.08 ? 50  DA  J C5    1 
ATOM   5477  C  C6    . DA  B 2  123 ? 18.078  -9.446  26.000 1.00 123.23 ? 50  DA  J C6    1 
ATOM   5478  N  N6    . DA  B 2  123 ? 17.464  -8.504  26.719 1.00 122.01 ? 50  DA  J N6    1 
ATOM   5479  N  N1    . DA  B 2  123 ? 19.039  -9.072  25.125 1.00 118.87 ? 50  DA  J N1    1 
ATOM   5480  C  C2    . DA  B 2  123 ? 19.660  -10.020 24.411 1.00 115.63 ? 50  DA  J C2    1 
ATOM   5481  N  N3    . DA  B 2  123 ? 19.478  -11.340 24.426 1.00 113.70 ? 50  DA  J N3    1 
ATOM   5482  C  C4    . DA  B 2  123 ? 18.520  -11.677 25.308 1.00 118.80 ? 50  DA  J C4    1 
ATOM   5483  P  P     . DG  B 2  124 ? 21.238  -17.373 25.116 1.00 154.95 ? 51  DG  J P     1 
ATOM   5484  O  OP1   . DG  B 2  124 ? 21.445  -18.798 24.742 1.00 125.55 ? 51  DG  J OP1   1 
ATOM   5485  O  OP2   . DG  B 2  124 ? 21.081  -16.989 26.547 1.00 151.25 ? 51  DG  J OP2   1 
ATOM   5486  O  "O5'" . DG  B 2  124 ? 22.443  -16.529 24.506 1.00 146.82 ? 51  DG  J "O5'" 1 
ATOM   5487  C  "C5'" . DG  B 2  124 ? 22.225  -15.300 23.780 1.00 141.92 ? 51  DG  J "C5'" 1 
ATOM   5488  C  "C4'" . DG  B 2  124 ? 23.158  -14.229 24.293 1.00 143.89 ? 51  DG  J "C4'" 1 
ATOM   5489  O  "O4'" . DG  B 2  124 ? 22.387  -13.155 24.885 1.00 141.42 ? 51  DG  J "O4'" 1 
ATOM   5490  C  "C3'" . DG  B 2  124 ? 24.124  -14.693 25.386 1.00 145.09 ? 51  DG  J "C3'" 1 
ATOM   5491  O  "O3'" . DG  B 2  124 ? 25.381  -14.034 25.231 1.00 159.77 ? 51  DG  J "O3'" 1 
ATOM   5492  C  "C2'" . DG  B 2  124 ? 23.444  -14.236 26.660 1.00 138.59 ? 51  DG  J "C2'" 1 
ATOM   5493  C  "C1'" . DG  B 2  124 ? 22.876  -12.916 26.195 1.00 138.11 ? 51  DG  J "C1'" 1 
ATOM   5494  N  N9    . DG  B 2  124 ? 21.780  -12.385 26.991 1.00 133.01 ? 51  DG  J N9    1 
ATOM   5495  C  C8    . DG  B 2  124 ? 20.815  -13.084 27.674 1.00 130.99 ? 51  DG  J C8    1 
ATOM   5496  N  N7    . DG  B 2  124 ? 19.960  -12.310 28.285 1.00 127.76 ? 51  DG  J N7    1 
ATOM   5497  C  C5    . DG  B 2  124 ? 20.391  -11.025 27.991 1.00 130.17 ? 51  DG  J C5    1 
ATOM   5498  C  C6    . DG  B 2  124 ? 19.866  -9.769  28.384 1.00 129.17 ? 51  DG  J C6    1 
ATOM   5499  O  O6    . DG  B 2  124 ? 18.877  -9.533  29.086 1.00 115.52 ? 51  DG  J O6    1 
ATOM   5500  N  N1    . DG  B 2  124 ? 20.606  -8.716  27.854 1.00 137.11 ? 51  DG  J N1    1 
ATOM   5501  C  C2    . DG  B 2  124 ? 21.715  -8.855  27.054 1.00 144.98 ? 51  DG  J C2    1 
ATOM   5502  N  N2    . DG  B 2  124 ? 22.299  -7.718  26.647 1.00 148.23 ? 51  DG  J N2    1 
ATOM   5503  N  N3    . DG  B 2  124 ? 22.219  -10.021 26.689 1.00 143.04 ? 51  DG  J N3    1 
ATOM   5504  C  C4    . DG  B 2  124 ? 21.512  -11.056 27.190 1.00 136.00 ? 51  DG  J C4    1 
ATOM   5505  P  P     . DT  B 2  125 ? 26.690  -14.604 25.960 1.00 169.63 ? 52  DT  J P     1 
ATOM   5506  O  OP1   . DT  B 2  125 ? 27.636  -15.066 24.912 1.00 165.31 ? 52  DT  J OP1   1 
ATOM   5507  O  OP2   . DT  B 2  125 ? 26.260  -15.539 27.033 1.00 162.36 ? 52  DT  J OP2   1 
ATOM   5508  O  "O5'" . DT  B 2  125 ? 27.306  -13.313 26.658 1.00 156.24 ? 52  DT  J "O5'" 1 
ATOM   5509  C  "C5'" . DT  B 2  125 ? 27.316  -12.034 26.000 1.00 156.89 ? 52  DT  J "C5'" 1 
ATOM   5510  C  "C4'" . DT  B 2  125 ? 27.453  -10.943 27.034 1.00 164.46 ? 52  DT  J "C4'" 1 
ATOM   5511  O  "O4'" . DT  B 2  125 ? 26.137  -10.537 27.492 1.00 165.35 ? 52  DT  J "O4'" 1 
ATOM   5512  C  "C3'" . DT  B 2  125 ? 28.230  -11.360 28.292 1.00 169.37 ? 52  DT  J "C3'" 1 
ATOM   5513  O  "O3'" . DT  B 2  125 ? 29.206  -10.355 28.605 1.00 176.07 ? 52  DT  J "O3'" 1 
ATOM   5514  C  "C2'" . DT  B 2  125 ? 27.131  -11.545 29.323 1.00 164.99 ? 52  DT  J "C2'" 1 
ATOM   5515  C  "C1'" . DT  B 2  125 ? 26.193  -10.440 28.902 1.00 165.78 ? 52  DT  J "C1'" 1 
ATOM   5516  N  N1    . DT  B 2  125 ? 24.820  -10.486 29.438 1.00 167.06 ? 52  DT  J N1    1 
ATOM   5517  C  C2    . DT  B 2  125 ? 24.056  -9.345  29.330 1.00 160.39 ? 52  DT  J C2    1 
ATOM   5518  O  O2    . DT  B 2  125 ? 24.445  -8.333  28.769 1.00 151.14 ? 52  DT  J O2    1 
ATOM   5519  N  N3    . DT  B 2  125 ? 22.807  -9.437  29.893 1.00 152.44 ? 52  DT  J N3    1 
ATOM   5520  C  C4    . DT  B 2  125 ? 22.267  -10.526 30.551 1.00 149.36 ? 52  DT  J C4    1 
ATOM   5521  O  O4    . DT  B 2  125 ? 21.127  -10.463 31.001 1.00 135.06 ? 52  DT  J O4    1 
ATOM   5522  C  C5    . DT  B 2  125 ? 23.130  -11.682 30.643 1.00 159.14 ? 52  DT  J C5    1 
ATOM   5523  C  C7    . DT  B 2  125 ? 22.630  -12.908 31.339 1.00 155.05 ? 52  DT  J C7    1 
ATOM   5524  C  C6    . DT  B 2  125 ? 24.351  -11.600 30.101 1.00 168.24 ? 52  DT  J C6    1 
ATOM   5525  P  P     . DA  B 2  126 ? 29.593  -10.011 30.124 1.00 168.95 ? 53  DA  J P     1 
ATOM   5526  O  OP1   . DA  B 2  126 ? 30.931  -9.372  30.117 1.00 165.08 ? 53  DA  J OP1   1 
ATOM   5527  O  OP2   . DA  B 2  126 ? 29.380  -11.228 30.952 1.00 161.56 ? 53  DA  J OP2   1 
ATOM   5528  O  "O5'" . DA  B 2  126 ? 28.542  -8.874  30.493 1.00 159.49 ? 53  DA  J "O5'" 1 
ATOM   5529  C  "C5'" . DA  B 2  126 ? 28.389  -7.721  29.637 1.00 158.12 ? 53  DA  J "C5'" 1 
ATOM   5530  C  "C4'" . DA  B 2  126 ? 27.636  -6.631  30.361 1.00 160.94 ? 53  DA  J "C4'" 1 
ATOM   5531  O  "O4'" . DA  B 2  126 ? 26.214  -6.883  30.330 1.00 162.97 ? 53  DA  J "O4'" 1 
ATOM   5532  C  "C3'" . DA  B 2  126 ? 27.959  -6.516  31.843 1.00 162.32 ? 53  DA  J "C3'" 1 
ATOM   5533  O  "O3'" . DA  B 2  126 ? 29.157  -5.786  32.081 1.00 167.86 ? 53  DA  J "O3'" 1 
ATOM   5534  C  "C2'" . DA  B 2  126 ? 26.737  -5.802  32.379 1.00 162.11 ? 53  DA  J "C2'" 1 
ATOM   5535  C  "C1'" . DA  B 2  126 ? 25.623  -6.420  31.548 1.00 163.47 ? 53  DA  J "C1'" 1 
ATOM   5536  N  N9    . DA  B 2  126 ? 24.963  -7.553  32.195 1.00 162.59 ? 53  DA  J N9    1 
ATOM   5537  C  C8    . DA  B 2  126 ? 25.234  -8.893  32.066 1.00 158.75 ? 53  DA  J C8    1 
ATOM   5538  N  N7    . DA  B 2  126 ? 24.448  -9.661  32.782 1.00 157.03 ? 53  DA  J N7    1 
ATOM   5539  C  C5    . DA  B 2  126 ? 23.615  -8.767  33.439 1.00 156.43 ? 53  DA  J C5    1 
ATOM   5540  C  C6    . DA  B 2  126 ? 22.560  -8.949  34.351 1.00 146.54 ? 53  DA  J C6    1 
ATOM   5541  N  N6    . DA  B 2  126 ? 22.152  -10.145 34.779 1.00 141.12 ? 53  DA  J N6    1 
ATOM   5542  N  N1    . DA  B 2  126 ? 21.937  -7.846  34.822 1.00 137.66 ? 53  DA  J N1    1 
ATOM   5543  C  C2    . DA  B 2  126 ? 22.344  -6.646  34.388 1.00 140.26 ? 53  DA  J C2    1 
ATOM   5544  N  N3    . DA  B 2  126 ? 23.326  -6.347  33.539 1.00 150.41 ? 53  DA  J N3    1 
ATOM   5545  C  C4    . DA  B 2  126 ? 23.926  -7.464  33.094 1.00 159.89 ? 53  DA  J C4    1 
ATOM   5546  P  P     . DT  B 2  127 ? 29.830  -5.856  33.519 1.00 171.95 ? 54  DT  J P     1 
ATOM   5547  O  OP1   . DT  B 2  127 ? 31.144  -5.179  33.447 1.00 172.64 ? 54  DT  J OP1   1 
ATOM   5548  O  OP2   . DT  B 2  127 ? 29.728  -7.256  34.014 1.00 157.59 ? 54  DT  J OP2   1 
ATOM   5549  O  "O5'" . DT  B 2  127 ? 28.881  -4.940  34.404 1.00 173.24 ? 54  DT  J "O5'" 1 
ATOM   5550  C  "C5'" . DT  B 2  127 ? 28.651  -3.560  34.080 1.00 165.50 ? 54  DT  J "C5'" 1 
ATOM   5551  C  "C4'" . DT  B 2  127 ? 27.646  -3.008  35.061 1.00 168.49 ? 54  DT  J "C4'" 1 
ATOM   5552  O  "O4'" . DT  B 2  127 ? 26.537  -3.942  35.161 1.00 176.86 ? 54  DT  J "O4'" 1 
ATOM   5553  C  "C3'" . DT  B 2  127 ? 28.201  -2.845  36.481 1.00 165.41 ? 54  DT  J "C3'" 1 
ATOM   5554  O  "O3'" . DT  B 2  127 ? 27.870  -1.544  37.003 1.00 146.46 ? 54  DT  J "O3'" 1 
ATOM   5555  C  "C2'" . DT  B 2  127 ? 27.662  -4.063  37.211 1.00 168.72 ? 54  DT  J "C2'" 1 
ATOM   5556  C  "C1'" . DT  B 2  127 ? 26.323  -4.272  36.525 1.00 174.73 ? 54  DT  J "C1'" 1 
ATOM   5557  N  N1    . DT  B 2  127 ? 25.765  -5.644  36.604 1.00 169.65 ? 54  DT  J N1    1 
ATOM   5558  C  C2    . DT  B 2  127 ? 24.398  -5.778  36.723 1.00 163.18 ? 54  DT  J C2    1 
ATOM   5559  O  O2    . DT  B 2  127 ? 23.630  -4.829  36.728 1.00 158.63 ? 54  DT  J O2    1 
ATOM   5560  N  N3    . DT  B 2  127 ? 23.957  -7.074  36.832 1.00 155.72 ? 54  DT  J N3    1 
ATOM   5561  C  C4    . DT  B 2  127 ? 24.729  -8.220  36.838 1.00 160.65 ? 54  DT  J C4    1 
ATOM   5562  O  O4    . DT  B 2  127 ? 24.190  -9.317  36.935 1.00 166.12 ? 54  DT  J O4    1 
ATOM   5563  C  C5    . DT  B 2  127 ? 26.155  -8.005  36.724 1.00 157.30 ? 54  DT  J C5    1 
ATOM   5564  C  C7    . DT  B 2  127 ? 27.071  -9.189  36.721 1.00 150.95 ? 54  DT  J C7    1 
ATOM   5565  C  C6    . DT  B 2  127 ? 26.596  -6.745  36.623 1.00 159.95 ? 54  DT  J C6    1 
ATOM   5566  P  P     . DC  B 2  128 ? 26.945  -1.358  38.313 1.00 141.41 ? 55  DC  J P     1 
ATOM   5567  O  OP1   . DC  B 2  128 ? 26.915  0.088   38.657 1.00 126.35 ? 55  DC  J OP1   1 
ATOM   5568  O  OP2   . DC  B 2  128 ? 27.400  -2.331  39.349 1.00 115.49 ? 55  DC  J OP2   1 
ATOM   5569  O  "O5'" . DC  B 2  128 ? 25.489  -1.728  37.772 1.00 143.39 ? 55  DC  J "O5'" 1 
ATOM   5570  C  "C5'" . DC  B 2  128 ? 24.427  -0.753  37.649 1.00 134.66 ? 55  DC  J "C5'" 1 
ATOM   5571  C  "C4'" . DC  B 2  128 ? 23.280  -1.072  38.585 1.00 129.36 ? 55  DC  J "C4'" 1 
ATOM   5572  O  "O4'" . DC  B 2  128 ? 23.068  -2.504  38.693 1.00 126.23 ? 55  DC  J "O4'" 1 
ATOM   5573  C  "C3'" . DC  B 2  128 ? 23.430  -0.553  40.021 1.00 118.97 ? 55  DC  J "C3'" 1 
ATOM   5574  O  "O3'" . DC  B 2  128 ? 22.210  0.108   40.379 1.00 114.01 ? 55  DC  J "O3'" 1 
ATOM   5575  C  "C2'" . DC  B 2  128 ? 23.740  -1.803  40.828 1.00 115.10 ? 55  DC  J "C2'" 1 
ATOM   5576  C  "C1'" . DC  B 2  128 ? 22.990  -2.874  40.064 1.00 125.16 ? 55  DC  J "C1'" 1 
ATOM   5577  N  N1    . DC  B 2  128 ? 23.552  -4.227  40.203 1.00 132.00 ? 55  DC  J N1    1 
ATOM   5578  C  C2    . DC  B 2  128 ? 22.819  -5.195  40.897 1.00 141.45 ? 55  DC  J C2    1 
ATOM   5579  O  O2    . DC  B 2  128 ? 21.718  -4.884  41.375 1.00 150.14 ? 55  DC  J O2    1 
ATOM   5580  N  N3    . DC  B 2  128 ? 23.324  -6.444  41.020 1.00 142.75 ? 55  DC  J N3    1 
ATOM   5581  C  C4    . DC  B 2  128 ? 24.512  -6.739  40.487 1.00 143.05 ? 55  DC  J C4    1 
ATOM   5582  N  N4    . DC  B 2  128 ? 24.973  -7.982  40.635 1.00 139.65 ? 55  DC  J N4    1 
ATOM   5583  C  C5    . DC  B 2  128 ? 25.285  -5.768  39.787 1.00 146.00 ? 55  DC  J C5    1 
ATOM   5584  C  C6    . DC  B 2  128 ? 24.772  -4.537  39.669 1.00 140.39 ? 55  DC  J C6    1 
ATOM   5585  P  P     . DT  B 2  129 ? 21.881  0.485   41.907 1.00 121.29 ? 56  DT  J P     1 
ATOM   5586  O  OP1   . DT  B 2  129 ? 21.104  1.756   41.908 1.00 106.04 ? 56  DT  J OP1   1 
ATOM   5587  O  OP2   . DT  B 2  129 ? 23.130  0.370   42.709 1.00 101.49 ? 56  DT  J OP2   1 
ATOM   5588  O  "O5'" . DT  B 2  129 ? 20.899  -0.688  42.359 1.00 124.99 ? 56  DT  J "O5'" 1 
ATOM   5589  C  "C5'" . DT  B 2  129 ? 19.565  -0.414  42.842 1.00 103.92 ? 56  DT  J "C5'" 1 
ATOM   5590  C  "C4'" . DT  B 2  129 ? 19.257  -1.275  44.044 1.00 89.26  ? 56  DT  J "C4'" 1 
ATOM   5591  O  "O4'" . DT  B 2  129 ? 19.971  -2.530  43.937 1.00 79.94  ? 56  DT  J "O4'" 1 
ATOM   5592  C  "C3'" . DT  B 2  129 ? 19.654  -0.685  45.401 1.00 85.19  ? 56  DT  J "C3'" 1 
ATOM   5593  O  "O3'" . DT  B 2  129 ? 18.685  -1.026  46.401 1.00 88.34  ? 56  DT  J "O3'" 1 
ATOM   5594  C  "C2'" . DT  B 2  129 ? 20.918  -1.449  45.749 1.00 85.80  ? 56  DT  J "C2'" 1 
ATOM   5595  C  "C1'" . DT  B 2  129 ? 20.549  -2.808  45.196 1.00 88.16  ? 56  DT  J "C1'" 1 
ATOM   5596  N  N1    . DT  B 2  129 ? 21.641  -3.769  44.992 1.00 96.51  ? 56  DT  J N1    1 
ATOM   5597  C  C2    . DT  B 2  129 ? 21.432  -5.070  45.388 1.00 102.91 ? 56  DT  J C2    1 
ATOM   5598  O  O2    . DT  B 2  129 ? 20.399  -5.449  45.913 1.00 91.46  ? 56  DT  J O2    1 
ATOM   5599  N  N3    . DT  B 2  129 ? 22.486  -5.915  45.154 1.00 119.26 ? 56  DT  J N3    1 
ATOM   5600  C  C4    . DT  B 2  129 ? 23.693  -5.599  44.561 1.00 121.15 ? 56  DT  J C4    1 
ATOM   5601  O  O4    . DT  B 2  129 ? 24.545  -6.469  44.409 1.00 120.84 ? 56  DT  J O4    1 
ATOM   5602  C  C5    . DT  B 2  129 ? 23.838  -4.216  44.157 1.00 116.49 ? 56  DT  J C5    1 
ATOM   5603  C  C7    . DT  B 2  129 ? 25.110  -3.778  43.503 1.00 119.47 ? 56  DT  J C7    1 
ATOM   5604  C  C6    . DT  B 2  129 ? 22.817  -3.384  44.387 1.00 108.02 ? 56  DT  J C6    1 
ATOM   5605  P  P     . DG  B 2  130 ? 17.466  -0.057  46.749 1.00 86.57  ? 57  DG  J P     1 
ATOM   5606  O  OP1   . DG  B 2  130 ? 16.868  0.440   45.481 1.00 76.36  ? 57  DG  J OP1   1 
ATOM   5607  O  OP2   . DG  B 2  130 ? 17.887  0.846   47.846 1.00 79.57  ? 57  DG  J OP2   1 
ATOM   5608  O  "O5'" . DG  B 2  130 ? 16.404  -1.011  47.449 1.00 89.74  ? 57  DG  J "O5'" 1 
ATOM   5609  C  "C5'" . DG  B 2  130 ? 15.539  -1.856  46.676 1.00 82.91  ? 57  DG  J "C5'" 1 
ATOM   5610  C  "C4'" . DG  B 2  130 ? 15.306  -3.144  47.426 1.00 75.62  ? 57  DG  J "C4'" 1 
ATOM   5611  O  "O4'" . DG  B 2  130 ? 16.533  -3.914  47.466 1.00 74.41  ? 57  DG  J "O4'" 1 
ATOM   5612  C  "C3'" . DG  B 2  130 ? 14.864  -2.966  48.878 1.00 75.27  ? 57  DG  J "C3'" 1 
ATOM   5613  O  "O3'" . DG  B 2  130 ? 13.825  -3.922  49.117 1.00 67.02  ? 57  DG  J "O3'" 1 
ATOM   5614  C  "C2'" . DG  B 2  130 ? 16.141  -3.177  49.678 1.00 71.93  ? 57  DG  J "C2'" 1 
ATOM   5615  C  "C1'" . DG  B 2  130 ? 16.942  -4.143  48.812 1.00 81.37  ? 57  DG  J "C1'" 1 
ATOM   5616  N  N9    . DG  B 2  130 ? 18.399  -4.020  48.858 1.00 95.44  ? 57  DG  J N9    1 
ATOM   5617  C  C8    . DG  B 2  130 ? 19.140  -2.868  48.975 1.00 94.36  ? 57  DG  J C8    1 
ATOM   5618  N  N7    . DG  B 2  130 ? 20.428  -3.082  48.945 1.00 91.52  ? 57  DG  J N7    1 
ATOM   5619  C  C5    . DG  B 2  130 ? 20.546  -4.456  48.789 1.00 99.56  ? 57  DG  J C5    1 
ATOM   5620  C  C6    . DG  B 2  130 ? 21.700  -5.274  48.698 1.00 101.83 ? 57  DG  J C6    1 
ATOM   5621  O  O6    . DG  B 2  130 ? 22.889  -4.937  48.728 1.00 105.09 ? 57  DG  J O6    1 
ATOM   5622  N  N1    . DG  B 2  130 ? 21.364  -6.614  48.541 1.00 100.30 ? 57  DG  J N1    1 
ATOM   5623  C  C2    . DG  B 2  130 ? 20.085  -7.107  48.488 1.00 90.48  ? 57  DG  J C2    1 
ATOM   5624  N  N2    . DG  B 2  130 ? 19.969  -8.429  48.332 1.00 88.86  ? 57  DG  J N2    1 
ATOM   5625  N  N3    . DG  B 2  130 ? 19.000  -6.356  48.571 1.00 92.70  ? 57  DG  J N3    1 
ATOM   5626  C  C4    . DG  B 2  130 ? 19.302  -5.050  48.724 1.00 99.39  ? 57  DG  J C4    1 
ATOM   5627  P  P     . DC  B 2  131 ? 12.882  -3.818  50.403 1.00 63.96  ? 58  DC  J P     1 
ATOM   5628  O  OP1   . DC  B 2  131 ? 11.489  -4.015  49.928 1.00 69.93  ? 58  DC  J OP1   1 
ATOM   5629  O  OP2   . DC  B 2  131 ? 13.204  -2.567  51.151 1.00 68.29  ? 58  DC  J OP2   1 
ATOM   5630  O  "O5'" . DC  B 2  131 ? 13.342  -5.093  51.233 1.00 64.43  ? 58  DC  J "O5'" 1 
ATOM   5631  C  "C5'" . DC  B 2  131 ? 13.779  -6.286  50.529 1.00 68.15  ? 58  DC  J "C5'" 1 
ATOM   5632  C  "C4'" . DC  B 2  131 ? 14.619  -7.166  51.427 1.00 77.94  ? 58  DC  J "C4'" 1 
ATOM   5633  O  "O4'" . DC  B 2  131 ? 16.031  -6.876  51.241 1.00 82.80  ? 58  DC  J "O4'" 1 
ATOM   5634  C  "C3'" . DC  B 2  131 ? 14.358  -6.996  52.926 1.00 85.52  ? 58  DC  J "C3'" 1 
ATOM   5635  O  "O3'" . DC  B 2  131 ? 14.520  -8.249  53.608 1.00 91.33  ? 58  DC  J "O3'" 1 
ATOM   5636  C  "C2'" . DC  B 2  131 ? 15.466  -6.049  53.352 1.00 88.16  ? 58  DC  J "C2'" 1 
ATOM   5637  C  "C1'" . DC  B 2  131 ? 16.612  -6.593  52.511 1.00 92.68  ? 58  DC  J "C1'" 1 
ATOM   5638  N  N1    . DC  B 2  131 ? 17.790  -5.715  52.309 1.00 101.17 ? 58  DC  J N1    1 
ATOM   5639  C  C2    . DC  B 2  131 ? 19.047  -6.307  52.128 1.00 100.68 ? 58  DC  J C2    1 
ATOM   5640  O  O2    . DC  B 2  131 ? 19.135  -7.543  52.127 1.00 97.97  ? 58  DC  J O2    1 
ATOM   5641  N  N3    . DC  B 2  131 ? 20.128  -5.517  51.947 1.00 108.52 ? 58  DC  J N3    1 
ATOM   5642  C  C4    . DC  B 2  131 ? 19.994  -4.189  51.955 1.00 108.88 ? 58  DC  J C4    1 
ATOM   5643  N  N4    . DC  B 2  131 ? 21.089  -3.450  51.772 1.00 110.86 ? 58  DC  J N4    1 
ATOM   5644  C  C5    . DC  B 2  131 ? 18.728  -3.561  52.139 1.00 100.27 ? 58  DC  J C5    1 
ATOM   5645  C  C6    . DC  B 2  131 ? 17.664  -4.354  52.318 1.00 100.52 ? 58  DC  J C6    1 
ATOM   5646  P  P     . DA  B 2  132 ? 13.249  -9.145  54.008 1.00 83.29  ? 59  DA  J P     1 
ATOM   5647  O  OP1   . DA  B 2  132 ? 12.329  -9.183  52.834 1.00 70.91  ? 59  DA  J OP1   1 
ATOM   5648  O  OP2   . DA  B 2  132 ? 12.773  -8.706  55.347 1.00 59.70  ? 59  DA  J OP2   1 
ATOM   5649  O  "O5'" . DA  B 2  132 ? 13.874  -10.598 54.189 1.00 84.66  ? 59  DA  J "O5'" 1 
ATOM   5650  C  "C5'" . DA  B 2  132 ? 14.608  -11.224 53.121 1.00 88.10  ? 59  DA  J "C5'" 1 
ATOM   5651  C  "C4'" . DA  B 2  132 ? 15.752  -12.033 53.686 1.00 91.52  ? 59  DA  J "C4'" 1 
ATOM   5652  O  "O4'" . DA  B 2  132 ? 16.927  -11.200 53.819 1.00 96.23  ? 59  DA  J "O4'" 1 
ATOM   5653  C  "C3'" . DA  B 2  132 ? 15.508  -12.601 55.080 1.00 95.98  ? 59  DA  J "C3'" 1 
ATOM   5654  O  "O3'" . DA  B 2  132 ? 16.284  -13.798 55.200 1.00 103.30 ? 59  DA  J "O3'" 1 
ATOM   5655  C  "C2'" . DA  B 2  132 ? 16.033  -11.497 55.979 1.00 98.10  ? 59  DA  J "C2'" 1 
ATOM   5656  C  "C1'" . DA  B 2  132 ? 17.240  -11.008 55.195 1.00 95.51  ? 59  DA  J "C1'" 1 
ATOM   5657  N  N9    . DA  B 2  132 ? 17.584  -9.602  55.374 1.00 98.94  ? 59  DA  J N9    1 
ATOM   5658  C  C8    . DA  B 2  132 ? 16.761  -8.558  55.712 1.00 98.19  ? 59  DA  J C8    1 
ATOM   5659  N  N7    . DA  B 2  132 ? 17.370  -7.399  55.756 1.00 105.09 ? 59  DA  J N7    1 
ATOM   5660  C  C5    . DA  B 2  132 ? 18.680  -7.697  55.408 1.00 114.50 ? 59  DA  J C5    1 
ATOM   5661  C  C6    . DA  B 2  132 ? 19.827  -6.897  55.269 1.00 117.56 ? 59  DA  J C6    1 
ATOM   5662  N  N6    . DA  B 2  132 ? 19.837  -5.578  55.466 1.00 124.67 ? 59  DA  J N6    1 
ATOM   5663  N  N1    . DA  B 2  132 ? 20.978  -7.507  54.914 1.00 123.49 ? 59  DA  J N1    1 
ATOM   5664  C  C2    . DA  B 2  132 ? 20.968  -8.831  54.718 1.00 119.02 ? 59  DA  J C2    1 
ATOM   5665  N  N3    . DA  B 2  132 ? 19.953  -9.688  54.812 1.00 115.00 ? 59  DA  J N3    1 
ATOM   5666  C  C4    . DA  B 2  132 ? 18.825  -9.050  55.165 1.00 108.37 ? 59  DA  J C4    1 
ATOM   5667  P  P     . DG  B 2  133 ? 16.020  -14.851 56.384 1.00 104.96 ? 60  DG  J P     1 
ATOM   5668  O  OP1   . DG  B 2  133 ? 15.512  -16.097 55.761 1.00 88.93  ? 60  DG  J OP1   1 
ATOM   5669  O  OP2   . DG  B 2  133 ? 15.236  -14.188 57.475 1.00 89.19  ? 60  DG  J OP2   1 
ATOM   5670  O  "O5'" . DG  B 2  133 ? 17.491  -15.130 56.932 1.00 105.57 ? 60  DG  J "O5'" 1 
ATOM   5671  C  "C5'" . DG  B 2  133 ? 18.671  -14.858 56.146 1.00 114.33 ? 60  DG  J "C5'" 1 
ATOM   5672  C  "C4'" . DG  B 2  133 ? 19.824  -14.512 57.061 1.00 128.41 ? 60  DG  J "C4'" 1 
ATOM   5673  O  "O4'" . DG  B 2  133 ? 19.970  -13.069 57.133 1.00 128.93 ? 60  DG  J "O4'" 1 
ATOM   5674  C  "C3'" . DG  B 2  133 ? 19.662  -14.990 58.511 1.00 131.50 ? 60  DG  J "C3'" 1 
ATOM   5675  O  "O3'" . DG  B 2  133 ? 20.933  -15.455 58.997 1.00 137.43 ? 60  DG  J "O3'" 1 
ATOM   5676  C  "C2'" . DG  B 2  133 ? 19.142  -13.749 59.215 1.00 124.66 ? 60  DG  J "C2'" 1 
ATOM   5677  C  "C1'" . DG  B 2  133 ? 19.937  -12.674 58.497 1.00 128.05 ? 60  DG  J "C1'" 1 
ATOM   5678  N  N9    . DG  B 2  133 ? 19.401  -11.318 58.574 1.00 129.51 ? 60  DG  J N9    1 
ATOM   5679  C  C8    . DG  B 2  133 ? 18.092  -10.937 58.751 1.00 122.25 ? 60  DG  J C8    1 
ATOM   5680  N  N7    . DG  B 2  133 ? 17.939  -9.642  58.809 1.00 109.56 ? 60  DG  J N7    1 
ATOM   5681  C  C5    . DG  B 2  133 ? 19.225  -9.138  58.678 1.00 120.40 ? 60  DG  J C5    1 
ATOM   5682  C  C6    . DG  B 2  133 ? 19.689  -7.799  58.669 1.00 120.62 ? 60  DG  J C6    1 
ATOM   5683  O  O6    . DG  B 2  133 ? 19.035  -6.756  58.778 1.00 99.25  ? 60  DG  J O6    1 
ATOM   5684  N  N1    . DG  B 2  133 ? 21.072  -7.737  58.516 1.00 133.15 ? 60  DG  J N1    1 
ATOM   5685  C  C2    . DG  B 2  133 ? 21.901  -8.825  58.386 1.00 137.99 ? 60  DG  J C2    1 
ATOM   5686  N  N2    . DG  B 2  133 ? 23.209  -8.560  58.244 1.00 142.29 ? 60  DG  J N2    1 
ATOM   5687  N  N3    . DG  B 2  133 ? 21.480  -10.079 58.391 1.00 135.71 ? 60  DG  J N3    1 
ATOM   5688  C  C4    . DG  B 2  133 ? 20.140  -10.160 58.539 1.00 131.31 ? 60  DG  J C4    1 
ATOM   5689  P  P     . DG  B 2  134 ? 21.102  -16.078 60.479 1.00 129.47 ? 61  DG  J P     1 
ATOM   5690  O  OP1   . DG  B 2  134 ? 21.590  -17.473 60.337 1.00 125.92 ? 61  DG  J OP1   1 
ATOM   5691  O  OP2   . DG  B 2  134 ? 19.874  -15.792 61.272 1.00 113.97 ? 61  DG  J OP2   1 
ATOM   5692  O  "O5'" . DG  B 2  134 ? 22.292  -15.217 61.097 1.00 130.94 ? 61  DG  J "O5'" 1 
ATOM   5693  C  "C5'" . DG  B 2  134 ? 23.416  -14.797 60.298 1.00 135.84 ? 61  DG  J "C5'" 1 
ATOM   5694  C  "C4'" . DG  B 2  134 ? 23.929  -13.463 60.792 1.00 142.34 ? 61  DG  J "C4'" 1 
ATOM   5695  O  "O4'" . DG  B 2  134 ? 22.992  -12.415 60.469 1.00 145.37 ? 61  DG  J "O4'" 1 
ATOM   5696  C  "C3'" . DG  B 2  134 ? 24.114  -13.366 62.304 1.00 142.30 ? 61  DG  J "C3'" 1 
ATOM   5697  O  "O3'" . DG  B 2  134 ? 25.449  -13.715 62.678 1.00 150.08 ? 61  DG  J "O3'" 1 
ATOM   5698  C  "C2'" . DG  B 2  134 ? 23.819  -11.907 62.613 1.00 140.82 ? 61  DG  J "C2'" 1 
ATOM   5699  C  "C1'" . DG  B 2  134 ? 23.252  -11.318 61.329 1.00 138.73 ? 61  DG  J "C1'" 1 
ATOM   5700  N  N9    . DG  B 2  134 ? 22.001  -10.600 61.542 1.00 131.58 ? 61  DG  J N9    1 
ATOM   5701  C  C8    . DG  B 2  134 ? 20.755  -11.156 61.697 1.00 135.50 ? 61  DG  J C8    1 
ATOM   5702  N  N7    . DG  B 2  134 ? 19.820  -10.269 61.896 1.00 135.95 ? 61  DG  J N7    1 
ATOM   5703  C  C5    . DG  B 2  134 ? 20.490  -9.054  61.893 1.00 124.91 ? 61  DG  J C5    1 
ATOM   5704  C  C6    . DG  B 2  134 ? 19.999  -7.737  62.068 1.00 115.15 ? 61  DG  J C6    1 
ATOM   5705  O  O6    . DG  B 2  134 ? 18.837  -7.371  62.266 1.00 101.94 ? 61  DG  J O6    1 
ATOM   5706  N  N1    . DG  B 2  134 ? 21.021  -6.795  61.994 1.00 116.03 ? 61  DG  J N1    1 
ATOM   5707  C  C2    . DG  B 2  134 ? 22.347  -7.084  61.776 1.00 119.87 ? 61  DG  J C2    1 
ATOM   5708  N  N2    . DG  B 2  134 ? 23.183  -6.035  61.735 1.00 113.20 ? 61  DG  J N2    1 
ATOM   5709  N  N3    . DG  B 2  134 ? 22.817  -8.310  61.609 1.00 124.30 ? 61  DG  J N3    1 
ATOM   5710  C  C4    . DG  B 2  134 ? 21.839  -9.240  61.682 1.00 127.57 ? 61  DG  J C4    1 
ATOM   5711  P  P     . DT  B 2  135 ? 25.835  -13.886 64.224 1.00 151.38 ? 62  DT  J P     1 
ATOM   5712  O  OP1   . DT  B 2  135 ? 27.195  -14.481 64.280 1.00 147.55 ? 62  DT  J OP1   1 
ATOM   5713  O  OP2   . DT  B 2  135 ? 24.714  -14.588 64.899 1.00 147.24 ? 62  DT  J OP2   1 
ATOM   5714  O  "O5'" . DT  B 2  135 ? 25.884  -12.380 64.754 1.00 142.06 ? 62  DT  J "O5'" 1 
ATOM   5715  C  "C5'" . DT  B 2  135 ? 26.774  -11.419 64.150 1.00 142.91 ? 62  DT  J "C5'" 1 
ATOM   5716  C  "C4'" . DT  B 2  135 ? 26.482  -10.000 64.592 1.00 148.36 ? 62  DT  J "C4'" 1 
ATOM   5717  O  "O4'" . DT  B 2  135 ? 25.278  -9.439  64.022 1.00 146.91 ? 62  DT  J "O4'" 1 
ATOM   5718  C  "C3'" . DT  B 2  135 ? 26.276  -9.757  66.076 1.00 155.24 ? 62  DT  J "C3'" 1 
ATOM   5719  O  "O3'" . DT  B 2  135 ? 27.435  -9.859  66.895 1.00 186.95 ? 62  DT  J "O3'" 1 
ATOM   5720  C  "C2'" . DT  B 2  135 ? 25.805  -8.319  66.060 1.00 145.40 ? 62  DT  J "C2'" 1 
ATOM   5721  C  "C1'" . DT  B 2  135 ? 24.966  -8.266  64.790 1.00 145.56 ? 62  DT  J "C1'" 1 
ATOM   5722  N  N1    . DT  B 2  135 ? 23.519  -8.250  65.105 1.00 150.83 ? 62  DT  J N1    1 
ATOM   5723  C  C2    . DT  B 2  135 ? 23.022  -7.042  65.538 1.00 142.68 ? 62  DT  J C2    1 
ATOM   5724  O  O2    . DT  B 2  135 ? 23.702  -6.033  65.617 1.00 168.48 ? 62  DT  J O2    1 
ATOM   5725  N  N3    . DT  B 2  135 ? 21.689  -7.053  65.860 1.00 110.98 ? 62  DT  J N3    1 
ATOM   5726  C  C4    . DT  B 2  135 ? 20.830  -8.127  65.809 1.00 102.25 ? 62  DT  J C4    1 
ATOM   5727  O  O4    . DT  B 2  135 ? 19.657  -7.977  66.110 1.00 88.64  ? 62  DT  J O4    1 
ATOM   5728  C  C5    . DT  B 2  135 ? 21.420  -9.372  65.378 1.00 122.02 ? 62  DT  J C5    1 
ATOM   5729  C  C7    . DT  B 2  135 ? 20.558  -10.592 65.292 1.00 121.92 ? 62  DT  J C7    1 
ATOM   5730  C  C6    . DT  B 2  135 ? 22.723  -9.377  65.065 1.00 143.38 ? 62  DT  J C6    1 
ATOM   5731  P  P     . DG  B 2  136 ? 27.290  -9.583  68.462 1.00 207.59 ? 63  DG  J P     1 
ATOM   5732  O  OP1   . DG  B 2  136 ? 28.650  -9.599  69.056 1.00 211.83 ? 63  DG  J OP1   1 
ATOM   5733  O  OP2   . DG  B 2  136 ? 26.237  -10.490 68.993 1.00 196.02 ? 63  DG  J OP2   1 
ATOM   5734  O  "O5'" . DG  B 2  136 ? 26.675  -8.114  68.518 1.00 187.72 ? 63  DG  J "O5'" 1 
ATOM   5735  C  "C5'" . DG  B 2  136 ? 27.502  -6.935  68.567 1.00 170.22 ? 63  DG  J "C5'" 1 
ATOM   5736  C  "C4'" . DG  B 2  136 ? 26.699  -5.778  69.112 1.00 163.20 ? 63  DG  J "C4'" 1 
ATOM   5737  O  "O4'" . DG  B 2  136 ? 25.322  -5.927  68.695 1.00 150.73 ? 63  DG  J "O4'" 1 
ATOM   5738  C  "C3'" . DG  B 2  136 ? 26.634  -5.711  70.636 1.00 164.73 ? 63  DG  J "C3'" 1 
ATOM   5739  O  "O3'" . DG  B 2  136 ? 26.323  -4.360  71.009 1.00 169.61 ? 63  DG  J "O3'" 1 
ATOM   5740  C  "C2'" . DG  B 2  136 ? 25.465  -6.629  70.933 1.00 158.25 ? 63  DG  J "C2'" 1 
ATOM   5741  C  "C1'" . DG  B 2  136 ? 24.522  -6.134  69.856 1.00 157.15 ? 63  DG  J "C1'" 1 
ATOM   5742  N  N9    . DG  B 2  136 ? 23.398  -6.985  69.490 1.00 156.70 ? 63  DG  J N9    1 
ATOM   5743  C  C8    . DG  B 2  136 ? 23.299  -8.356  69.514 1.00 148.19 ? 63  DG  J C8    1 
ATOM   5744  N  N7    . DG  B 2  136 ? 22.135  -8.790  69.110 1.00 132.94 ? 63  DG  J N7    1 
ATOM   5745  C  C5    . DG  B 2  136 ? 21.427  -7.636  68.806 1.00 119.11 ? 63  DG  J C5    1 
ATOM   5746  C  C6    . DG  B 2  136 ? 20.113  -7.473  68.328 1.00 91.48  ? 63  DG  J C6    1 
ATOM   5747  O  O6    . DG  B 2  136 ? 19.282  -8.342  68.073 1.00 85.59  ? 63  DG  J O6    1 
ATOM   5748  N  N1    . DG  B 2  136 ? 19.795  -6.129  68.146 1.00 94.34  ? 63  DG  J N1    1 
ATOM   5749  C  C2    . DG  B 2  136 ? 20.631  -5.075  68.420 1.00 112.09 ? 63  DG  J C2    1 
ATOM   5750  N  N2    . DG  B 2  136 ? 20.140  -3.847  68.191 1.00 108.66 ? 63  DG  J N2    1 
ATOM   5751  N  N3    . DG  B 2  136 ? 21.867  -5.216  68.862 1.00 121.48 ? 63  DG  J N3    1 
ATOM   5752  C  C4    . DG  B 2  136 ? 22.194  -6.515  69.035 1.00 139.13 ? 63  DG  J C4    1 
ATOM   5753  P  P     . DG  B 2  137 ? 26.567  -3.851  72.511 1.00 168.24 ? 64  DG  J P     1 
ATOM   5754  O  OP1   . DG  B 2  137 ? 28.028  -3.857  72.762 1.00 164.37 ? 64  DG  J OP1   1 
ATOM   5755  O  OP2   . DG  B 2  137 ? 25.671  -4.615  73.413 1.00 163.16 ? 64  DG  J OP2   1 
ATOM   5756  O  "O5'" . DG  B 2  137 ? 26.112  -2.322  72.478 1.00 147.92 ? 64  DG  J "O5'" 1 
ATOM   5757  C  "C5'" . DG  B 2  137 ? 25.167  -1.811  71.521 1.00 144.13 ? 64  DG  J "C5'" 1 
ATOM   5758  C  "C4'" . DG  B 2  137 ? 23.852  -1.485  72.192 1.00 152.38 ? 64  DG  J "C4'" 1 
ATOM   5759  O  "O4'" . DG  B 2  137 ? 22.857  -2.467  71.810 1.00 160.99 ? 64  DG  J "O4'" 1 
ATOM   5760  C  "C3'" . DG  B 2  137 ? 23.848  -1.472  73.728 1.00 156.63 ? 64  DG  J "C3'" 1 
ATOM   5761  O  "O3'" . DG  B 2  137 ? 22.989  -0.398  74.142 1.00 160.17 ? 64  DG  J "O3'" 1 
ATOM   5762  C  "C2'" . DG  B 2  137 ? 23.274  -2.836  74.076 1.00 158.90 ? 64  DG  J "C2'" 1 
ATOM   5763  C  "C1'" . DG  B 2  137 ? 22.226  -2.949  72.991 1.00 159.04 ? 64  DG  J "C1'" 1 
ATOM   5764  N  N9    . DG  B 2  137 ? 21.650  -4.263  72.706 1.00 148.09 ? 64  DG  J N9    1 
ATOM   5765  C  C8    . DG  B 2  137 ? 22.169  -5.516  72.939 1.00 138.70 ? 64  DG  J C8    1 
ATOM   5766  N  N7    . DG  B 2  137 ? 21.369  -6.479  72.565 1.00 121.35 ? 64  DG  J N7    1 
ATOM   5767  C  C5    . DG  B 2  137 ? 20.254  -5.820  72.064 1.00 135.13 ? 64  DG  J C5    1 
ATOM   5768  C  C6    . DG  B 2  137 ? 19.051  -6.333  71.511 1.00 132.64 ? 64  DG  J C6    1 
ATOM   5769  O  O6    . DG  B 2  137 ? 18.719  -7.515  71.349 1.00 123.69 ? 64  DG  J O6    1 
ATOM   5770  N  N1    . DG  B 2  137 ? 18.189  -5.310  71.126 1.00 122.31 ? 64  DG  J N1    1 
ATOM   5771  C  C2    . DG  B 2  137 ? 18.449  -3.966  71.254 1.00 120.88 ? 64  DG  J C2    1 
ATOM   5772  N  N2    . DG  B 2  137 ? 17.494  -3.127  70.828 1.00 119.35 ? 64  DG  J N2    1 
ATOM   5773  N  N3    . DG  B 2  137 ? 19.563  -3.478  71.766 1.00 121.67 ? 64  DG  J N3    1 
ATOM   5774  C  C4    . DG  B 2  137 ? 20.414  -4.453  72.147 1.00 133.94 ? 64  DG  J C4    1 
ATOM   5775  P  P     . DA  B 2  138 ? 22.615  -0.162  75.695 1.00 158.42 ? 65  DA  J P     1 
ATOM   5776  O  OP1   . DA  B 2  138 ? 23.867  0.098   76.445 1.00 162.12 ? 65  DA  J OP1   1 
ATOM   5777  O  OP2   . DA  B 2  138 ? 21.710  -1.249  76.133 1.00 137.50 ? 65  DA  J OP2   1 
ATOM   5778  O  "O5'" . DA  B 2  138 ? 21.791  1.201   75.663 1.00 151.68 ? 65  DA  J "O5'" 1 
ATOM   5779  C  "C5'" . DA  B 2  138 ? 20.982  1.561   74.522 1.00 150.86 ? 65  DA  J "C5'" 1 
ATOM   5780  C  "C4'" . DA  B 2  138 ? 19.533  1.200   74.756 1.00 144.61 ? 65  DA  J "C4'" 1 
ATOM   5781  O  "O4'" . DA  B 2  138 ? 19.258  -0.144  74.287 1.00 143.70 ? 65  DA  J "O4'" 1 
ATOM   5782  C  "C3'" . DA  B 2  138 ? 19.073  1.243   76.220 1.00 142.98 ? 65  DA  J "C3'" 1 
ATOM   5783  O  "O3'" . DA  B 2  138 ? 17.968  2.143   76.360 1.00 142.12 ? 65  DA  J "O3'" 1 
ATOM   5784  C  "C2'" . DA  B 2  138 ? 18.672  -0.192  76.520 1.00 141.93 ? 65  DA  J "C2'" 1 
ATOM   5785  C  "C1'" . DA  B 2  138 ? 18.289  -0.702  75.151 1.00 139.77 ? 65  DA  J "C1'" 1 
ATOM   5786  N  N9    . DA  B 2  138 ? 18.340  -2.157  75.030 1.00 135.21 ? 65  DA  J N9    1 
ATOM   5787  C  C8    . DA  B 2  138 ? 19.402  -2.978  75.322 1.00 128.35 ? 65  DA  J C8    1 
ATOM   5788  N  N7    . DA  B 2  138 ? 19.148  -4.251  75.152 1.00 127.46 ? 65  DA  J N7    1 
ATOM   5789  C  C5    . DA  B 2  138 ? 17.825  -4.274  74.733 1.00 131.50 ? 65  DA  J C5    1 
ATOM   5790  C  C6    . DA  B 2  138 ? 16.966  -5.327  74.382 1.00 129.85 ? 65  DA  J C6    1 
ATOM   5791  N  N6    . DA  B 2  138 ? 17.332  -6.611  74.402 1.00 131.58 ? 65  DA  J N6    1 
ATOM   5792  N  N1    . DA  B 2  138 ? 15.706  -5.013  74.007 1.00 126.36 ? 65  DA  J N1    1 
ATOM   5793  C  C2    . DA  B 2  138 ? 15.345  -3.722  73.991 1.00 122.01 ? 65  DA  J C2    1 
ATOM   5794  N  N3    . DA  B 2  138 ? 16.066  -2.643  74.293 1.00 125.38 ? 65  DA  J N3    1 
ATOM   5795  C  C4    . DA  B 2  138 ? 17.311  -2.992  74.665 1.00 132.84 ? 65  DA  J C4    1 
ATOM   5796  P  P     . DT  B 2  139 ? 17.052  2.101   77.674 1.00 133.10 ? 66  DT  J P     1 
ATOM   5797  O  OP1   . DT  B 2  139 ? 16.448  3.446   77.860 1.00 126.01 ? 66  DT  J OP1   1 
ATOM   5798  O  OP2   . DT  B 2  139 ? 17.857  1.510   78.774 1.00 119.25 ? 66  DT  J OP2   1 
ATOM   5799  O  "O5'" . DT  B 2  139 ? 15.895  1.081   77.261 1.00 145.61 ? 66  DT  J "O5'" 1 
ATOM   5800  C  "C5'" . DT  B 2  139 ? 15.168  1.232   76.019 1.00 144.21 ? 66  DT  J "C5'" 1 
ATOM   5801  C  "C4'" . DT  B 2  139 ? 14.016  0.255   75.941 1.00 140.00 ? 66  DT  J "C4'" 1 
ATOM   5802  O  "O4'" . DT  B 2  139 ? 14.501  -1.109  75.873 1.00 135.48 ? 66  DT  J "O4'" 1 
ATOM   5803  C  "C3'" . DT  B 2  139 ? 13.035  0.294   77.119 1.00 135.27 ? 66  DT  J "C3'" 1 
ATOM   5804  O  "O3'" . DT  B 2  139 ? 11.693  0.345   76.617 1.00 148.31 ? 66  DT  J "O3'" 1 
ATOM   5805  C  "C2'" . DT  B 2  139 ? 13.317  -1.001  77.859 1.00 129.91 ? 66  DT  J "C2'" 1 
ATOM   5806  C  "C1'" . DT  B 2  139 ? 13.687  -1.909  76.712 1.00 131.08 ? 66  DT  J "C1'" 1 
ATOM   5807  N  N1    . DT  B 2  139 ? 14.457  -3.102  77.103 1.00 130.61 ? 66  DT  J N1    1 
ATOM   5808  C  C2    . DT  B 2  139 ? 13.895  -4.343  76.901 1.00 133.71 ? 66  DT  J C2    1 
ATOM   5809  O  O2    . DT  B 2  139 ? 12.797  -4.504  76.396 1.00 147.23 ? 66  DT  J O2    1 
ATOM   5810  N  N3    . DT  B 2  139 ? 14.677  -5.397  77.301 1.00 131.26 ? 66  DT  J N3    1 
ATOM   5811  C  C4    . DT  B 2  139 ? 15.933  -5.333  77.873 1.00 133.77 ? 66  DT  J C4    1 
ATOM   5812  O  O4    . DT  B 2  139 ? 16.515  -6.368  78.182 1.00 151.80 ? 66  DT  J O4    1 
ATOM   5813  C  C5    . DT  B 2  139 ? 16.458  -3.999  78.062 1.00 128.32 ? 66  DT  J C5    1 
ATOM   5814  C  C7    . DT  B 2  139 ? 17.811  -3.831  78.678 1.00 131.87 ? 66  DT  J C7    1 
ATOM   5815  C  C6    . DT  B 2  139 ? 15.701  -2.965  77.678 1.00 124.21 ? 66  DT  J C6    1 
ATOM   5816  P  P     . DA  B 2  140 ? 10.436  0.131   77.601 1.00 156.70 ? 67  DA  J P     1 
ATOM   5817  O  OP1   . DA  B 2  140 ? 9.334   1.015   77.148 1.00 141.16 ? 67  DA  J OP1   1 
ATOM   5818  O  OP2   . DA  B 2  140 ? 10.924  0.248   78.999 1.00 137.72 ? 67  DA  J OP2   1 
ATOM   5819  O  "O5'" . DA  B 2  140 ? 10.001  -1.376  77.305 1.00 156.22 ? 67  DA  J "O5'" 1 
ATOM   5820  C  "C5'" . DA  B 2  140 ? 9.596   -1.812  75.986 1.00 139.40 ? 67  DA  J "C5'" 1 
ATOM   5821  C  "C4'" . DA  B 2  140 ? 8.839   -3.118  76.075 1.00 127.87 ? 67  DA  J "C4'" 1 
ATOM   5822  O  "O4'" . DA  B 2  140 ? 9.750   -4.186  76.432 1.00 127.87 ? 67  DA  J "O4'" 1 
ATOM   5823  C  "C3'" . DA  B 2  140 ? 7.732   -3.138  77.130 1.00 119.51 ? 67  DA  J "C3'" 1 
ATOM   5824  O  "O3'" . DA  B 2  140 ? 6.576   -3.809  76.615 1.00 117.19 ? 67  DA  J "O3'" 1 
ATOM   5825  C  "C2'" . DA  B 2  140 ? 8.380   -3.843  78.308 1.00 117.56 ? 67  DA  J "C2'" 1 
ATOM   5826  C  "C1'" . DA  B 2  140 ? 9.330   -4.814  77.637 1.00 116.79 ? 67  DA  J "C1'" 1 
ATOM   5827  N  N9    . DA  B 2  140 ? 10.520  -5.132  78.425 1.00 107.66 ? 67  DA  J N9    1 
ATOM   5828  C  C8    . DA  B 2  140 ? 11.301  -4.271  79.155 1.00 99.78  ? 67  DA  J C8    1 
ATOM   5829  N  N7    . DA  B 2  140 ? 12.308  -4.854  79.758 1.00 104.56 ? 67  DA  J N7    1 
ATOM   5830  C  C5    . DA  B 2  140 ? 12.176  -6.191  79.412 1.00 107.94 ? 67  DA  J C5    1 
ATOM   5831  C  C6    . DA  B 2  140 ? 12.932  -7.329  79.734 1.00 113.87 ? 67  DA  J C6    1 
ATOM   5832  N  N6    . DA  B 2  140 ? 14.013  -7.299  80.516 1.00 119.39 ? 67  DA  J N6    1 
ATOM   5833  N  N1    . DA  B 2  140 ? 12.535  -8.514  79.222 1.00 116.04 ? 67  DA  J N1    1 
ATOM   5834  C  C2    . DA  B 2  140 ? 11.443  -8.543  78.448 1.00 117.52 ? 67  DA  J C2    1 
ATOM   5835  N  N3    . DA  B 2  140 ? 10.657  -7.539  78.064 1.00 114.13 ? 67  DA  J N3    1 
ATOM   5836  C  C4    . DA  B 2  140 ? 11.080  -6.377  78.590 1.00 109.79 ? 67  DA  J C4    1 
ATOM   5837  P  P     . DT  B 2  141 ? 5.262   -4.022  77.534 1.00 117.95 ? 68  DT  J P     1 
ATOM   5838  O  OP1   . DT  B 2  141 ? 4.104   -3.360  76.883 1.00 108.22 ? 68  DT  J OP1   1 
ATOM   5839  O  OP2   . DT  B 2  141 ? 5.601   -3.702  78.942 1.00 109.16 ? 68  DT  J OP2   1 
ATOM   5840  O  "O5'" . DT  B 2  141 ? 5.004   -5.585  77.410 1.00 119.99 ? 68  DT  J "O5'" 1 
ATOM   5841  C  "C5'" . DT  B 2  141 ? 5.900   -6.414  76.653 1.00 113.31 ? 68  DT  J "C5'" 1 
ATOM   5842  C  "C4'" . DT  B 2  141 ? 5.947   -7.783  77.281 1.00 102.57 ? 68  DT  J "C4'" 1 
ATOM   5843  O  "O4'" . DT  B 2  141 ? 7.166   -7.941  78.049 1.00 97.83  ? 68  DT  J "O4'" 1 
ATOM   5844  C  "C3'" . DT  B 2  141 ? 4.799   -8.069  78.253 1.00 97.11  ? 68  DT  J "C3'" 1 
ATOM   5845  O  "O3'" . DT  B 2  141 ? 4.483   -9.437  78.044 1.00 93.87  ? 68  DT  J "O3'" 1 
ATOM   5846  C  "C2'" . DT  B 2  141 ? 5.441   -7.889  79.615 1.00 97.82  ? 68  DT  J "C2'" 1 
ATOM   5847  C  "C1'" . DT  B 2  141 ? 6.819   -8.457  79.326 1.00 100.59 ? 68  DT  J "C1'" 1 
ATOM   5848  N  N1    . DT  B 2  141 ? 7.886   -8.092  80.269 1.00 91.94  ? 68  DT  J N1    1 
ATOM   5849  C  C2    . DT  B 2  141 ? 8.783   -9.061  80.661 1.00 91.99  ? 68  DT  J C2    1 
ATOM   5850  O  O2    . DT  B 2  141 ? 8.726   -10.220 80.283 1.00 96.90  ? 68  DT  J O2    1 
ATOM   5851  N  N3    . DT  B 2  141 ? 9.755   -8.622  81.524 1.00 94.94  ? 68  DT  J N3    1 
ATOM   5852  C  C4    . DT  B 2  141 ? 9.918   -7.341  82.015 1.00 93.84  ? 68  DT  J C4    1 
ATOM   5853  O  O4    . DT  B 2  141 ? 10.840  -7.097  82.786 1.00 86.19  ? 68  DT  J O4    1 
ATOM   5854  C  C5    . DT  B 2  141 ? 8.948   -6.375  81.551 1.00 95.21  ? 68  DT  J C5    1 
ATOM   5855  C  C7    . DT  B 2  141 ? 9.047   -4.959  82.022 1.00 98.65  ? 68  DT  J C7    1 
ATOM   5856  C  C6    . DT  B 2  141 ? 7.992   -6.795  80.716 1.00 94.04  ? 68  DT  J C6    1 
ATOM   5857  P  P     . DT  B 2  142 ? 3.132   -10.066 78.557 1.00 90.83  ? 69  DT  J P     1 
ATOM   5858  O  OP1   . DT  B 2  142 ? 2.513   -10.723 77.380 1.00 84.65  ? 69  DT  J OP1   1 
ATOM   5859  O  OP2   . DT  B 2  142 ? 2.368   -9.035  79.320 1.00 82.09  ? 69  DT  J OP2   1 
ATOM   5860  O  "O5'" . DT  B 2  142 ? 3.666   -11.193 79.544 1.00 77.26  ? 69  DT  J "O5'" 1 
ATOM   5861  C  "C5'" . DT  B 2  142 ? 4.661   -12.112 79.061 1.00 78.07  ? 69  DT  J "C5'" 1 
ATOM   5862  C  "C4'" . DT  B 2  142 ? 5.293   -12.869 80.206 1.00 85.85  ? 69  DT  J "C4'" 1 
ATOM   5863  O  "O4'" . DT  B 2  142 ? 6.208   -12.006 80.924 1.00 90.21  ? 69  DT  J "O4'" 1 
ATOM   5864  C  "C3'" . DT  B 2  142 ? 4.315   -13.431 81.245 1.00 81.70  ? 69  DT  J "C3'" 1 
ATOM   5865  O  "O3'" . DT  B 2  142 ? 4.540   -14.842 81.389 1.00 71.29  ? 69  DT  J "O3'" 1 
ATOM   5866  C  "C2'" . DT  B 2  142 ? 4.620   -12.636 82.503 1.00 84.36  ? 69  DT  J "C2'" 1 
ATOM   5867  C  "C1'" . DT  B 2  142 ? 6.075   -12.240 82.307 1.00 86.51  ? 69  DT  J "C1'" 1 
ATOM   5868  N  N1    . DT  B 2  142 ? 6.508   -11.016 83.013 1.00 95.61  ? 69  DT  J N1    1 
ATOM   5869  C  C2    . DT  B 2  142 ? 7.702   -11.041 83.701 1.00 91.10  ? 69  DT  J C2    1 
ATOM   5870  O  O2    . DT  B 2  142 ? 8.420   -12.025 83.755 1.00 87.69  ? 69  DT  J O2    1 
ATOM   5871  N  N3    . DT  B 2  142 ? 8.026   -9.863  84.327 1.00 87.80  ? 69  DT  J N3    1 
ATOM   5872  C  C4    . DT  B 2  142 ? 7.303   -8.685  84.315 1.00 100.93 ? 69  DT  J C4    1 
ATOM   5873  O  O4    . DT  B 2  142 ? 7.725   -7.702  84.918 1.00 112.34 ? 69  DT  J O4    1 
ATOM   5874  C  C5    . DT  B 2  142 ? 6.063   -8.728  83.572 1.00 103.56 ? 69  DT  J C5    1 
ATOM   5875  C  C7    . DT  B 2  142 ? 5.208   -7.502  83.511 1.00 98.06  ? 69  DT  J C7    1 
ATOM   5876  C  C6    . DT  B 2  142 ? 5.736   -9.874  82.960 1.00 103.96 ? 69  DT  J C6    1 
ATOM   5877  P  P     . DG  B 2  143 ? 3.508   -15.745 82.199 1.00 72.58  ? 70  DG  J P     1 
ATOM   5878  O  OP1   . DG  B 2  143 ? 3.452   -17.087 81.569 1.00 76.43  ? 70  DG  J OP1   1 
ATOM   5879  O  OP2   . DG  B 2  143 ? 2.273   -14.965 82.450 1.00 68.25  ? 70  DG  J OP2   1 
ATOM   5880  O  "O5'" . DG  B 2  143 ? 4.216   -15.934 83.604 1.00 80.63  ? 70  DG  J "O5'" 1 
ATOM   5881  C  "C5'" . DG  B 2  143 ? 5.495   -16.572 83.719 1.00 78.27  ? 70  DG  J "C5'" 1 
ATOM   5882  C  "C4'" . DG  B 2  143 ? 5.929   -16.500 85.162 1.00 79.86  ? 70  DG  J "C4'" 1 
ATOM   5883  O  "O4'" . DG  B 2  143 ? 6.281   -15.133 85.493 1.00 79.76  ? 70  DG  J "O4'" 1 
ATOM   5884  C  "C3'" . DG  B 2  143 ? 4.827   -16.899 86.145 1.00 82.98  ? 70  DG  J "C3'" 1 
ATOM   5885  O  "O3'" . DG  B 2  143 ? 5.465   -17.661 87.155 1.00 88.97  ? 70  DG  J "O3'" 1 
ATOM   5886  C  "C2'" . DG  B 2  143 ? 4.282   -15.568 86.633 1.00 79.59  ? 70  DG  J "C2'" 1 
ATOM   5887  C  "C1'" . DG  B 2  143 ? 5.545   -14.736 86.638 1.00 83.41  ? 70  DG  J "C1'" 1 
ATOM   5888  N  N9    . DG  B 2  143 ? 5.380   -13.288 86.595 1.00 89.90  ? 70  DG  J N9    1 
ATOM   5889  C  C8    . DG  B 2  143 ? 4.304   -12.554 86.152 1.00 99.11  ? 70  DG  J C8    1 
ATOM   5890  N  N7    . DG  B 2  143 ? 4.476   -11.266 86.282 1.00 96.80  ? 70  DG  J N7    1 
ATOM   5891  C  C5    . DG  B 2  143 ? 5.734   -11.145 86.854 1.00 93.13  ? 70  DG  J C5    1 
ATOM   5892  C  C6    . DG  B 2  143 ? 6.465   -9.992  87.228 1.00 85.05  ? 70  DG  J C6    1 
ATOM   5893  O  O6    . DG  B 2  143 ? 6.136   -8.805  87.127 1.00 82.69  ? 70  DG  J O6    1 
ATOM   5894  N  N1    . DG  B 2  143 ? 7.701   -10.327 87.774 1.00 88.39  ? 70  DG  J N1    1 
ATOM   5895  C  C2    . DG  B 2  143 ? 8.173   -11.608 87.936 1.00 89.07  ? 70  DG  J C2    1 
ATOM   5896  N  N2    . DG  B 2  143 ? 9.394   -11.733 88.478 1.00 96.31  ? 70  DG  J N2    1 
ATOM   5897  N  N3    . DG  B 2  143 ? 7.501   -12.688 87.590 1.00 85.05  ? 70  DG  J N3    1 
ATOM   5898  C  C4    . DG  B 2  143 ? 6.300   -12.385 87.058 1.00 91.15  ? 70  DG  J C4    1 
ATOM   5899  P  P     . DA  B 2  144 ? 4.614   -18.422 88.262 1.00 94.66  ? 71  DA  J P     1 
ATOM   5900  O  OP1   . DA  B 2  144 ? 4.305   -19.775 87.748 1.00 90.21  ? 71  DA  J OP1   1 
ATOM   5901  O  OP2   . DA  B 2  144 ? 3.501   -17.532 88.694 1.00 82.93  ? 71  DA  J OP2   1 
ATOM   5902  O  "O5'" . DA  B 2  144 ? 5.698   -18.581 89.420 1.00 100.25 ? 71  DA  J "O5'" 1 
ATOM   5903  C  "C5'" . DA  B 2  144 ? 7.119   -18.499 89.116 1.00 102.84 ? 71  DA  J "C5'" 1 
ATOM   5904  C  "C4'" . DA  B 2  144 ? 7.885   -17.848 90.248 1.00 103.89 ? 71  DA  J "C4'" 1 
ATOM   5905  O  "O4'" . DA  B 2  144 ? 7.925   -16.409 90.064 1.00 96.70  ? 71  DA  J "O4'" 1 
ATOM   5906  C  "C3'" . DA  B 2  144 ? 7.305   -18.078 91.649 1.00 112.97 ? 71  DA  J "C3'" 1 
ATOM   5907  O  "O3'" . DA  B 2  144 ? 8.355   -18.268 92.607 1.00 130.04 ? 71  DA  J "O3'" 1 
ATOM   5908  C  "C2'" . DA  B 2  144 ? 6.558   -16.791 91.931 1.00 103.79 ? 71  DA  J "C2'" 1 
ATOM   5909  C  "C1'" . DA  B 2  144 ? 7.438   -15.771 91.234 1.00 99.75  ? 71  DA  J "C1'" 1 
ATOM   5910  N  N9    . DA  B 2  144 ? 6.697   -14.586 90.830 1.00 99.32  ? 71  DA  J N9    1 
ATOM   5911  C  C8    . DA  B 2  144 ? 5.474   -14.539 90.209 1.00 100.76 ? 71  DA  J C8    1 
ATOM   5912  N  N7    . DA  B 2  144 ? 5.030   -13.323 90.008 1.00 102.39 ? 71  DA  J N7    1 
ATOM   5913  C  C5    . DA  B 2  144 ? 6.015   -12.515 90.559 1.00 102.74 ? 71  DA  J C5    1 
ATOM   5914  C  C6    . DA  B 2  144 ? 6.139   -11.122 90.670 1.00 96.56  ? 71  DA  J C6    1 
ATOM   5915  N  N6    . DA  B 2  144 ? 5.230   -10.261 90.210 1.00 96.43  ? 71  DA  J N6    1 
ATOM   5916  N  N1    . DA  B 2  144 ? 7.250   -10.637 91.268 1.00 97.86  ? 71  DA  J N1    1 
ATOM   5917  C  C2    . DA  B 2  144 ? 8.164   -11.503 91.723 1.00 92.25  ? 71  DA  J C2    1 
ATOM   5918  N  N3    . DA  B 2  144 ? 8.158   -12.832 91.679 1.00 98.27  ? 71  DA  J N3    1 
ATOM   5919  C  C4    . DA  B 2  144 ? 7.044   -13.281 91.077 1.00 104.18 ? 71  DA  J C4    1 
ATOM   5920  P  P     . DT  B 2  145 ? 8.025   -18.607 94.149 1.00 129.16 ? 72  DT  J P     1 
ATOM   5921  O  OP1   . DT  B 2  145 ? 9.174   -19.372 94.695 1.00 115.21 ? 72  DT  J OP1   1 
ATOM   5922  O  OP2   . DT  B 2  145 ? 6.629   -19.135 94.245 1.00 102.04 ? 72  DT  J OP2   1 
ATOM   5923  O  "O5'" . DT  B 2  145 ? 8.056   -17.182 94.854 1.00 116.63 ? 72  DT  J "O5'" 1 
ATOM   5924  C  "C5'" . DT  B 2  145 ? 9.214   -16.341 94.786 1.00 111.54 ? 72  DT  J "C5'" 1 
ATOM   5925  C  "C4'" . DT  B 2  145 ? 8.934   -15.099 95.595 1.00 118.92 ? 72  DT  J "C4'" 1 
ATOM   5926  O  "O4'" . DT  B 2  145 ? 8.082   -14.204 94.836 1.00 113.13 ? 72  DT  J "O4'" 1 
ATOM   5927  C  "C3'" . DT  B 2  145 ? 8.191   -15.380 96.908 1.00 123.33 ? 72  DT  J "C3'" 1 
ATOM   5928  O  "O3'" . DT  B 2  145 ? 8.823   -14.699 98.001 1.00 137.61 ? 72  DT  J "O3'" 1 
ATOM   5929  C  "C2'" . DT  B 2  145 ? 6.786   -14.865 96.646 1.00 112.27 ? 72  DT  J "C2'" 1 
ATOM   5930  C  "C1'" . DT  B 2  145 ? 7.078   -13.715 95.704 1.00 108.92 ? 72  DT  J "C1'" 1 
ATOM   5931  N  N1    . DT  B 2  145 ? 5.950   -13.232 94.885 1.00 113.23 ? 72  DT  J N1    1 
ATOM   5932  C  C2    . DT  B 2  145 ? 5.875   -11.882 94.623 1.00 109.99 ? 72  DT  J C2    1 
ATOM   5933  O  O2    . DT  B 2  145 ? 6.700   -11.079 95.022 1.00 110.75 ? 72  DT  J O2    1 
ATOM   5934  N  N3    . DT  B 2  145 ? 4.792   -11.503 93.870 1.00 115.98 ? 72  DT  J N3    1 
ATOM   5935  C  C4    . DT  B 2  145 ? 3.798   -12.321 93.368 1.00 118.48 ? 72  DT  J C4    1 
ATOM   5936  O  O4    . DT  B 2  145 ? 2.881   -11.835 92.710 1.00 117.99 ? 72  DT  J O4    1 
ATOM   5937  C  C5    . DT  B 2  145 ? 3.937   -13.726 93.683 1.00 122.95 ? 72  DT  J C5    1 
ATOM   5938  C  C7    . DT  B 2  145 ? 2.909   -14.689 93.178 1.00 124.07 ? 72  DT  J C7    1 
ATOM   5939  C  C6    . DT  B 2  145 ? 4.991   -14.106 94.417 1.00 124.99 ? 72  DT  J C6    1 
ATOM   5940  N  N     . PRO C 3  38  ? -60.480 -28.560 80.469 1.00 144.24 ? 38  PRO A N     1 
ATOM   5941  C  CA    . PRO C 3  38  ? -59.280 -27.786 80.750 1.00 144.59 ? 38  PRO A CA    1 
ATOM   5942  C  C     . PRO C 3  38  ? -58.023 -28.618 80.468 1.00 149.13 ? 38  PRO A C     1 
ATOM   5943  O  O     . PRO C 3  38  ? -57.565 -29.365 81.344 1.00 140.11 ? 38  PRO A O     1 
ATOM   5944  C  CB    . PRO C 3  38  ? -59.422 -27.495 82.246 1.00 141.47 ? 38  PRO A CB    1 
ATOM   5945  C  CG    . PRO C 3  38  ? -60.165 -28.692 82.787 1.00 142.04 ? 38  PRO A CG    1 
ATOM   5946  C  CD    . PRO C 3  38  ? -60.870 -29.375 81.634 1.00 141.90 ? 38  PRO A CD    1 
ATOM   5947  N  N     . HIS C 3  39  ? -57.481 -28.490 79.253 1.00 148.79 ? 39  HIS A N     1 
ATOM   5948  C  CA    . HIS C 3  39  ? -56.399 -29.374 78.769 1.00 141.27 ? 39  HIS A CA    1 
ATOM   5949  C  C     . HIS C 3  39  ? -55.321 -28.633 77.982 1.00 128.39 ? 39  HIS A C     1 
ATOM   5950  O  O     . HIS C 3  39  ? -55.600 -28.019 76.945 1.00 124.20 ? 39  HIS A O     1 
ATOM   5951  C  CB    . HIS C 3  39  ? -56.979 -30.473 77.879 1.00 145.15 ? 39  HIS A CB    1 
ATOM   5952  C  CG    . HIS C 3  39  ? -55.975 -31.491 77.439 1.00 136.58 ? 39  HIS A CG    1 
ATOM   5953  N  ND1   . HIS C 3  39  ? -55.455 -31.519 76.162 1.00 127.03 ? 39  HIS A ND1   1 
ATOM   5954  C  CD2   . HIS C 3  39  ? -55.404 -32.524 78.104 1.00 132.99 ? 39  HIS A CD2   1 
ATOM   5955  C  CE1   . HIS C 3  39  ? -54.608 -32.527 76.061 1.00 131.72 ? 39  HIS A CE1   1 
ATOM   5956  N  NE2   . HIS C 3  39  ? -54.559 -33.151 77.224 1.00 137.12 ? 39  HIS A NE2   1 
ATOM   5957  N  N     . ARG C 3  40  ? -54.083 -28.733 78.463 1.00 117.66 ? 40  ARG A N     1 
ATOM   5958  C  CA    . ARG C 3  40  ? -52.956 -27.970 77.903 1.00 103.68 ? 40  ARG A CA    1 
ATOM   5959  C  C     . ARG C 3  40  ? -51.760 -28.809 77.487 1.00 95.34  ? 40  ARG A C     1 
ATOM   5960  O  O     . ARG C 3  40  ? -51.183 -29.549 78.312 1.00 75.97  ? 40  ARG A O     1 
ATOM   5961  C  CB    . ARG C 3  40  ? -52.462 -26.938 78.907 1.00 92.19  ? 40  ARG A CB    1 
ATOM   5962  C  CG    . ARG C 3  40  ? -52.910 -25.535 78.570 1.00 89.15  ? 40  ARG A CG    1 
ATOM   5963  C  CD    . ARG C 3  40  ? -52.474 -24.584 79.654 1.00 84.32  ? 40  ARG A CD    1 
ATOM   5964  N  NE    . ARG C 3  40  ? -51.262 -23.867 79.308 1.00 73.88  ? 40  ARG A NE    1 
ATOM   5965  C  CZ    . ARG C 3  40  ? -51.248 -22.757 78.590 1.00 77.85  ? 40  ARG A CZ    1 
ATOM   5966  N  NH1   . ARG C 3  40  ? -52.380 -22.251 78.098 1.00 78.27  ? 40  ARG A NH1   1 
ATOM   5967  N  NH2   . ARG C 3  40  ? -50.091 -22.162 78.338 1.00 83.88  ? 40  ARG A NH2   1 
ATOM   5968  N  N     . TYR C 3  41  ? -51.367 -28.643 76.219 1.00 88.25  ? 41  TYR A N     1 
ATOM   5969  C  CA    . TYR C 3  41  ? -50.193 -29.318 75.701 1.00 84.76  ? 41  TYR A CA    1 
ATOM   5970  C  C     . TYR C 3  41  ? -48.916 -28.740 76.315 1.00 78.37  ? 41  TYR A C     1 
ATOM   5971  O  O     . TYR C 3  41  ? -48.823 -27.539 76.620 1.00 73.55  ? 41  TYR A O     1 
ATOM   5972  C  CB    . TYR C 3  41  ? -50.173 -29.291 74.173 1.00 83.69  ? 41  TYR A CB    1 
ATOM   5973  C  CG    . TYR C 3  41  ? -51.110 -30.316 73.557 1.00 80.62  ? 41  TYR A CG    1 
ATOM   5974  C  CD1   . TYR C 3  41  ? -52.129 -29.926 72.692 1.00 77.29  ? 41  TYR A CD1   1 
ATOM   5975  C  CD2   . TYR C 3  41  ? -50.979 -31.678 73.853 1.00 78.01  ? 41  TYR A CD2   1 
ATOM   5976  C  CE1   . TYR C 3  41  ? -52.983 -30.853 72.126 1.00 72.56  ? 41  TYR A CE1   1 
ATOM   5977  C  CE2   . TYR C 3  41  ? -51.832 -32.614 73.289 1.00 79.13  ? 41  TYR A CE2   1 
ATOM   5978  C  CZ    . TYR C 3  41  ? -52.838 -32.192 72.431 1.00 78.07  ? 41  TYR A CZ    1 
ATOM   5979  O  OH    . TYR C 3  41  ? -53.697 -33.116 71.870 1.00 85.15  ? 41  TYR A OH    1 
ATOM   5980  N  N     . ARG C 3  42  ? -47.947 -29.619 76.535 1.00 72.80  ? 42  ARG A N     1 
ATOM   5981  C  CA    . ARG C 3  42  ? -46.694 -29.213 77.149 1.00 79.35  ? 42  ARG A CA    1 
ATOM   5982  C  C     . ARG C 3  42  ? -45.884 -28.371 76.166 1.00 82.68  ? 42  ARG A C     1 
ATOM   5983  O  O     . ARG C 3  42  ? -45.996 -28.545 74.942 1.00 87.05  ? 42  ARG A O     1 
ATOM   5984  C  CB    . ARG C 3  42  ? -45.879 -30.429 77.572 1.00 83.59  ? 42  ARG A CB    1 
ATOM   5985  C  CG    . ARG C 3  42  ? -46.609 -31.343 78.531 1.00 85.58  ? 42  ARG A CG    1 
ATOM   5986  C  CD    . ARG C 3  42  ? -46.679 -30.724 79.913 1.00 91.33  ? 42  ARG A CD    1 
ATOM   5987  N  NE    . ARG C 3  42  ? -45.596 -31.235 80.729 1.00 96.04  ? 42  ARG A NE    1 
ATOM   5988  C  CZ    . ARG C 3  42  ? -45.603 -32.419 81.330 1.00 96.87  ? 42  ARG A CZ    1 
ATOM   5989  N  NH1   . ARG C 3  42  ? -46.649 -33.242 81.232 1.00 105.55 ? 42  ARG A NH1   1 
ATOM   5990  N  NH2   . ARG C 3  42  ? -44.548 -32.781 82.036 1.00 101.04 ? 42  ARG A NH2   1 
ATOM   5991  N  N     . PRO C 3  43  ? -45.067 -27.452 76.695 1.00 79.86  ? 43  PRO A N     1 
ATOM   5992  C  CA    . PRO C 3  43  ? -44.236 -26.631 75.842 1.00 80.62  ? 43  PRO A CA    1 
ATOM   5993  C  C     . PRO C 3  43  ? -43.281 -27.505 75.053 1.00 77.94  ? 43  PRO A C     1 
ATOM   5994  O  O     . PRO C 3  43  ? -42.525 -28.279 75.661 1.00 71.28  ? 43  PRO A O     1 
ATOM   5995  C  CB    . PRO C 3  43  ? -43.460 -25.757 76.836 1.00 83.46  ? 43  PRO A CB    1 
ATOM   5996  C  CG    . PRO C 3  43  ? -44.183 -25.874 78.123 1.00 82.58  ? 43  PRO A CG    1 
ATOM   5997  C  CD    . PRO C 3  43  ? -44.733 -27.257 78.113 1.00 85.95  ? 43  PRO A CD    1 
ATOM   5998  N  N     . GLY C 3  44  ? -43.349 -27.407 73.723 1.00 71.06  ? 44  GLY A N     1 
ATOM   5999  C  CA    . GLY C 3  44  ? -42.487 -28.193 72.847 1.00 75.05  ? 44  GLY A CA    1 
ATOM   6000  C  C     . GLY C 3  44  ? -43.250 -29.244 72.085 1.00 74.80  ? 44  GLY A C     1 
ATOM   6001  O  O     . GLY C 3  44  ? -42.814 -29.676 71.021 1.00 82.47  ? 44  GLY A O     1 
ATOM   6002  N  N     . THR C 3  45  ? -44.410 -29.631 72.603 1.00 70.16  ? 45  THR A N     1 
ATOM   6003  C  CA    . THR C 3  45  ? -45.171 -30.724 72.016 1.00 67.11  ? 45  THR A CA    1 
ATOM   6004  C  C     . THR C 3  45  ? -45.831 -30.267 70.759 1.00 60.11  ? 45  THR A C     1 
ATOM   6005  O  O     . THR C 3  45  ? -45.902 -30.995 69.789 1.00 66.15  ? 45  THR A O     1 
ATOM   6006  C  CB    . THR C 3  45  ? -46.221 -31.247 72.991 1.00 70.20  ? 45  THR A CB    1 
ATOM   6007  O  OG1   . THR C 3  45  ? -45.544 -31.784 74.132 1.00 76.27  ? 45  THR A OG1   1 
ATOM   6008  C  CG2   . THR C 3  45  ? -47.063 -32.341 72.358 1.00 70.37  ? 45  THR A CG2   1 
ATOM   6009  N  N     . VAL C 3  46  ? -46.296 -29.042 70.770 1.00 64.74  ? 46  VAL A N     1 
ATOM   6010  C  CA    . VAL C 3  46  ? -46.840 -28.465 69.564 1.00 72.55  ? 46  VAL A CA    1 
ATOM   6011  C  C     . VAL C 3  46  ? -45.700 -28.163 68.607 1.00 75.21  ? 46  VAL A C     1 
ATOM   6012  O  O     . VAL C 3  46  ? -45.806 -28.464 67.411 1.00 71.87  ? 46  VAL A O     1 
ATOM   6013  C  CB    . VAL C 3  46  ? -47.608 -27.169 69.826 1.00 72.24  ? 46  VAL A CB    1 
ATOM   6014  C  CG1   . VAL C 3  46  ? -48.445 -26.822 68.609 1.00 74.37  ? 46  VAL A CG1   1 
ATOM   6015  C  CG2   . VAL C 3  46  ? -48.500 -27.329 71.043 1.00 74.83  ? 46  VAL A CG2   1 
ATOM   6016  N  N     . ALA C 3  47  ? -44.610 -27.590 69.130 1.00 71.90  ? 47  ALA A N     1 
ATOM   6017  C  CA    . ALA C 3  47  ? -43.437 -27.297 68.296 1.00 66.21  ? 47  ALA A CA    1 
ATOM   6018  C  C     . ALA C 3  47  ? -43.156 -28.527 67.422 1.00 63.08  ? 47  ALA A C     1 
ATOM   6019  O  O     . ALA C 3  47  ? -43.201 -28.455 66.205 1.00 61.91  ? 47  ALA A O     1 
ATOM   6020  C  CB    . ALA C 3  47  ? -42.249 -26.942 69.159 1.00 59.49  ? 47  ALA A CB    1 
ATOM   6021  N  N     . LEU C 3  48  ? -42.952 -29.675 68.052 1.00 59.21  ? 48  LEU A N     1 
ATOM   6022  C  CA    . LEU C 3  48  ? -42.804 -30.941 67.324 1.00 58.22  ? 48  LEU A CA    1 
ATOM   6023  C  C     . LEU C 3  48  ? -43.896 -31.268 66.281 1.00 64.41  ? 48  LEU A C     1 
ATOM   6024  O  O     . LEU C 3  48  ? -43.605 -31.740 65.168 1.00 57.77  ? 48  LEU A O     1 
ATOM   6025  C  CB    . LEU C 3  48  ? -42.747 -32.068 68.336 1.00 60.90  ? 48  LEU A CB    1 
ATOM   6026  C  CG    . LEU C 3  48  ? -41.385 -32.506 68.888 1.00 67.89  ? 48  LEU A CG    1 
ATOM   6027  C  CD1   . LEU C 3  48  ? -40.251 -31.587 68.476 1.00 74.40  ? 48  LEU A CD1   1 
ATOM   6028  C  CD2   . LEU C 3  48  ? -41.418 -32.644 70.405 1.00 66.98  ? 48  LEU A CD2   1 
ATOM   6029  N  N     . ARG C 3  49  ? -45.153 -31.041 66.644 1.00 62.72  ? 49  ARG A N     1 
ATOM   6030  C  CA    . ARG C 3  49  ? -46.249 -31.393 65.759 1.00 65.79  ? 49  ARG A CA    1 
ATOM   6031  C  C     . ARG C 3  49  ? -46.188 -30.536 64.500 1.00 58.14  ? 49  ARG A C     1 
ATOM   6032  O  O     . ARG C 3  49  ? -46.444 -31.020 63.390 1.00 55.21  ? 49  ARG A O     1 
ATOM   6033  C  CB    . ARG C 3  49  ? -47.560 -31.183 66.506 1.00 77.36  ? 49  ARG A CB    1 
ATOM   6034  C  CG    . ARG C 3  49  ? -48.818 -31.558 65.739 1.00 85.24  ? 49  ARG A CG    1 
ATOM   6035  C  CD    . ARG C 3  49  ? -49.977 -31.906 66.679 1.00 86.42  ? 49  ARG A CD    1 
ATOM   6036  N  NE    . ARG C 3  49  ? -50.519 -30.758 67.424 1.00 84.97  ? 49  ARG A NE    1 
ATOM   6037  C  CZ    . ARG C 3  49  ? -50.649 -30.677 68.754 1.00 77.01  ? 49  ARG A CZ    1 
ATOM   6038  N  NH1   . ARG C 3  49  ? -50.252 -31.673 69.557 1.00 75.95  ? 49  ARG A NH1   1 
ATOM   6039  N  NH2   . ARG C 3  49  ? -51.182 -29.578 69.289 1.00 71.93  ? 49  ARG A NH2   1 
ATOM   6040  N  N     . GLU C 3  50  ? -45.874 -29.260 64.727 1.00 54.29  ? 50  GLU A N     1 
ATOM   6041  C  CA    . GLU C 3  50  ? -45.600 -28.282 63.699 1.00 58.55  ? 50  GLU A CA    1 
ATOM   6042  C  C     . GLU C 3  50  ? -44.344 -28.697 62.890 1.00 62.57  ? 50  GLU A C     1 
ATOM   6043  O  O     . GLU C 3  50  ? -44.300 -28.593 61.653 1.00 67.80  ? 50  GLU A O     1 
ATOM   6044  C  CB    . GLU C 3  50  ? -45.378 -26.878 64.321 1.00 61.57  ? 50  GLU A CB    1 
ATOM   6045  C  CG    . GLU C 3  50  ? -46.607 -26.109 64.839 1.00 64.92  ? 50  GLU A CG    1 
ATOM   6046  C  CD    . GLU C 3  50  ? -46.241 -24.813 65.606 1.00 71.56  ? 50  GLU A CD    1 
ATOM   6047  O  OE1   . GLU C 3  50  ? -45.479 -23.981 65.084 1.00 74.27  ? 50  GLU A OE1   1 
ATOM   6048  O  OE2   . GLU C 3  50  ? -46.696 -24.596 66.758 1.00 77.52  ? 50  GLU A OE2   1 
ATOM   6049  N  N     . ILE C 3  51  ? -43.319 -29.185 63.562 1.00 51.50  ? 51  ILE A N     1 
ATOM   6050  C  CA    . ILE C 3  51  ? -42.158 -29.566 62.798 1.00 54.94  ? 51  ILE A CA    1 
ATOM   6051  C  C     . ILE C 3  51  ? -42.530 -30.659 61.832 1.00 50.18  ? 51  ILE A C     1 
ATOM   6052  O  O     . ILE C 3  51  ? -42.175 -30.596 60.684 1.00 58.36  ? 51  ILE A O     1 
ATOM   6053  C  CB    . ILE C 3  51  ? -40.978 -30.010 63.663 1.00 52.67  ? 51  ILE A CB    1 
ATOM   6054  C  CG1   . ILE C 3  51  ? -40.325 -28.772 64.302 1.00 55.93  ? 51  ILE A CG1   1 
ATOM   6055  C  CG2   . ILE C 3  51  ? -39.971 -30.741 62.801 1.00 50.79  ? 51  ILE A CG2   1 
ATOM   6056  C  CD1   . ILE C 3  51  ? -39.361 -29.059 65.450 1.00 57.68  ? 51  ILE A CD1   1 
ATOM   6057  N  N     . ARG C 3  52  ? -43.248 -31.658 62.307 1.00 52.09  ? 52  ARG A N     1 
ATOM   6058  C  CA    . ARG C 3  52  ? -43.622 -32.781 61.469 1.00 50.05  ? 52  ARG A CA    1 
ATOM   6059  C  C     . ARG C 3  52  ? -44.564 -32.343 60.376 1.00 54.86  ? 52  ARG A C     1 
ATOM   6060  O  O     . ARG C 3  52  ? -44.474 -32.810 59.245 1.00 63.53  ? 52  ARG A O     1 
ATOM   6061  C  CB    . ARG C 3  52  ? -44.266 -33.884 62.286 1.00 52.30  ? 52  ARG A CB    1 
ATOM   6062  C  CG    . ARG C 3  52  ? -43.366 -34.347 63.411 1.00 63.45  ? 52  ARG A CG    1 
ATOM   6063  C  CD    . ARG C 3  52  ? -43.755 -35.707 63.958 1.00 71.35  ? 52  ARG A CD    1 
ATOM   6064  N  NE    . ARG C 3  52  ? -42.640 -36.236 64.752 1.00 85.37  ? 52  ARG A NE    1 
ATOM   6065  C  CZ    . ARG C 3  52  ? -42.471 -36.092 66.073 1.00 85.70  ? 52  ARG A CZ    1 
ATOM   6066  N  NH1   . ARG C 3  52  ? -43.361 -35.447 66.821 1.00 78.53  ? 52  ARG A NH1   1 
ATOM   6067  N  NH2   . ARG C 3  52  ? -41.390 -36.616 66.655 1.00 90.27  ? 52  ARG A NH2   1 
ATOM   6068  N  N     . ARG C 3  53  ? -45.469 -31.442 60.690 1.00 54.93  ? 53  ARG A N     1 
ATOM   6069  C  CA    . ARG C 3  53  ? -46.437 -31.050 59.701 1.00 61.66  ? 53  ARG A CA    1 
ATOM   6070  C  C     . ARG C 3  53  ? -45.793 -30.297 58.547 1.00 60.13  ? 53  ARG A C     1 
ATOM   6071  O  O     . ARG C 3  53  ? -46.069 -30.551 57.376 1.00 63.77  ? 53  ARG A O     1 
ATOM   6072  C  CB    . ARG C 3  53  ? -47.475 -30.167 60.348 1.00 66.00  ? 53  ARG A CB    1 
ATOM   6073  C  CG    . ARG C 3  53  ? -48.374 -29.483 59.354 1.00 67.10  ? 53  ARG A CG    1 
ATOM   6074  C  CD    . ARG C 3  53  ? -49.264 -28.559 60.124 1.00 79.40  ? 53  ARG A CD    1 
ATOM   6075  N  NE    . ARG C 3  53  ? -49.933 -27.612 59.257 1.00 84.68  ? 53  ARG A NE    1 
ATOM   6076  C  CZ    . ARG C 3  53  ? -50.684 -26.616 59.709 1.00 96.05  ? 53  ARG A CZ    1 
ATOM   6077  N  NH1   . ARG C 3  53  ? -50.838 -26.440 61.021 1.00 107.89 ? 53  ARG A NH1   1 
ATOM   6078  N  NH2   . ARG C 3  53  ? -51.281 -25.792 58.857 1.00 90.50  ? 53  ARG A NH2   1 
ATOM   6079  N  N     . TYR C 3  54  ? -44.949 -29.339 58.873 1.00 56.52  ? 54  TYR A N     1 
ATOM   6080  C  CA    . TYR C 3  54  ? -44.340 -28.549 57.819 1.00 59.02  ? 54  TYR A CA    1 
ATOM   6081  C  C     . TYR C 3  54  ? -43.201 -29.267 57.013 1.00 56.56  ? 54  TYR A C     1 
ATOM   6082  O  O     . TYR C 3  54  ? -42.951 -28.937 55.852 1.00 57.20  ? 54  TYR A O     1 
ATOM   6083  C  CB    . TYR C 3  54  ? -43.883 -27.237 58.416 1.00 58.34  ? 54  TYR A CB    1 
ATOM   6084  C  CG    . TYR C 3  54  ? -45.022 -26.365 58.832 1.00 55.71  ? 54  TYR A CG    1 
ATOM   6085  C  CD1   . TYR C 3  54  ? -45.295 -26.115 60.172 1.00 62.30  ? 54  TYR A CD1   1 
ATOM   6086  C  CD2   . TYR C 3  54  ? -45.840 -25.800 57.887 1.00 57.22  ? 54  TYR A CD2   1 
ATOM   6087  C  CE1   . TYR C 3  54  ? -46.351 -25.299 60.546 1.00 59.86  ? 54  TYR A CE1   1 
ATOM   6088  C  CE2   . TYR C 3  54  ? -46.899 -25.006 58.249 1.00 57.95  ? 54  TYR A CE2   1 
ATOM   6089  C  CZ    . TYR C 3  54  ? -47.150 -24.747 59.572 1.00 56.91  ? 54  TYR A CZ    1 
ATOM   6090  O  OH    . TYR C 3  54  ? -48.218 -23.922 59.885 1.00 58.77  ? 54  TYR A OH    1 
ATOM   6091  N  N     . GLN C 3  55  ? -42.544 -30.254 57.606 1.00 48.72  ? 55  GLN A N     1 
ATOM   6092  C  CA    . GLN C 3  55  ? -41.568 -31.037 56.872 1.00 55.43  ? 55  GLN A CA    1 
ATOM   6093  C  C     . GLN C 3  55  ? -42.238 -31.930 55.848 1.00 60.99  ? 55  GLN A C     1 
ATOM   6094  O  O     . GLN C 3  55  ? -41.675 -32.231 54.799 1.00 68.04  ? 55  GLN A O     1 
ATOM   6095  C  CB    . GLN C 3  55  ? -40.677 -31.820 57.839 1.00 54.54  ? 55  GLN A CB    1 
ATOM   6096  C  CG    . GLN C 3  55  ? -39.823 -30.857 58.658 1.00 52.81  ? 55  GLN A CG    1 
ATOM   6097  C  CD    . GLN C 3  55  ? -38.614 -31.448 59.334 1.00 50.89  ? 55  GLN A CD    1 
ATOM   6098  O  OE1   . GLN C 3  55  ? -38.494 -32.653 59.509 1.00 55.48  ? 55  GLN A OE1   1 
ATOM   6099  N  NE2   . GLN C 3  55  ? -37.698 -30.571 59.742 1.00 51.25  ? 55  GLN A NE2   1 
ATOM   6100  N  N     . LYS C 3  56  ? -43.471 -32.295 56.136 1.00 66.01  ? 56  LYS A N     1 
ATOM   6101  C  CA    . LYS C 3  56  ? -44.264 -33.112 55.237 1.00 71.61  ? 56  LYS A CA    1 
ATOM   6102  C  C     . LYS C 3  56  ? -44.649 -32.303 54.032 1.00 71.84  ? 56  LYS A C     1 
ATOM   6103  O  O     . LYS C 3  56  ? -44.678 -32.812 52.920 1.00 73.81  ? 56  LYS A O     1 
ATOM   6104  C  CB    . LYS C 3  56  ? -45.549 -33.609 55.920 1.00 79.48  ? 56  LYS A CB    1 
ATOM   6105  C  CG    . LYS C 3  56  ? -45.431 -35.025 56.443 1.00 94.38  ? 56  LYS A CG    1 
ATOM   6106  C  CD    . LYS C 3  56  ? -46.619 -35.420 57.307 1.00 106.92 ? 56  LYS A CD    1 
ATOM   6107  C  CE    . LYS C 3  56  ? -46.463 -36.841 57.849 1.00 114.21 ? 56  LYS A CE    1 
ATOM   6108  N  NZ    . LYS C 3  56  ? -46.913 -36.947 59.269 1.00 116.14 ? 56  LYS A NZ    1 
ATOM   6109  N  N     . SER C 3  57  ? -44.954 -31.037 54.251 1.00 63.60  ? 57  SER A N     1 
ATOM   6110  C  CA    . SER C 3  57  ? -45.515 -30.250 53.193 1.00 59.41  ? 57  SER A CA    1 
ATOM   6111  C  C     . SER C 3  57  ? -44.482 -29.339 52.530 1.00 67.47  ? 57  SER A C     1 
ATOM   6112  O  O     . SER C 3  57  ? -43.298 -29.257 52.938 1.00 71.23  ? 57  SER A O     1 
ATOM   6113  C  CB    . SER C 3  57  ? -46.676 -29.437 53.750 1.00 61.03  ? 57  SER A CB    1 
ATOM   6114  O  OG    . SER C 3  57  ? -46.233 -28.474 54.689 1.00 65.30  ? 57  SER A OG    1 
ATOM   6115  N  N     . THR C 3  58  ? -44.970 -28.645 51.507 1.00 62.44  ? 58  THR A N     1 
ATOM   6116  C  CA    . THR C 3  58  ? -44.171 -27.804 50.663 1.00 53.48  ? 58  THR A CA    1 
ATOM   6117  C  C     . THR C 3  58  ? -44.819 -26.474 50.319 1.00 53.02  ? 58  THR A C     1 
ATOM   6118  O  O     . THR C 3  58  ? -44.212 -25.663 49.662 1.00 50.16  ? 58  THR A O     1 
ATOM   6119  C  CB    . THR C 3  58  ? -43.981 -28.491 49.325 1.00 50.28  ? 58  THR A CB    1 
ATOM   6120  O  OG1   . THR C 3  58  ? -45.049 -28.121 48.463 1.00 52.62  ? 58  THR A OG1   1 
ATOM   6121  C  CG2   . THR C 3  58  ? -44.003 -29.901 49.497 1.00 49.66  ? 58  THR A CG2   1 
ATOM   6122  N  N     . GLU C 3  59  ? -46.068 -26.255 50.691 1.00 58.63  ? 59  GLU A N     1 
ATOM   6123  C  CA    . GLU C 3  59  ? -46.686 -24.963 50.419 1.00 61.88  ? 59  GLU A CA    1 
ATOM   6124  C  C     . GLU C 3  59  ? -45.760 -23.886 50.968 1.00 58.46  ? 59  GLU A C     1 
ATOM   6125  O  O     . GLU C 3  59  ? -45.065 -24.115 51.969 1.00 55.95  ? 59  GLU A O     1 
ATOM   6126  C  CB    . GLU C 3  59  ? -48.103 -24.878 51.038 1.00 67.19  ? 59  GLU A CB    1 
ATOM   6127  C  CG    . GLU C 3  59  ? -48.212 -24.574 52.537 1.00 72.27  ? 59  GLU A CG    1 
ATOM   6128  C  CD    . GLU C 3  59  ? -47.851 -25.738 53.448 1.00 86.59  ? 59  GLU A CD    1 
ATOM   6129  O  OE1   . GLU C 3  59  ? -48.418 -25.823 54.564 1.00 92.21  ? 59  GLU A OE1   1 
ATOM   6130  O  OE2   . GLU C 3  59  ? -46.990 -26.563 53.065 1.00 94.59  ? 59  GLU A OE2   1 
ATOM   6131  N  N     . LEU C 3  60  ? -45.721 -22.732 50.308 1.00 54.67  ? 60  LEU A N     1 
ATOM   6132  C  CA    . LEU C 3  60  ? -44.977 -21.596 50.848 1.00 59.12  ? 60  LEU A CA    1 
ATOM   6133  C  C     . LEU C 3  60  ? -45.599 -21.155 52.169 1.00 58.91  ? 60  LEU A C     1 
ATOM   6134  O  O     . LEU C 3  60  ? -46.734 -21.497 52.461 1.00 66.76  ? 60  LEU A O     1 
ATOM   6135  C  CB    . LEU C 3  60  ? -44.907 -20.436 49.855 1.00 63.39  ? 60  LEU A CB    1 
ATOM   6136  C  CG    . LEU C 3  60  ? -44.153 -20.714 48.544 1.00 70.34  ? 60  LEU A CG    1 
ATOM   6137  C  CD1   . LEU C 3  60  ? -44.752 -19.924 47.399 1.00 80.18  ? 60  LEU A CD1   1 
ATOM   6138  C  CD2   . LEU C 3  60  ? -42.682 -20.402 48.650 1.00 72.46  ? 60  LEU A CD2   1 
ATOM   6139  N  N     . LEU C 3  61  ? -44.845 -20.412 52.969 1.00 61.59  ? 61  LEU A N     1 
ATOM   6140  C  CA    . LEU C 3  61  ? -45.174 -20.196 54.362 1.00 61.51  ? 61  LEU A CA    1 
ATOM   6141  C  C     . LEU C 3  61  ? -45.159 -18.752 54.719 1.00 62.28  ? 61  LEU A C     1 
ATOM   6142  O  O     . LEU C 3  61  ? -45.074 -18.412 55.901 1.00 71.16  ? 61  LEU A O     1 
ATOM   6143  C  CB    . LEU C 3  61  ? -44.161 -20.911 55.257 1.00 60.63  ? 61  LEU A CB    1 
ATOM   6144  C  CG    . LEU C 3  61  ? -43.986 -22.384 54.958 1.00 59.92  ? 61  LEU A CG    1 
ATOM   6145  C  CD1   . LEU C 3  61  ? -42.981 -23.016 55.912 1.00 58.87  ? 61  LEU A CD1   1 
ATOM   6146  C  CD2   . LEU C 3  61  ? -45.339 -23.069 55.053 1.00 62.29  ? 61  LEU A CD2   1 
ATOM   6147  N  N     . ILE C 3  62  ? -45.221 -17.901 53.708 1.00 63.50  ? 62  ILE A N     1 
ATOM   6148  C  CA    . ILE C 3  62  ? -45.308 -16.466 53.898 1.00 61.26  ? 62  ILE A CA    1 
ATOM   6149  C  C     . ILE C 3  62  ? -46.427 -15.993 53.010 1.00 62.59  ? 62  ILE A C     1 
ATOM   6150  O  O     . ILE C 3  62  ? -46.592 -16.459 51.883 1.00 67.07  ? 62  ILE A O     1 
ATOM   6151  C  CB    . ILE C 3  62  ? -44.025 -15.768 53.450 1.00 64.00  ? 62  ILE A CB    1 
ATOM   6152  C  CG1   . ILE C 3  62  ? -42.838 -16.236 54.268 1.00 60.72  ? 62  ILE A CG1   1 
ATOM   6153  C  CG2   . ILE C 3  62  ? -44.135 -14.257 53.595 1.00 71.28  ? 62  ILE A CG2   1 
ATOM   6154  C  CD1   . ILE C 3  62  ? -41.529 -15.763 53.684 1.00 63.07  ? 62  ILE A CD1   1 
ATOM   6155  N  N     . ARG C 3  63  ? -47.185 -15.031 53.487 1.00 70.25  ? 63  ARG A N     1 
ATOM   6156  C  CA    . ARG C 3  63  ? -48.386 -14.637 52.774 1.00 77.07  ? 63  ARG A CA    1 
ATOM   6157  C  C     . ARG C 3  63  ? -47.901 -13.905 51.528 1.00 67.10  ? 63  ARG A C     1 
ATOM   6158  O  O     . ARG C 3  63  ? -46.934 -13.161 51.608 1.00 69.94  ? 63  ARG A O     1 
ATOM   6159  C  CB    . ARG C 3  63  ? -49.276 -13.777 53.681 1.00 85.91  ? 63  ARG A CB    1 
ATOM   6160  C  CG    . ARG C 3  63  ? -49.443 -14.308 55.107 1.00 88.99  ? 63  ARG A CG    1 
ATOM   6161  C  CD    . ARG C 3  63  ? -50.082 -15.695 55.144 1.00 93.67  ? 63  ARG A CD    1 
ATOM   6162  N  NE    . ARG C 3  63  ? -51.372 -15.719 54.469 1.00 110.05 ? 63  ARG A NE    1 
ATOM   6163  C  CZ    . ARG C 3  63  ? -52.460 -15.061 54.885 1.00 134.03 ? 63  ARG A CZ    1 
ATOM   6164  N  NH1   . ARG C 3  63  ? -52.445 -14.297 55.991 1.00 134.07 ? 63  ARG A NH1   1 
ATOM   6165  N  NH2   . ARG C 3  63  ? -53.584 -15.157 54.180 1.00 140.77 ? 63  ARG A NH2   1 
ATOM   6166  N  N     . LYS C 3  64  ? -48.528 -14.131 50.381 1.00 62.47  ? 64  LYS A N     1 
ATOM   6167  C  CA    . LYS C 3  64  ? -47.926 -13.669 49.119 1.00 69.84  ? 64  LYS A CA    1 
ATOM   6168  C  C     . LYS C 3  64  ? -47.869 -12.179 49.023 1.00 73.17  ? 64  LYS A C     1 
ATOM   6169  O  O     . LYS C 3  64  ? -46.904 -11.626 48.494 1.00 79.06  ? 64  LYS A O     1 
ATOM   6170  C  CB    . LYS C 3  64  ? -48.651 -14.190 47.892 1.00 71.68  ? 64  LYS A CB    1 
ATOM   6171  C  CG    . LYS C 3  64  ? -49.109 -15.628 48.050 1.00 81.84  ? 64  LYS A CG    1 
ATOM   6172  C  CD    . LYS C 3  64  ? -49.007 -16.448 46.778 1.00 81.37  ? 64  LYS A CD    1 
ATOM   6173  C  CE    . LYS C 3  64  ? -48.725 -17.879 47.201 1.00 92.83  ? 64  LYS A CE    1 
ATOM   6174  N  NZ    . LYS C 3  64  ? -48.766 -18.817 46.057 1.00 99.03  ? 64  LYS A NZ    1 
ATOM   6175  N  N     . LEU C 3  65  ? -48.900 -11.521 49.533 1.00 74.53  ? 65  LEU A N     1 
ATOM   6176  C  CA    . LEU C 3  65  ? -48.979 -10.076 49.383 1.00 76.73  ? 65  LEU A CA    1 
ATOM   6177  C  C     . LEU C 3  65  ? -47.893 -9.340  50.161 1.00 62.94  ? 65  LEU A C     1 
ATOM   6178  O  O     . LEU C 3  65  ? -47.148 -8.558  49.578 1.00 61.64  ? 65  LEU A O     1 
ATOM   6179  C  CB    . LEU C 3  65  ? -50.370 -9.554  49.768 1.00 87.07  ? 65  LEU A CB    1 
ATOM   6180  C  CG    . LEU C 3  65  ? -50.485 -8.023  49.899 1.00 91.89  ? 65  LEU A CG    1 
ATOM   6181  C  CD1   . LEU C 3  65  ? -50.167 -7.319  48.579 1.00 85.76  ? 65  LEU A CD1   1 
ATOM   6182  C  CD2   . LEU C 3  65  ? -51.844 -7.606  50.458 1.00 94.83  ? 65  LEU A CD2   1 
ATOM   6183  N  N     . PRO C 3  66  ? -47.798 -9.571  51.474 1.00 58.46  ? 66  PRO A N     1 
ATOM   6184  C  CA    . PRO C 3  66  ? -46.777 -8.820  52.209 1.00 64.34  ? 66  PRO A CA    1 
ATOM   6185  C  C     . PRO C 3  66  ? -45.410 -9.034  51.585 1.00 71.01  ? 66  PRO A C     1 
ATOM   6186  O  O     . PRO C 3  66  ? -44.579 -8.144  51.614 1.00 74.74  ? 66  PRO A O     1 
ATOM   6187  C  CB    . PRO C 3  66  ? -46.816 -9.408  53.628 1.00 63.86  ? 66  PRO A CB    1 
ATOM   6188  C  CG    . PRO C 3  66  ? -47.627 -10.649 53.538 1.00 61.77  ? 66  PRO A CG    1 
ATOM   6189  C  CD    . PRO C 3  66  ? -48.511 -10.533 52.325 1.00 62.77  ? 66  PRO A CD    1 
ATOM   6190  N  N     . PHE C 3  67  ? -45.200 -10.211 50.997 1.00 74.83  ? 67  PHE A N     1 
ATOM   6191  C  CA    . PHE C 3  67  ? -43.989 -10.481 50.261 1.00 65.74  ? 67  PHE A CA    1 
ATOM   6192  C  C     . PHE C 3  67  ? -43.858 -9.589  49.046 1.00 65.83  ? 67  PHE A C     1 
ATOM   6193  O  O     . PHE C 3  67  ? -42.815 -8.987  48.807 1.00 69.68  ? 67  PHE A O     1 
ATOM   6194  C  CB    . PHE C 3  67  ? -43.946 -11.929 49.816 1.00 68.82  ? 67  PHE A CB    1 
ATOM   6195  C  CG    . PHE C 3  67  ? -42.596 -12.340 49.302 1.00 70.80  ? 67  PHE A CG    1 
ATOM   6196  C  CD1   . PHE C 3  67  ? -41.559 -12.585 50.187 1.00 62.60  ? 67  PHE A CD1   1 
ATOM   6197  C  CD2   . PHE C 3  67  ? -42.348 -12.438 47.935 1.00 71.45  ? 67  PHE A CD2   1 
ATOM   6198  C  CE1   . PHE C 3  67  ? -40.313 -12.927 49.731 1.00 57.17  ? 67  PHE A CE1   1 
ATOM   6199  C  CE2   . PHE C 3  67  ? -41.101 -12.800 47.473 1.00 64.36  ? 67  PHE A CE2   1 
ATOM   6200  C  CZ    . PHE C 3  67  ? -40.087 -13.051 48.377 1.00 63.78  ? 67  PHE A CZ    1 
ATOM   6201  N  N     . GLN C 3  68  ? -44.918 -9.524  48.260 1.00 68.59  ? 68  GLN A N     1 
ATOM   6202  C  CA    . GLN C 3  68  ? -44.911 -8.713  47.060 1.00 69.33  ? 68  GLN A CA    1 
ATOM   6203  C  C     . GLN C 3  68  ? -44.519 -7.259  47.368 1.00 64.41  ? 68  GLN A C     1 
ATOM   6204  O  O     . GLN C 3  68  ? -43.782 -6.645  46.614 1.00 62.92  ? 68  GLN A O     1 
ATOM   6205  C  CB    . GLN C 3  68  ? -46.286 -8.782  46.394 1.00 79.89  ? 68  GLN A CB    1 
ATOM   6206  C  CG    . GLN C 3  68  ? -46.315 -8.372  44.923 1.00 81.67  ? 68  GLN A CG    1 
ATOM   6207  C  CD    . GLN C 3  68  ? -46.941 -9.438  44.035 1.00 90.18  ? 68  GLN A CD    1 
ATOM   6208  O  OE1   . GLN C 3  68  ? -47.134 -10.579 44.457 1.00 95.13  ? 68  GLN A OE1   1 
ATOM   6209  N  NE2   . GLN C 3  68  ? -47.249 -9.077  42.795 1.00 90.50  ? 68  GLN A NE2   1 
ATOM   6210  N  N     . ARG C 3  69  ? -44.982 -6.712  48.481 1.00 61.50  ? 69  ARG A N     1 
ATOM   6211  C  CA    . ARG C 3  69  ? -44.670 -5.312  48.791 1.00 69.28  ? 69  ARG A CA    1 
ATOM   6212  C  C     . ARG C 3  69  ? -43.204 -5.167  49.145 1.00 62.99  ? 69  ARG A C     1 
ATOM   6213  O  O     . ARG C 3  69  ? -42.533 -4.224  48.717 1.00 57.43  ? 69  ARG A O     1 
ATOM   6214  C  CB    . ARG C 3  69  ? -45.524 -4.764  49.958 1.00 81.85  ? 69  ARG A CB    1 
ATOM   6215  C  CG    . ARG C 3  69  ? -47.013 -4.555  49.672 1.00 86.40  ? 69  ARG A CG    1 
ATOM   6216  C  CD    . ARG C 3  69  ? -47.694 -3.709  50.750 1.00 88.64  ? 69  ARG A CD    1 
ATOM   6217  N  NE    . ARG C 3  69  ? -47.530 -4.261  52.099 1.00 85.16  ? 69  ARG A NE    1 
ATOM   6218  C  CZ    . ARG C 3  69  ? -48.333 -5.154  52.681 1.00 82.04  ? 69  ARG A CZ    1 
ATOM   6219  N  NH1   . ARG C 3  69  ? -49.397 -5.640  52.058 1.00 75.28  ? 69  ARG A NH1   1 
ATOM   6220  N  NH2   . ARG C 3  69  ? -48.055 -5.578  53.910 1.00 83.32  ? 69  ARG A NH2   1 
ATOM   6221  N  N     . LEU C 3  70  ? -42.708 -6.104  49.946 1.00 64.49  ? 70  LEU A N     1 
ATOM   6222  C  CA    . LEU C 3  70  ? -41.310 -6.077  50.352 1.00 64.37  ? 70  LEU A CA    1 
ATOM   6223  C  C     . LEU C 3  70  ? -40.402 -6.044  49.144 1.00 64.54  ? 70  LEU A C     1 
ATOM   6224  O  O     . LEU C 3  70  ? -39.479 -5.239  49.059 1.00 63.03  ? 70  LEU A O     1 
ATOM   6225  C  CB    . LEU C 3  70  ? -40.962 -7.299  51.169 1.00 65.99  ? 70  LEU A CB    1 
ATOM   6226  C  CG    . LEU C 3  70  ? -39.531 -7.258  51.700 1.00 71.86  ? 70  LEU A CG    1 
ATOM   6227  C  CD1   . LEU C 3  70  ? -39.204 -5.939  52.380 1.00 71.20  ? 70  LEU A CD1   1 
ATOM   6228  C  CD2   . LEU C 3  70  ? -39.349 -8.399  52.677 1.00 78.01  ? 70  LEU A CD2   1 
ATOM   6229  N  N     . VAL C 3  71  ? -40.685 -6.924  48.200 1.00 59.10  ? 71  VAL A N     1 
ATOM   6230  C  CA    . VAL C 3  71  ? -39.910 -6.982  47.002 1.00 57.76  ? 71  VAL A CA    1 
ATOM   6231  C  C     . VAL C 3  71  ? -39.885 -5.638  46.319 1.00 57.78  ? 71  VAL A C     1 
ATOM   6232  O  O     . VAL C 3  71  ? -38.844 -5.036  46.123 1.00 64.52  ? 71  VAL A O     1 
ATOM   6233  C  CB    . VAL C 3  71  ? -40.518 -8.000  46.059 1.00 65.60  ? 71  VAL A CB    1 
ATOM   6234  C  CG1   . VAL C 3  71  ? -39.924 -7.844  44.666 1.00 69.59  ? 71  VAL A CG1   1 
ATOM   6235  C  CG2   . VAL C 3  71  ? -40.303 -9.401  46.618 1.00 63.54  ? 71  VAL A CG2   1 
ATOM   6236  N  N     . ARG C 3  72  ? -41.058 -5.139  45.992 1.00 67.77  ? 72  ARG A N     1 
ATOM   6237  C  CA    . ARG C 3  72  ? -41.159 -3.901  45.226 1.00 62.72  ? 72  ARG A CA    1 
ATOM   6238  C  C     . ARG C 3  72  ? -40.547 -2.743  46.005 1.00 59.74  ? 72  ARG A C     1 
ATOM   6239  O  O     . ARG C 3  72  ? -39.866 -1.895  45.403 1.00 56.24  ? 72  ARG A O     1 
ATOM   6240  C  CB    . ARG C 3  72  ? -42.608 -3.640  44.875 1.00 61.04  ? 72  ARG A CB    1 
ATOM   6241  C  CG    . ARG C 3  72  ? -43.206 -4.730  44.001 1.00 60.89  ? 72  ARG A CG    1 
ATOM   6242  C  CD    . ARG C 3  72  ? -44.719 -4.710  44.094 1.00 62.12  ? 72  ARG A CD    1 
ATOM   6243  N  NE    . ARG C 3  72  ? -45.349 -5.645  43.167 1.00 60.38  ? 72  ARG A NE    1 
ATOM   6244  C  CZ    . ARG C 3  72  ? -45.427 -5.437  41.855 1.00 68.03  ? 72  ARG A CZ    1 
ATOM   6245  N  NH1   . ARG C 3  72  ? -44.913 -4.328  41.307 1.00 64.68  ? 72  ARG A NH1   1 
ATOM   6246  N  NH2   . ARG C 3  72  ? -46.022 -6.340  41.074 1.00 67.72  ? 72  ARG A NH2   1 
ATOM   6247  N  N     . GLU C 3  73  ? -40.738 -2.730  47.333 1.00 53.46  ? 73  GLU A N     1 
ATOM   6248  C  CA    . GLU C 3  73  ? -40.135 -1.687  48.166 1.00 61.33  ? 73  GLU A CA    1 
ATOM   6249  C  C     . GLU C 3  73  ? -38.655 -1.683  47.844 1.00 65.33  ? 73  GLU A C     1 
ATOM   6250  O  O     . GLU C 3  73  ? -38.081 -0.665  47.475 1.00 66.93  ? 73  GLU A O     1 
ATOM   6251  C  CB    . GLU C 3  73  ? -40.385 -1.930  49.679 1.00 66.38  ? 73  GLU A CB    1 
ATOM   6252  C  CG    . GLU C 3  73  ? -39.583 -1.038  50.645 1.00 69.82  ? 73  GLU A CG    1 
ATOM   6253  C  CD    . GLU C 3  73  ? -39.889 -1.300  52.126 1.00 77.04  ? 73  GLU A CD    1 
ATOM   6254  O  OE1   . GLU C 3  73  ? -40.942 -0.846  52.614 1.00 90.32  ? 73  GLU A OE1   1 
ATOM   6255  O  OE2   . GLU C 3  73  ? -39.072 -1.935  52.834 1.00 83.68  ? 73  GLU A OE2   1 
ATOM   6256  N  N     . ILE C 3  74  ? -38.064 -2.868  47.938 1.00 70.92  ? 74  ILE A N     1 
ATOM   6257  C  CA    . ILE C 3  74  ? -36.631 -3.034  47.834 1.00 66.75  ? 74  ILE A CA    1 
ATOM   6258  C  C     . ILE C 3  74  ? -36.145 -2.718  46.440 1.00 67.25  ? 74  ILE A C     1 
ATOM   6259  O  O     . ILE C 3  74  ? -35.138 -2.019  46.275 1.00 68.92  ? 74  ILE A O     1 
ATOM   6260  C  CB    . ILE C 3  74  ? -36.231 -4.461  48.234 1.00 66.17  ? 74  ILE A CB    1 
ATOM   6261  C  CG1   . ILE C 3  74  ? -36.081 -4.529  49.755 1.00 64.45  ? 74  ILE A CG1   1 
ATOM   6262  C  CG2   . ILE C 3  74  ? -34.920 -4.871  47.589 1.00 72.88  ? 74  ILE A CG2   1 
ATOM   6263  C  CD1   . ILE C 3  74  ? -36.150 -5.930  50.322 1.00 62.31  ? 74  ILE A CD1   1 
ATOM   6264  N  N     . ALA C 3  75  ? -36.852 -3.245  45.444 1.00 60.12  ? 75  ALA A N     1 
ATOM   6265  C  CA    . ALA C 3  75  ? -36.470 -3.033  44.049 1.00 58.20  ? 75  ALA A CA    1 
ATOM   6266  C  C     . ALA C 3  75  ? -36.517 -1.579  43.650 1.00 65.64  ? 75  ALA A C     1 
ATOM   6267  O  O     . ALA C 3  75  ? -35.717 -1.152  42.823 1.00 69.18  ? 75  ALA A O     1 
ATOM   6268  C  CB    . ALA C 3  75  ? -37.362 -3.829  43.138 1.00 56.29  ? 75  ALA A CB    1 
ATOM   6269  N  N     . GLN C 3  76  ? -37.460 -0.826  44.230 1.00 76.68  ? 76  GLN A N     1 
ATOM   6270  C  CA    . GLN C 3  76  ? -37.558 0.620   44.003 1.00 78.05  ? 76  GLN A CA    1 
ATOM   6271  C  C     . GLN C 3  76  ? -36.222 1.336   44.182 1.00 74.93  ? 76  GLN A C     1 
ATOM   6272  O  O     . GLN C 3  76  ? -35.896 2.188   43.378 1.00 73.71  ? 76  GLN A O     1 
ATOM   6273  C  CB    . GLN C 3  76  ? -38.621 1.262   44.907 1.00 87.26  ? 76  GLN A CB    1 
ATOM   6274  C  CG    . GLN C 3  76  ? -39.084 2.654   44.466 1.00 98.06  ? 76  GLN A CG    1 
ATOM   6275  C  CD    . GLN C 3  76  ? -39.858 2.674   43.133 1.00 104.07 ? 76  GLN A CD    1 
ATOM   6276  O  OE1   . GLN C 3  76  ? -39.736 1.769   42.293 1.00 106.14 ? 76  GLN A OE1   1 
ATOM   6277  N  NE2   . GLN C 3  76  ? -40.649 3.725   42.932 1.00 99.19  ? 76  GLN A NE2   1 
ATOM   6278  N  N     . ASP C 3  77  ? -35.432 0.973   45.192 1.00 70.93  ? 77  ASP A N     1 
ATOM   6279  C  CA    . ASP C 3  77  ? -34.148 1.642   45.402 1.00 70.66  ? 77  ASP A CA    1 
ATOM   6280  C  C     . ASP C 3  77  ? -33.156 1.426   44.248 1.00 66.01  ? 77  ASP A C     1 
ATOM   6281  O  O     . ASP C 3  77  ? -32.145 2.096   44.185 1.00 76.90  ? 77  ASP A O     1 
ATOM   6282  C  CB    . ASP C 3  77  ? -33.519 1.253   46.765 1.00 80.20  ? 77  ASP A CB    1 
ATOM   6283  C  CG    . ASP C 3  77  ? -34.281 1.851   47.972 1.00 92.77  ? 77  ASP A CG    1 
ATOM   6284  O  OD1   . ASP C 3  77  ? -35.078 1.114   48.601 1.00 95.75  ? 77  ASP A OD1   1 
ATOM   6285  O  OD2   . ASP C 3  77  ? -34.095 3.057   48.288 1.00 96.82  ? 77  ASP A OD2   1 
ATOM   6286  N  N     . PHE C 3  78  ? -33.406 0.507   43.327 1.00 67.54  ? 78  PHE A N     1 
ATOM   6287  C  CA    . PHE C 3  78  ? -32.487 0.350   42.167 1.00 68.14  ? 78  PHE A CA    1 
ATOM   6288  C  C     . PHE C 3  78  ? -33.145 0.792   40.853 1.00 72.52  ? 78  PHE A C     1 
ATOM   6289  O  O     . PHE C 3  78  ? -32.451 1.014   39.851 1.00 69.93  ? 78  PHE A O     1 
ATOM   6290  C  CB    . PHE C 3  78  ? -31.967 -1.107  41.985 1.00 65.39  ? 78  PHE A CB    1 
ATOM   6291  C  CG    . PHE C 3  78  ? -31.565 -1.795  43.268 1.00 65.78  ? 78  PHE A CG    1 
ATOM   6292  C  CD1   . PHE C 3  78  ? -32.227 -2.937  43.701 1.00 64.29  ? 78  PHE A CD1   1 
ATOM   6293  C  CD2   . PHE C 3  78  ? -30.538 -1.298  44.046 1.00 64.32  ? 78  PHE A CD2   1 
ATOM   6294  C  CE1   . PHE C 3  78  ? -31.881 -3.552  44.887 1.00 62.90  ? 78  PHE A CE1   1 
ATOM   6295  C  CE2   . PHE C 3  78  ? -30.180 -1.923  45.233 1.00 63.70  ? 78  PHE A CE2   1 
ATOM   6296  C  CZ    . PHE C 3  78  ? -30.848 -3.046  45.654 1.00 58.67  ? 78  PHE A CZ    1 
ATOM   6297  N  N     . LYS C 3  79  ? -34.475 0.850   40.811 1.00 73.10  ? 79  LYS A N     1 
ATOM   6298  C  CA    . LYS C 3  79  ? -35.131 1.496   39.680 1.00 80.90  ? 79  LYS A CA    1 
ATOM   6299  C  C     . LYS C 3  79  ? -36.601 1.707   39.926 1.00 85.96  ? 79  LYS A C     1 
ATOM   6300  O  O     . LYS C 3  79  ? -37.271 0.874   40.549 1.00 95.14  ? 79  LYS A O     1 
ATOM   6301  C  CB    . LYS C 3  79  ? -34.954 0.725   38.376 1.00 82.57  ? 79  LYS A CB    1 
ATOM   6302  C  CG    . LYS C 3  79  ? -34.646 1.647   37.219 1.00 89.92  ? 79  LYS A CG    1 
ATOM   6303  C  CD    . LYS C 3  79  ? -35.546 1.402   36.023 1.00 96.25  ? 79  LYS A CD    1 
ATOM   6304  C  CE    . LYS C 3  79  ? -35.577 2.630   35.122 1.00 101.03 ? 79  LYS A CE    1 
ATOM   6305  N  NZ    . LYS C 3  79  ? -35.784 2.224   33.706 1.00 104.58 ? 79  LYS A NZ    1 
ATOM   6306  N  N     . THR C 3  80  ? -37.098 2.823   39.402 1.00 87.10  ? 80  THR A N     1 
ATOM   6307  C  CA    . THR C 3  80  ? -38.459 3.269   39.671 1.00 84.06  ? 80  THR A CA    1 
ATOM   6308  C  C     . THR C 3  80  ? -39.394 2.888   38.557 1.00 77.56  ? 80  THR A C     1 
ATOM   6309  O  O     . THR C 3  80  ? -38.984 2.684   37.421 1.00 63.98  ? 80  THR A O     1 
ATOM   6310  C  CB    . THR C 3  80  ? -38.503 4.786   39.823 1.00 84.18  ? 80  THR A CB    1 
ATOM   6311  O  OG1   . THR C 3  80  ? -37.755 5.373   38.757 1.00 84.96  ? 80  THR A OG1   1 
ATOM   6312  C  CG2   . THR C 3  80  ? -37.888 5.203   41.148 1.00 85.15  ? 80  THR A CG2   1 
ATOM   6313  N  N     . ASP C 3  81  ? -40.669 2.813   38.902 1.00 88.33  ? 81  ASP A N     1 
ATOM   6314  C  CA    . ASP C 3  81  ? -41.723 2.507   37.934 1.00 95.73  ? 81  ASP A CA    1 
ATOM   6315  C  C     . ASP C 3  81  ? -41.401 1.162   37.315 1.00 88.20  ? 81  ASP A C     1 
ATOM   6316  O  O     . ASP C 3  81  ? -40.815 1.057   36.235 1.00 90.42  ? 81  ASP A O     1 
ATOM   6317  C  CB    . ASP C 3  81  ? -41.885 3.612   36.871 1.00 96.51  ? 81  ASP A CB    1 
ATOM   6318  C  CG    . ASP C 3  81  ? -43.255 3.574   36.195 1.00 111.34 ? 81  ASP A CG    1 
ATOM   6319  O  OD1   . ASP C 3  81  ? -44.245 3.109   36.835 1.00 104.35 ? 81  ASP A OD1   1 
ATOM   6320  O  OD2   . ASP C 3  81  ? -43.339 4.017   35.023 1.00 116.16 ? 81  ASP A OD2   1 
ATOM   6321  N  N     . LEU C 3  82  ? -41.779 0.129   38.042 1.00 78.81  ? 82  LEU A N     1 
ATOM   6322  C  CA    . LEU C 3  82  ? -41.283 -1.189  37.766 1.00 79.75  ? 82  LEU A CA    1 
ATOM   6323  C  C     . LEU C 3  82  ? -42.388 -2.169  37.929 1.00 76.28  ? 82  LEU A C     1 
ATOM   6324  O  O     . LEU C 3  82  ? -43.053 -2.168  38.939 1.00 74.39  ? 82  LEU A O     1 
ATOM   6325  C  CB    . LEU C 3  82  ? -40.162 -1.550  38.745 1.00 79.78  ? 82  LEU A CB    1 
ATOM   6326  C  CG    . LEU C 3  82  ? -38.744 -1.477  38.175 1.00 83.21  ? 82  LEU A CG    1 
ATOM   6327  C  CD1   . LEU C 3  82  ? -37.718 -1.964  39.192 1.00 84.26  ? 82  LEU A CD1   1 
ATOM   6328  C  CD2   . LEU C 3  82  ? -38.635 -2.270  36.881 1.00 76.47  ? 82  LEU A CD2   1 
ATOM   6329  N  N     . ARG C 3  83  ? -42.563 -3.021  36.936 1.00 76.56  ? 83  ARG A N     1 
ATOM   6330  C  CA    . ARG C 3  83  ? -43.532 -4.086  37.024 1.00 80.46  ? 83  ARG A CA    1 
ATOM   6331  C  C     . ARG C 3  83  ? -42.713 -5.368  37.082 1.00 76.39  ? 83  ARG A C     1 
ATOM   6332  O  O     . ARG C 3  83  ? -41.508 -5.349  36.824 1.00 69.16  ? 83  ARG A O     1 
ATOM   6333  C  CB    . ARG C 3  83  ? -44.490 -4.044  35.823 1.00 88.08  ? 83  ARG A CB    1 
ATOM   6334  C  CG    . ARG C 3  83  ? -44.793 -2.623  35.338 1.00 91.87  ? 83  ARG A CG    1 
ATOM   6335  C  CD    . ARG C 3  83  ? -45.757 -2.564  34.166 1.00 89.84  ? 83  ARG A CD    1 
ATOM   6336  N  NE    . ARG C 3  83  ? -47.147 -2.482  34.612 1.00 95.35  ? 83  ARG A NE    1 
ATOM   6337  C  CZ    . ARG C 3  83  ? -48.188 -2.918  33.909 1.00 99.97  ? 83  ARG A CZ    1 
ATOM   6338  N  NH1   . ARG C 3  83  ? -48.007 -3.476  32.715 1.00 100.02 ? 83  ARG A NH1   1 
ATOM   6339  N  NH2   . ARG C 3  83  ? -49.420 -2.804  34.400 1.00 102.75 ? 83  ARG A NH2   1 
ATOM   6340  N  N     . PHE C 3  84  ? -43.381 -6.465  37.415 1.00 70.69  ? 84  PHE A N     1 
ATOM   6341  C  CA    . PHE C 3  84  ? -42.747 -7.729  37.760 1.00 70.20  ? 84  PHE A CA    1 
ATOM   6342  C  C     . PHE C 3  84  ? -43.637 -8.811  37.232 1.00 63.10  ? 84  PHE A C     1 
ATOM   6343  O  O     . PHE C 3  84  ? -44.800 -8.812  37.573 1.00 68.07  ? 84  PHE A O     1 
ATOM   6344  C  CB    . PHE C 3  84  ? -42.789 -7.926  39.278 1.00 74.20  ? 84  PHE A CB    1 
ATOM   6345  C  CG    . PHE C 3  84  ? -41.591 -7.421  40.020 1.00 75.17  ? 84  PHE A CG    1 
ATOM   6346  C  CD1   . PHE C 3  84  ? -41.363 -6.062  40.174 1.00 73.63  ? 84  PHE A CD1   1 
ATOM   6347  C  CD2   . PHE C 3  84  ? -40.732 -8.316  40.650 1.00 72.16  ? 84  PHE A CD2   1 
ATOM   6348  C  CE1   . PHE C 3  84  ? -40.260 -5.612  40.889 1.00 69.91  ? 84  PHE A CE1   1 
ATOM   6349  C  CE2   . PHE C 3  84  ? -39.639 -7.865  41.368 1.00 63.40  ? 84  PHE A CE2   1 
ATOM   6350  C  CZ    . PHE C 3  84  ? -39.397 -6.515  41.478 1.00 63.21  ? 84  PHE A CZ    1 
ATOM   6351  N  N     . GLN C 3  85  ? -43.142 -9.790  36.498 1.00 60.30  ? 85  GLN A N     1 
ATOM   6352  C  CA    . GLN C 3  85  ? -44.037 -10.897 36.198 1.00 62.75  ? 85  GLN A CA    1 
ATOM   6353  C  C     . GLN C 3  85  ? -44.460 -11.553 37.483 1.00 69.31  ? 85  GLN A C     1 
ATOM   6354  O  O     . GLN C 3  85  ? -43.706 -11.564 38.475 1.00 67.97  ? 85  GLN A O     1 
ATOM   6355  C  CB    . GLN C 3  85  ? -43.410 -11.928 35.313 1.00 64.18  ? 85  GLN A CB    1 
ATOM   6356  C  CG    . GLN C 3  85  ? -43.219 -11.417 33.923 1.00 63.74  ? 85  GLN A CG    1 
ATOM   6357  C  CD    . GLN C 3  85  ? -42.510 -12.406 33.067 1.00 61.26  ? 85  GLN A CD    1 
ATOM   6358  O  OE1   . GLN C 3  85  ? -42.216 -13.530 33.493 1.00 64.49  ? 85  GLN A OE1   1 
ATOM   6359  N  NE2   . GLN C 3  85  ? -42.234 -12.009 31.843 1.00 55.13  ? 85  GLN A NE2   1 
ATOM   6360  N  N     . SER C 3  86  ? -45.676 -12.086 37.450 1.00 65.03  ? 86  SER A N     1 
ATOM   6361  C  CA    . SER C 3  86  ? -46.242 -12.815 38.560 1.00 67.28  ? 86  SER A CA    1 
ATOM   6362  C  C     . SER C 3  86  ? -45.389 -14.037 38.919 1.00 72.14  ? 86  SER A C     1 
ATOM   6363  O  O     . SER C 3  86  ? -45.333 -14.416 40.081 1.00 81.26  ? 86  SER A O     1 
ATOM   6364  C  CB    . SER C 3  86  ? -47.651 -13.265 38.201 1.00 70.73  ? 86  SER A CB    1 
ATOM   6365  O  OG    . SER C 3  86  ? -48.047 -14.343 39.010 1.00 78.84  ? 86  SER A OG    1 
ATOM   6366  N  N     . SER C 3  87  ? -44.754 -14.658 37.921 1.00 68.04  ? 87  SER A N     1 
ATOM   6367  C  CA    . SER C 3  87  ? -43.818 -15.767 38.153 1.00 63.73  ? 87  SER A CA    1 
ATOM   6368  C  C     . SER C 3  87  ? -42.467 -15.271 38.709 1.00 67.10  ? 87  SER A C     1 
ATOM   6369  O  O     . SER C 3  87  ? -41.827 -15.966 39.516 1.00 62.69  ? 87  SER A O     1 
ATOM   6370  C  CB    . SER C 3  87  ? -43.552 -16.513 36.854 1.00 56.46  ? 87  SER A CB    1 
ATOM   6371  O  OG    . SER C 3  87  ? -42.947 -15.618 35.943 1.00 57.55  ? 87  SER A OG    1 
ATOM   6372  N  N     . ALA C 3  88  ? -42.021 -14.085 38.287 1.00 63.34  ? 88  ALA A N     1 
ATOM   6373  C  CA    . ALA C 3  88  ? -40.774 -13.518 38.842 1.00 61.96  ? 88  ALA A CA    1 
ATOM   6374  C  C     . ALA C 3  88  ? -40.837 -13.400 40.351 1.00 61.22  ? 88  ALA A C     1 
ATOM   6375  O  O     . ALA C 3  88  ? -39.873 -13.738 41.052 1.00 73.15  ? 88  ALA A O     1 
ATOM   6376  C  CB    . ALA C 3  88  ? -40.455 -12.164 38.239 1.00 61.80  ? 88  ALA A CB    1 
ATOM   6377  N  N     . VAL C 3  89  ? -41.969 -12.945 40.860 1.00 55.52  ? 89  VAL A N     1 
ATOM   6378  C  CA    . VAL C 3  89  ? -42.127 -12.822 42.295 1.00 55.86  ? 89  VAL A CA    1 
ATOM   6379  C  C     . VAL C 3  89  ? -42.181 -14.201 42.916 1.00 57.77  ? 89  VAL A C     1 
ATOM   6380  O  O     . VAL C 3  89  ? -41.755 -14.405 44.057 1.00 61.47  ? 89  VAL A O     1 
ATOM   6381  C  CB    . VAL C 3  89  ? -43.408 -12.058 42.689 1.00 56.48  ? 89  VAL A CB    1 
ATOM   6382  C  CG1   . VAL C 3  89  ? -43.456 -11.892 44.196 1.00 57.64  ? 89  VAL A CG1   1 
ATOM   6383  C  CG2   . VAL C 3  89  ? -43.466 -10.699 42.014 1.00 55.83  ? 89  VAL A CG2   1 
ATOM   6384  N  N     . MET C 3  90  ? -42.720 -15.154 42.183 1.00 56.89  ? 90  MET A N     1 
ATOM   6385  C  CA    . MET C 3  90  ? -42.813 -16.487 42.739 1.00 73.36  ? 90  MET A CA    1 
ATOM   6386  C  C     . MET C 3  90  ? -41.423 -17.096 42.898 1.00 66.17  ? 90  MET A C     1 
ATOM   6387  O  O     . MET C 3  90  ? -41.060 -17.544 43.987 1.00 57.64  ? 90  MET A O     1 
ATOM   6388  C  CB    . MET C 3  90  ? -43.755 -17.380 41.913 1.00 89.12  ? 90  MET A CB    1 
ATOM   6389  C  CG    . MET C 3  90  ? -45.238 -17.058 42.110 1.00 96.16  ? 90  MET A CG    1 
ATOM   6390  S  SD    . MET C 3  90  ? -45.723 -16.967 43.854 1.00 112.41 ? 90  MET A SD    1 
ATOM   6391  C  CE    . MET C 3  90  ? -45.568 -18.702 44.300 1.00 116.00 ? 90  MET A CE    1 
ATOM   6392  N  N     . ALA C 3  91  ? -40.642 -17.078 41.826 1.00 63.29  ? 91  ALA A N     1 
ATOM   6393  C  CA    . ALA C 3  91  ? -39.256 -17.512 41.897 1.00 61.12  ? 91  ALA A CA    1 
ATOM   6394  C  C     . ALA C 3  91  ? -38.633 -16.971 43.182 1.00 63.09  ? 91  ALA A C     1 
ATOM   6395  O  O     . ALA C 3  91  ? -38.198 -17.740 44.053 1.00 68.77  ? 91  ALA A O     1 
ATOM   6396  C  CB    . ALA C 3  91  ? -38.476 -17.035 40.680 1.00 56.24  ? 91  ALA A CB    1 
ATOM   6397  N  N     . LEU C 3  92  ? -38.640 -15.649 43.318 1.00 61.56  ? 92  LEU A N     1 
ATOM   6398  C  CA    . LEU C 3  92  ? -38.077 -14.987 44.489 1.00 55.75  ? 92  LEU A CA    1 
ATOM   6399  C  C     . LEU C 3  92  ? -38.596 -15.531 45.801 1.00 53.36  ? 92  LEU A C     1 
ATOM   6400  O  O     . LEU C 3  92  ? -37.849 -15.615 46.753 1.00 58.32  ? 92  LEU A O     1 
ATOM   6401  C  CB    . LEU C 3  92  ? -38.373 -13.491 44.454 1.00 60.22  ? 92  LEU A CB    1 
ATOM   6402  C  CG    . LEU C 3  92  ? -37.522 -12.624 43.520 1.00 66.32  ? 92  LEU A CG    1 
ATOM   6403  C  CD1   . LEU C 3  92  ? -38.090 -11.217 43.441 1.00 68.55  ? 92  LEU A CD1   1 
ATOM   6404  C  CD2   . LEU C 3  92  ? -36.075 -12.528 43.969 1.00 62.58  ? 92  LEU A CD2   1 
ATOM   6405  N  N     . GLN C 3  93  ? -39.872 -15.872 45.887 1.00 56.72  ? 93  GLN A N     1 
ATOM   6406  C  CA    . GLN C 3  93  ? -40.385 -16.401 47.152 1.00 59.41  ? 93  GLN A CA    1 
ATOM   6407  C  C     . GLN C 3  93  ? -39.921 -17.847 47.390 1.00 55.64  ? 93  GLN A C     1 
ATOM   6408  O  O     . GLN C 3  93  ? -39.573 -18.221 48.506 1.00 48.42  ? 93  GLN A O     1 
ATOM   6409  C  CB    . GLN C 3  93  ? -41.907 -16.290 47.246 1.00 59.14  ? 93  GLN A CB    1 
ATOM   6410  C  CG    . GLN C 3  93  ? -42.367 -16.239 48.687 1.00 61.00  ? 93  GLN A CG    1 
ATOM   6411  C  CD    . GLN C 3  93  ? -43.868 -16.297 48.844 1.00 65.12  ? 93  GLN A CD    1 
ATOM   6412  O  OE1   . GLN C 3  93  ? -44.627 -15.849 47.965 1.00 68.59  ? 93  GLN A OE1   1 
ATOM   6413  N  NE2   . GLN C 3  93  ? -44.317 -16.839 49.985 1.00 60.46  ? 93  GLN A NE2   1 
ATOM   6414  N  N     . GLU C 3  94  ? -39.906 -18.660 46.346 1.00 54.09  ? 94  GLU A N     1 
ATOM   6415  C  CA    . GLU C 3  94  ? -39.399 -20.011 46.487 1.00 54.20  ? 94  GLU A CA    1 
ATOM   6416  C  C     . GLU C 3  94  ? -37.965 -19.977 46.971 1.00 55.25  ? 94  GLU A C     1 
ATOM   6417  O  O     . GLU C 3  94  ? -37.564 -20.773 47.822 1.00 56.64  ? 94  GLU A O     1 
ATOM   6418  C  CB    . GLU C 3  94  ? -39.420 -20.709 45.156 1.00 57.50  ? 94  GLU A CB    1 
ATOM   6419  C  CG    . GLU C 3  94  ? -40.811 -21.047 44.664 1.00 64.18  ? 94  GLU A CG    1 
ATOM   6420  C  CD    . GLU C 3  94  ? -41.446 -22.169 45.443 1.00 66.21  ? 94  GLU A CD    1 
ATOM   6421  O  OE1   . GLU C 3  94  ? -42.684 -22.130 45.600 1.00 73.70  ? 94  GLU A OE1   1 
ATOM   6422  O  OE2   . GLU C 3  94  ? -40.712 -23.070 45.890 1.00 58.59  ? 94  GLU A OE2   1 
ATOM   6423  N  N     . ALA C 3  95  ? -37.187 -19.054 46.424 1.00 52.48  ? 95  ALA A N     1 
ATOM   6424  C  CA    . ALA C 3  95  ? -35.763 -19.015 46.719 1.00 51.19  ? 95  ALA A CA    1 
ATOM   6425  C  C     . ALA C 3  95  ? -35.538 -18.545 48.115 1.00 52.08  ? 95  ALA A C     1 
ATOM   6426  O  O     . ALA C 3  95  ? -34.750 -19.133 48.863 1.00 60.98  ? 95  ALA A O     1 
ATOM   6427  C  CB    . ALA C 3  95  ? -35.029 -18.115 45.747 1.00 49.06  ? 95  ALA A CB    1 
ATOM   6428  N  N     . SER C 3  96  ? -36.233 -17.480 48.477 1.00 51.43  ? 96  SER A N     1 
ATOM   6429  C  CA    . SER C 3  96  ? -36.050 -16.915 49.803 1.00 54.89  ? 96  SER A CA    1 
ATOM   6430  C  C     . SER C 3  96  ? -36.429 -17.936 50.870 1.00 55.14  ? 96  SER A C     1 
ATOM   6431  O  O     . SER C 3  96  ? -35.708 -18.133 51.847 1.00 55.84  ? 96  SER A O     1 
ATOM   6432  C  CB    . SER C 3  96  ? -36.860 -15.636 49.941 1.00 56.61  ? 96  SER A CB    1 
ATOM   6433  O  OG    . SER C 3  96  ? -36.542 -14.733 48.874 1.00 55.82  ? 96  SER A OG    1 
ATOM   6434  N  N     . GLU C 3  97  ? -37.532 -18.637 50.669 1.00 53.55  ? 97  GLU A N     1 
ATOM   6435  C  CA    . GLU C 3  97  ? -37.957 -19.618 51.660 1.00 53.33  ? 97  GLU A CA    1 
ATOM   6436  C  C     . GLU C 3  97  ? -36.986 -20.826 51.735 1.00 50.15  ? 97  GLU A C     1 
ATOM   6437  O  O     . GLU C 3  97  ? -36.719 -21.376 52.818 1.00 42.13  ? 97  GLU A O     1 
ATOM   6438  C  CB    . GLU C 3  97  ? -39.396 -20.054 51.374 1.00 58.78  ? 97  GLU A CB    1 
ATOM   6439  C  CG    . GLU C 3  97  ? -40.448 -18.915 51.428 1.00 64.18  ? 97  GLU A CG    1 
ATOM   6440  C  CD    . GLU C 3  97  ? -41.831 -19.366 51.941 1.00 67.78  ? 97  GLU A CD    1 
ATOM   6441  O  OE1   . GLU C 3  97  ? -41.992 -20.562 52.309 1.00 73.01  ? 97  GLU A OE1   1 
ATOM   6442  O  OE2   . GLU C 3  97  ? -42.763 -18.528 52.013 1.00 62.43  ? 97  GLU A OE2   1 
ATOM   6443  N  N     . ALA C 3  98  ? -36.434 -21.220 50.593 1.00 45.75  ? 98  ALA A N     1 
ATOM   6444  C  CA    . ALA C 3  98  ? -35.530 -22.367 50.557 1.00 44.13  ? 98  ALA A CA    1 
ATOM   6445  C  C     . ALA C 3  98  ? -34.260 -21.987 51.317 1.00 44.43  ? 98  ALA A C     1 
ATOM   6446  O  O     . ALA C 3  98  ? -33.751 -22.745 52.137 1.00 44.28  ? 98  ALA A O     1 
ATOM   6447  C  CB    . ALA C 3  98  ? -35.207 -22.734 49.115 1.00 45.36  ? 98  ALA A CB    1 
ATOM   6448  N  N     . TYR C 3  99  ? -33.798 -20.775 51.050 1.00 42.14  ? 99  TYR A N     1 
ATOM   6449  C  CA    . TYR C 3  99  ? -32.685 -20.200 51.737 1.00 41.79  ? 99  TYR A CA    1 
ATOM   6450  C  C     . TYR C 3  99  ? -32.896 -20.095 53.215 1.00 46.17  ? 99  TYR A C     1 
ATOM   6451  O  O     . TYR C 3  99  ? -31.998 -20.439 53.989 1.00 58.55  ? 99  TYR A O     1 
ATOM   6452  C  CB    . TYR C 3  99  ? -32.442 -18.812 51.212 1.00 42.92  ? 99  TYR A CB    1 
ATOM   6453  C  CG    . TYR C 3  99  ? -31.415 -18.037 51.985 1.00 47.48  ? 99  TYR A CG    1 
ATOM   6454  C  CD1   . TYR C 3  99  ? -30.030 -18.230 51.780 1.00 49.92  ? 99  TYR A CD1   1 
ATOM   6455  C  CD2   . TYR C 3  99  ? -31.799 -17.100 52.906 1.00 52.52  ? 99  TYR A CD2   1 
ATOM   6456  C  CE1   . TYR C 3  99  ? -29.074 -17.503 52.485 1.00 46.43  ? 99  TYR A CE1   1 
ATOM   6457  C  CE2   . TYR C 3  99  ? -30.846 -16.365 53.624 1.00 56.71  ? 99  TYR A CE2   1 
ATOM   6458  C  CZ    . TYR C 3  99  ? -29.494 -16.570 53.413 1.00 51.33  ? 99  TYR A CZ    1 
ATOM   6459  O  OH    . TYR C 3  99  ? -28.608 -15.818 54.164 1.00 55.27  ? 99  TYR A OH    1 
ATOM   6460  N  N     . LEU C 3  100 ? -34.053 -19.612 53.642 1.00 48.76  ? 100 LEU A N     1 
ATOM   6461  C  CA    . LEU C 3  100 ? -34.210 -19.333 55.067 1.00 47.51  ? 100 LEU A CA    1 
ATOM   6462  C  C     . LEU C 3  100 ? -34.408 -20.609 55.812 1.00 47.86  ? 100 LEU A C     1 
ATOM   6463  O  O     . LEU C 3  100 ? -33.922 -20.764 56.935 1.00 45.80  ? 100 LEU A O     1 
ATOM   6464  C  CB    . LEU C 3  100 ? -35.377 -18.426 55.331 1.00 50.39  ? 100 LEU A CB    1 
ATOM   6465  C  CG    . LEU C 3  100 ? -35.254 -16.953 54.939 1.00 54.17  ? 100 LEU A CG    1 
ATOM   6466  C  CD1   . LEU C 3  100 ? -36.582 -16.314 55.287 1.00 55.23  ? 100 LEU A CD1   1 
ATOM   6467  C  CD2   . LEU C 3  100 ? -34.126 -16.196 55.633 1.00 52.72  ? 100 LEU A CD2   1 
ATOM   6468  N  N     . VAL C 3  101 ? -35.115 -21.547 55.183 1.00 49.01  ? 101 VAL A N     1 
ATOM   6469  C  CA    . VAL C 3  101 ? -35.329 -22.836 55.822 1.00 44.27  ? 101 VAL A CA    1 
ATOM   6470  C  C     . VAL C 3  101 ? -33.993 -23.498 56.049 1.00 45.35  ? 101 VAL A C     1 
ATOM   6471  O  O     . VAL C 3  101 ? -33.731 -23.968 57.146 1.00 45.05  ? 101 VAL A O     1 
ATOM   6472  C  CB    . VAL C 3  101 ? -36.150 -23.778 54.974 1.00 45.59  ? 101 VAL A CB    1 
ATOM   6473  C  CG1   . VAL C 3  101 ? -35.983 -25.198 55.492 1.00 45.46  ? 101 VAL A CG1   1 
ATOM   6474  C  CG2   . VAL C 3  101 ? -37.611 -23.342 54.957 1.00 47.38  ? 101 VAL A CG2   1 
ATOM   6475  N  N     . ALA C 3  102 ? -33.140 -23.529 55.014 1.00 43.44  ? 102 ALA A N     1 
ATOM   6476  C  CA    . ALA C 3  102 ? -31.832 -24.169 55.158 1.00 39.13  ? 102 ALA A CA    1 
ATOM   6477  C  C     . ALA C 3  102 ? -30.987 -23.423 56.167 1.00 40.20  ? 102 ALA A C     1 
ATOM   6478  O  O     . ALA C 3  102 ? -30.302 -24.056 56.949 1.00 41.68  ? 102 ALA A O     1 
ATOM   6479  C  CB    . ALA C 3  102 ? -31.124 -24.262 53.843 1.00 36.22  ? 102 ALA A CB    1 
ATOM   6480  N  N     . LEU C 3  103 ? -31.065 -22.087 56.185 1.00 39.30  ? 103 LEU A N     1 
ATOM   6481  C  CA    . LEU C 3  103 ? -30.339 -21.327 57.209 1.00 41.58  ? 103 LEU A CA    1 
ATOM   6482  C  C     . LEU C 3  103 ? -30.789 -21.679 58.598 1.00 44.88  ? 103 LEU A C     1 
ATOM   6483  O  O     . LEU C 3  103 ? -30.000 -21.659 59.529 1.00 46.27  ? 103 LEU A O     1 
ATOM   6484  C  CB    . LEU C 3  103 ? -30.535 -19.831 57.046 1.00 46.73  ? 103 LEU A CB    1 
ATOM   6485  C  CG    . LEU C 3  103 ? -29.707 -18.934 57.980 1.00 46.40  ? 103 LEU A CG    1 
ATOM   6486  C  CD1   . LEU C 3  103 ? -28.235 -19.181 57.740 1.00 47.77  ? 103 LEU A CD1   1 
ATOM   6487  C  CD2   . LEU C 3  103 ? -30.008 -17.455 57.779 1.00 45.99  ? 103 LEU A CD2   1 
ATOM   6488  N  N     . PHE C 3  104 ? -32.076 -21.961 58.754 1.00 48.76  ? 104 PHE A N     1 
ATOM   6489  C  CA    . PHE C 3  104 ? -32.565 -22.368 60.049 1.00 48.45  ? 104 PHE A CA    1 
ATOM   6490  C  C     . PHE C 3  104 ? -31.970 -23.725 60.419 1.00 47.76  ? 104 PHE A C     1 
ATOM   6491  O  O     . PHE C 3  104 ? -31.714 -23.948 61.574 1.00 56.14  ? 104 PHE A O     1 
ATOM   6492  C  CB    . PHE C 3  104 ? -34.112 -22.357 60.095 1.00 51.10  ? 104 PHE A CB    1 
ATOM   6493  C  CG    . PHE C 3  104 ? -34.711 -20.989 60.354 1.00 48.40  ? 104 PHE A CG    1 
ATOM   6494  C  CD1   . PHE C 3  104 ? -35.650 -20.455 59.508 1.00 47.82  ? 104 PHE A CD1   1 
ATOM   6495  C  CD2   . PHE C 3  104 ? -34.322 -20.245 61.450 1.00 48.34  ? 104 PHE A CD2   1 
ATOM   6496  C  CE1   . PHE C 3  104 ? -36.188 -19.197 59.732 1.00 47.52  ? 104 PHE A CE1   1 
ATOM   6497  C  CE2   . PHE C 3  104 ? -34.837 -18.989 61.676 1.00 50.35  ? 104 PHE A CE2   1 
ATOM   6498  C  CZ    . PHE C 3  104 ? -35.775 -18.456 60.812 1.00 51.04  ? 104 PHE A CZ    1 
ATOM   6499  N  N     . GLU C 3  105 ? -31.719 -24.619 59.465 1.00 43.86  ? 105 GLU A N     1 
ATOM   6500  C  CA    . GLU C 3  105 ? -31.157 -25.913 59.830 1.00 45.86  ? 105 GLU A CA    1 
ATOM   6501  C  C     . GLU C 3  105 ? -29.773 -25.698 60.427 1.00 47.70  ? 105 GLU A C     1 
ATOM   6502  O  O     . GLU C 3  105 ? -29.441 -26.266 61.475 1.00 50.66  ? 105 GLU A O     1 
ATOM   6503  C  CB    . GLU C 3  105 ? -31.068 -26.852 58.635 1.00 46.58  ? 105 GLU A CB    1 
ATOM   6504  C  CG    . GLU C 3  105 ? -32.405 -27.135 57.960 1.00 54.10  ? 105 GLU A CG    1 
ATOM   6505  C  CD    . GLU C 3  105 ? -32.279 -27.763 56.556 1.00 59.24  ? 105 GLU A CD    1 
ATOM   6506  O  OE1   . GLU C 3  105 ? -31.193 -28.313 56.259 1.00 65.54  ? 105 GLU A OE1   1 
ATOM   6507  O  OE2   . GLU C 3  105 ? -33.263 -27.728 55.757 1.00 52.42  ? 105 GLU A OE2   1 
ATOM   6508  N  N     . ASP C 3  106 ? -28.978 -24.847 59.784 1.00 44.97  ? 106 ASP A N     1 
ATOM   6509  C  CA    . ASP C 3  106 ? -27.598 -24.652 60.196 1.00 45.82  ? 106 ASP A CA    1 
ATOM   6510  C  C     . ASP C 3  106 ? -27.606 -23.921 61.509 1.00 45.02  ? 106 ASP A C     1 
ATOM   6511  O  O     . ASP C 3  106 ? -26.752 -24.112 62.378 1.00 44.53  ? 106 ASP A O     1 
ATOM   6512  C  CB    . ASP C 3  106 ? -26.829 -23.810 59.173 1.00 46.85  ? 106 ASP A CB    1 
ATOM   6513  C  CG    . ASP C 3  106 ? -26.741 -24.461 57.805 1.00 49.58  ? 106 ASP A CG    1 
ATOM   6514  O  OD1   . ASP C 3  106 ? -27.053 -25.669 57.682 1.00 57.94  ? 106 ASP A OD1   1 
ATOM   6515  O  OD2   . ASP C 3  106 ? -26.384 -23.761 56.828 1.00 49.57  ? 106 ASP A OD2   1 
ATOM   6516  N  N     . THR C 3  107 ? -28.570 -23.035 61.630 1.00 45.80  ? 107 THR A N     1 
ATOM   6517  C  CA    . THR C 3  107 ? -28.704 -22.227 62.836 1.00 50.63  ? 107 THR A CA    1 
ATOM   6518  C  C     . THR C 3  107 ? -28.961 -23.158 64.002 1.00 53.73  ? 107 THR A C     1 
ATOM   6519  O  O     . THR C 3  107 ? -28.270 -23.122 65.027 1.00 54.22  ? 107 THR A O     1 
ATOM   6520  C  CB    . THR C 3  107 ? -29.871 -21.230 62.706 1.00 50.18  ? 107 THR A CB    1 
ATOM   6521  O  OG1   . THR C 3  107 ? -29.619 -20.328 61.614 1.00 48.78  ? 107 THR A OG1   1 
ATOM   6522  C  CG2   . THR C 3  107 ? -30.004 -20.447 63.945 1.00 50.56  ? 107 THR A CG2   1 
ATOM   6523  N  N     . ASN C 3  108 ? -29.947 -24.018 63.806 1.00 52.15  ? 108 ASN A N     1 
ATOM   6524  C  CA    . ASN C 3  108 ? -30.242 -25.059 64.753 1.00 51.12  ? 108 ASN A CA    1 
ATOM   6525  C  C     . ASN C 3  108 ? -29.013 -25.881 65.100 1.00 46.80  ? 108 ASN A C     1 
ATOM   6526  O  O     . ASN C 3  108 ? -28.753 -26.147 66.277 1.00 43.17  ? 108 ASN A O     1 
ATOM   6527  C  CB    . ASN C 3  108 ? -31.353 -25.974 64.219 1.00 54.47  ? 108 ASN A CB    1 
ATOM   6528  C  CG    . ASN C 3  108 ? -32.255 -26.489 65.318 1.00 58.53  ? 108 ASN A CG    1 
ATOM   6529  O  OD1   . ASN C 3  108 ? -32.313 -25.925 66.411 1.00 65.36  ? 108 ASN A OD1   1 
ATOM   6530  N  ND2   . ASN C 3  108 ? -32.964 -27.558 65.036 1.00 67.34  ? 108 ASN A ND2   1 
ATOM   6531  N  N     . LEU C 3  109 ? -28.238 -26.282 64.101 1.00 45.26  ? 109 LEU A N     1 
ATOM   6532  C  CA    . LEU C 3  109 ? -26.997 -26.996 64.423 1.00 44.00  ? 109 LEU A CA    1 
ATOM   6533  C  C     . LEU C 3  109 ? -26.095 -26.124 65.294 1.00 41.79  ? 109 LEU A C     1 
ATOM   6534  O  O     . LEU C 3  109 ? -25.548 -26.594 66.266 1.00 42.19  ? 109 LEU A O     1 
ATOM   6535  C  CB    . LEU C 3  109 ? -26.286 -27.473 63.171 1.00 44.96  ? 109 LEU A CB    1 
ATOM   6536  C  CG    . LEU C 3  109 ? -27.018 -28.559 62.347 1.00 46.99  ? 109 LEU A CG    1 
ATOM   6537  C  CD1   . LEU C 3  109 ? -26.273 -28.846 61.055 1.00 47.01  ? 109 LEU A CD1   1 
ATOM   6538  C  CD2   . LEU C 3  109 ? -27.186 -29.872 63.099 1.00 45.96  ? 109 LEU A CD2   1 
ATOM   6539  N  N     . CYS C 3  110 ? -26.006 -24.836 65.018 1.00 43.47  ? 110 CYS A N     1 
ATOM   6540  C  CA    . CYS C 3  110 ? -25.175 -23.996 65.882 1.00 48.76  ? 110 CYS A CA    1 
ATOM   6541  C  C     . CYS C 3  110 ? -25.698 -23.900 67.319 1.00 45.94  ? 110 CYS A C     1 
ATOM   6542  O  O     . CYS C 3  110 ? -24.931 -23.928 68.268 1.00 46.30  ? 110 CYS A O     1 
ATOM   6543  C  CB    . CYS C 3  110 ? -24.942 -22.621 65.272 1.00 48.67  ? 110 CYS A CB    1 
ATOM   6544  S  SG    . CYS C 3  110 ? -24.217 -22.733 63.609 1.00 46.53  ? 110 CYS A SG    1 
ATOM   6545  N  N     . ALA C 3  111 ? -26.999 -23.827 67.500 1.00 49.43  ? 111 ALA A N     1 
ATOM   6546  C  CA    . ALA C 3  111 ? -27.542 -23.864 68.864 1.00 45.51  ? 111 ALA A CA    1 
ATOM   6547  C  C     . ALA C 3  111 ? -27.220 -25.198 69.561 1.00 45.53  ? 111 ALA A C     1 
ATOM   6548  O  O     . ALA C 3  111 ? -26.539 -25.244 70.586 1.00 48.60  ? 111 ALA A O     1 
ATOM   6549  C  CB    . ALA C 3  111 ? -29.018 -23.600 68.840 1.00 48.56  ? 111 ALA A CB    1 
ATOM   6550  N  N     . ILE C 3  112 ? -27.626 -26.301 68.974 1.00 44.14  ? 112 ILE A N     1 
ATOM   6551  C  CA    . ILE C 3  112 ? -27.252 -27.600 69.532 1.00 44.08  ? 112 ILE A CA    1 
ATOM   6552  C  C     . ILE C 3  112 ? -25.758 -27.688 69.883 1.00 50.09  ? 112 ILE A C     1 
ATOM   6553  O  O     . ILE C 3  112 ? -25.368 -28.215 70.949 1.00 51.55  ? 112 ILE A O     1 
ATOM   6554  C  CB    . ILE C 3  112 ? -27.683 -28.718 68.566 1.00 45.33  ? 112 ILE A CB    1 
ATOM   6555  C  CG1   . ILE C 3  112 ? -29.226 -28.739 68.526 1.00 45.33  ? 112 ILE A CG1   1 
ATOM   6556  C  CG2   . ILE C 3  112 ? -27.185 -30.091 69.000 1.00 41.70  ? 112 ILE A CG2   1 
ATOM   6557  C  CD1   . ILE C 3  112 ? -29.848 -29.512 67.382 1.00 45.84  ? 112 ILE A CD1   1 
ATOM   6558  N  N     . HIS C 3  113 ? -24.909 -27.137 69.022 1.00 51.85  ? 113 HIS A N     1 
ATOM   6559  C  CA    . HIS C 3  113 ? -23.484 -27.163 69.294 1.00 45.62  ? 113 HIS A CA    1 
ATOM   6560  C  C     . HIS C 3  113 ? -23.150 -26.546 70.640 1.00 51.46  ? 113 HIS A C     1 
ATOM   6561  O  O     . HIS C 3  113 ? -22.274 -27.058 71.366 1.00 47.73  ? 113 HIS A O     1 
ATOM   6562  C  CB    . HIS C 3  113 ? -22.736 -26.415 68.217 1.00 48.01  ? 113 HIS A CB    1 
ATOM   6563  C  CG    . HIS C 3  113 ? -21.253 -26.579 68.296 1.00 45.86  ? 113 HIS A CG    1 
ATOM   6564  N  ND1   . HIS C 3  113 ? -20.623 -27.775 68.037 1.00 44.65  ? 113 HIS A ND1   1 
ATOM   6565  C  CD2   . HIS C 3  113 ? -20.280 -25.700 68.615 1.00 45.06  ? 113 HIS A CD2   1 
ATOM   6566  C  CE1   . HIS C 3  113 ? -19.320 -27.617 68.162 1.00 45.74  ? 113 HIS A CE1   1 
ATOM   6567  N  NE2   . HIS C 3  113 ? -19.086 -26.373 68.524 1.00 44.62  ? 113 HIS A NE2   1 
ATOM   6568  N  N     . ALA C 3  114 ? -23.835 -25.440 70.964 1.00 50.36  ? 114 ALA A N     1 
ATOM   6569  C  CA    . ALA C 3  114 ? -23.650 -24.745 72.245 1.00 48.80  ? 114 ALA A CA    1 
ATOM   6570  C  C     . ALA C 3  114 ? -24.460 -25.392 73.372 1.00 54.83  ? 114 ALA A C     1 
ATOM   6571  O  O     . ALA C 3  114 ? -24.640 -24.789 74.426 1.00 57.08  ? 114 ALA A O     1 
ATOM   6572  C  CB    . ALA C 3  114 ? -24.053 -23.295 72.099 1.00 46.84  ? 114 ALA A CB    1 
ATOM   6573  N  N     . LYS C 3  115 ? -24.968 -26.598 73.134 1.00 56.43  ? 115 LYS A N     1 
ATOM   6574  C  CA    . LYS C 3  115 ? -25.670 -27.390 74.134 1.00 59.65  ? 115 LYS A CA    1 
ATOM   6575  C  C     . LYS C 3  115 ? -26.980 -26.757 74.531 1.00 60.86  ? 115 LYS A C     1 
ATOM   6576  O  O     . LYS C 3  115 ? -27.399 -26.818 75.685 1.00 66.25  ? 115 LYS A O     1 
ATOM   6577  C  CB    . LYS C 3  115 ? -24.771 -27.686 75.336 1.00 62.29  ? 115 LYS A CB    1 
ATOM   6578  C  CG    . LYS C 3  115 ? -23.599 -28.587 74.967 1.00 68.14  ? 115 LYS A CG    1 
ATOM   6579  C  CD    . LYS C 3  115 ? -22.788 -29.032 76.167 1.00 76.82  ? 115 LYS A CD    1 
ATOM   6580  C  CE    . LYS C 3  115 ? -21.949 -30.264 75.852 1.00 86.87  ? 115 LYS A CE    1 
ATOM   6581  N  NZ    . LYS C 3  115 ? -21.158 -30.742 77.033 1.00 92.75  ? 115 LYS A NZ    1 
ATOM   6582  N  N     . ARG C 3  116 ? -27.635 -26.174 73.541 1.00 52.62  ? 116 ARG A N     1 
ATOM   6583  C  CA    . ARG C 3  116 ? -28.893 -25.513 73.740 1.00 52.97  ? 116 ARG A CA    1 
ATOM   6584  C  C     . ARG C 3  116 ? -29.883 -26.199 72.845 1.00 52.99  ? 116 ARG A C     1 
ATOM   6585  O  O     . ARG C 3  116 ? -29.519 -27.089 72.100 1.00 61.86  ? 116 ARG A O     1 
ATOM   6586  C  CB    . ARG C 3  116 ? -28.793 -24.033 73.350 1.00 53.42  ? 116 ARG A CB    1 
ATOM   6587  C  CG    . ARG C 3  116 ? -28.071 -23.170 74.377 1.00 51.19  ? 116 ARG A CG    1 
ATOM   6588  C  CD    . ARG C 3  116 ? -28.171 -21.681 74.098 1.00 49.11  ? 116 ARG A CD    1 
ATOM   6589  N  NE    . ARG C 3  116 ? -27.101 -21.154 73.226 1.00 52.31  ? 116 ARG A NE    1 
ATOM   6590  C  CZ    . ARG C 3  116 ? -27.226 -20.843 71.929 1.00 49.98  ? 116 ARG A CZ    1 
ATOM   6591  N  NH1   . ARG C 3  116 ? -28.348 -21.031 71.270 1.00 52.15  ? 116 ARG A NH1   1 
ATOM   6592  N  NH2   . ARG C 3  116 ? -26.202 -20.341 71.269 1.00 54.20  ? 116 ARG A NH2   1 
ATOM   6593  N  N     . VAL C 3  117 ? -31.144 -25.801 72.963 1.00 46.45  ? 117 VAL A N     1 
ATOM   6594  C  CA    . VAL C 3  117 ? -32.167 -26.165 72.019 1.00 46.07  ? 117 VAL A CA    1 
ATOM   6595  C  C     . VAL C 3  117 ? -32.914 -24.966 71.501 1.00 45.02  ? 117 VAL A C     1 
ATOM   6596  O  O     . VAL C 3  117 ? -33.817 -25.158 70.694 1.00 43.18  ? 117 VAL A O     1 
ATOM   6597  C  CB    . VAL C 3  117 ? -33.202 -27.129 72.612 1.00 51.87  ? 117 VAL A CB    1 
ATOM   6598  C  CG1   . VAL C 3  117 ? -32.500 -28.348 73.207 1.00 52.89  ? 117 VAL A CG1   1 
ATOM   6599  C  CG2   . VAL C 3  117 ? -34.072 -26.430 73.641 1.00 53.51  ? 117 VAL A CG2   1 
ATOM   6600  N  N     . THR C 3  118 ? -32.525 -23.752 71.927 1.00 43.06  ? 118 THR A N     1 
ATOM   6601  C  CA    . THR C 3  118 ? -33.172 -22.520 71.494 1.00 49.40  ? 118 THR A CA    1 
ATOM   6602  C  C     . THR C 3  118 ? -32.353 -21.664 70.509 1.00 55.04  ? 118 THR A C     1 
ATOM   6603  O  O     . THR C 3  118 ? -31.338 -21.075 70.883 1.00 53.76  ? 118 THR A O     1 
ATOM   6604  C  CB    . THR C 3  118 ? -33.425 -21.573 72.685 1.00 50.53  ? 118 THR A CB    1 
ATOM   6605  O  OG1   . THR C 3  118 ? -33.890 -22.307 73.809 1.00 52.07  ? 118 THR A OG1   1 
ATOM   6606  C  CG2   . THR C 3  118 ? -34.434 -20.491 72.275 1.00 58.41  ? 118 THR A CG2   1 
ATOM   6607  N  N     . ILE C 3  119 ? -32.845 -21.467 69.293 1.00 54.77  ? 119 ILE A N     1 
ATOM   6608  C  CA    . ILE C 3  119 ? -32.050 -20.697 68.345 1.00 51.43  ? 119 ILE A CA    1 
ATOM   6609  C  C     . ILE C 3  119 ? -31.950 -19.229 68.760 1.00 53.45  ? 119 ILE A C     1 
ATOM   6610  O  O     . ILE C 3  119 ? -32.932 -18.619 69.175 1.00 49.66  ? 119 ILE A O     1 
ATOM   6611  C  CB    . ILE C 3  119 ? -32.528 -20.847 66.891 1.00 46.32  ? 119 ILE A CB    1 
ATOM   6612  C  CG1   . ILE C 3  119 ? -33.867 -20.192 66.674 1.00 47.73  ? 119 ILE A CG1   1 
ATOM   6613  C  CG2   . ILE C 3  119 ? -32.611 -22.316 66.503 1.00 49.22  ? 119 ILE A CG2   1 
ATOM   6614  C  CD1   . ILE C 3  119 ? -34.317 -20.277 65.223 1.00 48.20  ? 119 ILE A CD1   1 
ATOM   6615  N  N     . MET C 3  120 ? -30.741 -18.679 68.654 1.00 52.55  ? 120 MET A N     1 
ATOM   6616  C  CA    . MET C 3  120 ? -30.513 -17.293 69.003 1.00 56.24  ? 120 MET A CA    1 
ATOM   6617  C  C     . MET C 3  120 ? -29.843 -16.559 67.866 1.00 58.32  ? 120 MET A C     1 
ATOM   6618  O  O     . MET C 3  120 ? -29.382 -17.178 66.906 1.00 54.60  ? 120 MET A O     1 
ATOM   6619  C  CB    . MET C 3  120 ? -29.680 -17.209 70.260 1.00 54.74  ? 120 MET A CB    1 
ATOM   6620  C  CG    . MET C 3  120 ? -30.453 -17.636 71.490 1.00 59.71  ? 120 MET A CG    1 
ATOM   6621  S  SD    . MET C 3  120 ? -29.386 -17.841 72.919 1.00 70.05  ? 120 MET A SD    1 
ATOM   6622  C  CE    . MET C 3  120 ? -30.581 -18.416 74.145 1.00 67.73  ? 120 MET A CE    1 
ATOM   6623  N  N     . PRO C 3  121 ? -29.817 -15.229 67.957 1.00 57.66  ? 121 PRO A N     1 
ATOM   6624  C  CA    . PRO C 3  121 ? -29.220 -14.476 66.889 1.00 58.52  ? 121 PRO A CA    1 
ATOM   6625  C  C     . PRO C 3  121 ? -27.737 -14.814 66.680 1.00 55.47  ? 121 PRO A C     1 
ATOM   6626  O  O     . PRO C 3  121 ? -27.194 -14.751 65.552 1.00 45.45  ? 121 PRO A O     1 
ATOM   6627  C  CB    . PRO C 3  121 ? -29.416 -13.025 67.349 1.00 60.65  ? 121 PRO A CB    1 
ATOM   6628  C  CG    . PRO C 3  121 ? -30.666 -13.053 68.149 1.00 63.26  ? 121 PRO A CG    1 
ATOM   6629  C  CD    . PRO C 3  121 ? -30.575 -14.360 68.886 1.00 64.79  ? 121 PRO A CD    1 
ATOM   6630  N  N     . LYS C 3  122 ? -27.076 -15.192 67.750 1.00 53.98  ? 122 LYS A N     1 
ATOM   6631  C  CA    . LYS C 3  122 ? -25.679 -15.526 67.601 1.00 55.36  ? 122 LYS A CA    1 
ATOM   6632  C  C     . LYS C 3  122 ? -25.529 -16.795 66.781 1.00 50.98  ? 122 LYS A C     1 
ATOM   6633  O  O     . LYS C 3  122 ? -24.543 -16.960 66.095 1.00 51.33  ? 122 LYS A O     1 
ATOM   6634  C  CB    . LYS C 3  122 ? -24.965 -15.608 68.945 1.00 55.61  ? 122 LYS A CB    1 
ATOM   6635  C  CG    . LYS C 3  122 ? -25.459 -16.668 69.890 1.00 62.04  ? 122 LYS A CG    1 
ATOM   6636  C  CD    . LYS C 3  122 ? -24.581 -16.667 71.121 1.00 68.07  ? 122 LYS A CD    1 
ATOM   6637  C  CE    . LYS C 3  122 ? -25.416 -16.850 72.376 1.00 72.44  ? 122 LYS A CE    1 
ATOM   6638  N  NZ    . LYS C 3  122 ? -24.551 -16.914 73.583 1.00 74.62  ? 122 LYS A NZ    1 
ATOM   6639  N  N     . ASP C 3  123 ? -26.535 -17.657 66.817 1.00 52.94  ? 123 ASP A N     1 
ATOM   6640  C  CA    . ASP C 3  123 ? -26.506 -18.914 66.065 1.00 51.17  ? 123 ASP A CA    1 
ATOM   6641  C  C     . ASP C 3  123 ? -26.625 -18.655 64.580 1.00 49.66  ? 123 ASP A C     1 
ATOM   6642  O  O     . ASP C 3  123 ? -26.006 -19.343 63.777 1.00 54.36  ? 123 ASP A O     1 
ATOM   6643  C  CB    . ASP C 3  123 ? -27.638 -19.837 66.518 1.00 48.18  ? 123 ASP A CB    1 
ATOM   6644  C  CG    . ASP C 3  123 ? -27.485 -20.258 67.961 1.00 50.83  ? 123 ASP A CG    1 
ATOM   6645  O  OD1   . ASP C 3  123 ? -26.345 -20.551 68.341 1.00 51.85  ? 123 ASP A OD1   1 
ATOM   6646  O  OD2   . ASP C 3  123 ? -28.476 -20.280 68.725 1.00 51.87  ? 123 ASP A OD2   1 
ATOM   6647  N  N     . ILE C 3  124 ? -27.440 -17.678 64.220 1.00 50.94  ? 124 ILE A N     1 
ATOM   6648  C  CA    . ILE C 3  124 ? -27.623 -17.307 62.819 1.00 50.12  ? 124 ILE A CA    1 
ATOM   6649  C  C     . ILE C 3  124 ? -26.364 -16.604 62.335 1.00 49.02  ? 124 ILE A C     1 
ATOM   6650  O  O     . ILE C 3  124 ? -25.935 -16.793 61.212 1.00 51.14  ? 124 ILE A O     1 
ATOM   6651  C  CB    . ILE C 3  124 ? -28.826 -16.351 62.633 1.00 49.73  ? 124 ILE A CB    1 
ATOM   6652  C  CG1   . ILE C 3  124 ? -30.144 -17.067 62.882 1.00 50.88  ? 124 ILE A CG1   1 
ATOM   6653  C  CG2   . ILE C 3  124 ? -28.899 -15.828 61.216 1.00 51.43  ? 124 ILE A CG2   1 
ATOM   6654  C  CD1   . ILE C 3  124 ? -31.392 -16.190 62.749 1.00 50.76  ? 124 ILE A CD1   1 
ATOM   6655  N  N     . GLN C 3  125 ? -25.777 -15.803 63.203 1.00 53.25  ? 125 GLN A N     1 
ATOM   6656  C  CA    . GLN C 3  125 ? -24.613 -15.013 62.852 1.00 55.83  ? 125 GLN A CA    1 
ATOM   6657  C  C     . GLN C 3  125 ? -23.449 -15.932 62.556 1.00 52.08  ? 125 GLN A C     1 
ATOM   6658  O  O     . GLN C 3  125 ? -22.788 -15.817 61.523 1.00 48.79  ? 125 GLN A O     1 
ATOM   6659  C  CB    . GLN C 3  125 ? -24.290 -14.055 63.997 1.00 60.62  ? 125 GLN A CB    1 
ATOM   6660  C  CG    . GLN C 3  125 ? -25.188 -12.816 64.008 1.00 63.08  ? 125 GLN A CG    1 
ATOM   6661  C  CD    . GLN C 3  125 ? -25.335 -12.169 65.379 1.00 67.18  ? 125 GLN A CD    1 
ATOM   6662  O  OE1   . GLN C 3  125 ? -24.550 -12.415 66.311 1.00 69.55  ? 125 GLN A OE1   1 
ATOM   6663  N  NE2   . GLN C 3  125 ? -26.360 -11.322 65.507 1.00 71.97  ? 125 GLN A NE2   1 
ATOM   6664  N  N     . LEU C 3  126 ? -23.272 -16.902 63.434 1.00 45.24  ? 126 LEU A N     1 
ATOM   6665  C  CA    . LEU C 3  126 ? -22.245 -17.898 63.251 1.00 44.91  ? 126 LEU A CA    1 
ATOM   6666  C  C     . LEU C 3  126 ? -22.407 -18.692 61.977 1.00 47.95  ? 126 LEU A C     1 
ATOM   6667  O  O     . LEU C 3  126 ? -21.427 -19.011 61.319 1.00 50.26  ? 126 LEU A O     1 
ATOM   6668  C  CB    . LEU C 3  126 ? -22.279 -18.893 64.392 1.00 40.13  ? 126 LEU A CB    1 
ATOM   6669  C  CG    . LEU C 3  126 ? -21.185 -19.908 64.253 1.00 40.28  ? 126 LEU A CG    1 
ATOM   6670  C  CD1   . LEU C 3  126 ? -19.855 -19.195 64.236 1.00 37.24  ? 126 LEU A CD1   1 
ATOM   6671  C  CD2   . LEU C 3  126 ? -21.257 -20.888 65.402 1.00 42.82  ? 126 LEU A CD2   1 
ATOM   6672  N  N     . ALA C 3  127 ? -23.631 -19.097 61.677 1.00 44.50  ? 127 ALA A N     1 
ATOM   6673  C  CA    . ALA C 3  127 ? -23.854 -19.843 60.486 1.00 43.51  ? 127 ALA A CA    1 
ATOM   6674  C  C     . ALA C 3  127 ? -23.535 -18.989 59.280 1.00 45.27  ? 127 ALA A C     1 
ATOM   6675  O  O     . ALA C 3  127 ? -23.050 -19.477 58.276 1.00 44.73  ? 127 ALA A O     1 
ATOM   6676  C  CB    . ALA C 3  127 ? -25.284 -20.309 60.432 1.00 49.26  ? 127 ALA A CB    1 
ATOM   6677  N  N     . ARG C 3  128 ? -23.816 -17.702 59.346 1.00 47.10  ? 128 ARG A N     1 
ATOM   6678  C  CA    . ARG C 3  128 ? -23.623 -16.907 58.160 1.00 45.37  ? 128 ARG A CA    1 
ATOM   6679  C  C     . ARG C 3  128 ? -22.188 -16.601 58.042 1.00 45.11  ? 128 ARG A C     1 
ATOM   6680  O  O     . ARG C 3  128 ? -21.651 -16.504 56.941 1.00 49.39  ? 128 ARG A O     1 
ATOM   6681  C  CB    . ARG C 3  128 ? -24.436 -15.657 58.234 1.00 46.46  ? 128 ARG A CB    1 
ATOM   6682  C  CG    . ARG C 3  128 ? -25.881 -16.018 58.052 1.00 49.54  ? 128 ARG A CG    1 
ATOM   6683  C  CD    . ARG C 3  128 ? -26.759 -14.811 57.913 1.00 50.80  ? 128 ARG A CD    1 
ATOM   6684  N  NE    . ARG C 3  128 ? -26.473 -14.011 56.724 1.00 49.68  ? 128 ARG A NE    1 
ATOM   6685  C  CZ    . ARG C 3  128 ? -26.141 -12.726 56.763 1.00 49.20  ? 128 ARG A CZ    1 
ATOM   6686  N  NH1   . ARG C 3  128 ? -26.016 -12.113 57.917 1.00 53.02  ? 128 ARG A NH1   1 
ATOM   6687  N  NH2   . ARG C 3  128 ? -25.931 -12.045 55.653 1.00 50.64  ? 128 ARG A NH2   1 
ATOM   6688  N  N     . ARG C 3  129 ? -21.533 -16.480 59.176 1.00 41.44  ? 129 ARG A N     1 
ATOM   6689  C  CA    . ARG C 3  129 ? -20.111 -16.225 59.129 1.00 44.46  ? 129 ARG A CA    1 
ATOM   6690  C  C     . ARG C 3  129 ? -19.439 -17.427 58.471 1.00 42.55  ? 129 ARG A C     1 
ATOM   6691  O  O     . ARG C 3  129 ? -18.619 -17.266 57.606 1.00 47.67  ? 129 ARG A O     1 
ATOM   6692  C  CB    . ARG C 3  129 ? -19.577 -15.902 60.520 1.00 45.72  ? 129 ARG A CB    1 
ATOM   6693  C  CG    . ARG C 3  129 ? -18.087 -15.933 60.693 1.00 51.83  ? 129 ARG A CG    1 
ATOM   6694  C  CD    . ARG C 3  129 ? -17.297 -15.157 59.662 1.00 56.56  ? 129 ARG A CD    1 
ATOM   6695  N  NE    . ARG C 3  129 ? -15.867 -15.441 59.866 1.00 62.62  ? 129 ARG A NE    1 
ATOM   6696  C  CZ    . ARG C 3  129 ? -15.263 -16.582 59.504 1.00 60.20  ? 129 ARG A CZ    1 
ATOM   6697  N  NH1   . ARG C 3  129 ? -15.939 -17.547 58.878 1.00 59.62  ? 129 ARG A NH1   1 
ATOM   6698  N  NH2   . ARG C 3  129 ? -13.974 -16.764 59.755 1.00 50.94  ? 129 ARG A NH2   1 
ATOM   6699  N  N     . ILE C 3  130 ? -19.847 -18.636 58.803 1.00 45.52  ? 130 ILE A N     1 
ATOM   6700  C  CA    . ILE C 3  130 ? -19.133 -19.793 58.315 1.00 47.78  ? 130 ILE A CA    1 
ATOM   6701  C  C     . ILE C 3  130 ? -19.430 -20.117 56.859 1.00 53.26  ? 130 ILE A C     1 
ATOM   6702  O  O     . ILE C 3  130 ? -18.546 -20.481 56.089 1.00 46.68  ? 130 ILE A O     1 
ATOM   6703  C  CB    . ILE C 3  130 ? -19.333 -20.954 59.238 1.00 45.52  ? 130 ILE A CB    1 
ATOM   6704  C  CG1   . ILE C 3  130 ? -18.488 -20.675 60.474 1.00 50.06  ? 130 ILE A CG1   1 
ATOM   6705  C  CG2   . ILE C 3  130 ? -18.825 -22.237 58.615 1.00 47.24  ? 130 ILE A CG2   1 
ATOM   6706  C  CD1   . ILE C 3  130 ? -18.731 -21.688 61.581 1.00 57.30  ? 130 ILE A CD1   1 
ATOM   6707  N  N     . ARG C 3  131 ? -20.674 -19.930 56.471 1.00 53.81  ? 131 ARG A N     1 
ATOM   6708  C  CA    . ARG C 3  131 ? -21.007 -20.050 55.084 1.00 50.78  ? 131 ARG A CA    1 
ATOM   6709  C  C     . ARG C 3  131 ? -20.230 -19.103 54.184 1.00 52.98  ? 131 ARG A C     1 
ATOM   6710  O  O     . ARG C 3  131 ? -20.175 -19.335 52.999 1.00 50.40  ? 131 ARG A O     1 
ATOM   6711  C  CB    . ARG C 3  131 ? -22.469 -19.747 54.913 1.00 49.59  ? 131 ARG A CB    1 
ATOM   6712  C  CG    . ARG C 3  131 ? -23.381 -20.879 55.287 1.00 45.64  ? 131 ARG A CG    1 
ATOM   6713  C  CD    . ARG C 3  131 ? -24.744 -20.234 55.459 1.00 52.04  ? 131 ARG A CD    1 
ATOM   6714  N  NE    . ARG C 3  131 ? -25.799 -21.230 55.524 1.00 51.99  ? 131 ARG A NE    1 
ATOM   6715  C  CZ    . ARG C 3  131 ? -26.971 -21.114 54.921 1.00 52.71  ? 131 ARG A CZ    1 
ATOM   6716  N  NH1   . ARG C 3  131 ? -27.263 -20.038 54.203 1.00 57.99  ? 131 ARG A NH1   1 
ATOM   6717  N  NH2   . ARG C 3  131 ? -27.853 -22.088 55.028 1.00 55.36  ? 131 ARG A NH2   1 
ATOM   6718  N  N     . GLY C 3  132 ? -19.687 -18.017 54.727 1.00 58.67  ? 132 GLY A N     1 
ATOM   6719  C  CA    . GLY C 3  132 ? -19.013 -17.015 53.908 1.00 58.80  ? 132 GLY A CA    1 
ATOM   6720  C  C     . GLY C 3  132 ? -19.859 -15.819 53.532 1.00 62.93  ? 132 GLY A C     1 
ATOM   6721  O  O     . GLY C 3  132 ? -19.488 -15.055 52.645 1.00 75.78  ? 132 GLY A O     1 
ATOM   6722  N  N     . GLU C 3  133 ? -20.987 -15.633 54.213 1.00 65.71  ? 133 GLU A N     1 
ATOM   6723  C  CA    . GLU C 3  133 ? -21.787 -14.405 54.109 1.00 57.50  ? 133 GLU A CA    1 
ATOM   6724  C  C     . GLU C 3  133 ? -21.384 -13.604 55.340 1.00 58.95  ? 133 GLU A C     1 
ATOM   6725  O  O     . GLU C 3  133 ? -21.573 -12.418 55.398 1.00 65.21  ? 133 GLU A O     1 
ATOM   6726  C  CB    . GLU C 3  133 ? -23.296 -14.731 54.139 1.00 54.57  ? 133 GLU A CB    1 
ATOM   6727  C  CG    . GLU C 3  133 ? -23.684 -15.974 53.336 1.00 55.25  ? 133 GLU A CG    1 
ATOM   6728  C  CD    . GLU C 3  133 ? -25.118 -16.460 53.540 1.00 55.94  ? 133 GLU A CD    1 
ATOM   6729  O  OE1   . GLU C 3  133 ? -25.879 -15.753 54.204 1.00 57.70  ? 133 GLU A OE1   1 
ATOM   6730  O  OE2   . GLU C 3  133 ? -25.486 -17.575 53.063 1.00 54.47  ? 133 GLU A OE2   1 
ATOM   6731  N  N     . VAL D 4  21  ? -53.544 1.816   60.286 1.00 161.88 ? 21  VAL B N     1 
ATOM   6732  C  CA    . VAL D 4  21  ? -52.457 1.095   61.027 1.00 165.15 ? 21  VAL B CA    1 
ATOM   6733  C  C     . VAL D 4  21  ? -51.189 1.010   60.144 1.00 168.35 ? 21  VAL B C     1 
ATOM   6734  O  O     . VAL D 4  21  ? -50.700 -0.081  59.814 1.00 161.90 ? 21  VAL B O     1 
ATOM   6735  C  CB    . VAL D 4  21  ? -52.928 -0.312  61.509 1.00 165.45 ? 21  VAL B CB    1 
ATOM   6736  C  CG1   . VAL D 4  21  ? -51.998 -0.859  62.590 1.00 164.95 ? 21  VAL B CG1   1 
ATOM   6737  C  CG2   . VAL D 4  21  ? -54.368 -0.269  62.025 1.00 155.29 ? 21  VAL B CG2   1 
ATOM   6738  N  N     . LEU D 4  22  ? -50.676 2.188   59.776 1.00 165.34 ? 22  LEU B N     1 
ATOM   6739  C  CA    . LEU D 4  22  ? -49.508 2.352   58.886 1.00 159.29 ? 22  LEU B CA    1 
ATOM   6740  C  C     . LEU D 4  22  ? -48.307 1.490   59.290 1.00 150.63 ? 22  LEU B C     1 
ATOM   6741  O  O     . LEU D 4  22  ? -47.619 1.794   60.263 1.00 154.65 ? 22  LEU B O     1 
ATOM   6742  C  CB    . LEU D 4  22  ? -49.098 3.836   58.854 1.00 159.72 ? 22  LEU B CB    1 
ATOM   6743  C  CG    . LEU D 4  22  ? -48.851 4.548   60.202 1.00 160.94 ? 22  LEU B CG    1 
ATOM   6744  C  CD1   . LEU D 4  22  ? -47.370 4.844   60.425 1.00 163.58 ? 22  LEU B CD1   1 
ATOM   6745  C  CD2   . LEU D 4  22  ? -49.651 5.842   60.301 1.00 154.88 ? 22  LEU B CD2   1 
ATOM   6746  N  N     . ARG D 4  23  ? -48.049 0.420   58.543 1.00 131.44 ? 23  ARG B N     1 
ATOM   6747  C  CA    . ARG D 4  23  ? -47.056 -0.562  58.973 1.00 123.20 ? 23  ARG B CA    1 
ATOM   6748  C  C     . ARG D 4  23  ? -45.897 -0.675  57.997 1.00 121.48 ? 23  ARG B C     1 
ATOM   6749  O  O     . ARG D 4  23  ? -46.080 -0.610  56.777 1.00 119.15 ? 23  ARG B O     1 
ATOM   6750  C  CB    . ARG D 4  23  ? -47.716 -1.929  59.159 1.00 119.74 ? 23  ARG B CB    1 
ATOM   6751  C  CG    . ARG D 4  23  ? -47.087 -2.802  60.244 1.00 114.93 ? 23  ARG B CG    1 
ATOM   6752  C  CD    . ARG D 4  23  ? -48.138 -3.658  60.945 1.00 117.79 ? 23  ARG B CD    1 
ATOM   6753  N  NE    . ARG D 4  23  ? -47.958 -5.115  60.841 1.00 119.55 ? 23  ARG B NE    1 
ATOM   6754  C  CZ    . ARG D 4  23  ? -48.017 -5.841  59.718 1.00 108.58 ? 23  ARG B CZ    1 
ATOM   6755  N  NH1   . ARG D 4  23  ? -48.194 -5.266  58.535 1.00 107.13 ? 23  ARG B NH1   1 
ATOM   6756  N  NH2   . ARG D 4  23  ? -47.879 -7.165  59.777 1.00 93.83  ? 23  ARG B NH2   1 
ATOM   6757  N  N     . ASP D 4  24  ? -44.703 -0.857  58.555 1.00 119.62 ? 24  ASP B N     1 
ATOM   6758  C  CA    . ASP D 4  24  ? -43.496 -1.071  57.760 1.00 111.91 ? 24  ASP B CA    1 
ATOM   6759  C  C     . ASP D 4  24  ? -43.636 -2.349  56.957 1.00 95.15  ? 24  ASP B C     1 
ATOM   6760  O  O     . ASP D 4  24  ? -44.321 -3.288  57.385 1.00 86.58  ? 24  ASP B O     1 
ATOM   6761  C  CB    . ASP D 4  24  ? -42.264 -1.166  58.665 1.00 117.37 ? 24  ASP B CB    1 
ATOM   6762  C  CG    . ASP D 4  24  ? -41.082 -0.428  58.094 1.00 125.38 ? 24  ASP B CG    1 
ATOM   6763  O  OD1   . ASP D 4  24  ? -40.765 -0.649  56.900 1.00 128.76 ? 24  ASP B OD1   1 
ATOM   6764  O  OD2   . ASP D 4  24  ? -40.490 0.388   58.835 1.00 127.75 ? 24  ASP B OD2   1 
ATOM   6765  N  N     . ASN D 4  25  ? -43.000 -2.396  55.794 1.00 83.35  ? 25  ASN B N     1 
ATOM   6766  C  CA    . ASN D 4  25  ? -43.163 -3.566  54.919 1.00 84.72  ? 25  ASN B CA    1 
ATOM   6767  C  C     . ASN D 4  25  ? -42.480 -4.851  55.395 1.00 81.03  ? 25  ASN B C     1 
ATOM   6768  O  O     . ASN D 4  25  ? -43.063 -5.941  55.352 1.00 72.05  ? 25  ASN B O     1 
ATOM   6769  C  CB    . ASN D 4  25  ? -42.710 -3.229  53.516 1.00 85.35  ? 25  ASN B CB    1 
ATOM   6770  C  CG    . ASN D 4  25  ? -43.814 -2.603  52.705 1.00 86.52  ? 25  ASN B CG    1 
ATOM   6771  O  OD1   . ASN D 4  25  ? -44.972 -3.007  52.818 1.00 80.61  ? 25  ASN B OD1   1 
ATOM   6772  N  ND2   . ASN D 4  25  ? -43.472 -1.626  51.876 1.00 90.54  ? 25  ASN B ND2   1 
ATOM   6773  N  N     . ILE D 4  26  ? -41.250 -4.701  55.866 1.00 76.77  ? 26  ILE B N     1 
ATOM   6774  C  CA    . ILE D 4  26  ? -40.485 -5.795  56.433 1.00 77.46  ? 26  ILE B CA    1 
ATOM   6775  C  C     . ILE D 4  26  ? -41.249 -6.526  57.544 1.00 78.31  ? 26  ILE B C     1 
ATOM   6776  O  O     . ILE D 4  26  ? -41.039 -7.717  57.794 1.00 77.45  ? 26  ILE B O     1 
ATOM   6777  C  CB    . ILE D 4  26  ? -39.134 -5.265  56.976 1.00 84.00  ? 26  ILE B CB    1 
ATOM   6778  C  CG1   . ILE D 4  26  ? -38.200 -6.426  57.303 1.00 81.78  ? 26  ILE B CG1   1 
ATOM   6779  C  CG2   . ILE D 4  26  ? -39.330 -4.340  58.182 1.00 85.53  ? 26  ILE B CG2   1 
ATOM   6780  C  CD1   . ILE D 4  26  ? -37.632 -7.066  56.063 1.00 82.43  ? 26  ILE B CD1   1 
ATOM   6781  N  N     . GLN D 4  27  ? -42.138 -5.803  58.208 1.00 76.28  ? 27  GLN B N     1 
ATOM   6782  C  CA    . GLN D 4  27  ? -42.878 -6.337  59.335 1.00 76.11  ? 27  GLN B CA    1 
ATOM   6783  C  C     . GLN D 4  27  ? -44.040 -7.160  58.864 1.00 74.52  ? 27  GLN B C     1 
ATOM   6784  O  O     . GLN D 4  27  ? -44.604 -7.931  59.645 1.00 77.56  ? 27  GLN B O     1 
ATOM   6785  C  CB    . GLN D 4  27  ? -43.369 -5.190  60.192 1.00 75.48  ? 27  GLN B CB    1 
ATOM   6786  C  CG    . GLN D 4  27  ? -42.220 -4.395  60.774 1.00 70.14  ? 27  GLN B CG    1 
ATOM   6787  C  CD    . GLN D 4  27  ? -41.434 -5.240  61.726 1.00 72.61  ? 27  GLN B CD    1 
ATOM   6788  O  OE1   . GLN D 4  27  ? -41.988 -6.156  62.332 1.00 75.86  ? 27  GLN B OE1   1 
ATOM   6789  N  NE2   . GLN D 4  27  ? -40.139 -4.962  61.861 1.00 75.84  ? 27  GLN B NE2   1 
ATOM   6790  N  N     . GLY D 4  28  ? -44.380 -6.992  57.584 1.00 75.50  ? 28  GLY B N     1 
ATOM   6791  C  CA    . GLY D 4  28  ? -45.367 -7.835  56.896 1.00 78.67  ? 28  GLY B CA    1 
ATOM   6792  C  C     . GLY D 4  28  ? -44.951 -9.289  56.888 1.00 81.48  ? 28  GLY B C     1 
ATOM   6793  O  O     . GLY D 4  28  ? -45.767 -10.196 56.681 1.00 79.13  ? 28  GLY B O     1 
ATOM   6794  N  N     . ILE D 4  29  ? -43.653 -9.494  57.086 1.00 78.26  ? 29  ILE B N     1 
ATOM   6795  C  CA    . ILE D 4  29  ? -43.102 -10.802 57.290 1.00 66.89  ? 29  ILE B CA    1 
ATOM   6796  C  C     . ILE D 4  29  ? -43.211 -11.042 58.774 1.00 62.15  ? 29  ILE B C     1 
ATOM   6797  O  O     . ILE D 4  29  ? -42.434 -10.511 59.551 1.00 68.63  ? 29  ILE B O     1 
ATOM   6798  C  CB    . ILE D 4  29  ? -41.637 -10.877 56.852 1.00 61.65  ? 29  ILE B CB    1 
ATOM   6799  C  CG1   . ILE D 4  29  ? -41.473 -10.371 55.420 1.00 61.98  ? 29  ILE B CG1   1 
ATOM   6800  C  CG2   . ILE D 4  29  ? -41.139 -12.307 56.968 1.00 58.00  ? 29  ILE B CG2   1 
ATOM   6801  C  CD1   . ILE D 4  29  ? -42.155 -11.207 54.346 1.00 61.75  ? 29  ILE B CD1   1 
ATOM   6802  N  N     . THR D 4  30  ? -44.160 -11.876 59.156 1.00 58.16  ? 30  THR B N     1 
ATOM   6803  C  CA    . THR D 4  30  ? -44.686 -11.833 60.501 1.00 61.09  ? 30  THR B CA    1 
ATOM   6804  C  C     . THR D 4  30  ? -44.116 -12.913 61.350 1.00 56.02  ? 30  THR B C     1 
ATOM   6805  O  O     . THR D 4  30  ? -43.706 -13.949 60.860 1.00 60.80  ? 30  THR B O     1 
ATOM   6806  C  CB    . THR D 4  30  ? -46.218 -11.993 60.455 1.00 63.55  ? 30  THR B CB    1 
ATOM   6807  O  OG1   . THR D 4  30  ? -46.563 -13.320 60.032 1.00 69.29  ? 30  THR B OG1   1 
ATOM   6808  C  CG2   . THR D 4  30  ? -46.818 -11.002 59.459 1.00 66.14  ? 30  THR B CG2   1 
ATOM   6809  N  N     . LYS D 4  31  ? -44.161 -12.701 62.647 1.00 60.80  ? 31  LYS B N     1 
ATOM   6810  C  CA    . LYS D 4  31  ? -43.724 -13.731 63.593 1.00 59.88  ? 31  LYS B CA    1 
ATOM   6811  C  C     . LYS D 4  31  ? -44.200 -15.152 63.269 1.00 59.59  ? 31  LYS B C     1 
ATOM   6812  O  O     . LYS D 4  31  ? -43.412 -16.081 63.265 1.00 65.43  ? 31  LYS B O     1 
ATOM   6813  C  CB    . LYS D 4  31  ? -44.131 -13.354 65.009 1.00 54.56  ? 31  LYS B CB    1 
ATOM   6814  C  CG    . LYS D 4  31  ? -44.084 -14.521 65.965 1.00 62.04  ? 31  LYS B CG    1 
ATOM   6815  C  CD    . LYS D 4  31  ? -43.995 -14.033 67.397 1.00 68.20  ? 31  LYS B CD    1 
ATOM   6816  C  CE    . LYS D 4  31  ? -44.120 -15.178 68.400 1.00 70.16  ? 31  LYS B CE    1 
ATOM   6817  N  NZ    . LYS D 4  31  ? -43.853 -14.622 69.761 1.00 71.53  ? 31  LYS B NZ    1 
ATOM   6818  N  N     . PRO D 4  32  ? -45.493 -15.341 63.027 1.00 65.61  ? 32  PRO B N     1 
ATOM   6819  C  CA    . PRO D 4  32  ? -45.916 -16.724 62.803 1.00 68.90  ? 32  PRO B CA    1 
ATOM   6820  C  C     . PRO D 4  32  ? -45.317 -17.360 61.555 1.00 71.57  ? 32  PRO B C     1 
ATOM   6821  O  O     . PRO D 4  32  ? -45.079 -18.550 61.532 1.00 75.53  ? 32  PRO B O     1 
ATOM   6822  C  CB    . PRO D 4  32  ? -47.430 -16.607 62.614 1.00 67.53  ? 32  PRO B CB    1 
ATOM   6823  C  CG    . PRO D 4  32  ? -47.810 -15.301 63.192 1.00 65.91  ? 32  PRO B CG    1 
ATOM   6824  C  CD    . PRO D 4  32  ? -46.626 -14.406 63.046 1.00 65.09  ? 32  PRO B CD    1 
ATOM   6825  N  N     . ALA D 4  33  ? -45.119 -16.571 60.514 1.00 73.04  ? 33  ALA B N     1 
ATOM   6826  C  CA    . ALA D 4  33  ? -44.646 -17.108 59.247 1.00 75.16  ? 33  ALA B CA    1 
ATOM   6827  C  C     . ALA D 4  33  ? -43.146 -17.429 59.346 1.00 72.72  ? 33  ALA B C     1 
ATOM   6828  O  O     . ALA D 4  33  ? -42.659 -18.444 58.841 1.00 73.20  ? 33  ALA B O     1 
ATOM   6829  C  CB    . ALA D 4  33  ? -44.919 -16.114 58.134 1.00 76.05  ? 33  ALA B CB    1 
ATOM   6830  N  N     . ILE D 4  34  ? -42.413 -16.566 60.022 1.00 64.92  ? 34  ILE B N     1 
ATOM   6831  C  CA    . ILE D 4  34  ? -41.048 -16.887 60.392 1.00 61.47  ? 34  ILE B CA    1 
ATOM   6832  C  C     . ILE D 4  34  ? -41.038 -18.178 61.194 1.00 59.65  ? 34  ILE B C     1 
ATOM   6833  O  O     . ILE D 4  34  ? -40.270 -19.099 60.932 1.00 67.28  ? 34  ILE B O     1 
ATOM   6834  C  CB    . ILE D 4  34  ? -40.421 -15.750 61.228 1.00 58.26  ? 34  ILE B CB    1 
ATOM   6835  C  CG1   . ILE D 4  34  ? -40.169 -14.527 60.354 1.00 54.59  ? 34  ILE B CG1   1 
ATOM   6836  C  CG2   . ILE D 4  34  ? -39.141 -16.223 61.858 1.00 57.62  ? 34  ILE B CG2   1 
ATOM   6837  C  CD1   . ILE D 4  34  ? -39.875 -13.272 61.133 1.00 62.28  ? 34  ILE B CD1   1 
ATOM   6838  N  N     . ARG D 4  35  ? -41.909 -18.256 62.176 1.00 61.74  ? 35  ARG B N     1 
ATOM   6839  C  CA    . ARG D 4  35  ? -41.948 -19.433 63.022 1.00 61.83  ? 35  ARG B CA    1 
ATOM   6840  C  C     . ARG D 4  35  ? -42.172 -20.698 62.176 1.00 60.74  ? 35  ARG B C     1 
ATOM   6841  O  O     . ARG D 4  35  ? -41.528 -21.718 62.422 1.00 64.98  ? 35  ARG B O     1 
ATOM   6842  C  CB    . ARG D 4  35  ? -42.992 -19.205 64.098 1.00 68.94  ? 35  ARG B CB    1 
ATOM   6843  C  CG    . ARG D 4  35  ? -43.325 -20.383 64.986 1.00 77.40  ? 35  ARG B CG    1 
ATOM   6844  C  CD    . ARG D 4  35  ? -44.127 -19.877 66.163 1.00 69.97  ? 35  ARG B CD    1 
ATOM   6845  N  NE    . ARG D 4  35  ? -43.199 -19.225 67.072 1.00 70.17  ? 35  ARG B NE    1 
ATOM   6846  C  CZ    . ARG D 4  35  ? -42.874 -19.703 68.268 1.00 74.52  ? 35  ARG B CZ    1 
ATOM   6847  N  NH1   . ARG D 4  35  ? -43.441 -20.804 68.741 1.00 81.62  ? 35  ARG B NH1   1 
ATOM   6848  N  NH2   . ARG D 4  35  ? -42.008 -19.052 69.020 1.00 79.94  ? 35  ARG B NH2   1 
ATOM   6849  N  N     . ARG D 4  36  ? -43.010 -20.627 61.136 1.00 55.86  ? 36  ARG B N     1 
ATOM   6850  C  CA    . ARG D 4  36  ? -43.253 -21.795 60.279 1.00 57.18  ? 36  ARG B CA    1 
ATOM   6851  C  C     . ARG D 4  36  ? -42.018 -22.171 59.438 1.00 55.68  ? 36  ARG B C     1 
ATOM   6852  O  O     . ARG D 4  36  ? -41.716 -23.353 59.189 1.00 52.40  ? 36  ARG B O     1 
ATOM   6853  C  CB    . ARG D 4  36  ? -44.469 -21.578 59.365 1.00 63.52  ? 36  ARG B CB    1 
ATOM   6854  C  CG    . ARG D 4  36  ? -45.825 -21.481 60.074 1.00 71.62  ? 36  ARG B CG    1 
ATOM   6855  C  CD    . ARG D 4  36  ? -47.012 -21.522 59.104 1.00 74.08  ? 36  ARG B CD    1 
ATOM   6856  N  NE    . ARG D 4  36  ? -47.137 -20.355 58.228 1.00 78.28  ? 36  ARG B NE    1 
ATOM   6857  C  CZ    . ARG D 4  36  ? -47.713 -19.203 58.567 1.00 88.02  ? 36  ARG B CZ    1 
ATOM   6858  N  NH1   . ARG D 4  36  ? -48.218 -19.031 59.787 1.00 94.33  ? 36  ARG B NH1   1 
ATOM   6859  N  NH2   . ARG D 4  36  ? -47.782 -18.213 57.680 1.00 85.44  ? 36  ARG B NH2   1 
ATOM   6860  N  N     . LEU D 4  37  ? -41.292 -21.170 58.985 1.00 55.23  ? 37  LEU B N     1 
ATOM   6861  C  CA    . LEU D 4  37  ? -40.066 -21.449 58.267 1.00 52.83  ? 37  LEU B CA    1 
ATOM   6862  C  C     . LEU D 4  37  ? -39.144 -22.239 59.185 1.00 50.53  ? 37  LEU B C     1 
ATOM   6863  O  O     . LEU D 4  37  ? -38.771 -23.400 58.915 1.00 55.69  ? 37  LEU B O     1 
ATOM   6864  C  CB    . LEU D 4  37  ? -39.428 -20.150 57.785 1.00 54.57  ? 37  LEU B CB    1 
ATOM   6865  C  CG    . LEU D 4  37  ? -40.211 -19.582 56.579 1.00 55.81  ? 37  LEU B CG    1 
ATOM   6866  C  CD1   . LEU D 4  37  ? -39.825 -18.145 56.278 1.00 60.49  ? 37  LEU B CD1   1 
ATOM   6867  C  CD2   . LEU D 4  37  ? -40.025 -20.428 55.329 1.00 54.76  ? 37  LEU B CD2   1 
ATOM   6868  N  N     . ALA D 4  38  ? -38.850 -21.667 60.323 1.00 43.59  ? 38  ALA B N     1 
ATOM   6869  C  CA    . ALA D 4  38  ? -38.036 -22.393 61.284 1.00 47.43  ? 38  ALA B CA    1 
ATOM   6870  C  C     . ALA D 4  38  ? -38.482 -23.843 61.484 1.00 49.15  ? 38  ALA B C     1 
ATOM   6871  O  O     . ALA D 4  38  ? -37.676 -24.724 61.731 1.00 50.62  ? 38  ALA B O     1 
ATOM   6872  C  CB    . ALA D 4  38  ? -38.048 -21.662 62.612 1.00 48.75  ? 38  ALA B CB    1 
ATOM   6873  N  N     . ARG D 4  39  ? -39.786 -24.080 61.435 1.00 59.71  ? 39  ARG B N     1 
ATOM   6874  C  CA    . ARG D 4  39  ? -40.326 -25.391 61.747 1.00 55.44  ? 39  ARG B CA    1 
ATOM   6875  C  C     . ARG D 4  39  ? -39.943 -26.317 60.639 1.00 49.68  ? 39  ARG B C     1 
ATOM   6876  O  O     . ARG D 4  39  ? -39.462 -27.422 60.879 1.00 53.13  ? 39  ARG B O     1 
ATOM   6877  C  CB    . ARG D 4  39  ? -41.841 -25.320 61.939 1.00 58.17  ? 39  ARG B CB    1 
ATOM   6878  C  CG    . ARG D 4  39  ? -42.243 -24.559 63.201 1.00 61.01  ? 39  ARG B CG    1 
ATOM   6879  C  CD    . ARG D 4  39  ? -41.987 -25.398 64.448 1.00 64.83  ? 39  ARG B CD    1 
ATOM   6880  N  NE    . ARG D 4  39  ? -42.604 -24.879 65.676 1.00 65.04  ? 39  ARG B NE    1 
ATOM   6881  C  CZ    . ARG D 4  39  ? -41.959 -24.281 66.679 1.00 70.55  ? 39  ARG B CZ    1 
ATOM   6882  N  NH1   . ARG D 4  39  ? -40.643 -24.076 66.646 1.00 73.24  ? 39  ARG B NH1   1 
ATOM   6883  N  NH2   . ARG D 4  39  ? -42.640 -23.870 67.736 1.00 73.39  ? 39  ARG B NH2   1 
ATOM   6884  N  N     . ARG D 4  40  ? -40.122 -25.867 59.413 1.00 48.76  ? 40  ARG B N     1 
ATOM   6885  C  CA    . ARG D 4  40  ? -39.666 -26.656 58.271 1.00 51.34  ? 40  ARG B CA    1 
ATOM   6886  C  C     . ARG D 4  40  ? -38.166 -26.980 58.428 1.00 51.63  ? 40  ARG B C     1 
ATOM   6887  O  O     . ARG D 4  40  ? -37.707 -28.044 58.046 1.00 51.12  ? 40  ARG B O     1 
ATOM   6888  C  CB    . ARG D 4  40  ? -39.913 -25.860 56.999 1.00 54.24  ? 40  ARG B CB    1 
ATOM   6889  C  CG    . ARG D 4  40  ? -39.810 -26.623 55.681 1.00 55.19  ? 40  ARG B CG    1 
ATOM   6890  C  CD    . ARG D 4  40  ? -40.669 -25.955 54.588 1.00 54.52  ? 40  ARG B CD    1 
ATOM   6891  N  NE    . ARG D 4  40  ? -42.008 -26.538 54.485 1.00 57.94  ? 40  ARG B NE    1 
ATOM   6892  C  CZ    . ARG D 4  40  ? -42.999 -26.035 53.752 1.00 63.03  ? 40  ARG B CZ    1 
ATOM   6893  N  NH1   . ARG D 4  40  ? -42.826 -24.915 53.069 1.00 60.09  ? 40  ARG B NH1   1 
ATOM   6894  N  NH2   . ARG D 4  40  ? -44.180 -26.644 53.718 1.00 65.69  ? 40  ARG B NH2   1 
ATOM   6895  N  N     . GLY D 4  41  ? -37.416 -26.044 59.004 1.00 51.24  ? 41  GLY B N     1 
ATOM   6896  C  CA    . GLY D 4  41  ? -35.990 -26.220 59.256 1.00 51.26  ? 41  GLY B CA    1 
ATOM   6897  C  C     . GLY D 4  41  ? -35.676 -27.004 60.514 1.00 50.44  ? 41  GLY B C     1 
ATOM   6898  O  O     . GLY D 4  41  ? -34.515 -27.095 60.937 1.00 53.15  ? 41  GLY B O     1 
ATOM   6899  N  N     . GLY D 4  42  ? -36.701 -27.574 61.121 1.00 47.83  ? 42  GLY B N     1 
ATOM   6900  C  CA    . GLY D 4  42  ? -36.497 -28.515 62.218 1.00 50.17  ? 42  GLY B CA    1 
ATOM   6901  C  C     . GLY D 4  42  ? -36.346 -27.870 63.569 1.00 48.49  ? 42  GLY B C     1 
ATOM   6902  O  O     . GLY D 4  42  ? -35.945 -28.534 64.516 1.00 49.91  ? 42  GLY B O     1 
ATOM   6903  N  N     . VAL D 4  43  ? -36.707 -26.598 63.680 1.00 47.91  ? 43  VAL B N     1 
ATOM   6904  C  CA    . VAL D 4  43  ? -36.473 -25.846 64.926 1.00 55.19  ? 43  VAL B CA    1 
ATOM   6905  C  C     . VAL D 4  43  ? -37.599 -25.982 65.939 1.00 53.37  ? 43  VAL B C     1 
ATOM   6906  O  O     . VAL D 4  43  ? -38.742 -25.715 65.631 1.00 59.55  ? 43  VAL B O     1 
ATOM   6907  C  CB    . VAL D 4  43  ? -36.315 -24.336 64.634 1.00 55.63  ? 43  VAL B CB    1 
ATOM   6908  C  CG1   . VAL D 4  43  ? -36.088 -23.565 65.915 1.00 50.89  ? 43  VAL B CG1   1 
ATOM   6909  C  CG2   . VAL D 4  43  ? -35.159 -24.111 63.672 1.00 62.56  ? 43  VAL B CG2   1 
ATOM   6910  N  N     . LYS D 4  44  ? -37.245 -26.316 67.165 1.00 56.79  ? 44  LYS B N     1 
ATOM   6911  C  CA    . LYS D 4  44  ? -38.203 -26.557 68.258 1.00 58.60  ? 44  LYS B CA    1 
ATOM   6912  C  C     . LYS D 4  44  ? -38.490 -25.339 69.148 1.00 61.12  ? 44  LYS B C     1 
ATOM   6913  O  O     . LYS D 4  44  ? -39.635 -25.128 69.559 1.00 67.87  ? 44  LYS B O     1 
ATOM   6914  C  CB    . LYS D 4  44  ? -37.642 -27.658 69.136 1.00 58.73  ? 44  LYS B CB    1 
ATOM   6915  C  CG    . LYS D 4  44  ? -38.501 -28.059 70.303 1.00 61.70  ? 44  LYS B CG    1 
ATOM   6916  C  CD    . LYS D 4  44  ? -38.028 -29.395 70.863 1.00 63.74  ? 44  LYS B CD    1 
ATOM   6917  C  CE    . LYS D 4  44  ? -38.743 -29.766 72.151 1.00 68.23  ? 44  LYS B CE    1 
ATOM   6918  N  NZ    . LYS D 4  44  ? -38.539 -31.192 72.529 1.00 69.35  ? 44  LYS B NZ    1 
ATOM   6919  N  N     . ARG D 4  45  ? -37.457 -24.548 69.452 1.00 63.88  ? 45  ARG B N     1 
ATOM   6920  C  CA    . ARG D 4  45  ? -37.589 -23.408 70.356 1.00 61.09  ? 45  ARG B CA    1 
ATOM   6921  C  C     . ARG D 4  45  ? -36.835 -22.187 69.877 1.00 62.37  ? 45  ARG B C     1 
ATOM   6922  O  O     . ARG D 4  45  ? -35.676 -22.285 69.497 1.00 69.52  ? 45  ARG B O     1 
ATOM   6923  C  CB    . ARG D 4  45  ? -37.054 -23.809 71.717 1.00 70.84  ? 45  ARG B CB    1 
ATOM   6924  C  CG    . ARG D 4  45  ? -37.672 -23.038 72.851 1.00 71.96  ? 45  ARG B CG    1 
ATOM   6925  C  CD    . ARG D 4  45  ? -37.454 -23.751 74.174 1.00 75.75  ? 45  ARG B CD    1 
ATOM   6926  N  NE    . ARG D 4  45  ? -37.867 -22.850 75.249 1.00 83.81  ? 45  ARG B NE    1 
ATOM   6927  C  CZ    . ARG D 4  45  ? -37.147 -21.819 75.699 1.00 87.11  ? 45  ARG B CZ    1 
ATOM   6928  N  NH1   . ARG D 4  45  ? -35.937 -21.545 75.208 1.00 84.43  ? 45  ARG B NH1   1 
ATOM   6929  N  NH2   . ARG D 4  45  ? -37.643 -21.047 76.653 1.00 91.56  ? 45  ARG B NH2   1 
ATOM   6930  N  N     . ILE D 4  46  ? -37.467 -21.025 69.979 1.00 61.02  ? 46  ILE B N     1 
ATOM   6931  C  CA    . ILE D 4  46  ? -37.038 -19.831 69.259 1.00 55.86  ? 46  ILE B CA    1 
ATOM   6932  C  C     . ILE D 4  46  ? -36.998 -18.569 70.133 1.00 58.44  ? 46  ILE B C     1 
ATOM   6933  O  O     . ILE D 4  46  ? -37.997 -18.163 70.704 1.00 64.68  ? 46  ILE B O     1 
ATOM   6934  C  CB    . ILE D 4  46  ? -38.015 -19.567 68.115 1.00 50.58  ? 46  ILE B CB    1 
ATOM   6935  C  CG1   . ILE D 4  46  ? -38.111 -20.776 67.204 1.00 54.03  ? 46  ILE B CG1   1 
ATOM   6936  C  CG2   . ILE D 4  46  ? -37.599 -18.368 67.307 1.00 51.69  ? 46  ILE B CG2   1 
ATOM   6937  C  CD1   . ILE D 4  46  ? -39.181 -20.633 66.133 1.00 55.91  ? 46  ILE B CD1   1 
ATOM   6938  N  N     . SER D 4  47  ? -35.856 -17.912 70.174 1.00 58.31  ? 47  SER B N     1 
ATOM   6939  C  CA    . SER D 4  47  ? -35.670 -16.788 71.059 1.00 58.36  ? 47  SER B CA    1 
ATOM   6940  C  C     . SER D 4  47  ? -36.270 -15.579 70.401 1.00 56.48  ? 47  SER B C     1 
ATOM   6941  O  O     . SER D 4  47  ? -36.205 -15.446 69.197 1.00 60.37  ? 47  SER B O     1 
ATOM   6942  C  CB    . SER D 4  47  ? -34.193 -16.552 71.365 1.00 57.55  ? 47  SER B CB    1 
ATOM   6943  O  OG    . SER D 4  47  ? -33.731 -15.377 70.753 1.00 65.38  ? 47  SER B OG    1 
ATOM   6944  N  N     . GLY D 4  48  ? -36.834 -14.689 71.211 1.00 56.53  ? 48  GLY B N     1 
ATOM   6945  C  CA    . GLY D 4  48  ? -37.657 -13.583 70.730 1.00 51.43  ? 48  GLY B CA    1 
ATOM   6946  C  C     . GLY D 4  48  ? -36.951 -12.632 69.796 1.00 58.28  ? 48  GLY B C     1 
ATOM   6947  O  O     . GLY D 4  48  ? -37.621 -11.942 69.017 1.00 66.57  ? 48  GLY B O     1 
ATOM   6948  N  N     . LEU D 4  49  ? -35.610 -12.582 69.847 1.00 55.39  ? 49  LEU B N     1 
ATOM   6949  C  CA    . LEU D 4  49  ? -34.861 -11.610 69.028 1.00 55.28  ? 49  LEU B CA    1 
ATOM   6950  C  C     . LEU D 4  49  ? -34.710 -12.091 67.583 1.00 54.52  ? 49  LEU B C     1 
ATOM   6951  O  O     . LEU D 4  49  ? -34.290 -11.336 66.691 1.00 49.84  ? 49  LEU B O     1 
ATOM   6952  C  CB    . LEU D 4  49  ? -33.497 -11.323 69.644 1.00 57.20  ? 49  LEU B CB    1 
ATOM   6953  C  CG    . LEU D 4  49  ? -33.571 -10.825 71.109 1.00 59.25  ? 49  LEU B CG    1 
ATOM   6954  C  CD1   . LEU D 4  49  ? -32.373 -11.260 71.937 1.00 61.06  ? 49  LEU B CD1   1 
ATOM   6955  C  CD2   . LEU D 4  49  ? -33.694 -9.312  71.165 1.00 56.00  ? 49  LEU B CD2   1 
ATOM   6956  N  N     . ILE D 4  50  ? -35.088 -13.348 67.363 1.00 55.23  ? 50  ILE B N     1 
ATOM   6957  C  CA    . ILE D 4  50  ? -34.916 -14.013 66.087 1.00 52.76  ? 50  ILE B CA    1 
ATOM   6958  C  C     . ILE D 4  50  ? -35.668 -13.269 65.007 1.00 51.74  ? 50  ILE B C     1 
ATOM   6959  O  O     . ILE D 4  50  ? -35.130 -13.058 63.940 1.00 54.18  ? 50  ILE B O     1 
ATOM   6960  C  CB    . ILE D 4  50  ? -35.396 -15.493 66.151 1.00 52.59  ? 50  ILE B CB    1 
ATOM   6961  C  CG1   . ILE D 4  50  ? -34.367 -16.410 66.820 1.00 58.32  ? 50  ILE B CG1   1 
ATOM   6962  C  CG2   . ILE D 4  50  ? -35.689 -16.044 64.774 1.00 59.74  ? 50  ILE B CG2   1 
ATOM   6963  C  CD1   . ILE D 4  50  ? -32.973 -16.380 66.225 1.00 64.05  ? 50  ILE B CD1   1 
ATOM   6964  N  N     . TYR D 4  51  ? -36.898 -12.852 65.279 1.00 49.45  ? 51  TYR B N     1 
ATOM   6965  C  CA    . TYR D 4  51  ? -37.783 -12.412 64.203 1.00 48.06  ? 51  TYR B CA    1 
ATOM   6966  C  C     . TYR D 4  51  ? -37.177 -11.178 63.564 1.00 52.57  ? 51  TYR B C     1 
ATOM   6967  O  O     . TYR D 4  51  ? -37.170 -11.042 62.336 1.00 59.00  ? 51  TYR B O     1 
ATOM   6968  C  CB    . TYR D 4  51  ? -39.217 -12.204 64.730 1.00 52.54  ? 51  TYR B CB    1 
ATOM   6969  C  CG    . TYR D 4  51  ? -39.649 -13.402 65.548 1.00 46.50  ? 51  TYR B CG    1 
ATOM   6970  C  CD1   . TYR D 4  51  ? -39.958 -14.582 64.939 1.00 47.33  ? 51  TYR B CD1   1 
ATOM   6971  C  CD2   . TYR D 4  51  ? -39.643 -13.374 66.905 1.00 46.64  ? 51  TYR B CD2   1 
ATOM   6972  C  CE1   . TYR D 4  51  ? -40.274 -15.701 65.665 1.00 45.62  ? 51  TYR B CE1   1 
ATOM   6973  C  CE2   . TYR D 4  51  ? -39.946 -14.498 67.643 1.00 48.83  ? 51  TYR B CE2   1 
ATOM   6974  C  CZ    . TYR D 4  51  ? -40.274 -15.659 67.009 1.00 46.53  ? 51  TYR B CZ    1 
ATOM   6975  O  OH    . TYR D 4  51  ? -40.561 -16.817 67.734 1.00 50.02  ? 51  TYR B OH    1 
ATOM   6976  N  N     . GLU D 4  52  ? -36.598 -10.308 64.376 1.00 54.38  ? 52  GLU B N     1 
ATOM   6977  C  CA    . GLU D 4  52  ? -35.891 -9.160  63.810 1.00 65.88  ? 52  GLU B CA    1 
ATOM   6978  C  C     . GLU D 4  52  ? -34.602 -9.553  63.074 1.00 63.23  ? 52  GLU B C     1 
ATOM   6979  O  O     . GLU D 4  52  ? -34.305 -8.998  62.018 1.00 61.09  ? 52  GLU B O     1 
ATOM   6980  C  CB    . GLU D 4  52  ? -35.614 -8.067  64.862 1.00 68.84  ? 52  GLU B CB    1 
ATOM   6981  C  CG    . GLU D 4  52  ? -36.806 -7.138  65.076 1.00 73.58  ? 52  GLU B CG    1 
ATOM   6982  C  CD    . GLU D 4  52  ? -37.161 -6.352  63.824 1.00 77.89  ? 52  GLU B CD    1 
ATOM   6983  O  OE1   . GLU D 4  52  ? -36.394 -5.443  63.450 1.00 72.86  ? 52  GLU B OE1   1 
ATOM   6984  O  OE2   . GLU D 4  52  ? -38.210 -6.642  63.204 1.00 83.04  ? 52  GLU B OE2   1 
ATOM   6985  N  N     . GLU D 4  53  ? -33.833 -10.489 63.612 1.00 60.45  ? 53  GLU B N     1 
ATOM   6986  C  CA    . GLU D 4  53  ? -32.603 -10.875 62.928 1.00 60.19  ? 53  GLU B CA    1 
ATOM   6987  C  C     . GLU D 4  53  ? -33.007 -11.428 61.565 1.00 55.84  ? 53  GLU B C     1 
ATOM   6988  O  O     . GLU D 4  53  ? -32.497 -10.993 60.497 1.00 50.12  ? 53  GLU B O     1 
ATOM   6989  C  CB    . GLU D 4  53  ? -31.796 -11.896 63.727 1.00 61.20  ? 53  GLU B CB    1 
ATOM   6990  C  CG    . GLU D 4  53  ? -30.393 -12.134 63.170 1.00 68.10  ? 53  GLU B CG    1 
ATOM   6991  C  CD    . GLU D 4  53  ? -29.362 -11.081 63.570 1.00 70.74  ? 53  GLU B CD    1 
ATOM   6992  O  OE1   . GLU D 4  53  ? -29.630 -10.316 64.515 1.00 66.91  ? 53  GLU B OE1   1 
ATOM   6993  O  OE2   . GLU D 4  53  ? -28.262 -11.036 62.947 1.00 68.53  ? 53  GLU B OE2   1 
ATOM   6994  N  N     . THR D 4  54  ? -33.977 -12.334 61.610 1.00 49.14  ? 54  THR B N     1 
ATOM   6995  C  CA    . THR D 4  54  ? -34.460 -13.004 60.414 1.00 48.52  ? 54  THR B CA    1 
ATOM   6996  C  C     . THR D 4  54  ? -34.927 -12.027 59.363 1.00 49.37  ? 54  THR B C     1 
ATOM   6997  O  O     . THR D 4  54  ? -34.604 -12.184 58.207 1.00 50.84  ? 54  THR B O     1 
ATOM   6998  C  CB    . THR D 4  54  ? -35.592 -13.985 60.729 1.00 54.91  ? 54  THR B CB    1 
ATOM   6999  O  OG1   . THR D 4  54  ? -35.203 -14.874 61.806 1.00 55.64  ? 54  THR B OG1   1 
ATOM   7000  C  CG2   . THR D 4  54  ? -35.939 -14.818 59.500 1.00 53.86  ? 54  THR B CG2   1 
ATOM   7001  N  N     . ARG D 4  55  ? -35.655 -10.983 59.730 1.00 61.43  ? 55  ARG B N     1 
ATOM   7002  C  CA    . ARG D 4  55  ? -36.012 -9.982  58.707 1.00 60.06  ? 55  ARG B CA    1 
ATOM   7003  C  C     . ARG D 4  55  ? -34.776 -9.311  58.113 1.00 63.13  ? 55  ARG B C     1 
ATOM   7004  O  O     . ARG D 4  55  ? -34.687 -9.121  56.887 1.00 60.09  ? 55  ARG B O     1 
ATOM   7005  C  CB    . ARG D 4  55  ? -36.933 -8.941  59.270 1.00 64.06  ? 55  ARG B CB    1 
ATOM   7006  C  CG    . ARG D 4  55  ? -38.314 -9.483  59.564 1.00 66.32  ? 55  ARG B CG    1 
ATOM   7007  C  CD    . ARG D 4  55  ? -39.147 -8.470  60.328 1.00 68.88  ? 55  ARG B CD    1 
ATOM   7008  N  NE    . ARG D 4  55  ? -40.381 -9.090  60.798 1.00 66.74  ? 55  ARG B NE    1 
ATOM   7009  C  CZ    . ARG D 4  55  ? -40.660 -9.422  62.059 1.00 58.89  ? 55  ARG B CZ    1 
ATOM   7010  N  NH1   . ARG D 4  55  ? -39.828 -9.174  63.079 1.00 54.86  ? 55  ARG B NH1   1 
ATOM   7011  N  NH2   . ARG D 4  55  ? -41.814 -10.021 62.295 1.00 64.16  ? 55  ARG B NH2   1 
ATOM   7012  N  N     . GLY D 4  56  ? -33.810 -8.978  58.967 1.00 59.30  ? 56  GLY B N     1 
ATOM   7013  C  CA    . GLY D 4  56  ? -32.581 -8.340  58.486 1.00 59.96  ? 56  GLY B CA    1 
ATOM   7014  C  C     . GLY D 4  56  ? -31.905 -9.178  57.427 1.00 60.45  ? 56  GLY B C     1 
ATOM   7015  O  O     . GLY D 4  56  ? -31.481 -8.677  56.385 1.00 59.75  ? 56  GLY B O     1 
ATOM   7016  N  N     . VAL D 4  57  ? -31.845 -10.476 57.698 1.00 56.46  ? 57  VAL B N     1 
ATOM   7017  C  CA    . VAL D 4  57  ? -31.199 -11.419 56.809 1.00 53.46  ? 57  VAL B CA    1 
ATOM   7018  C  C     . VAL D 4  57  ? -31.928 -11.550 55.470 1.00 51.13  ? 57  VAL B C     1 
ATOM   7019  O  O     . VAL D 4  57  ? -31.312 -11.651 54.414 1.00 58.00  ? 57  VAL B O     1 
ATOM   7020  C  CB    . VAL D 4  57  ? -31.148 -12.799 57.475 1.00 53.85  ? 57  VAL B CB    1 
ATOM   7021  C  CG1   . VAL D 4  57  ? -30.733 -13.887 56.490 1.00 60.59  ? 57  VAL B CG1   1 
ATOM   7022  C  CG2   . VAL D 4  57  ? -30.206 -12.780 58.647 1.00 56.41  ? 57  VAL B CG2   1 
ATOM   7023  N  N     . LEU D 4  58  ? -33.242 -11.590 55.514 1.00 48.70  ? 58  LEU B N     1 
ATOM   7024  C  CA    . LEU D 4  58  ? -34.022 -11.737 54.303 1.00 48.67  ? 58  LEU B CA    1 
ATOM   7025  C  C     . LEU D 4  58  ? -33.906 -10.499 53.432 1.00 51.69  ? 58  LEU B C     1 
ATOM   7026  O  O     . LEU D 4  58  ? -33.972 -10.565 52.197 1.00 52.55  ? 58  LEU B O     1 
ATOM   7027  C  CB    . LEU D 4  58  ? -35.465 -11.931 54.703 1.00 53.15  ? 58  LEU B CB    1 
ATOM   7028  C  CG    . LEU D 4  58  ? -36.479 -11.939 53.563 1.00 56.14  ? 58  LEU B CG    1 
ATOM   7029  C  CD1   . LEU D 4  58  ? -36.112 -12.931 52.465 1.00 54.72  ? 58  LEU B CD1   1 
ATOM   7030  C  CD2   . LEU D 4  58  ? -37.841 -12.250 54.176 1.00 54.98  ? 58  LEU B CD2   1 
ATOM   7031  N  N     . LYS D 4  59  ? -33.745 -9.355  54.082 1.00 52.18  ? 59  LYS B N     1 
ATOM   7032  C  CA    . LYS D 4  59  ? -33.593 -8.114  53.358 1.00 55.01  ? 59  LYS B CA    1 
ATOM   7033  C  C     . LYS D 4  59  ? -32.312 -8.189  52.564 1.00 57.91  ? 59  LYS B C     1 
ATOM   7034  O  O     . LYS D 4  59  ? -32.295 -7.875  51.376 1.00 61.05  ? 59  LYS B O     1 
ATOM   7035  C  CB    . LYS D 4  59  ? -33.560 -6.948  54.327 1.00 58.04  ? 59  LYS B CB    1 
ATOM   7036  C  CG    . LYS D 4  59  ? -33.641 -5.587  53.676 1.00 68.59  ? 59  LYS B CG    1 
ATOM   7037  C  CD    . LYS D 4  59  ? -34.358 -4.591  54.586 1.00 73.94  ? 59  LYS B CD    1 
ATOM   7038  C  CE    . LYS D 4  59  ? -34.101 -3.156  54.173 1.00 80.07  ? 59  LYS B CE    1 
ATOM   7039  N  NZ    . LYS D 4  59  ? -32.742 -2.711  54.616 1.00 84.77  ? 59  LYS B NZ    1 
ATOM   7040  N  N     . VAL D 4  60  ? -31.241 -8.647  53.215 1.00 53.99  ? 60  VAL B N     1 
ATOM   7041  C  CA    . VAL D 4  60  ? -29.952 -8.731  52.553 1.00 48.24  ? 60  VAL B CA    1 
ATOM   7042  C  C     . VAL D 4  60  ? -30.095 -9.699  51.387 1.00 45.99  ? 60  VAL B C     1 
ATOM   7043  O  O     . VAL D 4  60  ? -29.720 -9.396  50.267 1.00 44.47  ? 60  VAL B O     1 
ATOM   7044  C  CB    . VAL D 4  60  ? -28.857 -9.257  53.478 1.00 51.17  ? 60  VAL B CB    1 
ATOM   7045  C  CG1   . VAL D 4  60  ? -27.625 -9.588  52.675 1.00 52.77  ? 60  VAL B CG1   1 
ATOM   7046  C  CG2   . VAL D 4  60  ? -28.511 -8.255  54.556 1.00 52.41  ? 60  VAL B CG2   1 
ATOM   7047  N  N     . PHE D 4  61  ? -30.652 -10.868 51.630 1.00 42.41  ? 61  PHE B N     1 
ATOM   7048  C  CA    . PHE D 4  61  ? -30.813 -11.833 50.531 1.00 44.50  ? 61  PHE B CA    1 
ATOM   7049  C  C     . PHE D 4  61  ? -31.473 -11.180 49.324 1.00 48.40  ? 61  PHE B C     1 
ATOM   7050  O  O     . PHE D 4  61  ? -30.973 -11.268 48.176 1.00 46.49  ? 61  PHE B O     1 
ATOM   7051  C  CB    . PHE D 4  61  ? -31.655 -13.000 50.995 1.00 44.78  ? 61  PHE B CB    1 
ATOM   7052  C  CG    . PHE D 4  61  ? -31.850 -14.074 49.962 1.00 47.10  ? 61  PHE B CG    1 
ATOM   7053  C  CD1   . PHE D 4  61  ? -30.855 -15.045 49.727 1.00 44.93  ? 61  PHE B CD1   1 
ATOM   7054  C  CD2   . PHE D 4  61  ? -33.061 -14.177 49.275 1.00 47.06  ? 61  PHE B CD2   1 
ATOM   7055  C  CE1   . PHE D 4  61  ? -31.049 -16.064 48.793 1.00 41.64  ? 61  PHE B CE1   1 
ATOM   7056  C  CE2   . PHE D 4  61  ? -33.253 -15.182 48.325 1.00 48.61  ? 61  PHE B CE2   1 
ATOM   7057  C  CZ    . PHE D 4  61  ? -32.246 -16.123 48.073 1.00 44.12  ? 61  PHE B CZ    1 
ATOM   7058  N  N     . LEU D 4  62  ? -32.583 -10.500 49.594 1.00 47.00  ? 62  LEU B N     1 
ATOM   7059  C  CA    . LEU D 4  62  ? -33.363 -9.913  48.530 1.00 50.33  ? 62  LEU B CA    1 
ATOM   7060  C  C     . LEU D 4  62  ? -32.674 -8.691  47.883 1.00 48.17  ? 62  LEU B C     1 
ATOM   7061  O  O     . LEU D 4  62  ? -32.762 -8.472  46.677 1.00 45.39  ? 62  LEU B O     1 
ATOM   7062  C  CB    . LEU D 4  62  ? -34.744 -9.542  49.067 1.00 56.22  ? 62  LEU B CB    1 
ATOM   7063  C  CG    . LEU D 4  62  ? -35.634 -10.754 49.387 1.00 58.60  ? 62  LEU B CG    1 
ATOM   7064  C  CD1   . LEU D 4  62  ? -36.897 -10.344 50.112 1.00 61.01  ? 62  LEU B CD1   1 
ATOM   7065  C  CD2   . LEU D 4  62  ? -36.034 -11.513 48.136 1.00 59.87  ? 62  LEU B CD2   1 
ATOM   7066  N  N     . GLU D 4  63  ? -31.975 -7.889  48.656 1.00 43.85  ? 63  GLU B N     1 
ATOM   7067  C  CA    . GLU D 4  63  ? -31.268 -6.814  48.030 1.00 48.32  ? 63  GLU B CA    1 
ATOM   7068  C  C     . GLU D 4  63  ? -30.316 -7.425  47.011 1.00 50.59  ? 63  GLU B C     1 
ATOM   7069  O  O     . GLU D 4  63  ? -30.253 -6.996  45.856 1.00 48.76  ? 63  GLU B O     1 
ATOM   7070  C  CB    . GLU D 4  63  ? -30.502 -6.022  49.073 1.00 56.66  ? 63  GLU B CB    1 
ATOM   7071  C  CG    . GLU D 4  63  ? -31.411 -5.244  50.011 1.00 62.70  ? 63  GLU B CG    1 
ATOM   7072  C  CD    . GLU D 4  63  ? -30.698 -4.694  51.238 1.00 66.86  ? 63  GLU B CD    1 
ATOM   7073  O  OE1   . GLU D 4  63  ? -29.597 -5.175  51.600 1.00 70.63  ? 63  GLU B OE1   1 
ATOM   7074  O  OE2   . GLU D 4  63  ? -31.257 -3.756  51.843 1.00 75.07  ? 63  GLU B OE2   1 
ATOM   7075  N  N     . ASN D 4  64  ? -29.581 -8.455  47.439 1.00 53.06  ? 64  ASN B N     1 
ATOM   7076  C  CA    . ASN D 4  64  ? -28.498 -8.970  46.628 1.00 49.98  ? 64  ASN B CA    1 
ATOM   7077  C  C     . ASN D 4  64  ? -29.023 -9.541  45.345 1.00 48.36  ? 64  ASN B C     1 
ATOM   7078  O  O     . ASN D 4  64  ? -28.459 -9.332  44.280 1.00 47.41  ? 64  ASN B O     1 
ATOM   7079  C  CB    . ASN D 4  64  ? -27.666 -9.973  47.402 1.00 51.05  ? 64  ASN B CB    1 
ATOM   7080  C  CG    . ASN D 4  64  ? -26.643 -9.292  48.267 1.00 57.33  ? 64  ASN B CG    1 
ATOM   7081  O  OD1   . ASN D 4  64  ? -25.812 -8.539  47.772 1.00 76.24  ? 64  ASN B OD1   1 
ATOM   7082  N  ND2   . ASN D 4  64  ? -26.703 -9.519  49.552 1.00 64.30  ? 64  ASN B ND2   1 
ATOM   7083  N  N     . VAL D 4  65  ? -30.137 -10.237 45.447 1.00 49.21  ? 65  VAL B N     1 
ATOM   7084  C  CA    . VAL D 4  65  ? -30.667 -10.918 44.295 1.00 50.12  ? 65  VAL B CA    1 
ATOM   7085  C  C     . VAL D 4  65  ? -31.420 -9.973  43.397 1.00 53.26  ? 65  VAL B C     1 
ATOM   7086  O  O     . VAL D 4  65  ? -31.281 -10.033 42.166 1.00 53.02  ? 65  VAL B O     1 
ATOM   7087  C  CB    . VAL D 4  65  ? -31.562 -12.059 44.716 1.00 48.51  ? 65  VAL B CB    1 
ATOM   7088  C  CG1   . VAL D 4  65  ? -32.161 -12.725 43.511 1.00 48.22  ? 65  VAL B CG1   1 
ATOM   7089  C  CG2   . VAL D 4  65  ? -30.728 -13.072 45.488 1.00 53.11  ? 65  VAL B CG2   1 
ATOM   7090  N  N     . ILE D 4  66  ? -32.203 -9.084  44.002 1.00 60.78  ? 66  ILE B N     1 
ATOM   7091  C  CA    . ILE D 4  66  ? -33.054 -8.203  43.210 1.00 60.70  ? 66  ILE B CA    1 
ATOM   7092  C  C     . ILE D 4  66  ? -32.178 -7.270  42.406 1.00 57.04  ? 66  ILE B C     1 
ATOM   7093  O  O     . ILE D 4  66  ? -32.404 -7.089  41.206 1.00 49.41  ? 66  ILE B O     1 
ATOM   7094  C  CB    . ILE D 4  66  ? -34.066 -7.431  44.064 1.00 63.43  ? 66  ILE B CB    1 
ATOM   7095  C  CG1   . ILE D 4  66  ? -35.122 -8.401  44.592 1.00 60.67  ? 66  ILE B CG1   1 
ATOM   7096  C  CG2   . ILE D 4  66  ? -34.768 -6.377  43.223 1.00 65.66  ? 66  ILE B CG2   1 
ATOM   7097  C  CD1   . ILE D 4  66  ? -35.974 -7.839  45.710 1.00 60.30  ? 66  ILE B CD1   1 
ATOM   7098  N  N     . ARG D 4  67  ? -31.165 -6.716  43.066 1.00 51.94  ? 67  ARG B N     1 
ATOM   7099  C  CA    . ARG D 4  67  ? -30.192 -5.881  42.393 1.00 49.40  ? 67  ARG B CA    1 
ATOM   7100  C  C     . ARG D 4  67  ? -29.761 -6.526  41.090 1.00 49.54  ? 67  ARG B C     1 
ATOM   7101  O  O     . ARG D 4  67  ? -29.808 -5.887  40.048 1.00 55.24  ? 67  ARG B O     1 
ATOM   7102  C  CB    . ARG D 4  67  ? -28.986 -5.645  43.291 1.00 53.00  ? 67  ARG B CB    1 
ATOM   7103  C  CG    . ARG D 4  67  ? -27.880 -4.824  42.641 1.00 59.96  ? 67  ARG B CG    1 
ATOM   7104  C  CD    . ARG D 4  67  ? -26.556 -4.835  43.436 1.00 64.17  ? 67  ARG B CD    1 
ATOM   7105  N  NE    . ARG D 4  67  ? -26.664 -4.150  44.733 1.00 76.36  ? 67  ARG B NE    1 
ATOM   7106  C  CZ    . ARG D 4  67  ? -26.567 -4.726  45.940 1.00 83.70  ? 67  ARG B CZ    1 
ATOM   7107  N  NH1   . ARG D 4  67  ? -26.347 -6.037  46.089 1.00 94.30  ? 67  ARG B NH1   1 
ATOM   7108  N  NH2   . ARG D 4  67  ? -26.688 -3.972  47.020 1.00 77.96  ? 67  ARG B NH2   1 
ATOM   7109  N  N     . ASP D 4  68  ? -29.354 -7.789  41.131 1.00 49.55  ? 68  ASP B N     1 
ATOM   7110  C  CA    . ASP D 4  68  ? -28.788 -8.405  39.935 1.00 51.18  ? 68  ASP B CA    1 
ATOM   7111  C  C     . ASP D 4  68  ? -29.919 -8.633  38.923 1.00 52.96  ? 68  ASP B C     1 
ATOM   7112  O  O     . ASP D 4  68  ? -29.723 -8.425  37.737 1.00 49.48  ? 68  ASP B O     1 
ATOM   7113  C  CB    . ASP D 4  68  ? -28.075 -9.732  40.247 1.00 52.81  ? 68  ASP B CB    1 
ATOM   7114  C  CG    . ASP D 4  68  ? -26.651 -9.561  40.817 1.00 55.36  ? 68  ASP B CG    1 
ATOM   7115  O  OD1   . ASP D 4  68  ? -26.233 -8.499  41.347 1.00 51.03  ? 68  ASP B OD1   1 
ATOM   7116  O  OD2   . ASP D 4  68  ? -25.929 -10.567 40.762 1.00 56.24  ? 68  ASP B OD2   1 
ATOM   7117  N  N     . ALA D 4  69  ? -31.106 -9.052  39.365 1.00 51.71  ? 69  ALA B N     1 
ATOM   7118  C  CA    . ALA D 4  69  ? -32.220 -9.291  38.393 1.00 57.02  ? 69  ALA B CA    1 
ATOM   7119  C  C     . ALA D 4  69  ? -32.592 -8.010  37.696 1.00 58.43  ? 69  ALA B C     1 
ATOM   7120  O  O     . ALA D 4  69  ? -32.738 -7.948  36.480 1.00 65.19  ? 69  ALA B O     1 
ATOM   7121  C  CB    . ALA D 4  69  ? -33.460 -9.866  39.064 1.00 57.13  ? 69  ALA B CB    1 
ATOM   7122  N  N     . VAL D 4  70  ? -32.721 -6.966  38.479 1.00 58.08  ? 70  VAL B N     1 
ATOM   7123  C  CA    . VAL D 4  70  ? -33.049 -5.692  37.909 1.00 61.17  ? 70  VAL B CA    1 
ATOM   7124  C  C     . VAL D 4  70  ? -31.983 -5.294  36.931 1.00 58.33  ? 70  VAL B C     1 
ATOM   7125  O  O     . VAL D 4  70  ? -32.302 -4.899  35.838 1.00 65.35  ? 70  VAL B O     1 
ATOM   7126  C  CB    . VAL D 4  70  ? -33.176 -4.615  38.985 1.00 62.11  ? 70  VAL B CB    1 
ATOM   7127  C  CG1   . VAL D 4  70  ? -33.138 -3.223  38.356 1.00 58.31  ? 70  VAL B CG1   1 
ATOM   7128  C  CG2   . VAL D 4  70  ? -34.455 -4.854  39.787 1.00 59.21  ? 70  VAL B CG2   1 
ATOM   7129  N  N     . THR D 4  71  ? -30.722 -5.403  37.318 1.00 54.44  ? 71  THR B N     1 
ATOM   7130  C  CA    . THR D 4  71  ? -29.646 -5.091  36.401 1.00 50.37  ? 71  THR B CA    1 
ATOM   7131  C  C     . THR D 4  71  ? -29.793 -5.851  35.105 1.00 51.65  ? 71  THR B C     1 
ATOM   7132  O  O     . THR D 4  71  ? -29.353 -5.385  34.072 1.00 51.19  ? 71  THR B O     1 
ATOM   7133  C  CB    . THR D 4  71  ? -28.298 -5.439  37.013 1.00 51.99  ? 71  THR B CB    1 
ATOM   7134  O  OG1   . THR D 4  71  ? -28.040 -4.560  38.105 1.00 57.60  ? 71  THR B OG1   1 
ATOM   7135  C  CG2   . THR D 4  71  ? -27.175 -5.303  35.998 1.00 56.70  ? 71  THR B CG2   1 
ATOM   7136  N  N     . TYR D 4  72  ? -30.376 -7.045  35.158 1.00 55.03  ? 72  TYR B N     1 
ATOM   7137  C  CA    . TYR D 4  72  ? -30.683 -7.767  33.930 1.00 56.08  ? 72  TYR B CA    1 
ATOM   7138  C  C     . TYR D 4  72  ? -31.827 -7.113  33.203 1.00 57.73  ? 72  TYR B C     1 
ATOM   7139  O  O     . TYR D 4  72  ? -31.801 -7.053  31.975 1.00 56.45  ? 72  TYR B O     1 
ATOM   7140  C  CB    . TYR D 4  72  ? -31.068 -9.213  34.202 1.00 57.72  ? 72  TYR B CB    1 
ATOM   7141  C  CG    . TYR D 4  72  ? -29.896 -10.093 34.410 1.00 53.77  ? 72  TYR B CG    1 
ATOM   7142  C  CD1   . TYR D 4  72  ? -29.711 -10.750 35.597 1.00 58.46  ? 72  TYR B CD1   1 
ATOM   7143  C  CD2   . TYR D 4  72  ? -28.973 -10.270 33.417 1.00 51.58  ? 72  TYR B CD2   1 
ATOM   7144  C  CE1   . TYR D 4  72  ? -28.621 -11.571 35.794 1.00 57.57  ? 72  TYR B CE1   1 
ATOM   7145  C  CE2   . TYR D 4  72  ? -27.883 -11.078 33.607 1.00 56.88  ? 72  TYR B CE2   1 
ATOM   7146  C  CZ    . TYR D 4  72  ? -27.708 -11.719 34.808 1.00 50.49  ? 72  TYR B CZ    1 
ATOM   7147  O  OH    . TYR D 4  72  ? -26.613 -12.510 34.999 1.00 44.12  ? 72  TYR B OH    1 
ATOM   7148  N  N     . THR D 4  73  ? -32.837 -6.680  33.963 1.00 56.28  ? 73  THR B N     1 
ATOM   7149  C  CA    . THR D 4  73  ? -33.973 -5.958  33.397 1.00 60.03  ? 73  THR B CA    1 
ATOM   7150  C  C     . THR D 4  73  ? -33.454 -4.737  32.638 1.00 62.93  ? 73  THR B C     1 
ATOM   7151  O  O     . THR D 4  73  ? -33.598 -4.673  31.427 1.00 73.81  ? 73  THR B O     1 
ATOM   7152  C  CB    . THR D 4  73  ? -35.003 -5.545  34.464 1.00 58.02  ? 73  THR B CB    1 
ATOM   7153  O  OG1   . THR D 4  73  ? -35.363 -6.672  35.264 1.00 60.01  ? 73  THR B OG1   1 
ATOM   7154  C  CG2   . THR D 4  73  ? -36.252 -5.077  33.811 1.00 63.09  ? 73  THR B CG2   1 
ATOM   7155  N  N     . GLU D 4  74  ? -32.789 -3.815  33.330 1.00 70.78  ? 74  GLU B N     1 
ATOM   7156  C  CA    . GLU D 4  74  ? -32.221 -2.605  32.702 1.00 74.63  ? 74  GLU B CA    1 
ATOM   7157  C  C     . GLU D 4  74  ? -31.432 -2.939  31.457 1.00 73.35  ? 74  GLU B C     1 
ATOM   7158  O  O     . GLU D 4  74  ? -31.482 -2.191  30.483 1.00 83.00  ? 74  GLU B O     1 
ATOM   7159  C  CB    . GLU D 4  74  ? -31.308 -1.793  33.649 1.00 76.40  ? 74  GLU B CB    1 
ATOM   7160  C  CG    . GLU D 4  74  ? -32.047 -0.919  34.659 1.00 86.69  ? 74  GLU B CG    1 
ATOM   7161  C  CD    . GLU D 4  74  ? -31.210 0.239   35.215 1.00 101.29 ? 74  GLU B CD    1 
ATOM   7162  O  OE1   . GLU D 4  74  ? -31.003 1.233   34.474 1.00 104.62 ? 74  GLU B OE1   1 
ATOM   7163  O  OE2   . GLU D 4  74  ? -30.793 0.177   36.404 1.00 92.16  ? 74  GLU B OE2   1 
ATOM   7164  N  N     . HIS D 4  75  ? -30.710 -4.052  31.464 1.00 70.19  ? 75  HIS B N     1 
ATOM   7165  C  CA    . HIS D 4  75  ? -29.882 -4.351  30.311 1.00 70.43  ? 75  HIS B CA    1 
ATOM   7166  C  C     . HIS D 4  75  ? -30.742 -4.630  29.104 1.00 71.07  ? 75  HIS B C     1 
ATOM   7167  O  O     . HIS D 4  75  ? -30.457 -4.152  28.019 1.00 72.84  ? 75  HIS B O     1 
ATOM   7168  C  CB    . HIS D 4  75  ? -28.929 -5.516  30.533 1.00 67.90  ? 75  HIS B CB    1 
ATOM   7169  C  CG    . HIS D 4  75  ? -27.980 -5.719  29.392 1.00 65.41  ? 75  HIS B CG    1 
ATOM   7170  N  ND1   . HIS D 4  75  ? -26.750 -5.099  29.330 1.00 58.94  ? 75  HIS B ND1   1 
ATOM   7171  C  CD2   . HIS D 4  75  ? -28.101 -6.434  28.246 1.00 64.30  ? 75  HIS B CD2   1 
ATOM   7172  C  CE1   . HIS D 4  75  ? -26.144 -5.438  28.201 1.00 61.30  ? 75  HIS B CE1   1 
ATOM   7173  N  NE2   . HIS D 4  75  ? -26.941 -6.250  27.527 1.00 59.55  ? 75  HIS B NE2   1 
ATOM   7174  N  N     . ALA D 4  76  ? -31.808 -5.389  29.293 1.00 71.26  ? 76  ALA B N     1 
ATOM   7175  C  CA    . ALA D 4  76  ? -32.653 -5.751  28.174 1.00 73.10  ? 76  ALA B CA    1 
ATOM   7176  C  C     . ALA D 4  76  ? -33.563 -4.578  27.756 1.00 76.08  ? 76  ALA B C     1 
ATOM   7177  O  O     . ALA D 4  76  ? -34.308 -4.695  26.784 1.00 73.13  ? 76  ALA B O     1 
ATOM   7178  C  CB    . ALA D 4  76  ? -33.465 -6.990  28.515 1.00 68.74  ? 76  ALA B CB    1 
ATOM   7179  N  N     . LYS D 4  77  ? -33.474 -3.455  28.475 1.00 76.77  ? 77  LYS B N     1 
ATOM   7180  C  CA    . LYS D 4  77  ? -34.341 -2.276  28.264 1.00 80.21  ? 77  LYS B CA    1 
ATOM   7181  C  C     . LYS D 4  77  ? -35.822 -2.622  28.473 1.00 74.32  ? 77  LYS B C     1 
ATOM   7182  O  O     . LYS D 4  77  ? -36.648 -2.381  27.604 1.00 77.52  ? 77  LYS B O     1 
ATOM   7183  C  CB    . LYS D 4  77  ? -34.135 -1.650  26.876 1.00 79.01  ? 77  LYS B CB    1 
ATOM   7184  C  CG    . LYS D 4  77  ? -32.723 -1.170  26.575 1.00 85.17  ? 77  LYS B CG    1 
ATOM   7185  C  CD    . LYS D 4  77  ? -32.358 -1.516  25.131 1.00 92.42  ? 77  LYS B CD    1 
ATOM   7186  C  CE    . LYS D 4  77  ? -31.194 -0.693  24.585 1.00 94.45  ? 77  LYS B CE    1 
ATOM   7187  N  NZ    . LYS D 4  77  ? -30.849 -1.097  23.182 1.00 92.76  ? 77  LYS B NZ    1 
ATOM   7188  N  N     . ARG D 4  78  ? -36.146 -3.189  29.629 1.00 65.22  ? 78  ARG B N     1 
ATOM   7189  C  CA    . ARG D 4  78  ? -37.508 -3.523  29.956 1.00 64.57  ? 78  ARG B CA    1 
ATOM   7190  C  C     . ARG D 4  78  ? -37.909 -2.725  31.176 1.00 65.04  ? 78  ARG B C     1 
ATOM   7191  O  O     . ARG D 4  78  ? -37.070 -2.103  31.777 1.00 63.76  ? 78  ARG B O     1 
ATOM   7192  C  CB    . ARG D 4  78  ? -37.627 -5.021  30.189 1.00 70.86  ? 78  ARG B CB    1 
ATOM   7193  C  CG    . ARG D 4  78  ? -37.694 -5.808  28.887 1.00 75.52  ? 78  ARG B CG    1 
ATOM   7194  C  CD    . ARG D 4  78  ? -37.997 -7.289  29.085 1.00 76.02  ? 78  ARG B CD    1 
ATOM   7195  N  NE    . ARG D 4  78  ? -36.770 -8.059  29.296 1.00 79.17  ? 78  ARG B NE    1 
ATOM   7196  C  CZ    . ARG D 4  78  ? -36.257 -8.396  30.482 1.00 75.88  ? 78  ARG B CZ    1 
ATOM   7197  N  NH1   . ARG D 4  78  ? -36.849 -8.078  31.636 1.00 72.85  ? 78  ARG B NH1   1 
ATOM   7198  N  NH2   . ARG D 4  78  ? -35.122 -9.070  30.506 1.00 83.00  ? 78  ARG B NH2   1 
ATOM   7199  N  N     . LYS D 4  79  ? -39.203 -2.665  31.469 1.00 74.15  ? 79  LYS B N     1 
ATOM   7200  C  CA    . LYS D 4  79  ? -39.734 -2.009  32.665 1.00 78.45  ? 79  LYS B CA    1 
ATOM   7201  C  C     . LYS D 4  79  ? -40.273 -3.093  33.570 1.00 78.40  ? 79  LYS B C     1 
ATOM   7202  O  O     . LYS D 4  79  ? -40.737 -2.814  34.686 1.00 78.80  ? 79  LYS B O     1 
ATOM   7203  C  CB    . LYS D 4  79  ? -40.902 -1.070  32.306 1.00 91.53  ? 79  LYS B CB    1 
ATOM   7204  C  CG    . LYS D 4  79  ? -40.542 0.233   31.597 1.00 98.18  ? 79  LYS B CG    1 
ATOM   7205  C  CD    . LYS D 4  79  ? -41.635 1.282   31.819 1.00 102.08 ? 79  LYS B CD    1 
ATOM   7206  C  CE    . LYS D 4  79  ? -41.074 2.689   32.002 1.00 105.47 ? 79  LYS B CE    1 
ATOM   7207  N  NZ    . LYS D 4  79  ? -41.830 3.436   33.051 1.00 104.74 ? 79  LYS B NZ    1 
ATOM   7208  N  N     . THR D 4  80  ? -40.247 -4.322  33.053 1.00 77.01  ? 80  THR B N     1 
ATOM   7209  C  CA    . THR D 4  80  ? -40.811 -5.484  33.716 1.00 79.92  ? 80  THR B CA    1 
ATOM   7210  C  C     . THR D 4  80  ? -39.688 -6.466  34.069 1.00 76.79  ? 80  THR B C     1 
ATOM   7211  O  O     . THR D 4  80  ? -38.934 -6.912  33.184 1.00 65.13  ? 80  THR B O     1 
ATOM   7212  C  CB    . THR D 4  80  ? -41.804 -6.238  32.807 1.00 82.42  ? 80  THR B CB    1 
ATOM   7213  O  OG1   . THR D 4  80  ? -42.529 -5.324  31.965 1.00 87.54  ? 80  THR B OG1   1 
ATOM   7214  C  CG2   . THR D 4  80  ? -42.758 -7.060  33.662 1.00 82.71  ? 80  THR B CG2   1 
ATOM   7215  N  N     . VAL D 4  81  ? -39.582 -6.807  35.352 1.00 69.36  ? 81  VAL B N     1 
ATOM   7216  C  CA    . VAL D 4  81  ? -38.615 -7.813  35.788 1.00 68.60  ? 81  VAL B CA    1 
ATOM   7217  C  C     . VAL D 4  81  ? -39.197 -9.168  35.484 1.00 61.60  ? 81  VAL B C     1 
ATOM   7218  O  O     . VAL D 4  81  ? -40.232 -9.489  36.042 1.00 58.97  ? 81  VAL B O     1 
ATOM   7219  C  CB    . VAL D 4  81  ? -38.339 -7.726  37.293 1.00 67.75  ? 81  VAL B CB    1 
ATOM   7220  C  CG1   . VAL D 4  81  ? -37.448 -8.866  37.735 1.00 67.19  ? 81  VAL B CG1   1 
ATOM   7221  C  CG2   . VAL D 4  81  ? -37.686 -6.399  37.621 1.00 67.31  ? 81  VAL B CG2   1 
ATOM   7222  N  N     . THR D 4  82  ? -38.544 -9.939  34.603 1.00 65.55  ? 82  THR B N     1 
ATOM   7223  C  CA    . THR D 4  82  ? -39.027 -11.285 34.195 1.00 68.96  ? 82  THR B CA    1 
ATOM   7224  C  C     . THR D 4  82  ? -38.612 -12.353 35.176 1.00 63.80  ? 82  THR B C     1 
ATOM   7225  O  O     . THR D 4  82  ? -37.731 -12.156 35.976 1.00 60.69  ? 82  THR B O     1 
ATOM   7226  C  CB    . THR D 4  82  ? -38.449 -11.754 32.846 1.00 68.32  ? 82  THR B CB    1 
ATOM   7227  O  OG1   . THR D 4  82  ? -37.041 -11.968 32.971 1.00 77.53  ? 82  THR B OG1   1 
ATOM   7228  C  CG2   . THR D 4  82  ? -38.682 -10.740 31.773 1.00 74.24  ? 82  THR B CG2   1 
ATOM   7229  N  N     . ALA D 4  83  ? -39.236 -13.508 35.096 1.00 66.99  ? 83  ALA B N     1 
ATOM   7230  C  CA    . ALA D 4  83  ? -38.765 -14.631 35.879 1.00 62.92  ? 83  ALA B CA    1 
ATOM   7231  C  C     . ALA D 4  83  ? -37.326 -14.990 35.486 1.00 61.61  ? 83  ALA B C     1 
ATOM   7232  O  O     . ALA D 4  83  ? -36.506 -15.255 36.364 1.00 71.23  ? 83  ALA B O     1 
ATOM   7233  C  CB    . ALA D 4  83  ? -39.681 -15.815 35.700 1.00 65.61  ? 83  ALA B CB    1 
ATOM   7234  N  N     . MET D 4  84  ? -37.002 -14.972 34.197 1.00 51.74  ? 84  MET B N     1 
ATOM   7235  C  CA    . MET D 4  84  ? -35.628 -15.234 33.771 1.00 55.26  ? 84  MET B CA    1 
ATOM   7236  C  C     . MET D 4  84  ? -34.592 -14.278 34.382 1.00 59.85  ? 84  MET B C     1 
ATOM   7237  O  O     . MET D 4  84  ? -33.509 -14.714 34.788 1.00 57.23  ? 84  MET B O     1 
ATOM   7238  C  CB    . MET D 4  84  ? -35.507 -15.184 32.265 1.00 53.74  ? 84  MET B CB    1 
ATOM   7239  C  CG    . MET D 4  84  ? -36.312 -16.269 31.586 1.00 58.33  ? 84  MET B CG    1 
ATOM   7240  S  SD    . MET D 4  84  ? -36.004 -17.895 32.298 1.00 63.49  ? 84  MET B SD    1 
ATOM   7241  C  CE    . MET D 4  84  ? -34.469 -18.360 31.473 1.00 63.93  ? 84  MET B CE    1 
ATOM   7242  N  N     . ASP D 4  85  ? -34.919 -12.991 34.462 1.00 60.94  ? 85  ASP B N     1 
ATOM   7243  C  CA    . ASP D 4  85  ? -34.037 -12.035 35.135 1.00 62.25  ? 85  ASP B CA    1 
ATOM   7244  C  C     . ASP D 4  85  ? -33.698 -12.602 36.494 1.00 60.90  ? 85  ASP B C     1 
ATOM   7245  O  O     . ASP D 4  85  ? -32.568 -12.473 36.973 1.00 61.74  ? 85  ASP B O     1 
ATOM   7246  C  CB    . ASP D 4  85  ? -34.693 -10.657 35.371 1.00 63.81  ? 85  ASP B CB    1 
ATOM   7247  C  CG    . ASP D 4  85  ? -34.891 -9.843  34.092 1.00 65.50  ? 85  ASP B CG    1 
ATOM   7248  O  OD1   . ASP D 4  85  ? -34.183 -10.084 33.089 1.00 57.92  ? 85  ASP B OD1   1 
ATOM   7249  O  OD2   . ASP D 4  85  ? -35.761 -8.935  34.114 1.00 66.39  ? 85  ASP B OD2   1 
ATOM   7250  N  N     . VAL D 4  86  ? -34.694 -13.204 37.132 1.00 56.94  ? 86  VAL B N     1 
ATOM   7251  C  CA    . VAL D 4  86  ? -34.558 -13.640 38.533 1.00 54.27  ? 86  VAL B CA    1 
ATOM   7252  C  C     . VAL D 4  86  ? -33.776 -14.924 38.622 1.00 53.25  ? 86  VAL B C     1 
ATOM   7253  O  O     . VAL D 4  86  ? -32.915 -15.086 39.472 1.00 56.11  ? 86  VAL B O     1 
ATOM   7254  C  CB    . VAL D 4  86  ? -35.927 -13.881 39.141 1.00 50.20  ? 86  VAL B CB    1 
ATOM   7255  C  CG1   . VAL D 4  86  ? -35.827 -14.739 40.371 1.00 55.28  ? 86  VAL B CG1   1 
ATOM   7256  C  CG2   . VAL D 4  86  ? -36.589 -12.547 39.446 1.00 50.00  ? 86  VAL B CG2   1 
ATOM   7257  N  N     . VAL D 4  87  ? -34.094 -15.826 37.717 1.00 50.74  ? 87  VAL B N     1 
ATOM   7258  C  CA    . VAL D 4  87  ? -33.488 -17.132 37.697 1.00 52.69  ? 87  VAL B CA    1 
ATOM   7259  C  C     . VAL D 4  87  ? -32.006 -17.018 37.363 1.00 54.27  ? 87  VAL B C     1 
ATOM   7260  O  O     . VAL D 4  87  ? -31.154 -17.691 37.955 1.00 47.00  ? 87  VAL B O     1 
ATOM   7261  C  CB    . VAL D 4  87  ? -34.204 -17.994 36.660 1.00 51.93  ? 87  VAL B CB    1 
ATOM   7262  C  CG1   . VAL D 4  87  ? -33.372 -19.223 36.296 1.00 51.78  ? 87  VAL B CG1   1 
ATOM   7263  C  CG2   . VAL D 4  87  ? -35.603 -18.351 37.172 1.00 48.81  ? 87  VAL B CG2   1 
ATOM   7264  N  N     . TYR D 4  88  ? -31.724 -16.142 36.421 1.00 50.35  ? 88  TYR B N     1 
ATOM   7265  C  CA    . TYR D 4  88  ? -30.389 -15.851 36.083 1.00 50.82  ? 88  TYR B CA    1 
ATOM   7266  C  C     . TYR D 4  88  ? -29.661 -15.251 37.273 1.00 52.02  ? 88  TYR B C     1 
ATOM   7267  O  O     . TYR D 4  88  ? -28.457 -15.444 37.417 1.00 61.78  ? 88  TYR B O     1 
ATOM   7268  C  CB    . TYR D 4  88  ? -30.350 -14.862 34.906 1.00 54.68  ? 88  TYR B CB    1 
ATOM   7269  C  CG    . TYR D 4  88  ? -30.766 -15.442 33.570 1.00 57.47  ? 88  TYR B CG    1 
ATOM   7270  C  CD1   . TYR D 4  88  ? -31.425 -14.679 32.646 1.00 55.47  ? 88  TYR B CD1   1 
ATOM   7271  C  CD2   . TYR D 4  88  ? -30.499 -16.770 33.242 1.00 67.00  ? 88  TYR B CD2   1 
ATOM   7272  C  CE1   . TYR D 4  88  ? -31.816 -15.200 31.432 1.00 63.71  ? 88  TYR B CE1   1 
ATOM   7273  C  CE2   . TYR D 4  88  ? -30.879 -17.299 32.023 1.00 69.59  ? 88  TYR B CE2   1 
ATOM   7274  C  CZ    . TYR D 4  88  ? -31.538 -16.507 31.123 1.00 66.69  ? 88  TYR B CZ    1 
ATOM   7275  O  OH    . TYR D 4  88  ? -31.892 -17.030 29.903 1.00 73.31  ? 88  TYR B OH    1 
ATOM   7276  N  N     . ALA D 4  89  ? -30.352 -14.494 38.112 1.00 50.06  ? 89  ALA B N     1 
ATOM   7277  C  CA    . ALA D 4  89  ? -29.647 -13.755 39.176 1.00 49.44  ? 89  ALA B CA    1 
ATOM   7278  C  C     . ALA D 4  89  ? -29.344 -14.740 40.232 1.00 48.28  ? 89  ALA B C     1 
ATOM   7279  O  O     . ALA D 4  89  ? -28.275 -14.759 40.824 1.00 47.09  ? 89  ALA B O     1 
ATOM   7280  C  CB    . ALA D 4  89  ? -30.504 -12.653 39.771 1.00 48.95  ? 89  ALA B CB    1 
ATOM   7281  N  N     . LEU D 4  90  ? -30.338 -15.548 40.495 1.00 47.10  ? 90  LEU B N     1 
ATOM   7282  C  CA    . LEU D 4  90  ? -30.176 -16.588 41.454 1.00 48.64  ? 90  LEU B CA    1 
ATOM   7283  C  C     . LEU D 4  90  ? -28.973 -17.441 41.076 1.00 52.02  ? 90  LEU B C     1 
ATOM   7284  O  O     . LEU D 4  90  ? -28.133 -17.756 41.934 1.00 49.45  ? 90  LEU B O     1 
ATOM   7285  C  CB    . LEU D 4  90  ? -31.440 -17.411 41.474 1.00 48.16  ? 90  LEU B CB    1 
ATOM   7286  C  CG    . LEU D 4  90  ? -32.551 -16.725 42.264 1.00 50.27  ? 90  LEU B CG    1 
ATOM   7287  C  CD1   . LEU D 4  90  ? -33.880 -17.417 42.055 1.00 51.97  ? 90  LEU B CD1   1 
ATOM   7288  C  CD2   . LEU D 4  90  ? -32.216 -16.701 43.747 1.00 52.43  ? 90  LEU B CD2   1 
ATOM   7289  N  N     . LYS D 4  91  ? -28.872 -17.759 39.787 1.00 47.23  ? 91  LYS B N     1 
ATOM   7290  C  CA    . LYS D 4  91  ? -27.826 -18.636 39.334 1.00 49.02  ? 91  LYS B CA    1 
ATOM   7291  C  C     . LYS D 4  91  ? -26.496 -18.054 39.628 1.00 48.93  ? 91  LYS B C     1 
ATOM   7292  O  O     . LYS D 4  91  ? -25.645 -18.748 40.159 1.00 54.98  ? 91  LYS B O     1 
ATOM   7293  C  CB    . LYS D 4  91  ? -27.888 -18.949 37.842 1.00 51.90  ? 91  LYS B CB    1 
ATOM   7294  C  CG    . LYS D 4  91  ? -26.859 -20.014 37.463 1.00 57.87  ? 91  LYS B CG    1 
ATOM   7295  C  CD    . LYS D 4  91  ? -27.322 -20.963 36.352 1.00 64.71  ? 91  LYS B CD    1 
ATOM   7296  C  CE    . LYS D 4  91  ? -27.228 -20.334 34.961 1.00 74.00  ? 91  LYS B CE    1 
ATOM   7297  N  NZ    . LYS D 4  91  ? -28.197 -20.937 34.003 1.00 79.56  ? 91  LYS B NZ    1 
ATOM   7298  N  N     . ARG D 4  92  ? -26.280 -16.787 39.319 1.00 49.18  ? 92  ARG B N     1 
ATOM   7299  C  CA    . ARG D 4  92  ? -24.906 -16.269 39.510 1.00 51.25  ? 92  ARG B CA    1 
ATOM   7300  C  C     . ARG D 4  92  ? -24.579 -16.024 40.971 1.00 49.86  ? 92  ARG B C     1 
ATOM   7301  O  O     . ARG D 4  92  ? -23.411 -15.921 41.293 1.00 52.69  ? 92  ARG B O     1 
ATOM   7302  C  CB    . ARG D 4  92  ? -24.614 -15.011 38.700 1.00 49.07  ? 92  ARG B CB    1 
ATOM   7303  C  CG    . ARG D 4  92  ? -25.401 -13.788 39.149 1.00 50.96  ? 92  ARG B CG    1 
ATOM   7304  C  CD    . ARG D 4  92  ? -25.054 -12.580 38.306 1.00 50.47  ? 92  ARG B CD    1 
ATOM   7305  N  NE    . ARG D 4  92  ? -23.609 -12.421 38.267 1.00 50.59  ? 92  ARG B NE    1 
ATOM   7306  C  CZ    . ARG D 4  92  ? -22.881 -11.915 39.245 1.00 48.03  ? 92  ARG B CZ    1 
ATOM   7307  N  NH1   . ARG D 4  92  ? -23.451 -11.486 40.357 1.00 52.13  ? 92  ARG B NH1   1 
ATOM   7308  N  NH2   . ARG D 4  92  ? -21.574 -11.828 39.105 1.00 51.83  ? 92  ARG B NH2   1 
ATOM   7309  N  N     . GLN D 4  93  ? -25.595 -15.934 41.837 1.00 47.29  ? 93  GLN B N     1 
ATOM   7310  C  CA    . GLN D 4  93  ? -25.379 -15.837 43.272 1.00 46.81  ? 93  GLN B CA    1 
ATOM   7311  C  C     . GLN D 4  93  ? -25.183 -17.208 43.853 1.00 44.62  ? 93  GLN B C     1 
ATOM   7312  O  O     . GLN D 4  93  ? -25.317 -17.328 45.050 1.00 44.64  ? 93  GLN B O     1 
ATOM   7313  C  CB    . GLN D 4  93  ? -26.639 -15.340 44.002 1.00 56.27  ? 93  GLN B CB    1 
ATOM   7314  C  CG    . GLN D 4  93  ? -27.154 -13.970 43.651 1.00 57.51  ? 93  GLN B CG    1 
ATOM   7315  C  CD    . GLN D 4  93  ? -26.240 -12.875 44.115 1.00 63.28  ? 93  GLN B CD    1 
ATOM   7316  O  OE1   . GLN D 4  93  ? -25.678 -12.926 45.212 1.00 65.61  ? 93  GLN B OE1   1 
ATOM   7317  N  NE2   . GLN D 4  93  ? -26.087 -11.858 43.279 1.00 68.16  ? 93  GLN B NE2   1 
ATOM   7318  N  N     . GLY D 4  94  ? -24.991 -18.253 43.048 1.00 41.54  ? 94  GLY B N     1 
ATOM   7319  C  CA    . GLY D 4  94  ? -24.921 -19.598 43.578 1.00 41.26  ? 94  GLY B CA    1 
ATOM   7320  C  C     . GLY D 4  94  ? -26.210 -20.233 44.135 1.00 48.56  ? 94  GLY B C     1 
ATOM   7321  O  O     . GLY D 4  94  ? -26.174 -21.192 44.930 1.00 48.42  ? 94  GLY B O     1 
ATOM   7322  N  N     . ARG D 4  95  ? -27.361 -19.732 43.726 1.00 51.03  ? 95  ARG B N     1 
ATOM   7323  C  CA    . ARG D 4  95  ? -28.583 -20.239 44.273 1.00 51.79  ? 95  ARG B CA    1 
ATOM   7324  C  C     . ARG D 4  95  ? -29.497 -20.783 43.161 1.00 49.89  ? 95  ARG B C     1 
ATOM   7325  O  O     . ARG D 4  95  ? -30.674 -20.480 43.114 1.00 55.65  ? 95  ARG B O     1 
ATOM   7326  C  CB    . ARG D 4  95  ? -29.260 -19.140 45.096 1.00 55.45  ? 95  ARG B CB    1 
ATOM   7327  C  CG    . ARG D 4  95  ? -28.366 -18.425 46.112 1.00 59.47  ? 95  ARG B CG    1 
ATOM   7328  C  CD    . ARG D 4  95  ? -28.311 -19.004 47.531 1.00 63.48  ? 95  ARG B CD    1 
ATOM   7329  N  NE    . ARG D 4  95  ? -29.502 -19.764 47.917 1.00 74.15  ? 95  ARG B NE    1 
ATOM   7330  C  CZ    . ARG D 4  95  ? -29.536 -20.651 48.914 1.00 74.12  ? 95  ARG B CZ    1 
ATOM   7331  N  NH1   . ARG D 4  95  ? -28.453 -20.861 49.664 1.00 72.34  ? 95  ARG B NH1   1 
ATOM   7332  N  NH2   . ARG D 4  95  ? -30.667 -21.312 49.188 1.00 70.93  ? 95  ARG B NH2   1 
ATOM   7333  N  N     . THR D 4  96  ? -28.966 -21.645 42.300 1.00 51.71  ? 96  THR B N     1 
ATOM   7334  C  CA    . THR D 4  96  ? -29.702 -22.061 41.105 1.00 44.67  ? 96  THR B CA    1 
ATOM   7335  C  C     . THR D 4  96  ? -31.047 -22.531 41.504 1.00 44.82  ? 96  THR B C     1 
ATOM   7336  O  O     . THR D 4  96  ? -31.160 -23.363 42.394 1.00 48.25  ? 96  THR B O     1 
ATOM   7337  C  CB    . THR D 4  96  ? -29.010 -23.200 40.357 1.00 45.56  ? 96  THR B CB    1 
ATOM   7338  O  OG1   . THR D 4  96  ? -27.860 -22.704 39.662 1.00 47.64  ? 96  THR B OG1   1 
ATOM   7339  C  CG2   . THR D 4  96  ? -29.916 -23.773 39.338 1.00 48.84  ? 96  THR B CG2   1 
ATOM   7340  N  N     . LEU D 4  97  ? -32.079 -22.005 40.846 1.00 47.95  ? 97  LEU B N     1 
ATOM   7341  C  CA    . LEU D 4  97  ? -33.459 -22.423 41.116 1.00 46.37  ? 97  LEU B CA    1 
ATOM   7342  C  C     . LEU D 4  97  ? -34.022 -23.104 39.917 1.00 48.14  ? 97  LEU B C     1 
ATOM   7343  O  O     . LEU D 4  97  ? -33.832 -22.617 38.824 1.00 47.67  ? 97  LEU B O     1 
ATOM   7344  C  CB    . LEU D 4  97  ? -34.298 -21.211 41.379 1.00 44.51  ? 97  LEU B CB    1 
ATOM   7345  C  CG    . LEU D 4  97  ? -35.742 -21.468 41.790 1.00 46.31  ? 97  LEU B CG    1 
ATOM   7346  C  CD1   . LEU D 4  97  ? -35.807 -21.943 43.219 1.00 49.75  ? 97  LEU B CD1   1 
ATOM   7347  C  CD2   . LEU D 4  97  ? -36.552 -20.185 41.665 1.00 48.24  ? 97  LEU B CD2   1 
ATOM   7348  N  N     . TYR D 4  98  ? -34.776 -24.178 40.129 1.00 53.84  ? 98  TYR B N     1 
ATOM   7349  C  CA    . TYR D 4  98  ? -35.385 -24.963 39.037 1.00 51.99  ? 98  TYR B CA    1 
ATOM   7350  C  C     . TYR D 4  98  ? -36.889 -24.816 39.055 1.00 57.61  ? 98  TYR B C     1 
ATOM   7351  O  O     . TYR D 4  98  ? -37.506 -24.837 40.123 1.00 58.60  ? 98  TYR B O     1 
ATOM   7352  C  CB    . TYR D 4  98  ? -35.117 -26.430 39.288 1.00 51.35  ? 98  TYR B CB    1 
ATOM   7353  C  CG    . TYR D 4  98  ? -33.783 -26.995 38.874 1.00 46.87  ? 98  TYR B CG    1 
ATOM   7354  C  CD1   . TYR D 4  98  ? -32.756 -26.202 38.350 1.00 46.09  ? 98  TYR B CD1   1 
ATOM   7355  C  CD2   . TYR D 4  98  ? -33.547 -28.333 39.038 1.00 41.33  ? 98  TYR B CD2   1 
ATOM   7356  C  CE1   . TYR D 4  98  ? -31.546 -26.753 37.961 1.00 42.98  ? 98  TYR B CE1   1 
ATOM   7357  C  CE2   . TYR D 4  98  ? -32.352 -28.882 38.655 1.00 47.85  ? 98  TYR B CE2   1 
ATOM   7358  C  CZ    . TYR D 4  98  ? -31.351 -28.094 38.123 1.00 46.62  ? 98  TYR B CZ    1 
ATOM   7359  O  OH    . TYR D 4  98  ? -30.172 -28.719 37.791 1.00 43.47  ? 98  TYR B OH    1 
ATOM   7360  N  N     . GLY D 4  99  ? -37.491 -24.703 37.874 1.00 66.41  ? 99  GLY B N     1 
ATOM   7361  C  CA    . GLY D 4  99  ? -38.949 -24.598 37.771 1.00 61.68  ? 99  GLY B CA    1 
ATOM   7362  C  C     . GLY D 4  99  ? -39.526 -23.321 37.210 1.00 55.44  ? 99  GLY B C     1 
ATOM   7363  O  O     . GLY D 4  99  ? -40.719 -23.215 37.078 1.00 57.88  ? 99  GLY B O     1 
ATOM   7364  N  N     . PHE D 4  100 ? -38.709 -22.344 36.865 1.00 55.63  ? 100 PHE B N     1 
ATOM   7365  C  CA    . PHE D 4  100 ? -39.252 -21.134 36.297 1.00 51.71  ? 100 PHE B CA    1 
ATOM   7366  C  C     . PHE D 4  100 ? -38.604 -20.767 34.971 1.00 56.74  ? 100 PHE B C     1 
ATOM   7367  O  O     . PHE D 4  100 ? -38.590 -19.600 34.589 1.00 49.24  ? 100 PHE B O     1 
ATOM   7368  C  CB    . PHE D 4  100 ? -39.131 -20.018 37.298 1.00 51.05  ? 100 PHE B CB    1 
ATOM   7369  C  CG    . PHE D 4  100 ? -39.912 -20.269 38.551 1.00 58.14  ? 100 PHE B CG    1 
ATOM   7370  C  CD1   . PHE D 4  100 ? -39.382 -21.015 39.573 1.00 59.26  ? 100 PHE B CD1   1 
ATOM   7371  C  CD2   . PHE D 4  100 ? -41.202 -19.779 38.695 1.00 57.67  ? 100 PHE B CD2   1 
ATOM   7372  C  CE1   . PHE D 4  100 ? -40.127 -21.242 40.731 1.00 63.05  ? 100 PHE B CE1   1 
ATOM   7373  C  CE2   . PHE D 4  100 ? -41.943 -20.006 39.841 1.00 57.85  ? 100 PHE B CE2   1 
ATOM   7374  C  CZ    . PHE D 4  100 ? -41.413 -20.739 40.862 1.00 58.31  ? 100 PHE B CZ    1 
ATOM   7375  N  N     . GLY D 4  101 ? -38.119 -21.763 34.237 1.00 58.46  ? 101 GLY B N     1 
ATOM   7376  C  CA    . GLY D 4  101 ? -37.519 -21.494 32.935 1.00 62.39  ? 101 GLY B CA    1 
ATOM   7377  C  C     . GLY D 4  101 ? -36.015 -21.644 32.951 1.00 69.07  ? 101 GLY B C     1 
ATOM   7378  O  O     . GLY D 4  101 ? -35.424 -22.035 33.962 1.00 75.82  ? 101 GLY B O     1 
ATOM   7379  N  N     . GLY D 4  102 ? -35.397 -21.349 31.811 1.00 76.40  ? 102 GLY B N     1 
ATOM   7380  C  CA    . GLY D 4  102 ? -33.964 -21.537 31.638 1.00 70.59  ? 102 GLY B CA    1 
ATOM   7381  C  C     . GLY D 4  102 ? -33.598 -22.996 31.802 1.00 75.66  ? 102 GLY B C     1 
ATOM   7382  O  O     . GLY D 4  102 ? -32.418 -23.271 32.000 1.00 73.11  ? 102 GLY B O     1 
ATOM   7383  O  OXT   . GLY D 4  102 ? -34.453 -23.911 31.763 1.00 80.47  ? 102 GLY B OXT   1 
ATOM   7384  N  N     . ALA E 5  14  ? 0.874   6.018   12.884 1.00 96.29  ? 14  ALA C N     1 
ATOM   7385  C  CA    . ALA E 5  14  ? 0.412   4.730   13.487 1.00 99.15  ? 14  ALA C CA    1 
ATOM   7386  C  C     . ALA E 5  14  ? 0.247   4.885   14.997 1.00 97.18  ? 14  ALA C C     1 
ATOM   7387  O  O     . ALA E 5  14  ? 1.200   4.727   15.763 1.00 94.24  ? 14  ALA C O     1 
ATOM   7388  C  CB    . ALA E 5  14  ? 1.384   3.596   13.162 1.00 103.13 ? 14  ALA C CB    1 
ATOM   7389  N  N     . LYS E 5  15  ? -0.970  5.222   15.406 1.00 94.96  ? 15  LYS C N     1 
ATOM   7390  C  CA    . LYS E 5  15  ? -1.328  5.347   16.816 1.00 99.94  ? 15  LYS C CA    1 
ATOM   7391  C  C     . LYS E 5  15  ? -1.742  3.944   17.286 1.00 91.10  ? 15  LYS C C     1 
ATOM   7392  O  O     . LYS E 5  15  ? -2.503  3.281   16.578 1.00 89.66  ? 15  LYS C O     1 
ATOM   7393  C  CB    . LYS E 5  15  ? -2.532  6.299   16.955 1.00 111.31 ? 15  LYS C CB    1 
ATOM   7394  C  CG    . LYS E 5  15  ? -2.408  7.399   17.988 1.00 118.78 ? 15  LYS C CG    1 
ATOM   7395  C  CD    . LYS E 5  15  ? -1.395  8.421   17.532 1.00 122.95 ? 15  LYS C CD    1 
ATOM   7396  C  CE    . LYS E 5  15  ? -0.463  8.795   18.666 1.00 131.34 ? 15  LYS C CE    1 
ATOM   7397  N  NZ    . LYS E 5  15  ? 0.835   9.250   18.104 1.00 135.49 ? 15  LYS C NZ    1 
ATOM   7398  N  N     . THR E 5  16  ? -1.286  3.486   18.456 1.00 79.09  ? 16  THR C N     1 
ATOM   7399  C  CA    . THR E 5  16  ? -1.947  2.315   19.063 1.00 72.96  ? 16  THR C CA    1 
ATOM   7400  C  C     . THR E 5  16  ? -3.364  2.710   19.505 1.00 73.25  ? 16  THR C C     1 
ATOM   7401  O  O     . THR E 5  16  ? -3.726  3.895   19.624 1.00 74.72  ? 16  THR C O     1 
ATOM   7402  C  CB    . THR E 5  16  ? -1.244  1.711   20.299 1.00 63.59  ? 16  THR C CB    1 
ATOM   7403  O  OG1   . THR E 5  16  ? -1.256  2.662   21.378 1.00 65.81  ? 16  THR C OG1   1 
ATOM   7404  C  CG2   . THR E 5  16  ? 0.171   1.248   19.970 1.00 60.40  ? 16  THR C CG2   1 
ATOM   7405  N  N     . ARG E 5  17  ? -4.162  1.693   19.748 1.00 63.58  ? 17  ARG C N     1 
ATOM   7406  C  CA    . ARG E 5  17  ? -5.515  1.906   20.211 1.00 67.43  ? 17  ARG C CA    1 
ATOM   7407  C  C     . ARG E 5  17  ? -5.514  2.257   21.685 1.00 63.34  ? 17  ARG C C     1 
ATOM   7408  O  O     . ARG E 5  17  ? -6.328  3.052   22.162 1.00 54.64  ? 17  ARG C O     1 
ATOM   7409  C  CB    . ARG E 5  17  ? -6.326  0.653   19.951 1.00 69.76  ? 17  ARG C CB    1 
ATOM   7410  C  CG    . ARG E 5  17  ? -6.356  0.314   18.475 1.00 65.95  ? 17  ARG C CG    1 
ATOM   7411  C  CD    . ARG E 5  17  ? -7.564  -0.499  18.128 1.00 65.51  ? 17  ARG C CD    1 
ATOM   7412  N  NE    . ARG E 5  17  ? -7.226  -1.915  18.172 1.00 70.47  ? 17  ARG C NE    1 
ATOM   7413  C  CZ    . ARG E 5  17  ? -8.094  -2.879  18.467 1.00 73.23  ? 17  ARG C CZ    1 
ATOM   7414  N  NH1   . ARG E 5  17  ? -9.365  -2.581  18.783 1.00 69.11  ? 17  ARG C NH1   1 
ATOM   7415  N  NH2   . ARG E 5  17  ? -7.672  -4.139  18.465 1.00 75.81  ? 17  ARG C NH2   1 
ATOM   7416  N  N     . SER E 5  18  ? -4.576  1.669   22.406 1.00 63.42  ? 18  SER C N     1 
ATOM   7417  C  CA    . SER E 5  18  ? -4.340  2.090   23.769 1.00 63.18  ? 18  SER C CA    1 
ATOM   7418  C  C     . SER E 5  18  ? -4.087  3.586   23.868 1.00 65.28  ? 18  SER C C     1 
ATOM   7419  O  O     . SER E 5  18  ? -4.794  4.244   24.632 1.00 64.91  ? 18  SER C O     1 
ATOM   7420  C  CB    . SER E 5  18  ? -3.216  1.292   24.372 1.00 59.12  ? 18  SER C CB    1 
ATOM   7421  O  OG    . SER E 5  18  ? -3.603  -0.065  24.376 1.00 57.99  ? 18  SER C OG    1 
ATOM   7422  N  N     . SER E 5  19  ? -3.152  4.147   23.092 1.00 69.31  ? 19  SER C N     1 
ATOM   7423  C  CA    . SER E 5  19  ? -2.948  5.633   23.127 1.00 75.32  ? 19  SER C CA    1 
ATOM   7424  C  C     . SER E 5  19  ? -4.254  6.347   22.743 1.00 68.93  ? 19  SER C C     1 
ATOM   7425  O  O     . SER E 5  19  ? -4.752  7.248   23.409 1.00 66.56  ? 19  SER C O     1 
ATOM   7426  C  CB    . SER E 5  19  ? -1.817  6.082   22.199 1.00 73.40  ? 19  SER C CB    1 
ATOM   7427  O  OG    . SER E 5  19  ? -1.812  5.325   20.986 1.00 79.17  ? 19  SER C OG    1 
ATOM   7428  N  N     . ARG E 5  20  ? -4.836  5.894   21.665 1.00 65.02  ? 20  ARG C N     1 
ATOM   7429  C  CA    . ARG E 5  20  ? -6.085  6.457   21.214 1.00 68.82  ? 20  ARG C CA    1 
ATOM   7430  C  C     . ARG E 5  20  ? -7.120  6.519   22.367 1.00 65.28  ? 20  ARG C C     1 
ATOM   7431  O  O     . ARG E 5  20  ? -7.888  7.468   22.455 1.00 69.09  ? 20  ARG C O     1 
ATOM   7432  C  CB    . ARG E 5  20  ? -6.578  5.599   20.031 1.00 78.16  ? 20  ARG C CB    1 
ATOM   7433  C  CG    . ARG E 5  20  ? -7.350  6.318   18.951 1.00 84.62  ? 20  ARG C CG    1 
ATOM   7434  C  CD    . ARG E 5  20  ? -7.681  5.371   17.808 1.00 93.13  ? 20  ARG C CD    1 
ATOM   7435  N  NE    . ARG E 5  20  ? -6.488  4.949   17.059 1.00 103.69 ? 20  ARG C NE    1 
ATOM   7436  C  CZ    . ARG E 5  20  ? -5.894  5.665   16.105 1.00 110.98 ? 20  ARG C CZ    1 
ATOM   7437  N  NH1   . ARG E 5  20  ? -6.345  6.876   15.770 1.00 116.62 ? 20  ARG C NH1   1 
ATOM   7438  N  NH2   . ARG E 5  20  ? -4.832  5.168   15.482 1.00 115.79 ? 20  ARG C NH2   1 
ATOM   7439  N  N     . ALA E 5  21  ? -7.141  5.509   23.244 1.00 67.06  ? 21  ALA C N     1 
ATOM   7440  C  CA    . ALA E 5  21  ? -8.139  5.421   24.337 1.00 65.20  ? 21  ALA C CA    1 
ATOM   7441  C  C     . ALA E 5  21  ? -7.667  5.988   25.680 1.00 65.55  ? 21  ALA C C     1 
ATOM   7442  O  O     . ALA E 5  21  ? -8.469  6.173   26.596 1.00 63.77  ? 21  ALA C O     1 
ATOM   7443  C  CB    . ALA E 5  21  ? -8.542  3.983   24.533 1.00 69.04  ? 21  ALA C CB    1 
ATOM   7444  N  N     . GLY E 5  22  ? -6.361  6.229   25.794 1.00 63.21  ? 22  GLY C N     1 
ATOM   7445  C  CA    . GLY E 5  22  ? -5.776  6.907   26.946 1.00 59.44  ? 22  GLY C CA    1 
ATOM   7446  C  C     . GLY E 5  22  ? -5.269  5.964   27.992 1.00 58.94  ? 22  GLY C C     1 
ATOM   7447  O  O     . GLY E 5  22  ? -5.135  6.329   29.166 1.00 59.66  ? 22  GLY C O     1 
ATOM   7448  N  N     . LEU E 5  23  ? -4.918  4.761   27.545 1.00 57.06  ? 23  LEU C N     1 
ATOM   7449  C  CA    . LEU E 5  23  ? -4.731  3.636   28.436 1.00 51.34  ? 23  LEU C CA    1 
ATOM   7450  C  C     . LEU E 5  23  ? -3.305  3.090   28.354 1.00 55.30  ? 23  LEU C C     1 
ATOM   7451  O  O     . LEU E 5  23  ? -2.699  3.061   27.296 1.00 52.59  ? 23  LEU C O     1 
ATOM   7452  C  CB    . LEU E 5  23  ? -5.749  2.545   28.110 1.00 48.48  ? 23  LEU C CB    1 
ATOM   7453  C  CG    . LEU E 5  23  ? -7.257  2.885   28.136 1.00 54.67  ? 23  LEU C CG    1 
ATOM   7454  C  CD1   . LEU E 5  23  ? -8.082  1.664   27.775 1.00 58.20  ? 23  LEU C CD1   1 
ATOM   7455  C  CD2   . LEU E 5  23  ? -7.768  3.401   29.476 1.00 59.21  ? 23  LEU C CD2   1 
ATOM   7456  N  N     . GLN E 5  24  ? -2.770  2.708   29.508 1.00 58.20  ? 24  GLN C N     1 
ATOM   7457  C  CA    . GLN E 5  24  ? -1.554  1.932   29.587 1.00 61.67  ? 24  GLN C CA    1 
ATOM   7458  C  C     . GLN E 5  24  ? -1.820  0.484   29.152 1.00 63.06  ? 24  GLN C C     1 
ATOM   7459  O  O     . GLN E 5  24  ? -0.969  -0.162  28.550 1.00 68.60  ? 24  GLN C O     1 
ATOM   7460  C  CB    . GLN E 5  24  ? -1.046  1.922   31.014 1.00 69.99  ? 24  GLN C CB    1 
ATOM   7461  C  CG    . GLN E 5  24  ? -0.952  3.300   31.660 1.00 71.24  ? 24  GLN C CG    1 
ATOM   7462  C  CD    . GLN E 5  24  ? -0.009  4.184   30.909 1.00 67.90  ? 24  GLN C CD    1 
ATOM   7463  O  OE1   . GLN E 5  24  ? 1.089   3.765   30.485 1.00 63.95  ? 24  GLN C OE1   1 
ATOM   7464  N  NE2   . GLN E 5  24  ? -0.437  5.401   30.696 1.00 69.10  ? 24  GLN C NE2   1 
ATOM   7465  N  N     . PHE E 5  25  ? -3.000  -0.040  29.443 1.00 56.41  ? 25  PHE C N     1 
ATOM   7466  C  CA    . PHE E 5  25  ? -3.221  -1.461  29.199 1.00 59.89  ? 25  PHE C CA    1 
ATOM   7467  C  C     . PHE E 5  25  ? -3.473  -1.703  27.707 1.00 57.61  ? 25  PHE C C     1 
ATOM   7468  O  O     . PHE E 5  25  ? -3.902  -0.790  27.027 1.00 62.82  ? 25  PHE C O     1 
ATOM   7469  C  CB    . PHE E 5  25  ? -4.364  -1.982  30.093 1.00 60.96  ? 25  PHE C CB    1 
ATOM   7470  C  CG    . PHE E 5  25  ? -3.893  -2.636  31.375 1.00 54.24  ? 25  PHE C CG    1 
ATOM   7471  C  CD1   . PHE E 5  25  ? -2.899  -2.078  32.129 1.00 56.59  ? 25  PHE C CD1   1 
ATOM   7472  C  CD2   . PHE E 5  25  ? -4.475  -3.813  31.814 1.00 58.16  ? 25  PHE C CD2   1 
ATOM   7473  C  CE1   . PHE E 5  25  ? -2.474  -2.670  33.300 1.00 58.73  ? 25  PHE C CE1   1 
ATOM   7474  C  CE2   . PHE E 5  25  ? -4.075  -4.418  32.975 1.00 55.15  ? 25  PHE C CE2   1 
ATOM   7475  C  CZ    . PHE E 5  25  ? -3.071  -3.846  33.724 1.00 58.96  ? 25  PHE C CZ    1 
ATOM   7476  N  N     . PRO E 5  26  ? -3.195  -2.923  27.194 1.00 56.82  ? 26  PRO C N     1 
ATOM   7477  C  CA    . PRO E 5  26  ? -3.126  -3.126  25.740 1.00 55.16  ? 26  PRO C CA    1 
ATOM   7478  C  C     . PRO E 5  26  ? -4.399  -3.564  25.134 1.00 52.21  ? 26  PRO C C     1 
ATOM   7479  O  O     . PRO E 5  26  ? -4.750  -4.713  25.237 1.00 62.63  ? 26  PRO C O     1 
ATOM   7480  C  CB    . PRO E 5  26  ? -2.101  -4.250  25.583 1.00 56.52  ? 26  PRO C CB    1 
ATOM   7481  C  CG    . PRO E 5  26  ? -2.241  -5.036  26.831 1.00 57.95  ? 26  PRO C CG    1 
ATOM   7482  C  CD    . PRO E 5  26  ? -2.538  -4.028  27.909 1.00 60.21  ? 26  PRO C CD    1 
ATOM   7483  N  N     . VAL E 5  27  ? -5.053  -2.660  24.436 1.00 55.59  ? 27  VAL C N     1 
ATOM   7484  C  CA    . VAL E 5  27  ? -6.337  -2.929  23.810 1.00 52.73  ? 27  VAL C CA    1 
ATOM   7485  C  C     . VAL E 5  27  ? -6.242  -3.957  22.682 1.00 56.53  ? 27  VAL C C     1 
ATOM   7486  O  O     . VAL E 5  27  ? -7.191  -4.688  22.449 1.00 58.00  ? 27  VAL C O     1 
ATOM   7487  C  CB    . VAL E 5  27  ? -6.936  -1.615  23.273 1.00 52.05  ? 27  VAL C CB    1 
ATOM   7488  C  CG1   . VAL E 5  27  ? -8.223  -1.855  22.527 1.00 54.94  ? 27  VAL C CG1   1 
ATOM   7489  C  CG2   . VAL E 5  27  ? -7.173  -0.641  24.414 1.00 51.90  ? 27  VAL C CG2   1 
ATOM   7490  N  N     . GLY E 5  28  ? -5.121  -4.012  21.969 1.00 58.49  ? 28  GLY C N     1 
ATOM   7491  C  CA    . GLY E 5  28  ? -5.043  -4.901  20.816 1.00 57.11  ? 28  GLY C CA    1 
ATOM   7492  C  C     . GLY E 5  28  ? -5.142  -6.331  21.292 1.00 55.88  ? 28  GLY C C     1 
ATOM   7493  O  O     . GLY E 5  28  ? -5.960  -7.120  20.808 1.00 49.54  ? 28  GLY C O     1 
ATOM   7494  N  N     . ARG E 5  29  ? -4.265  -6.639  22.240 1.00 54.18  ? 29  ARG C N     1 
ATOM   7495  C  CA    . ARG E 5  29  ? -4.259  -7.886  22.996 1.00 54.34  ? 29  ARG C CA    1 
ATOM   7496  C  C     . ARG E 5  29  ? -5.636  -8.251  23.551 1.00 59.88  ? 29  ARG C C     1 
ATOM   7497  O  O     . ARG E 5  29  ? -6.143  -9.357  23.350 1.00 62.12  ? 29  ARG C O     1 
ATOM   7498  C  CB    . ARG E 5  29  ? -3.337  -7.684  24.184 1.00 55.95  ? 29  ARG C CB    1 
ATOM   7499  C  CG    . ARG E 5  29  ? -3.026  -8.919  24.989 1.00 56.67  ? 29  ARG C CG    1 
ATOM   7500  C  CD    . ARG E 5  29  ? -1.546  -9.181  24.873 1.00 57.51  ? 29  ARG C CD    1 
ATOM   7501  N  NE    . ARG E 5  29  ? -0.940  -9.214  26.166 1.00 55.20  ? 29  ARG C NE    1 
ATOM   7502  C  CZ    . ARG E 5  29  ? 0.374   -9.147  26.375 1.00 71.84  ? 29  ARG C CZ    1 
ATOM   7503  N  NH1   . ARG E 5  29  ? 1.252   -9.035  25.360 1.00 65.22  ? 29  ARG C NH1   1 
ATOM   7504  N  NH2   . ARG E 5  29  ? 0.821   -9.203  27.633 1.00 78.96  ? 29  ARG C NH2   1 
ATOM   7505  N  N     . VAL E 5  30  ? -6.243  -7.318  24.267 1.00 54.77  ? 30  VAL C N     1 
ATOM   7506  C  CA    . VAL E 5  30  ? -7.521  -7.608  24.887 1.00 58.01  ? 30  VAL C CA    1 
ATOM   7507  C  C     . VAL E 5  30  ? -8.542  -7.970  23.812 1.00 60.34  ? 30  VAL C C     1 
ATOM   7508  O  O     . VAL E 5  30  ? -9.389  -8.834  24.019 1.00 67.47  ? 30  VAL C O     1 
ATOM   7509  C  CB    . VAL E 5  30  ? -8.027  -6.432  25.758 1.00 57.34  ? 30  VAL C CB    1 
ATOM   7510  C  CG1   . VAL E 5  30  ? -9.459  -6.649  26.172 1.00 58.48  ? 30  VAL C CG1   1 
ATOM   7511  C  CG2   . VAL E 5  30  ? -7.174  -6.267  27.003 1.00 57.35  ? 30  VAL C CG2   1 
ATOM   7512  N  N     . HIS E 5  31  ? -8.468  -7.319  22.659 1.00 69.83  ? 31  HIS C N     1 
ATOM   7513  C  CA    . HIS E 5  31  ? -9.371  -7.668  21.555 1.00 73.21  ? 31  HIS C CA    1 
ATOM   7514  C  C     . HIS E 5  31  ? -9.119  -9.098  21.140 1.00 68.21  ? 31  HIS C C     1 
ATOM   7515  O  O     . HIS E 5  31  ? -10.027 -9.894  20.972 1.00 63.54  ? 31  HIS C O     1 
ATOM   7516  C  CB    . HIS E 5  31  ? -9.152  -6.785  20.332 1.00 72.73  ? 31  HIS C CB    1 
ATOM   7517  C  CG    . HIS E 5  31  ? -10.370 -6.651  19.486 1.00 77.79  ? 31  HIS C CG    1 
ATOM   7518  N  ND1   . HIS E 5  31  ? -11.391 -7.575  19.508 1.00 82.64  ? 31  HIS C ND1   1 
ATOM   7519  C  CD2   . HIS E 5  31  ? -10.743 -5.697  18.603 1.00 79.12  ? 31  HIS C CD2   1 
ATOM   7520  C  CE1   . HIS E 5  31  ? -12.345 -7.190  18.679 1.00 89.11  ? 31  HIS C CE1   1 
ATOM   7521  N  NE2   . HIS E 5  31  ? -11.975 -6.056  18.116 1.00 88.10  ? 31  HIS C NE2   1 
ATOM   7522  N  N     . ARG E 5  32  ? -7.847  -9.407  20.990 1.00 66.73  ? 32  ARG C N     1 
ATOM   7523  C  CA    . ARG E 5  32  ? -7.447  -10.697 20.509 1.00 66.87  ? 32  ARG C CA    1 
ATOM   7524  C  C     . ARG E 5  32  ? -7.994  -11.754 21.425 1.00 67.27  ? 32  ARG C C     1 
ATOM   7525  O  O     . ARG E 5  32  ? -8.607  -12.716 20.967 1.00 69.99  ? 32  ARG C O     1 
ATOM   7526  C  CB    . ARG E 5  32  ? -5.931  -10.766 20.490 1.00 63.71  ? 32  ARG C CB    1 
ATOM   7527  C  CG    . ARG E 5  32  ? -5.383  -12.002 19.841 1.00 64.18  ? 32  ARG C CG    1 
ATOM   7528  C  CD    . ARG E 5  32  ? -3.886  -11.904 19.852 1.00 61.29  ? 32  ARG C CD    1 
ATOM   7529  N  NE    . ARG E 5  32  ? -3.389  -12.583 21.024 1.00 62.65  ? 32  ARG C NE    1 
ATOM   7530  C  CZ    . ARG E 5  32  ? -2.431  -12.135 21.831 1.00 62.52  ? 32  ARG C CZ    1 
ATOM   7531  N  NH1   . ARG E 5  32  ? -1.866  -10.955 21.652 1.00 65.23  ? 32  ARG C NH1   1 
ATOM   7532  N  NH2   . ARG E 5  32  ? -2.061  -12.874 22.855 1.00 63.48  ? 32  ARG C NH2   1 
ATOM   7533  N  N     . LEU E 5  33  ? -7.771  -11.541 22.727 1.00 63.92  ? 33  LEU C N     1 
ATOM   7534  C  CA    . LEU E 5  33  ? -8.035  -12.549 23.742 1.00 55.28  ? 33  LEU C CA    1 
ATOM   7535  C  C     . LEU E 5  33  ? -9.535  -12.774 23.846 1.00 58.26  ? 33  LEU C C     1 
ATOM   7536  O  O     . LEU E 5  33  ? -10.001 -13.895 24.081 1.00 64.48  ? 33  LEU C O     1 
ATOM   7537  C  CB    . LEU E 5  33  ? -7.437  -12.135 25.086 1.00 52.02  ? 33  LEU C CB    1 
ATOM   7538  C  CG    . LEU E 5  33  ? -5.909  -12.119 25.249 1.00 46.59  ? 33  LEU C CG    1 
ATOM   7539  C  CD1   . LEU E 5  33  ? -5.469  -11.661 26.628 1.00 44.71  ? 33  LEU C CD1   1 
ATOM   7540  C  CD2   . LEU E 5  33  ? -5.335  -13.499 25.009 1.00 49.40  ? 33  LEU C CD2   1 
ATOM   7541  N  N     . LEU E 5  34  ? -10.301 -11.719 23.619 1.00 57.86  ? 34  LEU C N     1 
ATOM   7542  C  CA    . LEU E 5  34  ? -11.742 -11.871 23.550 1.00 57.86  ? 34  LEU C CA    1 
ATOM   7543  C  C     . LEU E 5  34  ? -12.207 -12.757 22.392 1.00 64.54  ? 34  LEU C C     1 
ATOM   7544  O  O     . LEU E 5  34  ? -13.150 -13.535 22.549 1.00 64.46  ? 34  LEU C O     1 
ATOM   7545  C  CB    . LEU E 5  34  ? -12.390 -10.510 23.426 1.00 57.18  ? 34  LEU C CB    1 
ATOM   7546  C  CG    . LEU E 5  34  ? -12.540 -9.630  24.668 1.00 62.45  ? 34  LEU C CG    1 
ATOM   7547  C  CD1   . LEU E 5  34  ? -13.222 -8.302  24.306 1.00 69.65  ? 34  LEU C CD1   1 
ATOM   7548  C  CD2   . LEU E 5  34  ? -13.352 -10.305 25.748 1.00 57.74  ? 34  LEU C CD2   1 
ATOM   7549  N  N     . ARG E 5  35  ? -11.573 -12.613 21.224 1.00 74.42  ? 35  ARG C N     1 
ATOM   7550  C  CA    . ARG E 5  35  ? -11.945 -13.406 20.042 1.00 76.27  ? 35  ARG C CA    1 
ATOM   7551  C  C     . ARG E 5  35  ? -11.670 -14.873 20.303 1.00 71.53  ? 35  ARG C C     1 
ATOM   7552  O  O     . ARG E 5  35  ? -12.549 -15.716 20.137 1.00 72.59  ? 35  ARG C O     1 
ATOM   7553  C  CB    . ARG E 5  35  ? -11.169 -12.971 18.805 1.00 80.70  ? 35  ARG C CB    1 
ATOM   7554  C  CG    . ARG E 5  35  ? -11.506 -11.575 18.305 1.00 89.14  ? 35  ARG C CG    1 
ATOM   7555  C  CD    . ARG E 5  35  ? -11.221 -11.416 16.808 1.00 92.75  ? 35  ARG C CD    1 
ATOM   7556  N  NE    . ARG E 5  35  ? -11.215 -10.015 16.374 1.00 95.11  ? 35  ARG C NE    1 
ATOM   7557  C  CZ    . ARG E 5  35  ? -12.295 -9.229  16.244 1.00 95.52  ? 35  ARG C CZ    1 
ATOM   7558  N  NH1   . ARG E 5  35  ? -13.534 -9.649  16.532 1.00 87.36  ? 35  ARG C NH1   1 
ATOM   7559  N  NH2   . ARG E 5  35  ? -12.130 -7.984  15.821 1.00 100.83 ? 35  ARG C NH2   1 
ATOM   7560  N  N     . LYS E 5  36  ? -10.455 -15.157 20.746 1.00 68.90  ? 36  LYS C N     1 
ATOM   7561  C  CA    . LYS E 5  36  ? -10.037 -16.527 20.991 1.00 78.63  ? 36  LYS C CA    1 
ATOM   7562  C  C     . LYS E 5  36  ? -10.738 -17.225 22.184 1.00 81.57  ? 36  LYS C C     1 
ATOM   7563  O  O     . LYS E 5  36  ? -10.699 -18.446 22.280 1.00 88.55  ? 36  LYS C O     1 
ATOM   7564  C  CB    . LYS E 5  36  ? -8.518  -16.590 21.169 1.00 83.57  ? 36  LYS C CB    1 
ATOM   7565  C  CG    . LYS E 5  36  ? -8.040  -16.230 22.563 1.00 96.73  ? 36  LYS C CG    1 
ATOM   7566  C  CD    . LYS E 5  36  ? -6.511  -16.095 22.645 1.00 111.12 ? 36  LYS C CD    1 
ATOM   7567  C  CE    . LYS E 5  36  ? -5.825  -17.159 23.506 1.00 105.09 ? 36  LYS C CE    1 
ATOM   7568  N  NZ    . LYS E 5  36  ? -5.646  -18.454 22.790 1.00 107.18 ? 36  LYS C NZ    1 
ATOM   7569  N  N     . GLY E 5  37  ? -11.360 -16.477 23.095 1.00 75.25  ? 37  GLY C N     1 
ATOM   7570  C  CA    . GLY E 5  37  ? -12.040 -17.091 24.230 1.00 66.59  ? 37  GLY C CA    1 
ATOM   7571  C  C     . GLY E 5  37  ? -13.412 -17.650 23.898 1.00 70.09  ? 37  GLY C C     1 
ATOM   7572  O  O     . GLY E 5  37  ? -14.042 -18.322 24.734 1.00 69.41  ? 37  GLY C O     1 
ATOM   7573  N  N     . ASN E 5  38  ? -13.879 -17.389 22.677 1.00 69.53  ? 38  ASN C N     1 
ATOM   7574  C  CA    . ASN E 5  38  ? -15.179 -17.857 22.232 1.00 67.23  ? 38  ASN C CA    1 
ATOM   7575  C  C     . ASN E 5  38  ? -16.296 -17.406 23.129 1.00 61.18  ? 38  ASN C C     1 
ATOM   7576  O  O     . ASN E 5  38  ? -17.170 -18.175 23.494 1.00 59.87  ? 38  ASN C O     1 
ATOM   7577  C  CB    . ASN E 5  38  ? -15.186 -19.371 22.136 1.00 76.49  ? 38  ASN C CB    1 
ATOM   7578  C  CG    . ASN E 5  38  ? -14.687 -19.840 20.816 1.00 84.57  ? 38  ASN C CG    1 
ATOM   7579  O  OD1   . ASN E 5  38  ? -13.697 -20.572 20.745 1.00 85.49  ? 38  ASN C OD1   1 
ATOM   7580  N  ND2   . ASN E 5  38  ? -15.365 -19.408 19.738 1.00 87.78  ? 38  ASN C ND2   1 
ATOM   7581  N  N     . TYR E 5  39  ? -16.280 -16.139 23.490 1.00 60.27  ? 39  TYR C N     1 
ATOM   7582  C  CA    . TYR E 5  39  ? -17.337 -15.629 24.358 1.00 54.09  ? 39  TYR C CA    1 
ATOM   7583  C  C     . TYR E 5  39  ? -18.595 -15.289 23.549 1.00 52.86  ? 39  TYR C C     1 
ATOM   7584  O  O     . TYR E 5  39  ? -19.692 -15.313 24.087 1.00 51.32  ? 39  TYR C O     1 
ATOM   7585  C  CB    . TYR E 5  39  ? -16.802 -14.457 25.154 1.00 48.18  ? 39  TYR C CB    1 
ATOM   7586  C  CG    . TYR E 5  39  ? -15.561 -14.806 26.029 1.00 48.89  ? 39  TYR C CG    1 
ATOM   7587  C  CD1   . TYR E 5  39  ? -14.278 -14.415 25.647 1.00 47.45  ? 39  TYR C CD1   1 
ATOM   7588  C  CD2   . TYR E 5  39  ? -15.688 -15.481 27.243 1.00 43.33  ? 39  TYR C CD2   1 
ATOM   7589  C  CE1   . TYR E 5  39  ? -13.160 -14.690 26.427 1.00 46.11  ? 39  TYR C CE1   1 
ATOM   7590  C  CE2   . TYR E 5  39  ? -14.574 -15.774 28.025 1.00 44.15  ? 39  TYR C CE2   1 
ATOM   7591  C  CZ    . TYR E 5  39  ? -13.298 -15.393 27.601 1.00 47.01  ? 39  TYR C CZ    1 
ATOM   7592  O  OH    . TYR E 5  39  ? -12.158 -15.641 28.372 1.00 43.86  ? 39  TYR C OH    1 
ATOM   7593  N  N     . ALA E 5  40  ? -18.423 -15.044 22.241 1.00 57.60  ? 40  ALA C N     1 
ATOM   7594  C  CA    . ALA E 5  40  ? -19.510 -14.646 21.339 1.00 57.63  ? 40  ALA C CA    1 
ATOM   7595  C  C     . ALA E 5  40  ? -19.048 -14.635 19.879 1.00 58.71  ? 40  ALA C C     1 
ATOM   7596  O  O     . ALA E 5  40  ? -17.828 -14.605 19.607 1.00 51.86  ? 40  ALA C O     1 
ATOM   7597  C  CB    . ALA E 5  40  ? -19.974 -13.270 21.726 1.00 60.26  ? 40  ALA C CB    1 
ATOM   7598  N  N     . GLU E 5  41  ? -19.991 -14.653 18.932 1.00 61.14  ? 41  GLU C N     1 
ATOM   7599  C  CA    . GLU E 5  41  ? -19.586 -14.701 17.500 1.00 68.26  ? 41  GLU C CA    1 
ATOM   7600  C  C     . GLU E 5  41  ? -18.733 -13.490 17.220 1.00 68.66  ? 41  GLU C C     1 
ATOM   7601  O  O     . GLU E 5  41  ? -17.615 -13.608 16.753 1.00 70.51  ? 41  GLU C O     1 
ATOM   7602  C  CB    . GLU E 5  41  ? -20.761 -14.671 16.504 1.00 76.63  ? 41  GLU C CB    1 
ATOM   7603  C  CG    . GLU E 5  41  ? -21.806 -15.758 16.638 1.00 89.22  ? 41  GLU C CG    1 
ATOM   7604  C  CD    . GLU E 5  41  ? -21.206 -17.143 16.558 1.00 103.95 ? 41  GLU C CD    1 
ATOM   7605  O  OE1   . GLU E 5  41  ? -20.322 -17.366 15.695 1.00 107.84 ? 41  GLU C OE1   1 
ATOM   7606  O  OE2   . GLU E 5  41  ? -21.616 -18.004 17.375 1.00 116.91 ? 41  GLU C OE2   1 
ATOM   7607  N  N     . ARG E 5  42  ? -19.270 -12.321 17.546 1.00 69.94  ? 42  ARG C N     1 
ATOM   7608  C  CA    . ARG E 5  42  ? -18.634 -11.073 17.206 1.00 72.49  ? 42  ARG C CA    1 
ATOM   7609  C  C     . ARG E 5  42  ? -18.232 -10.333 18.455 1.00 70.17  ? 42  ARG C C     1 
ATOM   7610  O  O     . ARG E 5  42  ? -18.871 -10.459 19.486 1.00 60.64  ? 42  ARG C O     1 
ATOM   7611  C  CB    . ARG E 5  42  ? -19.609 -10.191 16.436 1.00 86.17  ? 42  ARG C CB    1 
ATOM   7612  C  CG    . ARG E 5  42  ? -20.172 -10.837 15.190 1.00 91.48  ? 42  ARG C CG    1 
ATOM   7613  C  CD    . ARG E 5  42  ? -21.232 -9.979  14.526 1.00 92.94  ? 42  ARG C CD    1 
ATOM   7614  N  NE    . ARG E 5  42  ? -21.188 -10.234 13.092 1.00 96.48  ? 42  ARG C NE    1 
ATOM   7615  C  CZ    . ARG E 5  42  ? -21.630 -9.404  12.157 1.00 98.02  ? 42  ARG C CZ    1 
ATOM   7616  N  NH1   . ARG E 5  42  ? -22.196 -8.240  12.483 1.00 96.43  ? 42  ARG C NH1   1 
ATOM   7617  N  NH2   . ARG E 5  42  ? -21.515 -9.758  10.882 1.00 102.73 ? 42  ARG C NH2   1 
ATOM   7618  N  N     . VAL E 5  43  ? -17.188 -9.523  18.327 1.00 72.27  ? 43  VAL C N     1 
ATOM   7619  C  CA    . VAL E 5  43  ? -16.749 -8.643  19.392 1.00 70.57  ? 43  VAL C CA    1 
ATOM   7620  C  C     . VAL E 5  43  ? -16.718 -7.201  18.936 1.00 68.29  ? 43  VAL C C     1 
ATOM   7621  O  O     . VAL E 5  43  ? -15.894 -6.824  18.110 1.00 76.18  ? 43  VAL C O     1 
ATOM   7622  C  CB    . VAL E 5  43  ? -15.346 -9.006  19.874 1.00 72.49  ? 43  VAL C CB    1 
ATOM   7623  C  CG1   . VAL E 5  43  ? -14.845 -7.998  20.907 1.00 68.76  ? 43  VAL C CG1   1 
ATOM   7624  C  CG2   . VAL E 5  43  ? -15.357 -10.405 20.452 1.00 74.45  ? 43  VAL C CG2   1 
ATOM   7625  N  N     . GLY E 5  44  ? -17.611 -6.407  19.519 1.00 71.37  ? 44  GLY C N     1 
ATOM   7626  C  CA    . GLY E 5  44  ? -17.634 -4.967  19.348 1.00 70.57  ? 44  GLY C CA    1 
ATOM   7627  C  C     . GLY E 5  44  ? -16.316 -4.260  19.627 1.00 75.48  ? 44  GLY C C     1 
ATOM   7628  O  O     . GLY E 5  44  ? -15.569 -4.610  20.546 1.00 71.10  ? 44  GLY C O     1 
ATOM   7629  N  N     . ALA E 5  45  ? -16.057 -3.248  18.806 1.00 77.10  ? 45  ALA C N     1 
ATOM   7630  C  CA    . ALA E 5  45  ? -14.872 -2.398  18.883 1.00 77.30  ? 45  ALA C CA    1 
ATOM   7631  C  C     . ALA E 5  45  ? -14.641 -1.729  20.252 1.00 76.91  ? 45  ALA C C     1 
ATOM   7632  O  O     . ALA E 5  45  ? -13.492 -1.554  20.680 1.00 81.00  ? 45  ALA C O     1 
ATOM   7633  C  CB    . ALA E 5  45  ? -14.972 -1.320  17.808 1.00 77.41  ? 45  ALA C CB    1 
ATOM   7634  N  N     . GLY E 5  46  ? -15.717 -1.323  20.918 1.00 67.46  ? 46  GLY C N     1 
ATOM   7635  C  CA    . GLY E 5  46  ? -15.582 -0.647  22.217 1.00 69.74  ? 46  GLY C CA    1 
ATOM   7636  C  C     . GLY E 5  46  ? -15.212 -1.572  23.353 1.00 65.85  ? 46  GLY C C     1 
ATOM   7637  O  O     . GLY E 5  46  ? -14.483 -1.189  24.273 1.00 70.31  ? 46  GLY C O     1 
ATOM   7638  N  N     . ALA E 5  47  ? -15.726 -2.797  23.263 1.00 60.25  ? 47  ALA C N     1 
ATOM   7639  C  CA    . ALA E 5  47  ? -15.527 -3.817  24.258 1.00 52.42  ? 47  ALA C CA    1 
ATOM   7640  C  C     . ALA E 5  47  ? -14.100 -3.868  24.857 1.00 51.59  ? 47  ALA C C     1 
ATOM   7641  O  O     . ALA E 5  47  ? -13.932 -3.602  26.065 1.00 47.81  ? 47  ALA C O     1 
ATOM   7642  C  CB    . ALA E 5  47  ? -15.926 -5.142  23.674 1.00 54.67  ? 47  ALA C CB    1 
ATOM   7643  N  N     . PRO E 5  48  ? -13.077 -4.167  24.036 1.00 43.85  ? 48  PRO C N     1 
ATOM   7644  C  CA    . PRO E 5  48  ? -11.727 -4.316  24.569 1.00 48.17  ? 48  PRO C CA    1 
ATOM   7645  C  C     . PRO E 5  48  ? -11.151 -3.057  25.134 1.00 57.54  ? 48  PRO C C     1 
ATOM   7646  O  O     . PRO E 5  48  ? -10.261 -3.129  26.003 1.00 59.89  ? 48  PRO C O     1 
ATOM   7647  C  CB    . PRO E 5  48  ? -10.891 -4.710  23.345 1.00 50.34  ? 48  PRO C CB    1 
ATOM   7648  C  CG    . PRO E 5  48  ? -11.667 -4.194  22.200 1.00 50.09  ? 48  PRO C CG    1 
ATOM   7649  C  CD    . PRO E 5  48  ? -13.105 -4.402  22.594 1.00 48.00  ? 48  PRO C CD    1 
ATOM   7650  N  N     . VAL E 5  49  ? -11.617 -1.919  24.614 1.00 58.89  ? 49  VAL C N     1 
ATOM   7651  C  CA    . VAL E 5  49  ? -11.257 -0.624  25.165 1.00 60.32  ? 49  VAL C CA    1 
ATOM   7652  C  C     . VAL E 5  49  ? -11.812 -0.513  26.576 1.00 55.54  ? 49  VAL C C     1 
ATOM   7653  O  O     . VAL E 5  49  ? -11.067 -0.211  27.520 1.00 57.68  ? 49  VAL C O     1 
ATOM   7654  C  CB    . VAL E 5  49  ? -11.778 0.551   24.290 1.00 63.40  ? 49  VAL C CB    1 
ATOM   7655  C  CG1   . VAL E 5  49  ? -11.643 1.886   25.005 1.00 62.28  ? 49  VAL C CG1   1 
ATOM   7656  C  CG2   . VAL E 5  49  ? -11.003 0.606   22.985 1.00 65.98  ? 49  VAL C CG2   1 
ATOM   7657  N  N     . TYR E 5  50  ? -13.106 -0.769  26.722 1.00 47.91  ? 50  TYR C N     1 
ATOM   7658  C  CA    . TYR E 5  50  ? -13.730 -0.656  28.035 1.00 51.62  ? 50  TYR C CA    1 
ATOM   7659  C  C     . TYR E 5  50  ? -13.096 -1.646  29.005 1.00 52.04  ? 50  TYR C C     1 
ATOM   7660  O  O     . TYR E 5  50  ? -12.648 -1.299  30.097 1.00 52.02  ? 50  TYR C O     1 
ATOM   7661  C  CB    . TYR E 5  50  ? -15.195 -0.947  27.903 1.00 49.91  ? 50  TYR C CB    1 
ATOM   7662  C  CG    . TYR E 5  50  ? -16.031 -0.473  29.040 1.00 50.77  ? 50  TYR C CG    1 
ATOM   7663  C  CD1   . TYR E 5  50  ? -16.961 0.559   28.867 1.00 55.05  ? 50  TYR C CD1   1 
ATOM   7664  C  CD2   . TYR E 5  50  ? -15.942 -1.067  30.273 1.00 50.33  ? 50  TYR C CD2   1 
ATOM   7665  C  CE1   . TYR E 5  50  ? -17.776 0.965   29.906 1.00 54.87  ? 50  TYR C CE1   1 
ATOM   7666  C  CE2   . TYR E 5  50  ? -16.753 -0.668  31.314 1.00 51.49  ? 50  TYR C CE2   1 
ATOM   7667  C  CZ    . TYR E 5  50  ? -17.662 0.339   31.123 1.00 55.57  ? 50  TYR C CZ    1 
ATOM   7668  O  OH    . TYR E 5  50  ? -18.435 0.725   32.182 1.00 68.21  ? 50  TYR C OH    1 
ATOM   7669  N  N     . LEU E 5  51  ? -13.041 -2.887  28.570 1.00 51.20  ? 51  LEU C N     1 
ATOM   7670  C  CA    . LEU E 5  51  ? -12.495 -3.943  29.378 1.00 49.04  ? 51  LEU C CA    1 
ATOM   7671  C  C     . LEU E 5  51  ? -11.037 -3.653  29.759 1.00 51.08  ? 51  LEU C C     1 
ATOM   7672  O  O     . LEU E 5  51  ? -10.620 -3.793  30.937 1.00 52.67  ? 51  LEU C O     1 
ATOM   7673  C  CB    . LEU E 5  51  ? -12.651 -5.268  28.646 1.00 47.41  ? 51  LEU C CB    1 
ATOM   7674  C  CG    . LEU E 5  51  ? -12.116 -6.533  29.345 1.00 53.66  ? 51  LEU C CG    1 
ATOM   7675  C  CD1   . LEU E 5  51  ? -12.517 -6.685  30.824 1.00 50.09  ? 51  LEU C CD1   1 
ATOM   7676  C  CD2   . LEU E 5  51  ? -12.531 -7.760  28.533 1.00 49.66  ? 51  LEU C CD2   1 
ATOM   7677  N  N     . ALA E 5  52  ? -10.253 -3.196  28.801 1.00 45.93  ? 52  ALA C N     1 
ATOM   7678  C  CA    . ALA E 5  52  ? -8.881  -2.867  29.143 1.00 45.13  ? 52  ALA C CA    1 
ATOM   7679  C  C     . ALA E 5  52  ? -8.823  -1.750  30.194 1.00 50.95  ? 52  ALA C C     1 
ATOM   7680  O  O     . ALA E 5  52  ? -7.940  -1.752  31.047 1.00 58.15  ? 52  ALA C O     1 
ATOM   7681  C  CB    . ALA E 5  52  ? -8.099  -2.497  27.907 1.00 42.48  ? 52  ALA C CB    1 
ATOM   7682  N  N     . ALA E 5  53  ? -9.770  -0.816  30.147 1.00 47.88  ? 53  ALA C N     1 
ATOM   7683  C  CA    . ALA E 5  53  ? -9.766  0.287   31.081 1.00 49.35  ? 53  ALA C CA    1 
ATOM   7684  C  C     . ALA E 5  53  ? -10.103 -0.200  32.452 1.00 48.68  ? 53  ALA C C     1 
ATOM   7685  O  O     . ALA E 5  53  ? -9.486  0.203   33.431 1.00 54.04  ? 53  ALA C O     1 
ATOM   7686  C  CB    . ALA E 5  53  ? -10.782 1.333   30.660 1.00 52.86  ? 53  ALA C CB    1 
ATOM   7687  N  N     . VAL E 5  54  ? -11.122 -1.048  32.514 1.00 47.00  ? 54  VAL C N     1 
ATOM   7688  C  CA    . VAL E 5  54  ? -11.556 -1.604  33.777 1.00 47.34  ? 54  VAL C CA    1 
ATOM   7689  C  C     . VAL E 5  54  ? -10.396 -2.346  34.463 1.00 46.61  ? 54  VAL C C     1 
ATOM   7690  O  O     . VAL E 5  54  ? -10.102 -2.160  35.666 1.00 43.07  ? 54  VAL C O     1 
ATOM   7691  C  CB    . VAL E 5  54  ? -12.746 -2.537  33.559 1.00 46.79  ? 54  VAL C CB    1 
ATOM   7692  C  CG1   . VAL E 5  54  ? -12.961 -3.459  34.764 1.00 45.71  ? 54  VAL C CG1   1 
ATOM   7693  C  CG2   . VAL E 5  54  ? -13.991 -1.697  33.288 1.00 47.08  ? 54  VAL C CG2   1 
ATOM   7694  N  N     . LEU E 5  55  ? -9.724  -3.153  33.661 1.00 42.29  ? 55  LEU C N     1 
ATOM   7695  C  CA    . LEU E 5  55  ? -8.648  -3.960  34.145 1.00 41.73  ? 55  LEU C CA    1 
ATOM   7696  C  C     . LEU E 5  55  ? -7.523  -3.100  34.640 1.00 41.73  ? 55  LEU C C     1 
ATOM   7697  O  O     . LEU E 5  55  ? -6.960  -3.352  35.686 1.00 38.45  ? 55  LEU C O     1 
ATOM   7698  C  CB    . LEU E 5  55  ? -8.173  -4.841  33.030 1.00 46.06  ? 55  LEU C CB    1 
ATOM   7699  C  CG    . LEU E 5  55  ? -9.123  -5.974  32.645 1.00 45.33  ? 55  LEU C CG    1 
ATOM   7700  C  CD1   . LEU E 5  55  ? -8.585  -6.750  31.457 1.00 49.72  ? 55  LEU C CD1   1 
ATOM   7701  C  CD2   . LEU E 5  55  ? -9.300  -6.945  33.783 1.00 46.71  ? 55  LEU C CD2   1 
ATOM   7702  N  N     . GLU E 5  56  ? -7.227  -2.047  33.906 1.00 49.15  ? 56  GLU C N     1 
ATOM   7703  C  CA    . GLU E 5  56  ? -6.212  -1.088  34.326 1.00 48.42  ? 56  GLU C CA    1 
ATOM   7704  C  C     . GLU E 5  56  ? -6.635  -0.396  35.627 1.00 46.27  ? 56  GLU C C     1 
ATOM   7705  O  O     . GLU E 5  56  ? -5.826  -0.207  36.555 1.00 40.07  ? 56  GLU C O     1 
ATOM   7706  C  CB    . GLU E 5  56  ? -6.048  -0.050  33.244 1.00 51.99  ? 56  GLU C CB    1 
ATOM   7707  C  CG    . GLU E 5  56  ? -4.952  0.940   33.541 1.00 56.54  ? 56  GLU C CG    1 
ATOM   7708  C  CD    . GLU E 5  56  ? -4.646  1.835   32.372 1.00 57.11  ? 56  GLU C CD    1 
ATOM   7709  O  OE1   . GLU E 5  56  ? -4.645  1.363   31.198 1.00 60.05  ? 56  GLU C OE1   1 
ATOM   7710  O  OE2   . GLU E 5  56  ? -4.394  3.017   32.647 1.00 61.76  ? 56  GLU C OE2   1 
ATOM   7711  N  N     . TYR E 5  57  ? -7.911  -0.034  35.712 1.00 43.76  ? 57  TYR C N     1 
ATOM   7712  C  CA    . TYR E 5  57  ? -8.363  0.629   36.918 1.00 48.45  ? 57  TYR C CA    1 
ATOM   7713  C  C     . TYR E 5  57  ? -8.020  -0.241  38.129 1.00 49.90  ? 57  TYR C C     1 
ATOM   7714  O  O     . TYR E 5  57  ? -7.313  0.188   39.076 1.00 45.80  ? 57  TYR C O     1 
ATOM   7715  C  CB    . TYR E 5  57  ? -9.868  0.914   36.879 1.00 52.25  ? 57  TYR C CB    1 
ATOM   7716  C  CG    . TYR E 5  57  ? -10.381 1.313   38.257 1.00 56.16  ? 57  TYR C CG    1 
ATOM   7717  C  CD1   . TYR E 5  57  ? -9.836  2.405   38.943 1.00 58.49  ? 57  TYR C CD1   1 
ATOM   7718  C  CD2   . TYR E 5  57  ? -11.383 0.590   38.876 1.00 56.73  ? 57  TYR C CD2   1 
ATOM   7719  C  CE1   . TYR E 5  57  ? -10.287 2.749   40.210 1.00 62.75  ? 57  TYR C CE1   1 
ATOM   7720  C  CE2   . TYR E 5  57  ? -11.827 0.927   40.137 1.00 57.58  ? 57  TYR C CE2   1 
ATOM   7721  C  CZ    . TYR E 5  57  ? -11.271 1.985   40.803 1.00 58.31  ? 57  TYR C CZ    1 
ATOM   7722  O  OH    . TYR E 5  57  ? -11.726 2.272   42.067 1.00 68.96  ? 57  TYR C OH    1 
ATOM   7723  N  N     . LEU E 5  58  ? -8.484  -1.490  38.042 1.00 47.03  ? 58  LEU C N     1 
ATOM   7724  C  CA    . LEU E 5  58  ? -8.375  -2.449  39.118 1.00 43.19  ? 58  LEU C CA    1 
ATOM   7725  C  C     . LEU E 5  58  ? -6.943  -2.736  39.507 1.00 40.96  ? 58  LEU C C     1 
ATOM   7726  O  O     . LEU E 5  58  ? -6.586  -2.788  40.695 1.00 36.47  ? 58  LEU C O     1 
ATOM   7727  C  CB    . LEU E 5  58  ? -9.062  -3.710  38.698 1.00 45.61  ? 58  LEU C CB    1 
ATOM   7728  C  CG    . LEU E 5  58  ? -10.580 -3.535  38.748 1.00 49.33  ? 58  LEU C CG    1 
ATOM   7729  C  CD1   . LEU E 5  58  ? -11.338 -4.770  38.253 1.00 48.73  ? 58  LEU C CD1   1 
ATOM   7730  C  CD2   . LEU E 5  58  ? -10.990 -3.228  40.174 1.00 49.65  ? 58  LEU C CD2   1 
ATOM   7731  N  N     . THR E 5  59  ? -6.069  -2.829  38.539 1.00 40.17  ? 59  THR C N     1 
ATOM   7732  C  CA    . THR E 5  59  ? -4.724  -3.127  38.969 1.00 45.04  ? 59  THR C CA    1 
ATOM   7733  C  C     . THR E 5  59  ? -4.139  -1.928  39.694 1.00 47.03  ? 59  THR C C     1 
ATOM   7734  O  O     . THR E 5  59  ? -3.305  -2.083  40.618 1.00 47.25  ? 59  THR C O     1 
ATOM   7735  C  CB    . THR E 5  59  ? -3.801  -3.626  37.852 1.00 45.74  ? 59  THR C CB    1 
ATOM   7736  O  OG1   . THR E 5  59  ? -2.825  -2.635  37.519 1.00 51.50  ? 59  THR C OG1   1 
ATOM   7737  C  CG2   . THR E 5  59  ? -4.586  -4.068  36.656 1.00 42.89  ? 59  THR C CG2   1 
ATOM   7738  N  N     . ALA E 5  60  ? -4.594  -0.742  39.286 1.00 45.12  ? 60  ALA C N     1 
ATOM   7739  C  CA    . ALA E 5  60  ? -4.148  0.502   39.920 1.00 46.22  ? 60  ALA C CA    1 
ATOM   7740  C  C     . ALA E 5  60  ? -4.627  0.583   41.356 1.00 45.20  ? 60  ALA C C     1 
ATOM   7741  O  O     . ALA E 5  60  ? -3.847  0.919   42.276 1.00 40.15  ? 60  ALA C O     1 
ATOM   7742  C  CB    . ALA E 5  60  ? -4.630  1.703   39.131 1.00 46.37  ? 60  ALA C CB    1 
ATOM   7743  N  N     . GLU E 5  61  ? -5.891  0.210   41.567 1.00 44.84  ? 61  GLU C N     1 
ATOM   7744  C  CA    . GLU E 5  61  ? -6.404  0.147   42.944 1.00 46.75  ? 61  GLU C CA    1 
ATOM   7745  C  C     . GLU E 5  61  ? -5.572  -0.829  43.800 1.00 43.01  ? 61  GLU C C     1 
ATOM   7746  O  O     . GLU E 5  61  ? -5.176  -0.537  44.918 1.00 42.48  ? 61  GLU C O     1 
ATOM   7747  C  CB    . GLU E 5  61  ? -7.863  -0.234  42.927 1.00 49.78  ? 61  GLU C CB    1 
ATOM   7748  C  CG    . GLU E 5  61  ? -8.583  0.016   44.231 1.00 62.12  ? 61  GLU C CG    1 
ATOM   7749  C  CD    . GLU E 5  61  ? -8.849  1.480   44.521 1.00 72.59  ? 61  GLU C CD    1 
ATOM   7750  O  OE1   . GLU E 5  61  ? -9.513  2.189   43.694 1.00 72.64  ? 61  GLU C OE1   1 
ATOM   7751  O  OE2   . GLU E 5  61  ? -8.403  1.894   45.613 1.00 76.17  ? 61  GLU C OE2   1 
ATOM   7752  N  N     . ILE E 5  62  ? -5.265  -1.994  43.273 1.00 41.16  ? 62  ILE C N     1 
ATOM   7753  C  CA    . ILE E 5  62  ? -4.648  -2.954  44.142 1.00 41.60  ? 62  ILE C CA    1 
ATOM   7754  C  C     . ILE E 5  62  ? -3.206  -2.566  44.398 1.00 43.86  ? 62  ILE C C     1 
ATOM   7755  O  O     . ILE E 5  62  ? -2.717  -2.716  45.533 1.00 46.53  ? 62  ILE C O     1 
ATOM   7756  C  CB    . ILE E 5  62  ? -4.866  -4.391  43.667 1.00 42.60  ? 62  ILE C CB    1 
ATOM   7757  C  CG1   . ILE E 5  62  ? -4.150  -5.383  44.538 1.00 43.53  ? 62  ILE C CG1   1 
ATOM   7758  C  CG2   . ILE E 5  62  ? -4.374  -4.624  42.283 1.00 45.86  ? 62  ILE C CG2   1 
ATOM   7759  C  CD1   . ILE E 5  62  ? -4.940  -6.676  44.607 1.00 46.18  ? 62  ILE C CD1   1 
ATOM   7760  N  N     . LEU E 5  63  ? -2.554  -1.959  43.407 1.00 40.09  ? 63  LEU C N     1 
ATOM   7761  C  CA    . LEU E 5  63  ? -1.187  -1.422  43.651 1.00 38.49  ? 63  LEU C CA    1 
ATOM   7762  C  C     . LEU E 5  63  ? -1.191  -0.217  44.584 1.00 39.59  ? 63  LEU C C     1 
ATOM   7763  O  O     . LEU E 5  63  ? -0.324  -0.080  45.435 1.00 40.70  ? 63  LEU C O     1 
ATOM   7764  C  CB    . LEU E 5  63  ? -0.476  -1.097  42.351 1.00 39.37  ? 63  LEU C CB    1 
ATOM   7765  C  CG    . LEU E 5  63  ? -0.347  -2.313  41.413 1.00 41.59  ? 63  LEU C CG    1 
ATOM   7766  C  CD1   . LEU E 5  63  ? 0.113   -1.893  40.049 1.00 44.06  ? 63  LEU C CD1   1 
ATOM   7767  C  CD2   . LEU E 5  63  ? 0.602   -3.355  41.978 1.00 42.75  ? 63  LEU C CD2   1 
ATOM   7768  N  N     . GLU E 5  64  ? -2.196  0.633   44.511 1.00 40.11  ? 64  GLU C N     1 
ATOM   7769  C  CA    . GLU E 5  64  ? -2.202  1.685   45.472 1.00 41.49  ? 64  GLU C CA    1 
ATOM   7770  C  C     . GLU E 5  64  ? -2.120  1.043   46.827 1.00 43.59  ? 64  GLU C C     1 
ATOM   7771  O  O     . GLU E 5  64  ? -1.196  1.272   47.621 1.00 47.87  ? 64  GLU C O     1 
ATOM   7772  C  CB    . GLU E 5  64  ? -3.427  2.539   45.335 1.00 45.36  ? 64  GLU C CB    1 
ATOM   7773  C  CG    . GLU E 5  64  ? -3.446  3.685   46.328 1.00 53.20  ? 64  GLU C CG    1 
ATOM   7774  C  CD    . GLU E 5  64  ? -2.557  4.865   45.981 1.00 55.00  ? 64  GLU C CD    1 
ATOM   7775  O  OE1   . GLU E 5  64  ? -2.818  5.949   46.516 1.00 65.73  ? 64  GLU C OE1   1 
ATOM   7776  O  OE2   . GLU E 5  64  ? -1.632  4.745   45.176 1.00 58.96  ? 64  GLU C OE2   1 
ATOM   7777  N  N     . LEU E 5  65  ? -3.046  0.146   47.088 1.00 48.94  ? 65  LEU C N     1 
ATOM   7778  C  CA    . LEU E 5  65  ? -3.178  -0.368  48.460 1.00 44.85  ? 65  LEU C CA    1 
ATOM   7779  C  C     . LEU E 5  65  ? -2.026  -1.246  48.906 1.00 48.63  ? 65  LEU C C     1 
ATOM   7780  O  O     . LEU E 5  65  ? -1.651  -1.234  50.103 1.00 49.76  ? 65  LEU C O     1 
ATOM   7781  C  CB    . LEU E 5  65  ? -4.471  -1.114  48.590 1.00 41.69  ? 65  LEU C CB    1 
ATOM   7782  C  CG    . LEU E 5  65  ? -5.664  -0.174  48.364 1.00 43.17  ? 65  LEU C CG    1 
ATOM   7783  C  CD1   . LEU E 5  65  ? -6.928  -1.008  48.201 1.00 47.35  ? 65  LEU C CD1   1 
ATOM   7784  C  CD2   . LEU E 5  65  ? -5.819  0.815   49.506 1.00 39.68  ? 65  LEU C CD2   1 
ATOM   7785  N  N     . ALA E 5  66  ? -1.459  -1.994  47.955 1.00 41.90  ? 66  ALA C N     1 
ATOM   7786  C  CA    . ALA E 5  66  ? -0.338  -2.834  48.275 1.00 45.16  ? 66  ALA C CA    1 
ATOM   7787  C  C     . ALA E 5  66  ? 0.887   -1.982  48.538 1.00 44.23  ? 66  ALA C C     1 
ATOM   7788  O  O     . ALA E 5  66  ? 1.547   -2.119  49.570 1.00 44.19  ? 66  ALA C O     1 
ATOM   7789  C  CB    . ALA E 5  66  ? -0.077  -3.808  47.148 1.00 49.46  ? 66  ALA C CB    1 
ATOM   7790  N  N     . GLY E 5  67  ? 1.160   -1.067  47.627 1.00 42.57  ? 67  GLY C N     1 
ATOM   7791  C  CA    . GLY E 5  67  ? 2.154   -0.031  47.888 1.00 44.57  ? 67  GLY C CA    1 
ATOM   7792  C  C     . GLY E 5  67  ? 2.094   0.547   49.294 1.00 41.58  ? 67  GLY C C     1 
ATOM   7793  O  O     . GLY E 5  67  ? 3.139   0.807   49.918 1.00 43.64  ? 67  GLY C O     1 
ATOM   7794  N  N     . ASN E 5  68  ? 0.895   0.764   49.819 1.00 39.33  ? 68  ASN C N     1 
ATOM   7795  C  CA    . ASN E 5  68  ? 0.833   1.315   51.162 1.00 40.33  ? 68  ASN C CA    1 
ATOM   7796  C  C     . ASN E 5  68  ? 1.261   0.353   52.208 1.00 45.06  ? 68  ASN C C     1 
ATOM   7797  O  O     . ASN E 5  68  ? 1.872   0.753   53.222 1.00 51.32  ? 68  ASN C O     1 
ATOM   7798  C  CB    . ASN E 5  68  ? -0.548  1.802   51.491 1.00 42.66  ? 68  ASN C CB    1 
ATOM   7799  C  CG    . ASN E 5  68  ? -0.920  3.016   50.688 1.00 47.65  ? 68  ASN C CG    1 
ATOM   7800  O  OD1   . ASN E 5  68  ? -0.055  3.680   50.100 1.00 48.93  ? 68  ASN C OD1   1 
ATOM   7801  N  ND2   . ASN E 5  68  ? -2.217  3.316   50.644 1.00 49.08  ? 68  ASN C ND2   1 
ATOM   7802  N  N     . ALA E 5  69  ? 0.937   -0.922  52.019 1.00 44.40  ? 69  ALA C N     1 
ATOM   7803  C  CA    . ALA E 5  69  ? 1.313   -1.886  53.055 1.00 45.98  ? 69  ALA C CA    1 
ATOM   7804  C  C     . ALA E 5  69  ? 2.796   -2.076  52.983 1.00 45.91  ? 69  ALA C C     1 
ATOM   7805  O  O     . ALA E 5  69  ? 3.454   -2.120  54.029 1.00 45.35  ? 69  ALA C O     1 
ATOM   7806  C  CB    . ALA E 5  69  ? 0.609   -3.202  52.899 1.00 47.58  ? 69  ALA C CB    1 
ATOM   7807  N  N     . ALA E 5  70  ? 3.320   -2.163  51.759 1.00 41.66  ? 70  ALA C N     1 
ATOM   7808  C  CA    . ALA E 5  70  ? 4.761   -2.104  51.577 1.00 47.43  ? 70  ALA C CA    1 
ATOM   7809  C  C     . ALA E 5  70  ? 5.317   -0.988  52.467 1.00 50.94  ? 70  ALA C C     1 
ATOM   7810  O  O     . ALA E 5  70  ? 6.220   -1.213  53.270 1.00 53.20  ? 70  ALA C O     1 
ATOM   7811  C  CB    . ALA E 5  70  ? 5.111   -1.850  50.124 1.00 45.12  ? 70  ALA C CB    1 
ATOM   7812  N  N     . ARG E 5  71  ? 4.739   0.205   52.352 1.00 53.33  ? 71  ARG C N     1 
ATOM   7813  C  CA    . ARG E 5  71  ? 5.291   1.345   53.033 1.00 53.20  ? 71  ARG C CA    1 
ATOM   7814  C  C     . ARG E 5  71  ? 5.061   1.247   54.521 1.00 54.97  ? 71  ARG C C     1 
ATOM   7815  O  O     . ARG E 5  71  ? 5.981   1.454   55.304 1.00 55.02  ? 71  ARG C O     1 
ATOM   7816  C  CB    . ARG E 5  71  ? 4.718   2.628   52.503 1.00 55.47  ? 71  ARG C CB    1 
ATOM   7817  C  CG    . ARG E 5  71  ? 5.569   3.802   52.909 1.00 63.21  ? 71  ARG C CG    1 
ATOM   7818  C  CD    . ARG E 5  71  ? 4.792   5.092   53.092 1.00 73.82  ? 71  ARG C CD    1 
ATOM   7819  N  NE    . ARG E 5  71  ? 5.019   5.999   51.959 1.00 88.27  ? 71  ARG C NE    1 
ATOM   7820  C  CZ    . ARG E 5  71  ? 5.111   7.331   52.040 1.00 95.22  ? 71  ARG C CZ    1 
ATOM   7821  N  NH1   . ARG E 5  71  ? 5.014   7.969   53.213 1.00 100.66 ? 71  ARG C NH1   1 
ATOM   7822  N  NH2   . ARG E 5  71  ? 5.307   8.038   50.933 1.00 90.52  ? 71  ARG C NH2   1 
ATOM   7823  N  N     . ASP E 5  72  ? 3.836   0.936   54.921 1.00 57.06  ? 72  ASP C N     1 
ATOM   7824  C  CA    . ASP E 5  72  ? 3.581   0.593   56.314 1.00 60.23  ? 72  ASP C CA    1 
ATOM   7825  C  C     . ASP E 5  72  ? 4.611   -0.433  56.922 1.00 64.93  ? 72  ASP C C     1 
ATOM   7826  O  O     . ASP E 5  72  ? 4.852   -0.403  58.117 1.00 63.98  ? 72  ASP C O     1 
ATOM   7827  C  CB    . ASP E 5  72  ? 2.162   0.022   56.457 1.00 62.79  ? 72  ASP C CB    1 
ATOM   7828  C  CG    . ASP E 5  72  ? 1.069   1.047   56.227 1.00 65.71  ? 72  ASP C CG    1 
ATOM   7829  O  OD1   . ASP E 5  72  ? 1.271   2.265   56.482 1.00 70.29  ? 72  ASP C OD1   1 
ATOM   7830  O  OD2   . ASP E 5  72  ? -0.029  0.616   55.810 1.00 62.80  ? 72  ASP C OD2   1 
ATOM   7831  N  N     . ASN E 5  73  ? 5.194   -1.346  56.135 1.00 67.77  ? 73  ASN C N     1 
ATOM   7832  C  CA    . ASN E 5  73  ? 6.196   -2.307  56.671 1.00 70.09  ? 73  ASN C CA    1 
ATOM   7833  C  C     . ASN E 5  73  ? 7.628   -1.921  56.378 1.00 71.45  ? 73  ASN C C     1 
ATOM   7834  O  O     . ASN E 5  73  ? 8.501   -2.774  56.429 1.00 73.84  ? 73  ASN C O     1 
ATOM   7835  C  CB    . ASN E 5  73  ? 5.969   -3.727  56.129 1.00 74.14  ? 73  ASN C CB    1 
ATOM   7836  C  CG    . ASN E 5  73  ? 4.707   -4.359  56.666 1.00 82.75  ? 73  ASN C CG    1 
ATOM   7837  O  OD1   . ASN E 5  73  ? 4.733   -4.969  57.729 1.00 93.30  ? 73  ASN C OD1   1 
ATOM   7838  N  ND2   . ASN E 5  73  ? 3.586   -4.209  55.944 1.00 80.48  ? 73  ASN C ND2   1 
ATOM   7839  N  N     . LYS E 5  74  ? 7.863   -0.649  56.060 1.00 70.21  ? 74  LYS C N     1 
ATOM   7840  C  CA    . LYS E 5  74  ? 9.207   -0.122  55.810 1.00 69.28  ? 74  LYS C CA    1 
ATOM   7841  C  C     . LYS E 5  74  ? 9.956   -0.817  54.682 1.00 63.17  ? 74  LYS C C     1 
ATOM   7842  O  O     . LYS E 5  74  ? 11.184  -1.002  54.743 1.00 54.90  ? 74  LYS C O     1 
ATOM   7843  C  CB    . LYS E 5  74  ? 10.020  -0.140  57.102 1.00 83.08  ? 74  LYS C CB    1 
ATOM   7844  C  CG    . LYS E 5  74  ? 9.673   1.030   58.012 1.00 97.38  ? 74  LYS C CG    1 
ATOM   7845  C  CD    . LYS E 5  74  ? 10.346  0.923   59.367 1.00 105.50 ? 74  LYS C CD    1 
ATOM   7846  C  CE    . LYS E 5  74  ? 10.032  2.153   60.200 1.00 117.68 ? 74  LYS C CE    1 
ATOM   7847  N  NZ    . LYS E 5  74  ? 10.059  1.855   61.661 1.00 123.62 ? 74  LYS C NZ    1 
ATOM   7848  N  N     . LYS E 5  75  ? 9.202   -1.181  53.645 1.00 57.72  ? 75  LYS C N     1 
ATOM   7849  C  CA    . LYS E 5  75  ? 9.764   -1.780  52.444 1.00 55.98  ? 75  LYS C CA    1 
ATOM   7850  C  C     . LYS E 5  75  ? 9.339   -0.976  51.248 1.00 54.78  ? 75  LYS C C     1 
ATOM   7851  O  O     . LYS E 5  75  ? 8.390   -0.177  51.300 1.00 60.16  ? 75  LYS C O     1 
ATOM   7852  C  CB    . LYS E 5  75  ? 9.275   -3.208  52.244 1.00 56.21  ? 75  LYS C CB    1 
ATOM   7853  C  CG    . LYS E 5  75  ? 9.246   -4.035  53.501 1.00 56.92  ? 75  LYS C CG    1 
ATOM   7854  C  CD    . LYS E 5  75  ? 10.557  -4.754  53.689 1.00 59.57  ? 75  LYS C CD    1 
ATOM   7855  C  CE    . LYS E 5  75  ? 10.524  -5.583  54.962 1.00 64.68  ? 75  LYS C CE    1 
ATOM   7856  N  NZ    . LYS E 5  75  ? 10.646  -4.759  56.184 1.00 70.73  ? 75  LYS C NZ    1 
ATOM   7857  N  N     . THR E 5  76  ? 10.045  -1.274  50.176 1.00 48.14  ? 76  THR C N     1 
ATOM   7858  C  CA    . THR E 5  76  ? 10.081  -0.546  48.942 1.00 48.17  ? 76  THR C CA    1 
ATOM   7859  C  C     . THR E 5  76  ? 9.716   -1.426  47.771 1.00 50.55  ? 76  THR C C     1 
ATOM   7860  O  O     . THR E 5  76  ? 9.466   -0.936  46.664 1.00 49.71  ? 76  THR C O     1 
ATOM   7861  C  CB    . THR E 5  76  ? 11.552  -0.088  48.756 1.00 54.72  ? 76  THR C CB    1 
ATOM   7862  O  OG1   . THR E 5  76  ? 11.675  1.241   49.276 1.00 53.38  ? 76  THR C OG1   1 
ATOM   7863  C  CG2   . THR E 5  76  ? 12.073  -0.183  47.283 1.00 50.80  ? 76  THR C CG2   1 
ATOM   7864  N  N     . ARG E 5  77  ? 9.759   -2.741  47.984 1.00 53.88  ? 77  ARG C N     1 
ATOM   7865  C  CA    . ARG E 5  77  ? 9.383   -3.680  46.968 1.00 51.39  ? 77  ARG C CA    1 
ATOM   7866  C  C     . ARG E 5  77  ? 8.199   -4.472  47.479 1.00 46.91  ? 77  ARG C C     1 
ATOM   7867  O  O     . ARG E 5  77  ? 8.273   -5.118  48.517 1.00 52.81  ? 77  ARG C O     1 
ATOM   7868  C  CB    . ARG E 5  77  ? 10.551  -4.590  46.677 1.00 59.01  ? 77  ARG C CB    1 
ATOM   7869  C  CG    . ARG E 5  77  ? 10.230  -5.710  45.697 1.00 65.53  ? 77  ARG C CG    1 
ATOM   7870  C  CD    . ARG E 5  77  ? 11.435  -6.607  45.620 1.00 68.22  ? 77  ARG C CD    1 
ATOM   7871  N  NE    . ARG E 5  77  ? 12.569  -5.865  45.077 1.00 73.56  ? 77  ARG C NE    1 
ATOM   7872  C  CZ    . ARG E 5  77  ? 13.792  -5.820  45.602 1.00 80.17  ? 77  ARG C CZ    1 
ATOM   7873  N  NH1   . ARG E 5  77  ? 14.102  -6.490  46.713 1.00 84.38  ? 77  ARG C NH1   1 
ATOM   7874  N  NH2   . ARG E 5  77  ? 14.727  -5.098  44.994 1.00 84.14  ? 77  ARG C NH2   1 
ATOM   7875  N  N     . ILE E 5  78  ? 7.104   -4.387  46.746 1.00 45.46  ? 78  ILE C N     1 
ATOM   7876  C  CA    . ILE E 5  78  ? 5.877   -5.107  47.047 1.00 45.86  ? 78  ILE C CA    1 
ATOM   7877  C  C     . ILE E 5  78  ? 6.042   -6.595  46.782 1.00 49.30  ? 78  ILE C C     1 
ATOM   7878  O  O     . ILE E 5  78  ? 6.359   -6.991  45.664 1.00 53.28  ? 78  ILE C O     1 
ATOM   7879  C  CB    . ILE E 5  78  ? 4.754   -4.673  46.090 1.00 47.34  ? 78  ILE C CB    1 
ATOM   7880  C  CG1   . ILE E 5  78  ? 4.250   -3.274  46.428 1.00 48.52  ? 78  ILE C CG1   1 
ATOM   7881  C  CG2   . ILE E 5  78  ? 3.614   -5.671  46.099 1.00 47.59  ? 78  ILE C CG2   1 
ATOM   7882  C  CD1   . ILE E 5  78  ? 3.368   -2.677  45.350 1.00 46.39  ? 78  ILE C CD1   1 
ATOM   7883  N  N     . ILE E 5  79  ? 5.749   -7.409  47.783 1.00 49.78  ? 79  ILE C N     1 
ATOM   7884  C  CA    . ILE E 5  79  ? 5.723   -8.853  47.671 1.00 46.17  ? 79  ILE C CA    1 
ATOM   7885  C  C     . ILE E 5  79  ? 4.272   -9.283  47.924 1.00 45.66  ? 79  ILE C C     1 
ATOM   7886  O  O     . ILE E 5  79  ? 3.419   -8.440  48.216 1.00 40.52  ? 79  ILE C O     1 
ATOM   7887  C  CB    . ILE E 5  79  ? 6.688   -9.460  48.688 1.00 42.80  ? 79  ILE C CB    1 
ATOM   7888  C  CG1   . ILE E 5  79  ? 6.192   -9.226  50.111 1.00 43.83  ? 79  ILE C CG1   1 
ATOM   7889  C  CG2   . ILE E 5  79  ? 8.017   -8.771  48.539 1.00 52.74  ? 79  ILE C CG2   1 
ATOM   7890  C  CD1   . ILE E 5  79  ? 7.127   -9.698  51.203 1.00 39.01  ? 79  ILE C CD1   1 
ATOM   7891  N  N     . PRO E 5  80  ? 3.986   -10.594 47.848 1.00 47.04  ? 80  PRO C N     1 
ATOM   7892  C  CA    . PRO E 5  80  ? 2.602   -11.004 47.912 1.00 42.23  ? 80  PRO C CA    1 
ATOM   7893  C  C     . PRO E 5  80  ? 2.011   -10.756 49.248 1.00 38.87  ? 80  PRO C C     1 
ATOM   7894  O  O     . PRO E 5  80  ? 0.811   -10.506 49.323 1.00 40.59  ? 80  PRO C O     1 
ATOM   7895  C  CB    . PRO E 5  80  ? 2.658   -12.503 47.612 1.00 45.90  ? 80  PRO C CB    1 
ATOM   7896  C  CG    . PRO E 5  80  ? 3.919   -12.675 46.802 1.00 45.47  ? 80  PRO C CG    1 
ATOM   7897  C  CD    . PRO E 5  80  ? 4.848   -11.759 47.575 1.00 51.15  ? 80  PRO C CD    1 
ATOM   7898  N  N     . ARG E 5  81  ? 2.787   -10.773 50.309 1.00 35.03  ? 81  ARG C N     1 
ATOM   7899  C  CA    . ARG E 5  81  ? 2.156   -10.383 51.574 1.00 39.24  ? 81  ARG C CA    1 
ATOM   7900  C  C     . ARG E 5  81  ? 1.536   -8.997  51.497 1.00 39.32  ? 81  ARG C C     1 
ATOM   7901  O  O     . ARG E 5  81  ? 0.499   -8.734  52.091 1.00 48.51  ? 81  ARG C O     1 
ATOM   7902  C  CB    . ARG E 5  81  ? 3.102   -10.431 52.779 1.00 40.00  ? 81  ARG C CB    1 
ATOM   7903  C  CG    . ARG E 5  81  ? 2.493   -9.683  53.939 1.00 40.27  ? 81  ARG C CG    1 
ATOM   7904  C  CD    . ARG E 5  81  ? 2.529   -10.383 55.281 1.00 45.40  ? 81  ARG C CD    1 
ATOM   7905  N  NE    . ARG E 5  81  ? 1.313   -11.128 55.501 1.00 52.09  ? 81  ARG C NE    1 
ATOM   7906  C  CZ    . ARG E 5  81  ? 0.666   -11.265 56.663 1.00 52.69  ? 81  ARG C CZ    1 
ATOM   7907  N  NH1   . ARG E 5  81  ? 1.058   -10.687 57.771 1.00 45.85  ? 81  ARG C NH1   1 
ATOM   7908  N  NH2   . ARG E 5  81  ? -0.398  -12.037 56.705 1.00 56.84  ? 81  ARG C NH2   1 
ATOM   7909  N  N     . HIS E 5  82  ? 2.147   -8.089  50.771 1.00 42.27  ? 82  HIS C N     1 
ATOM   7910  C  CA    . HIS E 5  82  ? 1.588   -6.729  50.693 1.00 39.64  ? 82  HIS C CA    1 
ATOM   7911  C  C     . HIS E 5  82  ? 0.319   -6.764  49.901 1.00 38.35  ? 82  HIS C C     1 
ATOM   7912  O  O     . HIS E 5  82  ? -0.629  -6.075  50.265 1.00 37.68  ? 82  HIS C O     1 
ATOM   7913  C  CB    . HIS E 5  82  ? 2.600   -5.715  50.162 1.00 36.41  ? 82  HIS C CB    1 
ATOM   7914  C  CG    . HIS E 5  82  ? 3.882   -5.737  50.932 1.00 37.36  ? 82  HIS C CG    1 
ATOM   7915  N  ND1   . HIS E 5  82  ? 5.122   -5.780  50.328 1.00 43.51  ? 82  HIS C ND1   1 
ATOM   7916  C  CD2   . HIS E 5  82  ? 4.116   -5.831  52.262 1.00 40.67  ? 82  HIS C CD2   1 
ATOM   7917  C  CE1   . HIS E 5  82  ? 6.068   -5.834  51.254 1.00 45.57  ? 82  HIS C CE1   1 
ATOM   7918  N  NE2   . HIS E 5  82  ? 5.484   -5.876  52.443 1.00 42.89  ? 82  HIS C NE2   1 
ATOM   7919  N  N     . LEU E 5  83  ? 0.255   -7.594  48.863 1.00 37.66  ? 83  LEU C N     1 
ATOM   7920  C  CA    . LEU E 5  83  ? -1.033  -7.758  48.169 1.00 40.77  ? 83  LEU C CA    1 
ATOM   7921  C  C     . LEU E 5  83  ? -2.155  -8.365  49.088 1.00 40.75  ? 83  LEU C C     1 
ATOM   7922  O  O     . LEU E 5  83  ? -3.351  -8.037  49.012 1.00 42.39  ? 83  LEU C O     1 
ATOM   7923  C  CB    . LEU E 5  83  ? -0.842  -8.619  46.948 1.00 39.81  ? 83  LEU C CB    1 
ATOM   7924  C  CG    . LEU E 5  83  ? 0.044   -8.038  45.845 1.00 42.41  ? 83  LEU C CG    1 
ATOM   7925  C  CD1   . LEU E 5  83  ? 0.305   -9.077  44.758 1.00 43.76  ? 83  LEU C CD1   1 
ATOM   7926  C  CD2   . LEU E 5  83  ? -0.613  -6.856  45.184 1.00 42.01  ? 83  LEU C CD2   1 
ATOM   7927  N  N     . GLN E 5  84  ? -1.764  -9.236  49.984 1.00 37.26  ? 84  GLN C N     1 
ATOM   7928  C  CA    . GLN E 5  84  ? -2.743  -9.912  50.766 1.00 39.43  ? 84  GLN C CA    1 
ATOM   7929  C  C     . GLN E 5  84  ? -3.228  -8.896  51.812 1.00 42.74  ? 84  GLN C C     1 
ATOM   7930  O  O     . GLN E 5  84  ? -4.435  -8.688  52.009 1.00 44.18  ? 84  GLN C O     1 
ATOM   7931  C  CB    . GLN E 5  84  ? -2.112  -11.156 51.349 1.00 38.34  ? 84  GLN C CB    1 
ATOM   7932  C  CG    . GLN E 5  84  ? -2.889  -11.774 52.460 1.00 41.57  ? 84  GLN C CG    1 
ATOM   7933  C  CD    . GLN E 5  84  ? -4.120  -12.584 52.006 1.00 41.34  ? 84  GLN C CD    1 
ATOM   7934  O  OE1   . GLN E 5  84  ? -4.655  -12.434 50.885 1.00 36.91  ? 84  GLN C OE1   1 
ATOM   7935  N  NE2   . GLN E 5  84  ? -4.572  -13.458 52.913 1.00 35.96  ? 84  GLN C NE2   1 
ATOM   7936  N  N     . LEU E 5  85  ? -2.298  -8.201  52.433 1.00 40.94  ? 85  LEU C N     1 
ATOM   7937  C  CA    . LEU E 5  85  ? -2.699  -7.157  53.354 1.00 44.91  ? 85  LEU C CA    1 
ATOM   7938  C  C     . LEU E 5  85  ? -3.656  -6.173  52.691 1.00 44.75  ? 85  LEU C C     1 
ATOM   7939  O  O     . LEU E 5  85  ? -4.694  -5.784  53.255 1.00 37.85  ? 85  LEU C O     1 
ATOM   7940  C  CB    . LEU E 5  85  ? -1.469  -6.392  53.840 1.00 47.94  ? 85  LEU C CB    1 
ATOM   7941  C  CG    . LEU E 5  85  ? -0.607  -7.235  54.796 1.00 51.27  ? 85  LEU C CG    1 
ATOM   7942  C  CD1   . LEU E 5  85  ? 0.652   -6.513  55.230 1.00 47.40  ? 85  LEU C CD1   1 
ATOM   7943  C  CD2   . LEU E 5  85  ? -1.411  -7.690  56.006 1.00 50.28  ? 85  LEU C CD2   1 
ATOM   7944  N  N     . ALA E 5  86  ? -3.292  -5.753  51.488 1.00 41.79  ? 86  ALA C N     1 
ATOM   7945  C  CA    . ALA E 5  86  ? -4.119  -4.796  50.773 1.00 43.25  ? 86  ALA C CA    1 
ATOM   7946  C  C     . ALA E 5  86  ? -5.518  -5.351  50.517 1.00 45.51  ? 86  ALA C C     1 
ATOM   7947  O  O     . ALA E 5  86  ? -6.509  -4.726  50.863 1.00 42.19  ? 86  ALA C O     1 
ATOM   7948  C  CB    . ALA E 5  86  ? -3.459  -4.398  49.459 1.00 44.35  ? 86  ALA C CB    1 
ATOM   7949  N  N     . VAL E 5  87  ? -5.582  -6.542  49.923 1.00 46.57  ? 87  VAL C N     1 
ATOM   7950  C  CA    . VAL E 5  87  ? -6.859  -7.126  49.551 1.00 43.59  ? 87  VAL C CA    1 
ATOM   7951  C  C     . VAL E 5  87  ? -7.752  -7.365  50.764 1.00 42.91  ? 87  VAL C C     1 
ATOM   7952  O  O     . VAL E 5  87  ? -8.917  -6.974  50.789 1.00 42.95  ? 87  VAL C O     1 
ATOM   7953  C  CB    . VAL E 5  87  ? -6.621  -8.432  48.785 1.00 44.67  ? 87  VAL C CB    1 
ATOM   7954  C  CG1   . VAL E 5  87  ? -7.907  -9.244  48.651 1.00 49.35  ? 87  VAL C CG1   1 
ATOM   7955  C  CG2   . VAL E 5  87  ? -6.102  -8.104  47.400 1.00 41.96  ? 87  VAL C CG2   1 
ATOM   7956  N  N     . ARG E 5  88  ? -7.196  -8.007  51.778 1.00 38.48  ? 88  ARG C N     1 
ATOM   7957  C  CA    . ARG E 5  88  ? -7.998  -8.419  52.864 1.00 36.44  ? 88  ARG C CA    1 
ATOM   7958  C  C     . ARG E 5  88  ? -8.409  -7.263  53.746 1.00 38.95  ? 88  ARG C C     1 
ATOM   7959  O  O     . ARG E 5  88  ? -9.395  -7.385  54.449 1.00 44.70  ? 88  ARG C O     1 
ATOM   7960  C  CB    . ARG E 5  88  ? -7.256  -9.467  53.691 1.00 36.35  ? 88  ARG C CB    1 
ATOM   7961  C  CG    . ARG E 5  88  ? -6.891  -10.763 52.934 1.00 37.61  ? 88  ARG C CG    1 
ATOM   7962  C  CD    . ARG E 5  88  ? -8.059  -11.339 52.124 1.00 35.78  ? 88  ARG C CD    1 
ATOM   7963  N  NE    . ARG E 5  88  ? -7.657  -12.170 50.983 1.00 32.33  ? 88  ARG C NE    1 
ATOM   7964  C  CZ    . ARG E 5  88  ? -8.513  -12.534 50.035 1.00 34.49  ? 88  ARG C CZ    1 
ATOM   7965  N  NH1   . ARG E 5  88  ? -9.789  -12.156 50.074 1.00 34.29  ? 88  ARG C NH1   1 
ATOM   7966  N  NH2   . ARG E 5  88  ? -8.129  -13.299 49.042 1.00 38.61  ? 88  ARG C NH2   1 
ATOM   7967  N  N     . ASN E 5  89  ? -7.655  -6.174  53.772 1.00 36.80  ? 89  ASN C N     1 
ATOM   7968  C  CA    . ASN E 5  89  ? -8.047  -5.003  54.606 1.00 40.02  ? 89  ASN C CA    1 
ATOM   7969  C  C     . ASN E 5  89  ? -9.011  -4.062  53.896 1.00 42.61  ? 89  ASN C C     1 
ATOM   7970  O  O     . ASN E 5  89  ? -9.449  -3.114  54.514 1.00 47.26  ? 89  ASN C O     1 
ATOM   7971  C  CB    . ASN E 5  89  ? -6.854  -4.159  55.091 1.00 37.19  ? 89  ASN C CB    1 
ATOM   7972  C  CG    . ASN E 5  89  ? -6.106  -4.813  56.233 1.00 40.10  ? 89  ASN C CG    1 
ATOM   7973  O  OD1   . ASN E 5  89  ? -6.711  -5.195  57.232 1.00 39.59  ? 89  ASN C OD1   1 
ATOM   7974  N  ND2   . ASN E 5  89  ? -4.781  -4.960  56.091 1.00 41.57  ? 89  ASN C ND2   1 
ATOM   7975  N  N     . ASP E 5  90  ? -9.339  -4.351  52.633 1.00 40.07  ? 90  ASP C N     1 
ATOM   7976  C  CA    . ASP E 5  90  ? -10.296 -3.616  51.853 1.00 41.82  ? 90  ASP C CA    1 
ATOM   7977  C  C     . ASP E 5  90  ? -11.590 -4.383  51.621 1.00 48.06  ? 90  ASP C C     1 
ATOM   7978  O  O     . ASP E 5  90  ? -11.624 -5.351  50.878 1.00 55.25  ? 90  ASP C O     1 
ATOM   7979  C  CB    . ASP E 5  90  ? -9.707  -3.333  50.501 1.00 42.67  ? 90  ASP C CB    1 
ATOM   7980  C  CG    . ASP E 5  90  ? -10.612 -2.446  49.667 1.00 53.08  ? 90  ASP C CG    1 
ATOM   7981  O  OD1   . ASP E 5  90  ? -10.741 -1.241  50.020 1.00 50.37  ? 90  ASP C OD1   1 
ATOM   7982  O  OD2   . ASP E 5  90  ? -11.193 -2.953  48.671 1.00 54.88  ? 90  ASP C OD2   1 
ATOM   7983  N  N     . GLU E 5  91  ? -12.672 -3.932  52.218 1.00 54.26  ? 91  GLU C N     1 
ATOM   7984  C  CA    . GLU E 5  91  ? -13.949 -4.647  52.148 1.00 52.19  ? 91  GLU C CA    1 
ATOM   7985  C  C     . GLU E 5  91  ? -14.272 -5.223  50.784 1.00 51.76  ? 91  GLU C C     1 
ATOM   7986  O  O     . GLU E 5  91  ? -14.707 -6.373  50.660 1.00 56.52  ? 91  GLU C O     1 
ATOM   7987  C  CB    . GLU E 5  91  ? -15.062 -3.676  52.474 1.00 60.85  ? 91  GLU C CB    1 
ATOM   7988  C  CG    . GLU E 5  91  ? -16.020 -4.118  53.552 1.00 73.33  ? 91  GLU C CG    1 
ATOM   7989  C  CD    . GLU E 5  91  ? -17.353 -3.427  53.346 1.00 87.22  ? 91  GLU C CD    1 
ATOM   7990  O  OE1   . GLU E 5  91  ? -18.130 -3.877  52.469 1.00 85.08  ? 91  GLU C OE1   1 
ATOM   7991  O  OE2   . GLU E 5  91  ? -17.591 -2.400  54.015 1.00 92.53  ? 91  GLU C OE2   1 
ATOM   7992  N  N     . GLU E 5  92  ? -14.087 -4.381  49.774 1.00 52.42  ? 92  GLU C N     1 
ATOM   7993  C  CA    . GLU E 5  92  ? -14.593 -4.599  48.416 1.00 46.57  ? 92  GLU C CA    1 
ATOM   7994  C  C     . GLU E 5  92  ? -13.672 -5.447  47.573 1.00 46.87  ? 92  GLU C C     1 
ATOM   7995  O  O     . GLU E 5  92  ? -14.143 -6.268  46.801 1.00 41.72  ? 92  GLU C O     1 
ATOM   7996  C  CB    . GLU E 5  92  ? -14.769 -3.250  47.700 1.00 46.98  ? 92  GLU C CB    1 
ATOM   7997  C  CG    . GLU E 5  92  ? -15.948 -2.428  48.197 1.00 47.05  ? 92  GLU C CG    1 
ATOM   7998  C  CD    . GLU E 5  92  ? -16.532 -1.498  47.139 1.00 55.56  ? 92  GLU C CD    1 
ATOM   7999  O  OE1   . GLU E 5  92  ? -15.769 -0.968  46.287 1.00 50.95  ? 92  GLU C OE1   1 
ATOM   8000  O  OE2   . GLU E 5  92  ? -17.773 -1.277  47.172 1.00 65.09  ? 92  GLU C OE2   1 
ATOM   8001  N  N     . LEU E 5  93  ? -12.360 -5.214  47.671 1.00 42.35  ? 93  LEU C N     1 
ATOM   8002  C  CA    . LEU E 5  93  ? -11.431 -6.127  47.071 1.00 39.86  ? 93  LEU C CA    1 
ATOM   8003  C  C     . LEU E 5  93  ? -11.495 -7.465  47.766 1.00 43.34  ? 93  LEU C C     1 
ATOM   8004  O  O     . LEU E 5  93  ? -11.417 -8.501  47.122 1.00 44.65  ? 93  LEU C O     1 
ATOM   8005  C  CB    . LEU E 5  93  ? -10.025 -5.618  47.171 1.00 42.26  ? 93  LEU C CB    1 
ATOM   8006  C  CG    . LEU E 5  93  ? -9.554  -4.564  46.164 1.00 41.11  ? 93  LEU C CG    1 
ATOM   8007  C  CD1   . LEU E 5  93  ? -8.105  -4.168  46.439 1.00 40.44  ? 93  LEU C CD1   1 
ATOM   8008  C  CD2   . LEU E 5  93  ? -9.725  -5.071  44.752 1.00 37.51  ? 93  LEU C CD2   1 
ATOM   8009  N  N     . ASN E 5  94  ? -11.624 -7.460  49.083 1.00 41.48  ? 94  ASN C N     1 
ATOM   8010  C  CA    . ASN E 5  94  ? -11.745 -8.713  49.773 1.00 41.40  ? 94  ASN C CA    1 
ATOM   8011  C  C     . ASN E 5  94  ? -12.893 -9.596  49.245 1.00 46.88  ? 94  ASN C C     1 
ATOM   8012  O  O     . ASN E 5  94  ? -12.795 -10.844 49.190 1.00 46.81  ? 94  ASN C O     1 
ATOM   8013  C  CB    . ASN E 5  94  ? -11.986 -8.488  51.227 1.00 39.05  ? 94  ASN C CB    1 
ATOM   8014  C  CG    . ASN E 5  94  ? -12.020 -9.778  51.965 1.00 39.23  ? 94  ASN C CG    1 
ATOM   8015  O  OD1   . ASN E 5  94  ? -11.105 -10.563 51.872 1.00 46.46  ? 94  ASN C OD1   1 
ATOM   8016  N  ND2   . ASN E 5  94  ? -13.070 -10.031 52.641 1.00 41.94  ? 94  ASN C ND2   1 
ATOM   8017  N  N     . LYS E 5  95  ? -13.986 -8.940  48.883 1.00 43.10  ? 95  LYS C N     1 
ATOM   8018  C  CA    . LYS E 5  95  ? -15.188 -9.642  48.493 1.00 43.73  ? 95  LYS C CA    1 
ATOM   8019  C  C     . LYS E 5  95  ? -14.962 -10.127 47.073 1.00 40.27  ? 95  LYS C C     1 
ATOM   8020  O  O     . LYS E 5  95  ? -15.170 -11.282 46.759 1.00 41.49  ? 95  LYS C O     1 
ATOM   8021  C  CB    . LYS E 5  95  ? -16.387 -8.692  48.600 1.00 46.52  ? 95  LYS C CB    1 
ATOM   8022  C  CG    . LYS E 5  95  ? -17.571 -9.088  47.770 1.00 57.09  ? 95  LYS C CG    1 
ATOM   8023  C  CD    . LYS E 5  95  ? -18.566 -9.900  48.562 1.00 70.19  ? 95  LYS C CD    1 
ATOM   8024  C  CE    . LYS E 5  95  ? -19.288 -10.899 47.670 1.00 80.89  ? 95  LYS C CE    1 
ATOM   8025  N  NZ    . LYS E 5  95  ? -20.589 -11.292 48.284 1.00 91.24  ? 95  LYS C NZ    1 
ATOM   8026  N  N     . LEU E 5  96  ? -14.502 -9.238  46.218 1.00 36.50  ? 96  LEU C N     1 
ATOM   8027  C  CA    . LEU E 5  96  ? -14.198 -9.600  44.853 1.00 39.67  ? 96  LEU C CA    1 
ATOM   8028  C  C     . LEU E 5  96  ? -13.320 -10.805 44.807 1.00 42.09  ? 96  LEU C C     1 
ATOM   8029  O  O     . LEU E 5  96  ? -13.474 -11.633 43.933 1.00 44.65  ? 96  LEU C O     1 
ATOM   8030  C  CB    . LEU E 5  96  ? -13.460 -8.466  44.154 1.00 41.54  ? 96  LEU C CB    1 
ATOM   8031  C  CG    . LEU E 5  96  ? -13.030 -8.722  42.706 1.00 44.47  ? 96  LEU C CG    1 
ATOM   8032  C  CD1   . LEU E 5  96  ? -14.222 -9.037  41.818 1.00 47.20  ? 96  LEU C CD1   1 
ATOM   8033  C  CD2   . LEU E 5  96  ? -12.258 -7.541  42.125 1.00 42.69  ? 96  LEU C CD2   1 
ATOM   8034  N  N     . LEU E 5  97  ? -12.395 -10.887 45.763 1.00 44.42  ? 97  LEU C N     1 
ATOM   8035  C  CA    . LEU E 5  97  ? -11.426 -11.951 45.818 1.00 42.15  ? 97  LEU C CA    1 
ATOM   8036  C  C     . LEU E 5  97  ? -11.664 -12.917 46.965 1.00 42.40  ? 97  LEU C C     1 
ATOM   8037  O  O     . LEU E 5  97  ? -10.706 -13.540 47.511 1.00 39.89  ? 97  LEU C O     1 
ATOM   8038  C  CB    . LEU E 5  97  ? -10.053 -11.336 45.965 1.00 43.90  ? 97  LEU C CB    1 
ATOM   8039  C  CG    . LEU E 5  97  ? -9.607  -10.418 44.831 1.00 46.18  ? 97  LEU C CG    1 
ATOM   8040  C  CD1   . LEU E 5  97  ? -8.187  -9.944  45.079 1.00 46.43  ? 97  LEU C CD1   1 
ATOM   8041  C  CD2   . LEU E 5  97  ? -9.693  -11.113 43.493 1.00 46.60  ? 97  LEU C CD2   1 
ATOM   8042  N  N     . GLY E 5  98  ? -12.938 -13.073 47.308 1.00 41.36  ? 98  GLY C N     1 
ATOM   8043  C  CA    . GLY E 5  98  ? -13.325 -13.855 48.476 1.00 37.30  ? 98  GLY C CA    1 
ATOM   8044  C  C     . GLY E 5  98  ? -13.191 -15.361 48.303 1.00 38.39  ? 98  GLY C C     1 
ATOM   8045  O  O     . GLY E 5  98  ? -13.168 -16.046 49.283 1.00 42.47  ? 98  GLY C O     1 
ATOM   8046  N  N     . ARG E 5  99  ? -13.100 -15.879 47.080 1.00 36.95  ? 99  ARG C N     1 
ATOM   8047  C  CA    . ARG E 5  99  ? -12.895 -17.272 46.844 1.00 36.50  ? 99  ARG C CA    1 
ATOM   8048  C  C     . ARG E 5  99  ? -11.557 -17.440 46.107 1.00 38.55  ? 99  ARG C C     1 
ATOM   8049  O  O     . ARG E 5  99  ? -11.467 -18.216 45.130 1.00 36.91  ? 99  ARG C O     1 
ATOM   8050  C  CB    . ARG E 5  99  ? -14.044 -17.846 46.004 1.00 40.02  ? 99  ARG C CB    1 
ATOM   8051  C  CG    . ARG E 5  99  ? -15.397 -17.893 46.697 1.00 49.79  ? 99  ARG C CG    1 
ATOM   8052  C  CD    . ARG E 5  99  ? -15.446 -18.823 47.920 1.00 67.19  ? 99  ARG C CD    1 
ATOM   8053  N  NE    . ARG E 5  99  ? -16.371 -18.322 48.958 1.00 94.45  ? 99  ARG C NE    1 
ATOM   8054  C  CZ    . ARG E 5  99  ? -17.698 -18.530 49.001 1.00 103.36 ? 99  ARG C CZ    1 
ATOM   8055  N  NH1   . ARG E 5  99  ? -18.310 -19.256 48.064 1.00 105.12 ? 99  ARG C NH1   1 
ATOM   8056  N  NH2   . ARG E 5  99  ? -18.421 -18.004 49.995 1.00 92.70  ? 99  ARG C NH2   1 
ATOM   8057  N  N     . VAL E 5  100 ? -10.520 -16.727 46.570 1.00 34.63  ? 100 VAL C N     1 
ATOM   8058  C  CA    . VAL E 5  100 ? -9.231  -16.696 45.893 1.00 33.79  ? 100 VAL C CA    1 
ATOM   8059  C  C     . VAL E 5  100 ? -8.129  -16.773 46.875 1.00 34.89  ? 100 VAL C C     1 
ATOM   8060  O  O     . VAL E 5  100 ? -8.226  -16.171 47.950 1.00 38.59  ? 100 VAL C O     1 
ATOM   8061  C  CB    . VAL E 5  100 ? -9.003  -15.366 45.170 1.00 35.61  ? 100 VAL C CB    1 
ATOM   8062  C  CG1   . VAL E 5  100 ? -7.520  -15.181 44.832 1.00 41.77  ? 100 VAL C CG1   1 
ATOM   8063  C  CG2   . VAL E 5  100 ? -9.760  -15.350 43.881 1.00 33.07  ? 100 VAL C CG2   1 
ATOM   8064  N  N     . THR E 5  101 ? -7.052  -17.457 46.508 1.00 33.56  ? 101 THR C N     1 
ATOM   8065  C  CA    . THR E 5  101 ? -5.937  -17.578 47.415 1.00 33.62  ? 101 THR C CA    1 
ATOM   8066  C  C     . THR E 5  101 ? -4.728  -16.961 46.806 1.00 33.91  ? 101 THR C C     1 
ATOM   8067  O  O     . THR E 5  101 ? -4.391  -17.215 45.634 1.00 34.77  ? 101 THR C O     1 
ATOM   8068  C  CB    . THR E 5  101 ? -5.643  -19.064 47.729 1.00 40.40  ? 101 THR C CB    1 
ATOM   8069  O  OG1   . THR E 5  101 ? -6.781  -19.669 48.374 1.00 38.67  ? 101 THR C OG1   1 
ATOM   8070  C  CG2   . THR E 5  101 ? -4.393  -19.199 48.652 1.00 36.46  ? 101 THR C CG2   1 
ATOM   8071  N  N     . ILE E 5  102 ? -4.044  -16.144 47.596 1.00 37.38  ? 102 ILE C N     1 
ATOM   8072  C  CA    . ILE E 5  102 ? -2.849  -15.438 47.116 1.00 34.03  ? 102 ILE C CA    1 
ATOM   8073  C  C     . ILE E 5  102 ? -1.738  -16.196 47.705 1.00 33.48  ? 102 ILE C C     1 
ATOM   8074  O  O     . ILE E 5  102 ? -1.555  -16.186 48.906 1.00 33.07  ? 102 ILE C O     1 
ATOM   8075  C  CB    . ILE E 5  102 ? -2.791  -14.008 47.619 1.00 35.76  ? 102 ILE C CB    1 
ATOM   8076  C  CG1   . ILE E 5  102 ? -3.656  -13.130 46.749 1.00 37.01  ? 102 ILE C CG1   1 
ATOM   8077  C  CG2   . ILE E 5  102 ? -1.369  -13.464 47.687 1.00 34.96  ? 102 ILE C CG2   1 
ATOM   8078  C  CD1   . ILE E 5  102 ? -4.174  -11.924 47.511 1.00 38.60  ? 102 ILE C CD1   1 
ATOM   8079  N  N     . ALA E 5  103 ? -1.012  -16.897 46.857 1.00 37.49  ? 103 ALA C N     1 
ATOM   8080  C  CA    . ALA E 5  103 ? 0.082   -17.699 47.331 1.00 43.12  ? 103 ALA C CA    1 
ATOM   8081  C  C     . ALA E 5  103 ? 1.034   -16.781 48.072 1.00 41.25  ? 103 ALA C C     1 
ATOM   8082  O  O     . ALA E 5  103 ? 1.184   -15.640 47.684 1.00 45.68  ? 103 ALA C O     1 
ATOM   8083  C  CB    . ALA E 5  103 ? 0.769   -18.372 46.162 1.00 46.62  ? 103 ALA C CB    1 
ATOM   8084  N  N     . GLN E 5  104 ? 1.616   -17.276 49.160 1.00 38.56  ? 104 GLN C N     1 
ATOM   8085  C  CA    . GLN E 5  104 ? 2.582   -16.551 49.959 1.00 40.02  ? 104 GLN C CA    1 
ATOM   8086  C  C     . GLN E 5  104 ? 2.059   -15.275 50.623 1.00 41.90  ? 104 GLN C C     1 
ATOM   8087  O  O     . GLN E 5  104 ? 2.838   -14.483 51.138 1.00 47.49  ? 104 GLN C O     1 
ATOM   8088  C  CB    . GLN E 5  104 ? 3.892   -16.348 49.198 1.00 40.49  ? 104 GLN C CB    1 
ATOM   8089  C  CG    . GLN E 5  104 ? 4.782   -17.593 49.285 1.00 45.60  ? 104 GLN C CG    1 
ATOM   8090  C  CD    . GLN E 5  104 ? 5.155   -17.952 50.739 1.00 52.38  ? 104 GLN C CD    1 
ATOM   8091  O  OE1   . GLN E 5  104 ? 5.666   -17.108 51.494 1.00 57.60  ? 104 GLN C OE1   1 
ATOM   8092  N  NE2   . GLN E 5  104 ? 4.841   -19.193 51.156 1.00 53.37  ? 104 GLN C NE2   1 
ATOM   8093  N  N     . GLY E 5  105 ? 0.740   -15.152 50.709 1.00 38.39  ? 105 GLY C N     1 
ATOM   8094  C  CA    . GLY E 5  105 ? 0.116   -14.088 51.458 1.00 40.97  ? 105 GLY C CA    1 
ATOM   8095  C  C     . GLY E 5  105 ? -0.063  -14.128 52.983 1.00 43.74  ? 105 GLY C C     1 
ATOM   8096  O  O     . GLY E 5  105 ? -0.273  -13.071 53.636 1.00 52.59  ? 105 GLY C O     1 
ATOM   8097  N  N     . GLY E 5  106 ? -0.042  -15.286 53.599 1.00 38.83  ? 106 GLY C N     1 
ATOM   8098  C  CA    . GLY E 5  106 ? -0.299  -15.289 55.045 1.00 39.47  ? 106 GLY C CA    1 
ATOM   8099  C  C     . GLY E 5  106 ? -1.739  -14.983 55.346 1.00 40.31  ? 106 GLY C C     1 
ATOM   8100  O  O     . GLY E 5  106 ? -2.605  -15.086 54.461 1.00 42.10  ? 106 GLY C O     1 
ATOM   8101  N  N     . VAL E 5  107 ? -1.983  -14.571 56.590 1.00 41.13  ? 107 VAL C N     1 
ATOM   8102  C  CA    . VAL E 5  107 ? -3.286  -14.085 57.012 1.00 39.98  ? 107 VAL C CA    1 
ATOM   8103  C  C     . VAL E 5  107 ? -3.194  -12.810 57.804 1.00 41.61  ? 107 VAL C C     1 
ATOM   8104  O  O     . VAL E 5  107 ? -2.148  -12.502 58.334 1.00 44.53  ? 107 VAL C O     1 
ATOM   8105  C  CB    . VAL E 5  107 ? -3.944  -15.093 57.944 1.00 42.11  ? 107 VAL C CB    1 
ATOM   8106  C  CG1   . VAL E 5  107 ? -4.177  -16.406 57.202 1.00 42.13  ? 107 VAL C CG1   1 
ATOM   8107  C  CG2   . VAL E 5  107 ? -3.140  -15.262 59.217 1.00 38.19  ? 107 VAL C CG2   1 
ATOM   8108  N  N     . LEU E 5  108 ? -4.296  -12.087 57.951 1.00 43.53  ? 108 LEU C N     1 
ATOM   8109  C  CA    . LEU E 5  108 ? -4.281  -10.896 58.808 1.00 42.86  ? 108 LEU C CA    1 
ATOM   8110  C  C     . LEU E 5  108 ? -4.100  -11.273 60.236 1.00 42.19  ? 108 LEU C C     1 
ATOM   8111  O  O     . LEU E 5  108 ? -4.715  -12.221 60.695 1.00 54.85  ? 108 LEU C O     1 
ATOM   8112  C  CB    . LEU E 5  108 ? -5.620  -10.169 58.734 1.00 44.31  ? 108 LEU C CB    1 
ATOM   8113  C  CG    . LEU E 5  108 ? -5.895  -9.498  57.407 1.00 43.43  ? 108 LEU C CG    1 
ATOM   8114  C  CD1   . LEU E 5  108 ? -7.179  -8.704  57.536 1.00 40.50  ? 108 LEU C CD1   1 
ATOM   8115  C  CD2   . LEU E 5  108 ? -4.712  -8.599  57.036 1.00 44.26  ? 108 LEU C CD2   1 
ATOM   8116  N  N     . PRO E 5  109 ? -3.279  -10.535 60.964 1.00 50.90  ? 109 PRO C N     1 
ATOM   8117  C  CA    . PRO E 5  109 ? -3.200  -10.747 62.409 1.00 53.56  ? 109 PRO C CA    1 
ATOM   8118  C  C     . PRO E 5  109 ? -4.557  -10.518 63.084 1.00 54.78  ? 109 PRO C C     1 
ATOM   8119  O  O     . PRO E 5  109 ? -5.147  -9.471  62.946 1.00 51.72  ? 109 PRO C O     1 
ATOM   8120  C  CB    . PRO E 5  109 ? -2.213  -9.686  62.846 1.00 53.81  ? 109 PRO C CB    1 
ATOM   8121  C  CG    . PRO E 5  109 ? -1.345  -9.474  61.662 1.00 53.60  ? 109 PRO C CG    1 
ATOM   8122  C  CD    . PRO E 5  109 ? -2.252  -9.593  60.493 1.00 53.64  ? 109 PRO C CD    1 
ATOM   8123  N  N     . ASN E 5  110 ? -5.068  -11.511 63.782 1.00 58.44  ? 110 ASN C N     1 
ATOM   8124  C  CA    . ASN E 5  110 ? -6.342  -11.346 64.419 1.00 58.77  ? 110 ASN C CA    1 
ATOM   8125  C  C     . ASN E 5  110 ? -6.554  -12.436 65.412 1.00 59.57  ? 110 ASN C C     1 
ATOM   8126  O  O     . ASN E 5  110 ? -6.643  -13.606 65.037 1.00 68.59  ? 110 ASN C O     1 
ATOM   8127  C  CB    . ASN E 5  110 ? -7.463  -11.379 63.416 1.00 61.12  ? 110 ASN C CB    1 
ATOM   8128  C  CG    . ASN E 5  110 ? -8.806  -11.179 64.057 1.00 65.36  ? 110 ASN C CG    1 
ATOM   8129  O  OD1   . ASN E 5  110 ? -8.898  -10.677 65.170 1.00 83.29  ? 110 ASN C OD1   1 
ATOM   8130  N  ND2   . ASN E 5  110 ? -9.863  -11.565 63.357 1.00 65.12  ? 110 ASN C ND2   1 
ATOM   8131  N  N     . ILE E 5  111 ? -6.639  -12.009 66.675 1.00 55.83  ? 111 ILE C N     1 
ATOM   8132  C  CA    . ILE E 5  111 ? -6.848  -12.842 67.834 1.00 49.13  ? 111 ILE C CA    1 
ATOM   8133  C  C     . ILE E 5  111 ? -8.200  -12.546 68.482 1.00 54.99  ? 111 ILE C C     1 
ATOM   8134  O  O     . ILE E 5  111 ? -8.543  -11.403 68.791 1.00 66.58  ? 111 ILE C O     1 
ATOM   8135  C  CB    . ILE E 5  111 ? -5.747  -12.607 68.853 1.00 47.29  ? 111 ILE C CB    1 
ATOM   8136  C  CG1   . ILE E 5  111 ? -4.403  -12.828 68.183 1.00 47.12  ? 111 ILE C CG1   1 
ATOM   8137  C  CG2   . ILE E 5  111 ? -5.897  -13.564 70.028 1.00 50.62  ? 111 ILE C CG2   1 
ATOM   8138  C  CD1   . ILE E 5  111 ? -3.249  -12.967 69.144 1.00 46.11  ? 111 ILE C CD1   1 
ATOM   8139  N  N     . GLN E 5  112 ? -8.969  -13.596 68.682 1.00 55.47  ? 112 GLN C N     1 
ATOM   8140  C  CA    . GLN E 5  112 ? -10.291 -13.469 69.218 1.00 55.67  ? 112 GLN C CA    1 
ATOM   8141  C  C     . GLN E 5  112 ? -10.164 -13.043 70.658 1.00 57.59  ? 112 GLN C C     1 
ATOM   8142  O  O     . GLN E 5  112 ? -9.277  -13.536 71.362 1.00 53.94  ? 112 GLN C O     1 
ATOM   8143  C  CB    . GLN E 5  112 ? -10.974 -14.821 69.130 1.00 56.07  ? 112 GLN C CB    1 
ATOM   8144  C  CG    . GLN E 5  112 ? -11.231 -15.218 67.702 1.00 54.56  ? 112 GLN C CG    1 
ATOM   8145  C  CD    . GLN E 5  112 ? -12.276 -14.328 67.085 1.00 58.81  ? 112 GLN C CD    1 
ATOM   8146  O  OE1   . GLN E 5  112 ? -13.418 -14.247 67.568 1.00 58.68  ? 112 GLN C OE1   1 
ATOM   8147  N  NE2   . GLN E 5  112 ? -11.887 -13.622 66.037 1.00 59.83  ? 112 GLN C NE2   1 
ATOM   8148  N  N     . SER E 5  113 ? -11.052 -12.138 71.084 1.00 58.54  ? 113 SER C N     1 
ATOM   8149  C  CA    . SER E 5  113 ? -11.030 -11.559 72.448 1.00 58.04  ? 113 SER C CA    1 
ATOM   8150  C  C     . SER E 5  113 ? -10.865 -12.538 73.600 1.00 56.79  ? 113 SER C C     1 
ATOM   8151  O  O     . SER E 5  113 ? -9.866  -12.491 74.312 1.00 58.48  ? 113 SER C O     1 
ATOM   8152  C  CB    . SER E 5  113 ? -12.306 -10.777 72.683 1.00 57.56  ? 113 SER C CB    1 
ATOM   8153  O  OG    . SER E 5  113 ? -12.213 -9.597  71.943 1.00 57.74  ? 113 SER C OG    1 
ATOM   8154  N  N     . VAL E 5  114 ? -11.838 -13.421 73.792 1.00 56.06  ? 114 VAL C N     1 
ATOM   8155  C  CA    . VAL E 5  114 ? -11.787 -14.344 74.931 1.00 60.68  ? 114 VAL C CA    1 
ATOM   8156  C  C     . VAL E 5  114 ? -10.454 -15.031 75.082 1.00 60.20  ? 114 VAL C C     1 
ATOM   8157  O  O     . VAL E 5  114 ? -10.171 -15.568 76.161 1.00 67.21  ? 114 VAL C O     1 
ATOM   8158  C  CB    . VAL E 5  114 ? -12.813 -15.496 74.868 1.00 60.40  ? 114 VAL C CB    1 
ATOM   8159  C  CG1   . VAL E 5  114 ? -14.226 -14.978 75.077 1.00 64.71  ? 114 VAL C CG1   1 
ATOM   8160  C  CG2   . VAL E 5  114 ? -12.681 -16.275 73.558 1.00 63.91  ? 114 VAL C CG2   1 
ATOM   8161  N  N     . LEU E 5  115 ? -9.670  -15.076 74.005 1.00 55.97  ? 115 LEU C N     1 
ATOM   8162  C  CA    . LEU E 5  115 ? -8.409  -15.805 74.025 1.00 56.52  ? 115 LEU C CA    1 
ATOM   8163  C  C     . LEU E 5  115 ? -7.329  -15.051 74.742 1.00 56.32  ? 115 LEU C C     1 
ATOM   8164  O  O     . LEU E 5  115 ? -6.405  -15.659 75.289 1.00 57.09  ? 115 LEU C O     1 
ATOM   8165  C  CB    . LEU E 5  115 ? -7.936  -16.122 72.610 1.00 58.72  ? 115 LEU C CB    1 
ATOM   8166  C  CG    . LEU E 5  115 ? -8.826  -17.070 71.811 1.00 58.84  ? 115 LEU C CG    1 
ATOM   8167  C  CD1   . LEU E 5  115 ? -8.111  -17.486 70.539 1.00 63.10  ? 115 LEU C CD1   1 
ATOM   8168  C  CD2   . LEU E 5  115 ? -9.197  -18.296 72.625 1.00 57.16  ? 115 LEU C CD2   1 
ATOM   8169  N  N     . LEU E 5  116 ? -7.437  -13.728 74.730 1.00 61.03  ? 116 LEU C N     1 
ATOM   8170  C  CA    . LEU E 5  116 ? -6.478  -12.885 75.421 1.00 63.95  ? 116 LEU C CA    1 
ATOM   8171  C  C     . LEU E 5  116 ? -6.498  -13.146 76.929 1.00 66.47  ? 116 LEU C C     1 
ATOM   8172  O  O     . LEU E 5  116 ? -7.512  -13.548 77.463 1.00 68.81  ? 116 LEU C O     1 
ATOM   8173  C  CB    . LEU E 5  116 ? -6.765  -11.424 75.109 1.00 62.60  ? 116 LEU C CB    1 
ATOM   8174  C  CG    . LEU E 5  116 ? -6.503  -11.003 73.654 1.00 63.37  ? 116 LEU C CG    1 
ATOM   8175  C  CD1   . LEU E 5  116 ? -6.650  -9.494  73.548 1.00 64.38  ? 116 LEU C CD1   1 
ATOM   8176  C  CD2   . LEU E 5  116 ? -5.139  -11.415 73.120 1.00 58.86  ? 116 LEU C CD2   1 
ATOM   8177  N  N     . PRO E 5  117 ? -5.366  -12.923 77.618 1.00 79.81  ? 117 PRO C N     1 
ATOM   8178  C  CA    . PRO E 5  117 ? -5.221  -13.221 79.066 1.00 85.10  ? 117 PRO C CA    1 
ATOM   8179  C  C     . PRO E 5  117 ? -5.887  -12.214 80.003 1.00 95.12  ? 117 PRO C C     1 
ATOM   8180  O  O     . PRO E 5  117 ? -6.094  -11.065 79.595 1.00 91.10  ? 117 PRO C O     1 
ATOM   8181  C  CB    . PRO E 5  117 ? -3.701  -13.171 79.276 1.00 83.25  ? 117 PRO C CB    1 
ATOM   8182  C  CG    . PRO E 5  117 ? -3.198  -12.239 78.221 1.00 79.74  ? 117 PRO C CG    1 
ATOM   8183  C  CD    . PRO E 5  117 ? -4.116  -12.390 77.036 1.00 77.83  ? 117 PRO C CD    1 
ATOM   8184  N  N     . LYS E 5  118 ? -6.198  -12.659 81.236 1.00 112.87 ? 118 LYS C N     1 
ATOM   8185  C  CA    . LYS E 5  118 ? -6.693  -11.812 82.369 1.00 122.97 ? 118 LYS C CA    1 
ATOM   8186  C  C     . LYS E 5  118 ? -7.883  -10.875 82.027 1.00 137.52 ? 118 LYS C C     1 
ATOM   8187  O  O     . LYS E 5  118 ? -8.517  -11.039 80.985 1.00 148.17 ? 118 LYS C O     1 
ATOM   8188  C  CB    . LYS E 5  118 ? -5.524  -11.023 83.008 1.00 119.90 ? 118 LYS C CB    1 
ATOM   8189  C  CG    . LYS E 5  118 ? -4.984  -9.860  82.173 1.00 117.61 ? 118 LYS C CG    1 
ATOM   8190  C  CD    . LYS E 5  118 ? -4.392  -8.752  83.026 1.00 116.04 ? 118 LYS C CD    1 
ATOM   8191  C  CE    . LYS E 5  118 ? -5.488  -7.884  83.622 1.00 116.00 ? 118 LYS C CE    1 
ATOM   8192  N  NZ    . LYS E 5  118 ? -5.097  -7.288  84.923 1.00 117.01 ? 118 LYS C NZ    1 
ATOM   8193  N  N     . LYS E 5  119 ? -8.203  -9.923  82.911 1.00 149.25 ? 119 LYS C N     1 
ATOM   8194  C  CA    . LYS E 5  119 ? -9.195  -8.865  82.608 1.00 153.72 ? 119 LYS C CA    1 
ATOM   8195  C  C     . LYS E 5  119 ? -8.619  -7.451  82.794 1.00 150.84 ? 119 LYS C C     1 
ATOM   8196  O  O     . LYS E 5  119 ? -9.066  -6.676  83.650 1.00 139.96 ? 119 LYS C O     1 
ATOM   8197  C  CB    . LYS E 5  119 ? -10.483 -9.039  83.440 1.00 155.32 ? 119 LYS C CB    1 
ATOM   8198  C  CG    . LYS E 5  119 ? -10.294 -9.119  84.952 1.00 156.44 ? 119 LYS C CG    1 
ATOM   8199  C  CD    . LYS E 5  119 ? -10.340 -10.557 85.446 1.00 159.83 ? 119 LYS C CD    1 
ATOM   8200  C  CE    . LYS E 5  119 ? -9.823  -10.686 86.870 1.00 159.71 ? 119 LYS C CE    1 
ATOM   8201  N  NZ    . LYS E 5  119 ? -8.336  -10.631 86.916 1.00 161.45 ? 119 LYS C NZ    1 
ATOM   8202  N  N     . LYS F 6  31  ? 10.779  -22.021 20.791 1.00 113.09 ? 28  LYS D N     1 
ATOM   8203  C  CA    . LYS F 6  31  ? 11.167  -21.564 22.166 1.00 121.31 ? 28  LYS D CA    1 
ATOM   8204  C  C     . LYS F 6  31  ? 10.023  -20.740 22.748 1.00 118.16 ? 28  LYS D C     1 
ATOM   8205  O  O     . LYS F 6  31  ? 10.245  -19.639 23.243 1.00 113.06 ? 28  LYS D O     1 
ATOM   8206  C  CB    . LYS F 6  31  ? 12.448  -20.699 22.120 1.00 125.29 ? 28  LYS D CB    1 
ATOM   8207  C  CG    . LYS F 6  31  ? 13.633  -21.275 21.340 1.00 122.48 ? 28  LYS D CG    1 
ATOM   8208  C  CD    . LYS F 6  31  ? 13.754  -20.768 19.894 1.00 115.07 ? 28  LYS D CD    1 
ATOM   8209  C  CE    . LYS F 6  31  ? 13.441  -21.831 18.831 1.00 109.28 ? 28  LYS D CE    1 
ATOM   8210  N  NZ    . LYS F 6  31  ? 14.125  -23.145 19.013 1.00 99.83  ? 28  LYS D NZ    1 
ATOM   8211  N  N     . THR F 6  32  ? 8.811   -21.296 22.720 1.00 121.42 ? 29  THR D N     1 
ATOM   8212  C  CA    . THR F 6  32  ? 7.611   -20.466 22.591 1.00 116.02 ? 29  THR D CA    1 
ATOM   8213  C  C     . THR F 6  32  ? 7.332   -19.481 23.724 1.00 111.73 ? 29  THR D C     1 
ATOM   8214  O  O     . THR F 6  32  ? 7.504   -19.744 24.923 1.00 97.47  ? 29  THR D O     1 
ATOM   8215  C  CB    . THR F 6  32  ? 6.321   -21.259 22.245 1.00 115.60 ? 29  THR D CB    1 
ATOM   8216  O  OG1   . THR F 6  32  ? 5.627   -20.583 21.182 1.00 114.88 ? 29  THR D OG1   1 
ATOM   8217  C  CG2   . THR F 6  32  ? 5.378   -21.405 23.466 1.00 113.39 ? 29  THR D CG2   1 
ATOM   8218  N  N     . ARG F 6  33  ? 6.823   -18.356 23.256 1.00 110.26 ? 30  ARG D N     1 
ATOM   8219  C  CA    . ARG F 6  33  ? 6.778   -17.105 23.975 1.00 107.72 ? 30  ARG D CA    1 
ATOM   8220  C  C     . ARG F 6  33  ? 5.570   -17.080 24.884 1.00 97.66  ? 30  ARG D C     1 
ATOM   8221  O  O     . ARG F 6  33  ? 4.455   -17.383 24.460 1.00 83.23  ? 30  ARG D O     1 
ATOM   8222  C  CB    . ARG F 6  33  ? 6.700   -15.952 22.968 1.00 105.11 ? 30  ARG D CB    1 
ATOM   8223  C  CG    . ARG F 6  33  ? 5.904   -16.289 21.698 1.00 110.89 ? 30  ARG D CG    1 
ATOM   8224  C  CD    . ARG F 6  33  ? 4.820   -15.278 21.421 1.00 112.90 ? 30  ARG D CD    1 
ATOM   8225  N  NE    . ARG F 6  33  ? 5.319   -13.925 21.622 1.00 111.41 ? 30  ARG D NE    1 
ATOM   8226  C  CZ    . ARG F 6  33  ? 4.559   -12.872 21.906 1.00 112.73 ? 30  ARG D CZ    1 
ATOM   8227  N  NH1   . ARG F 6  33  ? 3.237   -12.993 22.021 1.00 114.86 ? 30  ARG D NH1   1 
ATOM   8228  N  NH2   . ARG F 6  33  ? 5.131   -11.685 22.078 1.00 111.90 ? 30  ARG D NH2   1 
ATOM   8229  N  N     . LYS F 6  34  ? 5.793   -16.701 26.132 1.00 87.56  ? 31  LYS D N     1 
ATOM   8230  C  CA    . LYS F 6  34  ? 4.712   -16.659 27.089 1.00 89.02  ? 31  LYS D CA    1 
ATOM   8231  C  C     . LYS F 6  34  ? 4.366   -15.210 27.325 1.00 85.31  ? 31  LYS D C     1 
ATOM   8232  O  O     . LYS F 6  34  ? 5.219   -14.389 27.717 1.00 80.09  ? 31  LYS D O     1 
ATOM   8233  C  CB    . LYS F 6  34  ? 5.094   -17.298 28.413 1.00 93.53  ? 31  LYS D CB    1 
ATOM   8234  C  CG    . LYS F 6  34  ? 6.143   -18.386 28.316 1.00 102.90 ? 31  LYS D CG    1 
ATOM   8235  C  CD    . LYS F 6  34  ? 6.809   -18.575 29.670 1.00 103.53 ? 31  LYS D CD    1 
ATOM   8236  C  CE    . LYS F 6  34  ? 8.325   -18.565 29.568 1.00 100.69 ? 31  LYS D CE    1 
ATOM   8237  N  NZ    . LYS F 6  34  ? 8.899   -18.161 30.877 1.00 99.32  ? 31  LYS D NZ    1 
ATOM   8238  N  N     . GLU F 6  35  ? 3.100   -14.903 27.100 1.00 72.99  ? 32  GLU D N     1 
ATOM   8239  C  CA    . GLU F 6  35  ? 2.626   -13.551 27.252 1.00 70.31  ? 32  GLU D CA    1 
ATOM   8240  C  C     . GLU F 6  35  ? 2.216   -13.243 28.665 1.00 62.99  ? 32  GLU D C     1 
ATOM   8241  O  O     . GLU F 6  35  ? 1.719   -14.106 29.353 1.00 64.45  ? 32  GLU D O     1 
ATOM   8242  C  CB    . GLU F 6  35  ? 1.415   -13.344 26.388 1.00 73.55  ? 32  GLU D CB    1 
ATOM   8243  C  CG    . GLU F 6  35  ? 1.741   -12.804 25.022 1.00 79.31  ? 32  GLU D CG    1 
ATOM   8244  C  CD    . GLU F 6  35  ? 0.468   -12.659 24.242 1.00 87.83  ? 32  GLU D CD    1 
ATOM   8245  O  OE1   . GLU F 6  35  ? -0.507  -13.349 24.643 1.00 81.16  ? 32  GLU D OE1   1 
ATOM   8246  O  OE2   . GLU F 6  35  ? 0.426   -11.874 23.260 1.00 91.76  ? 32  GLU D OE2   1 
ATOM   8247  N  N     . SER F 6  36  ? 2.379   -11.987 29.077 1.00 60.10  ? 33  SER D N     1 
ATOM   8248  C  CA    . SER F 6  36  ? 1.859   -11.535 30.367 1.00 54.13  ? 33  SER D CA    1 
ATOM   8249  C  C     . SER F 6  36  ? 1.678   -10.035 30.430 1.00 55.00  ? 33  SER D C     1 
ATOM   8250  O  O     . SER F 6  36  ? 2.261   -9.285  29.654 1.00 52.64  ? 33  SER D O     1 
ATOM   8251  C  CB    . SER F 6  36  ? 2.781   -11.970 31.502 1.00 51.27  ? 33  SER D CB    1 
ATOM   8252  O  OG    . SER F 6  36  ? 3.609   -10.912 31.875 1.00 48.97  ? 33  SER D OG    1 
ATOM   8253  N  N     . TYR F 6  37  ? 0.869   -9.607  31.393 1.00 57.94  ? 34  TYR D N     1 
ATOM   8254  C  CA    . TYR F 6  37  ? 0.545   -8.191  31.605 1.00 51.02  ? 34  TYR D CA    1 
ATOM   8255  C  C     . TYR F 6  37  ? 1.625   -7.410  32.404 1.00 53.71  ? 34  TYR D C     1 
ATOM   8256  O  O     . TYR F 6  37  ? 1.431   -6.231  32.766 1.00 50.11  ? 34  TYR D O     1 
ATOM   8257  C  CB    . TYR F 6  37  ? -0.759  -8.109  32.354 1.00 48.25  ? 34  TYR D CB    1 
ATOM   8258  C  CG    . TYR F 6  37  ? -1.944  -8.551  31.557 1.00 52.71  ? 34  TYR D CG    1 
ATOM   8259  C  CD1   . TYR F 6  37  ? -2.433  -9.832  31.650 1.00 51.79  ? 34  TYR D CD1   1 
ATOM   8260  C  CD2   . TYR F 6  37  ? -2.620  -7.659  30.739 1.00 56.33  ? 34  TYR D CD2   1 
ATOM   8261  C  CE1   . TYR F 6  37  ? -3.543  -10.222 30.938 1.00 52.57  ? 34  TYR D CE1   1 
ATOM   8262  C  CE2   . TYR F 6  37  ? -3.724  -8.049  30.018 1.00 52.62  ? 34  TYR D CE2   1 
ATOM   8263  C  CZ    . TYR F 6  37  ? -4.175  -9.331  30.117 1.00 54.30  ? 34  TYR D CZ    1 
ATOM   8264  O  OH    . TYR F 6  37  ? -5.277  -9.724  29.387 1.00 61.55  ? 34  TYR D OH    1 
ATOM   8265  N  N     . ALA F 6  38  ? 2.762   -8.048  32.663 1.00 51.78  ? 35  ALA D N     1 
ATOM   8266  C  CA    . ALA F 6  38  ? 3.785   -7.452  33.520 1.00 55.22  ? 35  ALA D CA    1 
ATOM   8267  C  C     . ALA F 6  38  ? 4.194   -5.986  33.187 1.00 52.89  ? 35  ALA D C     1 
ATOM   8268  O  O     . ALA F 6  38  ? 4.292   -5.138  34.083 1.00 47.50  ? 35  ALA D O     1 
ATOM   8269  C  CB    . ALA F 6  38  ? 5.010   -8.361  33.560 1.00 53.82  ? 35  ALA D CB    1 
ATOM   8270  N  N     . ILE F 6  39  ? 4.448   -5.680  31.925 1.00 58.12  ? 36  ILE D N     1 
ATOM   8271  C  CA    . ILE F 6  39  ? 4.969   -4.341  31.611 1.00 60.25  ? 36  ILE D CA    1 
ATOM   8272  C  C     . ILE F 6  39  ? 3.911   -3.286  31.854 1.00 54.79  ? 36  ILE D C     1 
ATOM   8273  O  O     . ILE F 6  39  ? 4.226   -2.199  32.300 1.00 56.81  ? 36  ILE D O     1 
ATOM   8274  C  CB    . ILE F 6  39  ? 5.608   -4.211  30.195 1.00 60.22  ? 36  ILE D CB    1 
ATOM   8275  C  CG1   . ILE F 6  39  ? 4.674   -4.606  29.076 1.00 57.76  ? 36  ILE D CG1   1 
ATOM   8276  C  CG2   . ILE F 6  39  ? 6.866   -5.058  30.088 1.00 60.82  ? 36  ILE D CG2   1 
ATOM   8277  C  CD1   . ILE F 6  39  ? 5.400   -4.650  27.763 1.00 56.47  ? 36  ILE D CD1   1 
ATOM   8278  N  N     . TYR F 6  40  ? 2.662   -3.653  31.618 1.00 53.12  ? 37  TYR D N     1 
ATOM   8279  C  CA    . TYR F 6  40  ? 1.525   -2.773  31.871 1.00 52.04  ? 37  TYR D CA    1 
ATOM   8280  C  C     . TYR F 6  40  ? 1.314   -2.596  33.362 1.00 51.97  ? 37  TYR D C     1 
ATOM   8281  O  O     . TYR F 6  40  ? 0.994   -1.524  33.863 1.00 54.18  ? 37  TYR D O     1 
ATOM   8282  C  CB    . TYR F 6  40  ? 0.302   -3.375  31.208 1.00 50.40  ? 37  TYR D CB    1 
ATOM   8283  C  CG    . TYR F 6  40  ? 0.613   -3.727  29.773 1.00 57.93  ? 37  TYR D CG    1 
ATOM   8284  C  CD1   . TYR F 6  40  ? 0.711   -5.043  29.354 1.00 66.33  ? 37  TYR D CD1   1 
ATOM   8285  C  CD2   . TYR F 6  40  ? 0.885   -2.723  28.841 1.00 61.54  ? 37  TYR D CD2   1 
ATOM   8286  C  CE1   . TYR F 6  40  ? 1.036   -5.353  28.030 1.00 73.89  ? 37  TYR D CE1   1 
ATOM   8287  C  CE2   . TYR F 6  40  ? 1.202   -3.011  27.524 1.00 63.63  ? 37  TYR D CE2   1 
ATOM   8288  C  CZ    . TYR F 6  40  ? 1.280   -4.324  27.114 1.00 75.42  ? 37  TYR D CZ    1 
ATOM   8289  O  OH    . TYR F 6  40  ? 1.605   -4.587  25.793 1.00 83.91  ? 37  TYR D OH    1 
ATOM   8290  N  N     . VAL F 6  41  ? 1.506   -3.672  34.089 1.00 52.88  ? 38  VAL D N     1 
ATOM   8291  C  CA    . VAL F 6  41  ? 1.300   -3.633  35.511 1.00 53.22  ? 38  VAL D CA    1 
ATOM   8292  C  C     . VAL F 6  41  ? 2.329   -2.704  36.060 1.00 51.74  ? 38  VAL D C     1 
ATOM   8293  O  O     . VAL F 6  41  ? 2.069   -1.933  36.978 1.00 53.02  ? 38  VAL D O     1 
ATOM   8294  C  CB    . VAL F 6  41  ? 1.442   -5.041  36.145 1.00 51.10  ? 38  VAL D CB    1 
ATOM   8295  C  CG1   . VAL F 6  41  ? 1.734   -4.965  37.650 1.00 51.28  ? 38  VAL D CG1   1 
ATOM   8296  C  CG2   . VAL F 6  41  ? 0.181   -5.823  35.873 1.00 46.56  ? 38  VAL D CG2   1 
ATOM   8297  N  N     . TYR F 6  42  ? 3.510   -2.808  35.489 1.00 53.48  ? 39  TYR D N     1 
ATOM   8298  C  CA    . TYR F 6  42  ? 4.646   -2.059  35.955 1.00 57.29  ? 39  TYR D CA    1 
ATOM   8299  C  C     . TYR F 6  42  ? 4.473   -0.563  35.601 1.00 50.26  ? 39  TYR D C     1 
ATOM   8300  O  O     . TYR F 6  42  ? 4.690   0.312   36.418 1.00 46.07  ? 39  TYR D O     1 
ATOM   8301  C  CB    . TYR F 6  42  ? 5.893   -2.690  35.344 1.00 65.05  ? 39  TYR D CB    1 
ATOM   8302  C  CG    . TYR F 6  42  ? 7.163   -2.145  35.868 1.00 74.15  ? 39  TYR D CG    1 
ATOM   8303  C  CD1   . TYR F 6  42  ? 7.809   -2.742  36.958 1.00 81.87  ? 39  TYR D CD1   1 
ATOM   8304  C  CD2   . TYR F 6  42  ? 7.728   -1.023  35.278 1.00 82.93  ? 39  TYR D CD2   1 
ATOM   8305  C  CE1   . TYR F 6  42  ? 8.986   -2.208  37.455 1.00 99.17  ? 39  TYR D CE1   1 
ATOM   8306  C  CE2   . TYR F 6  42  ? 8.908   -0.484  35.745 1.00 96.94  ? 39  TYR D CE2   1 
ATOM   8307  C  CZ    . TYR F 6  42  ? 9.539   -1.064  36.832 1.00 104.19 ? 39  TYR D CZ    1 
ATOM   8308  O  OH    . TYR F 6  42  ? 10.709  -0.483  37.273 1.00 102.23 ? 39  TYR D OH    1 
ATOM   8309  N  N     . LYS F 6  43  ? 4.026   -0.261  34.398 1.00 49.42  ? 40  LYS D N     1 
ATOM   8310  C  CA    . LYS F 6  43  ? 3.726   1.128   34.080 1.00 54.57  ? 40  LYS D CA    1 
ATOM   8311  C  C     . LYS F 6  43  ? 2.888   1.719   35.176 1.00 51.74  ? 40  LYS D C     1 
ATOM   8312  O  O     . LYS F 6  43  ? 3.259   2.712   35.804 1.00 59.79  ? 40  LYS D O     1 
ATOM   8313  C  CB    . LYS F 6  43  ? 2.992   1.246   32.761 1.00 56.76  ? 40  LYS D CB    1 
ATOM   8314  C  CG    . LYS F 6  43  ? 3.915   1.010   31.579 1.00 64.48  ? 40  LYS D CG    1 
ATOM   8315  C  CD    . LYS F 6  43  ? 3.141   0.695   30.302 1.00 78.16  ? 40  LYS D CD    1 
ATOM   8316  C  CE    . LYS F 6  43  ? 3.945   1.014   29.045 1.00 89.43  ? 40  LYS D CE    1 
ATOM   8317  N  NZ    . LYS F 6  43  ? 3.206   0.635   27.801 1.00 95.97  ? 40  LYS D NZ    1 
ATOM   8318  N  N     . VAL F 6  44  ? 1.782   1.044   35.428 1.00 52.47  ? 41  VAL D N     1 
ATOM   8319  C  CA    . VAL F 6  44  ? 0.778   1.492   36.364 1.00 49.10  ? 41  VAL D CA    1 
ATOM   8320  C  C     . VAL F 6  44  ? 1.314   1.549   37.781 1.00 50.49  ? 41  VAL D C     1 
ATOM   8321  O  O     . VAL F 6  44  ? 1.052   2.489   38.543 1.00 60.97  ? 41  VAL D O     1 
ATOM   8322  C  CB    . VAL F 6  44  ? -0.411  0.555   36.284 1.00 51.82  ? 41  VAL D CB    1 
ATOM   8323  C  CG1   . VAL F 6  44  ? -1.385  0.818   37.424 1.00 56.04  ? 41  VAL D CG1   1 
ATOM   8324  C  CG2   . VAL F 6  44  ? -1.115  0.704   34.927 1.00 49.96  ? 41  VAL D CG2   1 
ATOM   8325  N  N     . LEU F 6  45  ? 2.135   0.590   38.140 1.00 50.26  ? 42  LEU D N     1 
ATOM   8326  C  CA    . LEU F 6  45  ? 2.823   0.720   39.414 1.00 53.90  ? 42  LEU D CA    1 
ATOM   8327  C  C     . LEU F 6  45  ? 3.538   2.076   39.545 1.00 53.59  ? 42  LEU D C     1 
ATOM   8328  O  O     . LEU F 6  45  ? 3.548   2.695   40.626 1.00 54.72  ? 42  LEU D O     1 
ATOM   8329  C  CB    . LEU F 6  45  ? 3.828   -0.403  39.595 1.00 49.29  ? 42  LEU D CB    1 
ATOM   8330  C  CG    . LEU F 6  45  ? 4.637   -0.303  40.879 1.00 50.44  ? 42  LEU D CG    1 
ATOM   8331  C  CD1   . LEU F 6  45  ? 3.723   -0.198  42.094 1.00 47.24  ? 42  LEU D CD1   1 
ATOM   8332  C  CD2   . LEU F 6  45  ? 5.599   -1.490  40.992 1.00 53.04  ? 42  LEU D CD2   1 
ATOM   8333  N  N     . LYS F 6  46  ? 4.147   2.525   38.457 1.00 50.49  ? 43  LYS D N     1 
ATOM   8334  C  CA    . LYS F 6  46  ? 5.011   3.692   38.546 1.00 53.36  ? 43  LYS D CA    1 
ATOM   8335  C  C     . LYS F 6  46  ? 4.145   4.897   38.662 1.00 50.02  ? 43  LYS D C     1 
ATOM   8336  O  O     . LYS F 6  46  ? 4.469   5.827   39.402 1.00 49.21  ? 43  LYS D O     1 
ATOM   8337  C  CB    . LYS F 6  46  ? 5.995   3.795   37.365 1.00 53.93  ? 43  LYS D CB    1 
ATOM   8338  C  CG    . LYS F 6  46  ? 7.166   2.813   37.432 1.00 55.29  ? 43  LYS D CG    1 
ATOM   8339  C  CD    . LYS F 6  46  ? 7.524   2.508   38.887 1.00 59.00  ? 43  LYS D CD    1 
ATOM   8340  C  CE    . LYS F 6  46  ? 8.920   1.939   39.100 1.00 60.69  ? 43  LYS D CE    1 
ATOM   8341  N  NZ    . LYS F 6  46  ? 9.192   2.062   40.561 1.00 60.40  ? 43  LYS D NZ    1 
ATOM   8342  N  N     . GLN F 6  47  ? 2.999   4.851   38.003 1.00 44.97  ? 44  GLN D N     1 
ATOM   8343  C  CA    . GLN F 6  47  ? 2.117   5.977   38.109 1.00 43.16  ? 44  GLN D CA    1 
ATOM   8344  C  C     . GLN F 6  47  ? 1.647   6.205   39.559 1.00 44.59  ? 44  GLN D C     1 
ATOM   8345  O  O     . GLN F 6  47  ? 1.545   7.360   39.986 1.00 58.18  ? 44  GLN D O     1 
ATOM   8346  C  CB    . GLN F 6  47  ? 0.933   5.845   37.196 1.00 41.28  ? 44  GLN D CB    1 
ATOM   8347  C  CG    . GLN F 6  47  ? 1.253   5.686   35.735 1.00 40.63  ? 44  GLN D CG    1 
ATOM   8348  C  CD    . GLN F 6  47  ? -0.036  5.614   34.920 1.00 50.16  ? 44  GLN D CD    1 
ATOM   8349  O  OE1   . GLN F 6  47  ? -0.971  4.836   35.214 1.00 61.52  ? 44  GLN D OE1   1 
ATOM   8350  N  NE2   . GLN F 6  47  ? -0.116  6.436   33.926 1.00 50.21  ? 44  GLN D NE2   1 
ATOM   8351  N  N     . VAL F 6  48  ? 1.383   5.148   40.321 1.00 42.36  ? 45  VAL D N     1 
ATOM   8352  C  CA    . VAL F 6  48  ? 0.814   5.316   41.671 1.00 41.22  ? 45  VAL D CA    1 
ATOM   8353  C  C     . VAL F 6  48  ? 1.835   5.322   42.773 1.00 42.07  ? 45  VAL D C     1 
ATOM   8354  O  O     . VAL F 6  48  ? 1.616   5.936   43.808 1.00 42.01  ? 45  VAL D O     1 
ATOM   8355  C  CB    . VAL F 6  48  ? -0.210  4.221   42.025 1.00 47.11  ? 45  VAL D CB    1 
ATOM   8356  C  CG1   . VAL F 6  48  ? -1.325  4.167   40.995 1.00 51.77  ? 45  VAL D CG1   1 
ATOM   8357  C  CG2   . VAL F 6  48  ? 0.438   2.855   42.127 1.00 50.81  ? 45  VAL D CG2   1 
ATOM   8358  N  N     . HIS F 6  49  ? 2.943   4.613   42.588 1.00 49.36  ? 46  HIS D N     1 
ATOM   8359  C  CA    . HIS F 6  49  ? 4.010   4.594   43.611 1.00 53.64  ? 46  HIS D CA    1 
ATOM   8360  C  C     . HIS F 6  49  ? 5.418   4.601   42.994 1.00 58.28  ? 46  HIS D C     1 
ATOM   8361  O  O     . HIS F 6  49  ? 6.112   3.569   42.997 1.00 62.07  ? 46  HIS D O     1 
ATOM   8362  C  CB    . HIS F 6  49  ? 3.882   3.382   44.499 1.00 48.64  ? 46  HIS D CB    1 
ATOM   8363  C  CG    . HIS F 6  49  ? 2.709   3.417   45.415 1.00 51.70  ? 46  HIS D CG    1 
ATOM   8364  N  ND1   . HIS F 6  49  ? 2.577   4.356   46.410 1.00 55.95  ? 46  HIS D ND1   1 
ATOM   8365  C  CD2   . HIS F 6  49  ? 1.642   2.593   45.531 1.00 51.84  ? 46  HIS D CD2   1 
ATOM   8366  C  CE1   . HIS F 6  49  ? 1.470   4.121   47.090 1.00 54.93  ? 46  HIS D CE1   1 
ATOM   8367  N  NE2   . HIS F 6  49  ? 0.881   3.065   46.569 1.00 51.75  ? 46  HIS D NE2   1 
ATOM   8368  N  N     . PRO F 6  50  ? 5.844   5.775   42.496 1.00 56.86  ? 47  PRO D N     1 
ATOM   8369  C  CA    . PRO F 6  50  ? 7.029   5.942   41.678 1.00 51.19  ? 47  PRO D CA    1 
ATOM   8370  C  C     . PRO F 6  50  ? 8.297   5.368   42.258 1.00 49.97  ? 47  PRO D C     1 
ATOM   8371  O  O     . PRO F 6  50  ? 9.156   4.965   41.507 1.00 50.69  ? 47  PRO D O     1 
ATOM   8372  C  CB    . PRO F 6  50  ? 7.150   7.449   41.572 1.00 51.63  ? 47  PRO D CB    1 
ATOM   8373  C  CG    . PRO F 6  50  ? 5.746   7.913   41.575 1.00 54.07  ? 47  PRO D CG    1 
ATOM   8374  C  CD    . PRO F 6  50  ? 5.149   7.070   42.674 1.00 58.96  ? 47  PRO D CD    1 
ATOM   8375  N  N     . ASP F 6  51  ? 8.431   5.292   43.569 1.00 54.62  ? 48  ASP D N     1 
ATOM   8376  C  CA    . ASP F 6  51  ? 9.680   4.764   44.100 1.00 63.44  ? 48  ASP D CA    1 
ATOM   8377  C  C     . ASP F 6  51  ? 9.526   3.345   44.620 1.00 64.13  ? 48  ASP D C     1 
ATOM   8378  O  O     . ASP F 6  51  ? 10.337  2.889   45.430 1.00 67.17  ? 48  ASP D O     1 
ATOM   8379  C  CB    . ASP F 6  51  ? 10.253  5.706   45.174 1.00 69.88  ? 48  ASP D CB    1 
ATOM   8380  C  CG    . ASP F 6  51  ? 10.602  7.096   44.613 1.00 79.09  ? 48  ASP D CG    1 
ATOM   8381  O  OD1   . ASP F 6  51  ? 11.125  7.174   43.467 1.00 76.37  ? 48  ASP D OD1   1 
ATOM   8382  O  OD2   . ASP F 6  51  ? 10.351  8.101   45.324 1.00 76.31  ? 48  ASP D OD2   1 
ATOM   8383  N  N     . THR F 6  52  ? 8.519   2.636   44.115 1.00 59.41  ? 49  THR D N     1 
ATOM   8384  C  CA    . THR F 6  52  ? 8.171   1.333   44.627 1.00 52.59  ? 49  THR D CA    1 
ATOM   8385  C  C     . THR F 6  52  ? 8.320   0.238   43.574 1.00 49.95  ? 49  THR D C     1 
ATOM   8386  O  O     . THR F 6  52  ? 7.886   0.376   42.425 1.00 46.04  ? 49  THR D O     1 
ATOM   8387  C  CB    . THR F 6  52  ? 6.736   1.363   45.146 1.00 55.52  ? 49  THR D CB    1 
ATOM   8388  O  OG1   . THR F 6  52  ? 6.633   2.380   46.138 1.00 51.13  ? 49  THR D OG1   1 
ATOM   8389  C  CG2   . THR F 6  52  ? 6.339   0.018   45.765 1.00 57.57  ? 49  THR D CG2   1 
ATOM   8390  N  N     . GLY F 6  53  ? 8.910   -0.868  43.992 1.00 47.65  ? 50  GLY D N     1 
ATOM   8391  C  CA    . GLY F 6  53  ? 9.144   -1.990  43.095 1.00 54.00  ? 50  GLY D CA    1 
ATOM   8392  C  C     . GLY F 6  53  ? 8.200   -3.148  43.362 1.00 57.65  ? 50  GLY D C     1 
ATOM   8393  O  O     . GLY F 6  53  ? 7.392   -3.145  44.313 1.00 46.95  ? 50  GLY D O     1 
ATOM   8394  N  N     . ILE F 6  54  ? 8.300   -4.161  42.516 1.00 55.09  ? 51  ILE D N     1 
ATOM   8395  C  CA    . ILE F 6  54  ? 7.501   -5.333  42.737 1.00 56.58  ? 51  ILE D CA    1 
ATOM   8396  C  C     . ILE F 6  54  ? 8.344   -6.569  42.470 1.00 55.37  ? 51  ILE D C     1 
ATOM   8397  O  O     . ILE F 6  54  ? 9.054   -6.614  41.473 1.00 58.67  ? 51  ILE D O     1 
ATOM   8398  C  CB    . ILE F 6  54  ? 6.201   -5.271  41.897 1.00 51.29  ? 51  ILE D CB    1 
ATOM   8399  C  CG1   . ILE F 6  54  ? 5.199   -6.355  42.339 1.00 47.47  ? 51  ILE D CG1   1 
ATOM   8400  C  CG2   . ILE F 6  54  ? 6.499   -5.375  40.427 1.00 47.96  ? 51  ILE D CG2   1 
ATOM   8401  C  CD1   . ILE F 6  54  ? 3.836   -6.209  41.669 1.00 47.38  ? 51  ILE D CD1   1 
ATOM   8402  N  N     . SER F 6  55  ? 8.257   -7.547  43.382 1.00 53.34  ? 52  SER D N     1 
ATOM   8403  C  CA    . SER F 6  55  ? 8.869   -8.889  43.237 1.00 48.71  ? 52  SER D CA    1 
ATOM   8404  C  C     . SER F 6  55  ? 8.241   -9.761  42.125 1.00 50.66  ? 52  SER D C     1 
ATOM   8405  O  O     . SER F 6  55  ? 7.114   -9.518  41.669 1.00 53.99  ? 52  SER D O     1 
ATOM   8406  C  CB    . SER F 6  55  ? 8.753   -9.639  44.546 1.00 49.83  ? 52  SER D CB    1 
ATOM   8407  O  OG    . SER F 6  55  ? 7.551   -10.403 44.554 1.00 53.22  ? 52  SER D OG    1 
ATOM   8408  N  N     . SER F 6  56  ? 8.959   -10.775 41.663 1.00 50.82  ? 53  SER D N     1 
ATOM   8409  C  CA    . SER F 6  56  ? 8.474   -11.516 40.501 1.00 56.67  ? 53  SER D CA    1 
ATOM   8410  C  C     . SER F 6  56  ? 7.337   -12.401 40.921 1.00 57.50  ? 53  SER D C     1 
ATOM   8411  O  O     . SER F 6  56  ? 6.414   -12.659 40.124 1.00 68.52  ? 53  SER D O     1 
ATOM   8412  C  CB    . SER F 6  56  ? 9.573   -12.331 39.860 1.00 60.54  ? 53  SER D CB    1 
ATOM   8413  O  OG    . SER F 6  56  ? 10.484  -12.773 40.846 1.00 72.21  ? 53  SER D OG    1 
ATOM   8414  N  N     . LYS F 6  57  ? 7.389   -12.855 42.175 1.00 52.07  ? 54  LYS D N     1 
ATOM   8415  C  CA    . LYS F 6  57  ? 6.271   -13.579 42.753 1.00 47.98  ? 54  LYS D CA    1 
ATOM   8416  C  C     . LYS F 6  57  ? 5.079   -12.690 42.903 1.00 49.26  ? 54  LYS D C     1 
ATOM   8417  O  O     . LYS F 6  57  ? 3.966   -13.088 42.565 1.00 57.84  ? 54  LYS D O     1 
ATOM   8418  C  CB    . LYS F 6  57  ? 6.626   -14.157 44.091 1.00 56.13  ? 54  LYS D CB    1 
ATOM   8419  C  CG    . LYS F 6  57  ? 7.402   -15.462 43.990 1.00 66.55  ? 54  LYS D CG    1 
ATOM   8420  C  CD    . LYS F 6  57  ? 7.642   -16.038 45.379 1.00 78.79  ? 54  LYS D CD    1 
ATOM   8421  C  CE    . LYS F 6  57  ? 8.373   -17.380 45.361 1.00 80.96  ? 54  LYS D CE    1 
ATOM   8422  N  NZ    . LYS F 6  57  ? 8.405   -17.921 46.760 1.00 75.58  ? 54  LYS D NZ    1 
ATOM   8423  N  N     . ALA F 6  58  ? 5.292   -11.455 43.349 1.00 48.17  ? 55  ALA D N     1 
ATOM   8424  C  CA    . ALA F 6  58  ? 4.175   -10.523 43.456 1.00 41.56  ? 55  ALA D CA    1 
ATOM   8425  C  C     . ALA F 6  58  ? 3.658   -10.150 42.127 1.00 39.41  ? 55  ALA D C     1 
ATOM   8426  O  O     . ALA F 6  58  ? 2.499   -9.914  42.009 1.00 43.29  ? 55  ALA D O     1 
ATOM   8427  C  CB    . ALA F 6  58  ? 4.531   -9.313  44.262 1.00 45.97  ? 55  ALA D CB    1 
ATOM   8428  N  N     . MET F 6  59  ? 4.486   -10.175 41.091 1.00 43.02  ? 56  MET D N     1 
ATOM   8429  C  CA    . MET F 6  59  ? 3.978   -9.918  39.737 1.00 44.32  ? 56  MET D CA    1 
ATOM   8430  C  C     . MET F 6  59  ? 3.199   -11.090 39.198 1.00 43.62  ? 56  MET D C     1 
ATOM   8431  O  O     . MET F 6  59  ? 2.250   -10.901 38.423 1.00 46.67  ? 56  MET D O     1 
ATOM   8432  C  CB    . MET F 6  59  ? 5.114   -9.599  38.768 1.00 47.58  ? 56  MET D CB    1 
ATOM   8433  C  CG    . MET F 6  59  ? 4.686   -9.292  37.340 1.00 49.20  ? 56  MET D CG    1 
ATOM   8434  S  SD    . MET F 6  59  ? 3.645   -7.809  37.185 1.00 60.62  ? 56  MET D SD    1 
ATOM   8435  C  CE    . MET F 6  59  ? 4.899   -6.544  37.377 1.00 61.34  ? 56  MET D CE    1 
ATOM   8436  N  N     . SER F 6  60  ? 3.574   -12.312 39.555 1.00 46.49  ? 57  SER D N     1 
ATOM   8437  C  CA    . SER F 6  60  ? 2.870   -13.464 38.948 1.00 46.31  ? 57  SER D CA    1 
ATOM   8438  C  C     . SER F 6  60  ? 1.446   -13.423 39.432 1.00 41.55  ? 57  SER D C     1 
ATOM   8439  O  O     . SER F 6  60  ? 0.470   -13.522 38.674 1.00 38.65  ? 57  SER D O     1 
ATOM   8440  C  CB    . SER F 6  60  ? 3.507   -14.770 39.343 1.00 51.56  ? 57  SER D CB    1 
ATOM   8441  O  OG    . SER F 6  60  ? 2.651   -15.814 38.910 1.00 63.78  ? 57  SER D OG    1 
ATOM   8442  N  N     . ILE F 6  61  ? 1.333   -13.138 40.712 1.00 39.13  ? 58  ILE D N     1 
ATOM   8443  C  CA    . ILE F 6  61  ? 0.027   -12.844 41.281 1.00 41.82  ? 58  ILE D CA    1 
ATOM   8444  C  C     . ILE F 6  61  ? -0.745  -11.739 40.582 1.00 41.69  ? 58  ILE D C     1 
ATOM   8445  O  O     . ILE F 6  61  ? -1.921  -11.903 40.249 1.00 46.35  ? 58  ILE D O     1 
ATOM   8446  C  CB    . ILE F 6  61  ? 0.162   -12.494 42.748 1.00 39.29  ? 58  ILE D CB    1 
ATOM   8447  C  CG1   . ILE F 6  61  ? 0.503   -13.776 43.501 1.00 40.56  ? 58  ILE D CG1   1 
ATOM   8448  C  CG2   . ILE F 6  61  ? -1.120  -11.900 43.238 1.00 36.40  ? 58  ILE D CG2   1 
ATOM   8449  C  CD1   . ILE F 6  61  ? 1.068   -13.477 44.848 1.00 43.78  ? 58  ILE D CD1   1 
ATOM   8450  N  N     . MET F 6  62  ? -0.112  -10.613 40.341 1.00 39.93  ? 59  MET D N     1 
ATOM   8451  C  CA    . MET F 6  62  ? -0.860  -9.581  39.644 1.00 46.01  ? 59  MET D CA    1 
ATOM   8452  C  C     . MET F 6  62  ? -1.248  -10.144 38.298 1.00 42.29  ? 59  MET D C     1 
ATOM   8453  O  O     . MET F 6  62  ? -2.337  -9.924  37.810 1.00 40.38  ? 59  MET D O     1 
ATOM   8454  C  CB    . MET F 6  62  ? -0.049  -8.295  39.475 1.00 48.68  ? 59  MET D CB    1 
ATOM   8455  C  CG    . MET F 6  62  ? 0.258   -7.578  40.783 1.00 47.96  ? 59  MET D CG    1 
ATOM   8456  S  SD    . MET F 6  62  ? -1.210  -6.935  41.585 1.00 47.57  ? 59  MET D SD    1 
ATOM   8457  C  CE    . MET F 6  62  ? -2.096  -6.184  40.251 1.00 42.32  ? 59  MET D CE    1 
ATOM   8458  N  N     . ASN F 6  63  ? -0.370  -10.908 37.693 1.00 42.44  ? 60  ASN D N     1 
ATOM   8459  C  CA    . ASN F 6  63  ? -0.792  -11.522 36.454 1.00 49.84  ? 60  ASN D CA    1 
ATOM   8460  C  C     . ASN F 6  63  ? -1.997  -12.507 36.583 1.00 48.14  ? 60  ASN D C     1 
ATOM   8461  O  O     . ASN F 6  63  ? -2.858  -12.631 35.675 1.00 38.64  ? 60  ASN D O     1 
ATOM   8462  C  CB    . ASN F 6  63  ? 0.381   -12.189 35.791 1.00 52.61  ? 60  ASN D CB    1 
ATOM   8463  C  CG    . ASN F 6  63  ? 0.156   -12.334 34.330 1.00 61.52  ? 60  ASN D CG    1 
ATOM   8464  O  OD1   . ASN F 6  63  ? -0.058  -11.345 33.634 1.00 63.63  ? 60  ASN D OD1   1 
ATOM   8465  N  ND2   . ASN F 6  63  ? 0.149   -13.567 33.848 1.00 66.49  ? 60  ASN D ND2   1 
ATOM   8466  N  N     . SER F 6  64  ? -2.067  -13.212 37.713 1.00 46.80  ? 61  SER D N     1 
ATOM   8467  C  CA    . SER F 6  64  ? -3.186  -14.116 37.914 1.00 44.49  ? 61  SER D CA    1 
ATOM   8468  C  C     . SER F 6  64  ? -4.418  -13.270 37.975 1.00 42.36  ? 61  SER D C     1 
ATOM   8469  O  O     . SER F 6  64  ? -5.441  -13.535 37.305 1.00 45.19  ? 61  SER D O     1 
ATOM   8470  C  CB    . SER F 6  64  ? -3.003  -14.890 39.203 1.00 49.36  ? 61  SER D CB    1 
ATOM   8471  O  OG    . SER F 6  64  ? -1.933  -15.842 39.132 1.00 51.50  ? 61  SER D OG    1 
ATOM   8472  N  N     . PHE F 6  65  ? -4.284  -12.203 38.752 1.00 41.70  ? 62  PHE D N     1 
ATOM   8473  C  CA    . PHE F 6  65  ? -5.397  -11.348 39.088 1.00 41.80  ? 62  PHE D CA    1 
ATOM   8474  C  C     . PHE F 6  65  ? -6.008  -10.784 37.860 1.00 41.16  ? 62  PHE D C     1 
ATOM   8475  O  O     . PHE F 6  65  ? -7.226  -10.760 37.723 1.00 52.99  ? 62  PHE D O     1 
ATOM   8476  C  CB    . PHE F 6  65  ? -4.936  -10.220 39.999 1.00 45.55  ? 62  PHE D CB    1 
ATOM   8477  C  CG    . PHE F 6  65  ? -5.945  -9.122  40.174 1.00 47.07  ? 62  PHE D CG    1 
ATOM   8478  C  CD1   . PHE F 6  65  ? -7.173  -9.375  40.745 1.00 50.50  ? 62  PHE D CD1   1 
ATOM   8479  C  CD2   . PHE F 6  65  ? -5.657  -7.817  39.768 1.00 50.97  ? 62  PHE D CD2   1 
ATOM   8480  C  CE1   . PHE F 6  65  ? -8.100  -8.353  40.915 1.00 51.82  ? 62  PHE D CE1   1 
ATOM   8481  C  CE2   . PHE F 6  65  ? -6.578  -6.792  39.923 1.00 48.98  ? 62  PHE D CE2   1 
ATOM   8482  C  CZ    . PHE F 6  65  ? -7.799  -7.063  40.496 1.00 50.54  ? 62  PHE D CZ    1 
ATOM   8483  N  N     . VAL F 6  66  ? -5.193  -10.337 36.930 1.00 41.49  ? 63  VAL D N     1 
ATOM   8484  C  CA    . VAL F 6  66  ? -5.778  -9.742  35.721 1.00 43.58  ? 63  VAL D CA    1 
ATOM   8485  C  C     . VAL F 6  66  ? -6.454  -10.775 34.838 1.00 41.79  ? 63  VAL D C     1 
ATOM   8486  O  O     . VAL F 6  66  ? -7.540  -10.549 34.356 1.00 41.24  ? 63  VAL D O     1 
ATOM   8487  C  CB    . VAL F 6  66  ? -4.745  -8.988  34.882 1.00 44.31  ? 63  VAL D CB    1 
ATOM   8488  C  CG1   . VAL F 6  66  ? -5.402  -8.459  33.612 1.00 48.06  ? 63  VAL D CG1   1 
ATOM   8489  C  CG2   . VAL F 6  66  ? -4.156  -7.849  35.688 1.00 43.46  ? 63  VAL D CG2   1 
ATOM   8490  N  N     . ASN F 6  67  ? -5.805  -11.906 34.609 1.00 42.62  ? 64  ASN D N     1 
ATOM   8491  C  CA    . ASN F 6  67  ? -6.467  -12.948 33.872 1.00 44.54  ? 64  ASN D CA    1 
ATOM   8492  C  C     . ASN F 6  67  ? -7.757  -13.370 34.533 1.00 43.56  ? 64  ASN D C     1 
ATOM   8493  O  O     . ASN F 6  67  ? -8.765  -13.649 33.882 1.00 41.30  ? 64  ASN D O     1 
ATOM   8494  C  CB    . ASN F 6  67  ? -5.589  -14.138 33.811 1.00 47.03  ? 64  ASN D CB    1 
ATOM   8495  C  CG    . ASN F 6  67  ? -4.432  -13.931 32.903 1.00 55.04  ? 64  ASN D CG    1 
ATOM   8496  O  OD1   . ASN F 6  67  ? -4.586  -13.423 31.784 1.00 56.53  ? 64  ASN D OD1   1 
ATOM   8497  N  ND2   . ASN F 6  67  ? -3.248  -14.321 33.371 1.00 60.01  ? 64  ASN D ND2   1 
ATOM   8498  N  N     . ASP F 6  68  ? -7.718  -13.453 35.841 1.00 40.51  ? 65  ASP D N     1 
ATOM   8499  C  CA    . ASP F 6  68  ? -8.904  -13.880 36.518 1.00 43.55  ? 65  ASP D CA    1 
ATOM   8500  C  C     . ASP F 6  68  ? -10.098 -12.964 36.235 1.00 44.55  ? 65  ASP D C     1 
ATOM   8501  O  O     . ASP F 6  68  ? -11.142 -13.363 35.746 1.00 49.84  ? 65  ASP D O     1 
ATOM   8502  C  CB    . ASP F 6  68  ? -8.635  -13.954 38.005 1.00 42.66  ? 65  ASP D CB    1 
ATOM   8503  C  CG    . ASP F 6  68  ? -9.758  -14.617 38.728 1.00 46.37  ? 65  ASP D CG    1 
ATOM   8504  O  OD1   . ASP F 6  68  ? -10.366 -15.486 38.075 1.00 47.33  ? 65  ASP D OD1   1 
ATOM   8505  O  OD2   . ASP F 6  68  ? -10.039 -14.271 39.907 1.00 45.93  ? 65  ASP D OD2   1 
ATOM   8506  N  N     . VAL F 6  69  ? -9.931  -11.703 36.532 1.00 46.73  ? 66  VAL D N     1 
ATOM   8507  C  CA    . VAL F 6  69  ? -11.008 -10.776 36.333 1.00 46.47  ? 66  VAL D CA    1 
ATOM   8508  C  C     . VAL F 6  69  ? -11.407 -10.652 34.864 1.00 42.33  ? 66  VAL D C     1 
ATOM   8509  O  O     . VAL F 6  69  ? -12.595 -10.544 34.522 1.00 47.00  ? 66  VAL D O     1 
ATOM   8510  C  CB    . VAL F 6  69  ? -10.589 -9.438  36.891 1.00 48.69  ? 66  VAL D CB    1 
ATOM   8511  C  CG1   . VAL F 6  69  ? -11.535 -8.362  36.431 1.00 52.05  ? 66  VAL D CG1   1 
ATOM   8512  C  CG2   . VAL F 6  69  ? -10.555 -9.520  38.399 1.00 48.22  ? 66  VAL D CG2   1 
ATOM   8513  N  N     . PHE F 6  70  ? -10.435 -10.681 33.978 1.00 40.49  ? 67  PHE D N     1 
ATOM   8514  C  CA    . PHE F 6  70  ? -10.766 -10.778 32.562 1.00 42.16  ? 67  PHE D CA    1 
ATOM   8515  C  C     . PHE F 6  70  ? -11.803 -11.873 32.323 1.00 43.45  ? 67  PHE D C     1 
ATOM   8516  O  O     . PHE F 6  70  ? -12.823 -11.598 31.723 1.00 41.18  ? 67  PHE D O     1 
ATOM   8517  C  CB    . PHE F 6  70  ? -9.529  -11.075 31.741 1.00 44.58  ? 67  PHE D CB    1 
ATOM   8518  C  CG    . PHE F 6  70  ? -9.804  -11.261 30.269 1.00 47.90  ? 67  PHE D CG    1 
ATOM   8519  C  CD1   . PHE F 6  70  ? -9.494  -10.272 29.360 1.00 50.49  ? 67  PHE D CD1   1 
ATOM   8520  C  CD2   . PHE F 6  70  ? -10.301 -12.452 29.781 1.00 57.94  ? 67  PHE D CD2   1 
ATOM   8521  C  CE1   . PHE F 6  70  ? -9.710  -10.451 28.001 1.00 54.21  ? 67  PHE D CE1   1 
ATOM   8522  C  CE2   . PHE F 6  70  ? -10.520 -12.636 28.418 1.00 60.87  ? 67  PHE D CE2   1 
ATOM   8523  C  CZ    . PHE F 6  70  ? -10.235 -11.632 27.529 1.00 55.00  ? 67  PHE D CZ    1 
ATOM   8524  N  N     . GLU F 6  71  ? -11.533 -13.105 32.798 1.00 44.76  ? 68  GLU D N     1 
ATOM   8525  C  CA    . GLU F 6  71  ? -12.334 -14.255 32.435 1.00 47.03  ? 68  GLU D CA    1 
ATOM   8526  C  C     . GLU F 6  71  ? -13.682 -14.105 33.067 1.00 43.05  ? 68  GLU D C     1 
ATOM   8527  O  O     . GLU F 6  71  ? -14.717 -14.329 32.455 1.00 35.01  ? 68  GLU D O     1 
ATOM   8528  C  CB    . GLU F 6  71  ? -11.680 -15.555 32.864 1.00 56.95  ? 68  GLU D CB    1 
ATOM   8529  C  CG    . GLU F 6  71  ? -10.410 -15.861 32.066 1.00 72.58  ? 68  GLU D CG    1 
ATOM   8530  C  CD    . GLU F 6  71  ? -9.533  -16.969 32.659 1.00 81.72  ? 68  GLU D CD    1 
ATOM   8531  O  OE1   . GLU F 6  71  ? -9.591  -17.218 33.887 1.00 83.61  ? 68  GLU D OE1   1 
ATOM   8532  O  OE2   . GLU F 6  71  ? -8.765  -17.593 31.889 1.00 92.27  ? 68  GLU D OE2   1 
ATOM   8533  N  N     . ARG F 6  72  ? -13.693 -13.659 34.297 1.00 42.78  ? 69  ARG D N     1 
ATOM   8534  C  CA    . ARG F 6  72  ? -14.983 -13.519 34.945 1.00 47.60  ? 69  ARG D CA    1 
ATOM   8535  C  C     . ARG F 6  72  ? -15.944 -12.545 34.221 1.00 50.42  ? 69  ARG D C     1 
ATOM   8536  O  O     . ARG F 6  72  ? -17.137 -12.860 34.002 1.00 51.72  ? 69  ARG D O     1 
ATOM   8537  C  CB    . ARG F 6  72  ? -14.756 -13.082 36.357 1.00 47.48  ? 69  ARG D CB    1 
ATOM   8538  C  CG    . ARG F 6  72  ? -14.029 -14.134 37.174 1.00 48.15  ? 69  ARG D CG    1 
ATOM   8539  C  CD    . ARG F 6  72  ? -14.444 -13.919 38.614 1.00 48.86  ? 69  ARG D CD    1 
ATOM   8540  N  NE    . ARG F 6  72  ? -13.321 -13.774 39.497 1.00 43.91  ? 69  ARG D NE    1 
ATOM   8541  C  CZ    . ARG F 6  72  ? -13.429 -13.240 40.702 1.00 49.22  ? 69  ARG D CZ    1 
ATOM   8542  N  NH1   . ARG F 6  72  ? -14.590 -12.808 41.140 1.00 47.32  ? 69  ARG D NH1   1 
ATOM   8543  N  NH2   . ARG F 6  72  ? -12.372 -13.162 41.495 1.00 57.94  ? 69  ARG D NH2   1 
ATOM   8544  N  N     . ILE F 6  73  ? -15.416 -11.376 33.850 1.00 48.01  ? 70  ILE D N     1 
ATOM   8545  C  CA    . ILE F 6  73  ? -16.219 -10.346 33.174 1.00 47.62  ? 70  ILE D CA    1 
ATOM   8546  C  C     . ILE F 6  73  ? -16.616 -10.791 31.790 1.00 48.43  ? 70  ILE D C     1 
ATOM   8547  O  O     . ILE F 6  73  ? -17.771 -10.648 31.377 1.00 51.61  ? 70  ILE D O     1 
ATOM   8548  C  CB    . ILE F 6  73  ? -15.414 -9.055  32.982 1.00 50.73  ? 70  ILE D CB    1 
ATOM   8549  C  CG1   . ILE F 6  73  ? -15.095 -8.404  34.337 1.00 52.67  ? 70  ILE D CG1   1 
ATOM   8550  C  CG2   . ILE F 6  73  ? -16.166 -8.089  32.094 1.00 43.41  ? 70  ILE D CG2   1 
ATOM   8551  C  CD1   . ILE F 6  73  ? -14.090 -7.284  34.257 1.00 50.45  ? 70  ILE D CD1   1 
ATOM   8552  N  N     . ALA F 6  74  ? -15.639 -11.306 31.051 1.00 46.78  ? 71  ALA D N     1 
ATOM   8553  C  CA    . ALA F 6  74  ? -15.904 -11.811 29.714 1.00 46.80  ? 71  ALA D CA    1 
ATOM   8554  C  C     . ALA F 6  74  ? -16.983 -12.883 29.795 1.00 45.22  ? 71  ALA D C     1 
ATOM   8555  O  O     . ALA F 6  74  ? -17.877 -12.901 28.983 1.00 47.71  ? 71  ALA D O     1 
ATOM   8556  C  CB    . ALA F 6  74  ? -14.634 -12.361 29.094 1.00 46.27  ? 71  ALA D CB    1 
ATOM   8557  N  N     . GLY F 6  75  ? -16.918 -13.727 30.818 1.00 44.94  ? 72  GLY D N     1 
ATOM   8558  C  CA    . GLY F 6  75  ? -17.880 -14.797 30.991 1.00 46.58  ? 72  GLY D CA    1 
ATOM   8559  C  C     . GLY F 6  75  ? -19.250 -14.238 31.216 1.00 51.82  ? 72  GLY D C     1 
ATOM   8560  O  O     . GLY F 6  75  ? -20.233 -14.662 30.592 1.00 50.22  ? 72  GLY D O     1 
ATOM   8561  N  N     . GLU F 6  76  ? -19.321 -13.268 32.115 1.00 56.91  ? 73  GLU D N     1 
ATOM   8562  C  CA    . GLU F 6  76  ? -20.615 -12.691 32.467 1.00 57.70  ? 73  GLU D CA    1 
ATOM   8563  C  C     . GLU F 6  76  ? -21.238 -12.099 31.231 1.00 58.67  ? 73  GLU D C     1 
ATOM   8564  O  O     . GLU F 6  76  ? -22.441 -12.204 31.035 1.00 59.46  ? 73  GLU D O     1 
ATOM   8565  C  CB    . GLU F 6  76  ? -20.448 -11.603 33.513 1.00 56.69  ? 73  GLU D CB    1 
ATOM   8566  C  CG    . GLU F 6  76  ? -20.272 -12.161 34.906 1.00 61.55  ? 73  GLU D CG    1 
ATOM   8567  C  CD    . GLU F 6  76  ? -21.590 -12.624 35.530 1.00 62.26  ? 73  GLU D CD    1 
ATOM   8568  O  OE1   . GLU F 6  76  ? -22.701 -12.420 34.940 1.00 55.83  ? 73  GLU D OE1   1 
ATOM   8569  O  OE2   . GLU F 6  76  ? -21.492 -13.188 36.641 1.00 60.15  ? 73  GLU D OE2   1 
ATOM   8570  N  N     . ALA F 6  77  ? -20.404 -11.464 30.405 1.00 52.23  ? 74  ALA D N     1 
ATOM   8571  C  CA    . ALA F 6  77  ? -20.877 -10.816 29.207 1.00 47.55  ? 74  ALA D CA    1 
ATOM   8572  C  C     . ALA F 6  77  ? -21.271 -11.858 28.190 1.00 50.15  ? 74  ALA D C     1 
ATOM   8573  O  O     . ALA F 6  77  ? -22.252 -11.699 27.482 1.00 49.81  ? 74  ALA D O     1 
ATOM   8574  C  CB    . ALA F 6  77  ? -19.794 -9.960  28.642 1.00 52.68  ? 74  ALA D CB    1 
ATOM   8575  N  N     . SER F 6  78  ? -20.493 -12.923 28.098 1.00 46.28  ? 75  SER D N     1 
ATOM   8576  C  CA    . SER F 6  78  ? -20.869 -14.016 27.246 1.00 48.10  ? 75  SER D CA    1 
ATOM   8577  C  C     . SER F 6  78  ? -22.314 -14.440 27.523 1.00 50.46  ? 75  SER D C     1 
ATOM   8578  O  O     . SER F 6  78  ? -23.161 -14.455 26.620 1.00 51.67  ? 75  SER D O     1 
ATOM   8579  C  CB    . SER F 6  78  ? -19.939 -15.194 27.476 1.00 48.72  ? 75  SER D CB    1 
ATOM   8580  O  OG    . SER F 6  78  ? -20.274 -16.201 26.568 1.00 53.83  ? 75  SER D OG    1 
ATOM   8581  N  N     . ARG F 6  79  ? -22.572 -14.794 28.776 1.00 54.97  ? 76  ARG D N     1 
ATOM   8582  C  CA    . ARG F 6  79  ? -23.887 -15.269 29.209 1.00 60.33  ? 76  ARG D CA    1 
ATOM   8583  C  C     . ARG F 6  79  ? -24.971 -14.222 28.948 1.00 58.98  ? 76  ARG D C     1 
ATOM   8584  O  O     . ARG F 6  79  ? -26.042 -14.496 28.426 1.00 60.26  ? 76  ARG D O     1 
ATOM   8585  C  CB    . ARG F 6  79  ? -23.857 -15.581 30.712 1.00 61.86  ? 76  ARG D CB    1 
ATOM   8586  C  CG    . ARG F 6  79  ? -23.519 -17.023 31.054 1.00 62.87  ? 76  ARG D CG    1 
ATOM   8587  C  CD    . ARG F 6  79  ? -23.035 -17.177 32.496 1.00 60.94  ? 76  ARG D CD    1 
ATOM   8588  N  NE    . ARG F 6  79  ? -21.586 -17.354 32.482 1.00 61.75  ? 76  ARG D NE    1 
ATOM   8589  C  CZ    . ARG F 6  79  ? -20.742 -16.871 33.380 1.00 56.58  ? 76  ARG D CZ    1 
ATOM   8590  N  NH1   . ARG F 6  79  ? -21.162 -16.142 34.410 1.00 56.37  ? 76  ARG D NH1   1 
ATOM   8591  N  NH2   . ARG F 6  79  ? -19.456 -17.094 33.203 1.00 57.08  ? 76  ARG D NH2   1 
ATOM   8592  N  N     . LEU F 6  80  ? -24.667 -13.004 29.334 1.00 62.13  ? 77  LEU D N     1 
ATOM   8593  C  CA    . LEU F 6  80  ? -25.566 -11.881 29.130 1.00 62.56  ? 77  LEU D CA    1 
ATOM   8594  C  C     . LEU F 6  80  ? -26.020 -11.704 27.652 1.00 59.37  ? 77  LEU D C     1 
ATOM   8595  O  O     . LEU F 6  80  ? -27.201 -11.518 27.366 1.00 55.11  ? 77  LEU D O     1 
ATOM   8596  C  CB    . LEU F 6  80  ? -24.835 -10.653 29.619 1.00 61.95  ? 77  LEU D CB    1 
ATOM   8597  C  CG    . LEU F 6  80  ? -25.586 -9.340  29.665 1.00 73.79  ? 77  LEU D CG    1 
ATOM   8598  C  CD1   . LEU F 6  80  ? -26.883 -9.491  30.455 1.00 71.79  ? 77  LEU D CD1   1 
ATOM   8599  C  CD2   . LEU F 6  80  ? -24.656 -8.285  30.269 1.00 75.90  ? 77  LEU D CD2   1 
ATOM   8600  N  N     . ALA F 6  81  ? -25.083 -11.766 26.718 1.00 54.60  ? 78  ALA D N     1 
ATOM   8601  C  CA    . ALA F 6  81  ? -25.437 -11.729 25.317 1.00 56.45  ? 78  ALA D CA    1 
ATOM   8602  C  C     . ALA F 6  81  ? -26.337 -12.915 24.990 1.00 60.82  ? 78  ALA D C     1 
ATOM   8603  O  O     . ALA F 6  81  ? -27.481 -12.734 24.552 1.00 61.11  ? 78  ALA D O     1 
ATOM   8604  C  CB    . ALA F 6  81  ? -24.192 -11.733 24.453 1.00 56.18  ? 78  ALA D CB    1 
ATOM   8605  N  N     . HIS F 6  82  ? -25.861 -14.127 25.247 1.00 63.44  ? 79  HIS D N     1 
ATOM   8606  C  CA    . HIS F 6  82  ? -26.697 -15.285 24.988 1.00 63.81  ? 79  HIS D CA    1 
ATOM   8607  C  C     . HIS F 6  82  ? -28.083 -15.045 25.552 1.00 65.43  ? 79  HIS D C     1 
ATOM   8608  O  O     . HIS F 6  82  ? -29.060 -15.158 24.838 1.00 70.12  ? 79  HIS D O     1 
ATOM   8609  C  CB    . HIS F 6  82  ? -26.093 -16.550 25.553 1.00 67.55  ? 79  HIS D CB    1 
ATOM   8610  C  CG    . HIS F 6  82  ? -24.909 -17.035 24.777 1.00 85.66  ? 79  HIS D CG    1 
ATOM   8611  N  ND1   . HIS F 6  82  ? -25.024 -17.558 23.506 1.00 92.09  ? 79  HIS D ND1   1 
ATOM   8612  C  CD2   . HIS F 6  82  ? -23.586 -17.065 25.079 1.00 90.19  ? 79  HIS D CD2   1 
ATOM   8613  C  CE1   . HIS F 6  82  ? -23.824 -17.891 23.061 1.00 94.91  ? 79  HIS D CE1   1 
ATOM   8614  N  NE2   . HIS F 6  82  ? -22.934 -17.600 23.995 1.00 90.14  ? 79  HIS D NE2   1 
ATOM   8615  N  N     . TYR F 6  83  ? -28.177 -14.663 26.816 1.00 65.34  ? 80  TYR D N     1 
ATOM   8616  C  CA    . TYR F 6  83  ? -29.485 -14.500 27.435 1.00 70.64  ? 80  TYR D CA    1 
ATOM   8617  C  C     . TYR F 6  83  ? -30.406 -13.601 26.615 1.00 73.50  ? 80  TYR D C     1 
ATOM   8618  O  O     . TYR F 6  83  ? -31.591 -13.869 26.550 1.00 65.19  ? 80  TYR D O     1 
ATOM   8619  C  CB    . TYR F 6  83  ? -29.373 -13.945 28.860 1.00 73.87  ? 80  TYR D CB    1 
ATOM   8620  C  CG    . TYR F 6  83  ? -28.697 -14.865 29.869 1.00 80.30  ? 80  TYR D CG    1 
ATOM   8621  C  CD1   . TYR F 6  83  ? -28.324 -14.386 31.131 1.00 78.13  ? 80  TYR D CD1   1 
ATOM   8622  C  CD2   . TYR F 6  83  ? -28.408 -16.208 29.566 1.00 79.05  ? 80  TYR D CD2   1 
ATOM   8623  C  CE1   . TYR F 6  83  ? -27.700 -15.208 32.057 1.00 76.27  ? 80  TYR D CE1   1 
ATOM   8624  C  CE2   . TYR F 6  83  ? -27.783 -17.031 30.487 1.00 75.17  ? 80  TYR D CE2   1 
ATOM   8625  C  CZ    . TYR F 6  83  ? -27.424 -16.526 31.728 1.00 75.65  ? 80  TYR D CZ    1 
ATOM   8626  O  OH    . TYR F 6  83  ? -26.798 -17.350 32.641 1.00 78.09  ? 80  TYR D OH    1 
ATOM   8627  N  N     . ASN F 6  84  ? -29.861 -12.550 26.005 1.00 70.58  ? 81  ASN D N     1 
ATOM   8628  C  CA    . ASN F 6  84  ? -30.635 -11.656 25.162 1.00 69.61  ? 81  ASN D CA    1 
ATOM   8629  C  C     . ASN F 6  84  ? -30.492 -11.926 23.672 1.00 73.78  ? 81  ASN D C     1 
ATOM   8630  O  O     . ASN F 6  84  ? -30.639 -11.009 22.855 1.00 72.06  ? 81  ASN D O     1 
ATOM   8631  C  CB    . ASN F 6  84  ? -30.211 -10.224 25.426 1.00 70.51  ? 81  ASN D CB    1 
ATOM   8632  C  CG    . ASN F 6  84  ? -30.635 -9.748  26.777 1.00 67.60  ? 81  ASN D CG    1 
ATOM   8633  O  OD1   . ASN F 6  84  ? -31.805 -9.447  27.015 1.00 71.77  ? 81  ASN D OD1   1 
ATOM   8634  N  ND2   . ASN F 6  84  ? -29.693 -9.670  27.672 1.00 71.73  ? 81  ASN D ND2   1 
ATOM   8635  N  N     . LYS F 6  85  ? -30.201 -13.169 23.303 1.00 74.31  ? 82  LYS D N     1 
ATOM   8636  C  CA    . LYS F 6  85  ? -30.039 -13.534 21.889 1.00 76.05  ? 82  LYS D CA    1 
ATOM   8637  C  C     . LYS F 6  85  ? -29.320 -12.458 21.071 1.00 71.23  ? 82  LYS D C     1 
ATOM   8638  O  O     . LYS F 6  85  ? -29.730 -12.134 19.978 1.00 72.60  ? 82  LYS D O     1 
ATOM   8639  C  CB    . LYS F 6  85  ? -31.400 -13.827 21.252 1.00 85.15  ? 82  LYS D CB    1 
ATOM   8640  C  CG    . LYS F 6  85  ? -32.226 -14.927 21.915 1.00 94.00  ? 82  LYS D CG    1 
ATOM   8641  C  CD    . LYS F 6  85  ? -33.707 -14.537 21.952 1.00 103.46 ? 82  LYS D CD    1 
ATOM   8642  C  CE    . LYS F 6  85  ? -34.538 -15.395 22.901 1.00 106.99 ? 82  LYS D CE    1 
ATOM   8643  N  NZ    . LYS F 6  85  ? -34.825 -16.753 22.358 1.00 106.37 ? 82  LYS D NZ    1 
ATOM   8644  N  N     . ARG F 6  86  ? -28.254 -11.901 21.627 1.00 77.93  ? 83  ARG D N     1 
ATOM   8645  C  CA    . ARG F 6  86  ? -27.334 -11.052 20.896 1.00 79.78  ? 83  ARG D CA    1 
ATOM   8646  C  C     . ARG F 6  86  ? -26.155 -11.936 20.570 1.00 73.34  ? 83  ARG D C     1 
ATOM   8647  O  O     . ARG F 6  86  ? -25.868 -12.871 21.295 1.00 79.85  ? 83  ARG D O     1 
ATOM   8648  C  CB    . ARG F 6  86  ? -26.847 -9.893  21.762 1.00 84.25  ? 83  ARG D CB    1 
ATOM   8649  C  CG    . ARG F 6  86  ? -27.933 -8.950  22.258 1.00 93.92  ? 83  ARG D CG    1 
ATOM   8650  C  CD    . ARG F 6  86  ? -28.113 -7.756  21.326 1.00 109.09 ? 83  ARG D CD    1 
ATOM   8651  N  NE    . ARG F 6  86  ? -29.404 -7.084  21.514 1.00 113.64 ? 83  ARG D NE    1 
ATOM   8652  C  CZ    . ARG F 6  86  ? -30.582 -7.569  21.108 1.00 104.48 ? 83  ARG D CZ    1 
ATOM   8653  N  NH1   . ARG F 6  86  ? -30.669 -8.747  20.490 1.00 107.74 ? 83  ARG D NH1   1 
ATOM   8654  N  NH2   . ARG F 6  86  ? -31.687 -6.878  21.333 1.00 98.85  ? 83  ARG D NH2   1 
ATOM   8655  N  N     . SER F 6  87  ? -25.472 -11.627 19.488 1.00 67.57  ? 84  SER D N     1 
ATOM   8656  C  CA    . SER F 6  87  ? -24.338 -12.386 19.033 1.00 62.31  ? 84  SER D CA    1 
ATOM   8657  C  C     . SER F 6  87  ? -23.058 -11.567 19.090 1.00 64.71  ? 84  SER D C     1 
ATOM   8658  O  O     . SER F 6  87  ? -21.948 -12.058 18.764 1.00 60.11  ? 84  SER D O     1 
ATOM   8659  C  CB    . SER F 6  87  ? -24.609 -12.746 17.577 1.00 69.24  ? 84  SER D CB    1 
ATOM   8660  O  OG    . SER F 6  87  ? -24.876 -11.554 16.846 1.00 68.59  ? 84  SER D OG    1 
ATOM   8661  N  N     . THR F 6  88  ? -23.219 -10.293 19.435 1.00 69.23  ? 85  THR D N     1 
ATOM   8662  C  CA    . THR F 6  88  ? -22.110 -9.346  19.498 1.00 75.08  ? 85  THR D CA    1 
ATOM   8663  C  C     . THR F 6  88  ? -21.887 -8.915  20.956 1.00 71.58  ? 85  THR D C     1 
ATOM   8664  O  O     . THR F 6  88  ? -22.829 -8.490  21.625 1.00 72.30  ? 85  THR D O     1 
ATOM   8665  C  CB    . THR F 6  88  ? -22.413 -8.057  18.694 1.00 78.00  ? 85  THR D CB    1 
ATOM   8666  O  OG1   . THR F 6  88  ? -23.105 -8.358  17.472 1.00 83.42  ? 85  THR D OG1   1 
ATOM   8667  C  CG2   . THR F 6  88  ? -21.122 -7.312  18.402 1.00 79.22  ? 85  THR D CG2   1 
ATOM   8668  N  N     . ILE F 6  89  ? -20.657 -9.011  21.448 1.00 64.27  ? 86  ILE D N     1 
ATOM   8669  C  CA    . ILE F 6  89  ? -20.317 -8.451  22.772 1.00 63.04  ? 86  ILE D CA    1 
ATOM   8670  C  C     . ILE F 6  89  ? -19.735 -7.046  22.612 1.00 63.97  ? 86  ILE D C     1 
ATOM   8671  O  O     . ILE F 6  89  ? -18.611 -6.875  22.080 1.00 58.94  ? 86  ILE D O     1 
ATOM   8672  C  CB    . ILE F 6  89  ? -19.274 -9.309  23.509 1.00 64.32  ? 86  ILE D CB    1 
ATOM   8673  C  CG1   . ILE F 6  89  ? -19.917 -10.569 24.067 1.00 64.84  ? 86  ILE D CG1   1 
ATOM   8674  C  CG2   . ILE F 6  89  ? -18.619 -8.541  24.652 1.00 69.00  ? 86  ILE D CG2   1 
ATOM   8675  C  CD1   . ILE F 6  89  ? -18.903 -11.602 24.494 1.00 65.26  ? 86  ILE D CD1   1 
ATOM   8676  N  N     . THR F 6  90  ? -20.473 -6.060  23.105 1.00 55.96  ? 87  THR D N     1 
ATOM   8677  C  CA    . THR F 6  90  ? -20.062 -4.652  23.018 1.00 60.26  ? 87  THR D CA    1 
ATOM   8678  C  C     . THR F 6  90  ? -19.633 -4.074  24.363 1.00 63.22  ? 87  THR D C     1 
ATOM   8679  O  O     . THR F 6  90  ? -19.653 -4.745  25.387 1.00 79.94  ? 87  THR D O     1 
ATOM   8680  C  CB    . THR F 6  90  ? -21.241 -3.796  22.533 1.00 60.95  ? 87  THR D CB    1 
ATOM   8681  O  OG1   . THR F 6  90  ? -22.183 -3.615  23.605 1.00 57.42  ? 87  THR D OG1   1 
ATOM   8682  C  CG2   . THR F 6  90  ? -21.932 -4.473  21.373 1.00 64.19  ? 87  THR D CG2   1 
ATOM   8683  N  N     . SER F 6  91  ? -19.292 -2.804  24.366 1.00 59.95  ? 88  SER D N     1 
ATOM   8684  C  CA    . SER F 6  91  ? -18.998 -2.114  25.601 1.00 59.85  ? 88  SER D CA    1 
ATOM   8685  C  C     . SER F 6  91  ? -20.190 -2.136  26.499 1.00 53.77  ? 88  SER D C     1 
ATOM   8686  O  O     . SER F 6  91  ? -20.041 -2.170  27.698 1.00 62.61  ? 88  SER D O     1 
ATOM   8687  C  CB    . SER F 6  91  ? -18.592 -0.658  25.329 1.00 66.91  ? 88  SER D CB    1 
ATOM   8688  O  OG    . SER F 6  91  ? -19.662 0.059   24.724 1.00 66.68  ? 88  SER D OG    1 
ATOM   8689  N  N     . ARG F 6  92  ? -21.384 -2.084  25.943 1.00 56.90  ? 89  ARG D N     1 
ATOM   8690  C  CA    . ARG F 6  92  ? -22.587 -2.142  26.776 1.00 57.69  ? 89  ARG D CA    1 
ATOM   8691  C  C     . ARG F 6  92  ? -22.666 -3.459  27.580 1.00 62.38  ? 89  ARG D C     1 
ATOM   8692  O  O     . ARG F 6  92  ? -23.053 -3.472  28.741 1.00 61.02  ? 89  ARG D O     1 
ATOM   8693  C  CB    . ARG F 6  92  ? -23.820 -1.979  25.904 1.00 61.21  ? 89  ARG D CB    1 
ATOM   8694  C  CG    . ARG F 6  92  ? -25.103 -1.870  26.703 1.00 72.77  ? 89  ARG D CG    1 
ATOM   8695  C  CD    . ARG F 6  92  ? -26.246 -1.235  25.923 1.00 73.20  ? 89  ARG D CD    1 
ATOM   8696  N  NE    . ARG F 6  92  ? -27.354 -0.937  26.832 1.00 78.00  ? 89  ARG D NE    1 
ATOM   8697  C  CZ    . ARG F 6  92  ? -28.317 -1.794  27.171 1.00 80.18  ? 89  ARG D CZ    1 
ATOM   8698  N  NH1   . ARG F 6  92  ? -28.330 -3.028  26.663 1.00 72.26  ? 89  ARG D NH1   1 
ATOM   8699  N  NH2   . ARG F 6  92  ? -29.282 -1.410  28.022 1.00 79.46  ? 89  ARG D NH2   1 
ATOM   8700  N  N     . GLU F 6  93  ? -22.262 -4.571  26.964 1.00 67.15  ? 90  GLU D N     1 
ATOM   8701  C  CA    . GLU F 6  93  ? -22.258 -5.864  27.659 1.00 61.16  ? 90  GLU D CA    1 
ATOM   8702  C  C     . GLU F 6  93  ? -21.141 -5.955  28.699 1.00 56.95  ? 90  GLU D C     1 
ATOM   8703  O  O     . GLU F 6  93  ? -21.332 -6.503  29.786 1.00 54.75  ? 90  GLU D O     1 
ATOM   8704  C  CB    . GLU F 6  93  ? -22.168 -7.007  26.665 1.00 57.29  ? 90  GLU D CB    1 
ATOM   8705  C  CG    . GLU F 6  93  ? -23.507 -7.378  26.035 1.00 64.16  ? 90  GLU D CG    1 
ATOM   8706  C  CD    . GLU F 6  93  ? -24.029 -6.359  25.023 1.00 65.13  ? 90  GLU D CD    1 
ATOM   8707  O  OE1   . GLU F 6  93  ? -25.209 -5.953  25.130 1.00 58.63  ? 90  GLU D OE1   1 
ATOM   8708  O  OE2   . GLU F 6  93  ? -23.254 -5.952  24.131 1.00 66.85  ? 90  GLU D OE2   1 
ATOM   8709  N  N     . ILE F 6  94  ? -19.987 -5.391  28.380 1.00 50.51  ? 91  ILE D N     1 
ATOM   8710  C  CA    . ILE F 6  94  ? -18.922 -5.317  29.357 1.00 52.93  ? 91  ILE D CA    1 
ATOM   8711  C  C     . ILE F 6  94  ? -19.364 -4.523  30.577 1.00 53.51  ? 91  ILE D C     1 
ATOM   8712  O  O     . ILE F 6  94  ? -19.130 -4.906  31.731 1.00 54.99  ? 91  ILE D O     1 
ATOM   8713  C  CB    . ILE F 6  94  ? -17.681 -4.632  28.794 1.00 54.73  ? 91  ILE D CB    1 
ATOM   8714  C  CG1   . ILE F 6  94  ? -17.204 -5.344  27.539 1.00 62.08  ? 91  ILE D CG1   1 
ATOM   8715  C  CG2   . ILE F 6  94  ? -16.558 -4.640  29.831 1.00 56.51  ? 91  ILE D CG2   1 
ATOM   8716  C  CD1   . ILE F 6  94  ? -16.883 -6.809  27.776 1.00 68.23  ? 91  ILE D CD1   1 
ATOM   8717  N  N     . GLN F 6  95  ? -20.012 -3.409  30.311 1.00 55.13  ? 92  GLN D N     1 
ATOM   8718  C  CA    . GLN F 6  95  ? -20.382 -2.520  31.370 1.00 58.17  ? 92  GLN D CA    1 
ATOM   8719  C  C     . GLN F 6  95  ? -21.323 -3.232  32.315 1.00 53.94  ? 92  GLN D C     1 
ATOM   8720  O  O     . GLN F 6  95  ? -21.103 -3.241  33.514 1.00 52.84  ? 92  GLN D O     1 
ATOM   8721  C  CB    . GLN F 6  95  ? -21.003 -1.243  30.814 1.00 62.51  ? 92  GLN D CB    1 
ATOM   8722  C  CG    . GLN F 6  95  ? -21.443 -0.287  31.910 1.00 69.10  ? 92  GLN D CG    1 
ATOM   8723  C  CD    . GLN F 6  95  ? -21.623 1.122   31.410 1.00 64.21  ? 92  GLN D CD    1 
ATOM   8724  O  OE1   . GLN F 6  95  ? -22.705 1.496   31.013 1.00 57.98  ? 92  GLN D OE1   1 
ATOM   8725  N  NE2   . GLN F 6  95  ? -20.561 1.888   31.397 1.00 65.63  ? 92  GLN D NE2   1 
ATOM   8726  N  N     . THR F 6  96  ? -22.362 -3.854  31.791 1.00 51.13  ? 93  THR D N     1 
ATOM   8727  C  CA    . THR F 6  96  ? -23.241 -4.546  32.678 1.00 52.84  ? 93  THR D CA    1 
ATOM   8728  C  C     . THR F 6  96  ? -22.437 -5.592  33.460 1.00 49.37  ? 93  THR D C     1 
ATOM   8729  O  O     . THR F 6  96  ? -22.543 -5.687  34.673 1.00 51.14  ? 93  THR D O     1 
ATOM   8730  C  CB    . THR F 6  96  ? -24.386 -5.210  31.911 1.00 54.32  ? 93  THR D CB    1 
ATOM   8731  O  OG1   . THR F 6  96  ? -25.088 -4.197  31.189 1.00 50.86  ? 93  THR D OG1   1 
ATOM   8732  C  CG2   . THR F 6  96  ? -25.354 -5.937  32.881 1.00 49.54  ? 93  THR D CG2   1 
ATOM   8733  N  N     . ALA F 6  97  ? -21.608 -6.355  32.770 1.00 48.85  ? 94  ALA D N     1 
ATOM   8734  C  CA    . ALA F 6  97  ? -20.912 -7.472  33.412 1.00 46.26  ? 94  ALA D CA    1 
ATOM   8735  C  C     . ALA F 6  97  ? -20.175 -6.952  34.607 1.00 47.14  ? 94  ALA D C     1 
ATOM   8736  O  O     . ALA F 6  97  ? -20.100 -7.620  35.649 1.00 41.62  ? 94  ALA D O     1 
ATOM   8737  C  CB    . ALA F 6  97  ? -19.931 -8.078  32.443 1.00 47.86  ? 94  ALA D CB    1 
ATOM   8738  N  N     . VAL F 6  98  ? -19.624 -5.752  34.440 1.00 43.61  ? 95  VAL D N     1 
ATOM   8739  C  CA    . VAL F 6  98  ? -18.961 -5.083  35.529 1.00 47.75  ? 95  VAL D CA    1 
ATOM   8740  C  C     . VAL F 6  98  ? -19.892 -4.767  36.692 1.00 48.64  ? 95  VAL D C     1 
ATOM   8741  O  O     . VAL F 6  98  ? -19.508 -4.950  37.870 1.00 49.57  ? 95  VAL D O     1 
ATOM   8742  C  CB    . VAL F 6  98  ? -18.274 -3.789  35.072 1.00 50.47  ? 95  VAL D CB    1 
ATOM   8743  C  CG1   . VAL F 6  98  ? -17.835 -2.976  36.268 1.00 50.57  ? 95  VAL D CG1   1 
ATOM   8744  C  CG2   . VAL F 6  98  ? -17.067 -4.090  34.193 1.00 52.56  ? 95  VAL D CG2   1 
ATOM   8745  N  N     . ARG F 6  99  ? -21.084 -4.270  36.393 1.00 49.86  ? 96  ARG D N     1 
ATOM   8746  C  CA    . ARG F 6  99  ? -22.021 -3.932  37.468 1.00 57.89  ? 96  ARG D CA    1 
ATOM   8747  C  C     . ARG F 6  99  ? -22.442 -5.171  38.221 1.00 52.38  ? 96  ARG D C     1 
ATOM   8748  O  O     . ARG F 6  99  ? -22.661 -5.101  39.448 1.00 54.66  ? 96  ARG D O     1 
ATOM   8749  C  CB    . ARG F 6  99  ? -23.243 -3.156  36.977 1.00 63.71  ? 96  ARG D CB    1 
ATOM   8750  C  CG    . ARG F 6  99  ? -22.880 -1.793  36.395 1.00 71.59  ? 96  ARG D CG    1 
ATOM   8751  C  CD    . ARG F 6  99  ? -23.570 -0.592  37.051 1.00 81.26  ? 96  ARG D CD    1 
ATOM   8752  N  NE    . ARG F 6  99  ? -23.726 0.469   36.057 1.00 96.42  ? 96  ARG D NE    1 
ATOM   8753  C  CZ    . ARG F 6  99  ? -24.749 0.556   35.200 1.00 114.91 ? 96  ARG D CZ    1 
ATOM   8754  N  NH1   . ARG F 6  99  ? -25.756 -0.324  35.236 1.00 129.82 ? 96  ARG D NH1   1 
ATOM   8755  N  NH2   . ARG F 6  99  ? -24.784 1.540   34.309 1.00 112.10 ? 96  ARG D NH2   1 
ATOM   8756  N  N     . LEU F 6  100 ? -22.478 -6.296  37.509 1.00 45.03  ? 97  LEU D N     1 
ATOM   8757  C  CA    . LEU F 6  100 ? -22.874 -7.589  38.097 1.00 47.15  ? 97  LEU D CA    1 
ATOM   8758  C  C     . LEU F 6  100 ? -21.793 -8.220  38.919 1.00 46.11  ? 97  LEU D C     1 
ATOM   8759  O  O     . LEU F 6  100 ? -22.061 -8.803  39.929 1.00 49.37  ? 97  LEU D O     1 
ATOM   8760  C  CB    . LEU F 6  100 ? -23.249 -8.597  37.028 1.00 46.64  ? 97  LEU D CB    1 
ATOM   8761  C  CG    . LEU F 6  100 ? -24.617 -8.347  36.414 1.00 47.66  ? 97  LEU D CG    1 
ATOM   8762  C  CD1   . LEU F 6  100 ? -24.766 -9.218  35.175 1.00 46.99  ? 97  LEU D CD1   1 
ATOM   8763  C  CD2   . LEU F 6  100 ? -25.735 -8.579  37.427 1.00 47.40  ? 97  LEU D CD2   1 
ATOM   8764  N  N     . LEU F 6  101 ? -20.568 -8.089  38.472 1.00 49.02  ? 98  LEU D N     1 
ATOM   8765  C  CA    . LEU F 6  101 ? -19.454 -8.741  39.095 1.00 45.72  ? 98  LEU D CA    1 
ATOM   8766  C  C     . LEU F 6  101 ? -18.847 -7.936  40.237 1.00 44.56  ? 98  LEU D C     1 
ATOM   8767  O  O     . LEU F 6  101 ? -18.569 -8.477  41.290 1.00 46.90  ? 98  LEU D O     1 
ATOM   8768  C  CB    . LEU F 6  101 ? -18.417 -8.951  38.034 1.00 50.18  ? 98  LEU D CB    1 
ATOM   8769  C  CG    . LEU F 6  101 ? -17.340 -9.897  38.503 1.00 62.10  ? 98  LEU D CG    1 
ATOM   8770  C  CD1   . LEU F 6  101 ? -17.843 -11.323 38.341 1.00 65.11  ? 98  LEU D CD1   1 
ATOM   8771  C  CD2   . LEU F 6  101 ? -16.048 -9.644  37.726 1.00 68.06  ? 98  LEU D CD2   1 
ATOM   8772  N  N     . LEU F 6  102 ? -18.615 -6.648  40.059 1.00 44.20  ? 99  LEU D N     1 
ATOM   8773  C  CA    . LEU F 6  102 ? -17.946 -5.915  41.108 1.00 43.68  ? 99  LEU D CA    1 
ATOM   8774  C  C     . LEU F 6  102 ? -18.869 -5.329  42.186 1.00 47.69  ? 99  LEU D C     1 
ATOM   8775  O  O     . LEU F 6  102 ? -20.035 -4.992  41.935 1.00 57.25  ? 99  LEU D O     1 
ATOM   8776  C  CB    . LEU F 6  102 ? -17.166 -4.783  40.504 1.00 46.70  ? 99  LEU D CB    1 
ATOM   8777  C  CG    . LEU F 6  102 ? -16.297 -5.035  39.290 1.00 46.26  ? 99  LEU D CG    1 
ATOM   8778  C  CD1   . LEU F 6  102 ? -15.384 -3.839  39.065 1.00 48.75  ? 99  LEU D CD1   1 
ATOM   8779  C  CD2   . LEU F 6  102 ? -15.459 -6.243  39.521 1.00 50.18  ? 99  LEU D CD2   1 
ATOM   8780  N  N     . PRO F 6  103 ? -18.335 -5.138  43.387 1.00 43.32  ? 100 PRO D N     1 
ATOM   8781  C  CA    . PRO F 6  103 ? -19.133 -4.493  44.408 1.00 46.27  ? 100 PRO D CA    1 
ATOM   8782  C  C     . PRO F 6  103 ? -19.150 -2.989  44.273 1.00 52.76  ? 100 PRO D C     1 
ATOM   8783  O  O     . PRO F 6  103 ? -18.248 -2.415  43.660 1.00 49.84  ? 100 PRO D O     1 
ATOM   8784  C  CB    . PRO F 6  103 ? -18.476 -4.895  45.708 1.00 45.34  ? 100 PRO D CB    1 
ATOM   8785  C  CG    . PRO F 6  103 ? -17.141 -5.441  45.344 1.00 48.24  ? 100 PRO D CG    1 
ATOM   8786  C  CD    . PRO F 6  103 ? -17.002 -5.489  43.856 1.00 45.26  ? 100 PRO D CD    1 
ATOM   8787  N  N     . GLY F 6  104 ? -20.181 -2.394  44.897 1.00 56.55  ? 101 GLY D N     1 
ATOM   8788  C  CA    . GLY F 6  104 ? -20.563 -1.001  44.751 1.00 51.31  ? 101 GLY D CA    1 
ATOM   8789  C  C     . GLY F 6  104 ? -19.515 -0.038  44.256 1.00 55.71  ? 101 GLY D C     1 
ATOM   8790  O  O     . GLY F 6  104 ? -19.520 0.360   43.090 1.00 61.28  ? 101 GLY D O     1 
ATOM   8791  N  N     . GLU F 6  105 ? -18.601 0.340   45.126 1.00 55.05  ? 102 GLU D N     1 
ATOM   8792  C  CA    . GLU F 6  105 ? -17.751 1.480   44.816 1.00 58.07  ? 102 GLU D CA    1 
ATOM   8793  C  C     . GLU F 6  105 ? -16.781 1.212   43.671 1.00 56.86  ? 102 GLU D C     1 
ATOM   8794  O  O     . GLU F 6  105 ? -16.403 2.137   42.957 1.00 60.61  ? 102 GLU D O     1 
ATOM   8795  C  CB    . GLU F 6  105 ? -16.993 1.938   46.074 1.00 58.49  ? 102 GLU D CB    1 
ATOM   8796  C  CG    . GLU F 6  105 ? -16.687 3.426   46.126 1.00 66.15  ? 102 GLU D CG    1 
ATOM   8797  C  CD    . GLU F 6  105 ? -17.937 4.290   45.999 1.00 72.48  ? 102 GLU D CD    1 
ATOM   8798  O  OE1   . GLU F 6  105 ? -19.062 3.790   46.244 1.00 70.94  ? 102 GLU D OE1   1 
ATOM   8799  O  OE2   . GLU F 6  105 ? -17.794 5.467   45.612 1.00 81.28  ? 102 GLU D OE2   1 
ATOM   8800  N  N     . LEU F 6  106 ? -16.354 -0.044  43.527 1.00 56.95  ? 103 LEU D N     1 
ATOM   8801  C  CA    . LEU F 6  106 ? -15.351 -0.418  42.539 1.00 49.31  ? 103 LEU D CA    1 
ATOM   8802  C  C     . LEU F 6  106 ? -15.988 -0.405  41.183 1.00 56.94  ? 103 LEU D C     1 
ATOM   8803  O  O     . LEU F 6  106 ? -15.373 0.005   40.190 1.00 54.65  ? 103 LEU D O     1 
ATOM   8804  C  CB    . LEU F 6  106 ? -14.843 -1.821  42.785 1.00 47.89  ? 103 LEU D CB    1 
ATOM   8805  C  CG    . LEU F 6  106 ? -13.719 -2.012  43.786 1.00 50.61  ? 103 LEU D CG    1 
ATOM   8806  C  CD1   . LEU F 6  106 ? -13.415 -3.495  43.872 1.00 49.42  ? 103 LEU D CD1   1 
ATOM   8807  C  CD2   . LEU F 6  106 ? -12.459 -1.232  43.423 1.00 49.90  ? 103 LEU D CD2   1 
ATOM   8808  N  N     . ALA F 6  107 ? -17.214 -0.909  41.140 1.00 57.98  ? 104 ALA D N     1 
ATOM   8809  C  CA    . ALA F 6  107 ? -18.020 -0.838  39.955 1.00 55.66  ? 104 ALA D CA    1 
ATOM   8810  C  C     . ALA F 6  107 ? -18.206 0.614   39.488 1.00 59.34  ? 104 ALA D C     1 
ATOM   8811  O  O     . ALA F 6  107 ? -18.005 0.934   38.306 1.00 59.47  ? 104 ALA D O     1 
ATOM   8812  C  CB    . ALA F 6  107 ? -19.356 -1.474  40.224 1.00 56.07  ? 104 ALA D CB    1 
ATOM   8813  N  N     . LYS F 6  108 ? -18.579 1.501   40.400 1.00 60.90  ? 105 LYS D N     1 
ATOM   8814  C  CA    . LYS F 6  108 ? -18.847 2.890   40.004 1.00 62.75  ? 105 LYS D CA    1 
ATOM   8815  C  C     . LYS F 6  108 ? -17.584 3.443   39.399 1.00 54.60  ? 105 LYS D C     1 
ATOM   8816  O  O     . LYS F 6  108 ? -17.583 3.955   38.294 1.00 56.24  ? 105 LYS D O     1 
ATOM   8817  C  CB    . LYS F 6  108 ? -19.308 3.738   41.185 1.00 73.06  ? 105 LYS D CB    1 
ATOM   8818  C  CG    . LYS F 6  108 ? -18.935 5.223   41.093 1.00 94.02  ? 105 LYS D CG    1 
ATOM   8819  C  CD    . LYS F 6  108 ? -18.992 5.937   42.448 1.00 106.14 ? 105 LYS D CD    1 
ATOM   8820  C  CE    . LYS F 6  108 ? -20.407 5.944   43.033 1.00 114.52 ? 105 LYS D CE    1 
ATOM   8821  N  NZ    . LYS F 6  108 ? -20.455 6.183   44.507 1.00 115.82 ? 105 LYS D NZ    1 
ATOM   8822  N  N     . HIS F 6  109 ? -16.475 3.293   40.089 1.00 53.95  ? 106 HIS D N     1 
ATOM   8823  C  CA    . HIS F 6  109 ? -15.240 3.832   39.532 1.00 56.63  ? 106 HIS D CA    1 
ATOM   8824  C  C     . HIS F 6  109 ? -14.825 3.144   38.253 1.00 52.07  ? 106 HIS D C     1 
ATOM   8825  O  O     . HIS F 6  109 ? -14.374 3.798   37.327 1.00 62.06  ? 106 HIS D O     1 
ATOM   8826  C  CB    . HIS F 6  109 ? -14.114 3.853   40.558 1.00 57.20  ? 106 HIS D CB    1 
ATOM   8827  C  CG    . HIS F 6  109 ? -14.355 4.797   41.699 1.00 64.56  ? 106 HIS D CG    1 
ATOM   8828  N  ND1   . HIS F 6  109 ? -14.023 4.493   43.002 1.00 78.10  ? 106 HIS D ND1   1 
ATOM   8829  C  CD2   . HIS F 6  109 ? -14.904 6.032   41.731 1.00 67.87  ? 106 HIS D CD2   1 
ATOM   8830  C  CE1   . HIS F 6  109 ? -14.357 5.498   43.791 1.00 76.42  ? 106 HIS D CE1   1 
ATOM   8831  N  NE2   . HIS F 6  109 ? -14.899 6.443   43.042 1.00 79.01  ? 106 HIS D NE2   1 
ATOM   8832  N  N     . ALA F 6  110 ? -14.994 1.836   38.176 1.00 53.32  ? 107 ALA D N     1 
ATOM   8833  C  CA    . ALA F 6  110 ? -14.621 1.101   36.962 1.00 51.23  ? 107 ALA D CA    1 
ATOM   8834  C  C     . ALA F 6  110 ? -15.416 1.553   35.764 1.00 50.37  ? 107 ALA D C     1 
ATOM   8835  O  O     . ALA F 6  110 ? -14.854 1.774   34.701 1.00 47.10  ? 107 ALA D O     1 
ATOM   8836  C  CB    . ALA F 6  110 ? -14.820 -0.377  37.155 1.00 54.92  ? 107 ALA D CB    1 
ATOM   8837  N  N     . VAL F 6  111 ? -16.725 1.704   35.942 1.00 52.90  ? 108 VAL D N     1 
ATOM   8838  C  CA    . VAL F 6  111 ? -17.583 2.269   34.895 1.00 51.36  ? 108 VAL D CA    1 
ATOM   8839  C  C     . VAL F 6  111 ? -17.132 3.657   34.413 1.00 55.24  ? 108 VAL D C     1 
ATOM   8840  O  O     . VAL F 6  111 ? -17.167 3.928   33.227 1.00 59.84  ? 108 VAL D O     1 
ATOM   8841  C  CB    . VAL F 6  111 ? -19.022 2.414   35.383 1.00 52.35  ? 108 VAL D CB    1 
ATOM   8842  C  CG1   . VAL F 6  111 ? -19.846 3.138   34.349 1.00 56.09  ? 108 VAL D CG1   1 
ATOM   8843  C  CG2   . VAL F 6  111 ? -19.646 1.063   35.641 1.00 54.16  ? 108 VAL D CG2   1 
ATOM   8844  N  N     . SER F 6  112 ? -16.744 4.561   35.307 1.00 58.86  ? 109 SER D N     1 
ATOM   8845  C  CA    . SER F 6  112 ? -16.258 5.864   34.835 1.00 63.61  ? 109 SER D CA    1 
ATOM   8846  C  C     . SER F 6  112 ? -15.176 5.608   33.829 1.00 64.29  ? 109 SER D C     1 
ATOM   8847  O  O     . SER F 6  112 ? -15.248 6.052   32.689 1.00 68.34  ? 109 SER D O     1 
ATOM   8848  C  CB    . SER F 6  112 ? -15.653 6.717   35.946 1.00 60.57  ? 109 SER D CB    1 
ATOM   8849  O  OG    . SER F 6  112 ? -16.661 7.095   36.837 1.00 75.45  ? 109 SER D OG    1 
ATOM   8850  N  N     . GLU F 6  113 ? -14.188 4.848   34.263 1.00 59.69  ? 110 GLU D N     1 
ATOM   8851  C  CA    . GLU F 6  113 ? -12.961 4.728   33.521 1.00 62.27  ? 110 GLU D CA    1 
ATOM   8852  C  C     . GLU F 6  113 ? -13.211 4.036   32.168 1.00 58.99  ? 110 GLU D C     1 
ATOM   8853  O  O     . GLU F 6  113 ? -12.585 4.346   31.152 1.00 55.28  ? 110 GLU D O     1 
ATOM   8854  C  CB    . GLU F 6  113 ? -11.952 3.980   34.378 1.00 62.33  ? 110 GLU D CB    1 
ATOM   8855  C  CG    . GLU F 6  113 ? -11.644 4.654   35.707 1.00 63.09  ? 110 GLU D CG    1 
ATOM   8856  C  CD    . GLU F 6  113 ? -10.302 5.332   35.670 1.00 72.03  ? 110 GLU D CD    1 
ATOM   8857  O  OE1   . GLU F 6  113 ? -10.210 6.393   35.029 1.00 79.22  ? 110 GLU D OE1   1 
ATOM   8858  O  OE2   . GLU F 6  113 ? -9.334  4.793   36.258 1.00 77.98  ? 110 GLU D OE2   1 
ATOM   8859  N  N     . GLY F 6  114 ? -14.171 3.132   32.151 1.00 52.70  ? 111 GLY D N     1 
ATOM   8860  C  CA    . GLY F 6  114 ? -14.547 2.483   30.925 1.00 54.24  ? 111 GLY D CA    1 
ATOM   8861  C  C     . GLY F 6  114 ? -15.324 3.401   30.010 1.00 57.04  ? 111 GLY D C     1 
ATOM   8862  O  O     . GLY F 6  114 ? -15.096 3.422   28.815 1.00 54.71  ? 111 GLY D O     1 
ATOM   8863  N  N     . THR F 6  115 ? -16.259 4.157   30.563 1.00 58.62  ? 112 THR D N     1 
ATOM   8864  C  CA    . THR F 6  115 ? -17.034 5.090   29.760 1.00 58.70  ? 112 THR D CA    1 
ATOM   8865  C  C     . THR F 6  115 ? -16.126 6.116   29.116 1.00 57.74  ? 112 THR D C     1 
ATOM   8866  O  O     . THR F 6  115 ? -16.236 6.447   27.946 1.00 61.43  ? 112 THR D O     1 
ATOM   8867  C  CB    . THR F 6  115 ? -18.029 5.842   30.635 1.00 61.64  ? 112 THR D CB    1 
ATOM   8868  O  OG1   . THR F 6  115 ? -18.822 4.898   31.361 1.00 69.95  ? 112 THR D OG1   1 
ATOM   8869  C  CG2   . THR F 6  115 ? -18.935 6.715   29.777 1.00 61.49  ? 112 THR D CG2   1 
ATOM   8870  N  N     . LYS F 6  116 ? -15.194 6.598   29.903 1.00 60.53  ? 113 LYS D N     1 
ATOM   8871  C  CA    . LYS F 6  116 ? -14.353 7.678   29.471 1.00 62.34  ? 113 LYS D CA    1 
ATOM   8872  C  C     . LYS F 6  116 ? -13.262 7.216   28.543 1.00 58.01  ? 113 LYS D C     1 
ATOM   8873  O  O     . LYS F 6  116 ? -12.874 7.952   27.668 1.00 64.92  ? 113 LYS D O     1 
ATOM   8874  C  CB    . LYS F 6  116 ? -13.836 8.465   30.687 1.00 65.56  ? 113 LYS D CB    1 
ATOM   8875  C  CG    . LYS F 6  116 ? -12.342 8.564   30.869 1.00 65.24  ? 113 LYS D CG    1 
ATOM   8876  C  CD    . LYS F 6  116 ? -12.100 9.340   32.139 1.00 68.69  ? 113 LYS D CD    1 
ATOM   8877  C  CE    . LYS F 6  116 ? -10.624 9.487   32.430 1.00 76.00  ? 113 LYS D CE    1 
ATOM   8878  N  NZ    . LYS F 6  116 ? -10.215 8.543   33.496 1.00 84.58  ? 113 LYS D NZ    1 
ATOM   8879  N  N     . ALA F 6  117 ? -12.760 6.006   28.699 1.00 63.37  ? 114 ALA D N     1 
ATOM   8880  C  CA    . ALA F 6  117 ? -11.805 5.503   27.714 1.00 60.62  ? 114 ALA D CA    1 
ATOM   8881  C  C     . ALA F 6  117 ? -12.489 5.337   26.350 1.00 68.11  ? 114 ALA D C     1 
ATOM   8882  O  O     . ALA F 6  117 ? -11.866 5.498   25.282 1.00 61.05  ? 114 ALA D O     1 
ATOM   8883  C  CB    . ALA F 6  117 ? -11.245 4.183   28.156 1.00 59.96  ? 114 ALA D CB    1 
ATOM   8884  N  N     . VAL F 6  118 ? -13.773 5.016   26.380 1.00 64.72  ? 115 VAL D N     1 
ATOM   8885  C  CA    . VAL F 6  118 ? -14.473 4.761   25.137 1.00 71.07  ? 115 VAL D CA    1 
ATOM   8886  C  C     . VAL F 6  118 ? -14.804 6.080   24.455 1.00 68.47  ? 115 VAL D C     1 
ATOM   8887  O  O     . VAL F 6  118 ? -14.291 6.355   23.367 1.00 67.90  ? 115 VAL D O     1 
ATOM   8888  C  CB    . VAL F 6  118 ? -15.698 3.867   25.371 1.00 70.95  ? 115 VAL D CB    1 
ATOM   8889  C  CG1   . VAL F 6  118 ? -16.590 3.816   24.141 1.00 69.54  ? 115 VAL D CG1   1 
ATOM   8890  C  CG2   . VAL F 6  118 ? -15.208 2.472   25.735 1.00 68.49  ? 115 VAL D CG2   1 
ATOM   8891  N  N     . THR F 6  119 ? -15.629 6.901   25.091 1.00 64.70  ? 116 THR D N     1 
ATOM   8892  C  CA    . THR F 6  119 ? -15.727 8.307   24.697 1.00 63.57  ? 116 THR D CA    1 
ATOM   8893  C  C     . THR F 6  119 ? -14.456 8.795   23.992 1.00 62.50  ? 116 THR D C     1 
ATOM   8894  O  O     . THR F 6  119 ? -14.500 9.225   22.852 1.00 66.16  ? 116 THR D O     1 
ATOM   8895  C  CB    . THR F 6  119 ? -15.871 9.195   25.922 1.00 65.53  ? 116 THR D CB    1 
ATOM   8896  O  OG1   . THR F 6  119 ? -17.146 8.988   26.545 1.00 70.90  ? 116 THR D OG1   1 
ATOM   8897  C  CG2   . THR F 6  119 ? -15.713 10.621  25.512 1.00 75.03  ? 116 THR D CG2   1 
ATOM   8898  N  N     . LYS F 6  120 ? -13.318 8.680   24.673 1.00 60.43  ? 117 LYS D N     1 
ATOM   8899  C  CA    . LYS F 6  120 ? -12.054 9.222   24.179 1.00 61.24  ? 117 LYS D CA    1 
ATOM   8900  C  C     . LYS F 6  120 ? -11.544 8.538   22.916 1.00 65.00  ? 117 LYS D C     1 
ATOM   8901  O  O     . LYS F 6  120 ? -11.029 9.182   22.001 1.00 70.75  ? 117 LYS D O     1 
ATOM   8902  C  CB    . LYS F 6  120 ? -10.987 9.179   25.273 1.00 58.67  ? 117 LYS D CB    1 
ATOM   8903  C  CG    . LYS F 6  120 ? -9.587  9.390   24.745 1.00 62.02  ? 117 LYS D CG    1 
ATOM   8904  C  CD    . LYS F 6  120 ? -8.630  9.895   25.825 1.00 69.27  ? 117 LYS D CD    1 
ATOM   8905  C  CE    . LYS F 6  120 ? -7.184  9.965   25.301 1.00 72.73  ? 117 LYS D CE    1 
ATOM   8906  N  NZ    . LYS F 6  120 ? -6.512  11.280  25.554 1.00 68.90  ? 117 LYS D NZ    1 
ATOM   8907  N  N     . TYR F 6  121 ? -11.680 7.224   22.883 1.00 72.52  ? 118 TYR D N     1 
ATOM   8908  C  CA    . TYR F 6  121 ? -11.305 6.416   21.726 1.00 64.71  ? 118 TYR D CA    1 
ATOM   8909  C  C     . TYR F 6  121 ? -12.186 6.725   20.520 1.00 64.09  ? 118 TYR D C     1 
ATOM   8910  O  O     . TYR F 6  121 ? -11.691 6.881   19.418 1.00 57.36  ? 118 TYR D O     1 
ATOM   8911  C  CB    . TYR F 6  121 ? -11.486 4.958   22.102 1.00 65.21  ? 118 TYR D CB    1 
ATOM   8912  C  CG    . TYR F 6  121 ? -11.235 3.978   20.999 1.00 62.67  ? 118 TYR D CG    1 
ATOM   8913  C  CD1   . TYR F 6  121 ? -9.940  3.527   20.736 1.00 67.48  ? 118 TYR D CD1   1 
ATOM   8914  C  CD2   . TYR F 6  121 ? -12.286 3.461   20.241 1.00 62.99  ? 118 TYR D CD2   1 
ATOM   8915  C  CE1   . TYR F 6  121 ? -9.687  2.613   19.729 1.00 66.68  ? 118 TYR D CE1   1 
ATOM   8916  C  CE2   . TYR F 6  121 ? -12.044 2.546   19.229 1.00 65.29  ? 118 TYR D CE2   1 
ATOM   8917  C  CZ    . TYR F 6  121 ? -10.743 2.127   18.985 1.00 67.04  ? 118 TYR D CZ    1 
ATOM   8918  O  OH    . TYR F 6  121 ? -10.477 1.203   18.008 1.00 82.09  ? 118 TYR D OH    1 
ATOM   8919  N  N     . THR F 6  122 ? -13.496 6.793   20.746 1.00 69.17  ? 119 THR D N     1 
ATOM   8920  C  CA    . THR F 6  122 ? -14.450 7.272   19.752 1.00 75.52  ? 119 THR D CA    1 
ATOM   8921  C  C     . THR F 6  122 ? -14.162 8.680   19.253 1.00 80.32  ? 119 THR D C     1 
ATOM   8922  O  O     . THR F 6  122 ? -14.476 9.005   18.110 1.00 87.94  ? 119 THR D O     1 
ATOM   8923  C  CB    . THR F 6  122 ? -15.846 7.367   20.351 1.00 78.59  ? 119 THR D CB    1 
ATOM   8924  O  OG1   . THR F 6  122 ? -16.120 6.166   21.074 1.00 88.67  ? 119 THR D OG1   1 
ATOM   8925  C  CG2   . THR F 6  122 ? -16.876 7.578   19.258 1.00 80.64  ? 119 THR D CG2   1 
ATOM   8926  N  N     . SER F 6  123 ? -13.608 9.528   20.118 1.00 82.56  ? 120 SER D N     1 
ATOM   8927  C  CA    . SER F 6  123 ? -13.229 10.879  19.705 1.00 83.94  ? 120 SER D CA    1 
ATOM   8928  C  C     . SER F 6  123 ? -12.026 10.902  18.761 1.00 84.68  ? 120 SER D C     1 
ATOM   8929  O  O     . SER F 6  123 ? -11.702 11.962  18.258 1.00 85.29  ? 120 SER D O     1 
ATOM   8930  C  CB    . SER F 6  123 ? -12.919 11.783  20.895 1.00 80.96  ? 120 SER D CB    1 
ATOM   8931  O  OG    . SER F 6  123 ? -11.517 11.789  21.161 1.00 75.74  ? 120 SER D OG    1 
ATOM   8932  N  N     . ALA F 6  124 ? -11.365 9.780   18.497 1.00 87.74  ? 121 ALA D N     1 
ATOM   8933  C  CA    . ALA F 6  124 ? -10.383 9.756   17.397 1.00 104.68 ? 121 ALA D CA    1 
ATOM   8934  C  C     . ALA F 6  124 ? -11.046 9.567   16.024 1.00 120.89 ? 121 ALA D C     1 
ATOM   8935  O  O     . ALA F 6  124 ? -10.588 8.750   15.221 1.00 135.94 ? 121 ALA D O     1 
ATOM   8936  C  CB    . ALA F 6  124 ? -9.343  8.672   17.624 1.00 101.75 ? 121 ALA D CB    1 
ATOM   8937  N  N     . LYS F 6  125 ? -12.101 10.331  15.737 1.00 125.33 ? 122 LYS D N     1 
ATOM   8938  C  CA    . LYS F 6  125 ? -12.874 10.119  14.515 1.00 125.84 ? 122 LYS D CA    1 
ATOM   8939  C  C     . LYS F 6  125 ? -13.629 11.362  14.062 1.00 127.11 ? 122 LYS D C     1 
ATOM   8940  O  O     . LYS F 6  125 ? -13.125 12.103  13.209 1.00 131.45 ? 122 LYS D O     1 
ATOM   8941  C  CB    . LYS F 6  125 ? -13.851 8.960   14.701 1.00 117.98 ? 122 LYS D CB    1 
ATOM   8942  C  CG    . LYS F 6  125 ? -14.643 8.701   13.450 1.00 110.80 ? 122 LYS D CG    1 
ATOM   8943  C  CD    . LYS F 6  125 ? -15.173 7.305   13.400 1.00 108.20 ? 122 LYS D CD    1 
ATOM   8944  C  CE    . LYS F 6  125 ? -16.021 7.214   12.159 1.00 117.59 ? 122 LYS D CE    1 
ATOM   8945  N  NZ    . LYS F 6  125 ? -16.579 5.856   12.029 1.00 127.98 ? 122 LYS D NZ    1 
ATOM   8946  O  OXT   . LYS F 6  125 ? -14.741 11.646  14.524 1.00 110.85 ? 122 LYS D OXT   1 
ATOM   8947  N  N     . PRO G 3  38  ? 14.791  -21.979 87.207 1.00 124.08 ? 38  PRO E N     1 
ATOM   8948  C  CA    . PRO G 3  38  ? 14.233  -22.481 85.944 1.00 120.52 ? 38  PRO E CA    1 
ATOM   8949  C  C     . PRO G 3  38  ? 12.845  -21.885 85.644 1.00 125.44 ? 38  PRO E C     1 
ATOM   8950  O  O     . PRO G 3  38  ? 11.847  -22.370 86.175 1.00 120.00 ? 38  PRO E O     1 
ATOM   8951  C  CB    . PRO G 3  38  ? 14.142  -23.994 86.197 1.00 114.63 ? 38  PRO E CB    1 
ATOM   8952  C  CG    . PRO G 3  38  ? 13.981  -24.124 87.697 1.00 112.13 ? 38  PRO E CG    1 
ATOM   8953  C  CD    . PRO G 3  38  ? 14.434  -22.840 88.352 1.00 111.16 ? 38  PRO E CD    1 
ATOM   8954  N  N     . HIS G 3  39  ? 12.782  -20.846 84.806 1.00 136.70 ? 39  HIS E N     1 
ATOM   8955  C  CA    . HIS G 3  39  ? 11.517  -20.105 84.566 1.00 138.83 ? 39  HIS E CA    1 
ATOM   8956  C  C     . HIS G 3  39  ? 10.487  -20.939 83.811 1.00 130.40 ? 39  HIS E C     1 
ATOM   8957  O  O     . HIS G 3  39  ? 10.858  -21.875 83.101 1.00 121.11 ? 39  HIS E O     1 
ATOM   8958  C  CB    . HIS G 3  39  ? 11.771  -18.800 83.792 1.00 146.84 ? 39  HIS E CB    1 
ATOM   8959  C  CG    . HIS G 3  39  ? 10.700  -17.764 83.977 1.00 156.76 ? 39  HIS E CG    1 
ATOM   8960  N  ND1   . HIS G 3  39  ? 10.116  -17.095 82.921 1.00 153.70 ? 39  HIS E ND1   1 
ATOM   8961  C  CD2   . HIS G 3  39  ? 10.112  -17.281 85.099 1.00 161.75 ? 39  HIS E CD2   1 
ATOM   8962  C  CE1   . HIS G 3  39  ? 9.219   -16.242 83.387 1.00 159.57 ? 39  HIS E CE1   1 
ATOM   8963  N  NE2   . HIS G 3  39  ? 9.196   -16.336 84.705 1.00 160.57 ? 39  HIS E NE2   1 
ATOM   8964  N  N     . ARG G 3  40  ? 9.202   -20.597 83.978 1.00 123.10 ? 40  ARG E N     1 
ATOM   8965  C  CA    . ARG G 3  40  ? 8.090   -21.301 83.301 1.00 110.00 ? 40  ARG E CA    1 
ATOM   8966  C  C     . ARG G 3  40  ? 6.956   -20.409 82.872 1.00 95.36  ? 40  ARG E C     1 
ATOM   8967  O  O     . ARG G 3  40  ? 6.243   -19.858 83.724 1.00 92.76  ? 40  ARG E O     1 
ATOM   8968  C  CB    . ARG G 3  40  ? 7.457   -22.355 84.207 1.00 110.12 ? 40  ARG E CB    1 
ATOM   8969  C  CG    . ARG G 3  40  ? 8.009   -23.745 84.003 1.00 103.37 ? 40  ARG E CG    1 
ATOM   8970  C  CD    . ARG G 3  40  ? 6.918   -24.781 83.853 1.00 93.19  ? 40  ARG E CD    1 
ATOM   8971  N  NE    . ARG G 3  40  ? 7.541   -25.978 83.325 1.00 88.07  ? 40  ARG E NE    1 
ATOM   8972  C  CZ    . ARG G 3  40  ? 6.917   -26.924 82.644 1.00 85.97  ? 40  ARG E CZ    1 
ATOM   8973  N  NH1   . ARG G 3  40  ? 5.621   -26.841 82.400 1.00 87.61  ? 40  ARG E NH1   1 
ATOM   8974  N  NH2   . ARG G 3  40  ? 7.607   -27.964 82.206 1.00 94.22  ? 40  ARG E NH2   1 
ATOM   8975  N  N     . TYR G 3  41  ? 6.746   -20.318 81.561 1.00 81.41  ? 41  TYR E N     1 
ATOM   8976  C  CA    . TYR G 3  41  ? 5.578   -19.620 81.065 1.00 77.58  ? 41  TYR E CA    1 
ATOM   8977  C  C     . TYR G 3  41  ? 4.346   -20.456 81.390 1.00 72.71  ? 41  TYR E C     1 
ATOM   8978  O  O     . TYR G 3  41  ? 4.386   -21.693 81.348 1.00 74.35  ? 41  TYR E O     1 
ATOM   8979  C  CB    . TYR G 3  41  ? 5.713   -19.313 79.580 1.00 77.24  ? 41  TYR E CB    1 
ATOM   8980  C  CG    . TYR G 3  41  ? 6.782   -18.285 79.334 1.00 72.95  ? 41  TYR E CG    1 
ATOM   8981  C  CD1   . TYR G 3  41  ? 7.976   -18.622 78.686 1.00 73.20  ? 41  TYR E CD1   1 
ATOM   8982  C  CD2   . TYR G 3  41  ? 6.627   -16.987 79.803 1.00 71.19  ? 41  TYR E CD2   1 
ATOM   8983  C  CE1   . TYR G 3  41  ? 8.977   -17.682 78.494 1.00 69.89  ? 41  TYR E CE1   1 
ATOM   8984  C  CE2   . TYR G 3  41  ? 7.617   -16.038 79.614 1.00 74.46  ? 41  TYR E CE2   1 
ATOM   8985  C  CZ    . TYR G 3  41  ? 8.786   -16.390 78.957 1.00 75.94  ? 41  TYR E CZ    1 
ATOM   8986  O  OH    . TYR G 3  41  ? 9.763   -15.436 78.766 1.00 85.18  ? 41  TYR E OH    1 
ATOM   8987  N  N     . ARG G 3  42  ? 3.276   -19.768 81.774 1.00 68.50  ? 42  ARG E N     1 
ATOM   8988  C  CA    . ARG G 3  42  ? 2.021   -20.417 82.145 1.00 69.82  ? 42  ARG E CA    1 
ATOM   8989  C  C     . ARG G 3  42  ? 1.322   -20.920 80.861 1.00 68.71  ? 42  ARG E C     1 
ATOM   8990  O  O     . ARG G 3  42  ? 1.640   -20.495 79.745 1.00 72.86  ? 42  ARG E O     1 
ATOM   8991  C  CB    . ARG G 3  42  ? 1.144   -19.434 82.929 1.00 69.46  ? 42  ARG E CB    1 
ATOM   8992  C  CG    . ARG G 3  42  ? 1.799   -18.944 84.228 1.00 80.43  ? 42  ARG E CG    1 
ATOM   8993  C  CD    . ARG G 3  42  ? 1.156   -17.699 84.825 1.00 87.09  ? 42  ARG E CD    1 
ATOM   8994  N  NE    . ARG G 3  42  ? -0.291  -17.868 84.928 1.00 95.60  ? 42  ARG E NE    1 
ATOM   8995  C  CZ    . ARG G 3  42  ? -1.172  -16.882 85.055 1.00 96.09  ? 42  ARG E CZ    1 
ATOM   8996  N  NH1   . ARG G 3  42  ? -0.767  -15.615 85.128 1.00 104.52 ? 42  ARG E NH1   1 
ATOM   8997  N  NH2   . ARG G 3  42  ? -2.469  -17.171 85.121 1.00 91.61  ? 42  ARG E NH2   1 
ATOM   8998  N  N     . PRO G 3  43  ? 0.435   -21.888 80.995 1.00 62.04  ? 43  PRO E N     1 
ATOM   8999  C  CA    . PRO G 3  43  ? -0.293  -22.322 79.831 1.00 63.49  ? 43  PRO E CA    1 
ATOM   9000  C  C     . PRO G 3  43  ? -1.028  -21.218 79.062 1.00 59.05  ? 43  PRO E C     1 
ATOM   9001  O  O     . PRO G 3  43  ? -1.851  -20.476 79.611 1.00 62.09  ? 43  PRO E O     1 
ATOM   9002  C  CB    . PRO G 3  43  ? -1.257  -23.336 80.426 1.00 67.34  ? 43  PRO E CB    1 
ATOM   9003  C  CG    . PRO G 3  43  ? -0.452  -24.000 81.498 1.00 66.41  ? 43  PRO E CG    1 
ATOM   9004  C  CD    . PRO G 3  43  ? 0.568   -22.986 81.963 1.00 71.16  ? 43  PRO E CD    1 
ATOM   9005  N  N     . GLY G 3  44  ? -0.694  -21.103 77.790 1.00 59.11  ? 44  GLY E N     1 
ATOM   9006  C  CA    . GLY G 3  44  ? -1.365  -20.162 76.913 1.00 65.26  ? 44  GLY E CA    1 
ATOM   9007  C  C     . GLY G 3  44  ? -0.422  -19.101 76.417 1.00 69.35  ? 44  GLY E C     1 
ATOM   9008  O  O     . GLY G 3  44  ? -0.634  -18.491 75.380 1.00 87.29  ? 44  GLY E O     1 
ATOM   9009  N  N     . THR G 3  45  ? 0.634   -18.883 77.163 1.00 63.44  ? 45  THR E N     1 
ATOM   9010  C  CA    . THR G 3  45  ? 1.457   -17.734 76.949 1.00 58.80  ? 45  THR E CA    1 
ATOM   9011  C  C     . THR G 3  45  ? 2.358   -18.008 75.778 1.00 54.43  ? 45  THR E C     1 
ATOM   9012  O  O     . THR G 3  45  ? 2.580   -17.139 74.934 1.00 55.60  ? 45  THR E O     1 
ATOM   9013  C  CB    . THR G 3  45  ? 2.234   -17.420 78.249 1.00 61.92  ? 45  THR E CB    1 
ATOM   9014  O  OG1   . THR G 3  45  ? 1.285   -17.093 79.284 1.00 60.80  ? 45  THR E OG1   1 
ATOM   9015  C  CG2   . THR G 3  45  ? 3.174   -16.262 78.060 1.00 59.64  ? 45  THR E CG2   1 
ATOM   9016  N  N     . VAL G 3  46  ? 2.873   -19.225 75.694 1.00 55.42  ? 46  VAL E N     1 
ATOM   9017  C  CA    . VAL G 3  46  ? 3.655   -19.549 74.519 1.00 55.05  ? 46  VAL E CA    1 
ATOM   9018  C  C     . VAL G 3  46  ? 2.721   -19.643 73.311 1.00 52.72  ? 46  VAL E C     1 
ATOM   9019  O  O     . VAL G 3  46  ? 3.070   -19.163 72.241 1.00 54.61  ? 46  VAL E O     1 
ATOM   9020  C  CB    . VAL G 3  46  ? 4.523   -20.816 74.654 1.00 55.09  ? 46  VAL E CB    1 
ATOM   9021  C  CG1   . VAL G 3  46  ? 5.468   -20.922 73.435 1.00 52.99  ? 46  VAL E CG1   1 
ATOM   9022  C  CG2   . VAL G 3  46  ? 5.335   -20.784 75.937 1.00 51.07  ? 46  VAL E CG2   1 
ATOM   9023  N  N     . ALA G 3  47  ? 1.544   -20.242 73.488 1.00 51.71  ? 47  ALA E N     1 
ATOM   9024  C  CA    . ALA G 3  47  ? 0.560   -20.336 72.409 1.00 50.08  ? 47  ALA E CA    1 
ATOM   9025  C  C     . ALA G 3  47  ? 0.255   -18.973 71.780 1.00 49.96  ? 47  ALA E C     1 
ATOM   9026  O  O     . ALA G 3  47  ? 0.270   -18.816 70.559 1.00 55.73  ? 47  ALA E O     1 
ATOM   9027  C  CB    . ALA G 3  47  ? -0.714  -20.985 72.905 1.00 49.39  ? 47  ALA E CB    1 
ATOM   9028  N  N     . LEU G 3  48  ? -0.001  -17.972 72.598 1.00 51.78  ? 48  LEU E N     1 
ATOM   9029  C  CA    . LEU G 3  48  ? -0.254  -16.627 72.063 1.00 48.16  ? 48  LEU E CA    1 
ATOM   9030  C  C     . LEU G 3  48  ? 0.990   -16.105 71.366 1.00 49.24  ? 48  LEU E C     1 
ATOM   9031  O  O     . LEU G 3  48  ? 0.909   -15.459 70.316 1.00 52.28  ? 48  LEU E O     1 
ATOM   9032  C  CB    . LEU G 3  48  ? -0.665  -15.694 73.181 1.00 47.28  ? 48  LEU E CB    1 
ATOM   9033  C  CG    . LEU G 3  48  ? -2.043  -16.028 73.745 1.00 52.59  ? 48  LEU E CG    1 
ATOM   9034  C  CD1   . LEU G 3  48  ? -2.295  -15.407 75.103 1.00 53.85  ? 48  LEU E CD1   1 
ATOM   9035  C  CD2   . LEU G 3  48  ? -3.126  -15.583 72.779 1.00 56.43  ? 48  LEU E CD2   1 
ATOM   9036  N  N     . ARG G 3  49  ? 2.156   -16.408 71.916 1.00 45.46  ? 49  ARG E N     1 
ATOM   9037  C  CA    . ARG G 3  49  ? 3.373   -15.989 71.253 1.00 51.04  ? 49  ARG E CA    1 
ATOM   9038  C  C     . ARG G 3  49  ? 3.450   -16.564 69.808 1.00 54.95  ? 49  ARG E C     1 
ATOM   9039  O  O     . ARG G 3  49  ? 3.794   -15.850 68.834 1.00 48.70  ? 49  ARG E O     1 
ATOM   9040  C  CB    . ARG G 3  49  ? 4.592   -16.391 72.094 1.00 60.77  ? 49  ARG E CB    1 
ATOM   9041  C  CG    . ARG G 3  49  ? 5.688   -15.334 72.137 1.00 67.83  ? 49  ARG E CG    1 
ATOM   9042  C  CD    . ARG G 3  49  ? 7.096   -15.893 72.359 1.00 75.59  ? 49  ARG E CD    1 
ATOM   9043  N  NE    . ARG G 3  49  ? 7.422   -16.610 73.603 1.00 76.42  ? 49  ARG E NE    1 
ATOM   9044  C  CZ    . ARG G 3  49  ? 6.992   -16.342 74.838 1.00 83.32  ? 49  ARG E CZ    1 
ATOM   9045  N  NH1   . ARG G 3  49  ? 6.145   -15.349 75.126 1.00 87.76  ? 49  ARG E NH1   1 
ATOM   9046  N  NH2   . ARG G 3  49  ? 7.430   -17.106 75.824 1.00 84.14  ? 49  ARG E NH2   1 
ATOM   9047  N  N     . GLU G 3  50  ? 3.105   -17.850 69.676 1.00 56.50  ? 50  GLU E N     1 
ATOM   9048  C  CA    . GLU G 3  50  ? 3.187   -18.558 68.401 1.00 54.22  ? 50  GLU E CA    1 
ATOM   9049  C  C     . GLU G 3  50  ? 2.143   -18.020 67.407 1.00 52.05  ? 50  GLU E C     1 
ATOM   9050  O  O     . GLU G 3  50  ? 2.406   -17.865 66.185 1.00 48.39  ? 50  GLU E O     1 
ATOM   9051  C  CB    . GLU G 3  50  ? 2.957   -20.044 68.638 1.00 58.20  ? 50  GLU E CB    1 
ATOM   9052  C  CG    . GLU G 3  50  ? 4.062   -20.764 69.405 1.00 58.42  ? 50  GLU E CG    1 
ATOM   9053  C  CD    . GLU G 3  50  ? 3.730   -22.235 69.725 1.00 63.35  ? 50  GLU E CD    1 
ATOM   9054  O  OE1   . GLU G 3  50  ? 4.079   -22.686 70.842 1.00 64.81  ? 50  GLU E OE1   1 
ATOM   9055  O  OE2   . GLU G 3  50  ? 3.110   -22.953 68.886 1.00 59.08  ? 50  GLU E OE2   1 
ATOM   9056  N  N     . ILE G 3  51  ? 0.969   -17.702 67.933 1.00 41.03  ? 51  ILE E N     1 
ATOM   9057  C  CA    . ILE G 3  51  ? -0.070  -17.108 67.113 1.00 41.39  ? 51  ILE E CA    1 
ATOM   9058  C  C     . ILE G 3  51  ? 0.434   -15.821 66.534 1.00 42.85  ? 51  ILE E C     1 
ATOM   9059  O  O     . ILE G 3  51  ? 0.323   -15.600 65.335 1.00 46.74  ? 51  ILE E O     1 
ATOM   9060  C  CB    . ILE G 3  51  ? -1.343  -16.799 67.920 1.00 44.21  ? 51  ILE E CB    1 
ATOM   9061  C  CG1   . ILE G 3  51  ? -1.985  -18.104 68.407 1.00 42.25  ? 51  ILE E CG1   1 
ATOM   9062  C  CG2   . ILE G 3  51  ? -2.309  -15.957 67.114 1.00 44.88  ? 51  ILE E CG2   1 
ATOM   9063  C  CD1   . ILE G 3  51  ? -3.300  -17.928 69.105 1.00 44.04  ? 51  ILE E CD1   1 
ATOM   9064  N  N     . ARG G 3  52  ? 0.986   -14.951 67.366 1.00 48.48  ? 52  ARG E N     1 
ATOM   9065  C  CA    . ARG G 3  52  ? 1.495   -13.662 66.833 1.00 50.08  ? 52  ARG E CA    1 
ATOM   9066  C  C     . ARG G 3  52  ? 2.560   -13.928 65.810 1.00 45.85  ? 52  ARG E C     1 
ATOM   9067  O  O     . ARG G 3  52  ? 2.611   -13.273 64.773 1.00 43.39  ? 52  ARG E O     1 
ATOM   9068  C  CB    . ARG G 3  52  ? 2.078   -12.762 67.922 1.00 54.79  ? 52  ARG E CB    1 
ATOM   9069  C  CG    . ARG G 3  52  ? 1.068   -12.130 68.870 1.00 58.20  ? 52  ARG E CG    1 
ATOM   9070  C  CD    . ARG G 3  52  ? 1.748   -11.526 70.105 1.00 68.76  ? 52  ARG E CD    1 
ATOM   9071  N  NE    . ARG G 3  52  ? 1.029   -11.900 71.341 1.00 70.94  ? 52  ARG E NE    1 
ATOM   9072  C  CZ    . ARG G 3  52  ? -0.184  -11.432 71.659 1.00 70.09  ? 52  ARG E CZ    1 
ATOM   9073  N  NH1   . ARG G 3  52  ? -0.835  -10.572 70.862 1.00 69.39  ? 52  ARG E NH1   1 
ATOM   9074  N  NH2   . ARG G 3  52  ? -0.763  -11.822 72.776 1.00 69.06  ? 52  ARG E NH2   1 
ATOM   9075  N  N     . ARG G 3  53  ? 3.433   -14.886 66.092 1.00 46.42  ? 53  ARG E N     1 
ATOM   9076  C  CA    . ARG G 3  53  ? 4.525   -15.135 65.170 1.00 48.03  ? 53  ARG E CA    1 
ATOM   9077  C  C     . ARG G 3  53  ? 4.004   -15.620 63.843 1.00 50.76  ? 53  ARG E C     1 
ATOM   9078  O  O     . ARG G 3  53  ? 4.313   -15.032 62.817 1.00 56.09  ? 53  ARG E O     1 
ATOM   9079  C  CB    . ARG G 3  53  ? 5.488   -16.164 65.724 1.00 49.59  ? 53  ARG E CB    1 
ATOM   9080  C  CG    . ARG G 3  53  ? 6.438   -16.682 64.682 1.00 50.09  ? 53  ARG E CG    1 
ATOM   9081  C  CD    . ARG G 3  53  ? 7.306   -17.794 65.247 1.00 59.37  ? 53  ARG E CD    1 
ATOM   9082  N  NE    . ARG G 3  53  ? 8.020   -18.511 64.174 1.00 71.34  ? 53  ARG E NE    1 
ATOM   9083  C  CZ    . ARG G 3  53  ? 8.847   -19.546 64.364 1.00 75.69  ? 53  ARG E CZ    1 
ATOM   9084  N  NH1   . ARG G 3  53  ? 9.092   -19.996 65.595 1.00 71.86  ? 53  ARG E NH1   1 
ATOM   9085  N  NH2   . ARG G 3  53  ? 9.426   -20.146 63.317 1.00 79.21  ? 53  ARG E NH2   1 
ATOM   9086  N  N     . TYR G 3  54  ? 3.203   -16.694 63.857 1.00 53.83  ? 54  TYR E N     1 
ATOM   9087  C  CA    . TYR G 3  54  ? 2.810   -17.346 62.591 1.00 49.70  ? 54  TYR E CA    1 
ATOM   9088  C  C     . TYR G 3  54  ? 1.872   -16.485 61.786 1.00 44.07  ? 54  TYR E C     1 
ATOM   9089  O  O     . TYR G 3  54  ? 1.875   -16.563 60.567 1.00 47.66  ? 54  TYR E O     1 
ATOM   9090  C  CB    . TYR G 3  54  ? 2.276   -18.775 62.804 1.00 47.14  ? 54  TYR E CB    1 
ATOM   9091  C  CG    . TYR G 3  54  ? 3.398   -19.675 63.221 1.00 45.85  ? 54  TYR E CG    1 
ATOM   9092  C  CD1   . TYR G 3  54  ? 3.420   -20.292 64.461 1.00 45.20  ? 54  TYR E CD1   1 
ATOM   9093  C  CD2   . TYR G 3  54  ? 4.496   -19.859 62.388 1.00 48.51  ? 54  TYR E CD2   1 
ATOM   9094  C  CE1   . TYR G 3  54  ? 4.508   -21.080 64.852 1.00 43.14  ? 54  TYR E CE1   1 
ATOM   9095  C  CE2   . TYR G 3  54  ? 5.585   -20.636 62.779 1.00 45.54  ? 54  TYR E CE2   1 
ATOM   9096  C  CZ    . TYR G 3  54  ? 5.587   -21.238 64.008 1.00 42.74  ? 54  TYR E CZ    1 
ATOM   9097  O  OH    . TYR G 3  54  ? 6.684   -22.008 64.345 1.00 44.53  ? 54  TYR E OH    1 
ATOM   9098  N  N     . GLN G 3  55  ? 1.116   -15.629 62.448 1.00 43.60  ? 55  GLN E N     1 
ATOM   9099  C  CA    . GLN G 3  55  ? 0.246   -14.687 61.727 1.00 49.70  ? 55  GLN E CA    1 
ATOM   9100  C  C     . GLN G 3  55  ? 1.008   -13.538 61.043 1.00 53.53  ? 55  GLN E C     1 
ATOM   9101  O  O     . GLN G 3  55  ? 0.503   -12.882 60.129 1.00 60.75  ? 55  GLN E O     1 
ATOM   9102  C  CB    . GLN G 3  55  ? -0.835  -14.149 62.656 1.00 48.67  ? 55  GLN E CB    1 
ATOM   9103  C  CG    . GLN G 3  55  ? -1.825  -15.213 63.097 1.00 49.58  ? 55  GLN E CG    1 
ATOM   9104  C  CD    . GLN G 3  55  ? -3.056  -14.651 63.753 1.00 51.10  ? 55  GLN E CD    1 
ATOM   9105  O  OE1   . GLN G 3  55  ? -3.106  -13.497 64.121 1.00 55.70  ? 55  GLN E OE1   1 
ATOM   9106  N  NE2   . GLN G 3  55  ? -4.068  -15.477 63.897 1.00 59.33  ? 55  GLN E NE2   1 
ATOM   9107  N  N     . LYS G 3  56  ? 2.234   -13.307 61.462 1.00 55.81  ? 56  LYS E N     1 
ATOM   9108  C  CA    . LYS G 3  56  ? 3.020   -12.227 60.898 1.00 57.96  ? 56  LYS E CA    1 
ATOM   9109  C  C     . LYS G 3  56  ? 3.820   -12.748 59.712 1.00 56.22  ? 56  LYS E C     1 
ATOM   9110  O  O     . LYS G 3  56  ? 4.275   -11.967 58.868 1.00 55.49  ? 56  LYS E O     1 
ATOM   9111  C  CB    . LYS G 3  56  ? 3.919   -11.656 61.995 1.00 66.10  ? 56  LYS E CB    1 
ATOM   9112  C  CG    . LYS G 3  56  ? 5.027   -10.754 61.525 1.00 73.65  ? 56  LYS E CG    1 
ATOM   9113  C  CD    . LYS G 3  56  ? 5.672   -10.039 62.712 1.00 87.08  ? 56  LYS E CD    1 
ATOM   9114  C  CE    . LYS G 3  56  ? 6.950   -9.296  62.298 1.00 95.29  ? 56  LYS E CE    1 
ATOM   9115  N  NZ    . LYS G 3  56  ? 7.806   -8.874  63.450 1.00 92.17  ? 56  LYS E NZ    1 
ATOM   9116  N  N     . SER G 3  57  ? 3.995   -14.063 59.621 1.00 49.27  ? 57  SER E N     1 
ATOM   9117  C  CA    . SER G 3  57  ? 4.798   -14.586 58.539 1.00 47.38  ? 57  SER E CA    1 
ATOM   9118  C  C     . SER G 3  57  ? 3.956   -15.315 57.524 1.00 49.96  ? 57  SER E C     1 
ATOM   9119  O  O     . SER G 3  57  ? 2.781   -15.613 57.757 1.00 50.19  ? 57  SER E O     1 
ATOM   9120  C  CB    . SER G 3  57  ? 5.864   -15.512 59.071 1.00 48.97  ? 57  SER E CB    1 
ATOM   9121  O  OG    . SER G 3  57  ? 5.326   -16.773 59.441 1.00 50.29  ? 57  SER E OG    1 
ATOM   9122  N  N     . THR G 3  58  ? 4.576   -15.631 56.397 1.00 46.82  ? 58  THR E N     1 
ATOM   9123  C  CA    . THR G 3  58  ? 3.877   -16.310 55.341 1.00 47.39  ? 58  THR E CA    1 
ATOM   9124  C  C     . THR G 3  58  ? 4.538   -17.599 54.853 1.00 46.72  ? 58  THR E C     1 
ATOM   9125  O  O     . THR G 3  58  ? 4.051   -18.178 53.902 1.00 47.27  ? 58  THR E O     1 
ATOM   9126  C  CB    . THR G 3  58  ? 3.787   -15.409 54.120 1.00 48.36  ? 58  THR E CB    1 
ATOM   9127  O  OG1   . THR G 3  58  ? 5.068   -15.355 53.524 1.00 45.34  ? 58  THR E OG1   1 
ATOM   9128  C  CG2   . THR G 3  58  ? 3.400   -14.041 54.511 1.00 49.34  ? 58  THR E CG2   1 
ATOM   9129  N  N     . GLU G 3  59  ? 5.631   -18.042 55.473 1.00 48.51  ? 59  GLU E N     1 
ATOM   9130  C  CA    . GLU G 3  59  ? 6.343   -19.241 55.005 1.00 45.78  ? 59  GLU E CA    1 
ATOM   9131  C  C     . GLU G 3  59  ? 5.416   -20.443 55.162 1.00 45.01  ? 59  GLU E C     1 
ATOM   9132  O  O     . GLU G 3  59  ? 4.541   -20.438 56.023 1.00 47.50  ? 59  GLU E O     1 
ATOM   9133  C  CB    . GLU G 3  59  ? 7.554   -19.463 55.870 1.00 47.91  ? 59  GLU E CB    1 
ATOM   9134  C  CG    . GLU G 3  59  ? 7.180   -20.161 57.156 1.00 56.28  ? 59  GLU E CG    1 
ATOM   9135  C  CD    . GLU G 3  59  ? 7.807   -19.564 58.381 1.00 63.52  ? 59  GLU E CD    1 
ATOM   9136  O  OE1   . GLU G 3  59  ? 9.020   -19.831 58.567 1.00 72.61  ? 59  GLU E OE1   1 
ATOM   9137  O  OE2   . GLU G 3  59  ? 7.074   -18.873 59.155 1.00 61.20  ? 59  GLU E OE2   1 
ATOM   9138  N  N     . LEU G 3  60  ? 5.598   -21.472 54.362 1.00 43.17  ? 60  LEU E N     1 
ATOM   9139  C  CA    . LEU G 3  60  ? 4.849   -22.709 54.573 1.00 45.42  ? 60  LEU E CA    1 
ATOM   9140  C  C     . LEU G 3  60  ? 5.272   -23.455 55.860 1.00 49.33  ? 60  LEU E C     1 
ATOM   9141  O  O     . LEU G 3  60  ? 6.423   -23.370 56.336 1.00 54.49  ? 60  LEU E O     1 
ATOM   9142  C  CB    . LEU G 3  60  ? 4.988   -23.613 53.360 1.00 47.04  ? 60  LEU E CB    1 
ATOM   9143  C  CG    . LEU G 3  60  ? 4.259   -23.071 52.138 1.00 48.12  ? 60  LEU E CG    1 
ATOM   9144  C  CD1   . LEU G 3  60  ? 4.537   -23.961 50.970 1.00 48.35  ? 60  LEU E CD1   1 
ATOM   9145  C  CD2   . LEU G 3  60  ? 2.741   -22.981 52.346 1.00 51.03  ? 60  LEU E CD2   1 
ATOM   9146  N  N     . LEU G 3  61  ? 4.317   -24.178 56.410 1.00 44.41  ? 61  LEU E N     1 
ATOM   9147  C  CA    . LEU G 3  61  ? 4.401   -24.677 57.770 1.00 47.83  ? 61  LEU E CA    1 
ATOM   9148  C  C     . LEU G 3  61  ? 4.436   -26.219 57.870 1.00 45.45  ? 61  LEU E C     1 
ATOM   9149  O  O     . LEU G 3  61  ? 4.801   -26.784 58.891 1.00 44.89  ? 61  LEU E O     1 
ATOM   9150  C  CB    . LEU G 3  61  ? 3.200   -24.115 58.531 1.00 50.93  ? 61  LEU E CB    1 
ATOM   9151  C  CG    . LEU G 3  61  ? 3.138   -22.592 58.647 1.00 49.12  ? 61  LEU E CG    1 
ATOM   9152  C  CD1   . LEU G 3  61  ? 1.867   -22.171 59.338 1.00 47.91  ? 61  LEU E CD1   1 
ATOM   9153  C  CD2   . LEU G 3  61  ? 4.315   -22.102 59.463 1.00 53.72  ? 61  LEU E CD2   1 
ATOM   9154  N  N     . ILE G 3  62  ? 4.048   -26.892 56.802 1.00 43.03  ? 62  ILE E N     1 
ATOM   9155  C  CA    . ILE G 3  62  ? 4.258   -28.303 56.669 1.00 43.86  ? 62  ILE E CA    1 
ATOM   9156  C  C     . ILE G 3  62  ? 5.625   -28.462 55.987 1.00 45.87  ? 62  ILE E C     1 
ATOM   9157  O  O     . ILE G 3  62  ? 5.916   -27.718 55.073 1.00 44.51  ? 62  ILE E O     1 
ATOM   9158  C  CB    . ILE G 3  62  ? 3.158   -28.919 55.784 1.00 43.74  ? 62  ILE E CB    1 
ATOM   9159  C  CG1   . ILE G 3  62  ? 1.758   -28.670 56.366 1.00 43.97  ? 62  ILE E CG1   1 
ATOM   9160  C  CG2   . ILE G 3  62  ? 3.363   -30.411 55.637 1.00 43.41  ? 62  ILE E CG2   1 
ATOM   9161  C  CD1   . ILE G 3  62  ? 0.636   -29.319 55.580 1.00 40.92  ? 62  ILE E CD1   1 
ATOM   9162  N  N     . ARG G 3  63  ? 6.440   -29.415 56.444 1.00 46.15  ? 63  ARG E N     1 
ATOM   9163  C  CA    . ARG G 3  63  ? 7.789   -29.627 55.942 1.00 46.04  ? 63  ARG E CA    1 
ATOM   9164  C  C     . ARG G 3  63  ? 7.627   -30.075 54.493 1.00 43.05  ? 63  ARG E C     1 
ATOM   9165  O  O     . ARG G 3  63  ? 6.736   -30.827 54.192 1.00 39.85  ? 63  ARG E O     1 
ATOM   9166  C  CB    . ARG G 3  63  ? 8.500   -30.735 56.759 1.00 55.97  ? 63  ARG E CB    1 
ATOM   9167  C  CG    . ARG G 3  63  ? 8.871   -30.472 58.227 1.00 59.17  ? 63  ARG E CG    1 
ATOM   9168  C  CD    . ARG G 3  63  ? 10.271  -29.883 58.420 1.00 75.71  ? 63  ARG E CD    1 
ATOM   9169  N  NE    . ARG G 3  63  ? 10.178  -28.431 58.583 1.00 92.34  ? 63  ARG E NE    1 
ATOM   9170  C  CZ    . ARG G 3  63  ? 10.721  -27.501 57.791 1.00 99.25  ? 63  ARG E CZ    1 
ATOM   9171  N  NH1   . ARG G 3  63  ? 11.482  -27.840 56.757 1.00 105.94 ? 63  ARG E NH1   1 
ATOM   9172  N  NH2   . ARG G 3  63  ? 10.512  -26.205 58.060 1.00 98.31  ? 63  ARG E NH2   1 
ATOM   9173  N  N     . LYS G 3  64  ? 8.483   -29.638 53.588 1.00 43.49  ? 64  LYS E N     1 
ATOM   9174  C  CA    . LYS G 3  64  ? 8.206   -29.823 52.164 1.00 52.87  ? 64  LYS E CA    1 
ATOM   9175  C  C     . LYS G 3  64  ? 8.178   -31.257 51.715 1.00 51.07  ? 64  LYS E C     1 
ATOM   9176  O  O     . LYS G 3  64  ? 7.250   -31.671 51.031 1.00 58.26  ? 64  LYS E O     1 
ATOM   9177  C  CB    . LYS G 3  64  ? 9.187   -29.037 51.288 1.00 61.68  ? 64  LYS E CB    1 
ATOM   9178  C  CG    . LYS G 3  64  ? 8.889   -27.548 51.271 1.00 69.78  ? 64  LYS E CG    1 
ATOM   9179  C  CD    . LYS G 3  64  ? 9.719   -26.835 50.223 1.00 82.62  ? 64  LYS E CD    1 
ATOM   9180  C  CE    . LYS G 3  64  ? 9.982   -25.377 50.612 1.00 89.92  ? 64  LYS E CE    1 
ATOM   9181  N  NZ    . LYS G 3  64  ? 8.770   -24.660 51.101 1.00 80.49  ? 64  LYS E NZ    1 
ATOM   9182  N  N     . LEU G 3  65  ? 9.187   -32.017 52.095 1.00 50.58  ? 65  LEU E N     1 
ATOM   9183  C  CA    . LEU G 3  65  ? 9.373   -33.327 51.495 1.00 46.99  ? 65  LEU E CA    1 
ATOM   9184  C  C     . LEU G 3  65  ? 8.278   -34.320 51.933 1.00 44.72  ? 65  LEU E C     1 
ATOM   9185  O  O     . LEU G 3  65  ? 7.667   -35.002 51.103 1.00 44.30  ? 65  LEU E O     1 
ATOM   9186  C  CB    . LEU G 3  65  ? 10.780  -33.852 51.770 1.00 47.94  ? 65  LEU E CB    1 
ATOM   9187  C  CG    . LEU G 3  65  ? 10.975  -35.290 51.253 1.00 52.84  ? 65  LEU E CG    1 
ATOM   9188  C  CD1   . LEU G 3  65  ? 10.990  -35.336 49.729 1.00 46.94  ? 65  LEU E CD1   1 
ATOM   9189  C  CD2   . LEU G 3  65  ? 12.223  -35.903 51.850 1.00 55.49  ? 65  LEU E CD2   1 
ATOM   9190  N  N     . PRO G 3  66  ? 8.005   -34.396 53.227 1.00 42.01  ? 66  PRO E N     1 
ATOM   9191  C  CA    . PRO G 3  66  ? 6.833   -35.154 53.655 1.00 40.74  ? 66  PRO E CA    1 
ATOM   9192  C  C     . PRO G 3  66  ? 5.556   -34.810 52.871 1.00 44.91  ? 66  PRO E C     1 
ATOM   9193  O  O     . PRO G 3  66  ? 4.816   -35.684 52.420 1.00 52.90  ? 66  PRO E O     1 
ATOM   9194  C  CB    . PRO G 3  66  ? 6.676   -34.736 55.100 1.00 41.89  ? 66  PRO E CB    1 
ATOM   9195  C  CG    . PRO G 3  66  ? 8.077   -34.366 55.550 1.00 42.89  ? 66  PRO E CG    1 
ATOM   9196  C  CD    . PRO G 3  66  ? 8.692   -33.726 54.346 1.00 43.36  ? 66  PRO E CD    1 
ATOM   9197  N  N     . PHE G 3  67  ? 5.305   -33.536 52.650 1.00 51.19  ? 67  PHE E N     1 
ATOM   9198  C  CA    . PHE G 3  67  ? 4.094   -33.171 51.928 1.00 46.55  ? 67  PHE E CA    1 
ATOM   9199  C  C     . PHE G 3  67  ? 4.168   -33.736 50.530 1.00 40.40  ? 67  PHE E C     1 
ATOM   9200  O  O     . PHE G 3  67  ? 3.185   -34.156 49.994 1.00 42.42  ? 67  PHE E O     1 
ATOM   9201  C  CB    . PHE G 3  67  ? 3.892   -31.651 51.882 1.00 43.57  ? 67  PHE E CB    1 
ATOM   9202  C  CG    . PHE G 3  67  ? 2.661   -31.246 51.135 1.00 41.46  ? 67  PHE E CG    1 
ATOM   9203  C  CD1   . PHE G 3  67  ? 1.463   -31.098 51.780 1.00 39.17  ? 67  PHE E CD1   1 
ATOM   9204  C  CD2   . PHE G 3  67  ? 2.697   -31.067 49.772 1.00 40.26  ? 67  PHE E CD2   1 
ATOM   9205  C  CE1   . PHE G 3  67  ? 0.321   -30.763 51.089 1.00 35.37  ? 67  PHE E CE1   1 
ATOM   9206  C  CE2   . PHE G 3  67  ? 1.568   -30.707 49.081 1.00 37.74  ? 67  PHE E CE2   1 
ATOM   9207  C  CZ    . PHE G 3  67  ? 0.382   -30.537 49.747 1.00 36.73  ? 67  PHE E CZ    1 
ATOM   9208  N  N     . GLN G 3  68  ? 5.333   -33.711 49.929 1.00 42.18  ? 68  GLN E N     1 
ATOM   9209  C  CA    . GLN G 3  68  ? 5.476   -34.131 48.551 1.00 46.74  ? 68  GLN E CA    1 
ATOM   9210  C  C     . GLN G 3  68  ? 5.150   -35.618 48.438 1.00 49.81  ? 68  GLN E C     1 
ATOM   9211  O  O     . GLN G 3  68  ? 4.500   -36.074 47.482 1.00 48.29  ? 68  GLN E O     1 
ATOM   9212  C  CB    . GLN G 3  68  ? 6.894   -33.863 48.124 1.00 52.64  ? 68  GLN E CB    1 
ATOM   9213  C  CG    . GLN G 3  68  ? 7.182   -34.145 46.670 1.00 68.65  ? 68  GLN E CG    1 
ATOM   9214  C  CD    . GLN G 3  68  ? 8.580   -33.679 46.297 1.00 82.00  ? 68  GLN E CD    1 
ATOM   9215  O  OE1   . GLN G 3  68  ? 9.473   -33.633 47.151 1.00 85.54  ? 68  GLN E OE1   1 
ATOM   9216  N  NE2   . GLN G 3  68  ? 8.772   -33.304 45.030 1.00 82.62  ? 68  GLN E NE2   1 
ATOM   9217  N  N     . ARG G 3  69  ? 5.589   -36.372 49.440 1.00 48.64  ? 69  ARG E N     1 
ATOM   9218  C  CA    . ARG G 3  69  ? 5.390   -37.813 49.443 1.00 49.05  ? 69  ARG E CA    1 
ATOM   9219  C  C     . ARG G 3  69  ? 3.952   -38.146 49.520 1.00 48.36  ? 69  ARG E C     1 
ATOM   9220  O  O     . ARG G 3  69  ? 3.481   -39.076 48.857 1.00 56.39  ? 69  ARG E O     1 
ATOM   9221  C  CB    . ARG G 3  69  ? 6.005   -38.411 50.674 1.00 52.27  ? 69  ARG E CB    1 
ATOM   9222  C  CG    . ARG G 3  69  ? 7.476   -38.678 50.546 1.00 54.70  ? 69  ARG E CG    1 
ATOM   9223  C  CD    . ARG G 3  69  ? 7.884   -39.517 51.736 1.00 57.26  ? 69  ARG E CD    1 
ATOM   9224  N  NE    . ARG G 3  69  ? 9.153   -39.045 52.224 1.00 57.57  ? 69  ARG E NE    1 
ATOM   9225  C  CZ    . ARG G 3  69  ? 9.380   -38.650 53.462 1.00 64.42  ? 69  ARG E CZ    1 
ATOM   9226  N  NH1   . ARG G 3  69  ? 8.413   -38.701 54.384 1.00 54.13  ? 69  ARG E NH1   1 
ATOM   9227  N  NH2   . ARG G 3  69  ? 10.604  -38.206 53.771 1.00 70.32  ? 69  ARG E NH2   1 
ATOM   9228  N  N     . LEU G 3  70  ? 3.261   -37.404 50.380 1.00 42.39  ? 70  LEU E N     1 
ATOM   9229  C  CA    . LEU G 3  70  ? 1.822   -37.576 50.550 1.00 43.07  ? 70  LEU E CA    1 
ATOM   9230  C  C     . LEU G 3  70  ? 1.104   -37.353 49.233 1.00 42.64  ? 70  LEU E C     1 
ATOM   9231  O  O     . LEU G 3  70  ? 0.216   -38.113 48.854 1.00 42.03  ? 70  LEU E O     1 
ATOM   9232  C  CB    . LEU G 3  70  ? 1.292   -36.611 51.594 1.00 42.08  ? 70  LEU E CB    1 
ATOM   9233  C  CG    . LEU G 3  70  ? -0.194  -36.768 51.877 1.00 44.62  ? 70  LEU E CG    1 
ATOM   9234  C  CD1   . LEU G 3  70  ? -0.477  -38.197 52.260 1.00 42.52  ? 70  LEU E CD1   1 
ATOM   9235  C  CD2   . LEU G 3  70  ? -0.614  -35.792 52.989 1.00 45.48  ? 70  LEU E CD2   1 
ATOM   9236  N  N     . VAL G 3  71  ? 1.518   -36.316 48.514 1.00 40.68  ? 71  VAL E N     1 
ATOM   9237  C  CA    . VAL G 3  71  ? 0.956   -36.072 47.196 1.00 41.54  ? 71  VAL E CA    1 
ATOM   9238  C  C     . VAL G 3  71  ? 1.227   -37.272 46.295 1.00 40.58  ? 71  VAL E C     1 
ATOM   9239  O  O     . VAL G 3  71  ? 0.314   -37.825 45.711 1.00 41.08  ? 71  VAL E O     1 
ATOM   9240  C  CB    . VAL G 3  71  ? 1.511   -34.795 46.594 1.00 43.74  ? 71  VAL E CB    1 
ATOM   9241  C  CG1   . VAL G 3  71  ? 0.988   -34.610 45.195 1.00 45.12  ? 71  VAL E CG1   1 
ATOM   9242  C  CG2   . VAL G 3  71  ? 1.085   -33.603 47.448 1.00 46.27  ? 71  VAL E CG2   1 
ATOM   9243  N  N     . ARG G 3  72  ? 2.464   -37.732 46.255 1.00 42.68  ? 72  ARG E N     1 
ATOM   9244  C  CA    . ARG G 3  72  ? 2.795   -38.839 45.353 1.00 47.60  ? 72  ARG E CA    1 
ATOM   9245  C  C     . ARG G 3  72  ? 2.044   -40.090 45.694 1.00 44.82  ? 72  ARG E C     1 
ATOM   9246  O  O     . ARG G 3  72  ? 1.501   -40.717 44.806 1.00 46.83  ? 72  ARG E O     1 
ATOM   9247  C  CB    . ARG G 3  72  ? 4.276   -39.073 45.307 1.00 48.73  ? 72  ARG E CB    1 
ATOM   9248  C  CG    . ARG G 3  72  ? 4.972   -37.895 44.655 1.00 52.95  ? 72  ARG E CG    1 
ATOM   9249  C  CD    . ARG G 3  72  ? 6.456   -38.029 44.759 1.00 57.34  ? 72  ARG E CD    1 
ATOM   9250  N  NE    . ARG G 3  72  ? 7.097   -36.799 44.349 1.00 65.85  ? 72  ARG E NE    1 
ATOM   9251  C  CZ    . ARG G 3  72  ? 7.243   -36.439 43.085 1.00 65.16  ? 72  ARG E CZ    1 
ATOM   9252  N  NH1   . ARG G 3  72  ? 6.788   -37.199 42.093 1.00 61.66  ? 72  ARG E NH1   1 
ATOM   9253  N  NH2   . ARG G 3  72  ? 7.852   -35.306 42.822 1.00 70.20  ? 72  ARG E NH2   1 
ATOM   9254  N  N     . GLU G 3  73  ? 1.944   -40.384 46.980 1.00 38.94  ? 73  GLU E N     1 
ATOM   9255  C  CA    . GLU G 3  73  ? 1.210   -41.525 47.422 1.00 40.51  ? 73  GLU E CA    1 
ATOM   9256  C  C     . GLU G 3  73  ? -0.242  -41.471 46.979 1.00 44.97  ? 73  GLU E C     1 
ATOM   9257  O  O     . GLU G 3  73  ? -0.763  -42.433 46.426 1.00 54.85  ? 73  GLU E O     1 
ATOM   9258  C  CB    . GLU G 3  73  ? 1.276   -41.629 48.952 1.00 41.96  ? 73  GLU E CB    1 
ATOM   9259  C  CG    . GLU G 3  73  ? 0.355   -42.703 49.524 1.00 41.23  ? 73  GLU E CG    1 
ATOM   9260  C  CD    . GLU G 3  73  ? 0.431   -42.876 51.058 1.00 42.92  ? 73  GLU E CD    1 
ATOM   9261  O  OE1   . GLU G 3  73  ? 1.516   -42.797 51.668 1.00 44.30  ? 73  GLU E OE1   1 
ATOM   9262  O  OE2   . GLU G 3  73  ? -0.616  -43.146 51.680 1.00 48.41  ? 73  GLU E OE2   1 
ATOM   9263  N  N     . ILE G 3  74  ? -0.918  -40.359 47.242 1.00 46.94  ? 74  ILE E N     1 
ATOM   9264  C  CA    . ILE G 3  74  ? -2.320  -40.239 46.846 1.00 44.38  ? 74  ILE E CA    1 
ATOM   9265  C  C     . ILE G 3  74  ? -2.445  -40.244 45.312 1.00 46.39  ? 74  ILE E C     1 
ATOM   9266  O  O     . ILE G 3  74  ? -3.337  -40.860 44.753 1.00 49.03  ? 74  ILE E O     1 
ATOM   9267  C  CB    . ILE G 3  74  ? -2.924  -38.966 47.420 1.00 44.97  ? 74  ILE E CB    1 
ATOM   9268  C  CG1   . ILE G 3  74  ? -3.019  -39.085 48.927 1.00 43.88  ? 74  ILE E CG1   1 
ATOM   9269  C  CG2   . ILE G 3  74  ? -4.316  -38.664 46.856 1.00 41.18  ? 74  ILE E CG2   1 
ATOM   9270  C  CD1   . ILE G 3  74  ? -3.366  -37.745 49.547 1.00 46.81  ? 74  ILE E CD1   1 
ATOM   9271  N  N     . ALA G 3  75  ? -1.542  -39.599 44.605 1.00 45.48  ? 75  ALA E N     1 
ATOM   9272  C  CA    . ALA G 3  75  ? -1.701  -39.584 43.151 1.00 48.23  ? 75  ALA E CA    1 
ATOM   9273  C  C     . ALA G 3  75  ? -1.503  -40.955 42.595 1.00 49.96  ? 75  ALA E C     1 
ATOM   9274  O  O     . ALA G 3  75  ? -2.156  -41.329 41.647 1.00 43.56  ? 75  ALA E O     1 
ATOM   9275  C  CB    . ALA G 3  75  ? -0.717  -38.627 42.495 1.00 49.25  ? 75  ALA E CB    1 
ATOM   9276  N  N     . GLN G 3  76  ? -0.553  -41.687 43.174 1.00 55.81  ? 76  GLN E N     1 
ATOM   9277  C  CA    . GLN G 3  76  ? -0.176  -42.994 42.679 1.00 51.90  ? 76  GLN E CA    1 
ATOM   9278  C  C     . GLN G 3  76  ? -1.356  -43.905 42.817 1.00 49.67  ? 76  GLN E C     1 
ATOM   9279  O  O     . GLN G 3  76  ? -1.678  -44.635 41.905 1.00 53.72  ? 76  GLN E O     1 
ATOM   9280  C  CB    . GLN G 3  76  ? 0.925   -43.543 43.520 1.00 58.92  ? 76  GLN E CB    1 
ATOM   9281  C  CG    . GLN G 3  76  ? 1.404   -44.897 43.124 1.00 58.65  ? 76  GLN E CG    1 
ATOM   9282  C  CD    . GLN G 3  76  ? 2.649   -45.160 43.881 1.00 61.51  ? 76  GLN E CD    1 
ATOM   9283  O  OE1   . GLN G 3  76  ? 2.648   -45.054 45.104 1.00 65.84  ? 76  GLN E OE1   1 
ATOM   9284  N  NE2   . GLN G 3  76  ? 3.740   -45.425 43.174 1.00 60.67  ? 76  GLN E NE2   1 
ATOM   9285  N  N     . ASP G 3  77  ? -2.024  -43.858 43.955 1.00 47.03  ? 77  ASP E N     1 
ATOM   9286  C  CA    . ASP G 3  77  ? -3.299  -44.573 44.062 1.00 45.44  ? 77  ASP E CA    1 
ATOM   9287  C  C     . ASP G 3  77  ? -4.334  -44.181 42.979 1.00 48.51  ? 77  ASP E C     1 
ATOM   9288  O  O     . ASP G 3  77  ? -5.152  -44.989 42.629 1.00 59.24  ? 77  ASP E O     1 
ATOM   9289  C  CB    . ASP G 3  77  ? -3.894  -44.435 45.445 1.00 40.01  ? 77  ASP E CB    1 
ATOM   9290  C  CG    . ASP G 3  77  ? -3.035  -45.100 46.532 1.00 44.43  ? 77  ASP E CG    1 
ATOM   9291  O  OD1   . ASP G 3  77  ? -2.162  -45.913 46.204 1.00 50.57  ? 77  ASP E OD1   1 
ATOM   9292  O  OD2   . ASP G 3  77  ? -3.262  -44.865 47.735 1.00 45.62  ? 77  ASP E OD2   1 
ATOM   9293  N  N     . PHE G 3  78  ? -4.328  -42.974 42.430 1.00 51.75  ? 78  PHE E N     1 
ATOM   9294  C  CA    . PHE G 3  78  ? -5.253  -42.701 41.325 1.00 50.43  ? 78  PHE E CA    1 
ATOM   9295  C  C     . PHE G 3  78  ? -4.696  -43.161 39.984 1.00 50.27  ? 78  PHE E C     1 
ATOM   9296  O  O     . PHE G 3  78  ? -5.464  -43.445 39.082 1.00 54.68  ? 78  PHE E O     1 
ATOM   9297  C  CB    . PHE G 3  78  ? -5.611  -41.215 41.215 1.00 55.22  ? 78  PHE E CB    1 
ATOM   9298  C  CG    . PHE G 3  78  ? -6.653  -40.763 42.196 1.00 65.91  ? 78  PHE E CG    1 
ATOM   9299  C  CD1   . PHE G 3  78  ? -6.397  -39.712 43.080 1.00 75.20  ? 78  PHE E CD1   1 
ATOM   9300  C  CD2   . PHE G 3  78  ? -7.900  -41.357 42.236 1.00 75.68  ? 78  PHE E CD2   1 
ATOM   9301  C  CE1   . PHE G 3  78  ? -7.362  -39.282 43.991 1.00 72.72  ? 78  PHE E CE1   1 
ATOM   9302  C  CE2   . PHE G 3  78  ? -8.870  -40.933 43.158 1.00 81.83  ? 78  PHE E CE2   1 
ATOM   9303  C  CZ    . PHE G 3  78  ? -8.603  -39.887 44.028 1.00 68.20  ? 78  PHE E CZ    1 
ATOM   9304  N  N     . LYS G 3  79  ? -3.377  -43.166 39.822 1.00 50.06  ? 79  LYS E N     1 
ATOM   9305  C  CA    . LYS G 3  79  ? -2.770  -43.500 38.551 1.00 53.42  ? 79  LYS E CA    1 
ATOM   9306  C  C     . LYS G 3  79  ? -1.267  -43.656 38.765 1.00 54.96  ? 79  LYS E C     1 
ATOM   9307  O  O     . LYS G 3  79  ? -0.705  -42.949 39.575 1.00 58.68  ? 79  LYS E O     1 
ATOM   9308  C  CB    . LYS G 3  79  ? -3.060  -42.380 37.570 1.00 59.26  ? 79  LYS E CB    1 
ATOM   9309  C  CG    . LYS G 3  79  ? -3.139  -42.827 36.126 1.00 71.86  ? 79  LYS E CG    1 
ATOM   9310  C  CD    . LYS G 3  79  ? -2.024  -42.223 35.282 1.00 74.96  ? 79  LYS E CD    1 
ATOM   9311  C  CE    . LYS G 3  79  ? -2.058  -42.763 33.864 1.00 72.01  ? 79  LYS E CE    1 
ATOM   9312  N  NZ    . LYS G 3  79  ? -1.323  -44.063 33.845 1.00 73.13  ? 79  LYS E NZ    1 
ATOM   9313  N  N     . THR G 3  80  ? -0.618  -44.564 38.053 1.00 55.77  ? 80  THR E N     1 
ATOM   9314  C  CA    . THR G 3  80  ? 0.802   -44.883 38.317 1.00 58.15  ? 80  THR E CA    1 
ATOM   9315  C  C     . THR G 3  80  ? 1.671   -44.309 37.258 1.00 59.55  ? 80  THR E C     1 
ATOM   9316  O  O     . THR G 3  80  ? 1.179   -43.932 36.197 1.00 70.96  ? 80  THR E O     1 
ATOM   9317  C  CB    . THR G 3  80  ? 1.065   -46.393 38.292 1.00 61.01  ? 80  THR E CB    1 
ATOM   9318  O  OG1   . THR G 3  80  ? 0.485   -46.959 37.096 1.00 53.74  ? 80  THR E OG1   1 
ATOM   9319  C  CG2   . THR G 3  80  ? 0.465   -47.061 39.553 1.00 63.10  ? 80  THR E CG2   1 
ATOM   9320  N  N     . ASP G 3  81  ? 2.970   -44.285 37.525 1.00 60.96  ? 81  ASP E N     1 
ATOM   9321  C  CA    . ASP G 3  81  ? 3.941   -43.696 36.594 1.00 71.52  ? 81  ASP E CA    1 
ATOM   9322  C  C     . ASP G 3  81  ? 3.612   -42.235 36.307 1.00 70.58  ? 81  ASP E C     1 
ATOM   9323  O  O     . ASP G 3  81  ? 3.713   -41.771 35.158 1.00 74.81  ? 81  ASP E O     1 
ATOM   9324  C  CB    . ASP G 3  81  ? 3.983   -44.476 35.272 1.00 82.87  ? 81  ASP E CB    1 
ATOM   9325  C  CG    . ASP G 3  81  ? 4.058   -45.982 35.482 1.00 92.67  ? 81  ASP E CG    1 
ATOM   9326  O  OD1   . ASP G 3  81  ? 3.212   -46.704 34.885 1.00 84.23  ? 81  ASP E OD1   1 
ATOM   9327  O  OD2   . ASP G 3  81  ? 4.953   -46.431 36.252 1.00 89.10  ? 81  ASP E OD2   1 
ATOM   9328  N  N     . LEU G 3  82  ? 3.194   -41.521 37.353 1.00 62.67  ? 82  LEU E N     1 
ATOM   9329  C  CA    . LEU G 3  82  ? 2.981   -40.081 37.260 1.00 58.59  ? 82  LEU E CA    1 
ATOM   9330  C  C     . LEU G 3  82  ? 4.190   -39.332 37.751 1.00 54.22  ? 82  LEU E C     1 
ATOM   9331  O  O     . LEU G 3  82  ? 4.784   -39.686 38.754 1.00 54.94  ? 82  LEU E O     1 
ATOM   9332  C  CB    . LEU G 3  82  ? 1.785   -39.634 38.098 1.00 57.03  ? 82  LEU E CB    1 
ATOM   9333  C  CG    . LEU G 3  82  ? 0.417   -39.844 37.477 1.00 58.27  ? 82  LEU E CG    1 
ATOM   9334  C  CD1   . LEU G 3  82  ? -0.661  -39.328 38.410 1.00 60.88  ? 82  LEU E CD1   1 
ATOM   9335  C  CD2   . LEU G 3  82  ? 0.365   -39.122 36.142 1.00 54.90  ? 82  LEU E CD2   1 
ATOM   9336  N  N     . ARG G 3  83  ? 4.518   -38.250 37.085 1.00 55.33  ? 83  ARG E N     1 
ATOM   9337  C  CA    . ARG G 3  83  ? 5.527   -37.349 37.618 1.00 65.25  ? 83  ARG E CA    1 
ATOM   9338  C  C     . ARG G 3  83  ? 4.842   -36.015 37.883 1.00 58.14  ? 83  ARG E C     1 
ATOM   9339  O  O     . ARG G 3  83  ? 3.714   -35.801 37.439 1.00 58.79  ? 83  ARG E O     1 
ATOM   9340  C  CB    . ARG G 3  83  ? 6.675   -37.177 36.618 1.00 70.46  ? 83  ARG E CB    1 
ATOM   9341  C  CG    . ARG G 3  83  ? 7.052   -38.460 35.917 1.00 71.49  ? 83  ARG E CG    1 
ATOM   9342  C  CD    . ARG G 3  83  ? 7.643   -38.218 34.532 1.00 77.39  ? 83  ARG E CD    1 
ATOM   9343  N  NE    . ARG G 3  83  ? 9.063   -38.542 34.580 1.00 92.32  ? 83  ARG E NE    1 
ATOM   9344  C  CZ    . ARG G 3  83  ? 10.061  -37.731 34.257 1.00 92.75  ? 83  ARG E CZ    1 
ATOM   9345  N  NH1   . ARG G 3  83  ? 9.828   -36.509 33.781 1.00 102.06 ? 83  ARG E NH1   1 
ATOM   9346  N  NH2   . ARG G 3  83  ? 11.305  -38.170 34.397 1.00 91.02  ? 83  ARG E NH2   1 
ATOM   9347  N  N     . PHE G 3  84  ? 5.544   -35.129 38.585 1.00 50.93  ? 84  PHE E N     1 
ATOM   9348  C  CA    . PHE G 3  84  ? 5.041   -33.809 38.935 1.00 49.53  ? 84  PHE E CA    1 
ATOM   9349  C  C     . PHE G 3  84  ? 6.042   -32.720 38.700 1.00 47.40  ? 84  PHE E C     1 
ATOM   9350  O  O     . PHE G 3  84  ? 7.179   -32.848 39.143 1.00 62.08  ? 84  PHE E O     1 
ATOM   9351  C  CB    . PHE G 3  84  ? 4.773   -33.754 40.428 1.00 49.52  ? 84  PHE E CB    1 
ATOM   9352  C  CG    . PHE G 3  84  ? 3.597   -34.537 40.847 1.00 55.41  ? 84  PHE E CG    1 
ATOM   9353  C  CD1   . PHE G 3  84  ? 3.612   -35.923 40.807 1.00 55.56  ? 84  PHE E CD1   1 
ATOM   9354  C  CD2   . PHE G 3  84  ? 2.451   -33.892 41.287 1.00 55.59  ? 84  PHE E CD2   1 
ATOM   9355  C  CE1   . PHE G 3  84  ? 2.497   -36.638 41.211 1.00 56.16  ? 84  PHE E CE1   1 
ATOM   9356  C  CE2   . PHE G 3  84  ? 1.338   -34.606 41.686 1.00 48.01  ? 84  PHE E CE2   1 
ATOM   9357  C  CZ    . PHE G 3  84  ? 1.359   -35.978 41.640 1.00 49.91  ? 84  PHE E CZ    1 
ATOM   9358  N  N     . GLN G 3  85  ? 5.606   -31.596 38.137 1.00 48.20  ? 85  GLN E N     1 
ATOM   9359  C  CA    . GLN G 3  85  ? 6.418   -30.377 38.193 1.00 44.67  ? 85  GLN E CA    1 
ATOM   9360  C  C     . GLN G 3  85  ? 6.559   -29.979 39.635 1.00 43.00  ? 85  GLN E C     1 
ATOM   9361  O  O     . GLN G 3  85  ? 5.618   -30.123 40.405 1.00 45.15  ? 85  GLN E O     1 
ATOM   9362  C  CB    . GLN G 3  85  ? 5.777   -29.256 37.407 1.00 43.90  ? 85  GLN E CB    1 
ATOM   9363  C  CG    . GLN G 3  85  ? 5.690   -29.534 35.922 1.00 44.45  ? 85  GLN E CG    1 
ATOM   9364  C  CD    . GLN G 3  85  ? 5.149   -28.332 35.177 1.00 50.01  ? 85  GLN E CD    1 
ATOM   9365  O  OE1   . GLN G 3  85  ? 4.528   -27.450 35.775 1.00 48.22  ? 85  GLN E OE1   1 
ATOM   9366  N  NE2   . GLN G 3  85  ? 5.378   -28.285 33.873 1.00 51.45  ? 85  GLN E NE2   1 
ATOM   9367  N  N     . SER G 3  86  ? 7.722   -29.499 40.039 1.00 44.78  ? 86  SER E N     1 
ATOM   9368  C  CA    . SER G 3  86  ? 7.821   -29.042 41.424 1.00 48.86  ? 86  SER E CA    1 
ATOM   9369  C  C     . SER G 3  86  ? 6.822   -27.937 41.717 1.00 43.78  ? 86  SER E C     1 
ATOM   9370  O  O     . SER G 3  86  ? 6.241   -27.933 42.769 1.00 46.21  ? 86  SER E O     1 
ATOM   9371  C  CB    . SER G 3  86  ? 9.232   -28.598 41.811 1.00 48.90  ? 86  SER E CB    1 
ATOM   9372  O  OG    . SER G 3  86  ? 9.814   -27.849 40.798 1.00 55.66  ? 86  SER E OG    1 
ATOM   9373  N  N     . SER G 3  87  ? 6.603   -27.016 40.796 1.00 38.56  ? 87  SER E N     1 
ATOM   9374  C  CA    . SER G 3  87  ? 5.670   -25.943 41.074 1.00 42.48  ? 87  SER E CA    1 
ATOM   9375  C  C     . SER G 3  87  ? 4.238   -26.508 41.238 1.00 46.22  ? 87  SER E C     1 
ATOM   9376  O  O     . SER G 3  87  ? 3.391   -25.890 41.872 1.00 48.90  ? 87  SER E O     1 
ATOM   9377  C  CB    . SER G 3  87  ? 5.682   -24.938 39.947 1.00 40.10  ? 87  SER E CB    1 
ATOM   9378  O  OG    . SER G 3  87  ? 5.376   -25.601 38.706 1.00 45.92  ? 87  SER E OG    1 
ATOM   9379  N  N     . ALA G 3  88  ? 3.956   -27.669 40.677 1.00 42.48  ? 88  ALA E N     1 
ATOM   9380  C  CA    . ALA G 3  88  ? 2.668   -28.306 40.960 1.00 48.64  ? 88  ALA E CA    1 
ATOM   9381  C  C     . ALA G 3  88  ? 2.530   -28.692 42.420 1.00 47.32  ? 88  ALA E C     1 
ATOM   9382  O  O     . ALA G 3  88  ? 1.488   -28.499 43.043 1.00 50.40  ? 88  ALA E O     1 
ATOM   9383  C  CB    . ALA G 3  88  ? 2.456   -29.533 40.098 1.00 49.56  ? 88  ALA E CB    1 
ATOM   9384  N  N     . VAL G 3  89  ? 3.581   -29.246 42.978 1.00 47.45  ? 89  VAL E N     1 
ATOM   9385  C  CA    . VAL G 3  89  ? 3.521   -29.681 44.377 1.00 45.92  ? 89  VAL E CA    1 
ATOM   9386  C  C     . VAL G 3  89  ? 3.411   -28.445 45.224 1.00 45.85  ? 89  VAL E C     1 
ATOM   9387  O  O     . VAL G 3  89  ? 2.677   -28.437 46.171 1.00 50.98  ? 89  VAL E O     1 
ATOM   9388  C  CB    . VAL G 3  89  ? 4.768   -30.491 44.856 1.00 43.05  ? 89  VAL E CB    1 
ATOM   9389  C  CG1   . VAL G 3  89  ? 4.591   -30.957 46.274 1.00 43.60  ? 89  VAL E CG1   1 
ATOM   9390  C  CG2   . VAL G 3  89  ? 5.037   -31.716 44.011 1.00 43.83  ? 89  VAL E CG2   1 
ATOM   9391  N  N     . MET G 3  90  ? 4.172   -27.411 44.894 1.00 53.59  ? 90  MET E N     1 
ATOM   9392  C  CA    . MET G 3  90  ? 4.132   -26.167 45.655 1.00 53.29  ? 90  MET E CA    1 
ATOM   9393  C  C     . MET G 3  90  ? 2.729   -25.587 45.606 1.00 46.14  ? 90  MET E C     1 
ATOM   9394  O  O     . MET G 3  90  ? 2.225   -25.083 46.614 1.00 46.55  ? 90  MET E O     1 
ATOM   9395  C  CB    . MET G 3  90  ? 5.168   -25.154 45.135 1.00 60.57  ? 90  MET E CB    1 
ATOM   9396  C  CG    . MET G 3  90  ? 6.591   -25.349 45.632 1.00 66.55  ? 90  MET E CG    1 
ATOM   9397  S  SD    . MET G 3  90  ? 6.626   -26.064 47.299 1.00 82.43  ? 90  MET E SD    1 
ATOM   9398  C  CE    . MET G 3  90  ? 6.543   -24.568 48.276 1.00 73.83  ? 90  MET E CE    1 
ATOM   9399  N  N     . ALA G 3  91  ? 2.080   -25.707 44.455 1.00 41.17  ? 91  ALA E N     1 
ATOM   9400  C  CA    . ALA G 3  91  ? 0.721   -25.170 44.301 1.00 43.56  ? 91  ALA E CA    1 
ATOM   9401  C  C     . ALA G 3  91  ? -0.225  -25.884 45.245 1.00 42.55  ? 91  ALA E C     1 
ATOM   9402  O  O     . ALA G 3  91  ? -1.027  -25.269 45.945 1.00 50.07  ? 91  ALA E O     1 
ATOM   9403  C  CB    . ALA G 3  91  ? 0.241   -25.324 42.868 1.00 42.29  ? 91  ALA E CB    1 
ATOM   9404  N  N     . LEU G 3  92  ? -0.105  -27.194 45.270 1.00 39.53  ? 92  LEU E N     1 
ATOM   9405  C  CA    . LEU G 3  92  ? -0.927  -27.995 46.122 1.00 39.33  ? 92  LEU E CA    1 
ATOM   9406  C  C     . LEU G 3  92  ? -0.685  -27.636 47.575 1.00 41.31  ? 92  LEU E C     1 
ATOM   9407  O  O     . LEU G 3  92  ? -1.628  -27.547 48.353 1.00 46.87  ? 92  LEU E O     1 
ATOM   9408  C  CB    . LEU G 3  92  ? -0.664  -29.491 45.860 1.00 42.10  ? 92  LEU E CB    1 
ATOM   9409  C  CG    . LEU G 3  92  ? -1.233  -30.059 44.528 1.00 43.22  ? 92  LEU E CG    1 
ATOM   9410  C  CD1   . LEU G 3  92  ? -0.642  -31.412 44.237 1.00 42.25  ? 92  LEU E CD1   1 
ATOM   9411  C  CD2   . LEU G 3  92  ? -2.742  -30.214 44.509 1.00 40.83  ? 92  LEU E CD2   1 
ATOM   9412  N  N     . GLN G 3  93  ? 0.563   -27.393 47.951 1.00 44.60  ? 93  GLN E N     1 
ATOM   9413  C  CA    . GLN G 3  93  ? 0.866   -27.090 49.339 1.00 43.17  ? 93  GLN E CA    1 
ATOM   9414  C  C     . GLN G 3  93  ? 0.333   -25.730 49.726 1.00 44.73  ? 93  GLN E C     1 
ATOM   9415  O  O     . GLN G 3  93  ? -0.338  -25.614 50.739 1.00 45.48  ? 93  GLN E O     1 
ATOM   9416  C  CB    . GLN G 3  93  ? 2.356   -27.154 49.625 1.00 42.05  ? 93  GLN E CB    1 
ATOM   9417  C  CG    . GLN G 3  93  ? 2.596   -27.398 51.113 1.00 41.76  ? 93  GLN E CG    1 
ATOM   9418  C  CD    . GLN G 3  93  ? 4.033   -27.596 51.432 1.00 39.96  ? 93  GLN E CD    1 
ATOM   9419  O  OE1   . GLN G 3  93  ? 4.840   -27.743 50.522 1.00 50.33  ? 93  GLN E OE1   1 
ATOM   9420  N  NE2   . GLN G 3  93  ? 4.382   -27.588 52.721 1.00 38.10  ? 93  GLN E NE2   1 
ATOM   9421  N  N     . GLU G 3  94  ? 0.599   -24.705 48.922 1.00 44.36  ? 94  GLU E N     1 
ATOM   9422  C  CA    . GLU G 3  94  ? -0.016  -23.412 49.174 1.00 41.45  ? 94  GLU E CA    1 
ATOM   9423  C  C     . GLU G 3  94  ? -1.542  -23.508 49.323 1.00 41.64  ? 94  GLU E C     1 
ATOM   9424  O  O     . GLU G 3  94  ? -2.121  -22.894 50.212 1.00 39.82  ? 94  GLU E O     1 
ATOM   9425  C  CB    . GLU G 3  94  ? 0.271   -22.499 48.034 1.00 45.06  ? 94  GLU E CB    1 
ATOM   9426  C  CG    . GLU G 3  94  ? 1.707   -22.007 47.963 1.00 49.25  ? 94  GLU E CG    1 
ATOM   9427  C  CD    . GLU G 3  94  ? 2.045   -20.983 49.006 1.00 50.48  ? 94  GLU E CD    1 
ATOM   9428  O  OE1   . GLU G 3  94  ? 1.141   -20.500 49.718 1.00 53.82  ? 94  GLU E OE1   1 
ATOM   9429  O  OE2   . GLU G 3  94  ? 3.252   -20.714 49.133 1.00 55.73  ? 94  GLU E OE2   1 
ATOM   9430  N  N     . ALA G 3  95  ? -2.196  -24.270 48.456 1.00 38.82  ? 95  ALA E N     1 
ATOM   9431  C  CA    . ALA G 3  95  ? -3.668  -24.365 48.489 1.00 38.69  ? 95  ALA E CA    1 
ATOM   9432  C  C     . ALA G 3  95  ? -4.117  -25.110 49.712 1.00 42.99  ? 95  ALA E C     1 
ATOM   9433  O  O     . ALA G 3  95  ? -5.181  -24.827 50.278 1.00 44.11  ? 95  ALA E O     1 
ATOM   9434  C  CB    . ALA G 3  95  ? -4.180  -25.102 47.268 1.00 36.23  ? 95  ALA E CB    1 
ATOM   9435  N  N     . SER G 3  96  ? -3.319  -26.107 50.098 1.00 39.09  ? 96  SER E N     1 
ATOM   9436  C  CA    . SER G 3  96  ? -3.694  -26.973 51.198 1.00 38.37  ? 96  SER E CA    1 
ATOM   9437  C  C     . SER G 3  96  ? -3.545  -26.263 52.519 1.00 38.73  ? 96  SER E C     1 
ATOM   9438  O  O     . SER G 3  96  ? -4.444  -26.266 53.344 1.00 44.32  ? 96  SER E O     1 
ATOM   9439  C  CB    . SER G 3  96  ? -2.834  -28.236 51.193 1.00 40.02  ? 96  SER E CB    1 
ATOM   9440  O  OG    . SER G 3  96  ? -3.112  -29.039 50.047 1.00 39.43  ? 96  SER E OG    1 
ATOM   9441  N  N     . GLU G 3  97  ? -2.393  -25.662 52.716 1.00 40.30  ? 97  GLU E N     1 
ATOM   9442  C  CA    . GLU G 3  97  ? -2.142  -24.833 53.878 1.00 40.55  ? 97  GLU E CA    1 
ATOM   9443  C  C     . GLU G 3  97  ? -3.143  -23.676 53.997 1.00 37.07  ? 97  GLU E C     1 
ATOM   9444  O  O     . GLU G 3  97  ? -3.638  -23.412 55.068 1.00 37.80  ? 97  GLU E O     1 
ATOM   9445  C  CB    . GLU G 3  97  ? -0.683  -24.327 53.849 1.00 44.23  ? 97  GLU E CB    1 
ATOM   9446  C  CG    . GLU G 3  97  ? 0.353   -25.460 53.957 1.00 46.13  ? 97  GLU E CG    1 
ATOM   9447  C  CD    . GLU G 3  97  ? 1.610   -25.140 54.774 1.00 48.14  ? 97  GLU E CD    1 
ATOM   9448  O  OE1   . GLU G 3  97  ? 1.771   -24.034 55.332 1.00 50.88  ? 97  GLU E OE1   1 
ATOM   9449  O  OE2   . GLU G 3  97  ? 2.488   -26.030 54.843 1.00 55.56  ? 97  GLU E OE2   1 
ATOM   9450  N  N     . ALA G 3  98  ? -3.491  -22.991 52.925 1.00 33.50  ? 98  ALA E N     1 
ATOM   9451  C  CA    . ALA G 3  98  ? -4.477  -21.914 53.114 1.00 31.94  ? 98  ALA E CA    1 
ATOM   9452  C  C     . ALA G 3  98  ? -5.814  -22.461 53.507 1.00 34.11  ? 98  ALA E C     1 
ATOM   9453  O  O     . ALA G 3  98  ? -6.530  -21.798 54.248 1.00 38.45  ? 98  ALA E O     1 
ATOM   9454  C  CB    . ALA G 3  98  ? -4.668  -21.073 51.889 1.00 29.47  ? 98  ALA E CB    1 
ATOM   9455  N  N     . TYR G 3  99  ? -6.173  -23.625 52.978 1.00 35.93  ? 99  TYR E N     1 
ATOM   9456  C  CA    . TYR G 3  99  ? -7.496  -24.226 53.266 1.00 36.67  ? 99  TYR E CA    1 
ATOM   9457  C  C     . TYR G 3  99  ? -7.532  -24.604 54.722 1.00 39.98  ? 99  TYR E C     1 
ATOM   9458  O  O     . TYR G 3  99  ? -8.470  -24.291 55.433 1.00 44.68  ? 99  TYR E O     1 
ATOM   9459  C  CB    . TYR G 3  99  ? -7.767  -25.427 52.392 1.00 37.12  ? 99  TYR E CB    1 
ATOM   9460  C  CG    . TYR G 3  99  ? -8.849  -26.335 52.870 1.00 36.49  ? 99  TYR E CG    1 
ATOM   9461  C  CD1   . TYR G 3  99  ? -10.186 -26.041 52.642 1.00 38.13  ? 99  TYR E CD1   1 
ATOM   9462  C  CD2   . TYR G 3  99  ? -8.539  -27.520 53.500 1.00 37.27  ? 99  TYR E CD2   1 
ATOM   9463  C  CE1   . TYR G 3  99  ? -11.186 -26.894 53.060 1.00 37.62  ? 99  TYR E CE1   1 
ATOM   9464  C  CE2   . TYR G 3  99  ? -9.524  -28.388 53.942 1.00 37.40  ? 99  TYR E CE2   1 
ATOM   9465  C  CZ    . TYR G 3  99  ? -10.847 -28.073 53.723 1.00 39.25  ? 99  TYR E CZ    1 
ATOM   9466  O  OH    . TYR G 3  99  ? -11.822 -28.914 54.209 1.00 36.62  ? 99  TYR E OH    1 
ATOM   9467  N  N     . LEU G 3  100 ? -6.475  -25.198 55.210 1.00 38.66  ? 100 LEU E N     1 
ATOM   9468  C  CA    . LEU G 3  100 ? -6.532  -25.661 56.574 1.00 40.44  ? 100 LEU E CA    1 
ATOM   9469  C  C     . LEU G 3  100 ? -6.515  -24.507 57.549 1.00 43.16  ? 100 LEU E C     1 
ATOM   9470  O  O     . LEU G 3  100 ? -7.093  -24.594 58.633 1.00 48.11  ? 100 LEU E O     1 
ATOM   9471  C  CB    . LEU G 3  100 ? -5.346  -26.577 56.883 1.00 40.12  ? 100 LEU E CB    1 
ATOM   9472  C  CG    . LEU G 3  100 ? -5.395  -27.983 56.253 1.00 39.79  ? 100 LEU E CG    1 
ATOM   9473  C  CD1   . LEU G 3  100 ? -4.061  -28.671 56.531 1.00 41.80  ? 100 LEU E CD1   1 
ATOM   9474  C  CD2   . LEU G 3  100 ? -6.525  -28.850 56.798 1.00 34.86  ? 100 LEU E CD2   1 
ATOM   9475  N  N     . VAL G 3  101 ? -5.804  -23.442 57.210 1.00 42.99  ? 101 VAL E N     1 
ATOM   9476  C  CA    . VAL G 3  101 ? -5.668  -22.365 58.150 1.00 35.92  ? 101 VAL E CA    1 
ATOM   9477  C  C     . VAL G 3  101 ? -7.031  -21.745 58.292 1.00 34.97  ? 101 VAL E C     1 
ATOM   9478  O  O     . VAL G 3  101 ? -7.515  -21.549 59.380 1.00 35.26  ? 101 VAL E O     1 
ATOM   9479  C  CB    . VAL G 3  101 ? -4.696  -21.333 57.667 1.00 37.84  ? 101 VAL E CB    1 
ATOM   9480  C  CG1   . VAL G 3  101 ? -4.837  -20.110 58.557 1.00 41.46  ? 101 VAL E CG1   1 
ATOM   9481  C  CG2   . VAL G 3  101 ? -3.265  -21.899 57.685 1.00 37.09  ? 101 VAL E CG2   1 
ATOM   9482  N  N     . ALA G 3  102 ? -7.686  -21.501 57.175 1.00 34.30  ? 102 ALA E N     1 
ATOM   9483  C  CA    . ALA G 3  102 ? -9.046  -20.969 57.204 1.00 33.15  ? 102 ALA E CA    1 
ATOM   9484  C  C     . ALA G 3  102 ? -10.015 -21.898 57.948 1.00 36.25  ? 102 ALA E C     1 
ATOM   9485  O  O     . ALA G 3  102 ? -10.876 -21.448 58.698 1.00 41.95  ? 102 ALA E O     1 
ATOM   9486  C  CB    . ALA G 3  102 ? -9.510  -20.757 55.799 1.00 28.17  ? 102 ALA E CB    1 
ATOM   9487  N  N     . LEU G 3  103 ? -9.864  -23.196 57.754 1.00 34.52  ? 103 LEU E N     1 
ATOM   9488  C  CA    . LEU G 3  103 ? -10.679 -24.155 58.469 1.00 34.25  ? 103 LEU E CA    1 
ATOM   9489  C  C     . LEU G 3  103 ? -10.528 -24.051 59.958 1.00 37.45  ? 103 LEU E C     1 
ATOM   9490  O  O     . LEU G 3  103 ? -11.510 -24.196 60.699 1.00 42.48  ? 103 LEU E O     1 
ATOM   9491  C  CB    . LEU G 3  103 ? -10.325 -25.560 58.076 1.00 35.97  ? 103 LEU E CB    1 
ATOM   9492  C  CG    . LEU G 3  103 ? -11.212 -26.639 58.661 1.00 38.76  ? 103 LEU E CG    1 
ATOM   9493  C  CD1   . LEU G 3  103 ? -12.659 -26.426 58.337 1.00 40.27  ? 103 LEU E CD1   1 
ATOM   9494  C  CD2   . LEU G 3  103 ? -10.792 -27.965 58.068 1.00 41.61  ? 103 LEU E CD2   1 
ATOM   9495  N  N     . PHE G 3  104 ? -9.312  -23.828 60.426 1.00 39.13  ? 104 PHE E N     1 
ATOM   9496  C  CA    . PHE G 3  104 ? -9.113  -23.650 61.867 1.00 41.17  ? 104 PHE E CA    1 
ATOM   9497  C  C     . PHE G 3  104 ? -9.674  -22.338 62.388 1.00 44.97  ? 104 PHE E C     1 
ATOM   9498  O  O     . PHE G 3  104 ? -9.990  -22.249 63.563 1.00 51.30  ? 104 PHE E O     1 
ATOM   9499  C  CB    . PHE G 3  104 ? -7.651  -23.676 62.207 1.00 42.68  ? 104 PHE E CB    1 
ATOM   9500  C  CG    . PHE G 3  104 ? -7.020  -25.034 62.128 1.00 41.02  ? 104 PHE E CG    1 
ATOM   9501  C  CD1   . PHE G 3  104 ? -5.835  -25.225 61.434 1.00 42.67  ? 104 PHE E CD1   1 
ATOM   9502  C  CD2   . PHE G 3  104 ? -7.539  -26.081 62.842 1.00 42.69  ? 104 PHE E CD2   1 
ATOM   9503  C  CE1   . PHE G 3  104 ? -5.207  -26.453 61.408 1.00 42.40  ? 104 PHE E CE1   1 
ATOM   9504  C  CE2   . PHE G 3  104 ? -6.929  -27.324 62.826 1.00 45.42  ? 104 PHE E CE2   1 
ATOM   9505  C  CZ    . PHE G 3  104 ? -5.763  -27.510 62.088 1.00 48.69  ? 104 PHE E CZ    1 
ATOM   9506  N  N     . GLU G 3  105 ? -9.786  -21.314 61.539 1.00 42.87  ? 105 GLU E N     1 
ATOM   9507  C  CA    . GLU G 3  105 ? -10.400 -20.061 61.973 1.00 40.17  ? 105 GLU E CA    1 
ATOM   9508  C  C     . GLU G 3  105 ? -11.824 -20.374 62.269 1.00 41.87  ? 105 GLU E C     1 
ATOM   9509  O  O     . GLU G 3  105 ? -12.327 -20.084 63.365 1.00 39.31  ? 105 GLU E O     1 
ATOM   9510  C  CB    . GLU G 3  105 ? -10.319 -18.968 60.908 1.00 43.69  ? 105 GLU E CB    1 
ATOM   9511  C  CG    . GLU G 3  105 ? -8.879  -18.533 60.584 1.00 47.87  ? 105 GLU E CG    1 
ATOM   9512  C  CD    . GLU G 3  105 ? -8.753  -17.595 59.380 1.00 53.90  ? 105 GLU E CD    1 
ATOM   9513  O  OE1   . GLU G 3  105 ? -9.829  -17.187 58.809 1.00 52.65  ? 105 GLU E OE1   1 
ATOM   9514  O  OE2   . GLU G 3  105 ? -7.555  -17.277 59.016 1.00 47.77  ? 105 GLU E OE2   1 
ATOM   9515  N  N     . ASP G 3  106 ? -12.479 -21.018 61.304 1.00 41.42  ? 106 ASP E N     1 
ATOM   9516  C  CA    . ASP G 3  106 ? -13.881 -21.337 61.478 1.00 38.49  ? 106 ASP E CA    1 
ATOM   9517  C  C     . ASP G 3  106 ? -14.014 -22.279 62.647 1.00 39.90  ? 106 ASP E C     1 
ATOM   9518  O  O     . ASP G 3  106 ? -14.922 -22.134 63.449 1.00 43.20  ? 106 ASP E O     1 
ATOM   9519  C  CB    . ASP G 3  106 ? -14.421 -21.993 60.249 1.00 38.74  ? 106 ASP E CB    1 
ATOM   9520  C  CG    . ASP G 3  106 ? -14.500 -21.066 59.075 1.00 38.75  ? 106 ASP E CG    1 
ATOM   9521  O  OD1   . ASP G 3  106 ? -14.443 -19.831 59.279 1.00 44.18  ? 106 ASP E OD1   1 
ATOM   9522  O  OD2   . ASP G 3  106 ? -14.680 -21.582 57.946 1.00 36.31  ? 106 ASP E OD2   1 
ATOM   9523  N  N     . THR G 3  107 ? -13.078 -23.215 62.777 1.00 38.28  ? 107 THR E N     1 
ATOM   9524  C  CA    . THR G 3  107 ? -13.189 -24.220 63.813 1.00 37.90  ? 107 THR E CA    1 
ATOM   9525  C  C     . THR G 3  107 ? -13.127 -23.529 65.176 1.00 41.81  ? 107 THR E C     1 
ATOM   9526  O  O     . THR G 3  107 ? -13.901 -23.829 66.066 1.00 40.82  ? 107 THR E O     1 
ATOM   9527  C  CB    . THR G 3  107 ? -12.062 -25.237 63.707 1.00 36.12  ? 107 THR E CB    1 
ATOM   9528  O  OG1   . THR G 3  107 ? -12.037 -25.819 62.394 1.00 36.49  ? 107 THR E OG1   1 
ATOM   9529  C  CG2   . THR G 3  107 ? -12.253 -26.322 64.673 1.00 34.95  ? 107 THR E CG2   1 
ATOM   9530  N  N     . ASN G 3  108 ? -12.204 -22.582 65.296 1.00 45.57  ? 108 ASN E N     1 
ATOM   9531  C  CA    . ASN G 3  108 ? -11.997 -21.798 66.507 1.00 42.25  ? 108 ASN E CA    1 
ATOM   9532  C  C     . ASN G 3  108 ? -13.275 -21.075 66.871 1.00 42.11  ? 108 ASN E C     1 
ATOM   9533  O  O     . ASN G 3  108 ? -13.659 -20.996 68.042 1.00 45.62  ? 108 ASN E O     1 
ATOM   9534  C  CB    . ASN G 3  108 ? -10.891 -20.776 66.238 1.00 39.93  ? 108 ASN E CB    1 
ATOM   9535  C  CG    . ASN G 3  108 ? -10.099 -20.420 67.465 1.00 42.75  ? 108 ASN E CG    1 
ATOM   9536  O  OD1   . ASN G 3  108 ? -9.966  -21.208 68.380 1.00 43.47  ? 108 ASN E OD1   1 
ATOM   9537  N  ND2   . ASN G 3  108 ? -9.504  -19.237 67.457 1.00 45.21  ? 108 ASN E ND2   1 
ATOM   9538  N  N     . LEU G 3  109 ? -13.963 -20.557 65.860 1.00 40.66  ? 109 LEU E N     1 
ATOM   9539  C  CA    . LEU G 3  109 ? -15.218 -19.849 66.118 1.00 40.69  ? 109 LEU E CA    1 
ATOM   9540  C  C     . LEU G 3  109 ? -16.301 -20.821 66.598 1.00 41.10  ? 109 LEU E C     1 
ATOM   9541  O  O     . LEU G 3  109 ? -17.150 -20.448 67.399 1.00 43.48  ? 109 LEU E O     1 
ATOM   9542  C  CB    . LEU G 3  109 ? -15.700 -19.099 64.882 1.00 38.47  ? 109 LEU E CB    1 
ATOM   9543  C  CG    . LEU G 3  109 ? -14.885 -17.879 64.433 1.00 38.17  ? 109 LEU E CG    1 
ATOM   9544  C  CD1   . LEU G 3  109 ? -15.566 -17.252 63.212 1.00 41.64  ? 109 LEU E CD1   1 
ATOM   9545  C  CD2   . LEU G 3  109 ? -14.758 -16.821 65.488 1.00 32.98  ? 109 LEU E CD2   1 
ATOM   9546  N  N     . CYS G 3  110 ? -16.287 -22.056 66.110 1.00 38.36  ? 110 CYS E N     1 
ATOM   9547  C  CA    . CYS G 3  110 ? -17.216 -23.038 66.657 1.00 43.21  ? 110 CYS E CA    1 
ATOM   9548  C  C     . CYS G 3  110 ? -16.936 -23.428 68.152 1.00 42.09  ? 110 CYS E C     1 
ATOM   9549  O  O     . CYS G 3  110 ? -17.851 -23.539 68.949 1.00 41.47  ? 110 CYS E O     1 
ATOM   9550  C  CB    . CYS G 3  110 ? -17.275 -24.251 65.752 1.00 43.49  ? 110 CYS E CB    1 
ATOM   9551  S  SG    . CYS G 3  110 ? -17.874 -23.834 64.109 1.00 41.79  ? 110 CYS E SG    1 
ATOM   9552  N  N     . ALA G 3  111 ? -15.685 -23.598 68.532 1.00 42.55  ? 111 ALA E N     1 
ATOM   9553  C  CA    . ALA G 3  111 ? -15.327 -23.773 69.941 1.00 44.80  ? 111 ALA E CA    1 
ATOM   9554  C  C     . ALA G 3  111 ? -15.735 -22.564 70.770 1.00 48.84  ? 111 ALA E C     1 
ATOM   9555  O  O     . ALA G 3  111 ? -16.445 -22.660 71.762 1.00 51.96  ? 111 ALA E O     1 
ATOM   9556  C  CB    . ALA G 3  111 ? -13.843 -24.004 70.068 1.00 44.87  ? 111 ALA E CB    1 
ATOM   9557  N  N     . ILE G 3  112 ? -15.335 -21.388 70.350 1.00 51.67  ? 112 ILE E N     1 
ATOM   9558  C  CA    . ILE G 3  112 ? -15.722 -20.221 71.126 1.00 46.48  ? 112 ILE E CA    1 
ATOM   9559  C  C     . ILE G 3  112 ? -17.241 -20.105 71.278 1.00 47.33  ? 112 ILE E C     1 
ATOM   9560  O  O     . ILE G 3  112 ? -17.731 -19.707 72.300 1.00 55.97  ? 112 ILE E O     1 
ATOM   9561  C  CB    . ILE G 3  112 ? -15.179 -18.978 70.460 1.00 44.68  ? 112 ILE E CB    1 
ATOM   9562  C  CG1   . ILE G 3  112 ? -13.676 -18.956 70.619 1.00 46.61  ? 112 ILE E CG1   1 
ATOM   9563  C  CG2   . ILE G 3  112 ? -15.818 -17.721 71.043 1.00 43.49  ? 112 ILE E CG2   1 
ATOM   9564  C  CD1   . ILE G 3  112 ? -13.011 -17.899 69.755 1.00 53.26  ? 112 ILE E CD1   1 
ATOM   9565  N  N     . HIS G 3  113 ? -17.992 -20.442 70.248 1.00 47.86  ? 113 HIS E N     1 
ATOM   9566  C  CA    . HIS G 3  113 ? -19.457 -20.400 70.329 1.00 48.77  ? 113 HIS E CA    1 
ATOM   9567  C  C     . HIS G 3  113 ? -19.969 -21.257 71.443 1.00 50.72  ? 113 HIS E C     1 
ATOM   9568  O  O     . HIS G 3  113 ? -20.968 -20.945 72.060 1.00 58.32  ? 113 HIS E O     1 
ATOM   9569  C  CB    . HIS G 3  113 ? -20.033 -20.951 69.039 1.00 46.89  ? 113 HIS E CB    1 
ATOM   9570  C  CG    . HIS G 3  113 ? -21.512 -20.834 68.931 1.00 44.80  ? 113 HIS E CG    1 
ATOM   9571  N  ND1   . HIS G 3  113 ? -22.147 -19.623 68.786 1.00 43.66  ? 113 HIS E ND1   1 
ATOM   9572  C  CD2   . HIS G 3  113 ? -22.478 -21.783 68.840 1.00 48.76  ? 113 HIS E CD2   1 
ATOM   9573  C  CE1   . HIS G 3  113 ? -23.446 -19.825 68.633 1.00 45.88  ? 113 HIS E CE1   1 
ATOM   9574  N  NE2   . HIS G 3  113 ? -23.676 -21.127 68.676 1.00 47.62  ? 113 HIS E NE2   1 
ATOM   9575  N  N     . ALA G 3  114 ? -19.273 -22.375 71.650 1.00 57.00  ? 114 ALA E N     1 
ATOM   9576  C  CA    . ALA G 3  114 ? -19.614 -23.381 72.653 1.00 52.71  ? 114 ALA E CA    1 
ATOM   9577  C  C     . ALA G 3  114 ? -19.053 -23.022 74.005 1.00 53.04  ? 114 ALA E C     1 
ATOM   9578  O  O     . ALA G 3  114 ? -19.000 -23.856 74.905 1.00 51.40  ? 114 ALA E O     1 
ATOM   9579  C  CB    . ALA G 3  114 ? -19.043 -24.715 72.214 1.00 54.05  ? 114 ALA E CB    1 
ATOM   9580  N  N     . LYS G 3  115 ? -18.577 -21.783 74.121 1.00 61.35  ? 115 LYS E N     1 
ATOM   9581  C  CA    . LYS G 3  115 ? -17.962 -21.269 75.343 1.00 59.59  ? 115 LYS E CA    1 
ATOM   9582  C  C     . LYS G 3  115 ? -16.726 -22.054 75.741 1.00 55.02  ? 115 LYS E C     1 
ATOM   9583  O  O     . LYS G 3  115 ? -16.468 -22.238 76.906 1.00 59.55  ? 115 LYS E O     1 
ATOM   9584  C  CB    . LYS G 3  115 ? -18.991 -21.235 76.467 1.00 63.28  ? 115 LYS E CB    1 
ATOM   9585  C  CG    . LYS G 3  115 ? -20.201 -20.348 76.150 1.00 73.77  ? 115 LYS E CG    1 
ATOM   9586  C  CD    . LYS G 3  115 ? -21.357 -20.622 77.103 1.00 81.13  ? 115 LYS E CD    1 
ATOM   9587  C  CE    . LYS G 3  115 ? -22.313 -19.447 77.224 1.00 89.75  ? 115 LYS E CE    1 
ATOM   9588  N  NZ    . LYS G 3  115 ? -23.399 -19.749 78.212 1.00 100.53 ? 115 LYS E NZ    1 
ATOM   9589  N  N     . ARG G 3  116 ? -15.956 -22.498 74.760 1.00 48.67  ? 116 ARG E N     1 
ATOM   9590  C  CA    . ARG G 3  116 ? -14.669 -23.115 75.007 1.00 45.74  ? 116 ARG E CA    1 
ATOM   9591  C  C     . ARG G 3  116 ? -13.520 -22.312 74.401 1.00 43.12  ? 116 ARG E C     1 
ATOM   9592  O  O     . ARG G 3  116 ? -13.731 -21.371 73.668 1.00 43.90  ? 116 ARG E O     1 
ATOM   9593  C  CB    . ARG G 3  116 ? -14.673 -24.493 74.387 1.00 48.84  ? 116 ARG E CB    1 
ATOM   9594  C  CG    . ARG G 3  116 ? -15.647 -25.430 75.042 1.00 48.05  ? 116 ARG E CG    1 
ATOM   9595  C  CD    . ARG G 3  116 ? -15.481 -26.856 74.536 1.00 48.45  ? 116 ARG E CD    1 
ATOM   9596  N  NE    . ARG G 3  116 ? -16.324 -27.110 73.368 1.00 49.61  ? 116 ARG E NE    1 
ATOM   9597  C  CZ    . ARG G 3  116 ? -15.933 -27.178 72.096 1.00 46.70  ? 116 ARG E CZ    1 
ATOM   9598  N  NH1   . ARG G 3  116 ? -14.669 -27.036 71.745 1.00 46.84  ? 116 ARG E NH1   1 
ATOM   9599  N  NH2   . ARG G 3  116 ? -16.841 -27.422 71.158 1.00 47.01  ? 116 ARG E NH2   1 
ATOM   9600  N  N     . VAL G 3  117 ? -12.293 -22.700 74.723 1.00 44.67  ? 117 VAL E N     1 
ATOM   9601  C  CA    . VAL G 3  117 ? -11.105 -22.158 74.059 1.00 43.82  ? 117 VAL E CA    1 
ATOM   9602  C  C     . VAL G 3  117 ? -10.279 -23.257 73.393 1.00 44.96  ? 117 VAL E C     1 
ATOM   9603  O  O     . VAL G 3  117 ? -9.167  -23.023 72.895 1.00 44.50  ? 117 VAL E O     1 
ATOM   9604  C  CB    . VAL G 3  117 ? -10.247 -21.365 75.057 1.00 42.16  ? 117 VAL E CB    1 
ATOM   9605  C  CG1   . VAL G 3  117 ? -11.116 -20.340 75.769 1.00 44.23  ? 117 VAL E CG1   1 
ATOM   9606  C  CG2   . VAL G 3  117 ? -9.618  -22.285 76.076 1.00 43.74  ? 117 VAL E CG2   1 
ATOM   9607  N  N     . THR G 3  118 ? -10.854 -24.443 73.333 1.00 45.61  ? 118 THR E N     1 
ATOM   9608  C  CA    . THR G 3  118 ? -10.142 -25.620 72.912 1.00 49.51  ? 118 THR E CA    1 
ATOM   9609  C  C     . THR G 3  118 ? -10.836 -26.220 71.707 1.00 45.90  ? 118 THR E C     1 
ATOM   9610  O  O     . THR G 3  118 ? -11.953 -26.715 71.806 1.00 47.63  ? 118 THR E O     1 
ATOM   9611  C  CB    . THR G 3  118 ? -10.172 -26.597 74.078 1.00 50.90  ? 118 THR E CB    1 
ATOM   9612  O  OG1   . THR G 3  118 ? -9.859  -25.850 75.257 1.00 54.32  ? 118 THR E OG1   1 
ATOM   9613  C  CG2   . THR G 3  118 ? -9.190  -27.726 73.858 1.00 51.46  ? 118 THR E CG2   1 
ATOM   9614  N  N     . ILE G 3  119 ? -10.195 -26.191 70.563 1.00 42.63  ? 119 ILE E N     1 
ATOM   9615  C  CA    . ILE G 3  119 ? -10.817 -26.827 69.409 1.00 42.53  ? 119 ILE E CA    1 
ATOM   9616  C  C     . ILE G 3  119 ? -10.887 -28.357 69.533 1.00 42.30  ? 119 ILE E C     1 
ATOM   9617  O  O     . ILE G 3  119 ? -9.952  -29.018 69.982 1.00 37.72  ? 119 ILE E O     1 
ATOM   9618  C  CB    . ILE G 3  119 ? -10.156 -26.434 68.110 1.00 42.95  ? 119 ILE E CB    1 
ATOM   9619  C  CG1   . ILE G 3  119 ? -8.664  -26.741 68.128 1.00 45.86  ? 119 ILE E CG1   1 
ATOM   9620  C  CG2   . ILE G 3  119 ? -10.320 -24.944 67.898 1.00 50.83  ? 119 ILE E CG2   1 
ATOM   9621  C  CD1   . ILE G 3  119 ? -8.061  -26.701 66.733 1.00 44.53  ? 119 ILE E CD1   1 
ATOM   9622  N  N     . MET G 3  120 ? -12.027 -28.899 69.128 1.00 44.97  ? 120 MET E N     1 
ATOM   9623  C  CA    . MET G 3  120 ? -12.290 -30.318 69.185 1.00 43.23  ? 120 MET E CA    1 
ATOM   9624  C  C     . MET G 3  120 ? -12.794 -30.776 67.841 1.00 42.83  ? 120 MET E C     1 
ATOM   9625  O  O     . MET G 3  120 ? -13.215 -29.956 67.000 1.00 40.30  ? 120 MET E O     1 
ATOM   9626  C  CB    . MET G 3  120 ? -13.332 -30.575 70.244 1.00 45.94  ? 120 MET E CB    1 
ATOM   9627  C  CG    . MET G 3  120 ? -12.787 -30.245 71.613 1.00 52.62  ? 120 MET E CG    1 
ATOM   9628  S  SD    . MET G 3  120 ? -13.982 -30.274 72.942 1.00 58.67  ? 120 MET E SD    1 
ATOM   9629  C  CE    . MET G 3  120 ? -14.441 -32.017 72.922 1.00 64.25  ? 120 MET E CE    1 
ATOM   9630  N  N     . PRO G 3  121 ? -12.763 -32.082 67.622 1.00 39.76  ? 121 PRO E N     1 
ATOM   9631  C  CA    . PRO G 3  121 ? -13.231 -32.542 66.350 1.00 37.84  ? 121 PRO E CA    1 
ATOM   9632  C  C     . PRO G 3  121 ? -14.656 -32.084 66.080 1.00 39.37  ? 121 PRO E C     1 
ATOM   9633  O  O     . PRO G 3  121 ? -14.981 -31.636 64.973 1.00 45.48  ? 121 PRO E O     1 
ATOM   9634  C  CB    . PRO G 3  121 ? -13.097 -34.062 66.461 1.00 35.47  ? 121 PRO E CB    1 
ATOM   9635  C  CG    . PRO G 3  121 ? -11.947 -34.267 67.364 1.00 36.73  ? 121 PRO E CG    1 
ATOM   9636  C  CD    . PRO G 3  121 ? -12.046 -33.139 68.360 1.00 40.91  ? 121 PRO E CD    1 
ATOM   9637  N  N     . LYS G 3  122 ? -15.522 -32.183 67.056 1.00 41.86  ? 122 LYS E N     1 
ATOM   9638  C  CA    . LYS G 3  122 ? -16.882 -31.693 66.818 1.00 41.57  ? 122 LYS E CA    1 
ATOM   9639  C  C     . LYS G 3  122 ? -16.871 -30.284 66.229 1.00 39.24  ? 122 LYS E C     1 
ATOM   9640  O  O     . LYS G 3  122 ? -17.738 -29.969 65.472 1.00 45.44  ? 122 LYS E O     1 
ATOM   9641  C  CB    . LYS G 3  122 ? -17.722 -31.740 68.101 1.00 43.60  ? 122 LYS E CB    1 
ATOM   9642  C  CG    . LYS G 3  122 ? -17.184 -30.887 69.231 1.00 50.17  ? 122 LYS E CG    1 
ATOM   9643  C  CD    . LYS G 3  122 ? -17.698 -31.347 70.582 1.00 57.51  ? 122 LYS E CD    1 
ATOM   9644  C  CE    . LYS G 3  122 ? -19.184 -31.154 70.657 1.00 66.38  ? 122 LYS E CE    1 
ATOM   9645  N  NZ    . LYS G 3  122 ? -19.677 -31.441 72.025 1.00 77.33  ? 122 LYS E NZ    1 
ATOM   9646  N  N     . ASP G 3  123 ? -15.898 -29.439 66.541 1.00 37.70  ? 123 ASP E N     1 
ATOM   9647  C  CA    . ASP G 3  123 ? -15.878 -28.077 65.977 1.00 38.93  ? 123 ASP E CA    1 
ATOM   9648  C  C     . ASP G 3  123 ? -15.572 -28.141 64.491 1.00 40.17  ? 123 ASP E C     1 
ATOM   9649  O  O     . ASP G 3  123 ? -16.238 -27.516 63.683 1.00 43.50  ? 123 ASP E O     1 
ATOM   9650  C  CB    . ASP G 3  123 ? -14.877 -27.141 66.686 1.00 37.19  ? 123 ASP E CB    1 
ATOM   9651  C  CG    . ASP G 3  123 ? -15.122 -27.060 68.198 1.00 42.97  ? 123 ASP E CG    1 
ATOM   9652  O  OD1   . ASP G 3  123 ? -16.274 -26.808 68.614 1.00 43.62  ? 123 ASP E OD1   1 
ATOM   9653  O  OD2   . ASP G 3  123 ? -14.188 -27.312 68.988 1.00 40.11  ? 123 ASP E OD2   1 
ATOM   9654  N  N     . ILE G 3  124 ? -14.576 -28.924 64.122 1.00 40.95  ? 124 ILE E N     1 
ATOM   9655  C  CA    . ILE G 3  124 ? -14.181 -29.021 62.730 1.00 39.67  ? 124 ILE E CA    1 
ATOM   9656  C  C     . ILE G 3  124 ? -15.340 -29.546 61.917 1.00 44.69  ? 124 ILE E C     1 
ATOM   9657  O  O     . ILE G 3  124 ? -15.593 -29.076 60.833 1.00 47.33  ? 124 ILE E O     1 
ATOM   9658  C  CB    . ILE G 3  124 ? -13.025 -29.974 62.559 1.00 39.88  ? 124 ILE E CB    1 
ATOM   9659  C  CG1   . ILE G 3  124 ? -11.750 -29.356 63.145 1.00 44.69  ? 124 ILE E CG1   1 
ATOM   9660  C  CG2   . ILE G 3  124 ? -12.824 -30.286 61.095 1.00 41.91  ? 124 ILE E CG2   1 
ATOM   9661  C  CD1   . ILE G 3  124 ? -10.525 -30.278 63.096 1.00 44.32  ? 124 ILE E CD1   1 
ATOM   9662  N  N     . GLN G 3  125 ? -16.059 -30.505 62.477 1.00 46.13  ? 125 GLN E N     1 
ATOM   9663  C  CA    . GLN G 3  125 ? -17.144 -31.143 61.784 1.00 43.30  ? 125 GLN E CA    1 
ATOM   9664  C  C     . GLN G 3  125 ? -18.305 -30.188 61.611 1.00 43.38  ? 125 GLN E C     1 
ATOM   9665  O  O     . GLN G 3  125 ? -18.930 -30.143 60.555 1.00 43.10  ? 125 GLN E O     1 
ATOM   9666  C  CB    . GLN G 3  125 ? -17.559 -32.368 62.554 1.00 45.78  ? 125 GLN E CB    1 
ATOM   9667  C  CG    . GLN G 3  125 ? -16.431 -33.383 62.624 1.00 52.90  ? 125 GLN E CG    1 
ATOM   9668  C  CD    . GLN G 3  125 ? -16.658 -34.461 63.663 1.00 60.23  ? 125 GLN E CD    1 
ATOM   9669  O  OE1   . GLN G 3  125 ? -17.709 -34.521 64.293 1.00 66.52  ? 125 GLN E OE1   1 
ATOM   9670  N  NE2   . GLN G 3  125 ? -15.659 -35.316 63.858 1.00 67.35  ? 125 GLN E NE2   1 
ATOM   9671  N  N     . LEU G 3  126 ? -18.573 -29.368 62.611 1.00 39.84  ? 126 LEU E N     1 
ATOM   9672  C  CA    . LEU G 3  126 ? -19.672 -28.422 62.458 1.00 39.20  ? 126 LEU E CA    1 
ATOM   9673  C  C     . LEU G 3  126 ? -19.317 -27.415 61.362 1.00 40.21  ? 126 LEU E C     1 
ATOM   9674  O  O     . LEU G 3  126 ? -20.159 -27.071 60.544 1.00 38.97  ? 126 LEU E O     1 
ATOM   9675  C  CB    . LEU G 3  126 ? -19.931 -27.705 63.780 1.00 39.07  ? 126 LEU E CB    1 
ATOM   9676  C  CG    . LEU G 3  126 ? -21.020 -26.642 63.727 1.00 42.63  ? 126 LEU E CG    1 
ATOM   9677  C  CD1   . LEU G 3  126 ? -22.327 -27.314 63.392 1.00 39.27  ? 126 LEU E CD1   1 
ATOM   9678  C  CD2   . LEU G 3  126 ? -21.156 -25.885 65.052 1.00 47.19  ? 126 LEU E CD2   1 
ATOM   9679  N  N     . ALA G 3  127 ? -18.059 -26.957 61.351 1.00 39.51  ? 127 ALA E N     1 
ATOM   9680  C  CA    . ALA G 3  127 ? -17.558 -26.051 60.325 1.00 40.33  ? 127 ALA E CA    1 
ATOM   9681  C  C     . ALA G 3  127 ? -17.799 -26.632 58.953 1.00 42.73  ? 127 ALA E C     1 
ATOM   9682  O  O     . ALA G 3  127 ? -18.325 -25.976 58.046 1.00 40.40  ? 127 ALA E O     1 
ATOM   9683  C  CB    . ALA G 3  127 ? -16.075 -25.797 60.521 1.00 40.35  ? 127 ALA E CB    1 
ATOM   9684  N  N     . ARG G 3  128 ? -17.418 -27.890 58.807 1.00 45.00  ? 128 ARG E N     1 
ATOM   9685  C  CA    . ARG G 3  128 ? -17.482 -28.531 57.512 1.00 39.83  ? 128 ARG E CA    1 
ATOM   9686  C  C     . ARG G 3  128 ? -18.909 -28.805 57.086 1.00 41.89  ? 128 ARG E C     1 
ATOM   9687  O  O     . ARG G 3  128 ? -19.194 -28.725 55.914 1.00 38.65  ? 128 ARG E O     1 
ATOM   9688  C  CB    . ARG G 3  128 ? -16.646 -29.768 57.520 1.00 36.14  ? 128 ARG E CB    1 
ATOM   9689  C  CG    . ARG G 3  128 ? -15.156 -29.441 57.706 1.00 41.37  ? 128 ARG E CG    1 
ATOM   9690  C  CD    . ARG G 3  128 ? -14.240 -30.147 56.717 1.00 40.86  ? 128 ARG E CD    1 
ATOM   9691  N  NE    . ARG G 3  128 ? -14.466 -31.577 56.788 1.00 47.93  ? 128 ARG E NE    1 
ATOM   9692  C  CZ    . ARG G 3  128 ? -14.691 -32.386 55.761 1.00 48.25  ? 128 ARG E CZ    1 
ATOM   9693  N  NH1   . ARG G 3  128 ? -14.649 -31.968 54.510 1.00 53.64  ? 128 ARG E NH1   1 
ATOM   9694  N  NH2   . ARG G 3  128 ? -14.890 -33.648 56.009 1.00 54.35  ? 128 ARG E NH2   1 
ATOM   9695  N  N     . ARG G 3  129 ? -19.797 -29.123 58.033 1.00 41.92  ? 129 ARG E N     1 
ATOM   9696  C  CA    . ARG G 3  129 ? -21.227 -29.258 57.750 1.00 39.57  ? 129 ARG E CA    1 
ATOM   9697  C  C     . ARG G 3  129 ? -21.704 -27.872 57.299 1.00 43.50  ? 129 ARG E C     1 
ATOM   9698  O  O     . ARG G 3  129 ? -22.279 -27.734 56.244 1.00 41.69  ? 129 ARG E O     1 
ATOM   9699  C  CB    . ARG G 3  129 ? -21.985 -29.699 59.019 1.00 46.11  ? 129 ARG E CB    1 
ATOM   9700  C  CG    . ARG G 3  129 ? -23.297 -30.474 58.866 1.00 49.52  ? 129 ARG E CG    1 
ATOM   9701  C  CD    . ARG G 3  129 ? -24.084 -30.005 57.657 1.00 54.25  ? 129 ARG E CD    1 
ATOM   9702  N  NE    . ARG G 3  129 ? -25.506 -29.784 57.884 1.00 57.92  ? 129 ARG E NE    1 
ATOM   9703  C  CZ    . ARG G 3  129 ? -26.162 -28.699 57.444 1.00 63.02  ? 129 ARG E CZ    1 
ATOM   9704  N  NH1   . ARG G 3  129 ? -25.526 -27.735 56.773 1.00 63.03  ? 129 ARG E NH1   1 
ATOM   9705  N  NH2   . ARG G 3  129 ? -27.462 -28.550 57.675 1.00 64.40  ? 129 ARG E NH2   1 
ATOM   9706  N  N     . ILE G 3  130 ? -21.424 -26.811 58.049 1.00 44.95  ? 130 ILE E N     1 
ATOM   9707  C  CA    . ILE G 3  130 ? -21.985 -25.509 57.644 1.00 48.65  ? 130 ILE E CA    1 
ATOM   9708  C  C     . ILE G 3  130 ? -21.449 -24.950 56.327 1.00 48.60  ? 130 ILE E C     1 
ATOM   9709  O  O     . ILE G 3  130 ? -22.219 -24.503 55.487 1.00 56.49  ? 130 ILE E O     1 
ATOM   9710  C  CB    . ILE G 3  130 ? -21.861 -24.461 58.735 1.00 48.98  ? 130 ILE E CB    1 
ATOM   9711  C  CG1   . ILE G 3  130 ? -22.766 -24.854 59.913 1.00 56.15  ? 130 ILE E CG1   1 
ATOM   9712  C  CG2   . ILE G 3  130 ? -22.302 -23.121 58.197 1.00 45.30  ? 130 ILE E CG2   1 
ATOM   9713  C  CD1   . ILE G 3  130 ? -22.547 -24.014 61.144 1.00 57.75  ? 130 ILE E CD1   1 
ATOM   9714  N  N     . ARG G 3  131 ? -20.134 -24.966 56.173 1.00 48.78  ? 131 ARG E N     1 
ATOM   9715  C  CA    . ARG G 3  131 ? -19.443 -24.762 54.877 1.00 49.83  ? 131 ARG E CA    1 
ATOM   9716  C  C     . ARG G 3  131 ? -19.953 -25.484 53.616 1.00 50.74  ? 131 ARG E C     1 
ATOM   9717  O  O     . ARG G 3  131 ? -19.613 -25.047 52.520 1.00 49.89  ? 131 ARG E O     1 
ATOM   9718  C  CB    . ARG G 3  131 ? -18.006 -25.207 55.020 1.00 46.02  ? 131 ARG E CB    1 
ATOM   9719  C  CG    . ARG G 3  131 ? -17.149 -24.175 55.686 1.00 45.86  ? 131 ARG E CG    1 
ATOM   9720  C  CD    . ARG G 3  131 ? -15.745 -24.703 55.694 1.00 44.03  ? 131 ARG E CD    1 
ATOM   9721  N  NE    . ARG G 3  131 ? -14.797 -23.687 56.107 1.00 39.85  ? 131 ARG E NE    1 
ATOM   9722  C  CZ    . ARG G 3  131 ? -13.545 -23.671 55.663 1.00 42.62  ? 131 ARG E CZ    1 
ATOM   9723  N  NH1   . ARG G 3  131 ? -13.155 -24.589 54.795 1.00 43.33  ? 131 ARG E NH1   1 
ATOM   9724  N  NH2   . ARG G 3  131 ? -12.670 -22.733 56.049 1.00 43.29  ? 131 ARG E NH2   1 
ATOM   9725  N  N     . GLY G 3  132 ? -20.693 -26.594 53.774 1.00 47.76  ? 132 GLY E N     1 
ATOM   9726  C  CA    . GLY G 3  132 ? -21.215 -27.368 52.648 1.00 49.14  ? 132 GLY E CA    1 
ATOM   9727  C  C     . GLY G 3  132 ? -20.342 -28.532 52.221 1.00 54.76  ? 132 GLY E C     1 
ATOM   9728  O  O     . GLY G 3  132 ? -20.384 -28.943 51.087 1.00 71.76  ? 132 GLY E O     1 
ATOM   9729  N  N     . GLU G 3  133 ? -19.548 -29.051 53.138 1.00 58.97  ? 133 GLU E N     1 
ATOM   9730  C  CA    . GLU G 3  133 ? -18.583 -30.102 52.881 1.00 62.59  ? 133 GLU E CA    1 
ATOM   9731  C  C     . GLU G 3  133 ? -19.064 -31.320 53.697 1.00 67.95  ? 133 GLU E C     1 
ATOM   9732  O  O     . GLU G 3  133 ? -18.786 -32.470 53.363 1.00 71.85  ? 133 GLU E O     1 
ATOM   9733  C  CB    . GLU G 3  133 ? -17.142 -29.663 53.340 1.00 58.28  ? 133 GLU E CB    1 
ATOM   9734  C  CG    . GLU G 3  133 ? -16.545 -28.349 52.787 1.00 54.15  ? 133 GLU E CG    1 
ATOM   9735  C  CD    . GLU G 3  133 ? -15.132 -27.954 53.368 1.00 55.65  ? 133 GLU E CD    1 
ATOM   9736  O  OE1   . GLU G 3  133 ? -14.371 -28.803 53.918 1.00 47.49  ? 133 GLU E OE1   1 
ATOM   9737  O  OE2   . GLU G 3  133 ? -14.771 -26.756 53.301 1.00 41.16  ? 133 GLU E OE2   1 
ATOM   9738  N  N     . LYS H 4  16  ? 14.691  -47.304 35.121 1.00 147.38 ? 16  LYS F N     1 
ATOM   9739  C  CA    . LYS H 4  16  ? 14.590  -48.793 34.996 1.00 152.65 ? 16  LYS F CA    1 
ATOM   9740  C  C     . LYS H 4  16  ? 14.203  -49.496 36.307 1.00 154.33 ? 16  LYS F C     1 
ATOM   9741  O  O     . LYS H 4  16  ? 13.187  -50.195 36.344 1.00 148.70 ? 16  LYS F O     1 
ATOM   9742  C  CB    . LYS H 4  16  ? 15.891  -49.404 34.432 1.00 155.86 ? 16  LYS F CB    1 
ATOM   9743  C  CG    . LYS H 4  16  ? 17.181  -48.865 35.049 1.00 157.19 ? 16  LYS F CG    1 
ATOM   9744  C  CD    . LYS H 4  16  ? 18.128  -49.968 35.492 1.00 152.77 ? 16  LYS F CD    1 
ATOM   9745  C  CE    . LYS H 4  16  ? 19.186  -49.428 36.441 1.00 149.51 ? 16  LYS F CE    1 
ATOM   9746  N  NZ    . LYS H 4  16  ? 19.866  -50.528 37.173 1.00 154.95 ? 16  LYS F NZ    1 
ATOM   9747  N  N     . ARG H 4  17  ? 14.985  -49.295 37.376 1.00 152.43 ? 17  ARG F N     1 
ATOM   9748  C  CA    . ARG H 4  17  ? 14.954  -50.202 38.535 1.00 139.98 ? 17  ARG F CA    1 
ATOM   9749  C  C     . ARG H 4  17  ? 14.238  -49.745 39.820 1.00 126.39 ? 17  ARG F C     1 
ATOM   9750  O  O     . ARG H 4  17  ? 14.845  -49.635 40.887 1.00 121.81 ? 17  ARG F O     1 
ATOM   9751  C  CB    . ARG H 4  17  ? 16.370  -50.691 38.872 1.00 149.31 ? 17  ARG F CB    1 
ATOM   9752  C  CG    . ARG H 4  17  ? 17.308  -49.658 39.487 1.00 155.07 ? 17  ARG F CG    1 
ATOM   9753  C  CD    . ARG H 4  17  ? 18.401  -50.344 40.299 1.00 155.66 ? 17  ARG F CD    1 
ATOM   9754  N  NE    . ARG H 4  17  ? 19.255  -49.381 40.985 1.00 145.11 ? 17  ARG F NE    1 
ATOM   9755  C  CZ    . ARG H 4  17  ? 18.904  -48.701 42.072 1.00 133.62 ? 17  ARG F CZ    1 
ATOM   9756  N  NH1   . ARG H 4  17  ? 17.700  -48.862 42.618 1.00 133.61 ? 17  ARG F NH1   1 
ATOM   9757  N  NH2   . ARG H 4  17  ? 19.763  -47.847 42.613 1.00 129.37 ? 17  ARG F NH2   1 
ATOM   9758  N  N     . HIS H 4  18  ? 12.944  -49.479 39.704 1.00 109.09 ? 18  HIS F N     1 
ATOM   9759  C  CA    . HIS H 4  18  ? 12.004  -49.788 40.781 1.00 112.66 ? 18  HIS F CA    1 
ATOM   9760  C  C     . HIS H 4  18  ? 11.892  -48.823 41.956 1.00 107.22 ? 18  HIS F C     1 
ATOM   9761  O  O     . HIS H 4  18  ? 12.716  -48.791 42.877 1.00 101.57 ? 18  HIS F O     1 
ATOM   9762  C  CB    . HIS H 4  18  ? 12.275  -51.204 41.313 1.00 125.35 ? 18  HIS F CB    1 
ATOM   9763  C  CG    . HIS H 4  18  ? 11.195  -51.734 42.198 1.00 124.19 ? 18  HIS F CG    1 
ATOM   9764  N  ND1   . HIS H 4  18  ? 9.871   -51.371 42.058 1.00 111.91 ? 18  HIS F ND1   1 
ATOM   9765  C  CD2   . HIS H 4  18  ? 11.243  -52.609 43.231 1.00 127.47 ? 18  HIS F CD2   1 
ATOM   9766  C  CE1   . HIS H 4  18  ? 9.154   -51.993 42.974 1.00 122.81 ? 18  HIS F CE1   1 
ATOM   9767  N  NE2   . HIS H 4  18  ? 9.960   -52.754 43.694 1.00 126.95 ? 18  HIS F NE2   1 
ATOM   9768  N  N     . ARG H 4  19  ? 10.782  -48.104 41.940 1.00 104.57 ? 19  ARG F N     1 
ATOM   9769  C  CA    . ARG H 4  19  ? 10.538  -47.006 42.842 1.00 105.87 ? 19  ARG F CA    1 
ATOM   9770  C  C     . ARG H 4  19  ? 10.034  -47.550 44.186 1.00 86.62  ? 19  ARG F C     1 
ATOM   9771  O  O     . ARG H 4  19  ? 9.091   -48.322 44.219 1.00 96.61  ? 19  ARG F O     1 
ATOM   9772  C  CB    . ARG H 4  19  ? 9.509   -46.093 42.159 1.00 122.91 ? 19  ARG F CB    1 
ATOM   9773  C  CG    . ARG H 4  19  ? 9.441   -44.685 42.698 1.00 130.99 ? 19  ARG F CG    1 
ATOM   9774  C  CD    . ARG H 4  19  ? 8.558   -44.650 43.927 1.00 140.64 ? 19  ARG F CD    1 
ATOM   9775  N  NE    . ARG H 4  19  ? 8.638   -43.354 44.571 1.00 153.76 ? 19  ARG F NE    1 
ATOM   9776  C  CZ    . ARG H 4  19  ? 8.044   -42.249 44.124 1.00 152.80 ? 19  ARG F CZ    1 
ATOM   9777  N  NH1   . ARG H 4  19  ? 7.301   -42.261 43.017 1.00 151.18 ? 19  ARG F NH1   1 
ATOM   9778  N  NH2   . ARG H 4  19  ? 8.197   -41.117 44.796 1.00 142.56 ? 19  ARG F NH2   1 
ATOM   9779  N  N     . LYS H 4  20  ? 10.658  -47.151 45.285 1.00 69.95  ? 20  LYS F N     1 
ATOM   9780  C  CA    . LYS H 4  20  ? 10.278  -47.631 46.631 1.00 67.55  ? 20  LYS F CA    1 
ATOM   9781  C  C     . LYS H 4  20  ? 8.778   -47.456 47.042 1.00 69.46  ? 20  LYS F C     1 
ATOM   9782  O  O     . LYS H 4  20  ? 8.041   -46.587 46.544 1.00 69.30  ? 20  LYS F O     1 
ATOM   9783  C  CB    . LYS H 4  20  ? 11.188  -46.948 47.649 1.00 75.83  ? 20  LYS F CB    1 
ATOM   9784  C  CG    . LYS H 4  20  ? 10.643  -46.769 49.063 1.00 80.74  ? 20  LYS F CG    1 
ATOM   9785  C  CD    . LYS H 4  20  ? 10.787  -47.999 49.937 1.00 76.21  ? 20  LYS F CD    1 
ATOM   9786  C  CE    . LYS H 4  20  ? 11.282  -47.614 51.319 1.00 80.93  ? 20  LYS F CE    1 
ATOM   9787  N  NZ    . LYS H 4  20  ? 10.190  -47.063 52.174 1.00 83.76  ? 20  LYS F NZ    1 
ATOM   9788  N  N     . VAL H 4  21  ? 8.318   -48.304 47.952 1.00 65.52  ? 21  VAL F N     1 
ATOM   9789  C  CA    . VAL H 4  21  ? 6.893   -48.345 48.280 1.00 62.31  ? 21  VAL F CA    1 
ATOM   9790  C  C     . VAL H 4  21  ? 6.524   -47.141 49.122 1.00 65.57  ? 21  VAL F C     1 
ATOM   9791  O  O     . VAL H 4  21  ? 7.271   -46.765 50.029 1.00 70.35  ? 21  VAL F O     1 
ATOM   9792  C  CB    . VAL H 4  21  ? 6.495   -49.601 49.080 1.00 56.23  ? 21  VAL F CB    1 
ATOM   9793  C  CG1   . VAL H 4  21  ? 5.022   -49.590 49.372 1.00 58.84  ? 21  VAL F CG1   1 
ATOM   9794  C  CG2   . VAL H 4  21  ? 6.826   -50.851 48.317 1.00 63.56  ? 21  VAL F CG2   1 
ATOM   9795  N  N     . LEU H 4  22  ? 5.334   -46.602 48.846 1.00 59.96  ? 22  LEU F N     1 
ATOM   9796  C  CA    . LEU H 4  22  ? 4.788   -45.459 49.547 1.00 56.72  ? 22  LEU F CA    1 
ATOM   9797  C  C     . LEU H 4  22  ? 3.640   -45.870 50.418 1.00 54.54  ? 22  LEU F C     1 
ATOM   9798  O  O     . LEU H 4  22  ? 2.598   -46.342 49.930 1.00 51.63  ? 22  LEU F O     1 
ATOM   9799  C  CB    . LEU H 4  22  ? 4.273   -44.440 48.540 1.00 58.03  ? 22  LEU F CB    1 
ATOM   9800  C  CG    . LEU H 4  22  ? 5.425   -43.825 47.766 1.00 59.31  ? 22  LEU F CG    1 
ATOM   9801  C  CD1   . LEU H 4  22  ? 4.961   -42.915 46.654 1.00 56.11  ? 22  LEU F CD1   1 
ATOM   9802  C  CD2   . LEU H 4  22  ? 6.333   -43.076 48.740 1.00 64.56  ? 22  LEU F CD2   1 
ATOM   9803  N  N     . ARG H 4  23  ? 3.798   -45.645 51.711 1.00 51.11  ? 23  ARG F N     1 
ATOM   9804  C  CA    . ARG H 4  23  ? 2.720   -45.947 52.621 1.00 52.44  ? 23  ARG F CA    1 
ATOM   9805  C  C     . ARG H 4  23  ? 2.736   -45.050 53.813 1.00 51.89  ? 23  ARG F C     1 
ATOM   9806  O  O     . ARG H 4  23  ? 3.795   -44.755 54.338 1.00 54.12  ? 23  ARG F O     1 
ATOM   9807  C  CB    . ARG H 4  23  ? 2.804   -47.397 53.099 1.00 55.63  ? 23  ARG F CB    1 
ATOM   9808  C  CG    . ARG H 4  23  ? 4.220   -47.879 53.355 1.00 60.17  ? 23  ARG F CG    1 
ATOM   9809  C  CD    . ARG H 4  23  ? 4.320   -49.396 53.209 1.00 55.46  ? 23  ARG F CD    1 
ATOM   9810  N  NE    . ARG H 4  23  ? 3.890   -50.021 54.442 1.00 50.46  ? 23  ARG F NE    1 
ATOM   9811  C  CZ    . ARG H 4  23  ? 4.717   -50.390 55.407 1.00 49.79  ? 23  ARG F CZ    1 
ATOM   9812  N  NH1   . ARG H 4  23  ? 6.055   -50.227 55.299 1.00 48.19  ? 23  ARG F NH1   1 
ATOM   9813  N  NH2   . ARG H 4  23  ? 4.192   -50.906 56.497 1.00 48.23  ? 23  ARG F NH2   1 
ATOM   9814  N  N     . ASP H 4  24  ? 1.544   -44.645 54.259 1.00 53.30  ? 24  ASP F N     1 
ATOM   9815  C  CA    . ASP H 4  24  ? 1.393   -43.978 55.556 1.00 51.24  ? 24  ASP F CA    1 
ATOM   9816  C  C     . ASP H 4  24  ? 2.022   -42.593 55.613 1.00 51.88  ? 24  ASP F C     1 
ATOM   9817  O  O     . ASP H 4  24  ? 2.291   -42.075 56.712 1.00 43.17  ? 24  ASP F O     1 
ATOM   9818  C  CB    . ASP H 4  24  ? 2.005   -44.813 56.666 1.00 49.11  ? 24  ASP F CB    1 
ATOM   9819  C  CG    . ASP H 4  24  ? 1.293   -44.622 57.974 1.00 56.37  ? 24  ASP F CG    1 
ATOM   9820  O  OD1   . ASP H 4  24  ? 0.030   -44.641 57.940 1.00 57.19  ? 24  ASP F OD1   1 
ATOM   9821  O  OD2   . ASP H 4  24  ? 1.983   -44.475 59.017 1.00 53.28  ? 24  ASP F OD2   1 
ATOM   9822  N  N     . ASN H 4  25  ? 2.232   -41.983 54.446 1.00 47.56  ? 25  ASN F N     1 
ATOM   9823  C  CA    . ASN H 4  25  ? 2.899   -40.719 54.415 1.00 48.19  ? 25  ASN F CA    1 
ATOM   9824  C  C     . ASN H 4  25  ? 2.081   -39.619 55.065 1.00 47.77  ? 25  ASN F C     1 
ATOM   9825  O  O     . ASN H 4  25  ? 2.635   -38.681 55.550 1.00 57.20  ? 25  ASN F O     1 
ATOM   9826  C  CB    . ASN H 4  25  ? 3.257   -40.358 53.014 1.00 49.16  ? 25  ASN F CB    1 
ATOM   9827  C  CG    . ASN H 4  25  ? 4.407   -41.173 52.516 1.00 53.30  ? 25  ASN F CG    1 
ATOM   9828  O  OD1   . ASN H 4  25  ? 5.557   -40.932 52.892 1.00 51.44  ? 25  ASN F OD1   1 
ATOM   9829  N  ND2   . ASN H 4  25  ? 4.114   -42.173 51.689 1.00 60.96  ? 25  ASN F ND2   1 
ATOM   9830  N  N     . ILE H 4  26  ? 0.775   -39.783 55.137 1.00 50.17  ? 26  ILE F N     1 
ATOM   9831  C  CA    . ILE H 4  26  ? -0.089  -38.935 55.949 1.00 48.04  ? 26  ILE F CA    1 
ATOM   9832  C  C     . ILE H 4  26  ? 0.474   -38.589 57.319 1.00 48.03  ? 26  ILE F C     1 
ATOM   9833  O  O     . ILE H 4  26  ? 0.110   -37.568 57.858 1.00 56.57  ? 26  ILE F O     1 
ATOM   9834  C  CB    . ILE H 4  26  ? -1.481  -39.610 56.146 1.00 49.72  ? 26  ILE F CB    1 
ATOM   9835  C  CG1   . ILE H 4  26  ? -2.538  -38.646 56.684 1.00 51.15  ? 26  ILE F CG1   1 
ATOM   9836  C  CG2   . ILE H 4  26  ? -1.375  -40.772 57.106 1.00 54.02  ? 26  ILE F CG2   1 
ATOM   9837  C  CD1   . ILE H 4  26  ? -2.693  -37.374 55.874 1.00 51.78  ? 26  ILE F CD1   1 
ATOM   9838  N  N     . GLN H 4  27  ? 1.332   -39.427 57.897 1.00 51.17  ? 27  GLN F N     1 
ATOM   9839  C  CA    . GLN H 4  27  ? 1.888   -39.169 59.249 1.00 51.85  ? 27  GLN F CA    1 
ATOM   9840  C  C     . GLN H 4  27  ? 3.105   -38.233 59.199 1.00 48.45  ? 27  GLN F C     1 
ATOM   9841  O  O     . GLN H 4  27  ? 3.663   -37.838 60.239 1.00 47.37  ? 27  GLN F O     1 
ATOM   9842  C  CB    . GLN H 4  27  ? 2.266   -40.492 59.946 1.00 52.38  ? 27  GLN F CB    1 
ATOM   9843  C  CG    . GLN H 4  27  ? 1.082   -41.385 60.240 1.00 52.79  ? 27  GLN F CG    1 
ATOM   9844  C  CD    . GLN H 4  27  ? 0.209   -40.874 61.380 1.00 53.84  ? 27  GLN F CD    1 
ATOM   9845  O  OE1   . GLN H 4  27  ? 0.702   -40.346 62.386 1.00 53.35  ? 27  GLN F OE1   1 
ATOM   9846  N  NE2   . GLN H 4  27  ? -1.105  -41.053 61.237 1.00 53.04  ? 27  GLN F NE2   1 
ATOM   9847  N  N     . GLY H 4  28  ? 3.537   -37.901 57.992 1.00 44.13  ? 28  GLY F N     1 
ATOM   9848  C  CA    . GLY H 4  28  ? 4.518   -36.841 57.813 1.00 50.84  ? 28  GLY F CA    1 
ATOM   9849  C  C     . GLY H 4  28  ? 3.917   -35.469 58.088 1.00 56.86  ? 28  GLY F C     1 
ATOM   9850  O  O     . GLY H 4  28  ? 4.634   -34.457 58.132 1.00 56.12  ? 28  GLY F O     1 
ATOM   9851  N  N     . ILE H 4  29  ? 2.589   -35.437 58.227 1.00 57.33  ? 29  ILE F N     1 
ATOM   9852  C  CA    . ILE H 4  29  ? 1.881   -34.248 58.659 1.00 50.32  ? 29  ILE F CA    1 
ATOM   9853  C  C     . ILE H 4  29  ? 1.888   -34.316 60.170 1.00 48.78  ? 29  ILE F C     1 
ATOM   9854  O  O     . ILE H 4  29  ? 0.953   -34.814 60.826 1.00 44.36  ? 29  ILE F O     1 
ATOM   9855  C  CB    . ILE H 4  29  ? 0.450   -34.200 58.118 1.00 50.40  ? 29  ILE F CB    1 
ATOM   9856  C  CG1   . ILE H 4  29  ? 0.401   -34.465 56.606 1.00 53.58  ? 29  ILE F CG1   1 
ATOM   9857  C  CG2   . ILE H 4  29  ? -0.156  -32.850 58.404 1.00 52.79  ? 29  ILE F CG2   1 
ATOM   9858  C  CD1   . ILE H 4  29  ? 1.248   -33.531 55.768 1.00 49.19  ? 29  ILE F CD1   1 
ATOM   9859  N  N     . THR H 4  30  ? 2.974   -33.800 60.719 1.00 49.04  ? 30  THR F N     1 
ATOM   9860  C  CA    . THR H 4  30  ? 3.288   -33.970 62.136 1.00 50.91  ? 30  THR F CA    1 
ATOM   9861  C  C     . THR H 4  30  ? 2.445   -33.158 63.075 1.00 48.87  ? 30  THR F C     1 
ATOM   9862  O  O     . THR H 4  30  ? 1.899   -32.132 62.718 1.00 51.79  ? 30  THR F O     1 
ATOM   9863  C  CB    . THR H 4  30  ? 4.760   -33.618 62.385 1.00 51.21  ? 30  THR F CB    1 
ATOM   9864  O  OG1   . THR H 4  30  ? 5.008   -32.267 61.986 1.00 55.22  ? 30  THR F OG1   1 
ATOM   9865  C  CG2   . THR H 4  30  ? 5.659   -34.555 61.574 1.00 49.80  ? 30  THR F CG2   1 
ATOM   9866  N  N     . LYS H 4  31  ? 2.380   -33.612 64.312 1.00 51.44  ? 31  LYS F N     1 
ATOM   9867  C  CA    . LYS H 4  31  ? 1.716   -32.850 65.362 1.00 50.72  ? 31  LYS F CA    1 
ATOM   9868  C  C     . LYS H 4  31  ? 2.191   -31.390 65.447 1.00 49.11  ? 31  LYS F C     1 
ATOM   9869  O  O     . LYS H 4  31  ? 1.381   -30.502 65.463 1.00 55.95  ? 31  LYS F O     1 
ATOM   9870  C  CB    . LYS H 4  31  ? 1.910   -33.545 66.686 1.00 50.45  ? 31  LYS F CB    1 
ATOM   9871  C  CG    . LYS H 4  31  ? 1.181   -32.867 67.814 1.00 54.81  ? 31  LYS F CG    1 
ATOM   9872  C  CD    . LYS H 4  31  ? 1.565   -33.487 69.141 1.00 53.40  ? 31  LYS F CD    1 
ATOM   9873  C  CE    . LYS H 4  31  ? 1.041   -32.608 70.256 1.00 57.53  ? 31  LYS F CE    1 
ATOM   9874  N  NZ    . LYS H 4  31  ? 1.623   -33.078 71.532 1.00 59.44  ? 31  LYS F NZ    1 
ATOM   9875  N  N     . PRO H 4  32  ? 3.508   -31.144 65.490 1.00 47.88  ? 32  PRO F N     1 
ATOM   9876  C  CA    . PRO H 4  32  ? 4.034   -29.787 65.418 1.00 49.07  ? 32  PRO F CA    1 
ATOM   9877  C  C     . PRO H 4  32  ? 3.546   -28.962 64.227 1.00 51.85  ? 32  PRO F C     1 
ATOM   9878  O  O     . PRO H 4  32  ? 3.233   -27.781 64.379 1.00 47.36  ? 32  PRO F O     1 
ATOM   9879  C  CB    . PRO H 4  32  ? 5.529   -30.026 65.226 1.00 51.49  ? 32  PRO F CB    1 
ATOM   9880  C  CG    . PRO H 4  32  ? 5.772   -31.335 65.868 1.00 50.11  ? 32  PRO F CG    1 
ATOM   9881  C  CD    . PRO H 4  32  ? 4.596   -32.132 65.501 1.00 49.20  ? 32  PRO F CD    1 
ATOM   9882  N  N     . ALA H 4  33  ? 3.545   -29.560 63.040 1.00 46.52  ? 33  ALA F N     1 
ATOM   9883  C  CA    . ALA H 4  33  ? 3.253   -28.784 61.850 1.00 45.76  ? 33  ALA F CA    1 
ATOM   9884  C  C     . ALA H 4  33  ? 1.769   -28.380 61.788 1.00 49.20  ? 33  ALA F C     1 
ATOM   9885  O  O     . ALA H 4  33  ? 1.423   -27.324 61.281 1.00 52.66  ? 33  ALA F O     1 
ATOM   9886  C  CB    . ALA H 4  33  ? 3.631   -29.571 60.629 1.00 41.03  ? 33  ALA F CB    1 
ATOM   9887  N  N     . ILE H 4  34  ? 0.904   -29.242 62.301 1.00 49.64  ? 34  ILE F N     1 
ATOM   9888  C  CA    . ILE H 4  34  ? -0.531  -28.994 62.383 1.00 45.68  ? 34  ILE F CA    1 
ATOM   9889  C  C     . ILE H 4  34  ? -0.768  -27.942 63.423 1.00 46.18  ? 34  ILE F C     1 
ATOM   9890  O  O     . ILE H 4  34  ? -1.583  -27.083 63.291 1.00 50.88  ? 34  ILE F O     1 
ATOM   9891  C  CB    . ILE H 4  34  ? -1.286  -30.251 62.873 1.00 45.13  ? 34  ILE F CB    1 
ATOM   9892  C  CG1   . ILE H 4  34  ? -1.090  -31.409 61.877 1.00 45.41  ? 34  ILE F CG1   1 
ATOM   9893  C  CG2   . ILE H 4  34  ? -2.773  -29.976 63.008 1.00 42.70  ? 34  ILE F CG2   1 
ATOM   9894  C  CD1   . ILE H 4  34  ? -1.931  -32.613 62.184 1.00 44.20  ? 34  ILE F CD1   1 
ATOM   9895  N  N     . ARG H 4  35  ? -0.051  -28.029 64.500 1.00 49.76  ? 35  ARG F N     1 
ATOM   9896  C  CA    . ARG H 4  35  ? -0.184  -27.041 65.544 1.00 48.85  ? 35  ARG F CA    1 
ATOM   9897  C  C     . ARG H 4  35  ? 0.244   -25.652 64.980 1.00 45.93  ? 35  ARG F C     1 
ATOM   9898  O  O     . ARG H 4  35  ? -0.461  -24.685 65.154 1.00 47.43  ? 35  ARG F O     1 
ATOM   9899  C  CB    . ARG H 4  35  ? 0.580   -27.584 66.749 1.00 49.57  ? 35  ARG F CB    1 
ATOM   9900  C  CG    . ARG H 4  35  ? 1.034   -26.616 67.815 1.00 62.72  ? 35  ARG F CG    1 
ATOM   9901  C  CD    . ARG H 4  35  ? 1.671   -27.440 68.944 1.00 63.79  ? 35  ARG F CD    1 
ATOM   9902  N  NE    . ARG H 4  35  ? 0.671   -28.242 69.640 1.00 57.78  ? 35  ARG F NE    1 
ATOM   9903  C  CZ    . ARG H 4  35  ? 0.209   -27.975 70.869 1.00 69.43  ? 35  ARG F CZ    1 
ATOM   9904  N  NH1   . ARG H 4  35  ? 0.682   -26.969 71.601 1.00 59.69  ? 35  ARG F NH1   1 
ATOM   9905  N  NH2   . ARG H 4  35  ? -0.724  -28.755 71.407 1.00 88.21  ? 35  ARG F NH2   1 
ATOM   9906  N  N     . ARG H 4  36  ? 1.309   -25.566 64.194 1.00 44.49  ? 36  ARG F N     1 
ATOM   9907  C  CA    . ARG H 4  36  ? 1.649   -24.304 63.535 1.00 42.00  ? 36  ARG F CA    1 
ATOM   9908  C  C     . ARG H 4  36  ? 0.506   -23.764 62.688 1.00 43.54  ? 36  ARG F C     1 
ATOM   9909  O  O     . ARG H 4  36  ? 0.181   -22.575 62.730 1.00 44.62  ? 36  ARG F O     1 
ATOM   9910  C  CB    . ARG H 4  36  ? 2.904   -24.447 62.675 1.00 46.46  ? 36  ARG F CB    1 
ATOM   9911  C  CG    . ARG H 4  36  ? 4.208   -24.541 63.496 1.00 51.35  ? 36  ARG F CG    1 
ATOM   9912  C  CD    . ARG H 4  36  ? 5.486   -24.381 62.637 1.00 52.95  ? 36  ARG F CD    1 
ATOM   9913  N  NE    . ARG H 4  36  ? 5.772   -25.491 61.699 1.00 53.97  ? 36  ARG F NE    1 
ATOM   9914  C  CZ    . ARG H 4  36  ? 6.381   -26.641 62.026 1.00 58.33  ? 36  ARG F CZ    1 
ATOM   9915  N  NH1   . ARG H 4  36  ? 6.765   -26.880 63.282 1.00 68.92  ? 36  ARG F NH1   1 
ATOM   9916  N  NH2   . ARG H 4  36  ? 6.605   -27.574 61.110 1.00 51.89  ? 36  ARG F NH2   1 
ATOM   9917  N  N     . LEU H 4  37  ? -0.124  -24.632 61.910 1.00 41.84  ? 37  LEU F N     1 
ATOM   9918  C  CA    . LEU H 4  37  ? -1.253  -24.196 61.101 1.00 38.31  ? 37  LEU F CA    1 
ATOM   9919  C  C     . LEU H 4  37  ? -2.411  -23.625 61.946 1.00 37.94  ? 37  LEU F C     1 
ATOM   9920  O  O     . LEU H 4  37  ? -2.977  -22.581 61.645 1.00 38.01  ? 37  LEU F O     1 
ATOM   9921  C  CB    . LEU H 4  37  ? -1.739  -25.357 60.267 1.00 34.08  ? 37  LEU F CB    1 
ATOM   9922  C  CG    . LEU H 4  37  ? -0.863  -25.705 59.084 1.00 32.63  ? 37  LEU F CG    1 
ATOM   9923  C  CD1   . LEU H 4  37  ? -1.295  -27.064 58.571 1.00 33.61  ? 37  LEU F CD1   1 
ATOM   9924  C  CD2   . LEU H 4  37  ? -0.978  -24.726 57.929 1.00 32.63  ? 37  LEU F CD2   1 
ATOM   9925  N  N     . ALA H 4  38  ? -2.741  -24.321 63.012 1.00 36.49  ? 38  ALA F N     1 
ATOM   9926  C  CA    . ALA H 4  38  ? -3.737  -23.868 63.936 1.00 39.59  ? 38  ALA F CA    1 
ATOM   9927  C  C     . ALA H 4  38  ? -3.458  -22.473 64.455 1.00 40.63  ? 38  ALA F C     1 
ATOM   9928  O  O     . ALA H 4  38  ? -4.415  -21.692 64.652 1.00 36.50  ? 38  ALA F O     1 
ATOM   9929  C  CB    . ALA H 4  38  ? -3.803  -24.813 65.124 1.00 42.43  ? 38  ALA F CB    1 
ATOM   9930  N  N     . ARG H 4  39  ? -2.170  -22.205 64.729 1.00 40.70  ? 39  ARG F N     1 
ATOM   9931  C  CA    . ARG H 4  39  ? -1.691  -20.931 65.261 1.00 40.10  ? 39  ARG F CA    1 
ATOM   9932  C  C     . ARG H 4  39  ? -1.904  -19.831 64.244 1.00 41.67  ? 39  AR