data_5CRX
# 
_entry.id   5CRX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5CRX         
NDB   PD0048       
RCSB  RCSB000910   
WWPDB D_1000000910 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5CRX 
_pdbx_database_status.recvd_initial_deposition_date   1999-04-21 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guo, F.'         1 
'Gopaul, D.N.'    2 
'Van Duyne, G.D.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Asymmetric DNA bending in the Cre-loxP site-specific recombination synapse.'               Proc.Natl.Acad.Sci.USA 96  
7143 7148 1999 PNASA6 US 0027-8424 0040 ? 10377382 10.1073/pnas.96.13.7143  
1       'Structure of the Holliday junction intermediate in Cre-loxP site-specific recombination.'  'Embo J.'              17  
4175 4187 1998 EMJODG UK 0261-4189 0897 ? 9670032  10.1093/emboj/17.14.4175 
2       'Structure of Cre recombinase complexed with DNA in a site-specific recombination synapse.' Nature                 389 40 
46   1997 NATUAS UK 0028-0836 0006 ? 9288963  10.1038/37925            
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Guo, F.'         1 ? 
primary 'Gopaul, D.N.'    2 ? 
primary 'Van Duyne, G.D.' 3 ? 
1       'Gopaul, D.N.'    4 ? 
1       'Guo, F.'         5 ? 
1       'Van Duyne, G.D.' 6 ? 
2       'Guo, F.'         7 ? 
2       'Gopaul, D.N.'    8 ? 
2       'van Duyne, G.D.' 9 ? 
# 
_cell.entry_id           5CRX 
_cell.length_a           107.100 
_cell.length_b           123.100 
_cell.length_c           180.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         5CRX 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'DNA (35-MER)'                        10759.968 2   ? ?     ? ? 
2 polymer man 'PROTEIN (BACTERIOPHAGE P1 CRE GENE)' 38579.164 2   ? Y324F ? ? 
3 water   nat water                                 18.015    314 ? ?     ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DC)(DT)(DT)(DC)(DG)(DT)(DA)(DT)(DA)(DG)(DC)(DA)(DT)(DA)(DT)
(DG)(DC)(DT)(DA)(DT)(DA)(DC)(DG)(DA)(DA)(DG)(DT)(DT)(DA)(DT)
;
TATAACTTCGTATAGCATATGCTATACGAAGTTAT C,D ? 
2 'polypeptide(L)'        no no 
;MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQA
RGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
LAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFC
RVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNFIRNLDSETGAMVRLLEDGD
;
;MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQA
RGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
LAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFC
RVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNFIRNLDSETGAMVRLLEDGD
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DA  n 
1 3   DT  n 
1 4   DA  n 
1 5   DA  n 
1 6   DC  n 
1 7   DT  n 
1 8   DT  n 
1 9   DC  n 
1 10  DG  n 
1 11  DT  n 
1 12  DA  n 
1 13  DT  n 
1 14  DA  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DT  n 
1 19  DA  n 
1 20  DT  n 
1 21  DG  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DT  n 
1 26  DA  n 
1 27  DC  n 
1 28  DG  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DT  n 
1 34  DA  n 
1 35  DT  n 
2 1   MET n 
2 2   SER n 
2 3   ASN n 
2 4   LEU n 
2 5   LEU n 
2 6   THR n 
2 7   VAL n 
2 8   HIS n 
2 9   GLN n 
2 10  ASN n 
2 11  LEU n 
2 12  PRO n 
2 13  ALA n 
2 14  LEU n 
2 15  PRO n 
2 16  VAL n 
2 17  ASP n 
2 18  ALA n 
2 19  THR n 
2 20  SER n 
2 21  ASP n 
2 22  GLU n 
2 23  VAL n 
2 24  ARG n 
2 25  LYS n 
2 26  ASN n 
2 27  LEU n 
2 28  MET n 
2 29  ASP n 
2 30  MET n 
2 31  PHE n 
2 32  ARG n 
2 33  ASP n 
2 34  ARG n 
2 35  GLN n 
2 36  ALA n 
2 37  PHE n 
2 38  SER n 
2 39  GLU n 
2 40  HIS n 
2 41  THR n 
2 42  TRP n 
2 43  LYS n 
2 44  MET n 
2 45  LEU n 
2 46  LEU n 
2 47  SER n 
2 48  VAL n 
2 49  CYS n 
2 50  ARG n 
2 51  SER n 
2 52  TRP n 
2 53  ALA n 
2 54  ALA n 
2 55  TRP n 
2 56  CYS n 
2 57  LYS n 
2 58  LEU n 
2 59  ASN n 
2 60  ASN n 
2 61  ARG n 
2 62  LYS n 
2 63  TRP n 
2 64  PHE n 
2 65  PRO n 
2 66  ALA n 
2 67  GLU n 
2 68  PRO n 
2 69  GLU n 
2 70  ASP n 
2 71  VAL n 
2 72  ARG n 
2 73  ASP n 
2 74  TYR n 
2 75  LEU n 
2 76  LEU n 
2 77  TYR n 
2 78  LEU n 
2 79  GLN n 
2 80  ALA n 
2 81  ARG n 
2 82  GLY n 
2 83  LEU n 
2 84  ALA n 
2 85  VAL n 
2 86  LYS n 
2 87  THR n 
2 88  ILE n 
2 89  GLN n 
2 90  GLN n 
2 91  HIS n 
2 92  LEU n 
2 93  GLY n 
2 94  GLN n 
2 95  LEU n 
2 96  ASN n 
2 97  MET n 
2 98  LEU n 
2 99  HIS n 
2 100 ARG n 
2 101 ARG n 
2 102 SER n 
2 103 GLY n 
2 104 LEU n 
2 105 PRO n 
2 106 ARG n 
2 107 PRO n 
2 108 SER n 
2 109 ASP n 
2 110 SER n 
2 111 ASN n 
2 112 ALA n 
2 113 VAL n 
2 114 SER n 
2 115 LEU n 
2 116 VAL n 
2 117 MET n 
2 118 ARG n 
2 119 ARG n 
2 120 ILE n 
2 121 ARG n 
2 122 LYS n 
2 123 GLU n 
2 124 ASN n 
2 125 VAL n 
2 126 ASP n 
2 127 ALA n 
2 128 GLY n 
2 129 GLU n 
2 130 ARG n 
2 131 ALA n 
2 132 LYS n 
2 133 GLN n 
2 134 ALA n 
2 135 LEU n 
2 136 ALA n 
2 137 PHE n 
2 138 GLU n 
2 139 ARG n 
2 140 THR n 
2 141 ASP n 
2 142 PHE n 
2 143 ASP n 
2 144 GLN n 
2 145 VAL n 
2 146 ARG n 
2 147 SER n 
2 148 LEU n 
2 149 MET n 
2 150 GLU n 
2 151 ASN n 
2 152 SER n 
2 153 ASP n 
2 154 ARG n 
2 155 CYS n 
2 156 GLN n 
2 157 ASP n 
2 158 ILE n 
2 159 ARG n 
2 160 ASN n 
2 161 LEU n 
2 162 ALA n 
2 163 PHE n 
2 164 LEU n 
2 165 GLY n 
2 166 ILE n 
2 167 ALA n 
2 168 TYR n 
2 169 ASN n 
2 170 THR n 
2 171 LEU n 
2 172 LEU n 
2 173 ARG n 
2 174 ILE n 
2 175 ALA n 
2 176 GLU n 
2 177 ILE n 
2 178 ALA n 
2 179 ARG n 
2 180 ILE n 
2 181 ARG n 
2 182 VAL n 
2 183 LYS n 
2 184 ASP n 
2 185 ILE n 
2 186 SER n 
2 187 ARG n 
2 188 THR n 
2 189 ASP n 
2 190 GLY n 
2 191 GLY n 
2 192 ARG n 
2 193 MET n 
2 194 LEU n 
2 195 ILE n 
2 196 HIS n 
2 197 ILE n 
2 198 GLY n 
2 199 ARG n 
2 200 THR n 
2 201 LYS n 
2 202 THR n 
2 203 LEU n 
2 204 VAL n 
2 205 SER n 
2 206 THR n 
2 207 ALA n 
2 208 GLY n 
2 209 VAL n 
2 210 GLU n 
2 211 LYS n 
2 212 ALA n 
2 213 LEU n 
2 214 SER n 
2 215 LEU n 
2 216 GLY n 
2 217 VAL n 
2 218 THR n 
2 219 LYS n 
2 220 LEU n 
2 221 VAL n 
2 222 GLU n 
2 223 ARG n 
2 224 TRP n 
2 225 ILE n 
2 226 SER n 
2 227 VAL n 
2 228 SER n 
2 229 GLY n 
2 230 VAL n 
2 231 ALA n 
2 232 ASP n 
2 233 ASP n 
2 234 PRO n 
2 235 ASN n 
2 236 ASN n 
2 237 TYR n 
2 238 LEU n 
2 239 PHE n 
2 240 CYS n 
2 241 ARG n 
2 242 VAL n 
2 243 ARG n 
2 244 LYS n 
2 245 ASN n 
2 246 GLY n 
2 247 VAL n 
2 248 ALA n 
2 249 ALA n 
2 250 PRO n 
2 251 SER n 
2 252 ALA n 
2 253 THR n 
2 254 SER n 
2 255 GLN n 
2 256 LEU n 
2 257 SER n 
2 258 THR n 
2 259 ARG n 
2 260 ALA n 
2 261 LEU n 
2 262 GLU n 
2 263 GLY n 
2 264 ILE n 
2 265 PHE n 
2 266 GLU n 
2 267 ALA n 
2 268 THR n 
2 269 HIS n 
2 270 ARG n 
2 271 LEU n 
2 272 ILE n 
2 273 TYR n 
2 274 GLY n 
2 275 ALA n 
2 276 LYS n 
2 277 ASP n 
2 278 ASP n 
2 279 SER n 
2 280 GLY n 
2 281 GLN n 
2 282 ARG n 
2 283 TYR n 
2 284 LEU n 
2 285 ALA n 
2 286 TRP n 
2 287 SER n 
2 288 GLY n 
2 289 HIS n 
2 290 SER n 
2 291 ALA n 
2 292 ARG n 
2 293 VAL n 
2 294 GLY n 
2 295 ALA n 
2 296 ALA n 
2 297 ARG n 
2 298 ASP n 
2 299 MET n 
2 300 ALA n 
2 301 ARG n 
2 302 ALA n 
2 303 GLY n 
2 304 VAL n 
2 305 SER n 
2 306 ILE n 
2 307 PRO n 
2 308 GLU n 
2 309 ILE n 
2 310 MET n 
2 311 GLN n 
2 312 ALA n 
2 313 GLY n 
2 314 GLY n 
2 315 TRP n 
2 316 THR n 
2 317 ASN n 
2 318 VAL n 
2 319 ASN n 
2 320 ILE n 
2 321 VAL n 
2 322 MET n 
2 323 ASN n 
2 324 PHE n 
2 325 ILE n 
2 326 ARG n 
2 327 ASN n 
2 328 LEU n 
2 329 ASP n 
2 330 SER n 
2 331 GLU n 
2 332 THR n 
2 333 GLY n 
2 334 ALA n 
2 335 MET n 
2 336 VAL n 
2 337 ARG n 
2 338 LEU n 
2 339 LEU n 
2 340 GLU n 
2 341 ASP n 
2 342 GLY n 
2 343 ASP n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'P1-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 CRE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage P1' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10678 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 25404-B1 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    CYTOPLASMIC 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 5CRX      1 TATAACTTCGTATAGCATATGCTATACGAAGTTAT 1 5CRX   ? 
2 UNP RECR_BPP1 2 
;MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYLLYLQA
RGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRN
LAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFC
RVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNI
VMNYIRNLDSETGAMVRLLEDGD
;
1 P06956 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5CRX C 1 ? 35  ? 5CRX   1 ? 35  ? 1 35  
2 1 5CRX D 1 ? 35  ? 5CRX   1 ? 35  ? 1 35  
3 2 5CRX A 1 ? 343 ? P06956 1 ? 343 ? 1 343 
4 2 5CRX B 1 ? 343 ? P06956 1 ? 343 ? 1 343 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 5CRX PHE A 324 ? UNP P06956 TYR 324 ENGINEERED 324 1 
4 5CRX PHE B 324 ? UNP P06956 TYR 324 ENGINEERED 324 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          5CRX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.97 
_exptl_crystal.density_percent_sol   50.0 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    'pH 5.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   1997-12 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SI 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9188 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F2' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F2 
_diffrn_source.pdbx_wavelength             0.9188 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     5CRX 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             99.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   32242 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0690000 
_reflns.pdbx_netI_over_sigmaI        12.59 
_reflns.B_iso_Wilson_estimate        63.4 
_reflns.pdbx_redundancy              4.8 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.78 
_reflns_shell.percent_possible_all   93.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.2300000 
_reflns_shell.meanI_over_sigI_obs    23.76 
_reflns_shell.pdbx_redundancy        3.71 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 5CRX 
_refine.ls_number_reflns_obs                     30977 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               1000000.0 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.0 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    96.1 
_refine.ls_R_factor_obs                          0.2270000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2270000 
_refine.ls_R_factor_R_free                       0.3040000 
_refine.ls_R_factor_R_free_error                 0.017 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1511 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               50.4 
_refine.aniso_B[1][1]                            0.0 
_refine.aniso_B[2][2]                            0.0 
_refine.aniso_B[3][3]                            0.0 
_refine.aniso_B[1][2]                            0.0 
_refine.aniso_B[1][3]                            0.0 
_refine.aniso_B[2][3]                            0.0 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1CRX 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        5CRX 
_refine_analyze.Luzzati_coordinate_error_obs    0.0 
_refine_analyze.Luzzati_sigma_a_obs             0.0 
_refine_analyze.Luzzati_d_res_low_obs           0.0 
_refine_analyze.Luzzati_coordinate_error_free   0.0 
_refine_analyze.Luzzati_sigma_a_free            0.0 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4696 
_refine_hist.pdbx_number_atoms_nucleic_acid   1354 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             314 
_refine_hist.number_atoms_total               6364 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        48.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.26  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.6  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.0   ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             4.1   1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            6.0   2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             6.2   2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            8.4   2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.7 
_refine_ls_shell.d_res_low                        2.82 
_refine_ls_shell.number_reflns_R_work             3253 
_refine_ls_shell.R_factor_R_work                  0.3370000 
_refine_ls_shell.percent_reflns_obs               95.8 
_refine_ls_shell.R_factor_R_free                  0.4370000 
_refine_ls_shell.R_factor_R_free_error            0.02 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             167 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP  'X-RAY DIFFRACTION' 
3 PARAM19.SOL       N.A.         'X-RAY DIFFRACTION' 
4 N.A.              N.A.         'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  5CRX 
_struct.title                     'ASYMMETRIC DNA-BENDING IN THE CRE-LOXP SITE-SPECIFIC RECOMBINATION SYNAPSE' 
_struct.pdbx_descriptor           'BACTERIOPHAGE P1 CRE GENE/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5CRX 
_struct_keywords.pdbx_keywords   PROTEIN/DNA 
_struct_keywords.text            
'CRE RECOMBINASE, DNA BENDING, SITE SPECIFIC RECOMBINATION, PROTEIN-DNA INTERACTION, PROTEIN/DNA, PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP C 21  ? ARG C 32  ? ASP A 21  ARG A 32  1 ? 12 
HELX_P HELX_P2  2  ARG C 34  ? ALA C 36  ? ARG A 34  ALA A 36  5 ? 3  
HELX_P HELX_P3  18 GLU C 39  ? LEU C 58  ? GLU A 39  LEU A 58  1 ? 20 
HELX_P HELX_P4  4  PRO C 68  ? ARG C 81  ? PRO A 68  ARG A 81  1 ? 14 
HELX_P HELX_P5  5  VAL C 85  ? ARG C 100 ? VAL A 85  ARG A 100 1 ? 16 
HELX_P HELX_P6  21 PRO C 107 ? ASP C 109 ? PRO A 107 ASP A 109 5 ? 3  
HELX_P HELX_P7  7  ASN C 111 ? VAL C 125 ? ASN A 111 VAL A 125 1 ? 15 
HELX_P HELX_P8  23 ARG C 139 ? MET C 149 ? ARG A 139 MET A 149 1 ? 11 
HELX_P HELX_P9  24 CYS C 155 ? THR C 170 ? CYS A 155 THR A 170 1 ? 16 
HELX_P HELX_P10 10 ILE C 174 ? ARG C 179 ? ILE A 174 ARG A 179 1 ? 6  
HELX_P HELX_P11 11 GLY C 216 ? SER C 228 ? GLY A 216 SER A 228 1 ? 13 
HELX_P HELX_P12 29 THR C 258 ? TYR C 273 ? THR A 258 TYR A 273 1 ? 16 
HELX_P HELX_P13 13 SER C 290 ? ARG C 301 ? SER A 290 ARG A 301 1 ? 12 
HELX_P HELX_P14 14 ILE C 306 ? GLN C 311 ? ILE A 306 GLN A 311 1 ? 6  
HELX_P HELX_P15 15 ARG C 326 ? LEU C 328 ? ARG A 326 LEU A 328 5 ? 3  
HELX_P HELX_P16 16 ALA C 334 ? LEU C 339 ? ALA A 334 LEU A 339 1 ? 6  
HELX_P HELX_P17 17 SER D 20  ? ALA D 36  ? SER B 20  ALA B 36  1 ? 17 
HELX_P HELX_P18 18 GLU D 39  ? LEU D 58  ? GLU B 39  LEU B 58  1 ? 20 
HELX_P HELX_P19 19 PRO D 68  ? ALA D 80  ? PRO B 68  ALA B 80  1 ? 13 
HELX_P HELX_P20 20 VAL D 85  ? SER D 102 ? VAL B 85  SER B 102 1 ? 18 
HELX_P HELX_P21 21 PRO D 107 ? ASP D 109 ? PRO B 107 ASP B 109 5 ? 3  
HELX_P HELX_P22 22 ASN D 111 ? ASP D 126 ? ASN B 111 ASP B 126 1 ? 16 
HELX_P HELX_P23 23 ARG D 139 ? MET D 149 ? ARG B 139 MET B 149 1 ? 11 
HELX_P HELX_P24 24 CYS D 155 ? THR D 170 ? CYS B 155 THR B 170 1 ? 16 
HELX_P HELX_P25 25 ILE D 174 ? ILE D 177 ? ILE B 174 ILE B 177 1 ? 4  
HELX_P HELX_P26 26 VAL D 182 ? ASP D 184 ? VAL B 182 ASP B 184 5 ? 3  
HELX_P HELX_P27 27 LEU D 215 ? SER D 228 ? LEU B 215 SER B 228 1 ? 14 
HELX_P HELX_P28 28 VAL D 230 ? ASP D 232 ? VAL B 230 ASP B 232 5 ? 3  
HELX_P HELX_P29 29 THR D 258 ? TYR D 273 ? THR B 258 TYR B 273 1 ? 16 
HELX_P HELX_P30 30 SER D 290 ? ALA D 300 ? SER B 290 ALA B 300 1 ? 11 
HELX_P HELX_P31 31 ILE D 306 ? GLY D 313 ? ILE B 306 GLY B 313 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 34 N1 ? ? C DT 3  D DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 34 N6 ? ? C DT 3  D DA 34 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 33 N3 ? ? C DA 4  D DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 33 O4 ? ? C DA 4  D DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 32 N3 ? ? C DA 5  D DT 32 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog6  hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG 31 N1 ? ? C DC 6  D DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG 31 O6 ? ? C DC 6  D DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG 31 N2 ? ? C DC 6  D DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 30 N1 ? ? C DT 7  D DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 30 N6 ? ? C DT 7  D DA 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 29 N1 ? ? C DT 8  D DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 29 N6 ? ? C DT 8  D DA 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 28 N1 ? ? C DC 9  D DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG 28 O6 ? ? C DC 9  D DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 28 N2 ? ? C DC 9  D DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DG 10 N1 ? ? ? 1_555 B DC 27 N3 ? ? C DG 10 D DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 10 N2 ? ? ? 1_555 B DC 27 O2 ? ? C DG 10 D DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 10 O6 ? ? ? 1_555 B DC 27 N4 ? ? C DG 10 D DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 26 N1 ? ? C DT 11 D DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 26 N6 ? ? C DT 11 D DA 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 25 N3 ? ? C DA 12 D DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 25 O4 ? ? C DA 12 D DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 24 N1 ? ? C DT 13 D DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 24 N6 ? ? C DT 13 D DA 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 23 N3 ? ? C DA 14 D DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 23 O4 ? ? C DA 14 D DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DG 15 N1 ? ? ? 1_555 B DC 22 N3 ? ? C DG 15 D DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DG 15 N2 ? ? ? 1_555 B DC 22 O2 ? ? C DG 15 D DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DG 15 O6 ? ? ? 1_555 B DC 22 N4 ? ? C DG 15 D DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DC 16 O2 ? ? ? 1_555 B DG 21 N2 ? ? C DC 16 D DG 21 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog31 hydrog ? ? A DA 17 N1 ? ? ? 1_555 B DT 20 N3 ? ? C DA 17 D DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DA 17 N6 ? ? ? 1_555 B DT 20 O4 ? ? C DA 17 D DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DT 18 N3 ? ? ? 1_555 B DA 19 N1 ? ? C DT 18 D DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DT 18 O4 ? ? ? 1_555 B DA 19 N6 ? ? C DT 18 D DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DA 19 N1 ? ? ? 1_555 B DT 18 N3 ? ? C DA 19 D DT 18 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog36 hydrog ? ? A DT 20 N3 ? ? ? 1_555 B DA 17 N1 ? ? C DT 20 D DA 17 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog37 hydrog ? ? A DG 21 N1 ? ? ? 1_555 B DC 16 N3 ? ? C DG 21 D DC 16 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog38 hydrog ? ? A DC 22 N3 ? ? ? 1_555 B DG 15 N1 ? ? C DC 22 D DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? A DC 22 N4 ? ? ? 1_555 B DG 15 O6 ? ? C DC 22 D DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? A DC 22 O2 ? ? ? 1_555 B DG 15 N2 ? ? C DC 22 D DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? A DT 23 N3 ? ? ? 1_555 B DA 14 N1 ? ? C DT 23 D DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? A DT 23 O4 ? ? ? 1_555 B DA 14 N6 ? ? C DT 23 D DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? A DA 24 N1 ? ? ? 1_555 B DT 13 N3 ? ? C DA 24 D DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? A DA 24 N6 ? ? ? 1_555 B DT 13 O4 ? ? C DA 24 D DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? A DT 25 N3 ? ? ? 1_555 B DA 12 N1 ? ? C DT 25 D DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? A DT 25 O4 ? ? ? 1_555 B DA 12 N6 ? ? C DT 25 D DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? A DA 26 N1 ? ? ? 1_555 B DT 11 N3 ? ? C DA 26 D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? A DA 26 N6 ? ? ? 1_555 B DT 11 O4 ? ? C DA 26 D DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? A DC 27 N3 ? ? ? 1_555 B DG 10 N1 ? ? C DC 27 D DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? A DC 27 N4 ? ? ? 1_555 B DG 10 O6 ? ? C DC 27 D DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? A DC 27 O2 ? ? ? 1_555 B DG 10 N2 ? ? C DC 27 D DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? A DG 28 N1 ? ? ? 1_555 B DC 9  N3 ? ? C DG 28 D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? A DG 28 N2 ? ? ? 1_555 B DC 9  O2 ? ? C DG 28 D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? A DG 28 O6 ? ? ? 1_555 B DC 9  N4 ? ? C DG 28 D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? A DA 29 N1 ? ? ? 1_555 B DT 8  N3 ? ? C DA 29 D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? A DA 29 N6 ? ? ? 1_555 B DT 8  O4 ? ? C DA 29 D DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? A DA 30 N1 ? ? ? 1_555 B DT 7  N3 ? ? C DA 30 D DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? A DA 30 N6 ? ? ? 1_555 B DT 7  O4 ? ? C DA 30 D DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? A DG 31 N1 ? ? ? 1_555 B DC 6  N3 ? ? C DG 31 D DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? A DG 31 N2 ? ? ? 1_555 B DC 6  O2 ? ? C DG 31 D DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? A DG 31 O6 ? ? ? 1_555 B DC 6  N4 ? ? C DG 31 D DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? A DT 32 N3 ? ? ? 1_555 B DA 5  N1 ? ? C DT 32 D DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? A DT 32 O4 ? ? ? 1_555 B DA 5  N6 ? ? C DT 32 D DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? A DT 33 N3 ? ? ? 1_555 B DA 4  N1 ? ? C DT 33 D DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65 hydrog ? ? A DT 33 O4 ? ? ? 1_555 B DA 4  N6 ? ? C DT 33 D DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66 hydrog ? ? A DA 34 N1 ? ? ? 1_555 B DT 3  N3 ? ? C DA 34 D DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67 hydrog ? ? A DA 34 N6 ? ? ? 1_555 B DT 3  O4 ? ? C DA 34 D DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 64 C . ? PHE 64 A PRO 65 C ? PRO 65 A 1 -0.28 
2 PHE 64 D . ? PHE 64 B PRO 65 D ? PRO 65 B 1 -0.59 
# 
_struct_sheet.id               B 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
B 1 ILE D 185 ? ARG D 187 ? ILE B 185 ARG B 187 
B 2 MET D 193 ? ILE D 197 ? MET B 193 ILE B 197 
B 3 VAL D 209 ? ALA D 212 ? VAL B 209 ALA B 212 
# 
_struct_site.id                   CAT 
_struct_site.pdbx_evidence_code   Author 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'CATALYTIC SITE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 4 ARG C 173 ? ARG A 173 . ? 1_555 ? 
2 CAT 4 HIS C 289 ? HIS A 289 . ? 1_555 ? 
3 CAT 4 ARG C 292 ? ARG A 292 . ? 1_555 ? 
4 CAT 4 TRP C 315 ? TRP A 315 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5CRX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5CRX 
_atom_sites.fract_transf_matrix[1][1]   0.009337 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008123 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005556 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P P     . DA  A 1 2   ? 71.954  6.267  57.967  1.00 100.00 ? 2   DA  C P     1 
ATOM   2    O OP1   . DA  A 1 2   ? 70.674  6.795  58.512  1.00 100.00 ? 2   DA  C OP1   1 
ATOM   3    O OP2   . DA  A 1 2   ? 71.932  5.331  56.814  1.00 100.00 ? 2   DA  C OP2   1 
ATOM   4    O "O5'" . DA  A 1 2   ? 72.781  5.604  59.165  1.00 95.17  ? 2   DA  C "O5'" 1 
ATOM   5    C "C5'" . DA  A 1 2   ? 72.746  6.144  60.494  1.00 85.45  ? 2   DA  C "C5'" 1 
ATOM   6    C "C4'" . DA  A 1 2   ? 74.008  6.932  60.776  1.00 83.46  ? 2   DA  C "C4'" 1 
ATOM   7    O "O4'" . DA  A 1 2   ? 74.114  8.033  59.840  1.00 82.07  ? 2   DA  C "O4'" 1 
ATOM   8    C "C3'" . DA  A 1 2   ? 74.063  7.577  62.160  1.00 82.22  ? 2   DA  C "C3'" 1 
ATOM   9    O "O3'" . DA  A 1 2   ? 75.424  7.676  62.606  1.00 83.38  ? 2   DA  C "O3'" 1 
ATOM   10   C "C2'" . DA  A 1 2   ? 73.489  8.960  61.920  1.00 77.30  ? 2   DA  C "C2'" 1 
ATOM   11   C "C1'" . DA  A 1 2   ? 73.948  9.284  60.506  1.00 74.51  ? 2   DA  C "C1'" 1 
ATOM   12   N N9    . DA  A 1 2   ? 72.951  10.046 59.754  1.00 70.95  ? 2   DA  C N9    1 
ATOM   13   C C8    . DA  A 1 2   ? 71.597  9.815  59.737  1.00 74.35  ? 2   DA  C C8    1 
ATOM   14   N N7    . DA  A 1 2   ? 70.927  10.636 58.965  1.00 73.40  ? 2   DA  C N7    1 
ATOM   15   C C5    . DA  A 1 2   ? 71.901  11.469 58.438  1.00 60.99  ? 2   DA  C C5    1 
ATOM   16   C C6    . DA  A 1 2   ? 71.830  12.556 57.549  1.00 58.47  ? 2   DA  C C6    1 
ATOM   17   N N6    . DA  A 1 2   ? 70.687  13.013 57.023  1.00 58.68  ? 2   DA  C N6    1 
ATOM   18   N N1    . DA  A 1 2   ? 72.982  13.170 57.221  1.00 56.84  ? 2   DA  C N1    1 
ATOM   19   C C2    . DA  A 1 2   ? 74.125  12.721 57.766  1.00 59.45  ? 2   DA  C C2    1 
ATOM   20   N N3    . DA  A 1 2   ? 74.323  11.715 58.618  1.00 53.68  ? 2   DA  C N3    1 
ATOM   21   C C4    . DA  A 1 2   ? 73.156  11.120 58.918  1.00 63.67  ? 2   DA  C C4    1 
ATOM   22   P P     . DT  A 1 3   ? 75.761  8.454  63.972  1.00 76.29  ? 3   DT  C P     1 
ATOM   23   O OP1   . DT  A 1 3   ? 77.075  7.977  64.463  1.00 75.51  ? 3   DT  C OP1   1 
ATOM   24   O OP2   . DT  A 1 3   ? 74.563  8.334  64.848  1.00 75.20  ? 3   DT  C OP2   1 
ATOM   25   O "O5'" . DT  A 1 3   ? 75.911  9.975  63.513  1.00 69.93  ? 3   DT  C "O5'" 1 
ATOM   26   C "C5'" . DT  A 1 3   ? 77.042  10.403 62.758  1.00 61.82  ? 3   DT  C "C5'" 1 
ATOM   27   C "C4'" . DT  A 1 3   ? 77.168  11.910 62.799  1.00 59.96  ? 3   DT  C "C4'" 1 
ATOM   28   O "O4'" . DT  A 1 3   ? 76.304  12.539 61.821  1.00 59.91  ? 3   DT  C "O4'" 1 
ATOM   29   C "C3'" . DT  A 1 3   ? 76.853  12.586 64.136  1.00 57.90  ? 3   DT  C "C3'" 1 
ATOM   30   O "O3'" . DT  A 1 3   ? 77.795  13.629 64.352  1.00 57.05  ? 3   DT  C "O3'" 1 
ATOM   31   C "C2'" . DT  A 1 3   ? 75.492  13.217 63.890  1.00 52.71  ? 3   DT  C "C2'" 1 
ATOM   32   C "C1'" . DT  A 1 3   ? 75.619  13.620 62.434  1.00 47.38  ? 3   DT  C "C1'" 1 
ATOM   33   N N1    . DT  A 1 3   ? 74.352  13.850 61.700  1.00 42.65  ? 3   DT  C N1    1 
ATOM   34   C C2    . DT  A 1 3   ? 74.370  14.787 60.690  1.00 47.50  ? 3   DT  C C2    1 
ATOM   35   O O2    . DT  A 1 3   ? 75.376  15.409 60.381  1.00 56.01  ? 3   DT  C O2    1 
ATOM   36   N N3    . DT  A 1 3   ? 73.165  14.971 60.044  1.00 43.38  ? 3   DT  C N3    1 
ATOM   37   C C4    . DT  A 1 3   ? 71.978  14.313 60.295  1.00 47.68  ? 3   DT  C C4    1 
ATOM   38   O O4    . DT  A 1 3   ? 70.981  14.578 59.623  1.00 35.24  ? 3   DT  C O4    1 
ATOM   39   C C5    . DT  A 1 3   ? 72.033  13.333 61.364  1.00 43.80  ? 3   DT  C C5    1 
ATOM   40   C C7    . DT  A 1 3   ? 70.803  12.558 61.697  1.00 38.95  ? 3   DT  C C7    1 
ATOM   41   C C6    . DT  A 1 3   ? 73.198  13.159 62.009  1.00 43.58  ? 3   DT  C C6    1 
ATOM   42   P P     . DA  A 1 4   ? 77.909  14.319 65.793  1.00 55.48  ? 4   DA  C P     1 
ATOM   43   O OP1   . DA  A 1 4   ? 78.871  13.546 66.611  1.00 49.63  ? 4   DA  C OP1   1 
ATOM   44   O OP2   . DA  A 1 4   ? 76.525  14.529 66.285  1.00 62.01  ? 4   DA  C OP2   1 
ATOM   45   O "O5'" . DA  A 1 4   ? 78.565  15.730 65.451  1.00 44.42  ? 4   DA  C "O5'" 1 
ATOM   46   C "C5'" . DA  A 1 4   ? 79.610  15.809 64.485  1.00 42.83  ? 4   DA  C "C5'" 1 
ATOM   47   C "C4'" . DA  A 1 4   ? 79.540  17.120 63.740  1.00 41.62  ? 4   DA  C "C4'" 1 
ATOM   48   O "O4'" . DA  A 1 4   ? 78.293  17.216 63.021  1.00 40.55  ? 4   DA  C "O4'" 1 
ATOM   49   C "C3'" . DA  A 1 4   ? 79.578  18.344 64.644  1.00 38.40  ? 4   DA  C "C3'" 1 
ATOM   50   O "O3'" . DA  A 1 4   ? 80.136  19.444 63.928  1.00 41.50  ? 4   DA  C "O3'" 1 
ATOM   51   C "C2'" . DA  A 1 4   ? 78.114  18.603 64.911  1.00 34.81  ? 4   DA  C "C2'" 1 
ATOM   52   C "C1'" . DA  A 1 4   ? 77.483  18.238 63.583  1.00 36.50  ? 4   DA  C "C1'" 1 
ATOM   53   N N9    . DA  A 1 4   ? 76.129  17.701 63.687  1.00 38.87  ? 4   DA  C N9    1 
ATOM   54   C C8    . DA  A 1 4   ? 75.642  16.733 64.532  1.00 38.97  ? 4   DA  C C8    1 
ATOM   55   N N7    . DA  A 1 4   ? 74.381  16.442 64.326  1.00 32.54  ? 4   DA  C N7    1 
ATOM   56   C C5    . DA  A 1 4   ? 74.016  17.281 63.282  1.00 31.69  ? 4   DA  C C5    1 
ATOM   57   C C6    . DA  A 1 4   ? 72.811  17.455 62.581  1.00 36.09  ? 4   DA  C C6    1 
ATOM   58   N N6    . DA  A 1 4   ? 71.725  16.742 62.810  1.00 39.66  ? 4   DA  C N6    1 
ATOM   59   N N1    . DA  A 1 4   ? 72.773  18.388 61.614  1.00 33.82  ? 4   DA  C N1    1 
ATOM   60   C C2    . DA  A 1 4   ? 73.880  19.081 61.364  1.00 42.35  ? 4   DA  C C2    1 
ATOM   61   N N3    . DA  A 1 4   ? 75.076  18.998 61.936  1.00 33.70  ? 4   DA  C N3    1 
ATOM   62   C C4    . DA  A 1 4   ? 75.076  18.072 62.898  1.00 27.37  ? 4   DA  C C4    1 
ATOM   63   P P     . DA  A 1 5   ? 80.485  20.792 64.713  1.00 44.26  ? 5   DA  C P     1 
ATOM   64   O OP1   . DA  A 1 5   ? 81.610  21.442 64.024  1.00 42.12  ? 5   DA  C OP1   1 
ATOM   65   O OP2   . DA  A 1 5   ? 80.616  20.417 66.149  1.00 44.38  ? 5   DA  C OP2   1 
ATOM   66   O "O5'" . DA  A 1 5   ? 79.196  21.704 64.516  1.00 45.97  ? 5   DA  C "O5'" 1 
ATOM   67   C "C5'" . DA  A 1 5   ? 78.824  22.184 63.221  1.00 39.77  ? 5   DA  C "C5'" 1 
ATOM   68   C "C4'" . DA  A 1 5   ? 77.493  22.893 63.291  1.00 31.57  ? 5   DA  C "C4'" 1 
ATOM   69   O "O4'" . DA  A 1 5   ? 76.405  21.944 63.439  1.00 37.72  ? 5   DA  C "O4'" 1 
ATOM   70   C "C3'" . DA  A 1 5   ? 77.380  23.836 64.488  1.00 27.45  ? 5   DA  C "C3'" 1 
ATOM   71   O "O3'" . DA  A 1 5   ? 76.707  25.040 64.140  1.00 32.93  ? 5   DA  C "O3'" 1 
ATOM   72   C "C2'" . DA  A 1 5   ? 76.491  23.073 65.449  1.00 27.28  ? 5   DA  C "C2'" 1 
ATOM   73   C "C1'" . DA  A 1 5   ? 75.552  22.436 64.460  1.00 31.71  ? 5   DA  C "C1'" 1 
ATOM   74   N N9    . DA  A 1 5   ? 74.757  21.332 64.985  1.00 25.46  ? 5   DA  C N9    1 
ATOM   75   C C8    . DA  A 1 5   ? 75.085  20.460 65.980  1.00 26.42  ? 5   DA  C C8    1 
ATOM   76   N N7    . DA  A 1 5   ? 74.151  19.577 66.236  1.00 38.22  ? 5   DA  C N7    1 
ATOM   77   C C5    . DA  A 1 5   ? 73.140  19.891 65.341  1.00 32.83  ? 5   DA  C C5    1 
ATOM   78   C C6    . DA  A 1 5   ? 71.894  19.312 65.088  1.00 26.62  ? 5   DA  C C6    1 
ATOM   79   N N6    . DA  A 1 5   ? 71.432  18.267 65.763  1.00 34.16  ? 5   DA  C N6    1 
ATOM   80   N N1    . DA  A 1 5   ? 71.138  19.838 64.113  1.00 26.16  ? 5   DA  C N1    1 
ATOM   81   C C2    . DA  A 1 5   ? 71.615  20.882 63.439  1.00 31.64  ? 5   DA  C C2    1 
ATOM   82   N N3    . DA  A 1 5   ? 72.767  21.520 63.588  1.00 25.76  ? 5   DA  C N3    1 
ATOM   83   C C4    . DA  A 1 5   ? 73.497  20.967 64.566  1.00 28.11  ? 5   DA  C C4    1 
ATOM   84   P P     . DC  A 1 6   ? 77.019  26.368 64.966  1.00 38.04  ? 6   DC  C P     1 
ATOM   85   O OP1   . DC  A 1 6   ? 77.226  27.489 64.017  1.00 26.74  ? 6   DC  C OP1   1 
ATOM   86   O OP2   . DC  A 1 6   ? 78.098  25.989 65.905  1.00 40.39  ? 6   DC  C OP2   1 
ATOM   87   O "O5'" . DC  A 1 6   ? 75.705  26.661 65.814  1.00 35.43  ? 6   DC  C "O5'" 1 
ATOM   88   C "C5'" . DC  A 1 6   ? 74.641  25.735 65.840  1.00 24.33  ? 6   DC  C "C5'" 1 
ATOM   89   C "C4'" . DC  A 1 6   ? 73.670  26.047 64.731  1.00 22.96  ? 6   DC  C "C4'" 1 
ATOM   90   O "O4'" . DC  A 1 6   ? 73.098  24.781 64.389  1.00 19.75  ? 6   DC  C "O4'" 1 
ATOM   91   C "C3'" . DC  A 1 6   ? 72.513  26.956 65.121  1.00 22.82  ? 6   DC  C "C3'" 1 
ATOM   92   O "O3'" . DC  A 1 6   ? 72.211  27.946 64.168  1.00 24.79  ? 6   DC  C "O3'" 1 
ATOM   93   C "C2'" . DC  A 1 6   ? 71.322  26.041 65.278  1.00 22.64  ? 6   DC  C "C2'" 1 
ATOM   94   C "C1'" . DC  A 1 6   ? 71.715  24.735 64.612  1.00 20.16  ? 6   DC  C "C1'" 1 
ATOM   95   N N1    . DC  A 1 6   ? 71.506  23.658 65.564  1.00 22.38  ? 6   DC  C N1    1 
ATOM   96   C C2    . DC  A 1 6   ? 70.424  22.799 65.396  1.00 29.95  ? 6   DC  C C2    1 
ATOM   97   O O2    . DC  A 1 6   ? 69.715  22.920 64.393  1.00 49.23  ? 6   DC  C O2    1 
ATOM   98   N N3    . DC  A 1 6   ? 70.174  21.861 66.333  1.00 24.98  ? 6   DC  C N3    1 
ATOM   99   C C4    . DC  A 1 6   ? 70.967  21.762 67.402  1.00 28.46  ? 6   DC  C C4    1 
ATOM   100  N N4    . DC  A 1 6   ? 70.647  20.849 68.330  1.00 29.05  ? 6   DC  C N4    1 
ATOM   101  C C5    . DC  A 1 6   ? 72.114  22.601 67.575  1.00 22.23  ? 6   DC  C C5    1 
ATOM   102  C C6    . DC  A 1 6   ? 72.346  23.524 66.634  1.00 17.64  ? 6   DC  C C6    1 
ATOM   103  P P     . DT  A 1 7   ? 71.208  29.113 64.594  1.00 29.48  ? 7   DT  C P     1 
ATOM   104  O OP1   . DT  A 1 7   ? 71.206  30.190 63.556  1.00 31.05  ? 7   DT  C OP1   1 
ATOM   105  O OP2   . DT  A 1 7   ? 71.524  29.449 65.991  1.00 25.71  ? 7   DT  C OP2   1 
ATOM   106  O "O5'" . DT  A 1 7   ? 69.805  28.372 64.621  1.00 33.68  ? 7   DT  C "O5'" 1 
ATOM   107  C "C5'" . DT  A 1 7   ? 69.214  27.963 63.397  1.00 37.29  ? 7   DT  C "C5'" 1 
ATOM   108  C "C4'" . DT  A 1 7   ? 67.758  27.628 63.598  1.00 35.47  ? 7   DT  C "C4'" 1 
ATOM   109  O "O4'" . DT  A 1 7   ? 67.623  26.405 64.356  1.00 40.20  ? 7   DT  C "O4'" 1 
ATOM   110  C "C3'" . DT  A 1 7   ? 66.962  28.686 64.360  1.00 42.59  ? 7   DT  C "C3'" 1 
ATOM   111  O "O3'" . DT  A 1 7   ? 65.648  28.795 63.803  1.00 56.88  ? 7   DT  C "O3'" 1 
ATOM   112  C "C2'" . DT  A 1 7   ? 66.897  28.129 65.768  1.00 35.89  ? 7   DT  C "C2'" 1 
ATOM   113  C "C1'" . DT  A 1 7   ? 66.826  26.641 65.507  1.00 34.82  ? 7   DT  C "C1'" 1 
ATOM   114  N N1    . DT  A 1 7   ? 67.361  25.813 66.590  1.00 26.95  ? 7   DT  C N1    1 
ATOM   115  C C2    . DT  A 1 7   ? 66.625  24.730 66.998  1.00 30.02  ? 7   DT  C C2    1 
ATOM   116  O O2    . DT  A 1 7   ? 65.557  24.431 66.504  1.00 45.01  ? 7   DT  C O2    1 
ATOM   117  N N3    . DT  A 1 7   ? 67.192  23.999 68.004  1.00 33.52  ? 7   DT  C N3    1 
ATOM   118  C C4    . DT  A 1 7   ? 68.403  24.235 68.625  1.00 33.63  ? 7   DT  C C4    1 
ATOM   119  O O4    . DT  A 1 7   ? 68.790  23.483 69.517  1.00 37.59  ? 7   DT  C O4    1 
ATOM   120  C C5    . DT  A 1 7   ? 69.123  25.392 68.144  1.00 22.71  ? 7   DT  C C5    1 
ATOM   121  C C7    . DT  A 1 7   ? 70.441  25.740 68.756  1.00 23.85  ? 7   DT  C C7    1 
ATOM   122  C C6    . DT  A 1 7   ? 68.571  26.114 67.167  1.00 27.94  ? 7   DT  C C6    1 
ATOM   123  P P     . DT  A 1 8   ? 64.633  29.901 64.370  1.00 59.63  ? 8   DT  C P     1 
ATOM   124  O OP1   . DT  A 1 8   ? 63.915  30.482 63.214  1.00 59.76  ? 8   DT  C OP1   1 
ATOM   125  O OP2   . DT  A 1 8   ? 65.421  30.791 65.266  1.00 66.56  ? 8   DT  C OP2   1 
ATOM   126  O "O5'" . DT  A 1 8   ? 63.605  29.023 65.210  1.00 46.99  ? 8   DT  C "O5'" 1 
ATOM   127  C "C5'" . DT  A 1 8   ? 62.996  27.895 64.605  1.00 39.88  ? 8   DT  C "C5'" 1 
ATOM   128  C "C4'" . DT  A 1 8   ? 61.987  27.280 65.541  1.00 44.06  ? 8   DT  C "C4'" 1 
ATOM   129  O "O4'" . DT  A 1 8   ? 62.643  26.430 66.505  1.00 42.41  ? 8   DT  C "O4'" 1 
ATOM   130  C "C3'" . DT  A 1 8   ? 61.139  28.264 66.346  1.00 53.50  ? 8   DT  C "C3'" 1 
ATOM   131  O "O3'" . DT  A 1 8   ? 59.811  27.711 66.421  1.00 62.58  ? 8   DT  C "O3'" 1 
ATOM   132  C "C2'" . DT  A 1 8   ? 61.845  28.292 67.693  1.00 51.66  ? 8   DT  C "C2'" 1 
ATOM   133  C "C1'" . DT  A 1 8   ? 62.321  26.856 67.819  1.00 44.62  ? 8   DT  C "C1'" 1 
ATOM   134  N N1    . DT  A 1 8   ? 63.509  26.640 68.661  1.00 46.34  ? 8   DT  C N1    1 
ATOM   135  C C2    . DT  A 1 8   ? 63.533  25.484 69.394  1.00 46.33  ? 8   DT  C C2    1 
ATOM   136  O O2    . DT  A 1 8   ? 62.621  24.672 69.373  1.00 52.55  ? 8   DT  C O2    1 
ATOM   137  N N3    . DT  A 1 8   ? 64.670  25.304 70.147  1.00 46.98  ? 8   DT  C N3    1 
ATOM   138  C C4    . DT  A 1 8   ? 65.772  26.149 70.220  1.00 46.95  ? 8   DT  C C4    1 
ATOM   139  O O4    . DT  A 1 8   ? 66.748  25.837 70.915  1.00 31.54  ? 8   DT  C O4    1 
ATOM   140  C C5    . DT  A 1 8   ? 65.677  27.358 69.431  1.00 36.99  ? 8   DT  C C5    1 
ATOM   141  C C7    . DT  A 1 8   ? 66.818  28.331 69.453  1.00 16.98  ? 8   DT  C C7    1 
ATOM   142  C C6    . DT  A 1 8   ? 64.560  27.545 68.706  1.00 47.77  ? 8   DT  C C6    1 
ATOM   143  P P     . DC  A 1 9   ? 58.617  28.527 67.127  1.00 63.88  ? 9   DC  C P     1 
ATOM   144  O OP1   . DC  A 1 9   ? 57.365  28.151 66.432  1.00 69.13  ? 9   DC  C OP1   1 
ATOM   145  O OP2   . DC  A 1 9   ? 58.982  29.960 67.280  1.00 59.46  ? 9   DC  C OP2   1 
ATOM   146  O "O5'" . DC  A 1 9   ? 58.577  27.868 68.564  1.00 56.31  ? 9   DC  C "O5'" 1 
ATOM   147  C "C5'" . DC  A 1 9   ? 58.971  26.513 68.730  1.00 55.87  ? 9   DC  C "C5'" 1 
ATOM   148  C "C4'" . DC  A 1 9   ? 58.747  26.103 70.158  1.00 52.33  ? 9   DC  C "C4'" 1 
ATOM   149  O "O4'" . DC  A 1 9   ? 60.012  25.865 70.816  1.00 50.13  ? 9   DC  C "O4'" 1 
ATOM   150  C "C3'" . DC  A 1 9   ? 58.060  27.201 70.965  1.00 51.74  ? 9   DC  C "C3'" 1 
ATOM   151  O "O3'" . DC  A 1 9   ? 57.161  26.567 71.859  1.00 51.03  ? 9   DC  C "O3'" 1 
ATOM   152  C "C2'" . DC  A 1 9   ? 59.206  27.861 71.711  1.00 38.88  ? 9   DC  C "C2'" 1 
ATOM   153  C "C1'" . DC  A 1 9   ? 60.073  26.652 71.991  1.00 42.26  ? 9   DC  C "C1'" 1 
ATOM   154  N N1    . DC  A 1 9   ? 61.489  26.916 72.299  1.00 24.99  ? 9   DC  C N1    1 
ATOM   155  C C2    . DC  A 1 9   ? 62.131  26.077 73.226  1.00 21.78  ? 9   DC  C C2    1 
ATOM   156  O O2    . DC  A 1 9   ? 61.492  25.118 73.711  1.00 19.30  ? 9   DC  C O2    1 
ATOM   157  N N3    . DC  A 1 9   ? 63.415  26.330 73.572  1.00 11.82  ? 9   DC  C N3    1 
ATOM   158  C C4    . DC  A 1 9   ? 64.056  27.367 73.021  1.00 23.47  ? 9   DC  C C4    1 
ATOM   159  N N4    . DC  A 1 9   ? 65.315  27.605 73.414  1.00 20.39  ? 9   DC  C N4    1 
ATOM   160  C C5    . DC  A 1 9   ? 63.433  28.215 72.048  1.00 17.50  ? 9   DC  C C5    1 
ATOM   161  C C6    . DC  A 1 9   ? 62.164  27.953 71.718  1.00 24.47  ? 9   DC  C C6    1 
ATOM   162  P P     . DG  A 1 10  ? 56.035  27.425 72.590  1.00 47.51  ? 10  DG  C P     1 
ATOM   163  O OP1   . DG  A 1 10  ? 54.720  26.860 72.205  1.00 56.62  ? 10  DG  C OP1   1 
ATOM   164  O OP2   . DG  A 1 10  ? 56.326  28.865 72.354  1.00 41.59  ? 10  DG  C OP2   1 
ATOM   165  O "O5'" . DG  A 1 10  ? 56.287  27.045 74.104  1.00 40.44  ? 10  DG  C "O5'" 1 
ATOM   166  C "C5'" . DG  A 1 10  ? 56.361  25.675 74.466  1.00 37.11  ? 10  DG  C "C5'" 1 
ATOM   167  C "C4'" . DG  A 1 10  ? 56.863  25.550 75.878  1.00 39.65  ? 10  DG  C "C4'" 1 
ATOM   168  O "O4'" . DG  A 1 10  ? 58.299  25.748 75.926  1.00 38.20  ? 10  DG  C "O4'" 1 
ATOM   169  C "C3'" . DG  A 1 10  ? 56.249  26.609 76.791  1.00 39.41  ? 10  DG  C "C3'" 1 
ATOM   170  O "O3'" . DG  A 1 10  ? 55.972  26.030 78.068  1.00 39.82  ? 10  DG  C "O3'" 1 
ATOM   171  C "C2'" . DG  A 1 10  ? 57.347  27.648 76.877  1.00 40.63  ? 10  DG  C "C2'" 1 
ATOM   172  C "C1'" . DG  A 1 10  ? 58.588  26.768 76.863  1.00 39.35  ? 10  DG  C "C1'" 1 
ATOM   173  N N9    . DG  A 1 10  ? 59.758  27.485 76.391  1.00 30.89  ? 10  DG  C N9    1 
ATOM   174  C C8    . DG  A 1 10  ? 59.751  28.497 75.473  1.00 26.61  ? 10  DG  C C8    1 
ATOM   175  N N7    . DG  A 1 10  ? 60.936  28.995 75.253  1.00 32.85  ? 10  DG  C N7    1 
ATOM   176  C C5    . DG  A 1 10  ? 61.787  28.262 76.070  1.00 25.96  ? 10  DG  C C5    1 
ATOM   177  C C6    . DG  A 1 10  ? 63.198  28.368 76.264  1.00 16.48  ? 10  DG  C C6    1 
ATOM   178  O O6    . DG  A 1 10  ? 63.997  29.168 75.751  1.00 16.63  ? 10  DG  C O6    1 
ATOM   179  N N1    . DG  A 1 10  ? 63.654  27.427 77.165  1.00 16.37  ? 10  DG  C N1    1 
ATOM   180  C C2    . DG  A 1 10  ? 62.868  26.510 77.815  1.00 22.52  ? 10  DG  C C2    1 
ATOM   181  N N2    . DG  A 1 10  ? 63.524  25.669 78.627  1.00 15.20  ? 10  DG  C N2    1 
ATOM   182  N N3    . DG  A 1 10  ? 61.551  26.417 77.674  1.00 18.71  ? 10  DG  C N3    1 
ATOM   183  C C4    . DG  A 1 10  ? 61.080  27.316 76.779  1.00 28.38  ? 10  DG  C C4    1 
ATOM   184  P P     . DT  A 1 11  ? 55.307  26.923 79.221  1.00 40.93  ? 11  DT  C P     1 
ATOM   185  O OP1   . DT  A 1 11  ? 53.981  26.335 79.517  1.00 48.49  ? 11  DT  C OP1   1 
ATOM   186  O OP2   . DT  A 1 11  ? 55.412  28.371 78.863  1.00 30.39  ? 11  DT  C OP2   1 
ATOM   187  O "O5'" . DT  A 1 11  ? 56.278  26.642 80.449  1.00 45.80  ? 11  DT  C "O5'" 1 
ATOM   188  C "C5'" . DT  A 1 11  ? 56.781  25.328 80.678  1.00 39.46  ? 11  DT  C "C5'" 1 
ATOM   189  C "C4'" . DT  A 1 11  ? 57.980  25.397 81.590  1.00 32.41  ? 11  DT  C "C4'" 1 
ATOM   190  O "O4'" . DT  A 1 11  ? 59.038  26.082 80.882  1.00 35.98  ? 11  DT  C "O4'" 1 
ATOM   191  C "C3'" . DT  A 1 11  ? 57.718  26.223 82.849  1.00 32.96  ? 11  DT  C "C3'" 1 
ATOM   192  O "O3'" . DT  A 1 11  ? 58.494  25.692 83.932  1.00 40.96  ? 11  DT  C "O3'" 1 
ATOM   193  C "C2'" . DT  A 1 11  ? 58.183  27.608 82.441  1.00 20.06  ? 11  DT  C "C2'" 1 
ATOM   194  C "C1'" . DT  A 1 11  ? 59.376  27.264 81.579  1.00 27.18  ? 11  DT  C "C1'" 1 
ATOM   195  N N1    . DT  A 1 11  ? 59.795  28.276 80.598  1.00 25.65  ? 11  DT  C N1    1 
ATOM   196  C C2    . DT  A 1 11  ? 61.146  28.443 80.447  1.00 25.83  ? 11  DT  C C2    1 
ATOM   197  O O2    . DT  A 1 11  ? 61.965  27.750 81.011  1.00 33.38  ? 11  DT  C O2    1 
ATOM   198  N N3    . DT  A 1 11  ? 61.513  29.444 79.606  1.00 26.08  ? 11  DT  C N3    1 
ATOM   199  C C4    . DT  A 1 11  ? 60.687  30.271 78.891  1.00 33.90  ? 11  DT  C C4    1 
ATOM   200  O O4    . DT  A 1 11  ? 61.175  31.162 78.196  1.00 28.73  ? 11  DT  C O4    1 
ATOM   201  C C5    . DT  A 1 11  ? 59.270  30.007 79.046  1.00 28.00  ? 11  DT  C C5    1 
ATOM   202  C C7    . DT  A 1 11  ? 58.292  30.826 78.271  1.00 27.91  ? 11  DT  C C7    1 
ATOM   203  C C6    . DT  A 1 11  ? 58.897  29.034 79.886  1.00 23.31  ? 11  DT  C C6    1 
ATOM   204  P P     . DA  A 1 12  ? 58.259  26.225 85.429  1.00 43.24  ? 12  DA  C P     1 
ATOM   205  O OP1   . DA  A 1 12  ? 58.148  25.024 86.303  1.00 35.56  ? 12  DA  C OP1   1 
ATOM   206  O OP2   . DA  A 1 12  ? 57.174  27.231 85.416  1.00 46.18  ? 12  DA  C OP2   1 
ATOM   207  O "O5'" . DA  A 1 12  ? 59.617  26.974 85.775  1.00 41.45  ? 12  DA  C "O5'" 1 
ATOM   208  C "C5'" . DA  A 1 12  ? 60.839  26.256 85.699  1.00 36.76  ? 12  DA  C "C5'" 1 
ATOM   209  C "C4'" . DA  A 1 12  ? 62.030  27.171 85.847  1.00 30.95  ? 12  DA  C "C4'" 1 
ATOM   210  O "O4'" . DA  A 1 12  ? 62.294  27.928 84.637  1.00 33.05  ? 12  DA  C "O4'" 1 
ATOM   211  C "C3'" . DA  A 1 12  ? 61.955  28.175 86.989  1.00 32.77  ? 12  DA  C "C3'" 1 
ATOM   212  O "O3'" . DA  A 1 12  ? 63.108  28.071 87.806  1.00 23.70  ? 12  DA  C "O3'" 1 
ATOM   213  C "C2'" . DA  A 1 12  ? 61.912  29.529 86.292  1.00 34.17  ? 12  DA  C "C2'" 1 
ATOM   214  C "C1'" . DA  A 1 12  ? 62.631  29.261 84.978  1.00 29.95  ? 12  DA  C "C1'" 1 
ATOM   215  N N9    . DA  A 1 12  ? 62.237  30.132 83.860  1.00 35.68  ? 12  DA  C N9    1 
ATOM   216  C C8    . DA  A 1 12  ? 60.985  30.291 83.310  1.00 28.79  ? 12  DA  C C8    1 
ATOM   217  N N7    . DA  A 1 12  ? 60.943  31.167 82.341  1.00 23.92  ? 12  DA  C N7    1 
ATOM   218  C C5    . DA  A 1 12  ? 62.256  31.619 82.237  1.00 20.29  ? 12  DA  C C5    1 
ATOM   219  C C6    . DA  A 1 12  ? 62.872  32.565 81.387  1.00 25.53  ? 12  DA  C C6    1 
ATOM   220  N N6    . DA  A 1 12  ? 62.216  33.287 80.483  1.00 13.27  ? 12  DA  C N6    1 
ATOM   221  N N1    . DA  A 1 12  ? 64.200  32.746 81.509  1.00 23.81  ? 12  DA  C N1    1 
ATOM   222  C C2    . DA  A 1 12  ? 64.856  32.043 82.434  1.00 34.94  ? 12  DA  C C2    1 
ATOM   223  N N3    . DA  A 1 12  ? 64.391  31.147 83.307  1.00 32.92  ? 12  DA  C N3    1 
ATOM   224  C C4    . DA  A 1 12  ? 63.066  30.977 83.154  1.00 29.21  ? 12  DA  C C4    1 
ATOM   225  P P     . DT  A 1 13  ? 63.218  28.966 89.116  1.00 28.52  ? 13  DT  C P     1 
ATOM   226  O OP1   . DT  A 1 13  ? 64.049  28.264 90.115  1.00 40.64  ? 13  DT  C OP1   1 
ATOM   227  O OP2   . DT  A 1 13  ? 61.839  29.388 89.474  1.00 44.67  ? 13  DT  C OP2   1 
ATOM   228  O "O5'" . DT  A 1 13  ? 64.037  30.221 88.596  1.00 29.85  ? 13  DT  C "O5'" 1 
ATOM   229  C "C5'" . DT  A 1 13  ? 65.287  30.020 87.963  1.00 14.88  ? 13  DT  C "C5'" 1 
ATOM   230  C "C4'" . DT  A 1 13  ? 65.854  31.341 87.522  1.00 21.48  ? 13  DT  C "C4'" 1 
ATOM   231  O "O4'" . DT  A 1 13  ? 65.139  31.877 86.381  1.00 31.96  ? 13  DT  C "O4'" 1 
ATOM   232  C "C3'" . DT  A 1 13  ? 65.818  32.441 88.581  1.00 26.20  ? 13  DT  C "C3'" 1 
ATOM   233  O "O3'" . DT  A 1 13  ? 67.024  33.174 88.509  1.00 31.87  ? 13  DT  C "O3'" 1 
ATOM   234  C "C2'" . DT  A 1 13  ? 64.731  33.373 88.082  1.00 33.16  ? 13  DT  C "C2'" 1 
ATOM   235  C "C1'" . DT  A 1 13  ? 64.990  33.269 86.598  1.00 26.54  ? 13  DT  C "C1'" 1 
ATOM   236  N N1    . DT  A 1 13  ? 63.933  33.777 85.716  1.00 33.02  ? 13  DT  C N1    1 
ATOM   237  C C2    . DT  A 1 13  ? 64.293  34.730 84.786  1.00 33.51  ? 13  DT  C C2    1 
ATOM   238  O O2    . DT  A 1 13  ? 65.429  35.166 84.680  1.00 34.76  ? 13  DT  C O2    1 
ATOM   239  N N3    . DT  A 1 13  ? 63.265  35.167 83.986  1.00 33.81  ? 13  DT  C N3    1 
ATOM   240  C C4    . DT  A 1 13  ? 61.942  34.771 84.037  1.00 41.32  ? 13  DT  C C4    1 
ATOM   241  O O4    . DT  A 1 13  ? 61.128  35.273 83.265  1.00 40.61  ? 13  DT  C O4    1 
ATOM   242  C C5    . DT  A 1 13  ? 61.635  33.770 85.041  1.00 39.01  ? 13  DT  C C5    1 
ATOM   243  C C7    . DT  A 1 13  ? 60.228  33.281 85.174  1.00 34.69  ? 13  DT  C C7    1 
ATOM   244  C C6    . DT  A 1 13  ? 62.635  33.327 85.814  1.00 37.47  ? 13  DT  C C6    1 
ATOM   245  P P     . DA  A 1 14  ? 67.487  34.037 89.758  1.00 32.24  ? 14  DA  C P     1 
ATOM   246  O OP1   . DA  A 1 14  ? 68.375  33.170 90.575  1.00 35.88  ? 14  DA  C OP1   1 
ATOM   247  O OP2   . DA  A 1 14  ? 66.249  34.601 90.360  1.00 45.19  ? 14  DA  C OP2   1 
ATOM   248  O "O5'" . DA  A 1 14  ? 68.369  35.184 89.104  1.00 31.99  ? 14  DA  C "O5'" 1 
ATOM   249  C "C5'" . DA  A 1 14  ? 69.431  34.815 88.236  1.00 31.47  ? 14  DA  C "C5'" 1 
ATOM   250  C "C4'" . DA  A 1 14  ? 69.702  35.893 87.223  1.00 26.75  ? 14  DA  C "C4'" 1 
ATOM   251  O "O4'" . DA  A 1 14  ? 68.565  36.124 86.365  1.00 34.72  ? 14  DA  C "O4'" 1 
ATOM   252  C "C3'" . DA  A 1 14  ? 70.104  37.275 87.754  1.00 30.65  ? 14  DA  C "C3'" 1 
ATOM   253  O "O3'" . DA  A 1 14  ? 71.174  37.766 86.943  1.00 33.24  ? 14  DA  C "O3'" 1 
ATOM   254  C "C2'" . DA  A 1 14  ? 68.874  38.121 87.509  1.00 29.67  ? 14  DA  C "C2'" 1 
ATOM   255  C "C1'" . DA  A 1 14  ? 68.320  37.517 86.239  1.00 28.20  ? 14  DA  C "C1'" 1 
ATOM   256  N N9    . DA  A 1 14  ? 66.879  37.689 86.089  1.00 27.54  ? 14  DA  C N9    1 
ATOM   257  C C8    . DA  A 1 14  ? 65.914  37.040 86.811  1.00 24.59  ? 14  DA  C C8    1 
ATOM   258  N N7    . DA  A 1 14  ? 64.696  37.371 86.492  1.00 24.97  ? 14  DA  C N7    1 
ATOM   259  C C5    . DA  A 1 14  ? 64.859  38.312 85.484  1.00 29.78  ? 14  DA  C C5    1 
ATOM   260  C C6    . DA  A 1 14  ? 63.934  39.038 84.721  1.00 31.42  ? 14  DA  C C6    1 
ATOM   261  N N6    . DA  A 1 14  ? 62.619  38.924 84.882  1.00 37.33  ? 14  DA  C N6    1 
ATOM   262  N N1    . DA  A 1 14  ? 64.417  39.880 83.788  1.00 38.17  ? 14  DA  C N1    1 
ATOM   263  C C2    . DA  A 1 14  ? 65.739  39.980 83.638  1.00 37.14  ? 14  DA  C C2    1 
ATOM   264  N N3    . DA  A 1 14  ? 66.716  39.352 84.299  1.00 35.44  ? 14  DA  C N3    1 
ATOM   265  C C4    . DA  A 1 14  ? 66.200  38.517 85.221  1.00 30.68  ? 14  DA  C C4    1 
ATOM   266  P P     . DG  A 1 15  ? 71.897  39.134 87.325  1.00 39.40  ? 15  DG  C P     1 
ATOM   267  O OP1   . DG  A 1 15  ? 73.327  39.056 86.951  1.00 42.99  ? 15  DG  C OP1   1 
ATOM   268  O OP2   . DG  A 1 15  ? 71.529  39.398 88.734  1.00 50.52  ? 15  DG  C OP2   1 
ATOM   269  O "O5'" . DG  A 1 15  ? 71.189  40.181 86.364  1.00 37.99  ? 15  DG  C "O5'" 1 
ATOM   270  C "C5'" . DG  A 1 15  ? 71.097  39.892 84.967  1.00 26.86  ? 15  DG  C "C5'" 1 
ATOM   271  C "C4'" . DG  A 1 15  ? 70.616  41.093 84.203  1.00 30.07  ? 15  DG  C "C4'" 1 
ATOM   272  O "O4'" . DG  A 1 15  ? 69.203  41.312 84.281  1.00 26.65  ? 15  DG  C "O4'" 1 
ATOM   273  C "C3'" . DG  A 1 15  ? 71.232  42.426 84.591  1.00 29.67  ? 15  DG  C "C3'" 1 
ATOM   274  O "O3'" . DG  A 1 15  ? 71.207  43.173 83.386  1.00 41.48  ? 15  DG  C "O3'" 1 
ATOM   275  C "C2'" . DG  A 1 15  ? 70.205  42.979 85.560  1.00 20.15  ? 15  DG  C "C2'" 1 
ATOM   276  C "C1'" . DG  A 1 15  ? 68.941  42.584 84.847  1.00 19.54  ? 15  DG  C "C1'" 1 
ATOM   277  N N9    . DG  A 1 15  ? 67.756  42.392 85.653  1.00 29.11  ? 15  DG  C N9    1 
ATOM   278  C C8    . DG  A 1 15  ? 67.633  41.594 86.766  1.00 24.52  ? 15  DG  C C8    1 
ATOM   279  N N7    . DG  A 1 15  ? 66.396  41.420 87.123  1.00 30.82  ? 15  DG  C N7    1 
ATOM   280  C C5    . DG  A 1 15  ? 65.668  42.186 86.226  1.00 33.71  ? 15  DG  C C5    1 
ATOM   281  C C6    . DG  A 1 15  ? 64.268  42.365 86.085  1.00 29.87  ? 15  DG  C C6    1 
ATOM   282  O O6    . DG  A 1 15  ? 63.356  41.807 86.689  1.00 33.13  ? 15  DG  C O6    1 
ATOM   283  N N1    . DG  A 1 15  ? 63.965  43.282 85.090  1.00 22.27  ? 15  DG  C N1    1 
ATOM   284  C C2    . DG  A 1 15  ? 64.884  43.894 84.281  1.00 23.52  ? 15  DG  C C2    1 
ATOM   285  N N2    . DG  A 1 15  ? 64.398  44.721 83.370  1.00 27.02  ? 15  DG  C N2    1 
ATOM   286  N N3    . DG  A 1 15  ? 66.186  43.699 84.367  1.00 36.90  ? 15  DG  C N3    1 
ATOM   287  C C4    . DG  A 1 15  ? 66.504  42.845 85.361  1.00 34.17  ? 15  DG  C C4    1 
ATOM   288  P P     . DC  A 1 16  ? 72.407  44.135 83.043  1.00 51.19  ? 16  DC  C P     1 
ATOM   289  O OP1   . DC  A 1 16  ? 72.894  43.770 81.696  1.00 51.49  ? 16  DC  C OP1   1 
ATOM   290  O OP2   . DC  A 1 16  ? 73.329  44.077 84.191  1.00 57.72  ? 16  DC  C OP2   1 
ATOM   291  O "O5'" . DC  A 1 16  ? 71.694  45.560 83.050  1.00 64.75  ? 16  DC  C "O5'" 1 
ATOM   292  C "C5'" . DC  A 1 16  ? 70.655  45.829 84.004  1.00 62.86  ? 16  DC  C "C5'" 1 
ATOM   293  C "C4'" . DC  A 1 16  ? 69.767  46.935 83.500  1.00 62.85  ? 16  DC  C "C4'" 1 
ATOM   294  O "O4'" . DC  A 1 16  ? 68.396  46.609 83.829  1.00 60.38  ? 16  DC  C "O4'" 1 
ATOM   295  C "C3'" . DC  A 1 16  ? 70.052  48.284 84.165  1.00 66.13  ? 16  DC  C "C3'" 1 
ATOM   296  O "O3'" . DC  A 1 16  ? 69.920  49.351 83.214  1.00 70.10  ? 16  DC  C "O3'" 1 
ATOM   297  C "C2'" . DC  A 1 16  ? 69.019  48.361 85.277  1.00 58.30  ? 16  DC  C "C2'" 1 
ATOM   298  C "C1'" . DC  A 1 16  ? 67.844  47.570 84.719  1.00 58.41  ? 16  DC  C "C1'" 1 
ATOM   299  N N1    . DC  A 1 16  ? 67.054  46.834 85.735  1.00 58.18  ? 16  DC  C N1    1 
ATOM   300  C C2    . DC  A 1 16  ? 65.652  46.845 85.645  1.00 50.67  ? 16  DC  C C2    1 
ATOM   301  O O2    . DC  A 1 16  ? 65.117  47.475 84.725  1.00 65.11  ? 16  DC  C O2    1 
ATOM   302  N N3    . DC  A 1 16  ? 64.918  46.169 86.571  1.00 36.49  ? 16  DC  C N3    1 
ATOM   303  C C4    . DC  A 1 16  ? 65.528  45.507 87.557  1.00 43.26  ? 16  DC  C C4    1 
ATOM   304  N N4    . DC  A 1 16  ? 64.764  44.852 88.457  1.00 22.72  ? 16  DC  C N4    1 
ATOM   305  C C5    . DC  A 1 16  ? 66.947  45.482 87.672  1.00 47.81  ? 16  DC  C C5    1 
ATOM   306  C C6    . DC  A 1 16  ? 67.667  46.151 86.748  1.00 55.50  ? 16  DC  C C6    1 
ATOM   307  P P     . DA  A 1 17  ? 70.008  50.850 83.705  1.00 96.13  ? 17  DA  C P     1 
ATOM   308  O OP1   . DA  A 1 17  ? 69.769  51.753 82.551  1.00 98.72  ? 17  DA  C OP1   1 
ATOM   309  O OP2   . DA  A 1 17  ? 71.221  51.030 84.528  1.00 86.12  ? 17  DA  C OP2   1 
ATOM   310  O "O5'" . DA  A 1 17  ? 68.768  50.953 84.676  1.00 100.62 ? 17  DA  C "O5'" 1 
ATOM   311  C "C5'" . DA  A 1 17  ? 68.274  52.201 85.038  1.00 100.62 ? 17  DA  C "C5'" 1 
ATOM   312  C "C4'" . DA  A 1 17  ? 66.989  52.462 84.306  1.00 100.62 ? 17  DA  C "C4'" 1 
ATOM   313  O "O4'" . DA  A 1 17  ? 66.035  51.457 84.696  1.00 100.62 ? 17  DA  C "O4'" 1 
ATOM   314  C "C3'" . DA  A 1 17  ? 66.389  53.779 84.736  1.00 100.62 ? 17  DA  C "C3'" 1 
ATOM   315  O "O3'" . DA  A 1 17  ? 65.562  54.266 83.663  1.00 100.62 ? 17  DA  C "O3'" 1 
ATOM   316  C "C2'" . DA  A 1 17  ? 65.696  53.381 86.032  1.00 98.76  ? 17  DA  C "C2'" 1 
ATOM   317  C "C1'" . DA  A 1 17  ? 65.268  51.936 85.788  1.00 95.32  ? 17  DA  C "C1'" 1 
ATOM   318  N N9    . DA  A 1 17  ? 65.551  51.059 86.920  1.00 84.02  ? 17  DA  C N9    1 
ATOM   319  C C8    . DA  A 1 17  ? 66.711  50.988 87.651  1.00 79.50  ? 17  DA  C C8    1 
ATOM   320  N N7    . DA  A 1 17  ? 66.686  50.074 88.590  1.00 85.55  ? 17  DA  C N7    1 
ATOM   321  C C5    . DA  A 1 17  ? 65.421  49.515 88.478  1.00 78.32  ? 17  DA  C C5    1 
ATOM   322  C C6    . DA  A 1 17  ? 64.768  48.498 89.192  1.00 67.24  ? 17  DA  C C6    1 
ATOM   323  N N6    . DA  A 1 17  ? 65.311  47.838 90.218  1.00 59.25  ? 17  DA  C N6    1 
ATOM   324  N N1    . DA  A 1 17  ? 63.513  48.181 88.813  1.00 56.89  ? 17  DA  C N1    1 
ATOM   325  C C2    . DA  A 1 17  ? 62.963  48.852 87.795  1.00 72.83  ? 17  DA  C C2    1 
ATOM   326  N N3    . DA  A 1 17  ? 63.463  49.826 87.059  1.00 77.41  ? 17  DA  C N3    1 
ATOM   327  C C4    . DA  A 1 17  ? 64.714  50.116 87.456  1.00 83.89  ? 17  DA  C C4    1 
ATOM   328  P P     . DT  A 1 18  ? 64.328  55.241 83.974  1.00 45.94  ? 18  DT  C P     1 
ATOM   329  O OP1   . DT  A 1 18  ? 63.252  54.938 83.006  1.00 58.70  ? 18  DT  C OP1   1 
ATOM   330  O OP2   . DT  A 1 18  ? 64.809  56.633 84.116  1.00 53.92  ? 18  DT  C OP2   1 
ATOM   331  O "O5'" . DT  A 1 18  ? 63.832  54.723 85.389  1.00 40.16  ? 18  DT  C "O5'" 1 
ATOM   332  C "C5'" . DT  A 1 18  ? 64.019  55.480 86.565  1.00 46.80  ? 18  DT  C "C5'" 1 
ATOM   333  C "C4'" . DT  A 1 18  ? 62.899  55.178 87.514  1.00 50.59  ? 18  DT  C "C4'" 1 
ATOM   334  O "O4'" . DT  A 1 18  ? 63.022  53.867 88.128  1.00 40.20  ? 18  DT  C "O4'" 1 
ATOM   335  C "C3'" . DT  A 1 18  ? 62.710  56.169 88.642  1.00 52.56  ? 18  DT  C "C3'" 1 
ATOM   336  O "O3'" . DT  A 1 18  ? 61.364  56.647 88.543  1.00 37.36  ? 18  DT  C "O3'" 1 
ATOM   337  C "C2'" . DT  A 1 18  ? 62.993  55.351 89.907  1.00 51.28  ? 18  DT  C "C2'" 1 
ATOM   338  C "C1'" . DT  A 1 18  ? 62.587  53.949 89.478  1.00 51.00  ? 18  DT  C "C1'" 1 
ATOM   339  N N1    . DT  A 1 18  ? 63.199  52.809 90.232  1.00 53.87  ? 18  DT  C N1    1 
ATOM   340  C C2    . DT  A 1 18  ? 62.385  51.827 90.807  1.00 37.32  ? 18  DT  C C2    1 
ATOM   341  O O2    . DT  A 1 18  ? 61.163  51.836 90.729  1.00 55.32  ? 18  DT  C O2    1 
ATOM   342  N N3    . DT  A 1 18  ? 63.073  50.833 91.471  1.00 43.44  ? 18  DT  C N3    1 
ATOM   343  C C4    . DT  A 1 18  ? 64.441  50.718 91.605  1.00 41.14  ? 18  DT  C C4    1 
ATOM   344  O O4    . DT  A 1 18  ? 64.921  49.767 92.237  1.00 44.12  ? 18  DT  C O4    1 
ATOM   345  C C5    . DT  A 1 18  ? 65.219  51.761 90.973  1.00 54.88  ? 18  DT  C C5    1 
ATOM   346  C C7    . DT  A 1 18  ? 66.705  51.700 91.047  1.00 62.10  ? 18  DT  C C7    1 
ATOM   347  C C6    . DT  A 1 18  ? 64.565  52.739 90.338  1.00 46.08  ? 18  DT  C C6    1 
ATOM   348  P P     . DA  A 1 19  ? 60.861  57.795 89.530  1.00 41.21  ? 19  DA  C P     1 
ATOM   349  O OP1   . DA  A 1 19  ? 60.194  58.921 88.824  1.00 40.53  ? 19  DA  C OP1   1 
ATOM   350  O OP2   . DA  A 1 19  ? 62.083  58.048 90.304  1.00 62.25  ? 19  DA  C OP2   1 
ATOM   351  O "O5'" . DA  A 1 19  ? 59.829  57.047 90.486  1.00 32.84  ? 19  DA  C "O5'" 1 
ATOM   352  C "C5'" . DA  A 1 19  ? 58.429  57.192 90.301  1.00 34.37  ? 19  DA  C "C5'" 1 
ATOM   353  C "C4'" . DA  A 1 19  ? 57.726  56.194 91.174  1.00 48.60  ? 19  DA  C "C4'" 1 
ATOM   354  O "O4'" . DA  A 1 19  ? 58.747  55.213 91.499  1.00 58.72  ? 19  DA  C "O4'" 1 
ATOM   355  C "C3'" . DA  A 1 19  ? 57.259  56.753 92.517  1.00 38.24  ? 19  DA  C "C3'" 1 
ATOM   356  O "O3'" . DA  A 1 19  ? 56.070  56.050 92.893  1.00 54.81  ? 19  DA  C "O3'" 1 
ATOM   357  C "C2'" . DA  A 1 19  ? 58.402  56.415 93.459  1.00 34.88  ? 19  DA  C "C2'" 1 
ATOM   358  C "C1'" . DA  A 1 19  ? 58.854  55.082 92.911  1.00 53.72  ? 19  DA  C "C1'" 1 
ATOM   359  N N9    . DA  A 1 19  ? 60.235  54.721 93.261  1.00 35.20  ? 19  DA  C N9    1 
ATOM   360  C C8    . DA  A 1 19  ? 61.385  55.413 92.973  1.00 50.48  ? 19  DA  C C8    1 
ATOM   361  N N7    . DA  A 1 19  ? 62.475  54.856 93.449  1.00 62.36  ? 19  DA  C N7    1 
ATOM   362  C C5    . DA  A 1 19  ? 62.019  53.709 94.083  1.00 44.99  ? 19  DA  C C5    1 
ATOM   363  C C6    . DA  A 1 19  ? 62.689  52.683 94.783  1.00 50.24  ? 19  DA  C C6    1 
ATOM   364  N N6    . DA  A 1 19  ? 64.014  52.647 94.957  1.00 48.20  ? 19  DA  C N6    1 
ATOM   365  N N1    . DA  A 1 19  ? 61.940  51.689 95.299  1.00 59.95  ? 19  DA  C N1    1 
ATOM   366  C C2    . DA  A 1 19  ? 60.614  51.727 95.126  1.00 46.52  ? 19  DA  C C2    1 
ATOM   367  N N3    . DA  A 1 19  ? 59.870  52.632 94.487  1.00 44.20  ? 19  DA  C N3    1 
ATOM   368  C C4    . DA  A 1 19  ? 60.640  53.611 93.977  1.00 52.48  ? 19  DA  C C4    1 
ATOM   369  P P     . DT  A 1 20  ? 55.154  56.610 94.072  1.00 47.80  ? 20  DT  C P     1 
ATOM   370  O OP1   . DT  A 1 20  ? 53.743  56.478 93.642  1.00 39.84  ? 20  DT  C OP1   1 
ATOM   371  O OP2   . DT  A 1 20  ? 55.687  57.940 94.422  1.00 50.41  ? 20  DT  C OP2   1 
ATOM   372  O "O5'" . DT  A 1 20  ? 55.431  55.641 95.311  1.00 49.37  ? 20  DT  C "O5'" 1 
ATOM   373  C "C5'" . DT  A 1 20  ? 56.763  55.228 95.616  1.00 50.04  ? 20  DT  C "C5'" 1 
ATOM   374  C "C4'" . DT  A 1 20  ? 56.818  54.570 96.974  1.00 49.09  ? 20  DT  C "C4'" 1 
ATOM   375  O "O4'" . DT  A 1 20  ? 58.124  53.991 97.171  1.00 47.72  ? 20  DT  C "O4'" 1 
ATOM   376  C "C3'" . DT  A 1 20  ? 56.602  55.495 98.174  1.00 46.60  ? 20  DT  C "C3'" 1 
ATOM   377  O "O3'" . DT  A 1 20  ? 55.906  54.765 99.197  1.00 29.92  ? 20  DT  C "O3'" 1 
ATOM   378  C "C2'" . DT  A 1 20  ? 58.018  55.864 98.578  1.00 49.24  ? 20  DT  C "C2'" 1 
ATOM   379  C "C1'" . DT  A 1 20  ? 58.793  54.599 98.265  1.00 41.39  ? 20  DT  C "C1'" 1 
ATOM   380  N N1    . DT  A 1 20  ? 60.188  54.811 97.854  1.00 36.45  ? 20  DT  C N1    1 
ATOM   381  C C2    . DT  A 1 20  ? 61.081  53.789 98.079  1.00 51.56  ? 20  DT  C C2    1 
ATOM   382  O O2    . DT  A 1 20  ? 60.778  52.755 98.656  1.00 48.75  ? 20  DT  C O2    1 
ATOM   383  N N3    . DT  A 1 20  ? 62.348  54.028 97.609  1.00 42.08  ? 20  DT  C N3    1 
ATOM   384  C C4    . DT  A 1 20  ? 62.802  55.161 96.969  1.00 57.12  ? 20  DT  C C4    1 
ATOM   385  O O4    . DT  A 1 20  ? 63.969  55.216 96.586  1.00 43.64  ? 20  DT  C O4    1 
ATOM   386  C C5    . DT  A 1 20  ? 61.824  56.209 96.792  1.00 49.07  ? 20  DT  C C5    1 
ATOM   387  C C7    . DT  A 1 20  ? 62.231  57.477 96.118  1.00 41.19  ? 20  DT  C C7    1 
ATOM   388  C C6    . DT  A 1 20  ? 60.578  55.982 97.242  1.00 54.92  ? 20  DT  C C6    1 
ATOM   389  P P     . DG  A 1 21  ? 55.185  55.557 100.400 1.00 41.44  ? 21  DG  C P     1 
ATOM   390  O OP1   . DG  A 1 21  ? 53.798  55.060 100.506 1.00 42.44  ? 21  DG  C OP1   1 
ATOM   391  O OP2   . DG  A 1 21  ? 55.428  56.999 100.194 1.00 39.72  ? 21  DG  C OP2   1 
ATOM   392  O "O5'" . DG  A 1 21  ? 55.998  55.104 101.691 1.00 40.01  ? 21  DG  C "O5'" 1 
ATOM   393  C "C5'" . DG  A 1 21  ? 55.406  54.254 102.665 1.00 40.68  ? 21  DG  C "C5'" 1 
ATOM   394  C "C4'" . DG  A 1 21  ? 56.269  53.030 102.878 1.00 32.88  ? 21  DG  C "C4'" 1 
ATOM   395  O "O4'" . DG  A 1 21  ? 57.648  53.404 103.094 1.00 48.20  ? 21  DG  C "O4'" 1 
ATOM   396  C "C3'" . DG  A 1 21  ? 55.881  52.195 104.099 1.00 48.32  ? 21  DG  C "C3'" 1 
ATOM   397  O "O3'" . DG  A 1 21  ? 56.077  50.812 103.855 1.00 41.53  ? 21  DG  C "O3'" 1 
ATOM   398  C "C2'" . DG  A 1 21  ? 56.859  52.639 105.159 1.00 30.64  ? 21  DG  C "C2'" 1 
ATOM   399  C "C1'" . DG  A 1 21  ? 58.102  52.864 104.329 1.00 45.20  ? 21  DG  C "C1'" 1 
ATOM   400  N N9    . DG  A 1 21  ? 58.991  53.835 104.948 1.00 52.13  ? 21  DG  C N9    1 
ATOM   401  C C8    . DG  A 1 21  ? 58.633  55.055 105.477 1.00 37.48  ? 21  DG  C C8    1 
ATOM   402  N N7    . DG  A 1 21  ? 59.628  55.685 106.017 1.00 33.68  ? 21  DG  C N7    1 
ATOM   403  C C5    . DG  A 1 21  ? 60.714  54.845 105.822 1.00 34.38  ? 21  DG  C C5    1 
ATOM   404  C C6    . DG  A 1 21  ? 62.061  54.999 106.199 1.00 58.41  ? 21  DG  C C6    1 
ATOM   405  O O6    . DG  A 1 21  ? 62.586  55.937 106.808 1.00 55.91  ? 21  DG  C O6    1 
ATOM   406  N N1    . DG  A 1 21  ? 62.834  53.914 105.802 1.00 53.96  ? 21  DG  C N1    1 
ATOM   407  C C2    . DG  A 1 21  ? 62.362  52.816 105.120 1.00 48.49  ? 21  DG  C C2    1 
ATOM   408  N N2    . DG  A 1 21  ? 63.262  51.878 104.809 1.00 24.76  ? 21  DG  C N2    1 
ATOM   409  N N3    . DG  A 1 21  ? 61.097  52.659 104.767 1.00 54.25  ? 21  DG  C N3    1 
ATOM   410  C C4    . DG  A 1 21  ? 60.338  53.708 105.149 1.00 51.16  ? 21  DG  C C4    1 
ATOM   411  P P     . DC  A 1 22  ? 55.326  49.739 104.771 1.00 57.03  ? 22  DC  C P     1 
ATOM   412  O OP1   . DC  A 1 22  ? 54.764  48.705 103.887 1.00 69.54  ? 22  DC  C OP1   1 
ATOM   413  O OP2   . DC  A 1 22  ? 54.457  50.445 105.720 1.00 67.71  ? 22  DC  C OP2   1 
ATOM   414  O "O5'" . DC  A 1 22  ? 56.476  49.054 105.620 1.00 52.12  ? 22  DC  C "O5'" 1 
ATOM   415  C "C5'" . DC  A 1 22  ? 56.788  47.691 105.381 1.00 46.24  ? 22  DC  C "C5'" 1 
ATOM   416  C "C4'" . DC  A 1 22  ? 58.253  47.430 105.621 1.00 37.28  ? 22  DC  C "C4'" 1 
ATOM   417  O "O4'" . DC  A 1 22  ? 59.022  48.644 105.779 1.00 37.41  ? 22  DC  C "O4'" 1 
ATOM   418  C "C3'" . DC  A 1 22  ? 58.502  46.626 106.892 1.00 35.70  ? 22  DC  C "C3'" 1 
ATOM   419  O "O3'" . DC  A 1 22  ? 59.534  45.693 106.625 1.00 27.50  ? 22  DC  C "O3'" 1 
ATOM   420  C "C2'" . DC  A 1 22  ? 59.044  47.656 107.857 1.00 37.38  ? 22  DC  C "C2'" 1 
ATOM   421  C "C1'" . DC  A 1 22  ? 59.860  48.479 106.907 1.00 38.22  ? 22  DC  C "C1'" 1 
ATOM   422  N N1    . DC  A 1 22  ? 60.232  49.801 107.424 1.00 39.13  ? 22  DC  C N1    1 
ATOM   423  C C2    . DC  A 1 22  ? 61.585  50.050 107.700 1.00 44.23  ? 22  DC  C C2    1 
ATOM   424  O O2    . DC  A 1 22  ? 62.421  49.177 107.436 1.00 55.49  ? 22  DC  C O2    1 
ATOM   425  N N3    . DC  A 1 22  ? 61.936  51.225 108.250 1.00 43.23  ? 22  DC  C N3    1 
ATOM   426  C C4    . DC  A 1 22  ? 61.007  52.131 108.523 1.00 43.36  ? 22  DC  C C4    1 
ATOM   427  N N4    . DC  A 1 22  ? 61.403  53.249 109.118 1.00 43.79  ? 22  DC  C N4    1 
ATOM   428  C C5    . DC  A 1 22  ? 59.629  51.924 108.214 1.00 46.37  ? 22  DC  C C5    1 
ATOM   429  C C6    . DC  A 1 22  ? 59.289  50.759 107.662 1.00 40.08  ? 22  DC  C C6    1 
ATOM   430  P P     . DT  A 1 23  ? 59.735  44.461 107.606 1.00 35.73  ? 23  DT  C P     1 
ATOM   431  O OP1   . DT  A 1 23  ? 59.924  43.243 106.779 1.00 33.85  ? 23  DT  C OP1   1 
ATOM   432  O OP2   . DT  A 1 23  ? 58.639  44.506 108.605 1.00 40.58  ? 23  DT  C OP2   1 
ATOM   433  O "O5'" . DT  A 1 23  ? 61.085  44.821 108.368 1.00 47.58  ? 23  DT  C "O5'" 1 
ATOM   434  C "C5'" . DT  A 1 23  ? 62.299  44.954 107.640 1.00 53.48  ? 23  DT  C "C5'" 1 
ATOM   435  C "C4'" . DT  A 1 23  ? 63.410  45.401 108.546 1.00 53.79  ? 23  DT  C "C4'" 1 
ATOM   436  O "O4'" . DT  A 1 23  ? 63.327  46.801 108.889 1.00 47.57  ? 23  DT  C "O4'" 1 
ATOM   437  C "C3'" . DT  A 1 23  ? 63.479  44.658 109.878 1.00 54.39  ? 23  DT  C "C3'" 1 
ATOM   438  O "O3'" . DT  A 1 23  ? 64.862  44.433 110.135 1.00 61.45  ? 23  DT  C "O3'" 1 
ATOM   439  C "C2'" . DT  A 1 23  ? 62.940  45.672 110.869 1.00 40.64  ? 23  DT  C "C2'" 1 
ATOM   440  C "C1'" . DT  A 1 23  ? 63.528  46.932 110.278 1.00 35.62  ? 23  DT  C "C1'" 1 
ATOM   441  N N1    . DT  A 1 23  ? 62.937  48.199 110.700 1.00 25.20  ? 23  DT  C N1    1 
ATOM   442  C C2    . DT  A 1 23  ? 63.807  49.221 111.005 1.00 24.88  ? 23  DT  C C2    1 
ATOM   443  O O2    . DT  A 1 23  ? 65.013  49.123 110.895 1.00 39.81  ? 23  DT  C O2    1 
ATOM   444  N N3    . DT  A 1 23  ? 63.218  50.360 111.444 1.00 14.10  ? 23  DT  C N3    1 
ATOM   445  C C4    . DT  A 1 23  ? 61.878  50.591 111.603 1.00 27.40  ? 23  DT  C C4    1 
ATOM   446  O O4    . DT  A 1 23  ? 61.519  51.693 112.032 1.00 27.36  ? 23  DT  C O4    1 
ATOM   447  C C5    . DT  A 1 23  ? 61.003  49.469 111.242 1.00 26.60  ? 23  DT  C C5    1 
ATOM   448  C C7    . DT  A 1 23  ? 59.523  49.595 111.375 1.00 29.82  ? 23  DT  C C7    1 
ATOM   449  C C6    . DT  A 1 23  ? 61.583  48.351 110.806 1.00 25.24  ? 23  DT  C C6    1 
ATOM   450  P P     . DA  A 1 24  ? 65.306  43.412 111.277 1.00 71.67  ? 24  DA  C P     1 
ATOM   451  O OP1   . DA  A 1 24  ? 65.751  42.187 110.589 1.00 73.66  ? 24  DA  C OP1   1 
ATOM   452  O OP2   . DA  A 1 24  ? 64.231  43.339 112.297 1.00 67.17  ? 24  DA  C OP2   1 
ATOM   453  O "O5'" . DA  A 1 24  ? 66.558  44.153 111.910 1.00 70.10  ? 24  DA  C "O5'" 1 
ATOM   454  C "C5'" . DA  A 1 24  ? 67.449  44.906 111.082 1.00 62.03  ? 24  DA  C "C5'" 1 
ATOM   455  C "C4'" . DA  A 1 24  ? 68.116  45.987 111.887 1.00 58.90  ? 24  DA  C "C4'" 1 
ATOM   456  O "O4'" . DA  A 1 24  ? 67.198  47.091 112.108 1.00 46.96  ? 24  DA  C "O4'" 1 
ATOM   457  C "C3'" . DA  A 1 24  ? 68.562  45.511 113.274 1.00 56.90  ? 24  DA  C "C3'" 1 
ATOM   458  O "O3'" . DA  A 1 24  ? 69.911  45.929 113.553 1.00 62.02  ? 24  DA  C "O3'" 1 
ATOM   459  C "C2'" . DA  A 1 24  ? 67.563  46.162 114.218 1.00 49.12  ? 24  DA  C "C2'" 1 
ATOM   460  C "C1'" . DA  A 1 24  ? 67.171  47.432 113.483 1.00 37.31  ? 24  DA  C "C1'" 1 
ATOM   461  N N9    . DA  A 1 24  ? 65.822  47.890 113.816 1.00 28.47  ? 24  DA  C N9    1 
ATOM   462  C C8    . DA  A 1 24  ? 64.639  47.208 113.677 1.00 31.16  ? 24  DA  C C8    1 
ATOM   463  N N7    . DA  A 1 24  ? 63.595  47.857 114.134 1.00 30.24  ? 24  DA  C N7    1 
ATOM   464  C C5    . DA  A 1 24  ? 64.121  49.060 114.590 1.00 27.34  ? 24  DA  C C5    1 
ATOM   465  C C6    . DA  A 1 24  ? 63.526  50.198 115.191 1.00 31.02  ? 24  DA  C C6    1 
ATOM   466  N N6    . DA  A 1 24  ? 62.221  50.313 115.434 1.00 33.03  ? 24  DA  C N6    1 
ATOM   467  N N1    . DA  A 1 24  ? 64.336  51.221 115.524 1.00 26.68  ? 24  DA  C N1    1 
ATOM   468  C C2    . DA  A 1 24  ? 65.637  51.116 115.263 1.00 24.04  ? 24  DA  C C2    1 
ATOM   469  N N3    . DA  A 1 24  ? 66.313  50.108 114.704 1.00 24.66  ? 24  DA  C N3    1 
ATOM   470  C C4    . DA  A 1 24  ? 65.489  49.100 114.387 1.00 27.00  ? 24  DA  C C4    1 
ATOM   471  P P     . DT  A 1 25  ? 70.711  45.286 114.792 1.00 63.30  ? 25  DT  C P     1 
ATOM   472  O OP1   . DT  A 1 25  ? 71.988  44.718 114.301 1.00 59.04  ? 25  DT  C OP1   1 
ATOM   473  O OP2   . DT  A 1 25  ? 69.806  44.452 115.611 1.00 52.35  ? 25  DT  C OP2   1 
ATOM   474  O "O5'" . DT  A 1 25  ? 71.058  46.563 115.662 1.00 63.03  ? 25  DT  C "O5'" 1 
ATOM   475  C "C5'" . DT  A 1 25  ? 71.517  47.756 115.040 1.00 57.64  ? 25  DT  C "C5'" 1 
ATOM   476  C "C4'" . DT  A 1 25  ? 71.326  48.924 115.967 1.00 54.69  ? 25  DT  C "C4'" 1 
ATOM   477  O "O4'" . DT  A 1 25  ? 69.922  49.254 116.095 1.00 53.12  ? 25  DT  C "O4'" 1 
ATOM   478  C "C3'" . DT  A 1 25  ? 71.828  48.662 117.397 1.00 50.32  ? 25  DT  C "C3'" 1 
ATOM   479  O "O3'" . DT  A 1 25  ? 72.450  49.865 117.884 1.00 52.08  ? 25  DT  C "O3'" 1 
ATOM   480  C "C2'" . DT  A 1 25  ? 70.554  48.351 118.147 1.00 48.74  ? 25  DT  C "C2'" 1 
ATOM   481  C "C1'" . DT  A 1 25  ? 69.582  49.296 117.470 1.00 40.80  ? 25  DT  C "C1'" 1 
ATOM   482  N N1    . DT  A 1 25  ? 68.138  48.982 117.619 1.00 25.71  ? 25  DT  C N1    1 
ATOM   483  C C2    . DT  A 1 25  ? 67.337  49.977 118.129 1.00 25.40  ? 25  DT  C C2    1 
ATOM   484  O O2    . DT  A 1 25  ? 67.754  51.094 118.401 1.00 23.81  ? 25  DT  C O2    1 
ATOM   485  N N3    . DT  A 1 25  ? 66.012  49.618 118.294 1.00 29.65  ? 25  DT  C N3    1 
ATOM   486  C C4    . DT  A 1 25  ? 65.426  48.407 117.980 1.00 30.89  ? 25  DT  C C4    1 
ATOM   487  O O4    . DT  A 1 25  ? 64.220  48.231 118.181 1.00 36.85  ? 25  DT  C O4    1 
ATOM   488  C C5    . DT  A 1 25  ? 66.316  47.417 117.419 1.00 25.11  ? 25  DT  C C5    1 
ATOM   489  C C7    . DT  A 1 25  ? 65.759  46.090 117.027 1.00 13.80  ? 25  DT  C C7    1 
ATOM   490  C C6    . DT  A 1 25  ? 67.617  47.749 117.276 1.00 35.20  ? 25  DT  C C6    1 
ATOM   491  P P     . DA  A 1 26  ? 73.134  49.879 119.340 1.00 45.54  ? 26  DA  C P     1 
ATOM   492  O OP1   . DA  A 1 26  ? 74.469  50.518 119.227 1.00 55.70  ? 26  DA  C OP1   1 
ATOM   493  O OP2   . DA  A 1 26  ? 73.027  48.514 119.924 1.00 55.91  ? 26  DA  C OP2   1 
ATOM   494  O "O5'" . DA  A 1 26  ? 72.169  50.823 120.182 1.00 44.15  ? 26  DA  C "O5'" 1 
ATOM   495  C "C5'" . DA  A 1 26  ? 71.969  52.171 119.811 1.00 43.11  ? 26  DA  C "C5'" 1 
ATOM   496  C "C4'" . DA  A 1 26  ? 71.171  52.879 120.882 1.00 43.62  ? 26  DA  C "C4'" 1 
ATOM   497  O "O4'" . DA  A 1 26  ? 69.790  52.437 120.856 1.00 45.85  ? 26  DA  C "O4'" 1 
ATOM   498  C "C3'" . DA  A 1 26  ? 71.666  52.620 122.306 1.00 42.12  ? 26  DA  C "C3'" 1 
ATOM   499  O "O3'" . DA  A 1 26  ? 71.580  53.825 123.070 1.00 42.05  ? 26  DA  C "O3'" 1 
ATOM   500  C "C2'" . DA  A 1 26  ? 70.689  51.583 122.849 1.00 38.99  ? 26  DA  C "C2'" 1 
ATOM   501  C "C1'" . DA  A 1 26  ? 69.390  51.921 122.130 1.00 38.38  ? 26  DA  C "C1'" 1 
ATOM   502  N N9    . DA  A 1 26  ? 68.478  50.783 121.893 1.00 45.35  ? 26  DA  C N9    1 
ATOM   503  C C8    . DA  A 1 26  ? 68.808  49.578 121.312 1.00 40.99  ? 26  DA  C C8    1 
ATOM   504  N N7    . DA  A 1 26  ? 67.795  48.751 121.194 1.00 38.61  ? 26  DA  C N7    1 
ATOM   505  C C5    . DA  A 1 26  ? 66.721  49.451 121.729 1.00 18.82  ? 26  DA  C C5    1 
ATOM   506  C C6    . DA  A 1 26  ? 65.371  49.114 121.876 1.00 18.66  ? 26  DA  C C6    1 
ATOM   507  N N6    . DA  A 1 26  ? 64.861  47.957 121.461 1.00 29.51  ? 26  DA  C N6    1 
ATOM   508  N N1    . DA  A 1 26  ? 64.555  50.013 122.460 1.00 14.45  ? 26  DA  C N1    1 
ATOM   509  C C2    . DA  A 1 26  ? 65.078  51.178 122.865 1.00 29.69  ? 26  DA  C C2    1 
ATOM   510  N N3    . DA  A 1 26  ? 66.334  51.620 122.773 1.00 22.90  ? 26  DA  C N3    1 
ATOM   511  C C4    . DA  A 1 26  ? 67.123  50.699 122.182 1.00 27.18  ? 26  DA  C C4    1 
ATOM   512  P P     . DC  A 1 27  ? 72.376  53.948 124.451 1.00 37.28  ? 27  DC  C P     1 
ATOM   513  O OP1   . DC  A 1 27  ? 72.734  55.370 124.626 1.00 53.17  ? 27  DC  C OP1   1 
ATOM   514  O OP2   . DC  A 1 27  ? 73.433  52.907 124.464 1.00 48.52  ? 27  DC  C OP2   1 
ATOM   515  O "O5'" . DC  A 1 27  ? 71.303  53.573 125.557 1.00 34.71  ? 27  DC  C "O5'" 1 
ATOM   516  C "C5'" . DC  A 1 27  ? 70.097  54.304 125.646 1.00 40.15  ? 27  DC  C "C5'" 1 
ATOM   517  C "C4'" . DC  A 1 27  ? 69.243  53.739 126.746 1.00 46.40  ? 27  DC  C "C4'" 1 
ATOM   518  O "O4'" . DC  A 1 27  ? 68.385  52.701 126.206 1.00 50.31  ? 27  DC  C "O4'" 1 
ATOM   519  C "C3'" . DC  A 1 27  ? 70.029  53.092 127.885 1.00 42.98  ? 27  DC  C "C3'" 1 
ATOM   520  O "O3'" . DC  A 1 27  ? 69.387  53.428 129.103 1.00 52.35  ? 27  DC  C "O3'" 1 
ATOM   521  C "C2'" . DC  A 1 27  ? 69.861  51.606 127.627 1.00 42.46  ? 27  DC  C "C2'" 1 
ATOM   522  C "C1'" . DC  A 1 27  ? 68.462  51.570 127.050 1.00 45.62  ? 27  DC  C "C1'" 1 
ATOM   523  N N1    . DC  A 1 27  ? 68.114  50.375 126.260 1.00 37.83  ? 27  DC  C N1    1 
ATOM   524  C C2    . DC  A 1 27  ? 66.768  49.977 126.204 1.00 31.46  ? 27  DC  C C2    1 
ATOM   525  O O2    . DC  A 1 27  ? 65.917  50.653 126.794 1.00 27.74  ? 27  DC  C O2    1 
ATOM   526  N N3    . DC  A 1 27  ? 66.430  48.870 125.514 1.00 32.23  ? 27  DC  C N3    1 
ATOM   527  C C4    . DC  A 1 27  ? 67.373  48.162 124.893 1.00 36.04  ? 27  DC  C C4    1 
ATOM   528  N N4    . DC  A 1 27  ? 66.996  47.068 124.233 1.00 38.37  ? 27  DC  C N4    1 
ATOM   529  C C5    . DC  A 1 27  ? 68.750  48.544 124.923 1.00 27.89  ? 27  DC  C C5    1 
ATOM   530  C C6    . DC  A 1 27  ? 69.071  49.652 125.607 1.00 31.57  ? 27  DC  C C6    1 
ATOM   531  P P     . DG  A 1 28  ? 70.167  53.284 130.491 1.00 56.90  ? 28  DG  C P     1 
ATOM   532  O OP1   . DG  A 1 28  ? 71.082  54.438 130.670 1.00 59.34  ? 28  DG  C OP1   1 
ATOM   533  O OP2   . DG  A 1 28  ? 70.688  51.898 130.581 1.00 65.30  ? 28  DG  C OP2   1 
ATOM   534  O "O5'" . DG  A 1 28  ? 68.995  53.465 131.534 1.00 57.10  ? 28  DG  C "O5'" 1 
ATOM   535  C "C5'" . DG  A 1 28  ? 68.019  54.468 131.298 1.00 55.40  ? 28  DG  C "C5'" 1 
ATOM   536  C "C4'" . DG  A 1 28  ? 66.643  53.949 131.635 1.00 50.86  ? 28  DG  C "C4'" 1 
ATOM   537  O "O4'" . DG  A 1 28  ? 66.198  52.967 130.669 1.00 44.82  ? 28  DG  C "O4'" 1 
ATOM   538  C "C3'" . DG  A 1 28  ? 66.588  53.268 132.996 1.00 55.11  ? 28  DG  C "C3'" 1 
ATOM   539  O "O3'" . DG  A 1 28  ? 65.442  53.713 133.720 1.00 59.30  ? 28  DG  C "O3'" 1 
ATOM   540  C "C2'" . DG  A 1 28  ? 66.535  51.788 132.662 1.00 45.32  ? 28  DG  C "C2'" 1 
ATOM   541  C "C1'" . DG  A 1 28  ? 65.824  51.765 131.325 1.00 42.52  ? 28  DG  C "C1'" 1 
ATOM   542  N N9    . DG  A 1 28  ? 66.193  50.647 130.459 1.00 36.25  ? 28  DG  C N9    1 
ATOM   543  C C8    . DG  A 1 28  ? 67.453  50.297 130.032 1.00 28.73  ? 28  DG  C C8    1 
ATOM   544  N N7    . DG  A 1 28  ? 67.456  49.241 129.262 1.00 29.00  ? 28  DG  C N7    1 
ATOM   545  C C5    . DG  A 1 28  ? 66.117  48.874 129.171 1.00 23.14  ? 28  DG  C C5    1 
ATOM   546  C C6    . DG  A 1 28  ? 65.502  47.809 128.464 1.00 21.42  ? 28  DG  C C6    1 
ATOM   547  O O6    . DG  A 1 28  ? 66.033  46.950 127.763 1.00 31.93  ? 28  DG  C O6    1 
ATOM   548  N N1    . DG  A 1 28  ? 64.123  47.802 128.637 1.00 19.09  ? 28  DG  C N1    1 
ATOM   549  C C2    . DG  A 1 28  ? 63.423  48.709 129.394 1.00 36.82  ? 28  DG  C C2    1 
ATOM   550  N N2    . DG  A 1 28  ? 62.086  48.543 129.434 1.00 34.87  ? 28  DG  C N2    1 
ATOM   551  N N3    . DG  A 1 28  ? 63.983  49.708 130.062 1.00 41.60  ? 28  DG  C N3    1 
ATOM   552  C C4    . DG  A 1 28  ? 65.326  49.730 129.906 1.00 34.12  ? 28  DG  C C4    1 
ATOM   553  P P     . DA  A 1 29  ? 64.931  52.872 134.978 1.00 68.46  ? 29  DA  C P     1 
ATOM   554  O OP1   . DA  A 1 29  ? 63.805  53.620 135.599 1.00 67.08  ? 29  DA  C OP1   1 
ATOM   555  O OP2   . DA  A 1 29  ? 66.107  52.492 135.801 1.00 75.32  ? 29  DA  C OP2   1 
ATOM   556  O "O5'" . DA  A 1 29  ? 64.349  51.556 134.305 1.00 66.00  ? 29  DA  C "O5'" 1 
ATOM   557  C "C5'" . DA  A 1 29  ? 63.033  51.556 133.769 1.00 65.99  ? 29  DA  C "C5'" 1 
ATOM   558  C "C4'" . DA  A 1 29  ? 62.438  50.178 133.875 1.00 64.34  ? 29  DA  C "C4'" 1 
ATOM   559  O "O4'" . DA  A 1 29  ? 63.090  49.329 132.899 1.00 61.03  ? 29  DA  C "O4'" 1 
ATOM   560  C "C3'" . DA  A 1 29  ? 62.677  49.517 135.238 1.00 67.17  ? 29  DA  C "C3'" 1 
ATOM   561  O "O3'" . DA  A 1 29  ? 61.526  48.768 135.654 1.00 74.40  ? 29  DA  C "O3'" 1 
ATOM   562  C "C2'" . DA  A 1 29  ? 63.836  48.577 134.963 1.00 60.36  ? 29  DA  C "C2'" 1 
ATOM   563  C "C1'" . DA  A 1 29  ? 63.502  48.149 133.553 1.00 55.26  ? 29  DA  C "C1'" 1 
ATOM   564  N N9    . DA  A 1 29  ? 64.602  47.557 132.801 1.00 44.53  ? 29  DA  C N9    1 
ATOM   565  C C8    . DA  A 1 29  ? 65.924  47.897 132.816 1.00 40.89  ? 29  DA  C C8    1 
ATOM   566  N N7    . DA  A 1 29  ? 66.674  47.124 132.067 1.00 41.68  ? 29  DA  C N7    1 
ATOM   567  C C5    . DA  A 1 29  ? 65.778  46.225 131.509 1.00 36.47  ? 29  DA  C C5    1 
ATOM   568  C C6    . DA  A 1 29  ? 65.942  45.144 130.624 1.00 43.55  ? 29  DA  C C6    1 
ATOM   569  N N6    . DA  A 1 29  ? 67.128  44.759 130.141 1.00 43.66  ? 29  DA  C N6    1 
ATOM   570  N N1    . DA  A 1 29  ? 64.842  44.458 130.254 1.00 45.24  ? 29  DA  C N1    1 
ATOM   571  C C2    . DA  A 1 29  ? 63.662  44.834 130.755 1.00 48.89  ? 29  DA  C C2    1 
ATOM   572  N N3    . DA  A 1 29  ? 63.379  45.825 131.600 1.00 46.17  ? 29  DA  C N3    1 
ATOM   573  C C4    . DA  A 1 29  ? 64.497  46.491 131.941 1.00 36.61  ? 29  DA  C C4    1 
ATOM   574  P P     . DA  A 1 30  ? 61.299  48.442 137.215 1.00 74.09  ? 30  DA  C P     1 
ATOM   575  O OP1   . DA  A 1 30  ? 60.590  49.599 137.823 1.00 66.81  ? 30  DA  C OP1   1 
ATOM   576  O OP2   . DA  A 1 30  ? 62.591  47.987 137.794 1.00 78.16  ? 30  DA  C OP2   1 
ATOM   577  O "O5'" . DA  A 1 30  ? 60.333  47.182 137.180 1.00 67.53  ? 30  DA  C "O5'" 1 
ATOM   578  C "C5'" . DA  A 1 30  ? 59.292  47.113 136.218 1.00 64.88  ? 30  DA  C "C5'" 1 
ATOM   579  C "C4'" . DA  A 1 30  ? 59.250  45.741 135.585 1.00 60.87  ? 30  DA  C "C4'" 1 
ATOM   580  O "O4'" . DA  A 1 30  ? 60.435  45.536 134.776 1.00 54.59  ? 30  DA  C "O4'" 1 
ATOM   581  C "C3'" . DA  A 1 30  ? 59.201  44.569 136.571 1.00 68.60  ? 30  DA  C "C3'" 1 
ATOM   582  O "O3'" . DA  A 1 30  ? 58.210  43.616 136.148 1.00 74.98  ? 30  DA  C "O3'" 1 
ATOM   583  C "C2'" . DA  A 1 30  ? 60.600  43.970 136.489 1.00 64.90  ? 30  DA  C "C2'" 1 
ATOM   584  C "C1'" . DA  A 1 30  ? 60.970  44.248 135.043 1.00 57.80  ? 30  DA  C "C1'" 1 
ATOM   585  N N9    . DA  A 1 30  ? 62.408  44.256 134.727 1.00 52.72  ? 30  DA  C N9    1 
ATOM   586  C C8    . DA  A 1 30  ? 63.379  45.098 135.224 1.00 52.79  ? 30  DA  C C8    1 
ATOM   587  N N7    . DA  A 1 30  ? 64.591  44.836 134.775 1.00 46.16  ? 30  DA  C N7    1 
ATOM   588  C C5    . DA  A 1 30  ? 64.406  43.759 133.919 1.00 27.90  ? 30  DA  C C5    1 
ATOM   589  C C6    . DA  A 1 30  ? 65.307  43.015 133.134 1.00 31.75  ? 30  DA  C C6    1 
ATOM   590  N N6    . DA  A 1 30  ? 66.622  43.255 133.098 1.00 29.53  ? 30  DA  C N6    1 
ATOM   591  N N1    . DA  A 1 30  ? 64.808  42.002 132.382 1.00 28.67  ? 30  DA  C N1    1 
ATOM   592  C C2    . DA  A 1 30  ? 63.493  41.761 132.430 1.00 33.05  ? 30  DA  C C2    1 
ATOM   593  N N3    . DA  A 1 30  ? 62.542  42.388 133.134 1.00 32.29  ? 30  DA  C N3    1 
ATOM   594  C C4    . DA  A 1 30  ? 63.069  43.392 133.870 1.00 37.89  ? 30  DA  C C4    1 
ATOM   595  P P     . DG  A 1 31  ? 57.715  42.469 137.165 1.00 78.54  ? 31  DG  C P     1 
ATOM   596  O OP1   . DG  A 1 31  ? 56.228  42.427 137.183 1.00 82.21  ? 31  DG  C OP1   1 
ATOM   597  O OP2   . DG  A 1 31  ? 58.462  42.648 138.439 1.00 77.31  ? 31  DG  C OP2   1 
ATOM   598  O "O5'" . DG  A 1 31  ? 58.214  41.131 136.468 1.00 66.55  ? 31  DG  C "O5'" 1 
ATOM   599  C "C5'" . DG  A 1 31  ? 57.866  40.853 135.122 1.00 55.99  ? 31  DG  C "C5'" 1 
ATOM   600  C "C4'" . DG  A 1 31  ? 58.746  39.756 134.587 1.00 61.40  ? 31  DG  C "C4'" 1 
ATOM   601  O "O4'" . DG  A 1 31  ? 60.114  40.237 134.473 1.00 59.48  ? 31  DG  C "O4'" 1 
ATOM   602  C "C3'" . DG  A 1 31  ? 58.799  38.516 135.485 1.00 66.82  ? 31  DG  C "C3'" 1 
ATOM   603  O "O3'" . DG  A 1 31  ? 58.597  37.331 134.698 1.00 70.11  ? 31  DG  C "O3'" 1 
ATOM   604  C "C2'" . DG  A 1 31  ? 60.189  38.578 136.110 1.00 63.76  ? 31  DG  C "C2'" 1 
ATOM   605  C "C1'" . DG  A 1 31  ? 61.000  39.279 135.036 1.00 57.86  ? 31  DG  C "C1'" 1 
ATOM   606  N N9    . DG  A 1 31  ? 62.231  39.962 135.463 1.00 44.38  ? 31  DG  C N9    1 
ATOM   607  C C8    . DG  A 1 31  ? 62.353  41.022 136.335 1.00 38.08  ? 31  DG  C C8    1 
ATOM   608  N N7    . DG  A 1 31  ? 63.589  41.428 136.483 1.00 36.26  ? 31  DG  C N7    1 
ATOM   609  C C5    . DG  A 1 31  ? 64.334  40.581 135.667 1.00 32.46  ? 31  DG  C C5    1 
ATOM   610  C C6    . DG  A 1 31  ? 65.744  40.535 135.410 1.00 36.56  ? 31  DG  C C6    1 
ATOM   611  O O6    . DG  A 1 31  ? 66.637  41.262 135.858 1.00 47.08  ? 31  DG  C O6    1 
ATOM   612  N N1    . DG  A 1 31  ? 66.074  39.512 134.528 1.00 28.27  ? 31  DG  C N1    1 
ATOM   613  C C2    . DG  A 1 31  ? 65.176  38.646 133.961 1.00 39.22  ? 31  DG  C C2    1 
ATOM   614  N N2    . DG  A 1 31  ? 65.698  37.712 133.144 1.00 42.86  ? 31  DG  C N2    1 
ATOM   615  N N3    . DG  A 1 31  ? 63.864  38.681 134.177 1.00 43.00  ? 31  DG  C N3    1 
ATOM   616  C C4    . DG  A 1 31  ? 63.517  39.665 135.038 1.00 33.79  ? 31  DG  C C4    1 
ATOM   617  P P     . DT  A 1 32  ? 58.695  35.886 135.386 1.00 68.64  ? 32  DT  C P     1 
ATOM   618  O OP1   . DT  A 1 32  ? 57.874  34.906 134.630 1.00 74.31  ? 32  DT  C OP1   1 
ATOM   619  O OP2   . DT  A 1 32  ? 58.470  36.063 136.843 1.00 78.10  ? 32  DT  C OP2   1 
ATOM   620  O "O5'" . DT  A 1 32  ? 60.212  35.497 135.156 1.00 65.31  ? 32  DT  C "O5'" 1 
ATOM   621  C "C5'" . DT  A 1 32  ? 60.690  35.253 133.844 1.00 63.32  ? 32  DT  C "C5'" 1 
ATOM   622  C "C4'" . DT  A 1 32  ? 61.897  34.357 133.909 1.00 63.62  ? 32  DT  C "C4'" 1 
ATOM   623  O "O4'" . DT  A 1 32  ? 63.076  35.113 134.272 1.00 56.66  ? 32  DT  C "O4'" 1 
ATOM   624  C "C3'" . DT  A 1 32  ? 61.752  33.282 134.980 1.00 64.27  ? 32  DT  C "C3'" 1 
ATOM   625  O "O3'" . DT  A 1 32  ? 62.368  32.088 134.531 1.00 70.95  ? 32  DT  C "O3'" 1 
ATOM   626  C "C2'" . DT  A 1 32  ? 62.550  33.844 136.140 1.00 51.56  ? 32  DT  C "C2'" 1 
ATOM   627  C "C1'" . DT  A 1 32  ? 63.687  34.514 135.402 1.00 43.81  ? 32  DT  C "C1'" 1 
ATOM   628  N N1    . DT  A 1 32  ? 64.355  35.573 136.150 1.00 35.18  ? 32  DT  C N1    1 
ATOM   629  C C2    . DT  A 1 32  ? 65.729  35.698 136.047 1.00 43.19  ? 32  DT  C C2    1 
ATOM   630  O O2    . DT  A 1 32  ? 66.424  34.939 135.400 1.00 52.14  ? 32  DT  C O2    1 
ATOM   631  N N3    . DT  A 1 32  ? 66.263  36.749 136.730 1.00 33.30  ? 32  DT  C N3    1 
ATOM   632  C C4    . DT  A 1 32  ? 65.579  37.672 137.480 1.00 30.52  ? 32  DT  C C4    1 
ATOM   633  O O4    . DT  A 1 32  ? 66.201  38.592 137.992 1.00 35.59  ? 32  DT  C O4    1 
ATOM   634  C C5    . DT  A 1 32  ? 64.135  37.457 137.572 1.00 27.23  ? 32  DT  C C5    1 
ATOM   635  C C7    . DT  A 1 32  ? 63.295  38.388 138.383 1.00 15.85  ? 32  DT  C C7    1 
ATOM   636  C C6    . DT  A 1 32  ? 63.615  36.429 136.914 1.00 23.37  ? 32  DT  C C6    1 
ATOM   637  P P     . DT  A 1 33  ? 62.475  30.848 135.529 1.00 80.75  ? 33  DT  C P     1 
ATOM   638  O OP1   . DT  A 1 33  ? 61.928  29.670 134.819 1.00 89.06  ? 33  DT  C OP1   1 
ATOM   639  O OP2   . DT  A 1 33  ? 61.873  31.277 136.821 1.00 81.06  ? 33  DT  C OP2   1 
ATOM   640  O "O5'" . DT  A 1 33  ? 64.042  30.639 135.736 1.00 83.40  ? 33  DT  C "O5'" 1 
ATOM   641  C "C5'" . DT  A 1 33  ? 64.893  30.347 134.623 1.00 71.46  ? 33  DT  C "C5'" 1 
ATOM   642  C "C4'" . DT  A 1 33  ? 66.328  30.189 135.074 1.00 62.95  ? 33  DT  C "C4'" 1 
ATOM   643  O "O4'" . DT  A 1 33  ? 66.807  31.435 135.636 1.00 53.60  ? 33  DT  C "O4'" 1 
ATOM   644  C "C3'" . DT  A 1 33  ? 66.589  29.120 136.136 1.00 59.61  ? 33  DT  C "C3'" 1 
ATOM   645  O "O3'" . DT  A 1 33  ? 67.816  28.454 135.840 1.00 62.81  ? 33  DT  C "O3'" 1 
ATOM   646  C "C2'" . DT  A 1 33  ? 66.735  29.927 137.415 1.00 48.88  ? 33  DT  C "C2'" 1 
ATOM   647  C "C1'" . DT  A 1 33  ? 67.394  31.193 136.898 1.00 41.33  ? 33  DT  C "C1'" 1 
ATOM   648  N N1    . DT  A 1 33  ? 67.227  32.411 137.713 1.00 32.20  ? 33  DT  C N1    1 
ATOM   649  C C2    . DT  A 1 33  ? 68.328  33.232 137.816 1.00 35.07  ? 33  DT  C C2    1 
ATOM   650  O O2    . DT  A 1 33  ? 69.393  32.990 137.262 1.00 47.00  ? 33  DT  C O2    1 
ATOM   651  N N3    . DT  A 1 33  ? 68.145  34.350 138.584 1.00 25.74  ? 33  DT  C N3    1 
ATOM   652  C C4    . DT  A 1 33  ? 66.999  34.733 139.238 1.00 24.70  ? 33  DT  C C4    1 
ATOM   653  O O4    . DT  A 1 33  ? 66.998  35.775 139.887 1.00 27.20  ? 33  DT  C O4    1 
ATOM   654  C C5    . DT  A 1 33  ? 65.865  33.829 139.083 1.00 24.99  ? 33  DT  C C5    1 
ATOM   655  C C7    . DT  A 1 33  ? 64.566  34.165 139.744 1.00 18.28  ? 33  DT  C C7    1 
ATOM   656  C C6    . DT  A 1 33  ? 66.037  32.723 138.340 1.00 30.18  ? 33  DT  C C6    1 
ATOM   657  P P     . DA  A 1 34  ? 68.044  26.953 136.351 1.00 68.64  ? 34  DA  C P     1 
ATOM   658  O OP1   . DA  A 1 34  ? 68.045  26.009 135.195 1.00 71.37  ? 34  DA  C OP1   1 
ATOM   659  O OP2   . DA  A 1 34  ? 67.067  26.761 137.451 1.00 62.10  ? 34  DA  C OP2   1 
ATOM   660  O "O5'" . DA  A 1 34  ? 69.510  27.007 136.972 1.00 67.11  ? 34  DA  C "O5'" 1 
ATOM   661  C "C5'" . DA  A 1 34  ? 70.622  27.423 136.182 1.00 56.25  ? 34  DA  C "C5'" 1 
ATOM   662  C "C4'" . DA  A 1 34  ? 71.673  28.064 137.056 1.00 52.49  ? 34  DA  C "C4'" 1 
ATOM   663  O "O4'" . DA  A 1 34  ? 71.098  29.259 137.647 1.00 48.65  ? 34  DA  C "O4'" 1 
ATOM   664  C "C3'" . DA  A 1 34  ? 72.172  27.198 138.218 1.00 57.05  ? 34  DA  C "C3'" 1 
ATOM   665  O "O3'" . DA  A 1 34  ? 73.605  27.278 138.339 1.00 56.63  ? 34  DA  C "O3'" 1 
ATOM   666  C "C2'" . DA  A 1 34  ? 71.460  27.790 139.425 1.00 52.23  ? 34  DA  C "C2'" 1 
ATOM   667  C "C1'" . DA  A 1 34  ? 71.317  29.252 139.048 1.00 43.35  ? 34  DA  C "C1'" 1 
ATOM   668  N N9    . DA  A 1 34  ? 70.206  29.957 139.697 1.00 37.54  ? 34  DA  C N9    1 
ATOM   669  C C8    . DA  A 1 34  ? 68.915  29.521 139.876 1.00 36.05  ? 34  DA  C C8    1 
ATOM   670  N N7    . DA  A 1 34  ? 68.150  30.375 140.527 1.00 27.89  ? 34  DA  C N7    1 
ATOM   671  C C5    . DA  A 1 34  ? 68.991  31.448 140.787 1.00 12.44  ? 34  DA  C C5    1 
ATOM   672  C C6    . DA  A 1 34  ? 68.778  32.686 141.447 1.00 12.67  ? 34  DA  C C6    1 
ATOM   673  N N6    . DA  A 1 34  ? 67.613  33.054 141.983 1.00 17.61  ? 34  DA  C N6    1 
ATOM   674  N N1    . DA  A 1 34  ? 69.824  33.537 141.536 1.00 12.63  ? 34  DA  C N1    1 
ATOM   675  C C2    . DA  A 1 34  ? 70.999  33.164 140.994 1.00 32.16  ? 34  DA  C C2    1 
ATOM   676  N N3    . DA  A 1 34  ? 71.322  32.035 140.348 1.00 28.62  ? 34  DA  C N3    1 
ATOM   677  C C4    . DA  A 1 34  ? 70.261  31.209 140.279 1.00 24.53  ? 34  DA  C C4    1 
ATOM   678  P P     . DA  B 1 2   ? 66.354  39.844 148.254 1.00 100.00 ? 2   DA  D P     1 
ATOM   679  O OP1   . DA  B 1 2   ? 66.777  39.762 146.828 1.00 100.00 ? 2   DA  D OP1   1 
ATOM   680  O OP2   . DA  B 1 2   ? 66.213  41.185 148.898 1.00 100.00 ? 2   DA  D OP2   1 
ATOM   681  O "O5'" . DA  B 1 2   ? 67.360  38.956 149.129 1.00 91.36  ? 2   DA  D "O5'" 1 
ATOM   682  C "C5'" . DA  B 1 2   ? 68.126  39.526 150.204 1.00 71.99  ? 2   DA  D "C5'" 1 
ATOM   683  C "C4'" . DA  B 1 2   ? 69.605  39.488 149.879 1.00 62.88  ? 2   DA  D "C4'" 1 
ATOM   684  O "O4'" . DA  B 1 2   ? 69.953  38.115 149.578 1.00 59.17  ? 2   DA  D "O4'" 1 
ATOM   685  C "C3'" . DA  B 1 2   ? 70.018  40.308 148.650 1.00 59.68  ? 2   DA  D "C3'" 1 
ATOM   686  O "O3'" . DA  B 1 2   ? 71.282  40.962 148.819 1.00 55.11  ? 2   DA  D "O3'" 1 
ATOM   687  C "C2'" . DA  B 1 2   ? 70.089  39.288 147.530 1.00 53.55  ? 2   DA  D "C2'" 1 
ATOM   688  C "C1'" . DA  B 1 2   ? 70.423  37.986 148.239 1.00 50.05  ? 2   DA  D "C1'" 1 
ATOM   689  N N9    . DA  B 1 2   ? 69.753  36.834 147.631 1.00 41.39  ? 2   DA  D N9    1 
ATOM   690  C C8    . DA  B 1 2   ? 68.409  36.544 147.645 1.00 41.33  ? 2   DA  D C8    1 
ATOM   691  N N7    . DA  B 1 2   ? 68.094  35.456 146.981 1.00 46.60  ? 2   DA  D N7    1 
ATOM   692  C C5    . DA  B 1 2   ? 69.311  34.994 146.502 1.00 35.08  ? 2   DA  D C5    1 
ATOM   693  C C6    . DA  B 1 2   ? 69.657  33.876 145.716 1.00 38.24  ? 2   DA  D C6    1 
ATOM   694  N N6    . DA  B 1 2   ? 68.774  32.976 145.273 1.00 33.06  ? 2   DA  D N6    1 
ATOM   695  N N1    . DA  B 1 2   ? 70.958  33.709 145.402 1.00 42.55  ? 2   DA  D N1    1 
ATOM   696  C C2    . DA  B 1 2   ? 71.845  34.603 145.865 1.00 53.35  ? 2   DA  D C2    1 
ATOM   697  N N3    . DA  B 1 2   ? 71.646  35.686 146.618 1.00 44.13  ? 2   DA  D N3    1 
ATOM   698  C C4    . DA  B 1 2   ? 70.342  35.829 146.901 1.00 36.69  ? 2   DA  D C4    1 
ATOM   699  P P     . DT  B 1 3   ? 71.800  41.986 147.686 1.00 58.28  ? 3   DT  D P     1 
ATOM   700  O OP1   . DT  B 1 3   ? 73.065  42.636 148.129 1.00 52.43  ? 3   DT  D OP1   1 
ATOM   701  O OP2   . DT  B 1 3   ? 70.653  42.827 147.258 1.00 51.94  ? 3   DT  D OP2   1 
ATOM   702  O "O5'" . DT  B 1 3   ? 72.187  41.032 146.477 1.00 49.78  ? 3   DT  D "O5'" 1 
ATOM   703  C "C5'" . DT  B 1 3   ? 73.507  40.528 146.372 1.00 35.96  ? 3   DT  D "C5'" 1 
ATOM   704  C "C4'" . DT  B 1 3   ? 73.753  40.032 144.973 1.00 29.40  ? 3   DT  D "C4'" 1 
ATOM   705  O "O4'" . DT  B 1 3   ? 73.034  38.802 144.732 1.00 32.68  ? 3   DT  D "O4'" 1 
ATOM   706  C "C3'" . DT  B 1 3   ? 73.288  41.002 143.888 1.00 29.69  ? 3   DT  D "C3'" 1 
ATOM   707  O "O3'" . DT  B 1 3   ? 74.093  40.786 142.743 1.00 37.60  ? 3   DT  D "O3'" 1 
ATOM   708  C "C2'" . DT  B 1 3   ? 71.929  40.445 143.531 1.00 36.08  ? 3   DT  D "C2'" 1 
ATOM   709  C "C1'" . DT  B 1 3   ? 72.290  38.982 143.545 1.00 32.99  ? 3   DT  D "C1'" 1 
ATOM   710  N N1    . DT  B 1 3   ? 71.191  38.009 143.511 1.00 24.89  ? 3   DT  D N1    1 
ATOM   711  C C2    . DT  B 1 3   ? 71.517  36.764 143.065 1.00 26.27  ? 3   DT  D C2    1 
ATOM   712  O O2    . DT  B 1 3   ? 72.663  36.453 142.792 1.00 34.30  ? 3   DT  D O2    1 
ATOM   713  N N3    . DT  B 1 3   ? 70.460  35.892 142.956 1.00 25.20  ? 3   DT  D N3    1 
ATOM   714  C C4    . DT  B 1 3   ? 69.142  36.151 143.267 1.00 22.49  ? 3   DT  D C4    1 
ATOM   715  O O4    . DT  B 1 3   ? 68.294  35.285 143.098 1.00 38.47  ? 3   DT  D O4    1 
ATOM   716  C C5    . DT  B 1 3   ? 68.876  37.471 143.779 1.00 14.77  ? 3   DT  D C5    1 
ATOM   717  C C7    . DT  B 1 3   ? 67.480  37.819 144.181 1.00 22.51  ? 3   DT  D C7    1 
ATOM   718  C C6    . DT  B 1 3   ? 69.900  38.331 143.874 1.00 20.56  ? 3   DT  D C6    1 
ATOM   719  P P     . DA  B 1 4   ? 75.290  41.783 142.402 1.00 42.62  ? 4   DA  D P     1 
ATOM   720  O OP1   . DA  B 1 4   ? 76.057  42.033 143.644 1.00 41.24  ? 4   DA  D OP1   1 
ATOM   721  O OP2   . DA  B 1 4   ? 74.695  42.932 141.667 1.00 41.88  ? 4   DA  D OP2   1 
ATOM   722  O "O5'" . DA  B 1 4   ? 76.163  40.899 141.392 1.00 39.86  ? 4   DA  D "O5'" 1 
ATOM   723  C "C5'" . DA  B 1 4   ? 76.802  39.693 141.837 1.00 35.22  ? 4   DA  D "C5'" 1 
ATOM   724  C "C4'" . DA  B 1 4   ? 76.876  38.645 140.740 1.00 39.87  ? 4   DA  D "C4'" 1 
ATOM   725  O "O4'" . DA  B 1 4   ? 75.671  37.861 140.669 1.00 40.63  ? 4   DA  D "O4'" 1 
ATOM   726  C "C3'" . DA  B 1 4   ? 77.205  39.050 139.306 1.00 39.88  ? 4   DA  D "C3'" 1 
ATOM   727  O "O3'" . DA  B 1 4   ? 78.103  38.076 138.744 1.00 46.81  ? 4   DA  D "O3'" 1 
ATOM   728  C "C2'" . DA  B 1 4   ? 75.846  39.013 138.621 1.00 42.16  ? 4   DA  D "C2'" 1 
ATOM   729  C "C1'" . DA  B 1 4   ? 75.079  37.937 139.385 1.00 36.62  ? 4   DA  D "C1'" 1 
ATOM   730  N N9    . DA  B 1 4   ? 73.674  38.238 139.616 1.00 25.41  ? 4   DA  D N9    1 
ATOM   731  C C8    . DA  B 1 4   ? 73.167  39.408 140.096 1.00 32.88  ? 4   DA  D C8    1 
ATOM   732  N N7    . DA  B 1 4   ? 71.876  39.376 140.305 1.00 31.22  ? 4   DA  D N7    1 
ATOM   733  C C5    . DA  B 1 4   ? 71.503  38.100 139.918 1.00 10.26  ? 4   DA  D C5    1 
ATOM   734  C C6    . DA  B 1 4   ? 70.258  37.427 139.913 1.00 21.06  ? 4   DA  D C6    1 
ATOM   735  N N6    . DA  B 1 4   ? 69.111  37.952 140.352 1.00 27.65  ? 4   DA  D N6    1 
ATOM   736  N N1    . DA  B 1 4   ? 70.230  36.169 139.444 1.00 27.12  ? 4   DA  D N1    1 
ATOM   737  C C2    . DA  B 1 4   ? 71.378  35.623 139.029 1.00 30.25  ? 4   DA  D C2    1 
ATOM   738  N N3    . DA  B 1 4   ? 72.602  36.143 139.004 1.00 28.18  ? 4   DA  D N3    1 
ATOM   739  C C4    . DA  B 1 4   ? 72.597  37.399 139.465 1.00 8.50   ? 4   DA  D C4    1 
ATOM   740  P P     . DA  B 1 5   ? 78.724  38.303 137.282 1.00 45.37  ? 5   DA  D P     1 
ATOM   741  O OP1   . DA  B 1 5   ? 79.836  37.334 137.085 1.00 46.41  ? 5   DA  D OP1   1 
ATOM   742  O OP2   . DA  B 1 5   ? 78.968  39.748 137.094 1.00 44.93  ? 5   DA  D OP2   1 
ATOM   743  O "O5'" . DA  B 1 5   ? 77.530  37.845 136.349 1.00 42.09  ? 5   DA  D "O5'" 1 
ATOM   744  C "C5'" . DA  B 1 5   ? 77.263  36.465 136.188 1.00 44.83  ? 5   DA  D "C5'" 1 
ATOM   745  C "C4'" . DA  B 1 5   ? 76.289  36.264 135.061 1.00 42.54  ? 5   DA  D "C4'" 1 
ATOM   746  O "O4'" . DA  B 1 5   ? 74.943  36.535 135.514 1.00 33.38  ? 5   DA  D "O4'" 1 
ATOM   747  C "C3'" . DA  B 1 5   ? 76.568  37.223 133.907 1.00 46.89  ? 5   DA  D "C3'" 1 
ATOM   748  O "O3'" . DA  B 1 5   ? 76.499  36.505 132.664 1.00 58.75  ? 5   DA  D "O3'" 1 
ATOM   749  C "C2'" . DA  B 1 5   ? 75.494  38.286 134.080 1.00 31.16  ? 5   DA  D "C2'" 1 
ATOM   750  C "C1'" . DA  B 1 5   ? 74.350  37.476 134.650 1.00 26.05  ? 5   DA  D "C1'" 1 
ATOM   751  N N9    . DA  B 1 5   ? 73.351  38.230 135.401 1.00 22.43  ? 5   DA  D N9    1 
ATOM   752  C C8    . DA  B 1 5   ? 73.459  39.473 135.982 1.00 29.91  ? 5   DA  D C8    1 
ATOM   753  N N7    . DA  B 1 5   ? 72.343  39.898 136.537 1.00 26.72  ? 5   DA  D N7    1 
ATOM   754  C C5    . DA  B 1 5   ? 71.445  38.856 136.321 1.00 28.95  ? 5   DA  D C5    1 
ATOM   755  C C6    . DA  B 1 5   ? 70.069  38.681 136.660 1.00 29.36  ? 5   DA  D C6    1 
ATOM   756  N N6    . DA  B 1 5   ? 69.320  39.601 137.283 1.00 25.86  ? 5   DA  D N6    1 
ATOM   757  N N1    . DA  B 1 5   ? 69.481  37.509 136.315 1.00 22.07  ? 5   DA  D N1    1 
ATOM   758  C C2    . DA  B 1 5   ? 70.217  36.593 135.656 1.00 32.82  ? 5   DA  D C2    1 
ATOM   759  N N3    . DA  B 1 5   ? 71.503  36.649 135.270 1.00 32.40  ? 5   DA  D N3    1 
ATOM   760  C C4    . DA  B 1 5   ? 72.062  37.816 135.637 1.00 29.61  ? 5   DA  D C4    1 
ATOM   761  P P     . DC  B 1 6   ? 76.424  37.302 131.264 1.00 59.55  ? 6   DC  D P     1 
ATOM   762  O OP1   . DC  B 1 6   ? 77.141  36.465 130.276 1.00 65.54  ? 6   DC  D OP1   1 
ATOM   763  O OP2   . DC  B 1 6   ? 76.842  38.714 131.485 1.00 62.58  ? 6   DC  D OP2   1 
ATOM   764  O "O5'" . DC  B 1 6   ? 74.866  37.245 130.943 1.00 57.23  ? 6   DC  D "O5'" 1 
ATOM   765  C "C5'" . DC  B 1 6   ? 74.016  36.582 131.875 1.00 61.63  ? 6   DC  D "C5'" 1 
ATOM   766  C "C4'" . DC  B 1 6   ? 72.641  36.308 131.319 1.00 51.99  ? 6   DC  D "C4'" 1 
ATOM   767  O "O4'" . DC  B 1 6   ? 71.686  36.844 132.266 1.00 47.13  ? 6   DC  D "O4'" 1 
ATOM   768  C "C3'" . DC  B 1 6   ? 72.287  36.933 129.978 1.00 55.06  ? 6   DC  D "C3'" 1 
ATOM   769  O "O3'" . DC  B 1 6   ? 71.297  36.119 129.344 1.00 55.81  ? 6   DC  D "O3'" 1 
ATOM   770  C "C2'" . DC  B 1 6   ? 71.630  38.224 130.401 1.00 54.34  ? 6   DC  D "C2'" 1 
ATOM   771  C "C1'" . DC  B 1 6   ? 70.842  37.751 131.604 1.00 37.62  ? 6   DC  D "C1'" 1 
ATOM   772  N N1    . DC  B 1 6   ? 70.504  38.832 132.528 1.00 27.35  ? 6   DC  D N1    1 
ATOM   773  C C2    . DC  B 1 6   ? 69.300  38.764 133.212 1.00 25.23  ? 6   DC  D C2    1 
ATOM   774  O O2    . DC  B 1 6   ? 68.615  37.737 133.107 1.00 33.96  ? 6   DC  D O2    1 
ATOM   775  N N3    . DC  B 1 6   ? 68.910  39.811 133.971 1.00 19.29  ? 6   DC  D N3    1 
ATOM   776  C C4    . DC  B 1 6   ? 69.696  40.888 134.066 1.00 26.92  ? 6   DC  D C4    1 
ATOM   777  N N4    . DC  B 1 6   ? 69.258  41.924 134.772 1.00 33.95  ? 6   DC  D N4    1 
ATOM   778  C C5    . DC  B 1 6   ? 70.965  40.956 133.425 1.00 26.16  ? 6   DC  D C5    1 
ATOM   779  C C6    . DC  B 1 6   ? 71.330  39.912 132.677 1.00 25.24  ? 6   DC  D C6    1 
ATOM   780  P P     . DT  B 1 7   ? 70.871  36.405 127.822 1.00 51.20  ? 7   DT  D P     1 
ATOM   781  O OP1   . DT  B 1 7   ? 71.442  35.315 126.986 1.00 38.42  ? 7   DT  D OP1   1 
ATOM   782  O OP2   . DT  B 1 7   ? 71.150  37.815 127.489 1.00 60.26  ? 7   DT  D OP2   1 
ATOM   783  O "O5'" . DT  B 1 7   ? 69.299  36.233 127.870 1.00 43.74  ? 7   DT  D "O5'" 1 
ATOM   784  C "C5'" . DT  B 1 7   ? 68.762  35.032 128.370 1.00 42.78  ? 7   DT  D "C5'" 1 
ATOM   785  C "C4'" . DT  B 1 7   ? 67.280  35.186 128.574 1.00 43.16  ? 7   DT  D "C4'" 1 
ATOM   786  O "O4'" . DT  B 1 7   ? 67.081  36.208 129.581 1.00 34.72  ? 7   DT  D "O4'" 1 
ATOM   787  C "C3'" . DT  B 1 7   ? 66.538  35.655 127.325 1.00 41.78  ? 7   DT  D "C3'" 1 
ATOM   788  O "O3'" . DT  B 1 7   ? 65.278  34.990 127.240 1.00 56.03  ? 7   DT  D "O3'" 1 
ATOM   789  C "C2'" . DT  B 1 7   ? 66.362  37.143 127.565 1.00 37.20  ? 7   DT  D "C2'" 1 
ATOM   790  C "C1'" . DT  B 1 7   ? 66.261  37.243 129.079 1.00 26.20  ? 7   DT  D "C1'" 1 
ATOM   791  N N1    . DT  B 1 7   ? 66.755  38.515 129.631 1.00 21.21  ? 7   DT  D N1    1 
ATOM   792  C C2    . DT  B 1 7   ? 65.868  39.293 130.343 1.00 24.29  ? 7   DT  D C2    1 
ATOM   793  O O2    . DT  B 1 7   ? 64.698  38.972 130.528 1.00 34.89  ? 7   DT  D O2    1 
ATOM   794  N N3    . DT  B 1 7   ? 66.398  40.472 130.827 1.00 25.99  ? 7   DT  D N3    1 
ATOM   795  C C4    . DT  B 1 7   ? 67.700  40.939 130.655 1.00 29.97  ? 7   DT  D C4    1 
ATOM   796  O O4    . DT  B 1 7   ? 68.044  42.025 131.149 1.00 34.39  ? 7   DT  D O4    1 
ATOM   797  C C5    . DT  B 1 7   ? 68.568  40.075 129.885 1.00 23.00  ? 7   DT  D C5    1 
ATOM   798  C C7    . DT  B 1 7   ? 69.973  40.511 129.626 1.00 19.68  ? 7   DT  D C7    1 
ATOM   799  C C6    . DT  B 1 7   ? 68.065  38.917 129.427 1.00 25.95  ? 7   DT  D C6    1 
ATOM   800  P P     . DT  B 1 8   ? 64.365  35.177 125.942 1.00 60.55  ? 8   DT  D P     1 
ATOM   801  O OP1   . DT  B 1 8   ? 63.688  33.884 125.655 1.00 57.04  ? 8   DT  D OP1   1 
ATOM   802  O OP2   . DT  B 1 8   ? 65.164  35.844 124.889 1.00 63.05  ? 8   DT  D OP2   1 
ATOM   803  O "O5'" . DT  B 1 8   ? 63.282  36.207 126.451 1.00 48.35  ? 8   DT  D "O5'" 1 
ATOM   804  C "C5'" . DT  B 1 8   ? 62.489  35.874 127.565 1.00 51.27  ? 8   DT  D "C5'" 1 
ATOM   805  C "C4'" . DT  B 1 8   ? 61.596  37.032 127.902 1.00 54.64  ? 8   DT  D "C4'" 1 
ATOM   806  O "O4'" . DT  B 1 8   ? 62.405  38.096 128.465 1.00 49.43  ? 8   DT  D "O4'" 1 
ATOM   807  C "C3'" . DT  B 1 8   ? 60.890  37.622 126.679 1.00 53.91  ? 8   DT  D "C3'" 1 
ATOM   808  O "O3'" . DT  B 1 8   ? 59.536  37.918 127.032 1.00 60.35  ? 8   DT  D "O3'" 1 
ATOM   809  C "C2'" . DT  B 1 8   ? 61.686  38.887 126.405 1.00 52.18  ? 8   DT  D "C2'" 1 
ATOM   810  C "C1'" . DT  B 1 8   ? 62.069  39.306 127.814 1.00 45.51  ? 8   DT  D "C1'" 1 
ATOM   811  N N1    . DT  B 1 8   ? 63.210  40.249 127.933 1.00 38.33  ? 8   DT  D N1    1 
ATOM   812  C C2    . DT  B 1 8   ? 63.062  41.341 128.768 1.00 44.08  ? 8   DT  D C2    1 
ATOM   813  O O2    . DT  B 1 8   ? 62.055  41.553 129.422 1.00 52.96  ? 8   DT  D O2    1 
ATOM   814  N N3    . DT  B 1 8   ? 64.149  42.180 128.816 1.00 24.02  ? 8   DT  D N3    1 
ATOM   815  C C4    . DT  B 1 8   ? 65.341  42.035 128.150 1.00 28.26  ? 8   DT  D C4    1 
ATOM   816  O O4    . DT  B 1 8   ? 66.233  42.861 128.306 1.00 38.24  ? 8   DT  D O4    1 
ATOM   817  C C5    . DT  B 1 8   ? 65.435  40.876 127.307 1.00 30.32  ? 8   DT  D C5    1 
ATOM   818  C C7    . DT  B 1 8   ? 66.708  40.633 126.560 1.00 29.52  ? 8   DT  D C7    1 
ATOM   819  C C6    . DT  B 1 8   ? 64.377  40.053 127.233 1.00 36.19  ? 8   DT  D C6    1 
ATOM   820  P P     . DC  B 1 9   ? 58.500  38.419 125.916 1.00 53.88  ? 9   DC  D P     1 
ATOM   821  O OP1   . DC  B 1 9   ? 57.426  37.396 125.841 1.00 62.04  ? 9   DC  D OP1   1 
ATOM   822  O OP2   . DC  B 1 9   ? 59.278  38.762 124.697 1.00 59.51  ? 9   DC  D OP2   1 
ATOM   823  O "O5'" . DC  B 1 9   ? 57.928  39.772 126.531 1.00 41.55  ? 9   DC  D "O5'" 1 
ATOM   824  C "C5'" . DC  B 1 9   ? 58.766  40.573 127.362 1.00 32.43  ? 9   DC  D "C5'" 1 
ATOM   825  C "C4'" . DC  B 1 9   ? 58.163  41.934 127.603 1.00 34.26  ? 9   DC  D "C4'" 1 
ATOM   826  O "O4'" . DC  B 1 9   ? 59.245  42.796 128.020 1.00 35.76  ? 9   DC  D "O4'" 1 
ATOM   827  C "C3'" . DC  B 1 9   ? 57.515  42.628 126.399 1.00 41.42  ? 9   DC  D "C3'" 1 
ATOM   828  O "O3'" . DC  B 1 9   ? 56.336  43.322 126.838 1.00 43.84  ? 9   DC  D "O3'" 1 
ATOM   829  C "C2'" . DC  B 1 9   ? 58.606  43.564 125.893 1.00 35.20  ? 9   DC  D "C2'" 1 
ATOM   830  C "C1'" . DC  B 1 9   ? 59.387  43.908 127.152 1.00 35.97  ? 9   DC  D "C1'" 1 
ATOM   831  N N1    . DC  B 1 9   ? 60.836  44.147 126.958 1.00 28.88  ? 9   DC  D N1    1 
ATOM   832  C C2    . DC  B 1 9   ? 61.433  45.254 127.609 1.00 37.51  ? 9   DC  D C2    1 
ATOM   833  O O2    . DC  B 1 9   ? 60.730  45.983 128.334 1.00 40.09  ? 9   DC  D O2    1 
ATOM   834  N N3    . DC  B 1 9   ? 62.758  45.494 127.429 1.00 23.54  ? 9   DC  D N3    1 
ATOM   835  C C4    . DC  B 1 9   ? 63.488  44.685 126.655 1.00 20.13  ? 9   DC  D C4    1 
ATOM   836  N N4    . DC  B 1 9   ? 64.792  44.970 126.514 1.00 19.84  ? 9   DC  D N4    1 
ATOM   837  C C5    . DC  B 1 9   ? 62.915  43.546 125.990 1.00 18.47  ? 9   DC  D C5    1 
ATOM   838  C C6    . DC  B 1 9   ? 61.595  43.320 126.169 1.00 26.69  ? 9   DC  D C6    1 
ATOM   839  P P     . DG  B 1 10  ? 55.412  44.094 125.777 1.00 50.12  ? 10  DG  D P     1 
ATOM   840  O OP1   . DG  B 1 10  ? 53.995  44.082 126.236 1.00 50.64  ? 10  DG  D OP1   1 
ATOM   841  O OP2   . DG  B 1 10  ? 55.748  43.603 124.408 1.00 53.23  ? 10  DG  D OP2   1 
ATOM   842  O "O5'" . DG  B 1 10  ? 55.916  45.589 125.941 1.00 45.46  ? 10  DG  D "O5'" 1 
ATOM   843  C "C5'" . DG  B 1 10  ? 56.096  46.147 127.235 1.00 31.95  ? 10  DG  D "C5'" 1 
ATOM   844  C "C4'" . DG  B 1 10  ? 56.607  47.559 127.111 1.00 29.77  ? 10  DG  D "C4'" 1 
ATOM   845  O "O4'" . DG  B 1 10  ? 58.043  47.598 126.933 1.00 36.75  ? 10  DG  D "O4'" 1 
ATOM   846  C "C3'" . DG  B 1 10  ? 56.014  48.290 125.918 1.00 27.71  ? 10  DG  D "C3'" 1 
ATOM   847  O "O3'" . DG  B 1 10  ? 55.710  49.612 126.265 1.00 20.86  ? 10  DG  D "O3'" 1 
ATOM   848  C "C2'" . DG  B 1 10  ? 57.127  48.284 124.889 1.00 27.16  ? 10  DG  D "C2'" 1 
ATOM   849  C "C1'" . DG  B 1 10  ? 58.372  48.330 125.760 1.00 31.72  ? 10  DG  D "C1'" 1 
ATOM   850  N N9    . DG  B 1 10  ? 59.559  47.718 125.158 1.00 30.59  ? 10  DG  D N9    1 
ATOM   851  C C8    . DG  B 1 10  ? 59.597  46.629 124.312 1.00 23.66  ? 10  DG  D C8    1 
ATOM   852  N N7    . DG  B 1 10  ? 60.800  46.340 123.898 1.00 24.94  ? 10  DG  D N7    1 
ATOM   853  C C5    . DG  B 1 10  ? 61.615  47.285 124.516 1.00 24.15  ? 10  DG  D C5    1 
ATOM   854  C C6    . DG  B 1 10  ? 63.022  47.465 124.456 1.00 19.90  ? 10  DG  D C6    1 
ATOM   855  O O6    . DG  B 1 10  ? 63.863  46.798 123.829 1.00 30.09  ? 10  DG  D O6    1 
ATOM   856  N N1    . DG  B 1 10  ? 63.439  48.539 125.237 1.00 17.61  ? 10  DG  D N1    1 
ATOM   857  C C2    . DG  B 1 10  ? 62.609  49.328 125.999 1.00 26.13  ? 10  DG  D C2    1 
ATOM   858  N N2    . DG  B 1 10  ? 63.207  50.301 126.696 1.00 28.57  ? 10  DG  D N2    1 
ATOM   859  N N3    . DG  B 1 10  ? 61.294  49.170 126.075 1.00 24.04  ? 10  DG  D N3    1 
ATOM   860  C C4    . DG  B 1 10  ? 60.865  48.136 125.308 1.00 28.28  ? 10  DG  D C4    1 
ATOM   861  P P     . DT  B 1 11  ? 54.884  50.492 125.239 1.00 34.05  ? 11  DT  D P     1 
ATOM   862  O OP1   . DT  B 1 11  ? 53.668  50.997 125.922 1.00 41.08  ? 11  DT  D OP1   1 
ATOM   863  O OP2   . DT  B 1 11  ? 54.753  49.653 124.020 1.00 37.70  ? 11  DT  D OP2   1 
ATOM   864  O "O5'" . DT  B 1 11  ? 55.843  51.725 124.954 1.00 37.07  ? 11  DT  D "O5'" 1 
ATOM   865  C "C5'" . DT  B 1 11  ? 56.428  52.415 126.045 1.00 41.12  ? 11  DT  D "C5'" 1 
ATOM   866  C "C4'" . DT  B 1 11  ? 57.589  53.256 125.571 1.00 39.43  ? 11  DT  D "C4'" 1 
ATOM   867  O "O4'" . DT  B 1 11  ? 58.727  52.439 125.199 1.00 34.17  ? 11  DT  D "O4'" 1 
ATOM   868  C "C3'" . DT  B 1 11  ? 57.297  54.139 124.366 1.00 43.61  ? 11  DT  D "C3'" 1 
ATOM   869  O "O3'" . DT  B 1 11  ? 57.944  55.394 124.548 1.00 49.81  ? 11  DT  D "O3'" 1 
ATOM   870  C "C2'" . DT  B 1 11  ? 57.976  53.398 123.225 1.00 37.40  ? 11  DT  D "C2'" 1 
ATOM   871  C "C1'" . DT  B 1 11  ? 59.203  52.883 123.946 1.00 39.29  ? 11  DT  D "C1'" 1 
ATOM   872  N N1    . DT  B 1 11  ? 59.928  51.772 123.295 1.00 39.85  ? 11  DT  D N1    1 
ATOM   873  C C2    . DT  B 1 11  ? 61.310  51.765 123.401 1.00 43.51  ? 11  DT  D C2    1 
ATOM   874  O O2    . DT  B 1 11  ? 61.949  52.610 124.034 1.00 42.46  ? 11  DT  D O2    1 
ATOM   875  N N3    . DT  B 1 11  ? 61.921  50.724 122.752 1.00 35.98  ? 11  DT  D N3    1 
ATOM   876  C C4    . DT  B 1 11  ? 61.314  49.701 122.049 1.00 36.03  ? 11  DT  D C4    1 
ATOM   877  O O4    . DT  B 1 11  ? 62.011  48.814 121.563 1.00 30.93  ? 11  DT  D O4    1 
ATOM   878  C C5    . DT  B 1 11  ? 59.859  49.764 121.979 1.00 35.40  ? 11  DT  D C5    1 
ATOM   879  C C7    . DT  B 1 11  ? 59.111  48.703 121.228 1.00 22.37  ? 11  DT  D C7    1 
ATOM   880  C C6    . DT  B 1 11  ? 59.250  50.784 122.600 1.00 36.15  ? 11  DT  D C6    1 
ATOM   881  P P     . DA  B 1 12  ? 57.883  56.496 123.387 1.00 56.84  ? 12  DA  D P     1 
ATOM   882  O OP1   . DA  B 1 12  ? 57.313  57.719 123.978 1.00 61.63  ? 12  DA  D OP1   1 
ATOM   883  O OP2   . DA  B 1 12  ? 57.308  55.935 122.138 1.00 56.64  ? 12  DA  D OP2   1 
ATOM   884  O "O5'" . DA  B 1 12  ? 59.405  56.777 123.070 1.00 43.16  ? 12  DA  D "O5'" 1 
ATOM   885  C "C5'" . DA  B 1 12  ? 60.329  56.971 124.122 1.00 28.55  ? 12  DA  D "C5'" 1 
ATOM   886  C "C4'" . DA  B 1 12  ? 61.712  57.126 123.546 1.00 19.77  ? 12  DA  D "C4'" 1 
ATOM   887  O "O4'" . DA  B 1 12  ? 62.231  55.846 123.126 1.00 19.93  ? 12  DA  D "O4'" 1 
ATOM   888  C "C3'" . DA  B 1 12  ? 61.743  58.029 122.319 1.00 28.32  ? 12  DA  D "C3'" 1 
ATOM   889  O "O3'" . DA  B 1 12  ? 62.912  58.811 122.383 1.00 30.54  ? 12  DA  D "O3'" 1 
ATOM   890  C "C2'" . DA  B 1 12  ? 61.821  57.060 121.156 1.00 31.39  ? 12  DA  D "C2'" 1 
ATOM   891  C "C1'" . DA  B 1 12  ? 62.588  55.896 121.754 1.00 26.27  ? 12  DA  D "C1'" 1 
ATOM   892  N N9    . DA  B 1 12  ? 62.259  54.602 121.158 1.00 31.81  ? 12  DA  D N9    1 
ATOM   893  C C8    . DA  B 1 12  ? 61.028  53.996 121.004 1.00 21.88  ? 12  DA  D C8    1 
ATOM   894  N N7    . DA  B 1 12  ? 61.087  52.830 120.395 1.00 20.67  ? 12  DA  D N7    1 
ATOM   895  C C5    . DA  B 1 12  ? 62.442  52.664 120.128 1.00 20.47  ? 12  DA  D C5    1 
ATOM   896  C C6    . DA  B 1 12  ? 63.155  51.650 119.469 1.00 31.63  ? 12  DA  D C6    1 
ATOM   897  N N6    . DA  B 1 12  ? 62.578  50.577 118.926 1.00 17.10  ? 12  DA  D N6    1 
ATOM   898  N N1    . DA  B 1 12  ? 64.503  51.787 119.376 1.00 34.97  ? 12  DA  D N1    1 
ATOM   899  C C2    . DA  B 1 12  ? 65.080  52.885 119.897 1.00 33.68  ? 12  DA  D C2    1 
ATOM   900  N N3    . DA  B 1 12  ? 64.510  53.921 120.526 1.00 22.49  ? 12  DA  D N3    1 
ATOM   901  C C4    . DA  B 1 12  ? 63.176  53.742 120.608 1.00 32.85  ? 12  DA  D C4    1 
ATOM   902  P P     . DT  B 1 13  ? 63.130  59.985 121.342 1.00 42.57  ? 13  DT  D P     1 
ATOM   903  O OP1   . DT  B 1 13  ? 64.006  60.966 122.039 1.00 39.02  ? 13  DT  D OP1   1 
ATOM   904  O OP2   . DT  B 1 13  ? 61.813  60.424 120.776 1.00 38.83  ? 13  DT  D OP2   1 
ATOM   905  O "O5'" . DT  B 1 13  ? 63.989  59.253 120.232 1.00 37.45  ? 13  DT  D "O5'" 1 
ATOM   906  C "C5'" . DT  B 1 13  ? 65.255  58.730 120.590 1.00 23.95  ? 13  DT  D "C5'" 1 
ATOM   907  C "C4'" . DT  B 1 13  ? 65.913  58.064 119.408 1.00 28.55  ? 13  DT  D "C4'" 1 
ATOM   908  O "O4'" . DT  B 1 13  ? 65.319  56.774 119.129 1.00 24.36  ? 13  DT  D "O4'" 1 
ATOM   909  C "C3'" . DT  B 1 13  ? 65.932  58.826 118.090 1.00 27.66  ? 13  DT  D "C3'" 1 
ATOM   910  O "O3'" . DT  B 1 13  ? 67.217  58.627 117.486 1.00 38.57  ? 13  DT  D "O3'" 1 
ATOM   911  C "C2'" . DT  B 1 13  ? 64.872  58.102 117.274 1.00 28.41  ? 13  DT  D "C2'" 1 
ATOM   912  C "C1'" . DT  B 1 13  ? 65.132  56.680 117.738 1.00 26.54  ? 13  DT  D "C1'" 1 
ATOM   913  N N1    . DT  B 1 13  ? 64.076  55.703 117.491 1.00 26.22  ? 13  DT  D N1    1 
ATOM   914  C C2    . DT  B 1 13  ? 64.458  54.507 116.936 1.00 26.52  ? 13  DT  D C2    1 
ATOM   915  O O2    . DT  B 1 13  ? 65.622  54.202 116.739 1.00 18.84  ? 13  DT  D O2    1 
ATOM   916  N N3    . DT  B 1 13  ? 63.434  53.660 116.646 1.00 25.80  ? 13  DT  D N3    1 
ATOM   917  C C4    . DT  B 1 13  ? 62.092  53.868 116.897 1.00 30.89  ? 13  DT  D C4    1 
ATOM   918  O O4    . DT  B 1 13  ? 61.287  53.006 116.585 1.00 46.98  ? 13  DT  D O4    1 
ATOM   919  C C5    . DT  B 1 13  ? 61.761  55.124 117.542 1.00 24.57  ? 13  DT  D C5    1 
ATOM   920  C C7    . DT  B 1 13  ? 60.339  55.404 117.918 1.00 19.93  ? 13  DT  D C7    1 
ATOM   921  C C6    . DT  B 1 13  ? 62.757  55.976 117.789 1.00 30.10  ? 13  DT  D C6    1 
ATOM   922  P P     . DA  B 1 14  ? 67.769  59.678 116.414 1.00 44.79  ? 14  DA  D P     1 
ATOM   923  O OP1   . DA  B 1 14  ? 68.384  60.800 117.162 1.00 46.84  ? 14  DA  D OP1   1 
ATOM   924  O OP2   . DA  B 1 14  ? 66.633  59.940 115.486 1.00 58.12  ? 14  DA  D OP2   1 
ATOM   925  O "O5'" . DA  B 1 14  ? 68.886  58.871 115.619 1.00 34.28  ? 14  DA  D "O5'" 1 
ATOM   926  C "C5'" . DA  B 1 14  ? 69.770  58.006 116.311 1.00 26.56  ? 14  DA  D "C5'" 1 
ATOM   927  C "C4'" . DA  B 1 14  ? 70.002  56.752 115.511 1.00 31.59  ? 14  DA  D "C4'" 1 
ATOM   928  O "O4'" . DA  B 1 14  ? 68.810  55.938 115.440 1.00 34.58  ? 14  DA  D "O4'" 1 
ATOM   929  C "C3'" . DA  B 1 14  ? 70.422  57.002 114.065 1.00 35.11  ? 14  DA  D "C3'" 1 
ATOM   930  O "O3'" . DA  B 1 14  ? 71.425  56.048 113.727 1.00 43.78  ? 14  DA  D "O3'" 1 
ATOM   931  C "C2'" . DA  B 1 14  ? 69.157  56.731 113.271 1.00 34.75  ? 14  DA  D "C2'" 1 
ATOM   932  C "C1'" . DA  B 1 14  ? 68.504  55.633 114.085 1.00 30.37  ? 14  DA  D "C1'" 1 
ATOM   933  N N9    . DA  B 1 14  ? 67.045  55.544 113.959 1.00 18.62  ? 14  DA  D N9    1 
ATOM   934  C C8    . DA  B 1 14  ? 66.104  56.471 114.335 1.00 18.15  ? 14  DA  D C8    1 
ATOM   935  N N7    . DA  B 1 14  ? 64.869  56.106 114.089 1.00 27.49  ? 14  DA  D N7    1 
ATOM   936  C C5    . DA  B 1 14  ? 65.001  54.852 113.508 1.00 23.44  ? 14  DA  D C5    1 
ATOM   937  C C6    . DA  B 1 14  ? 64.053  53.929 113.017 1.00 34.31  ? 14  DA  D C6    1 
ATOM   938  N N6    . DA  B 1 14  ? 62.737  54.154 113.022 1.00 22.42  ? 14  DA  D N6    1 
ATOM   939  N N1    . DA  B 1 14  ? 64.517  52.763 112.514 1.00 34.00  ? 14  DA  D N1    1 
ATOM   940  C C2    . DA  B 1 14  ? 65.840  52.549 112.496 1.00 25.84  ? 14  DA  D C2    1 
ATOM   941  N N3    . DA  B 1 14  ? 66.829  53.338 112.921 1.00 32.85  ? 14  DA  D N3    1 
ATOM   942  C C4    . DA  B 1 14  ? 66.335  54.489 113.424 1.00 25.10  ? 14  DA  D C4    1 
ATOM   943  P P     . DG  B 1 15  ? 72.239  56.219 112.366 1.00 51.65  ? 15  DG  D P     1 
ATOM   944  O OP1   . DG  B 1 15  ? 73.683  56.096 112.636 1.00 53.40  ? 15  DG  D OP1   1 
ATOM   945  O OP2   . DG  B 1 15  ? 71.711  57.417 111.677 1.00 44.09  ? 15  DG  D OP2   1 
ATOM   946  O "O5'" . DG  B 1 15  ? 71.826  54.947 111.518 1.00 53.84  ? 15  DG  D "O5'" 1 
ATOM   947  C "C5'" . DG  B 1 15  ? 72.154  53.640 111.972 1.00 55.03  ? 15  DG  D "C5'" 1 
ATOM   948  C "C4'" . DG  B 1 15  ? 71.565  52.613 111.044 1.00 55.06  ? 15  DG  D "C4'" 1 
ATOM   949  O "O4'" . DG  B 1 15  ? 70.130  52.785 111.003 1.00 53.20  ? 15  DG  D "O4'" 1 
ATOM   950  C "C3'" . DG  B 1 15  ? 72.024  52.738 109.588 1.00 61.01  ? 15  DG  D "C3'" 1 
ATOM   951  O "O3'" . DG  B 1 15  ? 72.170  51.440 108.989 1.00 80.16  ? 15  DG  D "O3'" 1 
ATOM   952  C "C2'" . DG  B 1 15  ? 70.895  53.502 108.924 1.00 54.57  ? 15  DG  D "C2'" 1 
ATOM   953  C "C1'" . DG  B 1 15  ? 69.701  52.958 109.662 1.00 53.54  ? 15  DG  D "C1'" 1 
ATOM   954  N N9    . DG  B 1 15  ? 68.504  53.793 109.677 1.00 49.70  ? 15  DG  D N9    1 
ATOM   955  C C8    . DG  B 1 15  ? 68.414  55.115 110.054 1.00 52.38  ? 15  DG  D C8    1 
ATOM   956  N N7    . DG  B 1 15  ? 67.196  55.565 110.034 1.00 47.02  ? 15  DG  D N7    1 
ATOM   957  C C5    . DG  B 1 15  ? 66.433  54.487 109.613 1.00 36.32  ? 15  DG  D C5    1 
ATOM   958  C C6    . DG  B 1 15  ? 65.050  54.378 109.435 1.00 39.07  ? 15  DG  D C6    1 
ATOM   959  O O6    . DG  B 1 15  ? 64.195  55.227 109.646 1.00 48.91  ? 15  DG  D O6    1 
ATOM   960  N N1    . DG  B 1 15  ? 64.677  53.116 108.975 1.00 16.59  ? 15  DG  D N1    1 
ATOM   961  C C2    . DG  B 1 15  ? 65.548  52.084 108.729 1.00 33.65  ? 15  DG  D C2    1 
ATOM   962  N N2    . DG  B 1 15  ? 65.001  50.952 108.281 1.00 34.63  ? 15  DG  D N2    1 
ATOM   963  N N3    . DG  B 1 15  ? 66.858  52.170 108.913 1.00 41.68  ? 15  DG  D N3    1 
ATOM   964  C C4    . DG  B 1 15  ? 67.226  53.397 109.358 1.00 43.00  ? 15  DG  D C4    1 
ATOM   965  P P     . DC  B 1 16  ? 72.991  51.296 107.617 1.00 93.22  ? 16  DC  D P     1 
ATOM   966  O OP1   . DC  B 1 16  ? 74.342  50.796 107.938 1.00 94.08  ? 16  DC  D OP1   1 
ATOM   967  O OP2   . DC  B 1 16  ? 72.840  52.586 106.896 1.00 91.36  ? 16  DC  D OP2   1 
ATOM   968  O "O5'" . DC  B 1 16  ? 72.233  50.171 106.778 1.00 90.88  ? 16  DC  D "O5'" 1 
ATOM   969  C "C5'" . DC  B 1 16  ? 71.076  49.517 107.298 1.00 83.11  ? 16  DC  D "C5'" 1 
ATOM   970  C "C4'" . DC  B 1 16  ? 70.154  49.105 106.184 1.00 77.89  ? 16  DC  D "C4'" 1 
ATOM   971  O "O4'" . DC  B 1 16  ? 68.955  49.903 106.280 1.00 75.10  ? 16  DC  D "O4'" 1 
ATOM   972  C "C3'" . DC  B 1 16  ? 70.676  49.296 104.750 1.00 78.30  ? 16  DC  D "C3'" 1 
ATOM   973  O "O3'" . DC  B 1 16  ? 70.248  48.229 103.892 1.00 63.55  ? 16  DC  D "O3'" 1 
ATOM   974  C "C2'" . DC  B 1 16  ? 70.029  50.602 104.326 1.00 73.24  ? 16  DC  D "C2'" 1 
ATOM   975  C "C1'" . DC  B 1 16  ? 68.690  50.533 105.040 1.00 70.41  ? 16  DC  D "C1'" 1 
ATOM   976  N N1    . DC  B 1 16  ? 68.052  51.830 105.325 1.00 59.01  ? 16  DC  D N1    1 
ATOM   977  C C2    . DC  B 1 16  ? 66.654  51.910 105.313 1.00 47.11  ? 16  DC  D C2    1 
ATOM   978  O O2    . DC  B 1 16  ? 65.997  50.900 105.038 1.00 42.35  ? 16  DC  D O2    1 
ATOM   979  N N3    . DC  B 1 16  ? 66.056  53.086 105.600 1.00 34.81  ? 16  DC  D N3    1 
ATOM   980  C C4    . DC  B 1 16  ? 66.795  54.148 105.908 1.00 39.88  ? 16  DC  D C4    1 
ATOM   981  N N4    . DC  B 1 16  ? 66.164  55.277 106.218 1.00 40.60  ? 16  DC  D N4    1 
ATOM   982  C C5    . DC  B 1 16  ? 68.220  54.099 105.915 1.00 52.75  ? 16  DC  D C5    1 
ATOM   983  C C6    . DC  B 1 16  ? 68.804  52.930 105.612 1.00 56.98  ? 16  DC  D C6    1 
ATOM   984  P P     . DA  B 1 17  ? 71.083  47.889 102.584 1.00 78.93  ? 17  DA  D P     1 
ATOM   985  O OP1   . DA  B 1 17  ? 72.325  47.199 103.000 1.00 86.07  ? 17  DA  D OP1   1 
ATOM   986  O OP2   . DA  B 1 17  ? 71.178  49.159 101.825 1.00 78.14  ? 17  DA  D OP2   1 
ATOM   987  O "O5'" . DA  B 1 17  ? 70.122  46.865 101.824 1.00 89.73  ? 17  DA  D "O5'" 1 
ATOM   988  C "C5'" . DA  B 1 17  ? 68.892  47.307 101.254 1.00 96.63  ? 17  DA  D "C5'" 1 
ATOM   989  C "C4'" . DA  B 1 17  ? 67.741  47.041 102.201 1.00 96.90  ? 17  DA  D "C4'" 1 
ATOM   990  O "O4'" . DA  B 1 17  ? 67.212  48.309 102.646 1.00 91.03  ? 17  DA  D "O4'" 1 
ATOM   991  C "C3'" . DA  B 1 17  ? 66.571  46.326 101.523 1.00 100.62 ? 17  DA  D "C3'" 1 
ATOM   992  O "O3'" . DA  B 1 17  ? 66.016  45.259 102.294 1.00 100.62 ? 17  DA  D "O3'" 1 
ATOM   993  C "C2'" . DA  B 1 17  ? 65.531  47.396 101.233 1.00 100.29 ? 17  DA  D "C2'" 1 
ATOM   994  C "C1'" . DA  B 1 17  ? 66.008  48.642 101.973 1.00 92.53  ? 17  DA  D "C1'" 1 
ATOM   995  N N9    . DA  B 1 17  ? 66.312  49.691 100.991 1.00 90.00  ? 17  DA  D N9    1 
ATOM   996  C C8    . DA  B 1 17  ? 67.573  50.050 100.603 1.00 96.80  ? 17  DA  D C8    1 
ATOM   997  N N7    . DA  B 1 17  ? 67.581  50.921 99.602  1.00 100.62 ? 17  DA  D N7    1 
ATOM   998  C C5    . DA  B 1 17  ? 66.240  51.161 99.352  1.00 99.33  ? 17  DA  D C5    1 
ATOM   999  C C6    . DA  B 1 17  ? 65.601  51.955 98.393  1.00 99.79  ? 17  DA  D C6    1 
ATOM   1000 N N6    . DA  B 1 17  ? 66.238  52.641 97.446  1.00 100.62 ? 17  DA  D N6    1 
ATOM   1001 N N1    . DA  B 1 17  ? 64.248  52.011 98.419  1.00 80.53  ? 17  DA  D N1    1 
ATOM   1002 C C2    . DA  B 1 17  ? 63.597  51.281 99.345  1.00 77.18  ? 17  DA  D C2    1 
ATOM   1003 N N3    . DA  B 1 17  ? 64.096  50.468 100.275 1.00 85.48  ? 17  DA  D N3    1 
ATOM   1004 C C4    . DA  B 1 17  ? 65.443  50.442 100.234 1.00 91.09  ? 17  DA  D C4    1 
ATOM   1005 P P     . DT  B 1 18  ? 65.344  44.005 101.534 1.00 100.62 ? 18  DT  D P     1 
ATOM   1006 O OP1   . DT  B 1 18  ? 65.013  42.945 102.508 1.00 100.62 ? 18  DT  D OP1   1 
ATOM   1007 O OP2   . DT  B 1 18  ? 66.265  43.703 100.418 1.00 100.62 ? 18  DT  D OP2   1 
ATOM   1008 O "O5'" . DT  B 1 18  ? 63.986  44.560 100.912 1.00 100.62 ? 18  DT  D "O5'" 1 
ATOM   1009 C "C5'" . DT  B 1 18  ? 62.745  44.457 101.635 1.00 100.62 ? 18  DT  D "C5'" 1 
ATOM   1010 C "C4'" . DT  B 1 18  ? 61.609  45.061 100.846 1.00 100.62 ? 18  DT  D "C4'" 1 
ATOM   1011 O "O4'" . DT  B 1 18  ? 62.018  46.351 100.343 1.00 100.62 ? 18  DT  D "O4'" 1 
ATOM   1012 C "C3'" . DT  B 1 18  ? 61.117  44.284 99.619  1.00 99.32  ? 18  DT  D "C3'" 1 
ATOM   1013 O "O3'" . DT  B 1 18  ? 59.690  44.436 99.497  1.00 82.05  ? 18  DT  D "O3'" 1 
ATOM   1014 C "C2'" . DT  B 1 18  ? 61.798  44.988 98.467  1.00 100.62 ? 18  DT  D "C2'" 1 
ATOM   1015 C "C1'" . DT  B 1 18  ? 61.772  46.418 98.949  1.00 100.62 ? 18  DT  D "C1'" 1 
ATOM   1016 N N1    . DT  B 1 18  ? 62.797  47.281 98.343  1.00 100.62 ? 18  DT  D N1    1 
ATOM   1017 C C2    . DT  B 1 18  ? 62.388  48.469 97.780  1.00 100.32 ? 18  DT  D C2    1 
ATOM   1018 O O2    . DT  B 1 18  ? 61.225  48.841 97.779  1.00 100.62 ? 18  DT  D O2    1 
ATOM   1019 N N3    . DT  B 1 18  ? 63.399  49.203 97.213  1.00 99.63  ? 18  DT  D N3    1 
ATOM   1020 C C4    . DT  B 1 18  ? 64.738  48.879 97.158  1.00 98.49  ? 18  DT  D C4    1 
ATOM   1021 O O4    . DT  B 1 18  ? 65.531  49.641 96.603  1.00 100.62 ? 18  DT  D O4    1 
ATOM   1022 C C5    . DT  B 1 18  ? 65.099  47.625 97.780  1.00 99.34  ? 18  DT  D C5    1 
ATOM   1023 C C7    . DT  B 1 18  ? 66.528  47.199 97.779  1.00 91.22  ? 18  DT  D C7    1 
ATOM   1024 C C6    . DT  B 1 18  ? 64.118  46.900 98.335  1.00 100.62 ? 18  DT  D C6    1 
ATOM   1025 P P     . DA  B 1 19  ? 58.872  43.576 98.405  1.00 48.71  ? 19  DA  D P     1 
ATOM   1026 O OP1   . DA  B 1 19  ? 58.515  42.269 98.982  1.00 43.32  ? 19  DA  D OP1   1 
ATOM   1027 O OP2   . DA  B 1 19  ? 59.623  43.623 97.126  1.00 44.04  ? 19  DA  D OP2   1 
ATOM   1028 O "O5'" . DA  B 1 19  ? 57.518  44.392 98.208  1.00 40.44  ? 19  DA  D "O5'" 1 
ATOM   1029 C "C5'" . DA  B 1 19  ? 56.668  44.133 97.091  1.00 42.07  ? 19  DA  D "C5'" 1 
ATOM   1030 C "C4'" . DA  B 1 19  ? 55.963  45.398 96.673  1.00 46.28  ? 19  DA  D "C4'" 1 
ATOM   1031 O "O4'" . DA  B 1 19  ? 56.946  46.456 96.655  1.00 50.20  ? 19  DA  D "O4'" 1 
ATOM   1032 C "C3'" . DA  B 1 19  ? 55.365  45.363 95.267  1.00 52.91  ? 19  DA  D "C3'" 1 
ATOM   1033 O "O3'" . DA  B 1 19  ? 54.166  46.169 95.222  1.00 40.63  ? 19  DA  D "O3'" 1 
ATOM   1034 C "C2'" . DA  B 1 19  ? 56.505  45.882 94.420  1.00 40.95  ? 19  DA  D "C2'" 1 
ATOM   1035 C "C1'" . DA  B 1 19  ? 57.132  46.923 95.326  1.00 52.73  ? 19  DA  D "C1'" 1 
ATOM   1036 N N9    . DA  B 1 19  ? 58.563  47.109 95.107  1.00 57.05  ? 19  DA  D N9    1 
ATOM   1037 C C8    . DA  B 1 19  ? 59.603  46.412 95.664  1.00 55.20  ? 19  DA  D C8    1 
ATOM   1038 N N7    . DA  B 1 19  ? 60.784  46.808 95.260  1.00 40.57  ? 19  DA  D N7    1 
ATOM   1039 C C5    . DA  B 1 19  ? 60.505  47.839 94.375  1.00 48.64  ? 19  DA  D C5    1 
ATOM   1040 C C6    . DA  B 1 19  ? 61.330  48.672 93.605  1.00 46.90  ? 19  DA  D C6    1 
ATOM   1041 N N6    . DA  B 1 19  ? 62.659  48.591 93.605  1.00 52.04  ? 19  DA  D N6    1 
ATOM   1042 N N1    . DA  B 1 19  ? 60.731  49.600 92.828  1.00 28.76  ? 19  DA  D N1    1 
ATOM   1043 C C2    . DA  B 1 19  ? 59.396  49.676 92.830  1.00 27.19  ? 19  DA  D C2    1 
ATOM   1044 N N3    . DA  B 1 19  ? 58.514  48.948 93.509  1.00 37.52  ? 19  DA  D N3    1 
ATOM   1045 C C4    . DA  B 1 19  ? 59.140  48.037 94.274  1.00 48.04  ? 19  DA  D C4    1 
ATOM   1046 P P     . DT  B 1 20  ? 54.062  47.455 94.251  1.00 100.62 ? 20  DT  D P     1 
ATOM   1047 O OP1   . DT  B 1 20  ? 54.963  48.505 94.772  1.00 100.62 ? 20  DT  D OP1   1 
ATOM   1048 O OP2   . DT  B 1 20  ? 52.628  47.758 94.072  1.00 100.62 ? 20  DT  D OP2   1 
ATOM   1049 O "O5'" . DT  B 1 20  ? 54.637  47.002 92.841  1.00 95.30  ? 20  DT  D "O5'" 1 
ATOM   1050 C "C5'" . DT  B 1 20  ? 55.829  47.597 92.344  1.00 87.47  ? 20  DT  D "C5'" 1 
ATOM   1051 C "C4'" . DT  B 1 20  ? 55.510  48.647 91.316  1.00 83.31  ? 20  DT  D "C4'" 1 
ATOM   1052 O "O4'" . DT  B 1 20  ? 56.732  49.231 90.839  1.00 87.14  ? 20  DT  D "O4'" 1 
ATOM   1053 C "C3'" . DT  B 1 20  ? 54.846  48.058 90.093  1.00 78.26  ? 20  DT  D "C3'" 1 
ATOM   1054 O "O3'" . DT  B 1 20  ? 54.073  49.051 89.449  1.00 69.66  ? 20  DT  D "O3'" 1 
ATOM   1055 C "C2'" . DT  B 1 20  ? 56.010  47.683 89.207  1.00 77.88  ? 20  DT  D "C2'" 1 
ATOM   1056 C "C1'" . DT  B 1 20  ? 57.042  48.751 89.536  1.00 77.22  ? 20  DT  D "C1'" 1 
ATOM   1057 N N1    . DT  B 1 20  ? 58.383  48.197 89.624  1.00 62.37  ? 20  DT  D N1    1 
ATOM   1058 C C2    . DT  B 1 20  ? 59.398  48.755 88.898  1.00 56.66  ? 20  DT  D C2    1 
ATOM   1059 O O2    . DT  B 1 20  ? 59.239  49.673 88.106  1.00 55.37  ? 20  DT  D O2    1 
ATOM   1060 N N3    . DT  B 1 20  ? 60.620  48.189 89.133  1.00 56.65  ? 20  DT  D N3    1 
ATOM   1061 C C4    . DT  B 1 20  ? 60.917  47.139 89.983  1.00 56.59  ? 20  DT  D C4    1 
ATOM   1062 O O4    . DT  B 1 20  ? 62.079  46.749 90.099  1.00 64.22  ? 20  DT  D O4    1 
ATOM   1063 C C5    . DT  B 1 20  ? 59.793  46.583 90.685  1.00 48.87  ? 20  DT  D C5    1 
ATOM   1064 C C7    . DT  B 1 20  ? 60.006  45.439 91.617  1.00 37.74  ? 20  DT  D C7    1 
ATOM   1065 C C6    . DT  B 1 20  ? 58.596  47.135 90.465  1.00 42.25  ? 20  DT  D C6    1 
ATOM   1066 P P     . DG  B 1 21  ? 53.220  48.642 88.171  1.00 60.41  ? 21  DG  D P     1 
ATOM   1067 O OP1   . DG  B 1 21  ? 52.324  49.749 87.783  1.00 61.65  ? 21  DG  D OP1   1 
ATOM   1068 O OP2   . DG  B 1 21  ? 52.652  47.325 88.501  1.00 66.40  ? 21  DG  D OP2   1 
ATOM   1069 O "O5'" . DG  B 1 21  ? 54.303  48.390 87.032  1.00 71.60  ? 21  DG  D "O5'" 1 
ATOM   1070 C "C5'" . DG  B 1 21  ? 54.522  49.354 85.988  1.00 63.38  ? 21  DG  D "C5'" 1 
ATOM   1071 C "C4'" . DG  B 1 21  ? 55.507  48.844 84.962  1.00 49.74  ? 21  DG  D "C4'" 1 
ATOM   1072 O "O4'" . DG  B 1 21  ? 56.710  48.370 85.622  1.00 51.83  ? 21  DG  D "O4'" 1 
ATOM   1073 C "C3'" . DG  B 1 21  ? 55.048  47.686 84.058  1.00 47.83  ? 21  DG  D "C3'" 1 
ATOM   1074 O "O3'" . DG  B 1 21  ? 55.531  47.885 82.718  1.00 47.94  ? 21  DG  D "O3'" 1 
ATOM   1075 C "C2'" . DG  B 1 21  ? 55.763  46.487 84.650  1.00 49.15  ? 21  DG  D "C2'" 1 
ATOM   1076 C "C1'" . DG  B 1 21  ? 57.073  47.107 85.090  1.00 49.40  ? 21  DG  D "C1'" 1 
ATOM   1077 N N9    . DG  B 1 21  ? 57.857  46.355 86.078  1.00 48.93  ? 21  DG  D N9    1 
ATOM   1078 C C8    . DG  B 1 21  ? 57.380  45.478 87.034  1.00 49.16  ? 21  DG  D C8    1 
ATOM   1079 N N7    . DG  B 1 21  ? 58.327  44.913 87.731  1.00 41.27  ? 21  DG  D N7    1 
ATOM   1080 C C5    . DG  B 1 21  ? 59.499  45.443 87.222  1.00 44.09  ? 21  DG  D C5    1 
ATOM   1081 C C6    . DG  B 1 21  ? 60.841  45.201 87.589  1.00 41.97  ? 21  DG  D C6    1 
ATOM   1082 O O6    . DG  B 1 21  ? 61.287  44.415 88.439  1.00 43.28  ? 21  DG  D O6    1 
ATOM   1083 N N1    . DG  B 1 21  ? 61.715  45.993 86.856  1.00 40.48  ? 21  DG  D N1    1 
ATOM   1084 C C2    . DG  B 1 21  ? 61.345  46.891 85.880  1.00 35.00  ? 21  DG  D C2    1 
ATOM   1085 N N2    . DG  B 1 21  ? 62.332  47.595 85.327  1.00 48.30  ? 21  DG  D N2    1 
ATOM   1086 N N3    . DG  B 1 21  ? 60.096  47.095 85.498  1.00 49.54  ? 21  DG  D N3    1 
ATOM   1087 C C4    . DG  B 1 21  ? 59.228  46.352 86.219  1.00 50.84  ? 21  DG  D C4    1 
ATOM   1088 P P     . DC  B 1 22  ? 54.584  47.578 81.452  1.00 47.46  ? 22  DC  D P     1 
ATOM   1089 O OP1   . DC  B 1 22  ? 54.867  48.613 80.417  1.00 41.92  ? 22  DC  D OP1   1 
ATOM   1090 O OP2   . DC  B 1 22  ? 53.188  47.370 81.909  1.00 58.13  ? 22  DC  D OP2   1 
ATOM   1091 O "O5'" . DC  B 1 22  ? 55.059  46.162 80.892  1.00 43.30  ? 22  DC  D "O5'" 1 
ATOM   1092 C "C5'" . DC  B 1 22  ? 56.164  45.469 81.469  1.00 41.99  ? 22  DC  D "C5'" 1 
ATOM   1093 C "C4'" . DC  B 1 22  ? 57.463  46.043 80.950  1.00 38.74  ? 22  DC  D "C4'" 1 
ATOM   1094 O "O4'" . DC  B 1 22  ? 58.446  46.065 82.004  1.00 31.80  ? 22  DC  D "O4'" 1 
ATOM   1095 C "C3'" . DC  B 1 22  ? 58.127  45.320 79.778  1.00 40.02  ? 22  DC  D "C3'" 1 
ATOM   1096 O "O3'" . DC  B 1 22  ? 58.844  46.299 79.026  1.00 33.29  ? 22  DC  D "O3'" 1 
ATOM   1097 C "C2'" . DC  B 1 22  ? 59.113  44.402 80.470  1.00 38.68  ? 22  DC  D "C2'" 1 
ATOM   1098 C "C1'" . DC  B 1 22  ? 59.543  45.235 81.675  1.00 37.78  ? 22  DC  D "C1'" 1 
ATOM   1099 N N1    . DC  B 1 22  ? 59.812  44.426 82.855  1.00 40.59  ? 22  DC  D N1    1 
ATOM   1100 C C2    . DC  B 1 22  ? 61.082  44.447 83.402  1.00 41.03  ? 22  DC  D C2    1 
ATOM   1101 O O2    . DC  B 1 22  ? 61.923  45.192 82.899  1.00 48.88  ? 22  DC  D O2    1 
ATOM   1102 N N3    . DC  B 1 22  ? 61.357  43.659 84.464  1.00 35.65  ? 22  DC  D N3    1 
ATOM   1103 C C4    . DC  B 1 22  ? 60.401  42.875 84.976  1.00 25.42  ? 22  DC  D C4    1 
ATOM   1104 N N4    . DC  B 1 22  ? 60.721  42.067 85.988  1.00 10.94  ? 22  DC  D N4    1 
ATOM   1105 C C5    . DC  B 1 22  ? 59.077  42.871 84.456  1.00 39.20  ? 22  DC  D C5    1 
ATOM   1106 C C6    . DC  B 1 22  ? 58.828  43.652 83.403  1.00 39.38  ? 22  DC  D C6    1 
ATOM   1107 P P     . DT  B 1 23  ? 59.146  46.055 77.470  1.00 29.90  ? 23  DT  D P     1 
ATOM   1108 O OP1   . DT  B 1 23  ? 59.282  47.419 76.895  1.00 27.56  ? 23  DT  D OP1   1 
ATOM   1109 O OP2   . DT  B 1 23  ? 58.191  45.093 76.866  1.00 21.11  ? 23  DT  D OP2   1 
ATOM   1110 O "O5'" . DT  B 1 23  ? 60.579  45.379 77.520  1.00 35.79  ? 23  DT  D "O5'" 1 
ATOM   1111 C "C5'" . DT  B 1 23  ? 61.676  46.128 78.002  1.00 27.45  ? 23  DT  D "C5'" 1 
ATOM   1112 C "C4'" . DT  B 1 23  ? 62.914  45.272 78.066  1.00 21.49  ? 23  DT  D "C4'" 1 
ATOM   1113 O "O4'" . DT  B 1 23  ? 62.978  44.556 79.318  1.00 15.97  ? 23  DT  D "O4'" 1 
ATOM   1114 C "C3'" . DT  B 1 23  ? 62.986  44.217 76.966  1.00 23.92  ? 23  DT  D "C3'" 1 
ATOM   1115 O "O3'" . DT  B 1 23  ? 64.306  44.156 76.447  1.00 30.51  ? 23  DT  D "O3'" 1 
ATOM   1116 C "C2'" . DT  B 1 23  ? 62.654  42.929 77.693  1.00 8.80   ? 23  DT  D "C2'" 1 
ATOM   1117 C "C1'" . DT  B 1 23  ? 63.268  43.198 79.057  1.00 13.03  ? 23  DT  D "C1'" 1 
ATOM   1118 N N1    . DT  B 1 23  ? 62.701  42.412 80.146  1.00 15.99  ? 23  DT  D N1    1 
ATOM   1119 C C2    . DT  B 1 23  ? 63.525  41.937 81.145  1.00 18.36  ? 23  DT  D C2    1 
ATOM   1120 O O2    . DT  B 1 23  ? 64.721  42.171 81.209  1.00 24.75  ? 23  DT  D O2    1 
ATOM   1121 N N3    . DT  B 1 23  ? 62.882  41.172 82.083  1.00 27.55  ? 23  DT  D N3    1 
ATOM   1122 C C4    . DT  B 1 23  ? 61.540  40.841 82.116  1.00 25.17  ? 23  DT  D C4    1 
ATOM   1123 O O4    . DT  B 1 23  ? 61.125  40.102 82.992  1.00 27.24  ? 23  DT  D O4    1 
ATOM   1124 C C5    . DT  B 1 23  ? 60.733  41.412 81.056  1.00 29.28  ? 23  DT  D C5    1 
ATOM   1125 C C7    . DT  B 1 23  ? 59.259  41.150 81.021  1.00 14.84  ? 23  DT  D C7    1 
ATOM   1126 C C6    . DT  B 1 23  ? 61.351  42.157 80.140  1.00 31.43  ? 23  DT  D C6    1 
ATOM   1127 P P     . DA  B 1 24  ? 64.606  43.241 75.173  1.00 35.47  ? 24  DA  D P     1 
ATOM   1128 O OP1   . DA  B 1 24  ? 65.167  44.150 74.136  1.00 33.97  ? 24  DA  D OP1   1 
ATOM   1129 O OP2   . DA  B 1 24  ? 63.409  42.431 74.863  1.00 41.35  ? 24  DA  D OP2   1 
ATOM   1130 O "O5'" . DA  B 1 24  ? 65.704  42.251 75.766  1.00 39.58  ? 24  DA  D "O5'" 1 
ATOM   1131 C "C5'" . DA  B 1 24  ? 66.670  42.757 76.687  1.00 37.45  ? 24  DA  D "C5'" 1 
ATOM   1132 C "C4'" . DA  B 1 24  ? 67.317  41.648 77.480  1.00 39.60  ? 24  DA  D "C4'" 1 
ATOM   1133 O "O4'" . DA  B 1 24  ? 66.451  41.250 78.577  1.00 32.52  ? 24  DA  D "O4'" 1 
ATOM   1134 C "C3'" . DA  B 1 24  ? 67.644  40.377 76.686  1.00 44.48  ? 24  DA  D "C3'" 1 
ATOM   1135 O "O3'" . DA  B 1 24  ? 68.950  39.871 76.976  1.00 42.35  ? 24  DA  D "O3'" 1 
ATOM   1136 C "C2'" . DA  B 1 24  ? 66.622  39.390 77.201  1.00 46.45  ? 24  DA  D "C2'" 1 
ATOM   1137 C "C1'" . DA  B 1 24  ? 66.461  39.840 78.636  1.00 36.25  ? 24  DA  D "C1'" 1 
ATOM   1138 N N9    . DA  B 1 24  ? 65.192  39.363 79.167  1.00 28.20  ? 24  DA  D N9    1 
ATOM   1139 C C8    . DA  B 1 24  ? 63.937  39.592 78.685  1.00 20.09  ? 24  DA  D C8    1 
ATOM   1140 N N7    . DA  B 1 24  ? 63.009  38.898 79.296  1.00 32.44  ? 24  DA  D N7    1 
ATOM   1141 C C5    . DA  B 1 24  ? 63.703  38.198 80.274  1.00 28.51  ? 24  DA  D C5    1 
ATOM   1142 C C6    . DA  B 1 24  ? 63.293  37.294 81.258  1.00 22.20  ? 24  DA  D C6    1 
ATOM   1143 N N6    . DA  B 1 24  ? 62.034  36.922 81.442  1.00 35.22  ? 24  DA  D N6    1 
ATOM   1144 N N1    . DA  B 1 24  ? 64.235  36.780 82.072  1.00 24.42  ? 24  DA  D N1    1 
ATOM   1145 C C2    . DA  B 1 24  ? 65.497  37.170 81.911  1.00 25.06  ? 24  DA  D C2    1 
ATOM   1146 N N3    . DA  B 1 24  ? 66.004  38.018 81.031  1.00 30.33  ? 24  DA  D N3    1 
ATOM   1147 C C4    . DA  B 1 24  ? 65.042  38.499 80.226  1.00 31.03  ? 24  DA  D C4    1 
ATOM   1148 P P     . DT  B 1 25  ? 69.650  38.823 75.964  1.00 32.64  ? 25  DT  D P     1 
ATOM   1149 O OP1   . DT  B 1 25  ? 70.829  39.538 75.402  1.00 28.04  ? 25  DT  D OP1   1 
ATOM   1150 O OP2   . DT  B 1 25  ? 68.636  38.254 75.054  1.00 14.70  ? 25  DT  D OP2   1 
ATOM   1151 O "O5'" . DT  B 1 25  ? 70.176  37.692 76.949  1.00 29.21  ? 25  DT  D "O5'" 1 
ATOM   1152 C "C5'" . DT  B 1 25  ? 71.056  38.044 78.004  1.00 17.44  ? 25  DT  D "C5'" 1 
ATOM   1153 C "C4'" . DT  B 1 25  ? 70.956  37.058 79.135  1.00 13.87  ? 25  DT  D "C4'" 1 
ATOM   1154 O "O4'" . DT  B 1 25  ? 69.582  36.924 79.562  1.00 17.44  ? 25  DT  D "O4'" 1 
ATOM   1155 C "C3'" . DT  B 1 25  ? 71.432  35.637 78.841  1.00 22.30  ? 25  DT  D "C3'" 1 
ATOM   1156 O "O3'" . DT  B 1 25  ? 72.064  35.159 80.028  1.00 29.09  ? 25  DT  D "O3'" 1 
ATOM   1157 C "C2'" . DT  B 1 25  ? 70.138  34.877 78.628  1.00 17.09  ? 25  DT  D "C2'" 1 
ATOM   1158 C "C1'" . DT  B 1 25  ? 69.264  35.544 79.655  1.00 16.70  ? 25  DT  D "C1'" 1 
ATOM   1159 N N1    . DT  B 1 25  ? 67.825  35.380 79.417  1.00 21.41  ? 25  DT  D N1    1 
ATOM   1160 C C2    . DT  B 1 25  ? 67.122  34.523 80.240  1.00 26.27  ? 25  DT  D C2    1 
ATOM   1161 O O2    . DT  B 1 25  ? 67.639  33.870 81.121  1.00 41.76  ? 25  DT  D O2    1 
ATOM   1162 N N3    . DT  B 1 25  ? 65.794  34.438 79.978  1.00 20.07  ? 25  DT  D N3    1 
ATOM   1163 C C4    . DT  B 1 25  ? 65.111  35.070 78.980  1.00 15.56  ? 25  DT  D C4    1 
ATOM   1164 O O4    . DT  B 1 25  ? 63.908  34.876 78.888  1.00 19.49  ? 25  DT  D O4    1 
ATOM   1165 C C5    . DT  B 1 25  ? 65.919  35.930 78.114  1.00 9.83   ? 25  DT  D C5    1 
ATOM   1166 C C7    . DT  B 1 25  ? 65.293  36.610 76.943  1.00 2.69   ? 25  DT  D C7    1 
ATOM   1167 C C6    . DT  B 1 25  ? 67.212  36.058 78.397  1.00 14.43  ? 25  DT  D C6    1 
ATOM   1168 P P     . DA  B 1 26  ? 72.849  33.768 80.022  1.00 27.75  ? 26  DA  D P     1 
ATOM   1169 O OP1   . DA  B 1 26  ? 73.969  33.915 80.983  1.00 29.06  ? 26  DA  D OP1   1 
ATOM   1170 O OP2   . DA  B 1 26  ? 73.125  33.404 78.605  1.00 27.69  ? 26  DA  D OP2   1 
ATOM   1171 O "O5'" . DA  B 1 26  ? 71.789  32.736 80.613  1.00 18.16  ? 26  DA  D "O5'" 1 
ATOM   1172 C "C5'" . DA  B 1 26  ? 71.419  32.778 81.986  1.00 22.61  ? 26  DA  D "C5'" 1 
ATOM   1173 C "C4'" . DA  B 1 26  ? 70.925  31.417 82.416  1.00 28.71  ? 26  DA  D "C4'" 1 
ATOM   1174 O "O4'" . DA  B 1 26  ? 69.550  31.200 82.020  1.00 29.28  ? 26  DA  D "O4'" 1 
ATOM   1175 C "C3'" . DA  B 1 26  ? 71.720  30.288 81.770  1.00 31.33  ? 26  DA  D "C3'" 1 
ATOM   1176 O "O3'" . DA  B 1 26  ? 71.870  29.212 82.696  1.00 36.75  ? 26  DA  D "O3'" 1 
ATOM   1177 C "C2'" . DA  B 1 26  ? 70.874  29.913 80.561  1.00 29.69  ? 26  DA  D "C2'" 1 
ATOM   1178 C "C1'" . DA  B 1 26  ? 69.460  30.148 81.062  1.00 26.91  ? 26  DA  D "C1'" 1 
ATOM   1179 N N9    . DA  B 1 26  ? 68.487  30.575 80.060  1.00 25.65  ? 26  DA  D N9    1 
ATOM   1180 C C8    . DA  B 1 26  ? 68.645  31.468 79.034  1.00 24.04  ? 26  DA  D C8    1 
ATOM   1181 N N7    . DA  B 1 26  ? 67.539  31.707 78.372  1.00 31.62  ? 26  DA  D N7    1 
ATOM   1182 C C5    . DA  B 1 26  ? 66.596  30.899 78.994  1.00 23.55  ? 26  DA  D C5    1 
ATOM   1183 C C6    . DA  B 1 26  ? 65.226  30.684 78.766  1.00 26.74  ? 26  DA  D C6    1 
ATOM   1184 N N6    . DA  B 1 26  ? 64.536  31.302 77.808  1.00 39.30  ? 26  DA  D N6    1 
ATOM   1185 N N1    . DA  B 1 26  ? 64.583  29.801 79.557  1.00 24.66  ? 26  DA  D N1    1 
ATOM   1186 C C2    . DA  B 1 26  ? 65.274  29.181 80.505  1.00 6.92   ? 26  DA  D C2    1 
ATOM   1187 N N3    . DA  B 1 26  ? 66.558  29.297 80.820  1.00 30.11  ? 26  DA  D N3    1 
ATOM   1188 C C4    . DA  B 1 26  ? 67.171  30.183 80.017  1.00 19.91  ? 26  DA  D C4    1 
ATOM   1189 P P     . DC  B 1 27  ? 72.876  28.014 82.361  1.00 30.13  ? 27  DC  D P     1 
ATOM   1190 O OP1   . DC  B 1 27  ? 73.529  27.485 83.594  1.00 41.15  ? 27  DC  D OP1   1 
ATOM   1191 O OP2   . DC  B 1 27  ? 73.721  28.549 81.258  1.00 45.62  ? 27  DC  D OP2   1 
ATOM   1192 O "O5'" . DC  B 1 27  ? 71.909  26.870 81.833  1.00 37.37  ? 27  DC  D "O5'" 1 
ATOM   1193 C "C5'" . DC  B 1 27  ? 70.929  26.298 82.704  1.00 35.63  ? 27  DC  D "C5'" 1 
ATOM   1194 C "C4'" . DC  B 1 27  ? 70.072  25.306 81.956  1.00 30.21  ? 27  DC  D "C4'" 1 
ATOM   1195 O "O4'" . DC  B 1 27  ? 69.085  26.017 81.175  1.00 28.31  ? 27  DC  D "O4'" 1 
ATOM   1196 C "C3'" . DC  B 1 27  ? 70.803  24.390 80.968  1.00 34.50  ? 27  DC  D "C3'" 1 
ATOM   1197 O "O3'" . DC  B 1 27  ? 70.241  23.085 81.051  1.00 42.87  ? 27  DC  D "O3'" 1 
ATOM   1198 C "C2'" . DC  B 1 27  ? 70.456  24.993 79.617  1.00 30.01  ? 27  DC  D "C2'" 1 
ATOM   1199 C "C1'" . DC  B 1 27  ? 69.046  25.448 79.884  1.00 25.81  ? 27  DC  D "C1'" 1 
ATOM   1200 N N1    . DC  B 1 27  ? 68.472  26.436 78.969  1.00 29.51  ? 27  DC  D N1    1 
ATOM   1201 C C2    . DC  B 1 27  ? 67.151  26.241 78.559  1.00 30.36  ? 27  DC  D C2    1 
ATOM   1202 O O2    . DC  B 1 27  ? 66.545  25.227 78.950  1.00 38.43  ? 27  DC  D O2    1 
ATOM   1203 N N3    . DC  B 1 27  ? 66.574  27.141 77.755  1.00 25.53  ? 27  DC  D N3    1 
ATOM   1204 C C4    . DC  B 1 27  ? 67.262  28.197 77.340  1.00 24.77  ? 27  DC  D C4    1 
ATOM   1205 N N4    . DC  B 1 27  ? 66.631  29.050 76.546  1.00 21.24  ? 27  DC  D N4    1 
ATOM   1206 C C5    . DC  B 1 27  ? 68.625  28.421 77.728  1.00 19.57  ? 27  DC  D C5    1 
ATOM   1207 C C6    . DC  B 1 27  ? 69.181  27.523 78.539  1.00 20.46  ? 27  DC  D C6    1 
ATOM   1208 P P     . DG  B 1 28  ? 71.071  21.826 80.513  1.00 46.87  ? 28  DG  D P     1 
ATOM   1209 O OP1   . DG  B 1 28  ? 72.015  21.412 81.584  1.00 54.29  ? 28  DG  D OP1   1 
ATOM   1210 O OP2   . DG  B 1 28  ? 71.587  22.156 79.160  1.00 40.70  ? 28  DG  D OP2   1 
ATOM   1211 O "O5'" . DG  B 1 28  ? 69.964  20.698 80.339  1.00 51.89  ? 28  DG  D "O5'" 1 
ATOM   1212 C "C5'" . DG  B 1 28  ? 68.846  20.625 81.219  1.00 40.75  ? 28  DG  D "C5'" 1 
ATOM   1213 C "C4'" . DG  B 1 28  ? 67.591  20.341 80.427  1.00 36.59  ? 28  DG  D "C4'" 1 
ATOM   1214 O "O4'" . DG  B 1 28  ? 67.197  21.513 79.676  1.00 32.94  ? 28  DG  D "O4'" 1 
ATOM   1215 C "C3'" . DG  B 1 28  ? 67.734  19.218 79.406  1.00 37.73  ? 28  DG  D "C3'" 1 
ATOM   1216 O "O3'" . DG  B 1 28  ? 66.510  18.495 79.352  1.00 50.57  ? 28  DG  D "O3'" 1 
ATOM   1217 C "C2'" . DG  B 1 28  ? 67.955  19.964 78.102  1.00 28.58  ? 28  DG  D "C2'" 1 
ATOM   1218 C "C1'" . DG  B 1 28  ? 67.071  21.177 78.313  1.00 26.88  ? 28  DG  D "C1'" 1 
ATOM   1219 N N9    . DG  B 1 28  ? 67.402  22.368 77.535  1.00 24.23  ? 28  DG  D N9    1 
ATOM   1220 C C8    . DG  B 1 28  ? 68.632  22.951 77.364  1.00 22.15  ? 28  DG  D C8    1 
ATOM   1221 N N7    . DG  B 1 28  ? 68.592  24.013 76.606  1.00 21.89  ? 28  DG  D N7    1 
ATOM   1222 C C5    . DG  B 1 28  ? 67.253  24.133 76.255  1.00 23.63  ? 28  DG  D C5    1 
ATOM   1223 C C6    . DG  B 1 28  ? 66.583  25.106 75.442  1.00 35.90  ? 28  DG  D C6    1 
ATOM   1224 O O6    . DG  B 1 28  ? 67.055  26.089 74.846  1.00 40.83  ? 28  DG  D O6    1 
ATOM   1225 N N1    . DG  B 1 28  ? 65.217  24.852 75.365  1.00 34.50  ? 28  DG  D N1    1 
ATOM   1226 C C2    . DG  B 1 28  ? 64.576  23.811 75.986  1.00 33.43  ? 28  DG  D C2    1 
ATOM   1227 N N2    . DG  B 1 28  ? 63.250  23.756 75.802  1.00 31.01  ? 28  DG  D N2    1 
ATOM   1228 N N3    . DG  B 1 28  ? 65.187  22.904 76.734  1.00 28.15  ? 28  DG  D N3    1 
ATOM   1229 C C4    . DG  B 1 28  ? 66.510  23.127 76.828  1.00 20.28  ? 28  DG  D C4    1 
ATOM   1230 P P     . DA  B 1 29  ? 66.518  16.958 78.927  1.00 60.60  ? 29  DA  D P     1 
ATOM   1231 O OP1   . DA  B 1 29  ? 66.447  16.090 80.130  1.00 54.33  ? 29  DA  D OP1   1 
ATOM   1232 O OP2   . DA  B 1 29  ? 67.615  16.783 77.942  1.00 65.16  ? 29  DA  D OP2   1 
ATOM   1233 O "O5'" . DA  B 1 29  ? 65.151  16.808 78.160  1.00 66.46  ? 29  DA  D "O5'" 1 
ATOM   1234 C "C5'" . DA  B 1 29  ? 64.125  17.769 78.349  1.00 75.64  ? 29  DA  D "C5'" 1 
ATOM   1235 C "C4'" . DA  B 1 29  ? 63.483  18.077 77.020  1.00 77.13  ? 29  DA  D "C4'" 1 
ATOM   1236 O "O4'" . DA  B 1 29  ? 64.062  19.248 76.390  1.00 74.78  ? 29  DA  D "O4'" 1 
ATOM   1237 C "C3'" . DA  B 1 29  ? 63.683  16.931 76.032  1.00 81.06  ? 29  DA  D "C3'" 1 
ATOM   1238 O "O3'" . DA  B 1 29  ? 62.483  16.696 75.311  1.00 81.71  ? 29  DA  D "O3'" 1 
ATOM   1239 C "C2'" . DA  B 1 29  ? 64.761  17.455 75.099  1.00 75.73  ? 29  DA  D "C2'" 1 
ATOM   1240 C "C1'" . DA  B 1 29  ? 64.406  18.924 75.054  1.00 67.40  ? 29  DA  D "C1'" 1 
ATOM   1241 N N9    . DA  B 1 29  ? 65.479  19.817 74.632  1.00 57.20  ? 29  DA  D N9    1 
ATOM   1242 C C8    . DA  B 1 29  ? 66.816  19.728 74.914  1.00 62.52  ? 29  DA  D C8    1 
ATOM   1243 N N7    . DA  B 1 29  ? 67.529  20.702 74.403  1.00 58.60  ? 29  DA  D N7    1 
ATOM   1244 C C5    . DA  B 1 29  ? 66.597  21.483 73.736  1.00 45.30  ? 29  DA  D C5    1 
ATOM   1245 C C6    . DA  B 1 29  ? 66.716  22.675 73.001  1.00 47.08  ? 29  DA  D C6    1 
ATOM   1246 N N6    . DA  B 1 29  ? 67.874  23.312 72.815  1.00 49.20  ? 29  DA  D N6    1 
ATOM   1247 N N1    . DA  B 1 29  ? 65.593  23.201 72.466  1.00 39.53  ? 29  DA  D N1    1 
ATOM   1248 C C2    . DA  B 1 29  ? 64.438  22.562 72.666  1.00 31.11  ? 29  DA  D C2    1 
ATOM   1249 N N3    . DA  B 1 29  ? 64.200  21.437 73.339  1.00 30.20  ? 29  DA  D N3    1 
ATOM   1250 C C4    . DA  B 1 29  ? 65.333  20.945 73.860  1.00 44.80  ? 29  DA  D C4    1 
ATOM   1251 P P     . DA  B 1 30  ? 62.343  15.375 74.419  1.00 78.68  ? 30  DA  D P     1 
ATOM   1252 O OP1   . DA  B 1 30  ? 61.385  14.478 75.114  1.00 76.00  ? 30  DA  D OP1   1 
ATOM   1253 O OP2   . DA  B 1 30  ? 63.715  14.884 74.096  1.00 77.52  ? 30  DA  D OP2   1 
ATOM   1254 O "O5'" . DA  B 1 30  ? 61.685  15.949 73.094  1.00 67.94  ? 30  DA  D "O5'" 1 
ATOM   1255 C "C5'" . DA  B 1 30  ? 60.745  17.013 73.167  1.00 59.11  ? 30  DA  D "C5'" 1 
ATOM   1256 C "C4'" . DA  B 1 30  ? 60.761  17.814 71.888  1.00 66.01  ? 30  DA  D "C4'" 1 
ATOM   1257 O "O4'" . DA  B 1 30  ? 61.900  18.709 71.884  1.00 62.77  ? 30  DA  D "O4'" 1 
ATOM   1258 C "C3'" . DA  B 1 30  ? 60.869  16.963 70.618  1.00 71.71  ? 30  DA  D "C3'" 1 
ATOM   1259 O "O3'" . DA  B 1 30  ? 59.966  17.402 69.596  1.00 80.96  ? 30  DA  D "O3'" 1 
ATOM   1260 C "C2'" . DA  B 1 30  ? 62.299  17.179 70.166  1.00 65.28  ? 30  DA  D "C2'" 1 
ATOM   1261 C "C1'" . DA  B 1 30  ? 62.575  18.585 70.646  1.00 60.25  ? 30  DA  D "C1'" 1 
ATOM   1262 N N9    . DA  B 1 30  ? 63.995  18.875 70.850  1.00 47.44  ? 30  DA  D N9    1 
ATOM   1263 C C8    . DA  B 1 30  ? 64.953  18.179 71.550  1.00 50.43  ? 30  DA  D C8    1 
ATOM   1264 N N7    . DA  B 1 30  ? 66.153  18.711 71.474  1.00 44.48  ? 30  DA  D N7    1 
ATOM   1265 C C5    . DA  B 1 30  ? 65.965  19.835 70.687  1.00 25.14  ? 30  DA  D C5    1 
ATOM   1266 C C6    . DA  B 1 30  ? 66.840  20.831 70.239  1.00 35.31  ? 30  DA  D C6    1 
ATOM   1267 N N6    . DA  B 1 30  ? 68.136  20.871 70.549  1.00 27.93  ? 30  DA  D N6    1 
ATOM   1268 N N1    . DA  B 1 30  ? 66.334  21.810 69.458  1.00 41.65  ? 30  DA  D N1    1 
ATOM   1269 C C2    . DA  B 1 30  ? 65.024  21.785 69.168  1.00 51.51  ? 30  DA  D C2    1 
ATOM   1270 N N3    . DA  B 1 30  ? 64.095  20.912 69.539  1.00 42.46  ? 30  DA  D N3    1 
ATOM   1271 C C4    . DA  B 1 30  ? 64.640  19.950 70.304  1.00 31.40  ? 30  DA  D C4    1 
ATOM   1272 P P     . DG  B 1 31  ? 59.765  16.507 68.272  1.00 90.01  ? 31  DG  D P     1 
ATOM   1273 O OP1   . DG  B 1 31  ? 58.316  16.225 68.099  1.00 94.87  ? 31  DG  D OP1   1 
ATOM   1274 O OP2   . DG  B 1 31  ? 60.730  15.381 68.320  1.00 86.84  ? 31  DG  D OP2   1 
ATOM   1275 O "O5'" . DG  B 1 31  ? 60.226  17.489 67.110  1.00 84.51  ? 31  DG  D "O5'" 1 
ATOM   1276 C "C5'" . DG  B 1 31  ? 59.736  18.820 67.071  1.00 75.40  ? 31  DG  D "C5'" 1 
ATOM   1277 C "C4'" . DG  B 1 31  ? 60.521  19.637 66.076  1.00 67.46  ? 31  DG  D "C4'" 1 
ATOM   1278 O "O4'" . DG  B 1 31  ? 61.860  19.916 66.550  1.00 64.35  ? 31  DG  D "O4'" 1 
ATOM   1279 C "C3'" . DG  B 1 31  ? 60.685  18.998 64.703  1.00 66.44  ? 31  DG  D "C3'" 1 
ATOM   1280 O "O3'" . DG  B 1 31  ? 60.495  20.035 63.749  1.00 68.74  ? 31  DG  D "O3'" 1 
ATOM   1281 C "C2'" . DG  B 1 31  ? 62.126  18.519 64.710  1.00 58.66  ? 31  DG  D "C2'" 1 
ATOM   1282 C "C1'" . DG  B 1 31  ? 62.794  19.600 65.531  1.00 54.13  ? 31  DG  D "C1'" 1 
ATOM   1283 N N9    . DG  B 1 31  ? 64.050  19.222 66.174  1.00 44.18  ? 31  DG  D N9    1 
ATOM   1284 C C8    . DG  B 1 31  ? 64.272  18.126 66.970  1.00 40.92  ? 31  DG  D C8    1 
ATOM   1285 N N7    . DG  B 1 31  ? 65.502  18.048 67.403  1.00 38.96  ? 31  DG  D N7    1 
ATOM   1286 C C5    . DG  B 1 31  ? 66.133  19.163 66.862  1.00 34.89  ? 31  DG  D C5    1 
ATOM   1287 C C6    . DG  B 1 31  ? 67.485  19.606 66.978  1.00 34.95  ? 31  DG  D C6    1 
ATOM   1288 O O6    . DG  B 1 31  ? 68.417  19.089 67.624  1.00 37.15  ? 31  DG  D O6    1 
ATOM   1289 N N1    . DG  B 1 31  ? 67.710  20.775 66.248  1.00 15.65  ? 31  DG  D N1    1 
ATOM   1290 C C2    . DG  B 1 31  ? 66.752  21.445 65.521  1.00 25.82  ? 31  DG  D C2    1 
ATOM   1291 N N2    . DG  B 1 31  ? 67.158  22.568 64.891  1.00 24.57  ? 31  DG  D N2    1 
ATOM   1292 N N3    . DG  B 1 31  ? 65.485  21.048 65.416  1.00 36.49  ? 31  DG  D N3    1 
ATOM   1293 C C4    . DG  B 1 31  ? 65.253  19.902 66.102  1.00 37.00  ? 31  DG  D C4    1 
ATOM   1294 P P     . DT  B 1 32  ? 60.841  19.777 62.212  1.00 66.30  ? 32  DT  D P     1 
ATOM   1295 O OP1   . DT  B 1 32  ? 59.877  20.578 61.421  1.00 69.45  ? 32  DT  D OP1   1 
ATOM   1296 O OP2   . DT  B 1 32  ? 60.938  18.302 62.004  1.00 56.71  ? 32  DT  D OP2   1 
ATOM   1297 O "O5'" . DT  B 1 32  ? 62.286  20.425 62.033  1.00 71.86  ? 32  DT  D "O5'" 1 
ATOM   1298 C "C5'" . DT  B 1 32  ? 62.454  21.841 62.078  1.00 64.24  ? 32  DT  D "C5'" 1 
ATOM   1299 C "C4'" . DT  B 1 32  ? 63.671  22.246 61.278  1.00 58.26  ? 32  DT  D "C4'" 1 
ATOM   1300 O "O4'" . DT  B 1 32  ? 64.882  21.819 61.947  1.00 52.39  ? 32  DT  D "O4'" 1 
ATOM   1301 C "C3'" . DT  B 1 32  ? 63.736  21.631 59.882  1.00 57.64  ? 32  DT  D "C3'" 1 
ATOM   1302 O "O3'" . DT  B 1 32  ? 64.314  22.576 58.985  1.00 56.56  ? 32  DT  D "O3'" 1 
ATOM   1303 C "C2'" . DT  B 1 32  ? 64.679  20.456 60.065  1.00 51.03  ? 32  DT  D "C2'" 1 
ATOM   1304 C "C1'" . DT  B 1 32  ? 65.664  21.030 61.061  1.00 48.79  ? 32  DT  D "C1'" 1 
ATOM   1305 N N1    . DT  B 1 32  ? 66.378  20.038 61.868  1.00 44.13  ? 32  DT  D N1    1 
ATOM   1306 C C2    . DT  B 1 32  ? 67.742  20.197 62.064  1.00 44.02  ? 32  DT  D C2    1 
ATOM   1307 O O2    . DT  B 1 32  ? 68.402  21.082 61.542  1.00 46.44  ? 32  DT  D O2    1 
ATOM   1308 N N3    . DT  B 1 32  ? 68.307  19.279 62.902  1.00 27.11  ? 32  DT  D N3    1 
ATOM   1309 C C4    . DT  B 1 32  ? 67.675  18.241 63.543  1.00 30.45  ? 32  DT  D C4    1 
ATOM   1310 O O4    . DT  B 1 32  ? 68.320  17.532 64.314  1.00 23.71  ? 32  DT  D O4    1 
ATOM   1311 C C5    . DT  B 1 32  ? 66.250  18.097 63.242  1.00 29.15  ? 32  DT  D C5    1 
ATOM   1312 C C7    . DT  B 1 32  ? 65.482  16.960 63.836  1.00 26.71  ? 32  DT  D C7    1 
ATOM   1313 C C6    . DT  B 1 32  ? 65.687  18.994 62.434  1.00 36.34  ? 32  DT  D C6    1 
ATOM   1314 P P     . DT  B 1 33  ? 64.334  22.264 57.411  1.00 54.11  ? 33  DT  D P     1 
ATOM   1315 O OP1   . DT  B 1 33  ? 63.919  23.507 56.699  1.00 49.41  ? 33  DT  D OP1   1 
ATOM   1316 O OP2   . DT  B 1 33  ? 63.566  21.008 57.207  1.00 50.05  ? 33  DT  D OP2   1 
ATOM   1317 O "O5'" . DT  B 1 33  ? 65.872  21.974 57.104  1.00 58.80  ? 33  DT  D "O5'" 1 
ATOM   1318 C "C5'" . DT  B 1 33  ? 66.832  23.035 57.125  1.00 55.19  ? 33  DT  D "C5'" 1 
ATOM   1319 C "C4'" . DT  B 1 33  ? 68.215  22.519 56.801  1.00 45.94  ? 33  DT  D "C4'" 1 
ATOM   1320 O "O4'" . DT  B 1 33  ? 68.705  21.686 57.879  1.00 43.43  ? 33  DT  D "O4'" 1 
ATOM   1321 C "C3'" . DT  B 1 33  ? 68.314  21.664 55.534  1.00 40.00  ? 33  DT  D "C3'" 1 
ATOM   1322 O "O3'" . DT  B 1 33  ? 69.528  21.963 54.834  1.00 46.30  ? 33  DT  D "O3'" 1 
ATOM   1323 C "C2'" . DT  B 1 33  ? 68.376  20.251 56.085  1.00 34.47  ? 33  DT  D "C2'" 1 
ATOM   1324 C "C1'" . DT  B 1 33  ? 69.191  20.478 57.338  1.00 37.45  ? 33  DT  D "C1'" 1 
ATOM   1325 N N1    . DT  B 1 33  ? 69.097  19.443 58.372  1.00 37.76  ? 33  DT  D N1    1 
ATOM   1326 C C2    . DT  B 1 33  ? 70.201  19.274 59.181  1.00 48.35  ? 33  DT  D C2    1 
ATOM   1327 O O2    . DT  B 1 33  ? 71.193  19.988 59.120  1.00 42.99  ? 33  DT  D O2    1 
ATOM   1328 N N3    . DT  B 1 33  ? 70.104  18.247 60.074  1.00 47.62  ? 33  DT  D N3    1 
ATOM   1329 C C4    . DT  B 1 33  ? 69.032  17.407 60.251  1.00 46.66  ? 33  DT  D C4    1 
ATOM   1330 O O4    . DT  B 1 33  ? 69.108  16.500 61.066  1.00 40.79  ? 33  DT  D O4    1 
ATOM   1331 C C5    . DT  B 1 33  ? 67.881  17.685 59.409  1.00 43.22  ? 33  DT  D C5    1 
ATOM   1332 C C7    . DT  B 1 33  ? 66.640  16.876 59.587  1.00 40.92  ? 33  DT  D C7    1 
ATOM   1333 C C6    . DT  B 1 33  ? 67.976  18.667 58.517  1.00 36.20  ? 33  DT  D C6    1 
ATOM   1334 P P     . DA  B 1 34  ? 69.514  23.045 53.640  1.00 63.24  ? 34  DA  D P     1 
ATOM   1335 O OP1   . DA  B 1 34  ? 68.704  24.214 54.088  1.00 54.49  ? 34  DA  D OP1   1 
ATOM   1336 O OP2   . DA  B 1 34  ? 69.134  22.324 52.392  1.00 61.11  ? 34  DA  D OP2   1 
ATOM   1337 O "O5'" . DA  B 1 34  ? 71.035  23.516 53.521  1.00 61.53  ? 34  DA  D "O5'" 1 
ATOM   1338 C "C5'" . DA  B 1 34  ? 71.931  22.926 52.567  1.00 57.53  ? 34  DA  D "C5'" 1 
ATOM   1339 C "C4'" . DA  B 1 34  ? 73.241  22.592 53.236  1.00 46.41  ? 34  DA  D "C4'" 1 
ATOM   1340 O "O4'" . DA  B 1 34  ? 72.910  21.814 54.408  1.00 30.79  ? 34  DA  D "O4'" 1 
ATOM   1341 C "C3'" . DA  B 1 34  ? 74.223  21.756 52.411  1.00 51.04  ? 34  DA  D "C3'" 1 
ATOM   1342 O "O3'" . DA  B 1 34  ? 75.577  22.188 52.661  1.00 39.26  ? 34  DA  D "O3'" 1 
ATOM   1343 C "C2'" . DA  B 1 34  ? 73.937  20.342 52.892  1.00 48.42  ? 34  DA  D "C2'" 1 
ATOM   1344 C "C1'" . DA  B 1 34  ? 73.526  20.549 54.350  1.00 36.25  ? 34  DA  D "C1'" 1 
ATOM   1345 N N9    . DA  B 1 34  ? 72.574  19.571 54.877  1.00 39.13  ? 34  DA  D N9    1 
ATOM   1346 C C8    . DA  B 1 34  ? 71.273  19.355 54.499  1.00 39.09  ? 34  DA  D C8    1 
ATOM   1347 N N7    . DA  B 1 34  ? 70.674  18.404 55.184  1.00 40.31  ? 34  DA  D N7    1 
ATOM   1348 C C5    . DA  B 1 34  ? 71.652  17.964 56.071  1.00 33.37  ? 34  DA  D C5    1 
ATOM   1349 C C6    . DA  B 1 34  ? 71.654  16.971 57.072  1.00 32.66  ? 34  DA  D C6    1 
ATOM   1350 N N6    . DA  B 1 34  ? 70.598  16.211 57.373  1.00 24.69  ? 34  DA  D N6    1 
ATOM   1351 N N1    . DA  B 1 34  ? 72.797  16.781 57.764  1.00 35.43  ? 34  DA  D N1    1 
ATOM   1352 C C2    . DA  B 1 34  ? 73.861  17.541 57.469  1.00 42.24  ? 34  DA  D C2    1 
ATOM   1353 N N3    . DA  B 1 34  ? 73.981  18.505 56.558  1.00 47.62  ? 34  DA  D N3    1 
ATOM   1354 C C4    . DA  B 1 34  ? 72.828  18.670 55.886  1.00 41.79  ? 34  DA  D C4    1 
ATOM   1355 N N     . THR C 2 19  ? 32.939  52.186 105.491 1.00 100.00 ? 19  THR A N     1 
ATOM   1356 C CA    . THR C 2 19  ? 33.846  51.368 106.299 1.00 100.00 ? 19  THR A CA    1 
ATOM   1357 C C     . THR C 2 19  ? 33.105  50.338 107.180 1.00 100.00 ? 19  THR A C     1 
ATOM   1358 O O     . THR C 2 19  ? 32.223  50.719 107.969 1.00 100.00 ? 19  THR A O     1 
ATOM   1359 C CB    . THR C 2 19  ? 34.781  52.282 107.195 1.00 100.00 ? 19  THR A CB    1 
ATOM   1360 O OG1   . THR C 2 19  ? 34.279  52.358 108.539 1.00 100.00 ? 19  THR A OG1   1 
ATOM   1361 C CG2   . THR C 2 19  ? 34.852  53.708 106.621 1.00 100.00 ? 19  THR A CG2   1 
ATOM   1362 N N     . SER C 2 20  ? 33.453  49.047 107.052 1.00 90.13  ? 20  SER A N     1 
ATOM   1363 C CA    . SER C 2 20  ? 32.778  48.009 107.843 1.00 72.37  ? 20  SER A CA    1 
ATOM   1364 C C     . SER C 2 20  ? 33.300  46.574 107.774 1.00 58.57  ? 20  SER A C     1 
ATOM   1365 O O     . SER C 2 20  ? 34.003  46.123 108.661 1.00 51.85  ? 20  SER A O     1 
ATOM   1366 C CB    . SER C 2 20  ? 31.290  48.000 107.485 1.00 85.13  ? 20  SER A CB    1 
ATOM   1367 O OG    . SER C 2 20  ? 31.110  48.284 106.110 1.00 93.51  ? 20  SER A OG    1 
ATOM   1368 N N     . ASP C 2 21  ? 32.901  45.847 106.741 1.00 53.77  ? 21  ASP A N     1 
ATOM   1369 C CA    . ASP C 2 21  ? 33.313  44.459 106.553 1.00 51.50  ? 21  ASP A CA    1 
ATOM   1370 C C     . ASP C 2 21  ? 34.556  44.381 105.715 1.00 49.51  ? 21  ASP A C     1 
ATOM   1371 O O     . ASP C 2 21  ? 35.307  43.414 105.773 1.00 44.55  ? 21  ASP A O     1 
ATOM   1372 C CB    . ASP C 2 21  ? 32.230  43.696 105.825 1.00 56.60  ? 21  ASP A CB    1 
ATOM   1373 C CG    . ASP C 2 21  ? 31.155  43.230 106.736 1.00 67.29  ? 21  ASP A CG    1 
ATOM   1374 O OD1   . ASP C 2 21  ? 30.092  42.840 106.219 1.00 71.38  ? 21  ASP A OD1   1 
ATOM   1375 O OD2   . ASP C 2 21  ? 31.375  43.262 107.970 1.00 73.91  ? 21  ASP A OD2   1 
ATOM   1376 N N     . GLU C 2 22  ? 34.722  45.402 104.892 1.00 49.11  ? 22  GLU A N     1 
ATOM   1377 C CA    . GLU C 2 22  ? 35.845  45.516 104.001 1.00 43.83  ? 22  GLU A CA    1 
ATOM   1378 C C     . GLU C 2 22  ? 37.092  45.667 104.856 1.00 41.27  ? 22  GLU A C     1 
ATOM   1379 O O     . GLU C 2 22  ? 38.143  45.093 104.547 1.00 40.56  ? 22  GLU A O     1 
ATOM   1380 C CB    . GLU C 2 22  ? 35.614  46.728 103.099 1.00 52.17  ? 22  GLU A CB    1 
ATOM   1381 C CG    . GLU C 2 22  ? 36.857  47.460 102.631 1.00 78.87  ? 22  GLU A CG    1 
ATOM   1382 C CD    . GLU C 2 22  ? 36.509  48.682 101.800 1.00 87.90  ? 22  GLU A CD    1 
ATOM   1383 O OE1   . GLU C 2 22  ? 37.433  49.361 101.291 1.00 90.43  ? 22  GLU A OE1   1 
ATOM   1384 O OE2   . GLU C 2 22  ? 35.296  48.958 101.655 1.00 97.40  ? 22  GLU A OE2   1 
ATOM   1385 N N     . VAL C 2 23  ? 36.959  46.409 105.951 1.00 33.20  ? 23  VAL A N     1 
ATOM   1386 C CA    . VAL C 2 23  ? 38.088  46.618 106.841 1.00 27.49  ? 23  VAL A CA    1 
ATOM   1387 C C     . VAL C 2 23  ? 38.268  45.345 107.621 1.00 30.35  ? 23  VAL A C     1 
ATOM   1388 O O     . VAL C 2 23  ? 39.389  44.900 107.857 1.00 34.94  ? 23  VAL A O     1 
ATOM   1389 C CB    . VAL C 2 23  ? 37.871  47.820 107.798 1.00 23.93  ? 23  VAL A CB    1 
ATOM   1390 C CG1   . VAL C 2 23  ? 36.482  48.359 107.653 1.00 27.27  ? 23  VAL A CG1   1 
ATOM   1391 C CG2   . VAL C 2 23  ? 38.126  47.421 109.222 1.00 18.88  ? 23  VAL A CG2   1 
ATOM   1392 N N     . ARG C 2 24  ? 37.146  44.753 108.013 1.00 32.88  ? 24  ARG A N     1 
ATOM   1393 C CA    . ARG C 2 24  ? 37.172  43.500 108.753 1.00 35.02  ? 24  ARG A CA    1 
ATOM   1394 C C     . ARG C 2 24  ? 38.048  42.572 107.959 1.00 25.59  ? 24  ARG A C     1 
ATOM   1395 O O     . ARG C 2 24  ? 39.080  42.117 108.425 1.00 17.06  ? 24  ARG A O     1 
ATOM   1396 C CB    . ARG C 2 24  ? 35.766  42.893 108.853 1.00 51.04  ? 24  ARG A CB    1 
ATOM   1397 C CG    . ARG C 2 24  ? 35.692  41.606 109.685 1.00 57.29  ? 24  ARG A CG    1 
ATOM   1398 C CD    . ARG C 2 24  ? 34.257  41.094 109.848 1.00 71.38  ? 24  ARG A CD    1 
ATOM   1399 N NE    . ARG C 2 24  ? 34.203  39.634 109.960 1.00 91.04  ? 24  ARG A NE    1 
ATOM   1400 C CZ    . ARG C 2 24  ? 33.125  38.898 109.695 1.00 99.73  ? 24  ARG A CZ    1 
ATOM   1401 N NH1   . ARG C 2 24  ? 32.010  39.490 109.295 1.00 100.00 ? 24  ARG A NH1   1 
ATOM   1402 N NH2   . ARG C 2 24  ? 33.167  37.570 109.819 1.00 99.25  ? 24  ARG A NH2   1 
ATOM   1403 N N     . LYS C 2 25  ? 37.632  42.317 106.732 1.00 20.93  ? 25  LYS A N     1 
ATOM   1404 C CA    . LYS C 2 25  ? 38.375  41.430 105.874 1.00 21.64  ? 25  LYS A CA    1 
ATOM   1405 C C     . LYS C 2 25  ? 39.816  41.876 105.728 1.00 21.89  ? 25  LYS A C     1 
ATOM   1406 O O     . LYS C 2 25  ? 40.715  41.060 105.767 1.00 20.22  ? 25  LYS A O     1 
ATOM   1407 C CB    . LYS C 2 25  ? 37.712  41.350 104.512 1.00 26.44  ? 25  LYS A CB    1 
ATOM   1408 C CG    . LYS C 2 25  ? 38.685  41.111 103.399 1.00 40.80  ? 25  LYS A CG    1 
ATOM   1409 C CD    . LYS C 2 25  ? 38.839  39.635 103.097 1.00 34.85  ? 25  LYS A CD    1 
ATOM   1410 C CE    . LYS C 2 25  ? 39.027  39.449 101.597 1.00 52.67  ? 25  LYS A CE    1 
ATOM   1411 N NZ    . LYS C 2 25  ? 40.202  38.609 101.257 1.00 38.70  ? 25  LYS A NZ    1 
ATOM   1412 N N     . ASN C 2 26  ? 40.049  43.169 105.559 1.00 24.02  ? 26  ASN A N     1 
ATOM   1413 C CA    . ASN C 2 26  ? 41.425  43.623 105.432 1.00 17.11  ? 26  ASN A CA    1 
ATOM   1414 C C     . ASN C 2 26  ? 42.239  43.274 106.649 1.00 21.59  ? 26  ASN A C     1 
ATOM   1415 O O     . ASN C 2 26  ? 43.354  42.797 106.523 1.00 32.46  ? 26  ASN A O     1 
ATOM   1416 C CB    . ASN C 2 26  ? 41.479  45.111 105.231 1.00 25.85  ? 26  ASN A CB    1 
ATOM   1417 C CG    . ASN C 2 26  ? 41.102  45.493 103.854 1.00 33.20  ? 26  ASN A CG    1 
ATOM   1418 O OD1   . ASN C 2 26  ? 41.522  44.863 102.886 1.00 41.41  ? 26  ASN A OD1   1 
ATOM   1419 N ND2   . ASN C 2 26  ? 40.285  46.519 103.741 1.00 46.44  ? 26  ASN A ND2   1 
ATOM   1420 N N     . LEU C 2 27  ? 41.705  43.528 107.835 1.00 22.37  ? 27  LEU A N     1 
ATOM   1421 C CA    . LEU C 2 27  ? 42.434  43.180 109.044 1.00 15.87  ? 27  LEU A CA    1 
ATOM   1422 C C     . LEU C 2 27  ? 42.722  41.678 109.088 1.00 21.85  ? 27  LEU A C     1 
ATOM   1423 O O     . LEU C 2 27  ? 43.782  41.255 109.537 1.00 29.39  ? 27  LEU A O     1 
ATOM   1424 C CB    . LEU C 2 27  ? 41.624  43.564 110.265 1.00 13.41  ? 27  LEU A CB    1 
ATOM   1425 C CG    . LEU C 2 27  ? 41.666  45.012 110.730 1.00 23.00  ? 27  LEU A CG    1 
ATOM   1426 C CD1   . LEU C 2 27  ? 42.944  45.693 110.291 1.00 30.25  ? 27  LEU A CD1   1 
ATOM   1427 C CD2   . LEU C 2 27  ? 40.479  45.711 110.160 1.00 38.12  ? 27  LEU A CD2   1 
ATOM   1428 N N     . MET C 2 28  ? 41.767  40.876 108.622 1.00 29.40  ? 28  MET A N     1 
ATOM   1429 C CA    . MET C 2 28  ? 41.908  39.414 108.601 1.00 21.25  ? 28  MET A CA    1 
ATOM   1430 C C     . MET C 2 28  ? 43.063  38.939 107.703 1.00 27.34  ? 28  MET A C     1 
ATOM   1431 O O     . MET C 2 28  ? 43.701  37.924 107.987 1.00 28.32  ? 28  MET A O     1 
ATOM   1432 C CB    . MET C 2 28  ? 40.597  38.769 108.118 1.00 26.47  ? 28  MET A CB    1 
ATOM   1433 C CG    . MET C 2 28  ? 39.533  38.468 109.196 1.00 39.85  ? 28  MET A CG    1 
ATOM   1434 S SD    . MET C 2 28  ? 38.203  37.339 108.631 1.00 41.54  ? 28  MET A SD    1 
ATOM   1435 C CE    . MET C 2 28  ? 37.671  36.488 110.220 1.00 35.81  ? 28  MET A CE    1 
ATOM   1436 N N     . ASP C 2 29  ? 43.313  39.676 106.619 1.00 39.53  ? 29  ASP A N     1 
ATOM   1437 C CA    . ASP C 2 29  ? 44.399  39.363 105.671 1.00 48.04  ? 29  ASP A CA    1 
ATOM   1438 C C     . ASP C 2 29  ? 45.722  39.629 106.378 1.00 50.60  ? 29  ASP A C     1 
ATOM   1439 O O     . ASP C 2 29  ? 46.670  38.835 106.276 1.00 55.11  ? 29  ASP A O     1 
ATOM   1440 C CB    . ASP C 2 29  ? 44.367  40.277 104.445 1.00 50.47  ? 29  ASP A CB    1 
ATOM   1441 C CG    . ASP C 2 29  ? 43.124  40.122 103.622 1.00 61.10  ? 29  ASP A CG    1 
ATOM   1442 O OD1   . ASP C 2 29  ? 42.309  39.232 103.936 1.00 77.56  ? 29  ASP A OD1   1 
ATOM   1443 O OD2   . ASP C 2 29  ? 42.973  40.905 102.654 1.00 63.18  ? 29  ASP A OD2   1 
ATOM   1444 N N     . MET C 2 30  ? 45.760  40.767 107.080 1.00 51.02  ? 30  MET A N     1 
ATOM   1445 C CA    . MET C 2 30  ? 46.922  41.214 107.839 1.00 40.77  ? 30  MET A CA    1 
ATOM   1446 C C     . MET C 2 30  ? 47.396  40.158 108.856 1.00 45.29  ? 30  MET A C     1 
ATOM   1447 O O     . MET C 2 30  ? 48.594  39.843 108.915 1.00 52.19  ? 30  MET A O     1 
ATOM   1448 C CB    . MET C 2 30  ? 46.601  42.538 108.535 1.00 37.05  ? 30  MET A CB    1 
ATOM   1449 C CG    . MET C 2 30  ? 47.835  43.260 109.022 1.00 56.57  ? 30  MET A CG    1 
ATOM   1450 S SD    . MET C 2 30  ? 47.780  45.020 108.768 1.00 72.41  ? 30  MET A SD    1 
ATOM   1451 C CE    . MET C 2 30  ? 49.504  45.337 108.361 1.00 60.39  ? 30  MET A CE    1 
ATOM   1452 N N     . PHE C 2 31  ? 46.465  39.591 109.627 1.00 43.53  ? 31  PHE A N     1 
ATOM   1453 C CA    . PHE C 2 31  ? 46.798  38.558 110.618 1.00 39.45  ? 31  PHE A CA    1 
ATOM   1454 C C     . PHE C 2 31  ? 47.158  37.233 109.904 1.00 32.31  ? 31  PHE A C     1 
ATOM   1455 O O     . PHE C 2 31  ? 47.975  36.452 110.392 1.00 35.44  ? 31  PHE A O     1 
ATOM   1456 C CB    . PHE C 2 31  ? 45.601  38.374 111.577 1.00 59.02  ? 31  PHE A CB    1 
ATOM   1457 C CG    . PHE C 2 31  ? 45.970  37.890 112.973 1.00 74.29  ? 31  PHE A CG    1 
ATOM   1458 C CD1   . PHE C 2 31  ? 46.183  36.528 113.226 1.00 73.86  ? 31  PHE A CD1   1 
ATOM   1459 C CD2   . PHE C 2 31  ? 46.043  38.785 114.047 1.00 83.42  ? 31  PHE A CD2   1 
ATOM   1460 C CE1   . PHE C 2 31  ? 46.455  36.062 114.519 1.00 69.53  ? 31  PHE A CE1   1 
ATOM   1461 C CE2   . PHE C 2 31  ? 46.316  38.325 115.356 1.00 84.69  ? 31  PHE A CE2   1 
ATOM   1462 C CZ    . PHE C 2 31  ? 46.522  36.962 115.586 1.00 75.51  ? 31  PHE A CZ    1 
ATOM   1463 N N     . ARG C 2 32  ? 46.550  37.002 108.742 1.00 31.27  ? 32  ARG A N     1 
ATOM   1464 C CA    . ARG C 2 32  ? 46.795  35.797 107.938 1.00 27.94  ? 32  ARG A CA    1 
ATOM   1465 C C     . ARG C 2 32  ? 48.254  35.683 107.517 1.00 26.72  ? 32  ARG A C     1 
ATOM   1466 O O     . ARG C 2 32  ? 48.913  34.671 107.775 1.00 30.09  ? 32  ARG A O     1 
ATOM   1467 C CB    . ARG C 2 32  ? 45.932  35.824 106.676 1.00 19.82  ? 32  ARG A CB    1 
ATOM   1468 C CG    . ARG C 2 32  ? 46.050  34.581 105.810 1.00 11.52  ? 32  ARG A CG    1 
ATOM   1469 C CD    . ARG C 2 32  ? 44.803  34.410 104.984 1.00 14.15  ? 32  ARG A CD    1 
ATOM   1470 N NE    . ARG C 2 32  ? 44.635  35.493 104.009 1.00 15.03  ? 32  ARG A NE    1 
ATOM   1471 C CZ    . ARG C 2 32  ? 43.921  35.380 102.893 1.00 26.14  ? 32  ARG A CZ    1 
ATOM   1472 N NH1   . ARG C 2 32  ? 43.308  34.235 102.619 1.00 15.53  ? 32  ARG A NH1   1 
ATOM   1473 N NH2   . ARG C 2 32  ? 43.852  36.392 102.034 1.00 19.50  ? 32  ARG A NH2   1 
ATOM   1474 N N     . ASP C 2 33  ? 48.730  36.720 106.832 1.00 23.52  ? 33  ASP A N     1 
ATOM   1475 C CA    . ASP C 2 33  ? 50.106  36.782 106.366 1.00 28.33  ? 33  ASP A CA    1 
ATOM   1476 C C     . ASP C 2 33  ? 50.853  37.741 107.247 1.00 34.97  ? 33  ASP A C     1 
ATOM   1477 O O     . ASP C 2 33  ? 51.462  38.690 106.764 1.00 36.62  ? 33  ASP A O     1 
ATOM   1478 C CB    . ASP C 2 33  ? 50.159  37.284 104.943 1.00 13.21  ? 33  ASP A CB    1 
ATOM   1479 C CG    . ASP C 2 33  ? 49.526  36.328 103.985 1.00 38.62  ? 33  ASP A CG    1 
ATOM   1480 O OD1   . ASP C 2 33  ? 49.705  35.098 104.179 1.00 35.05  ? 33  ASP A OD1   1 
ATOM   1481 O OD2   . ASP C 2 33  ? 48.846  36.808 103.047 1.00 25.68  ? 33  ASP A OD2   1 
ATOM   1482 N N     . ARG C 2 34  ? 50.793  37.489 108.547 1.00 39.54  ? 34  ARG A N     1 
ATOM   1483 C CA    . ARG C 2 34  ? 51.462  38.335 109.519 1.00 39.74  ? 34  ARG A CA    1 
ATOM   1484 C C     . ARG C 2 34  ? 52.958  38.204 109.318 1.00 39.73  ? 34  ARG A C     1 
ATOM   1485 O O     . ARG C 2 34  ? 53.719  39.102 109.643 1.00 43.85  ? 34  ARG A O     1 
ATOM   1486 C CB    . ARG C 2 34  ? 51.060  37.920 110.937 1.00 34.47  ? 34  ARG A CB    1 
ATOM   1487 C CG    . ARG C 2 34  ? 52.167  37.306 111.746 1.00 52.16  ? 34  ARG A CG    1 
ATOM   1488 C CD    . ARG C 2 34  ? 51.605  36.393 112.806 1.00 62.38  ? 34  ARG A CD    1 
ATOM   1489 N NE    . ARG C 2 34  ? 51.154  35.142 112.215 1.00 74.56  ? 34  ARG A NE    1 
ATOM   1490 C CZ    . ARG C 2 34  ? 49.883  34.770 112.139 1.00 70.55  ? 34  ARG A CZ    1 
ATOM   1491 N NH1   . ARG C 2 34  ? 48.934  35.554 112.621 1.00 63.16  ? 34  ARG A NH1   1 
ATOM   1492 N NH2   . ARG C 2 34  ? 49.558  33.621 111.563 1.00 72.42  ? 34  ARG A NH2   1 
ATOM   1493 N N     . GLN C 2 35  ? 53.369  37.084 108.741 1.00 44.72  ? 35  GLN A N     1 
ATOM   1494 C CA    . GLN C 2 35  ? 54.781  36.839 108.503 1.00 37.39  ? 35  GLN A CA    1 
ATOM   1495 C C     . GLN C 2 35  ? 55.342  37.644 107.365 1.00 36.52  ? 35  GLN A C     1 
ATOM   1496 O O     . GLN C 2 35  ? 56.399  37.325 106.842 1.00 41.31  ? 35  GLN A O     1 
ATOM   1497 C CB    . GLN C 2 35  ? 55.012  35.377 108.198 1.00 36.85  ? 35  GLN A CB    1 
ATOM   1498 C CG    . GLN C 2 35  ? 55.698  34.680 109.307 1.00 44.36  ? 35  GLN A CG    1 
ATOM   1499 C CD    . GLN C 2 35  ? 55.059  33.367 109.595 1.00 53.17  ? 35  GLN A CD    1 
ATOM   1500 O OE1   . GLN C 2 35  ? 53.988  33.303 110.196 1.00 61.70  ? 35  GLN A OE1   1 
ATOM   1501 N NE2   . GLN C 2 35  ? 55.707  32.294 109.168 1.00 58.70  ? 35  GLN A NE2   1 
ATOM   1502 N N     . ALA C 2 36  ? 54.629  38.680 106.961 1.00 36.42  ? 36  ALA A N     1 
ATOM   1503 C CA    . ALA C 2 36  ? 55.105  39.504 105.874 1.00 36.74  ? 36  ALA A CA    1 
ATOM   1504 C C     . ALA C 2 36  ? 55.880  40.679 106.457 1.00 39.30  ? 36  ALA A C     1 
ATOM   1505 O O     . ALA C 2 36  ? 56.608  41.360 105.731 1.00 44.35  ? 36  ALA A O     1 
ATOM   1506 C CB    . ALA C 2 36  ? 53.943  40.002 105.040 1.00 34.42  ? 36  ALA A CB    1 
ATOM   1507 N N     . PHE C 2 37  ? 55.719  40.917 107.761 1.00 30.44  ? 37  PHE A N     1 
ATOM   1508 C CA    . PHE C 2 37  ? 56.419  41.996 108.440 1.00 20.08  ? 37  PHE A CA    1 
ATOM   1509 C C     . PHE C 2 37  ? 57.255  41.378 109.533 1.00 24.04  ? 37  PHE A C     1 
ATOM   1510 O O     . PHE C 2 37  ? 56.955  40.281 109.980 1.00 34.82  ? 37  PHE A O     1 
ATOM   1511 C CB    . PHE C 2 37  ? 55.430  42.968 109.063 1.00 23.23  ? 37  PHE A CB    1 
ATOM   1512 C CG    . PHE C 2 37  ? 54.625  43.743 108.059 1.00 39.52  ? 37  PHE A CG    1 
ATOM   1513 C CD1   . PHE C 2 37  ? 53.248  43.602 108.013 1.00 40.80  ? 37  PHE A CD1   1 
ATOM   1514 C CD2   . PHE C 2 37  ? 55.239  44.609 107.147 1.00 39.33  ? 37  PHE A CD2   1 
ATOM   1515 C CE1   . PHE C 2 37  ? 52.482  44.308 107.076 1.00 40.98  ? 37  PHE A CE1   1 
ATOM   1516 C CE2   . PHE C 2 37  ? 54.479  45.324 106.202 1.00 39.43  ? 37  PHE A CE2   1 
ATOM   1517 C CZ    . PHE C 2 37  ? 53.096  45.167 106.170 1.00 35.26  ? 37  PHE A CZ    1 
ATOM   1518 N N     . SER C 2 38  ? 58.317  42.060 109.951 1.00 35.08  ? 38  SER A N     1 
ATOM   1519 C CA    . SER C 2 38  ? 59.161  41.545 111.028 1.00 35.94  ? 38  SER A CA    1 
ATOM   1520 C C     . SER C 2 38  ? 58.441  41.721 112.336 1.00 33.23  ? 38  SER A C     1 
ATOM   1521 O O     . SER C 2 38  ? 57.533  42.547 112.456 1.00 29.53  ? 38  SER A O     1 
ATOM   1522 C CB    . SER C 2 38  ? 60.509  42.279 111.144 1.00 43.13  ? 38  SER A CB    1 
ATOM   1523 O OG    . SER C 2 38  ? 60.840  43.001 109.977 1.00 55.11  ? 38  SER A OG    1 
ATOM   1524 N N     . GLU C 2 39  ? 58.875  40.930 113.311 1.00 37.89  ? 39  GLU A N     1 
ATOM   1525 C CA    . GLU C 2 39  ? 58.331  40.953 114.656 1.00 42.31  ? 39  GLU A CA    1 
ATOM   1526 C C     . GLU C 2 39  ? 58.597  42.329 115.226 1.00 37.83  ? 39  GLU A C     1 
ATOM   1527 O O     . GLU C 2 39  ? 57.764  42.886 115.943 1.00 43.37  ? 39  GLU A O     1 
ATOM   1528 C CB    . GLU C 2 39  ? 59.020  39.903 115.540 1.00 59.79  ? 39  GLU A CB    1 
ATOM   1529 C CG    . GLU C 2 39  ? 60.258  39.235 114.911 1.00 83.50  ? 39  GLU A CG    1 
ATOM   1530 C CD    . GLU C 2 39  ? 61.565  39.475 115.685 1.00 96.72  ? 39  GLU A CD    1 
ATOM   1531 O OE1   . GLU C 2 39  ? 62.653  39.338 115.077 1.00 91.04  ? 39  GLU A OE1   1 
ATOM   1532 O OE2   . GLU C 2 39  ? 61.510  39.794 116.894 1.00 99.92  ? 39  GLU A OE2   1 
ATOM   1533 N N     . HIS C 2 40  ? 59.754  42.882 114.880 1.00 31.31  ? 40  HIS A N     1 
ATOM   1534 C CA    . HIS C 2 40  ? 60.145  44.193 115.375 1.00 47.56  ? 40  HIS A CA    1 
ATOM   1535 C C     . HIS C 2 40  ? 59.182  45.239 114.855 1.00 45.44  ? 40  HIS A C     1 
ATOM   1536 O O     . HIS C 2 40  ? 58.848  46.208 115.547 1.00 52.18  ? 40  HIS A O     1 
ATOM   1537 C CB    . HIS C 2 40  ? 61.576  44.534 114.930 1.00 57.08  ? 40  HIS A CB    1 
ATOM   1538 C CG    . HIS C 2 40  ? 62.643  43.827 115.718 1.00 59.87  ? 40  HIS A CG    1 
ATOM   1539 N ND1   . HIS C 2 40  ? 63.771  43.293 115.133 1.00 57.53  ? 40  HIS A ND1   1 
ATOM   1540 C CD2   . HIS C 2 40  ? 62.744  43.564 117.046 1.00 52.06  ? 40  HIS A CD2   1 
ATOM   1541 C CE1   . HIS C 2 40  ? 64.527  42.731 116.063 1.00 50.55  ? 40  HIS A CE1   1 
ATOM   1542 N NE2   . HIS C 2 40  ? 63.926  42.881 117.228 1.00 50.45  ? 40  HIS A NE2   1 
ATOM   1543 N N     . THR C 2 41  ? 58.741  45.041 113.624 1.00 40.75  ? 41  THR A N     1 
ATOM   1544 C CA    . THR C 2 41  ? 57.814  45.971 113.026 1.00 35.36  ? 41  THR A CA    1 
ATOM   1545 C C     . THR C 2 41  ? 56.475  45.867 113.708 1.00 33.44  ? 41  THR A C     1 
ATOM   1546 O O     . THR C 2 41  ? 55.880  46.880 114.093 1.00 31.46  ? 41  THR A O     1 
ATOM   1547 C CB    . THR C 2 41  ? 57.656  45.670 111.559 1.00 36.50  ? 41  THR A CB    1 
ATOM   1548 O OG1   . THR C 2 41  ? 58.946  45.363 111.013 1.00 35.19  ? 41  THR A OG1   1 
ATOM   1549 C CG2   . THR C 2 41  ? 57.058  46.860 110.842 1.00 43.93  ? 41  THR A CG2   1 
ATOM   1550 N N     . TRP C 2 42  ? 56.012  44.634 113.870 1.00 26.09  ? 42  TRP A N     1 
ATOM   1551 C CA    . TRP C 2 42  ? 54.734  44.406 114.511 1.00 33.02  ? 42  TRP A CA    1 
ATOM   1552 C C     . TRP C 2 42  ? 54.708  44.987 115.910 1.00 30.41  ? 42  TRP A C     1 
ATOM   1553 O O     . TRP C 2 42  ? 53.721  45.597 116.308 1.00 30.18  ? 42  TRP A O     1 
ATOM   1554 C CB    . TRP C 2 42  ? 54.434  42.913 114.542 1.00 34.63  ? 42  TRP A CB    1 
ATOM   1555 C CG    . TRP C 2 42  ? 53.716  42.462 113.306 1.00 34.75  ? 42  TRP A CG    1 
ATOM   1556 C CD1   . TRP C 2 42  ? 54.223  41.720 112.272 1.00 33.00  ? 42  TRP A CD1   1 
ATOM   1557 C CD2   . TRP C 2 42  ? 52.369  42.770 112.952 1.00 45.59  ? 42  TRP A CD2   1 
ATOM   1558 N NE1   . TRP C 2 42  ? 53.270  41.553 111.299 1.00 34.70  ? 42  TRP A NE1   1 
ATOM   1559 C CE2   . TRP C 2 42  ? 52.123  42.188 111.689 1.00 42.76  ? 42  TRP A CE2   1 
ATOM   1560 C CE3   . TRP C 2 42  ? 51.343  43.484 113.580 1.00 49.04  ? 42  TRP A CE3   1 
ATOM   1561 C CZ2   . TRP C 2 42  ? 50.896  42.299 111.047 1.00 43.90  ? 42  TRP A CZ2   1 
ATOM   1562 C CZ3   . TRP C 2 42  ? 50.126  43.593 112.941 1.00 41.15  ? 42  TRP A CZ3   1 
ATOM   1563 C CH2   . TRP C 2 42  ? 49.911  43.004 111.688 1.00 47.05  ? 42  TRP A CH2   1 
ATOM   1564 N N     . LYS C 2 43  ? 55.816  44.821 116.627 1.00 32.87  ? 43  LYS A N     1 
ATOM   1565 C CA    . LYS C 2 43  ? 55.954  45.309 117.999 1.00 28.43  ? 43  LYS A CA    1 
ATOM   1566 C C     . LYS C 2 43  ? 55.819  46.801 118.039 1.00 26.02  ? 43  LYS A C     1 
ATOM   1567 O O     . LYS C 2 43  ? 55.205  47.355 118.942 1.00 32.69  ? 43  LYS A O     1 
ATOM   1568 C CB    . LYS C 2 43  ? 57.318  44.939 118.566 1.00 32.61  ? 43  LYS A CB    1 
ATOM   1569 C CG    . LYS C 2 43  ? 57.274  43.807 119.563 1.00 48.43  ? 43  LYS A CG    1 
ATOM   1570 C CD    . LYS C 2 43  ? 57.706  42.506 118.911 1.00 52.60  ? 43  LYS A CD    1 
ATOM   1571 C CE    . LYS C 2 43  ? 59.232  42.424 118.837 1.00 60.94  ? 43  LYS A CE    1 
ATOM   1572 N NZ    . LYS C 2 43  ? 59.756  41.069 118.469 1.00 53.45  ? 43  LYS A NZ    1 
ATOM   1573 N N     . MET C 2 44  ? 56.409  47.462 117.054 1.00 23.87  ? 44  MET A N     1 
ATOM   1574 C CA    . MET C 2 44  ? 56.321  48.903 117.016 1.00 23.08  ? 44  MET A CA    1 
ATOM   1575 C C     . MET C 2 44  ? 54.885  49.267 116.687 1.00 27.12  ? 44  MET A C     1 
ATOM   1576 O O     . MET C 2 44  ? 54.307  50.121 117.342 1.00 36.40  ? 44  MET A O     1 
ATOM   1577 C CB    . MET C 2 44  ? 57.290  49.479 115.992 1.00 30.08  ? 44  MET A CB    1 
ATOM   1578 C CG    . MET C 2 44  ? 58.730  49.579 116.508 1.00 26.51  ? 44  MET A CG    1 
ATOM   1579 S SD    . MET C 2 44  ? 58.958  50.258 118.191 1.00 34.04  ? 44  MET A SD    1 
ATOM   1580 C CE    . MET C 2 44  ? 57.775  51.579 118.263 1.00 20.77  ? 44  MET A CE    1 
ATOM   1581 N N     . LEU C 2 45  ? 54.289  48.598 115.704 1.00 26.26  ? 45  LEU A N     1 
ATOM   1582 C CA    . LEU C 2 45  ? 52.892  48.884 115.369 1.00 26.20  ? 45  LEU A CA    1 
ATOM   1583 C C     . LEU C 2 45  ? 52.020  48.781 116.623 1.00 27.08  ? 45  LEU A C     1 
ATOM   1584 O O     . LEU C 2 45  ? 51.340  49.723 117.005 1.00 30.80  ? 45  LEU A O     1 
ATOM   1585 C CB    . LEU C 2 45  ? 52.359  47.913 114.310 1.00 17.86  ? 45  LEU A CB    1 
ATOM   1586 C CG    . LEU C 2 45  ? 50.867  48.047 113.941 1.00 16.00  ? 45  LEU A CG    1 
ATOM   1587 C CD1   . LEU C 2 45  ? 50.565  49.433 113.405 1.00 11.12  ? 45  LEU A CD1   1 
ATOM   1588 C CD2   . LEU C 2 45  ? 50.495  47.020 112.895 1.00 21.04  ? 45  LEU A CD2   1 
ATOM   1589 N N     . LEU C 2 46  ? 52.056  47.641 117.290 1.00 24.09  ? 46  LEU A N     1 
ATOM   1590 C CA    . LEU C 2 46  ? 51.238  47.499 118.481 1.00 27.54  ? 46  LEU A CA    1 
ATOM   1591 C C     . LEU C 2 46  ? 51.543  48.563 119.505 1.00 29.10  ? 46  LEU A C     1 
ATOM   1592 O O     . LEU C 2 46  ? 50.639  49.101 120.148 1.00 29.24  ? 46  LEU A O     1 
ATOM   1593 C CB    . LEU C 2 46  ? 51.441  46.119 119.087 1.00 36.40  ? 46  LEU A CB    1 
ATOM   1594 C CG    . LEU C 2 46  ? 51.159  45.097 117.988 1.00 52.38  ? 46  LEU A CG    1 
ATOM   1595 C CD1   . LEU C 2 46  ? 51.945  43.826 118.247 1.00 60.69  ? 46  LEU A CD1   1 
ATOM   1596 C CD2   . LEU C 2 46  ? 49.657  44.825 117.922 1.00 48.46  ? 46  LEU A CD2   1 
ATOM   1597 N N     . SER C 2 47  ? 52.823  48.875 119.652 1.00 31.10  ? 47  SER A N     1 
ATOM   1598 C CA    . SER C 2 47  ? 53.231  49.860 120.641 1.00 32.47  ? 47  SER A CA    1 
ATOM   1599 C C     . SER C 2 47  ? 52.615  51.229 120.375 1.00 37.31  ? 47  SER A C     1 
ATOM   1600 O O     . SER C 2 47  ? 52.074  51.869 121.286 1.00 38.88  ? 47  SER A O     1 
ATOM   1601 C CB    . SER C 2 47  ? 54.765  49.953 120.695 1.00 32.53  ? 47  SER A CB    1 
ATOM   1602 O OG    . SER C 2 47  ? 55.200  51.073 121.461 1.00 39.45  ? 47  SER A OG    1 
ATOM   1603 N N     . VAL C 2 48  ? 52.692  51.669 119.120 1.00 37.15  ? 48  VAL A N     1 
ATOM   1604 C CA    . VAL C 2 48  ? 52.149  52.971 118.708 1.00 28.88  ? 48  VAL A CA    1 
ATOM   1605 C C     . VAL C 2 48  ? 50.644  53.045 118.876 1.00 26.09  ? 48  VAL A C     1 
ATOM   1606 O O     . VAL C 2 48  ? 50.113  54.087 119.273 1.00 15.13  ? 48  VAL A O     1 
ATOM   1607 C CB    . VAL C 2 48  ? 52.456  53.275 117.239 1.00 27.40  ? 48  VAL A CB    1 
ATOM   1608 C CG1   . VAL C 2 48  ? 51.558  54.412 116.746 1.00 20.08  ? 48  VAL A CG1   1 
ATOM   1609 C CG2   . VAL C 2 48  ? 53.928  53.642 117.080 1.00 22.87  ? 48  VAL A CG2   1 
ATOM   1610 N N     . CYS C 2 49  ? 49.978  51.935 118.564 1.00 22.99  ? 49  CYS A N     1 
ATOM   1611 C CA    . CYS C 2 49  ? 48.537  51.829 118.693 1.00 28.87  ? 49  CYS A CA    1 
ATOM   1612 C C     . CYS C 2 49  ? 48.222  51.954 120.161 1.00 34.77  ? 49  CYS A C     1 
ATOM   1613 O O     . CYS C 2 49  ? 47.264  52.629 120.530 1.00 36.80  ? 49  CYS A O     1 
ATOM   1614 C CB    . CYS C 2 49  ? 48.054  50.468 118.214 1.00 36.62  ? 49  CYS A CB    1 
ATOM   1615 S SG    . CYS C 2 49  ? 48.209  50.202 116.447 1.00 45.94  ? 49  CYS A SG    1 
ATOM   1616 N N     . ARG C 2 50  ? 49.045  51.308 120.988 1.00 35.59  ? 50  ARG A N     1 
ATOM   1617 C CA    . ARG C 2 50  ? 48.856  51.318 122.436 1.00 39.24  ? 50  ARG A CA    1 
ATOM   1618 C C     . ARG C 2 50  ? 48.936  52.737 122.982 1.00 37.94  ? 50  ARG A C     1 
ATOM   1619 O O     . ARG C 2 50  ? 48.133  53.138 123.824 1.00 44.16  ? 50  ARG A O     1 
ATOM   1620 C CB    . ARG C 2 50  ? 49.912  50.444 123.109 1.00 41.31  ? 50  ARG A CB    1 
ATOM   1621 C CG    . ARG C 2 50  ? 49.539  48.972 123.179 1.00 47.08  ? 50  ARG A CG    1 
ATOM   1622 C CD    . ARG C 2 50  ? 50.513  48.204 124.058 1.00 39.95  ? 50  ARG A CD    1 
ATOM   1623 N NE    . ARG C 2 50  ? 51.874  48.195 123.522 1.00 38.62  ? 50  ARG A NE    1 
ATOM   1624 C CZ    . ARG C 2 50  ? 52.633  47.108 123.435 1.00 43.89  ? 50  ARG A CZ    1 
ATOM   1625 N NH1   . ARG C 2 50  ? 52.162  45.937 123.849 1.00 41.82  ? 50  ARG A NH1   1 
ATOM   1626 N NH2   . ARG C 2 50  ? 53.869  47.194 122.952 1.00 41.70  ? 50  ARG A NH2   1 
ATOM   1627 N N     . SER C 2 51  ? 49.898  53.501 122.483 1.00 39.35  ? 51  SER A N     1 
ATOM   1628 C CA    . SER C 2 51  ? 50.066  54.875 122.928 1.00 40.68  ? 51  SER A CA    1 
ATOM   1629 C C     . SER C 2 51  ? 48.963  55.736 122.319 1.00 38.37  ? 51  SER A C     1 
ATOM   1630 O O     . SER C 2 51  ? 48.352  56.573 123.000 1.00 33.64  ? 51  SER A O     1 
ATOM   1631 C CB    . SER C 2 51  ? 51.437  55.408 122.498 1.00 44.71  ? 51  SER A CB    1 
ATOM   1632 O OG    . SER C 2 51  ? 51.413  56.816 122.339 1.00 51.58  ? 51  SER A OG    1 
ATOM   1633 N N     . TRP C 2 52  ? 48.714  55.531 121.030 1.00 34.60  ? 52  TRP A N     1 
ATOM   1634 C CA    . TRP C 2 52  ? 47.697  56.290 120.327 1.00 28.44  ? 52  TRP A CA    1 
ATOM   1635 C C     . TRP C 2 52  ? 46.339  56.042 120.944 1.00 34.97  ? 52  TRP A C     1 
ATOM   1636 O O     . TRP C 2 52  ? 45.551  56.960 121.114 1.00 42.12  ? 52  TRP A O     1 
ATOM   1637 C CB    . TRP C 2 52  ? 47.682  55.885 118.858 1.00 28.41  ? 52  TRP A CB    1 
ATOM   1638 C CG    . TRP C 2 52  ? 46.402  56.164 118.122 1.00 36.25  ? 52  TRP A CG    1 
ATOM   1639 C CD1   . TRP C 2 52  ? 45.571  55.244 117.556 1.00 41.78  ? 52  TRP A CD1   1 
ATOM   1640 C CD2   . TRP C 2 52  ? 45.817  57.448 117.856 1.00 37.49  ? 52  TRP A CD2   1 
ATOM   1641 N NE1   . TRP C 2 52  ? 44.508  55.866 116.954 1.00 35.84  ? 52  TRP A NE1   1 
ATOM   1642 C CE2   . TRP C 2 52  ? 44.634  57.222 117.122 1.00 34.65  ? 52  TRP A CE2   1 
ATOM   1643 C CE3   . TRP C 2 52  ? 46.181  58.766 118.165 1.00 40.98  ? 52  TRP A CE3   1 
ATOM   1644 C CZ2   . TRP C 2 52  ? 43.806  58.268 116.691 1.00 32.25  ? 52  TRP A CZ2   1 
ATOM   1645 C CZ3   . TRP C 2 52  ? 45.358  59.812 117.735 1.00 29.56  ? 52  TRP A CZ3   1 
ATOM   1646 C CH2   . TRP C 2 52  ? 44.182  59.553 117.008 1.00 26.45  ? 52  TRP A CH2   1 
ATOM   1647 N N     . ALA C 2 53  ? 46.080  54.789 121.291 1.00 39.13  ? 53  ALA A N     1 
ATOM   1648 C CA    . ALA C 2 53  ? 44.799  54.405 121.882 1.00 43.92  ? 53  ALA A CA    1 
ATOM   1649 C C     . ALA C 2 53  ? 44.584  55.095 123.222 1.00 38.96  ? 53  ALA A C     1 
ATOM   1650 O O     . ALA C 2 53  ? 43.609  55.813 123.411 1.00 27.22  ? 53  ALA A O     1 
ATOM   1651 C CB    . ALA C 2 53  ? 44.736  52.900 122.054 1.00 49.76  ? 53  ALA A CB    1 
ATOM   1652 N N     . ALA C 2 54  ? 45.494  54.855 124.156 1.00 36.98  ? 54  ALA A N     1 
ATOM   1653 C CA    . ALA C 2 54  ? 45.418  55.486 125.462 1.00 38.76  ? 54  ALA A CA    1 
ATOM   1654 C C     . ALA C 2 54  ? 45.140  56.984 125.312 1.00 43.53  ? 54  ALA A C     1 
ATOM   1655 O O     . ALA C 2 54  ? 44.136  57.502 125.819 1.00 54.83  ? 54  ALA A O     1 
ATOM   1656 C CB    . ALA C 2 54  ? 46.730  55.281 126.211 1.00 22.22  ? 54  ALA A CB    1 
ATOM   1657 N N     . TRP C 2 55  ? 46.028  57.675 124.608 1.00 39.13  ? 55  TRP A N     1 
ATOM   1658 C CA    . TRP C 2 55  ? 45.867  59.105 124.426 1.00 41.11  ? 55  TRP A CA    1 
ATOM   1659 C C     . TRP C 2 55  ? 44.460  59.470 123.965 1.00 41.27  ? 55  TRP A C     1 
ATOM   1660 O O     . TRP C 2 55  ? 43.881  60.456 124.412 1.00 39.18  ? 55  TRP A O     1 
ATOM   1661 C CB    . TRP C 2 55  ? 46.892  59.639 123.425 1.00 38.51  ? 55  TRP A CB    1 
ATOM   1662 C CG    . TRP C 2 55  ? 46.688  61.092 123.151 1.00 25.84  ? 55  TRP A CG    1 
ATOM   1663 C CD1   . TRP C 2 55  ? 47.208  62.145 123.856 1.00 31.22  ? 55  TRP A CD1   1 
ATOM   1664 C CD2   . TRP C 2 55  ? 45.806  61.657 122.176 1.00 29.53  ? 55  TRP A CD2   1 
ATOM   1665 N NE1   . TRP C 2 55  ? 46.692  63.328 123.385 1.00 31.81  ? 55  TRP A NE1   1 
ATOM   1666 C CE2   . TRP C 2 55  ? 45.829  63.062 122.354 1.00 23.38  ? 55  TRP A CE2   1 
ATOM   1667 C CE3   . TRP C 2 55  ? 44.990  61.113 121.173 1.00 22.48  ? 55  TRP A CE3   1 
ATOM   1668 C CZ2   . TRP C 2 55  ? 45.068  63.933 121.565 1.00 21.50  ? 55  TRP A CZ2   1 
ATOM   1669 C CZ3   . TRP C 2 55  ? 44.226  61.978 120.384 1.00 29.95  ? 55  TRP A CZ3   1 
ATOM   1670 C CH2   . TRP C 2 55  ? 44.271  63.373 120.586 1.00 36.01  ? 55  TRP A CH2   1 
ATOM   1671 N N     . CYS C 2 56  ? 43.910  58.661 123.076 1.00 41.47  ? 56  CYS A N     1 
ATOM   1672 C CA    . CYS C 2 56  ? 42.582  58.910 122.553 1.00 41.68  ? 56  CYS A CA    1 
ATOM   1673 C C     . CYS C 2 56  ? 41.500  58.803 123.623 1.00 47.28  ? 56  CYS A C     1 
ATOM   1674 O O     . CYS C 2 56  ? 40.598  59.637 123.684 1.00 50.47  ? 56  CYS A O     1 
ATOM   1675 C CB    . CYS C 2 56  ? 42.290  57.921 121.429 1.00 36.23  ? 56  CYS A CB    1 
ATOM   1676 S SG    . CYS C 2 56  ? 42.719  58.540 119.808 1.00 42.40  ? 56  CYS A SG    1 
ATOM   1677 N N     . LYS C 2 57  ? 41.577  57.763 124.449 1.00 49.20  ? 57  LYS A N     1 
ATOM   1678 C CA    . LYS C 2 57  ? 40.593  57.558 125.512 1.00 52.77  ? 57  LYS A CA    1 
ATOM   1679 C C     . LYS C 2 57  ? 40.598  58.801 126.369 1.00 52.28  ? 57  LYS A C     1 
ATOM   1680 O O     . LYS C 2 57  ? 39.574  59.461 126.588 1.00 49.01  ? 57  LYS A O     1 
ATOM   1681 C CB    . LYS C 2 57  ? 40.992  56.376 126.384 1.00 53.24  ? 57  LYS A CB    1 
ATOM   1682 C CG    . LYS C 2 57  ? 40.005  56.076 127.483 1.00 62.70  ? 57  LYS A CG    1 
ATOM   1683 C CD    . LYS C 2 57  ? 40.378  54.804 128.209 1.00 72.99  ? 57  LYS A CD    1 
ATOM   1684 C CE    . LYS C 2 57  ? 40.058  54.899 129.695 1.00 85.59  ? 57  LYS A CE    1 
ATOM   1685 N NZ    . LYS C 2 57  ? 39.944  53.559 130.346 1.00 83.06  ? 57  LYS A NZ    1 
ATOM   1686 N N     . LEU C 2 58  ? 41.792  59.097 126.851 1.00 46.84  ? 58  LEU A N     1 
ATOM   1687 C CA    . LEU C 2 58  ? 42.024  60.248 127.681 1.00 43.15  ? 58  LEU A CA    1 
ATOM   1688 C C     . LEU C 2 58  ? 41.358  61.456 127.046 1.00 47.31  ? 58  LEU A C     1 
ATOM   1689 O O     . LEU C 2 58  ? 40.547  62.140 127.664 1.00 51.83  ? 58  LEU A O     1 
ATOM   1690 C CB    . LEU C 2 58  ? 43.522  60.475 127.769 1.00 44.76  ? 58  LEU A CB    1 
ATOM   1691 C CG    . LEU C 2 58  ? 43.970  61.674 128.583 1.00 50.25  ? 58  LEU A CG    1 
ATOM   1692 C CD1   . LEU C 2 58  ? 43.931  61.303 130.057 1.00 55.83  ? 58  LEU A CD1   1 
ATOM   1693 C CD2   . LEU C 2 58  ? 45.370  62.090 128.154 1.00 48.82  ? 58  LEU A CD2   1 
ATOM   1694 N N     . ASN C 2 59  ? 41.691  61.681 125.782 1.00 58.94  ? 59  ASN A N     1 
ATOM   1695 C CA    . ASN C 2 59  ? 41.187  62.818 125.023 1.00 57.53  ? 59  ASN A CA    1 
ATOM   1696 C C     . ASN C 2 59  ? 39.835  62.611 124.327 1.00 56.39  ? 59  ASN A C     1 
ATOM   1697 O O     . ASN C 2 59  ? 39.486  63.350 123.407 1.00 48.50  ? 59  ASN A O     1 
ATOM   1698 C CB    . ASN C 2 59  ? 42.264  63.245 124.020 1.00 55.10  ? 59  ASN A CB    1 
ATOM   1699 C CG    . ASN C 2 59  ? 43.533  63.746 124.705 1.00 59.66  ? 59  ASN A CG    1 
ATOM   1700 O OD1   . ASN C 2 59  ? 43.906  64.913 124.561 1.00 71.74  ? 59  ASN A OD1   1 
ATOM   1701 N ND2   . ASN C 2 59  ? 44.198  62.868 125.456 1.00 47.93  ? 59  ASN A ND2   1 
ATOM   1702 N N     . ASN C 2 60  ? 39.086  61.610 124.787 1.00 57.79  ? 60  ASN A N     1 
ATOM   1703 C CA    . ASN C 2 60  ? 37.756  61.290 124.265 1.00 60.08  ? 60  ASN A CA    1 
ATOM   1704 C C     . ASN C 2 60  ? 37.591  61.376 122.749 1.00 57.08  ? 60  ASN A C     1 
ATOM   1705 O O     . ASN C 2 60  ? 36.778  62.158 122.238 1.00 48.04  ? 60  ASN A O     1 
ATOM   1706 C CB    . ASN C 2 60  ? 36.723  62.181 124.952 1.00 70.27  ? 60  ASN A CB    1 
ATOM   1707 C CG    . ASN C 2 60  ? 36.526  61.813 126.408 1.00 81.26  ? 60  ASN A CG    1 
ATOM   1708 O OD1   . ASN C 2 60  ? 36.229  60.663 126.727 1.00 89.24  ? 60  ASN A OD1   1 
ATOM   1709 N ND2   . ASN C 2 60  ? 36.696  62.784 127.302 1.00 80.80  ? 60  ASN A ND2   1 
ATOM   1710 N N     . ARG C 2 61  ? 38.352  60.551 122.037 1.00 54.65  ? 61  ARG A N     1 
ATOM   1711 C CA    . ARG C 2 61  ? 38.300  60.524 120.579 1.00 53.65  ? 61  ARG A CA    1 
ATOM   1712 C C     . ARG C 2 61  ? 38.301  59.081 120.073 1.00 52.95  ? 61  ARG A C     1 
ATOM   1713 O O     . ARG C 2 61  ? 38.853  58.190 120.730 1.00 53.15  ? 61  ARG A O     1 
ATOM   1714 C CB    . ARG C 2 61  ? 39.493  61.289 119.999 1.00 54.58  ? 61  ARG A CB    1 
ATOM   1715 C CG    . ARG C 2 61  ? 39.934  62.481 120.837 1.00 59.66  ? 61  ARG A CG    1 
ATOM   1716 C CD    . ARG C 2 61  ? 39.597  63.810 120.163 1.00 66.11  ? 61  ARG A CD    1 
ATOM   1717 N NE    . ARG C 2 61  ? 39.966  64.968 120.984 1.00 67.75  ? 61  ARG A NE    1 
ATOM   1718 C CZ    . ARG C 2 61  ? 40.999  65.770 120.732 1.00 65.11  ? 61  ARG A CZ    1 
ATOM   1719 N NH1   . ARG C 2 61  ? 41.781  65.553 119.682 1.00 48.66  ? 61  ARG A NH1   1 
ATOM   1720 N NH2   . ARG C 2 61  ? 41.246  66.797 121.534 1.00 70.38  ? 61  ARG A NH2   1 
ATOM   1721 N N     . LYS C 2 62  ? 37.664  58.853 118.923 1.00 52.32  ? 62  LYS A N     1 
ATOM   1722 C CA    . LYS C 2 62  ? 37.590  57.515 118.341 1.00 51.82  ? 62  LYS A CA    1 
ATOM   1723 C C     . LYS C 2 62  ? 38.972  57.190 117.830 1.00 49.51  ? 62  LYS A C     1 
ATOM   1724 O O     . LYS C 2 62  ? 39.503  57.935 117.011 1.00 45.29  ? 62  LYS A O     1 
ATOM   1725 C CB    . LYS C 2 62  ? 36.611  57.497 117.176 1.00 54.75  ? 62  LYS A CB    1 
ATOM   1726 C CG    . LYS C 2 62  ? 36.809  56.320 116.238 1.00 66.36  ? 62  LYS A CG    1 
ATOM   1727 C CD    . LYS C 2 62  ? 35.504  55.893 115.597 1.00 75.51  ? 62  LYS A CD    1 
ATOM   1728 C CE    . LYS C 2 62  ? 34.525  55.377 116.634 1.00 82.44  ? 62  LYS A CE    1 
ATOM   1729 N NZ    . LYS C 2 62  ? 33.660  54.300 116.086 1.00 83.48  ? 62  LYS A NZ    1 
ATOM   1730 N N     . TRP C 2 63  ? 39.562  56.091 118.288 1.00 45.43  ? 63  TRP A N     1 
ATOM   1731 C CA    . TRP C 2 63  ? 40.907  55.786 117.833 1.00 43.99  ? 63  TRP A CA    1 
ATOM   1732 C C     . TRP C 2 63  ? 40.947  55.061 116.521 1.00 43.11  ? 63  TRP A C     1 
ATOM   1733 O O     . TRP C 2 63  ? 42.026  54.865 115.956 1.00 44.29  ? 63  TRP A O     1 
ATOM   1734 C CB    . TRP C 2 63  ? 41.677  54.996 118.884 1.00 38.20  ? 63  TRP A CB    1 
ATOM   1735 C CG    . TRP C 2 63  ? 41.509  53.526 118.802 1.00 44.89  ? 63  TRP A CG    1 
ATOM   1736 C CD1   . TRP C 2 63  ? 40.583  52.781 119.464 1.00 50.47  ? 63  TRP A CD1   1 
ATOM   1737 C CD2   . TRP C 2 63  ? 42.324  52.599 118.069 1.00 51.15  ? 63  TRP A CD2   1 
ATOM   1738 N NE1   . TRP C 2 63  ? 40.769  51.449 119.196 1.00 50.08  ? 63  TRP A NE1   1 
ATOM   1739 C CE2   . TRP C 2 63  ? 41.831  51.307 118.343 1.00 51.17  ? 63  TRP A CE2   1 
ATOM   1740 C CE3   . TRP C 2 63  ? 43.423  52.735 117.209 1.00 52.56  ? 63  TRP A CE3   1 
ATOM   1741 C CZ2   . TRP C 2 63  ? 42.398  50.155 117.789 1.00 48.92  ? 63  TRP A CZ2   1 
ATOM   1742 C CZ3   . TRP C 2 63  ? 43.989  51.588 116.657 1.00 36.86  ? 63  TRP A CZ3   1 
ATOM   1743 C CH2   . TRP C 2 63  ? 43.473  50.316 116.951 1.00 44.08  ? 63  TRP A CH2   1 
ATOM   1744 N N     . PHE C 2 64  ? 39.774  54.694 116.019 1.00 42.89  ? 64  PHE A N     1 
ATOM   1745 C CA    . PHE C 2 64  ? 39.695  53.970 114.755 1.00 45.30  ? 64  PHE A CA    1 
ATOM   1746 C C     . PHE C 2 64  ? 38.313  53.992 114.119 1.00 45.38  ? 64  PHE A C     1 
ATOM   1747 O O     . PHE C 2 64  ? 37.350  53.536 114.728 1.00 53.00  ? 64  PHE A O     1 
ATOM   1748 C CB    . PHE C 2 64  ? 40.109  52.519 114.964 1.00 41.00  ? 64  PHE A CB    1 
ATOM   1749 C CG    . PHE C 2 64  ? 40.485  51.819 113.703 1.00 46.34  ? 64  PHE A CG    1 
ATOM   1750 C CD1   . PHE C 2 64  ? 39.767  50.724 113.269 1.00 53.58  ? 64  PHE A CD1   1 
ATOM   1751 C CD2   . PHE C 2 64  ? 41.559  52.258 112.940 1.00 60.34  ? 64  PHE A CD2   1 
ATOM   1752 C CE1   . PHE C 2 64  ? 40.112  50.069 112.085 1.00 62.03  ? 64  PHE A CE1   1 
ATOM   1753 C CE2   . PHE C 2 64  ? 41.917  51.608 111.748 1.00 61.75  ? 64  PHE A CE2   1 
ATOM   1754 C CZ    . PHE C 2 64  ? 41.192  50.514 111.322 1.00 64.79  ? 64  PHE A CZ    1 
ATOM   1755 N N     . PRO C 2 65  ? 38.199  54.522 112.886 1.00 45.28  ? 65  PRO A N     1 
ATOM   1756 C CA    . PRO C 2 65  ? 39.308  55.086 112.111 1.00 37.66  ? 65  PRO A CA    1 
ATOM   1757 C C     . PRO C 2 65  ? 39.739  56.421 112.709 1.00 43.74  ? 65  PRO A C     1 
ATOM   1758 O O     . PRO C 2 65  ? 38.910  57.176 113.236 1.00 49.46  ? 65  PRO A O     1 
ATOM   1759 C CB    . PRO C 2 65  ? 38.735  55.246 110.694 1.00 34.38  ? 65  PRO A CB    1 
ATOM   1760 C CG    . PRO C 2 65  ? 37.369  54.613 110.707 1.00 38.90  ? 65  PRO A CG    1 
ATOM   1761 C CD    . PRO C 2 65  ? 36.928  54.604 112.141 1.00 52.67  ? 65  PRO A CD    1 
ATOM   1762 N N     . ALA C 2 66  ? 41.040  56.691 112.638 1.00 46.30  ? 66  ALA A N     1 
ATOM   1763 C CA    . ALA C 2 66  ? 41.620  57.921 113.162 1.00 50.63  ? 66  ALA A CA    1 
ATOM   1764 C C     . ALA C 2 66  ? 41.381  59.122 112.244 1.00 56.32  ? 66  ALA A C     1 
ATOM   1765 O O     . ALA C 2 66  ? 41.628  59.064 111.036 1.00 67.88  ? 66  ALA A O     1 
ATOM   1766 C CB    . ALA C 2 66  ? 43.111  57.723 113.395 1.00 20.94  ? 66  ALA A CB    1 
ATOM   1767 N N     . GLU C 2 67  ? 40.912  60.214 112.836 1.00 62.12  ? 67  GLU A N     1 
ATOM   1768 C CA    . GLU C 2 67  ? 40.628  61.431 112.094 1.00 62.01  ? 67  GLU A CA    1 
ATOM   1769 C C     . GLU C 2 67  ? 41.733  62.490 112.211 1.00 57.49  ? 67  GLU A C     1 
ATOM   1770 O O     . GLU C 2 67  ? 42.221  62.775 113.304 1.00 52.68  ? 67  GLU A O     1 
ATOM   1771 C CB    . GLU C 2 67  ? 39.290  61.984 112.568 1.00 73.58  ? 67  GLU A CB    1 
ATOM   1772 C CG    . GLU C 2 67  ? 38.201  60.906 112.631 1.00 91.89  ? 67  GLU A CG    1 
ATOM   1773 C CD    . GLU C 2 67  ? 37.208  61.126 113.756 1.00 100.00 ? 67  GLU A CD    1 
ATOM   1774 O OE1   . GLU C 2 67  ? 37.031  62.292 114.178 1.00 100.00 ? 67  GLU A OE1   1 
ATOM   1775 O OE2   . GLU C 2 67  ? 36.604  60.130 114.213 1.00 100.00 ? 67  GLU A OE2   1 
ATOM   1776 N N     . PRO C 2 68  ? 42.127  63.092 111.072 1.00 56.07  ? 68  PRO A N     1 
ATOM   1777 C CA    . PRO C 2 68  ? 43.156  64.123 110.909 1.00 51.76  ? 68  PRO A CA    1 
ATOM   1778 C C     . PRO C 2 68  ? 43.369  65.041 112.100 1.00 50.22  ? 68  PRO A C     1 
ATOM   1779 O O     . PRO C 2 68  ? 44.429  65.029 112.726 1.00 52.48  ? 68  PRO A O     1 
ATOM   1780 C CB    . PRO C 2 68  ? 42.694  64.904 109.677 1.00 55.45  ? 68  PRO A CB    1 
ATOM   1781 C CG    . PRO C 2 68  ? 41.547  64.111 109.084 1.00 50.46  ? 68  PRO A CG    1 
ATOM   1782 C CD    . PRO C 2 68  ? 41.505  62.787 109.778 1.00 56.60  ? 68  PRO A CD    1 
ATOM   1783 N N     . GLU C 2 69  ? 42.360  65.852 112.391 1.00 45.26  ? 69  GLU A N     1 
ATOM   1784 C CA    . GLU C 2 69  ? 42.419  66.789 113.500 1.00 41.60  ? 69  GLU A CA    1 
ATOM   1785 C C     . GLU C 2 69  ? 42.791  66.054 114.774 1.00 35.96  ? 69  GLU A C     1 
ATOM   1786 O O     . GLU C 2 69  ? 43.619  66.515 115.552 1.00 45.57  ? 69  GLU A O     1 
ATOM   1787 C CB    . GLU C 2 69  ? 41.059  67.473 113.670 1.00 49.22  ? 69  GLU A CB    1 
ATOM   1788 C CG    . GLU C 2 69  ? 41.121  68.955 114.051 1.00 72.15  ? 69  GLU A CG    1 
ATOM   1789 C CD    . GLU C 2 69  ? 42.269  69.695 113.396 1.00 81.04  ? 69  GLU A CD    1 
ATOM   1790 O OE1   . GLU C 2 69  ? 43.190  70.143 114.124 1.00 80.94  ? 69  GLU A OE1   1 
ATOM   1791 O OE2   . GLU C 2 69  ? 42.241  69.824 112.151 1.00 76.47  ? 69  GLU A OE2   1 
ATOM   1792 N N     . ASP C 2 70  ? 42.191  64.889 114.968 1.00 38.51  ? 70  ASP A N     1 
ATOM   1793 C CA    . ASP C 2 70  ? 42.450  64.097 116.158 1.00 40.99  ? 70  ASP A CA    1 
ATOM   1794 C C     . ASP C 2 70  ? 43.929  63.742 116.185 1.00 42.21  ? 70  ASP A C     1 
ATOM   1795 O O     . ASP C 2 70  ? 44.628  64.028 117.158 1.00 38.15  ? 70  ASP A O     1 
ATOM   1796 C CB    . ASP C 2 70  ? 41.590  62.823 116.150 1.00 58.36  ? 70  ASP A CB    1 
ATOM   1797 C CG    . ASP C 2 70  ? 40.124  63.082 116.533 1.00 66.34  ? 70  ASP A CG    1 
ATOM   1798 O OD1   . ASP C 2 70  ? 39.293  62.163 116.372 1.00 75.84  ? 70  ASP A OD1   1 
ATOM   1799 O OD2   . ASP C 2 70  ? 39.795  64.196 116.996 1.00 66.88  ? 70  ASP A OD2   1 
ATOM   1800 N N     . VAL C 2 71  ? 44.396  63.119 115.103 1.00 44.85  ? 71  VAL A N     1 
ATOM   1801 C CA    . VAL C 2 71  ? 45.799  62.737 114.966 1.00 38.83  ? 71  VAL A CA    1 
ATOM   1802 C C     . VAL C 2 71  ? 46.664  63.953 115.240 1.00 37.98  ? 71  VAL A C     1 
ATOM   1803 O O     . VAL C 2 71  ? 47.405  63.990 116.216 1.00 39.59  ? 71  VAL A O     1 
ATOM   1804 C CB    . VAL C 2 71  ? 46.119  62.270 113.539 1.00 31.03  ? 71  VAL A CB    1 
ATOM   1805 C CG1   . VAL C 2 71  ? 47.608  62.083 113.382 1.00 36.35  ? 71  VAL A CG1   1 
ATOM   1806 C CG2   . VAL C 2 71  ? 45.392  60.986 113.230 1.00 22.38  ? 71  VAL A CG2   1 
ATOM   1807 N N     . ARG C 2 72  ? 46.569  64.928 114.341 1.00 31.08  ? 72  ARG A N     1 
ATOM   1808 C CA    . ARG C 2 72  ? 47.304  66.173 114.454 1.00 32.12  ? 72  ARG A CA    1 
ATOM   1809 C C     . ARG C 2 72  ? 47.497  66.470 115.937 1.00 34.59  ? 72  ARG A C     1 
ATOM   1810 O O     . ARG C 2 72  ? 48.627  66.535 116.418 1.00 46.05  ? 72  ARG A O     1 
ATOM   1811 C CB    . ARG C 2 72  ? 46.518  67.293 113.771 1.00 28.02  ? 72  ARG A CB    1 
ATOM   1812 C CG    . ARG C 2 72  ? 47.075  68.681 114.014 1.00 33.33  ? 72  ARG A CG    1 
ATOM   1813 C CD    . ARG C 2 72  ? 46.100  69.747 113.532 1.00 32.45  ? 72  ARG A CD    1 
ATOM   1814 N NE    . ARG C 2 72  ? 46.743  71.054 113.417 1.00 36.55  ? 72  ARG A NE    1 
ATOM   1815 C CZ    . ARG C 2 72  ? 46.982  71.874 114.441 1.00 44.56  ? 72  ARG A CZ    1 
ATOM   1816 N NH1   . ARG C 2 72  ? 46.632  71.531 115.682 1.00 35.46  ? 72  ARG A NH1   1 
ATOM   1817 N NH2   . ARG C 2 72  ? 47.568  73.050 114.220 1.00 42.75  ? 72  ARG A NH2   1 
ATOM   1818 N N     . ASP C 2 73  ? 46.393  66.613 116.664 1.00 32.45  ? 73  ASP A N     1 
ATOM   1819 C CA    . ASP C 2 73  ? 46.438  66.886 118.107 1.00 36.02  ? 73  ASP A CA    1 
ATOM   1820 C C     . ASP C 2 73  ? 47.410  65.928 118.810 1.00 30.05  ? 73  ASP A C     1 
ATOM   1821 O O     . ASP C 2 73  ? 48.252  66.339 119.614 1.00 23.86  ? 73  ASP A O     1 
ATOM   1822 C CB    . ASP C 2 73  ? 45.047  66.701 118.730 1.00 40.81  ? 73  ASP A CB    1 
ATOM   1823 C CG    . ASP C 2 73  ? 44.055  67.770 118.299 1.00 40.42  ? 73  ASP A CG    1 
ATOM   1824 O OD1   . ASP C 2 73  ? 42.942  67.813 118.877 1.00 36.37  ? 73  ASP A OD1   1 
ATOM   1825 O OD2   . ASP C 2 73  ? 44.380  68.562 117.386 1.00 39.69  ? 73  ASP A OD2   1 
ATOM   1826 N N     . TYR C 2 74  ? 47.253  64.644 118.506 1.00 22.79  ? 74  TYR A N     1 
ATOM   1827 C CA    . TYR C 2 74  ? 48.090  63.596 119.050 1.00 25.60  ? 74  TYR A CA    1 
ATOM   1828 C C     . TYR C 2 74  ? 49.553  63.897 118.825 1.00 30.83  ? 74  TYR A C     1 
ATOM   1829 O O     . TYR C 2 74  ? 50.374  63.747 119.722 1.00 42.04  ? 74  TYR A O     1 
ATOM   1830 C CB    . TYR C 2 74  ? 47.788  62.282 118.364 1.00 18.33  ? 74  TYR A CB    1 
ATOM   1831 C CG    . TYR C 2 74  ? 48.734  61.204 118.786 1.00 24.51  ? 74  TYR A CG    1 
ATOM   1832 C CD1   . TYR C 2 74  ? 48.810  60.815 120.121 1.00 31.05  ? 74  TYR A CD1   1 
ATOM   1833 C CD2   . TYR C 2 74  ? 49.504  60.516 117.852 1.00 27.42  ? 74  TYR A CD2   1 
ATOM   1834 C CE1   . TYR C 2 74  ? 49.622  59.750 120.524 1.00 33.56  ? 74  TYR A CE1   1 
ATOM   1835 C CE2   . TYR C 2 74  ? 50.323  59.445 118.238 1.00 24.60  ? 74  TYR A CE2   1 
ATOM   1836 C CZ    . TYR C 2 74  ? 50.373  59.060 119.581 1.00 34.37  ? 74  TYR A CZ    1 
ATOM   1837 O OH    . TYR C 2 74  ? 51.119  57.969 119.988 1.00 25.48  ? 74  TYR A OH    1 
ATOM   1838 N N     . LEU C 2 75  ? 49.877  64.284 117.601 1.00 29.95  ? 75  LEU A N     1 
ATOM   1839 C CA    . LEU C 2 75  ? 51.245  64.595 117.251 1.00 26.56  ? 75  LEU A CA    1 
ATOM   1840 C C     . LEU C 2 75  ? 51.798  65.788 118.026 1.00 33.00  ? 75  LEU A C     1 
ATOM   1841 O O     . LEU C 2 75  ? 52.902  65.734 118.568 1.00 38.71  ? 75  LEU A O     1 
ATOM   1842 C CB    . LEU C 2 75  ? 51.338  64.859 115.751 1.00 32.06  ? 75  LEU A CB    1 
ATOM   1843 C CG    . LEU C 2 75  ? 50.877  63.729 114.809 1.00 32.75  ? 75  LEU A CG    1 
ATOM   1844 C CD1   . LEU C 2 75  ? 51.124  64.132 113.353 1.00 28.56  ? 75  LEU A CD1   1 
ATOM   1845 C CD2   . LEU C 2 75  ? 51.623  62.444 115.125 1.00 13.11  ? 75  LEU A CD2   1 
ATOM   1846 N N     . LEU C 2 76  ? 51.040  66.872 118.090 1.00 37.32  ? 76  LEU A N     1 
ATOM   1847 C CA    . LEU C 2 76  ? 51.529  68.044 118.813 1.00 42.81  ? 76  LEU A CA    1 
ATOM   1848 C C     . LEU C 2 76  ? 51.751  67.691 120.283 1.00 41.40  ? 76  LEU A C     1 
ATOM   1849 O O     . LEU C 2 76  ? 52.487  68.361 121.000 1.00 48.15  ? 76  LEU A O     1 
ATOM   1850 C CB    . LEU C 2 76  ? 50.541  69.210 118.681 1.00 42.10  ? 76  LEU A CB    1 
ATOM   1851 C CG    . LEU C 2 76  ? 50.279  69.759 117.263 1.00 45.06  ? 76  LEU A CG    1 
ATOM   1852 C CD1   . LEU C 2 76  ? 49.256  70.892 117.321 1.00 38.06  ? 76  LEU A CD1   1 
ATOM   1853 C CD2   . LEU C 2 76  ? 51.581  70.252 116.628 1.00 28.65  ? 76  LEU A CD2   1 
ATOM   1854 N N     . TYR C 2 77  ? 51.114  66.614 120.716 1.00 40.42  ? 77  TYR A N     1 
ATOM   1855 C CA    . TYR C 2 77  ? 51.237  66.146 122.082 1.00 25.51  ? 77  TYR A CA    1 
ATOM   1856 C C     . TYR C 2 77  ? 52.607  65.523 122.273 1.00 26.84  ? 77  TYR A C     1 
ATOM   1857 O O     . TYR C 2 77  ? 53.281  65.773 123.262 1.00 34.43  ? 77  TYR A O     1 
ATOM   1858 C CB    . TYR C 2 77  ? 50.151  65.115 122.349 1.00 26.18  ? 77  TYR A CB    1 
ATOM   1859 C CG    . TYR C 2 77  ? 50.437  64.188 123.495 1.00 32.90  ? 77  TYR A CG    1 
ATOM   1860 C CD1   . TYR C 2 77  ? 50.538  64.670 124.795 1.00 45.85  ? 77  TYR A CD1   1 
ATOM   1861 C CD2   . TYR C 2 77  ? 50.599  62.825 123.284 1.00 38.12  ? 77  TYR A CD2   1 
ATOM   1862 C CE1   . TYR C 2 77  ? 50.794  63.819 125.860 1.00 42.85  ? 77  TYR A CE1   1 
ATOM   1863 C CE2   . TYR C 2 77  ? 50.857  61.958 124.340 1.00 41.37  ? 77  TYR A CE2   1 
ATOM   1864 C CZ    . TYR C 2 77  ? 50.951  62.463 125.624 1.00 41.01  ? 77  TYR A CZ    1 
ATOM   1865 O OH    . TYR C 2 77  ? 51.182  61.612 126.677 1.00 58.28  ? 77  TYR A OH    1 
ATOM   1866 N N     . LEU C 2 78  ? 53.006  64.710 121.305 1.00 25.04  ? 78  LEU A N     1 
ATOM   1867 C CA    . LEU C 2 78  ? 54.285  64.025 121.318 1.00 24.67  ? 78  LEU A CA    1 
ATOM   1868 C C     . LEU C 2 78  ? 55.414  65.027 121.188 1.00 29.78  ? 78  LEU A C     1 
ATOM   1869 O O     . LEU C 2 78  ? 56.479  64.880 121.785 1.00 33.80  ? 78  LEU A O     1 
ATOM   1870 C CB    . LEU C 2 78  ? 54.355  63.032 120.152 1.00 32.04  ? 78  LEU A CB    1 
ATOM   1871 C CG    . LEU C 2 78  ? 53.273  61.951 120.011 1.00 26.76  ? 78  LEU A CG    1 
ATOM   1872 C CD1   . LEU C 2 78  ? 53.579  61.075 118.792 1.00 16.06  ? 78  LEU A CD1   1 
ATOM   1873 C CD2   . LEU C 2 78  ? 53.235  61.089 121.273 1.00 28.52  ? 78  LEU A CD2   1 
ATOM   1874 N N     . GLN C 2 79  ? 55.189  66.034 120.363 1.00 33.13  ? 79  GLN A N     1 
ATOM   1875 C CA    . GLN C 2 79  ? 56.200  67.047 120.190 1.00 38.96  ? 79  GLN A CA    1 
ATOM   1876 C C     . GLN C 2 79  ? 56.506  67.569 121.585 1.00 41.97  ? 79  GLN A C     1 
ATOM   1877 O O     . GLN C 2 79  ? 57.660  67.597 122.017 1.00 42.05  ? 79  GLN A O     1 
ATOM   1878 C CB    . GLN C 2 79  ? 55.685  68.190 119.312 1.00 37.28  ? 79  GLN A CB    1 
ATOM   1879 C CG    . GLN C 2 79  ? 56.699  69.332 119.180 1.00 37.67  ? 79  GLN A CG    1 
ATOM   1880 C CD    . GLN C 2 79  ? 56.245  70.470 118.263 1.00 40.43  ? 79  GLN A CD    1 
ATOM   1881 O OE1   . GLN C 2 79  ? 55.062  70.807 118.211 1.00 51.58  ? 79  GLN A OE1   1 
ATOM   1882 N NE2   . GLN C 2 79  ? 57.191  71.072 117.540 1.00 30.15  ? 79  GLN A NE2   1 
ATOM   1883 N N     . ALA C 2 80  ? 55.449  67.976 122.287 1.00 34.81  ? 80  ALA A N     1 
ATOM   1884 C CA    . ALA C 2 80  ? 55.589  68.508 123.640 1.00 28.60  ? 80  ALA A CA    1 
ATOM   1885 C C     . ALA C 2 80  ? 56.163  67.411 124.504 1.00 29.72  ? 80  ALA A C     1 
ATOM   1886 O O     . ALA C 2 80  ? 57.024  67.643 125.341 1.00 31.67  ? 80  ALA A O     1 
ATOM   1887 C CB    . ALA C 2 80  ? 54.243  68.935 124.186 1.00 25.17  ? 80  ALA A CB    1 
ATOM   1888 N N     . ARG C 2 81  ? 55.689  66.195 124.286 1.00 32.37  ? 81  ARG A N     1 
ATOM   1889 C CA    . ARG C 2 81  ? 56.187  65.062 125.048 1.00 31.42  ? 81  ARG A CA    1 
ATOM   1890 C C     . ARG C 2 81  ? 57.711  65.112 125.010 1.00 31.46  ? 81  ARG A C     1 
ATOM   1891 O O     . ARG C 2 81  ? 58.379  64.509 125.833 1.00 32.76  ? 81  ARG A O     1 
ATOM   1892 C CB    . ARG C 2 81  ? 55.687  63.745 124.431 1.00 37.36  ? 81  ARG A CB    1 
ATOM   1893 C CG    . ARG C 2 81  ? 55.019  62.809 125.439 1.00 45.62  ? 81  ARG A CG    1 
ATOM   1894 C CD    . ARG C 2 81  ? 54.820  61.369 124.933 1.00 41.99  ? 81  ARG A CD    1 
ATOM   1895 N NE    . ARG C 2 81  ? 55.944  60.506 125.281 1.00 52.13  ? 81  ARG A NE    1 
ATOM   1896 C CZ    . ARG C 2 81  ? 55.833  59.317 125.869 1.00 71.09  ? 81  ARG A CZ    1 
ATOM   1897 N NH1   . ARG C 2 81  ? 54.636  58.843 126.181 1.00 81.17  ? 81  ARG A NH1   1 
ATOM   1898 N NH2   . ARG C 2 81  ? 56.923  58.600 126.146 1.00 74.33  ? 81  ARG A NH2   1 
ATOM   1899 N N     . GLY C 2 82  ? 58.247  65.850 124.044 1.00 35.87  ? 82  GLY A N     1 
ATOM   1900 C CA    . GLY C 2 82  ? 59.685  65.957 123.891 1.00 34.40  ? 82  GLY A CA    1 
ATOM   1901 C C     . GLY C 2 82  ? 60.251  64.903 122.950 1.00 39.22  ? 82  GLY A C     1 
ATOM   1902 O O     . GLY C 2 82  ? 61.469  64.816 122.788 1.00 45.16  ? 82  GLY A O     1 
ATOM   1903 N N     . LEU C 2 83  ? 59.379  64.093 122.349 1.00 31.73  ? 83  LEU A N     1 
ATOM   1904 C CA    . LEU C 2 83  ? 59.813  63.046 121.424 1.00 30.63  ? 83  LEU A CA    1 
ATOM   1905 C C     . LEU C 2 83  ? 60.587  63.587 120.233 1.00 23.79  ? 83  LEU A C     1 
ATOM   1906 O O     . LEU C 2 83  ? 60.278  64.645 119.708 1.00 36.87  ? 83  LEU A O     1 
ATOM   1907 C CB    . LEU C 2 83  ? 58.606  62.267 120.898 1.00 35.80  ? 83  LEU A CB    1 
ATOM   1908 C CG    . LEU C 2 83  ? 57.645  61.617 121.884 1.00 34.52  ? 83  LEU A CG    1 
ATOM   1909 C CD1   . LEU C 2 83  ? 57.276  60.230 121.390 1.00 22.42  ? 83  LEU A CD1   1 
ATOM   1910 C CD2   . LEU C 2 83  ? 58.294  61.550 123.241 1.00 30.36  ? 83  LEU A CD2   1 
ATOM   1911 N N     . ALA C 2 84  ? 61.587  62.845 119.784 1.00 21.78  ? 84  ALA A N     1 
ATOM   1912 C CA    . ALA C 2 84  ? 62.360  63.292 118.638 1.00 23.04  ? 84  ALA A CA    1 
ATOM   1913 C C     . ALA C 2 84  ? 61.454  63.324 117.444 1.00 24.82  ? 84  ALA A C     1 
ATOM   1914 O O     . ALA C 2 84  ? 60.355  62.780 117.473 1.00 31.55  ? 84  ALA A O     1 
ATOM   1915 C CB    . ALA C 2 84  ? 63.516  62.354 118.369 1.00 22.47  ? 84  ALA A CB    1 
ATOM   1916 N N     . VAL C 2 85  ? 61.913  63.993 116.399 1.00 35.99  ? 85  VAL A N     1 
ATOM   1917 C CA    . VAL C 2 85  ? 61.147  64.077 115.175 1.00 40.24  ? 85  VAL A CA    1 
ATOM   1918 C C     . VAL C 2 85  ? 61.067  62.663 114.659 1.00 37.86  ? 85  VAL A C     1 
ATOM   1919 O O     . VAL C 2 85  ? 59.995  62.148 114.368 1.00 45.48  ? 85  VAL A O     1 
ATOM   1920 C CB    . VAL C 2 85  ? 61.856  64.937 114.112 1.00 41.08  ? 85  VAL A CB    1 
ATOM   1921 C CG1   . VAL C 2 85  ? 61.087  64.867 112.800 1.00 38.46  ? 85  VAL A CG1   1 
ATOM   1922 C CG2   . VAL C 2 85  ? 61.966  66.382 114.587 1.00 51.40  ? 85  VAL A CG2   1 
ATOM   1923 N N     . LYS C 2 86  ? 62.228  62.032 114.574 1.00 36.77  ? 86  LYS A N     1 
ATOM   1924 C CA    . LYS C 2 86  ? 62.295  60.666 114.084 1.00 47.19  ? 86  LYS A CA    1 
ATOM   1925 C C     . LYS C 2 86  ? 61.286  59.784 114.768 1.00 45.76  ? 86  LYS A C     1 
ATOM   1926 O O     . LYS C 2 86  ? 60.727  58.870 114.161 1.00 45.89  ? 86  LYS A O     1 
ATOM   1927 C CB    . LYS C 2 86  ? 63.682  60.077 114.325 1.00 53.76  ? 86  LYS A CB    1 
ATOM   1928 C CG    . LYS C 2 86  ? 64.371  59.573 113.068 1.00 59.74  ? 86  LYS A CG    1 
ATOM   1929 C CD    . LYS C 2 86  ? 63.439  59.569 111.868 1.00 64.13  ? 86  LYS A CD    1 
ATOM   1930 C CE    . LYS C 2 86  ? 63.963  58.658 110.783 1.00 76.18  ? 86  LYS A CE    1 
ATOM   1931 N NZ    . LYS C 2 86  ? 63.449  57.278 110.953 1.00 82.60  ? 86  LYS A NZ    1 
ATOM   1932 N N     . THR C 2 87  ? 61.062  60.063 116.042 1.00 42.66  ? 87  THR A N     1 
ATOM   1933 C CA    . THR C 2 87  ? 60.147  59.253 116.796 1.00 31.56  ? 87  THR A CA    1 
ATOM   1934 C C     . THR C 2 87  ? 58.725  59.561 116.383 1.00 33.67  ? 87  THR A C     1 
ATOM   1935 O O     . THR C 2 87  ? 57.908  58.650 116.207 1.00 31.24  ? 87  THR A O     1 
ATOM   1936 C CB    . THR C 2 87  ? 60.359  59.463 118.291 1.00 26.34  ? 87  THR A CB    1 
ATOM   1937 O OG1   . THR C 2 87  ? 61.528  58.735 118.691 1.00 21.51  ? 87  THR A OG1   1 
ATOM   1938 C CG2   . THR C 2 87  ? 59.159  58.956 119.077 1.00 25.63  ? 87  THR A CG2   1 
ATOM   1939 N N     . ILE C 2 88  ? 58.443  60.842 116.195 1.00 25.96  ? 88  ILE A N     1 
ATOM   1940 C CA    . ILE C 2 88  ? 57.116  61.256 115.795 1.00 18.81  ? 88  ILE A CA    1 
ATOM   1941 C C     . ILE C 2 88  ? 56.770  60.746 114.399 1.00 25.84  ? 88  ILE A C     1 
ATOM   1942 O O     . ILE C 2 88  ? 55.641  60.332 114.148 1.00 27.65  ? 88  ILE A O     1 
ATOM   1943 C CB    . ILE C 2 88  ? 56.997  62.777 115.822 1.00 19.55  ? 88  ILE A CB    1 
ATOM   1944 C CG1   . ILE C 2 88  ? 57.507  63.298 117.170 1.00 10.36  ? 88  ILE A CG1   1 
ATOM   1945 C CG2   . ILE C 2 88  ? 55.549  63.179 115.550 1.00 14.45  ? 88  ILE A CG2   1 
ATOM   1946 C CD1   . ILE C 2 88  ? 57.083  64.710 117.515 1.00 18.99  ? 88  ILE A CD1   1 
ATOM   1947 N N     . GLN C 2 89  ? 57.740  60.756 113.493 1.00 26.43  ? 89  GLN A N     1 
ATOM   1948 C CA    . GLN C 2 89  ? 57.491  60.295 112.139 1.00 31.41  ? 89  GLN A CA    1 
ATOM   1949 C C     . GLN C 2 89  ? 57.108  58.824 112.147 1.00 34.38  ? 89  GLN A C     1 
ATOM   1950 O O     . GLN C 2 89  ? 56.345  58.361 111.297 1.00 39.64  ? 89  GLN A O     1 
ATOM   1951 C CB    . GLN C 2 89  ? 58.736  60.483 111.283 1.00 32.07  ? 89  GLN A CB    1 
ATOM   1952 C CG    . GLN C 2 89  ? 58.757  61.807 110.548 1.00 55.95  ? 89  GLN A CG    1 
ATOM   1953 C CD    . GLN C 2 89  ? 60.152  62.210 110.082 1.00 61.64  ? 89  GLN A CD    1 
ATOM   1954 O OE1   . GLN C 2 89  ? 61.125  61.489 110.297 1.00 60.36  ? 89  GLN A OE1   1 
ATOM   1955 N NE2   . GLN C 2 89  ? 60.249  63.368 109.436 1.00 60.54  ? 89  GLN A NE2   1 
ATOM   1956 N N     . GLN C 2 90  ? 57.647  58.096 113.112 1.00 28.38  ? 90  GLN A N     1 
ATOM   1957 C CA    . GLN C 2 90  ? 57.373  56.678 113.229 1.00 37.62  ? 90  GLN A CA    1 
ATOM   1958 C C     . GLN C 2 90  ? 55.934  56.503 113.714 1.00 43.05  ? 90  GLN A C     1 
ATOM   1959 O O     . GLN C 2 90  ? 55.217  55.592 113.307 1.00 44.63  ? 90  GLN A O     1 
ATOM   1960 C CB    . GLN C 2 90  ? 58.329  56.057 114.241 1.00 43.54  ? 90  GLN A CB    1 
ATOM   1961 C CG    . GLN C 2 90  ? 57.860  54.732 114.820 1.00 49.35  ? 90  GLN A CG    1 
ATOM   1962 C CD    . GLN C 2 90  ? 58.292  53.546 113.971 1.00 60.54  ? 90  GLN A CD    1 
ATOM   1963 O OE1   . GLN C 2 90  ? 57.699  52.466 114.043 1.00 71.44  ? 90  GLN A OE1   1 
ATOM   1964 N NE2   . GLN C 2 90  ? 59.330  53.741 113.161 1.00 73.34  ? 90  GLN A NE2   1 
ATOM   1965 N N     . HIS C 2 91  ? 55.507  57.376 114.608 1.00 37.97  ? 91  HIS A N     1 
ATOM   1966 C CA    . HIS C 2 91  ? 54.159  57.256 115.112 1.00 35.17  ? 91  HIS A CA    1 
ATOM   1967 C C     . HIS C 2 91  ? 53.127  57.458 113.987 1.00 34.48  ? 91  HIS A C     1 
ATOM   1968 O O     . HIS C 2 91  ? 52.134  56.735 113.905 1.00 33.64  ? 91  HIS A O     1 
ATOM   1969 C CB    . HIS C 2 91  ? 53.944  58.255 116.256 1.00 40.80  ? 91  HIS A CB    1 
ATOM   1970 C CG    . HIS C 2 91  ? 54.302  57.711 117.609 1.00 30.49  ? 91  HIS A CG    1 
ATOM   1971 N ND1   . HIS C 2 91  ? 53.356  57.464 118.580 1.00 33.53  ? 91  HIS A ND1   1 
ATOM   1972 C CD2   . HIS C 2 91  ? 55.492  57.337 118.141 1.00 31.31  ? 91  HIS A CD2   1 
ATOM   1973 C CE1   . HIS C 2 91  ? 53.942  56.960 119.650 1.00 33.29  ? 91  HIS A CE1   1 
ATOM   1974 N NE2   . HIS C 2 91  ? 55.237  56.873 119.411 1.00 34.28  ? 91  HIS A NE2   1 
ATOM   1975 N N     . LEU C 2 92  ? 53.353  58.428 113.109 1.00 31.27  ? 92  LEU A N     1 
ATOM   1976 C CA    . LEU C 2 92  ? 52.405  58.637 112.018 1.00 28.86  ? 92  LEU A CA    1 
ATOM   1977 C C     . LEU C 2 92  ? 52.554  57.488 111.043 1.00 25.73  ? 92  LEU A C     1 
ATOM   1978 O O     . LEU C 2 92  ? 51.582  56.985 110.493 1.00 25.57  ? 92  LEU A O     1 
ATOM   1979 C CB    . LEU C 2 92  ? 52.677  59.953 111.281 1.00 22.87  ? 92  LEU A CB    1 
ATOM   1980 C CG    . LEU C 2 92  ? 51.438  60.679 110.735 1.00 26.76  ? 92  LEU A CG    1 
ATOM   1981 C CD1   . LEU C 2 92  ? 51.868  61.645 109.655 1.00 15.82  ? 92  LEU A CD1   1 
ATOM   1982 C CD2   . LEU C 2 92  ? 50.419  59.685 110.187 1.00 15.00  ? 92  LEU A CD2   1 
ATOM   1983 N N     . GLY C 2 93  ? 53.796  57.069 110.858 1.00 20.81  ? 93  GLY A N     1 
ATOM   1984 C CA    . GLY C 2 93  ? 54.090  55.997 109.938 1.00 23.56  ? 93  GLY A CA    1 
ATOM   1985 C C     . GLY C 2 93  ? 53.327  54.745 110.248 1.00 22.66  ? 93  GLY A C     1 
ATOM   1986 O O     . GLY C 2 93  ? 52.824  54.071 109.367 1.00 31.88  ? 93  GLY A O     1 
ATOM   1987 N N     . GLN C 2 94  ? 53.246  54.425 111.524 1.00 36.17  ? 94  GLN A N     1 
ATOM   1988 C CA    . GLN C 2 94  ? 52.535  53.231 111.949 1.00 37.85  ? 94  GLN A CA    1 
ATOM   1989 C C     . GLN C 2 94  ? 51.045  53.420 111.720 1.00 31.28  ? 94  GLN A C     1 
ATOM   1990 O O     . GLN C 2 94  ? 50.353  52.503 111.284 1.00 34.52  ? 94  GLN A O     1 
ATOM   1991 C CB    . GLN C 2 94  ? 52.842  52.958 113.422 1.00 43.28  ? 94  GLN A CB    1 
ATOM   1992 C CG    . GLN C 2 94  ? 54.278  52.482 113.658 1.00 54.52  ? 94  GLN A CG    1 
ATOM   1993 C CD    . GLN C 2 94  ? 54.587  51.185 112.929 1.00 62.75  ? 94  GLN A CD    1 
ATOM   1994 O OE1   . GLN C 2 94  ? 53.706  50.586 112.318 1.00 75.00  ? 94  GLN A OE1   1 
ATOM   1995 N NE2   . GLN C 2 94  ? 55.840  50.745 112.989 1.00 64.41  ? 94  GLN A NE2   1 
ATOM   1996 N N     . LEU C 2 95  ? 50.559  54.624 112.002 1.00 31.25  ? 95  LEU A N     1 
ATOM   1997 C CA    . LEU C 2 95  ? 49.156  54.938 111.794 1.00 26.89  ? 95  LEU A CA    1 
ATOM   1998 C C     . LEU C 2 95  ? 48.803  54.757 110.331 1.00 30.69  ? 95  LEU A C     1 
ATOM   1999 O O     . LEU C 2 95  ? 47.848  54.062 110.007 1.00 37.96  ? 95  LEU A O     1 
ATOM   2000 C CB    . LEU C 2 95  ? 48.868  56.373 112.214 1.00 22.33  ? 95  LEU A CB    1 
ATOM   2001 C CG    . LEU C 2 95  ? 47.998  56.541 113.464 1.00 31.55  ? 95  LEU A CG    1 
ATOM   2002 C CD1   . LEU C 2 95  ? 47.653  55.178 114.066 1.00 39.35  ? 95  LEU A CD1   1 
ATOM   2003 C CD2   . LEU C 2 95  ? 48.739  57.399 114.479 1.00 27.49  ? 95  LEU A CD2   1 
ATOM   2004 N N     . ASN C 2 96  ? 49.587  55.382 109.455 1.00 33.68  ? 96  ASN A N     1 
ATOM   2005 C CA    . ASN C 2 96  ? 49.371  55.274 108.017 1.00 27.46  ? 96  ASN A CA    1 
ATOM   2006 C C     . ASN C 2 96  ? 49.398  53.806 107.572 1.00 35.75  ? 96  ASN A C     1 
ATOM   2007 O O     . ASN C 2 96  ? 48.724  53.446 106.608 1.00 42.24  ? 96  ASN A O     1 
ATOM   2008 C CB    . ASN C 2 96  ? 50.443  56.051 107.250 1.00 15.52  ? 96  ASN A CB    1 
ATOM   2009 C CG    . ASN C 2 96  ? 50.355  57.546 107.476 1.00 25.61  ? 96  ASN A CG    1 
ATOM   2010 O OD1   . ASN C 2 96  ? 49.317  58.070 107.859 1.00 29.66  ? 96  ASN A OD1   1 
ATOM   2011 N ND2   . ASN C 2 96  ? 51.457  58.241 107.247 1.00 37.35  ? 96  ASN A ND2   1 
ATOM   2012 N N     . MET C 2 97  ? 50.173  52.968 108.267 1.00 26.87  ? 97  MET A N     1 
ATOM   2013 C CA    . MET C 2 97  ? 50.278  51.548 107.919 1.00 28.83  ? 97  MET A CA    1 
ATOM   2014 C C     . MET C 2 97  ? 48.996  50.802 108.248 1.00 35.20  ? 97  MET A C     1 
ATOM   2015 O O     . MET C 2 97  ? 48.369  50.178 107.385 1.00 46.33  ? 97  MET A O     1 
ATOM   2016 C CB    . MET C 2 97  ? 51.433  50.904 108.671 1.00 25.28  ? 97  MET A CB    1 
ATOM   2017 C CG    . MET C 2 97  ? 51.849  49.601 108.076 1.00 38.78  ? 97  MET A CG    1 
ATOM   2018 S SD    . MET C 2 97  ? 51.648  48.271 109.231 1.00 63.43  ? 97  MET A SD    1 
ATOM   2019 C CE    . MET C 2 97  ? 52.847  47.173 108.602 1.00 56.39  ? 97  MET A CE    1 
ATOM   2020 N N     . LEU C 2 98  ? 48.638  50.838 109.522 1.00 36.69  ? 98  LEU A N     1 
ATOM   2021 C CA    . LEU C 2 98  ? 47.412  50.230 110.002 1.00 32.97  ? 98  LEU A CA    1 
ATOM   2022 C C     . LEU C 2 98  ? 46.223  50.610 109.085 1.00 35.10  ? 98  LEU A C     1 
ATOM   2023 O O     . LEU C 2 98  ? 45.398  49.766 108.729 1.00 40.66  ? 98  LEU A O     1 
ATOM   2024 C CB    . LEU C 2 98  ? 47.161  50.737 111.411 1.00 26.37  ? 98  LEU A CB    1 
ATOM   2025 C CG    . LEU C 2 98  ? 45.893  50.288 112.126 1.00 36.82  ? 98  LEU A CG    1 
ATOM   2026 C CD1   . LEU C 2 98  ? 46.111  48.914 112.774 1.00 37.02  ? 98  LEU A CD1   1 
ATOM   2027 C CD2   . LEU C 2 98  ? 45.515  51.335 113.164 1.00 29.75  ? 98  LEU A CD2   1 
ATOM   2028 N N     . HIS C 2 99  ? 46.156  51.885 108.700 1.00 30.44  ? 99  HIS A N     1 
ATOM   2029 C CA    . HIS C 2 99  ? 45.090  52.406 107.839 1.00 25.25  ? 99  HIS A CA    1 
ATOM   2030 C C     . HIS C 2 99  ? 45.163  52.065 106.367 1.00 37.65  ? 99  HIS A C     1 
ATOM   2031 O O     . HIS C 2 99  ? 44.138  51.879 105.725 1.00 43.13  ? 99  HIS A O     1 
ATOM   2032 C CB    . HIS C 2 99  ? 45.043  53.911 107.947 1.00 16.53  ? 99  HIS A CB    1 
ATOM   2033 C CG    . HIS C 2 99  ? 44.445  54.388 109.218 1.00 28.47  ? 99  HIS A CG    1 
ATOM   2034 N ND1   . HIS C 2 99  ? 43.189  54.946 109.277 1.00 41.63  ? 99  HIS A ND1   1 
ATOM   2035 C CD2   . HIS C 2 99  ? 44.908  54.347 110.489 1.00 34.37  ? 99  HIS A CD2   1 
ATOM   2036 C CE1   . HIS C 2 99  ? 42.899  55.230 110.535 1.00 52.84  ? 99  HIS A CE1   1 
ATOM   2037 N NE2   . HIS C 2 99  ? 43.925  54.877 111.289 1.00 43.34  ? 99  HIS A NE2   1 
ATOM   2038 N N     . ARG C 2 100 ? 46.369  52.048 105.819 1.00 41.42  ? 100 ARG A N     1 
ATOM   2039 C CA    . ARG C 2 100 ? 46.553  51.725 104.417 1.00 45.61  ? 100 ARG A CA    1 
ATOM   2040 C C     . ARG C 2 100 ? 46.091  50.282 104.329 1.00 46.85  ? 100 ARG A C     1 
ATOM   2041 O O     . ARG C 2 100 ? 45.428  49.868 103.373 1.00 48.10  ? 100 ARG A O     1 
ATOM   2042 C CB    . ARG C 2 100 ? 48.040  51.829 104.043 1.00 61.02  ? 100 ARG A CB    1 
ATOM   2043 C CG    . ARG C 2 100 ? 48.353  51.703 102.546 1.00 76.75  ? 100 ARG A CG    1 
ATOM   2044 C CD    . ARG C 2 100 ? 49.130  52.928 102.021 1.00 92.05  ? 100 ARG A CD    1 
ATOM   2045 N NE    . ARG C 2 100 ? 48.503  53.538 100.843 1.00 99.14  ? 100 ARG A NE    1 
ATOM   2046 C CZ    . ARG C 2 100 ? 49.027  54.539 100.132 1.00 100.00 ? 100 ARG A CZ    1 
ATOM   2047 N NH1   . ARG C 2 100 ? 50.203  55.049 100.472 1.00 100.00 ? 100 ARG A NH1   1 
ATOM   2048 N NH2   . ARG C 2 100 ? 48.371  55.024 99.078  1.00 100.00 ? 100 ARG A NH2   1 
ATOM   2049 N N     . ARG C 2 101 ? 46.451  49.518 105.355 1.00 45.96  ? 101 ARG A N     1 
ATOM   2050 C CA    . ARG C 2 101 ? 46.087  48.108 105.418 1.00 53.74  ? 101 ARG A CA    1 
ATOM   2051 C C     . ARG C 2 101 ? 44.636  47.904 105.884 1.00 56.30  ? 101 ARG A C     1 
ATOM   2052 O O     . ARG C 2 101 ? 44.348  47.048 106.732 1.00 51.11  ? 101 ARG A O     1 
ATOM   2053 C CB    . ARG C 2 101 ? 47.054  47.372 106.341 1.00 46.02  ? 101 ARG A CB    1 
ATOM   2054 C CG    . ARG C 2 101 ? 48.520  47.582 105.997 1.00 43.27  ? 101 ARG A CG    1 
ATOM   2055 C CD    . ARG C 2 101 ? 48.868  46.947 104.662 1.00 43.86  ? 101 ARG A CD    1 
ATOM   2056 N NE    . ARG C 2 101 ? 50.279  47.120 104.326 1.00 60.76  ? 101 ARG A NE    1 
ATOM   2057 C CZ    . ARG C 2 101 ? 50.903  46.482 103.338 1.00 71.34  ? 101 ARG A CZ    1 
ATOM   2058 N NH1   . ARG C 2 101 ? 50.245  45.622 102.575 1.00 68.80  ? 101 ARG A NH1   1 
ATOM   2059 N NH2   . ARG C 2 101 ? 52.193  46.705 103.115 1.00 78.15  ? 101 ARG A NH2   1 
ATOM   2060 N N     . SER C 2 102 ? 43.748  48.727 105.328 1.00 57.51  ? 102 SER A N     1 
ATOM   2061 C CA    . SER C 2 102 ? 42.309  48.712 105.588 1.00 46.61  ? 102 SER A CA    1 
ATOM   2062 C C     . SER C 2 102 ? 41.705  49.710 104.592 1.00 44.23  ? 102 SER A C     1 
ATOM   2063 O O     . SER C 2 102 ? 42.335  50.683 104.205 1.00 38.03  ? 102 SER A O     1 
ATOM   2064 C CB    . SER C 2 102 ? 42.002  49.153 107.026 1.00 47.38  ? 102 SER A CB    1 
ATOM   2065 O OG    . SER C 2 102 ? 42.952  48.674 107.969 1.00 31.09  ? 102 SER A OG    1 
ATOM   2066 N N     . GLY C 2 103 ? 40.481  49.466 104.167 1.00 50.46  ? 103 GLY A N     1 
ATOM   2067 C CA    . GLY C 2 103 ? 39.855  50.362 103.208 1.00 64.77  ? 103 GLY A CA    1 
ATOM   2068 C C     . GLY C 2 103 ? 39.991  51.839 103.520 1.00 67.37  ? 103 GLY A C     1 
ATOM   2069 O O     . GLY C 2 103 ? 39.868  52.687 102.633 1.00 73.76  ? 103 GLY A O     1 
ATOM   2070 N N     . LEU C 2 104 ? 40.230  52.141 104.790 1.00 67.02  ? 104 LEU A N     1 
ATOM   2071 C CA    . LEU C 2 104 ? 40.374  53.511 105.240 1.00 65.56  ? 104 LEU A CA    1 
ATOM   2072 C C     . LEU C 2 104 ? 41.631  54.161 104.705 1.00 70.15  ? 104 LEU A C     1 
ATOM   2073 O O     . LEU C 2 104 ? 42.657  53.504 104.529 1.00 66.79  ? 104 LEU A O     1 
ATOM   2074 C CB    . LEU C 2 104 ? 40.395  53.570 106.760 1.00 66.18  ? 104 LEU A CB    1 
ATOM   2075 C CG    . LEU C 2 104 ? 39.957  52.326 107.530 1.00 70.83  ? 104 LEU A CG    1 
ATOM   2076 C CD1   . LEU C 2 104 ? 41.009  52.000 108.574 1.00 73.37  ? 104 LEU A CD1   1 
ATOM   2077 C CD2   . LEU C 2 104 ? 38.604  52.569 108.192 1.00 84.81  ? 104 LEU A CD2   1 
ATOM   2078 N N     . PRO C 2 105 ? 41.572  55.481 104.469 1.00 72.72  ? 105 PRO A N     1 
ATOM   2079 C CA    . PRO C 2 105 ? 42.723  56.219 103.947 1.00 75.97  ? 105 PRO A CA    1 
ATOM   2080 C C     . PRO C 2 105 ? 43.869  56.278 104.948 1.00 76.54  ? 105 PRO A C     1 
ATOM   2081 O O     . PRO C 2 105 ? 44.053  55.380 105.771 1.00 82.58  ? 105 PRO A O     1 
ATOM   2082 C CB    . PRO C 2 105 ? 42.152  57.607 103.655 1.00 73.53  ? 105 PRO A CB    1 
ATOM   2083 C CG    . PRO C 2 105 ? 41.024  57.749 104.606 1.00 65.04  ? 105 PRO A CG    1 
ATOM   2084 C CD    . PRO C 2 105 ? 40.421  56.371 104.716 1.00 68.23  ? 105 PRO A CD    1 
ATOM   2085 N N     . ARG C 2 106 ? 44.639  57.352 104.858 1.00 72.81  ? 106 ARG A N     1 
ATOM   2086 C CA    . ARG C 2 106 ? 45.761  57.564 105.751 1.00 62.28  ? 106 ARG A CA    1 
ATOM   2087 C C     . ARG C 2 106 ? 45.750  59.003 106.242 1.00 58.29  ? 106 ARG A C     1 
ATOM   2088 O O     . ARG C 2 106 ? 45.564  59.938 105.462 1.00 61.80  ? 106 ARG A O     1 
ATOM   2089 C CB    . ARG C 2 106 ? 47.078  57.279 105.029 1.00 50.83  ? 106 ARG A CB    1 
ATOM   2090 C CG    . ARG C 2 106 ? 47.183  55.889 104.449 1.00 44.01  ? 106 ARG A CG    1 
ATOM   2091 C CD    . ARG C 2 106 ? 48.590  55.610 103.973 1.00 58.12  ? 106 ARG A CD    1 
ATOM   2092 N NE    . ARG C 2 106 ? 49.313  56.830 103.617 1.00 67.58  ? 106 ARG A NE    1 
ATOM   2093 C CZ    . ARG C 2 106 ? 50.585  56.852 103.238 1.00 75.92  ? 106 ARG A CZ    1 
ATOM   2094 N NH1   . ARG C 2 106 ? 51.266  55.716 103.164 1.00 68.36  ? 106 ARG A NH1   1 
ATOM   2095 N NH2   . ARG C 2 106 ? 51.164  58.007 102.932 1.00 75.90  ? 106 ARG A NH2   1 
ATOM   2096 N N     . PRO C 2 107 ? 45.931  59.197 107.550 1.00 51.09  ? 107 PRO A N     1 
ATOM   2097 C CA    . PRO C 2 107 ? 45.947  60.538 108.134 1.00 48.29  ? 107 PRO A CA    1 
ATOM   2098 C C     . PRO C 2 107 ? 47.054  61.394 107.514 1.00 37.43  ? 107 PRO A C     1 
ATOM   2099 O O     . PRO C 2 107 ? 46.891  62.600 107.354 1.00 29.96  ? 107 PRO A O     1 
ATOM   2100 C CB    . PRO C 2 107 ? 46.183  60.276 109.620 1.00 51.25  ? 107 PRO A CB    1 
ATOM   2101 C CG    . PRO C 2 107 ? 46.816  58.909 109.660 1.00 42.52  ? 107 PRO A CG    1 
ATOM   2102 C CD    . PRO C 2 107 ? 46.140  58.157 108.565 1.00 43.16  ? 107 PRO A CD    1 
ATOM   2103 N N     . SER C 2 108 ? 48.167  60.761 107.146 1.00 32.45  ? 108 SER A N     1 
ATOM   2104 C CA    . SER C 2 108 ? 49.293  61.468 106.549 1.00 31.18  ? 108 SER A CA    1 
ATOM   2105 C C     . SER C 2 108 ? 48.916  62.061 105.205 1.00 40.09  ? 108 SER A C     1 
ATOM   2106 O O     . SER C 2 108 ? 49.656  62.856 104.623 1.00 50.90  ? 108 SER A O     1 
ATOM   2107 C CB    . SER C 2 108 ? 50.449  60.514 106.339 1.00 22.28  ? 108 SER A CB    1 
ATOM   2108 O OG    . SER C 2 108 ? 51.671  61.184 106.524 1.00 42.05  ? 108 SER A OG    1 
ATOM   2109 N N     . ASP C 2 109 ? 47.759  61.650 104.706 1.00 51.07  ? 109 ASP A N     1 
ATOM   2110 C CA    . ASP C 2 109 ? 47.261  62.121 103.422 1.00 52.71  ? 109 ASP A CA    1 
ATOM   2111 C C     . ASP C 2 109 ? 46.262  63.254 103.619 1.00 49.80  ? 109 ASP A C     1 
ATOM   2112 O O     . ASP C 2 109 ? 45.398  63.495 102.768 1.00 51.90  ? 109 ASP A O     1 
ATOM   2113 C CB    . ASP C 2 109 ? 46.581  60.978 102.654 1.00 59.70  ? 109 ASP A CB    1 
ATOM   2114 C CG    . ASP C 2 109 ? 47.357  59.677 102.724 1.00 64.11  ? 109 ASP A CG    1 
ATOM   2115 O OD1   . ASP C 2 109 ? 48.595  59.726 102.917 1.00 70.88  ? 109 ASP A OD1   1 
ATOM   2116 O OD2   . ASP C 2 109 ? 46.720  58.609 102.584 1.00 64.51  ? 109 ASP A OD2   1 
ATOM   2117 N N     . SER C 2 110 ? 46.372  63.945 104.749 1.00 44.37  ? 110 SER A N     1 
ATOM   2118 C CA    . SER C 2 110 ? 45.469  65.055 105.030 1.00 46.76  ? 110 SER A CA    1 
ATOM   2119 C C     . SER C 2 110 ? 46.249  66.359 105.133 1.00 46.41  ? 110 SER A C     1 
ATOM   2120 O O     . SER C 2 110 ? 47.418  66.369 105.521 1.00 49.35  ? 110 SER A O     1 
ATOM   2121 C CB    . SER C 2 110 ? 44.696  64.809 106.332 1.00 48.60  ? 110 SER A CB    1 
ATOM   2122 O OG    . SER C 2 110 ? 45.473  65.149 107.466 1.00 64.53  ? 110 SER A OG    1 
ATOM   2123 N N     . ASN C 2 111 ? 45.609  67.461 104.766 1.00 49.73  ? 111 ASN A N     1 
ATOM   2124 C CA    . ASN C 2 111 ? 46.278  68.747 104.846 1.00 50.80  ? 111 ASN A CA    1 
ATOM   2125 C C     . ASN C 2 111 ? 46.858  68.917 106.258 1.00 48.60  ? 111 ASN A C     1 
ATOM   2126 O O     . ASN C 2 111 ? 48.075  68.947 106.435 1.00 52.14  ? 111 ASN A O     1 
ATOM   2127 C CB    . ASN C 2 111 ? 45.289  69.870 104.519 1.00 52.54  ? 111 ASN A CB    1 
ATOM   2128 C CG    . ASN C 2 111 ? 45.972  71.209 104.320 1.00 62.50  ? 111 ASN A CG    1 
ATOM   2129 O OD1   . ASN C 2 111 ? 47.198  71.283 104.186 1.00 75.29  ? 111 ASN A OD1   1 
ATOM   2130 N ND2   . ASN C 2 111 ? 45.184  72.279 104.299 1.00 56.11  ? 111 ASN A ND2   1 
ATOM   2131 N N     . ALA C 2 112 ? 45.974  68.996 107.254 1.00 45.12  ? 112 ALA A N     1 
ATOM   2132 C CA    . ALA C 2 112 ? 46.359  69.170 108.662 1.00 40.02  ? 112 ALA A CA    1 
ATOM   2133 C C     . ALA C 2 112 ? 47.547  68.319 109.102 1.00 34.74  ? 112 ALA A C     1 
ATOM   2134 O O     . ALA C 2 112 ? 48.613  68.847 109.408 1.00 34.11  ? 112 ALA A O     1 
ATOM   2135 C CB    . ALA C 2 112 ? 45.167  68.882 109.557 1.00 41.54  ? 112 ALA A CB    1 
ATOM   2136 N N     . VAL C 2 113 ? 47.350  67.004 109.143 1.00 36.04  ? 113 VAL A N     1 
ATOM   2137 C CA    . VAL C 2 113 ? 48.404  66.070 109.539 1.00 36.96  ? 113 VAL A CA    1 
ATOM   2138 C C     . VAL C 2 113 ? 49.669  66.345 108.750 1.00 37.68  ? 113 VAL A C     1 
ATOM   2139 O O     . VAL C 2 113 ? 50.775  66.252 109.271 1.00 44.44  ? 113 VAL A O     1 
ATOM   2140 C CB    . VAL C 2 113 ? 47.984  64.607 109.291 1.00 42.87  ? 113 VAL A CB    1 
ATOM   2141 C CG1   . VAL C 2 113 ? 49.223  63.721 109.172 1.00 46.92  ? 113 VAL A CG1   1 
ATOM   2142 C CG2   . VAL C 2 113 ? 47.075  64.125 110.416 1.00 42.24  ? 113 VAL A CG2   1 
ATOM   2143 N N     . SER C 2 114 ? 49.501  66.703 107.487 1.00 36.30  ? 114 SER A N     1 
ATOM   2144 C CA    . SER C 2 114 ? 50.641  66.992 106.651 1.00 32.31  ? 114 SER A CA    1 
ATOM   2145 C C     . SER C 2 114 ? 51.281  68.316 107.063 1.00 32.04  ? 114 SER A C     1 
ATOM   2146 O O     . SER C 2 114 ? 52.503  68.429 107.079 1.00 35.15  ? 114 SER A O     1 
ATOM   2147 C CB    . SER C 2 114 ? 50.213  67.027 105.185 1.00 41.04  ? 114 SER A CB    1 
ATOM   2148 O OG    . SER C 2 114 ? 50.099  65.708 104.670 1.00 45.17  ? 114 SER A OG    1 
ATOM   2149 N N     . LEU C 2 115 ? 50.472  69.311 107.408 1.00 28.37  ? 115 LEU A N     1 
ATOM   2150 C CA    . LEU C 2 115 ? 51.040  70.595 107.803 1.00 33.66  ? 115 LEU A CA    1 
ATOM   2151 C C     . LEU C 2 115 ? 51.726  70.567 109.180 1.00 40.22  ? 115 LEU A C     1 
ATOM   2152 O O     . LEU C 2 115 ? 52.744  71.236 109.363 1.00 46.40  ? 115 LEU A O     1 
ATOM   2153 C CB    . LEU C 2 115 ? 49.974  71.698 107.777 1.00 26.19  ? 115 LEU A CB    1 
ATOM   2154 C CG    . LEU C 2 115 ? 49.396  72.070 106.413 1.00 27.78  ? 115 LEU A CG    1 
ATOM   2155 C CD1   . LEU C 2 115 ? 48.166  72.908 106.648 1.00 32.16  ? 115 LEU A CD1   1 
ATOM   2156 C CD2   . LEU C 2 115 ? 50.407  72.829 105.567 1.00 13.15  ? 115 LEU A CD2   1 
ATOM   2157 N N     . VAL C 2 116 ? 51.188  69.813 110.144 1.00 40.14  ? 116 VAL A N     1 
ATOM   2158 C CA    . VAL C 2 116 ? 51.808  69.750 111.480 1.00 35.86  ? 116 VAL A CA    1 
ATOM   2159 C C     . VAL C 2 116 ? 53.164  69.085 111.390 1.00 35.75  ? 116 VAL A C     1 
ATOM   2160 O O     . VAL C 2 116 ? 54.104  69.462 112.081 1.00 29.73  ? 116 VAL A O     1 
ATOM   2161 C CB    . VAL C 2 116 ? 51.027  68.909 112.497 1.00 36.21  ? 116 VAL A CB    1 
ATOM   2162 C CG1   . VAL C 2 116 ? 50.272  69.809 113.436 1.00 46.08  ? 116 VAL A CG1   1 
ATOM   2163 C CG2   . VAL C 2 116 ? 50.118  67.933 111.786 1.00 50.39  ? 116 VAL A CG2   1 
ATOM   2164 N N     . MET C 2 117 ? 53.258  68.062 110.557 1.00 37.51  ? 117 MET A N     1 
ATOM   2165 C CA    . MET C 2 117 ? 54.519  67.381 110.419 1.00 40.52  ? 117 MET A CA    1 
ATOM   2166 C C     . MET C 2 117 ? 55.535  68.406 109.908 1.00 45.76  ? 117 MET A C     1 
ATOM   2167 O O     . MET C 2 117 ? 56.646  68.501 110.431 1.00 50.17  ? 117 MET A O     1 
ATOM   2168 C CB    . MET C 2 117 ? 54.382  66.197 109.458 1.00 37.14  ? 117 MET A CB    1 
ATOM   2169 C CG    . MET C 2 117 ? 55.258  64.992 109.815 1.00 53.28  ? 117 MET A CG    1 
ATOM   2170 S SD    . MET C 2 117 ? 55.042  64.507 111.534 1.00 42.54  ? 117 MET A SD    1 
ATOM   2171 C CE    . MET C 2 117 ? 56.756  64.699 112.169 1.00 41.08  ? 117 MET A CE    1 
ATOM   2172 N N     . ARG C 2 118 ? 55.137  69.171 108.892 1.00 43.62  ? 118 ARG A N     1 
ATOM   2173 C CA    . ARG C 2 118 ? 55.991  70.199 108.311 1.00 41.07  ? 118 ARG A CA    1 
ATOM   2174 C C     . ARG C 2 118 ? 56.464  71.155 109.399 1.00 38.26  ? 118 ARG A C     1 
ATOM   2175 O O     . ARG C 2 118 ? 57.664  71.372 109.555 1.00 43.56  ? 118 ARG A O     1 
ATOM   2176 C CB    . ARG C 2 118 ? 55.222  70.993 107.244 1.00 55.73  ? 118 ARG A CB    1 
ATOM   2177 C CG    . ARG C 2 118 ? 55.850  71.052 105.833 1.00 54.96  ? 118 ARG A CG    1 
ATOM   2178 C CD    . ARG C 2 118 ? 55.717  72.469 105.209 1.00 53.27  ? 118 ARG A CD    1 
ATOM   2179 N NE    . ARG C 2 118 ? 56.517  72.644 103.992 1.00 55.46  ? 118 ARG A NE    1 
ATOM   2180 C CZ    . ARG C 2 118 ? 56.101  73.297 102.906 1.00 55.38  ? 118 ARG A CZ    1 
ATOM   2181 N NH1   . ARG C 2 118 ? 54.895  73.839 102.874 1.00 54.29  ? 118 ARG A NH1   1 
ATOM   2182 N NH2   . ARG C 2 118 ? 56.887  73.402 101.843 1.00 60.17  ? 118 ARG A NH2   1 
ATOM   2183 N N     . ARG C 2 119 ? 55.526  71.707 110.166 1.00 34.12  ? 119 ARG A N     1 
ATOM   2184 C CA    . ARG C 2 119 ? 55.868  72.652 111.234 1.00 33.47  ? 119 ARG A CA    1 
ATOM   2185 C C     . ARG C 2 119 ? 56.639  72.004 112.383 1.00 32.22  ? 119 ARG A C     1 
ATOM   2186 O O     . ARG C 2 119 ? 57.634  72.551 112.853 1.00 32.68  ? 119 ARG A O     1 
ATOM   2187 C CB    . ARG C 2 119 ? 54.601  73.325 111.772 1.00 30.03  ? 119 ARG A CB    1 
ATOM   2188 C CG    . ARG C 2 119 ? 54.338  73.052 113.238 1.00 38.15  ? 119 ARG A CG    1 
ATOM   2189 C CD    . ARG C 2 119 ? 53.994  74.314 113.995 1.00 50.12  ? 119 ARG A CD    1 
ATOM   2190 N NE    . ARG C 2 119 ? 52.650  74.256 114.564 1.00 60.25  ? 119 ARG A NE    1 
ATOM   2191 C CZ    . ARG C 2 119 ? 52.350  74.559 115.826 1.00 64.25  ? 119 ARG A CZ    1 
ATOM   2192 N NH1   . ARG C 2 119 ? 53.299  74.944 116.671 1.00 64.17  ? 119 ARG A NH1   1 
ATOM   2193 N NH2   . ARG C 2 119 ? 51.092  74.490 116.242 1.00 55.97  ? 119 ARG A NH2   1 
ATOM   2194 N N     . ILE C 2 120 ? 56.180  70.832 112.815 1.00 39.66  ? 120 ILE A N     1 
ATOM   2195 C CA    . ILE C 2 120 ? 56.808  70.082 113.907 1.00 36.84  ? 120 ILE A CA    1 
ATOM   2196 C C     . ILE C 2 120 ? 58.246  69.784 113.538 1.00 33.40  ? 120 ILE A C     1 
ATOM   2197 O O     . ILE C 2 120 ? 59.155  69.951 114.335 1.00 36.77  ? 120 ILE A O     1 
ATOM   2198 C CB    . ILE C 2 120 ? 56.099  68.734 114.155 1.00 34.95  ? 120 ILE A CB    1 
ATOM   2199 C CG1   . ILE C 2 120 ? 54.857  68.950 115.013 1.00 34.90  ? 120 ILE A CG1   1 
ATOM   2200 C CG2   . ILE C 2 120 ? 57.045  67.751 114.847 1.00 40.01  ? 120 ILE A CG2   1 
ATOM   2201 C CD1   . ILE C 2 120 ? 53.765  67.941 114.739 1.00 33.45  ? 120 ILE A CD1   1 
ATOM   2202 N N     . ARG C 2 121 ? 58.437  69.332 112.312 1.00 35.80  ? 121 ARG A N     1 
ATOM   2203 C CA    . ARG C 2 121 ? 59.762  69.023 111.830 1.00 41.57  ? 121 ARG A CA    1 
ATOM   2204 C C     . ARG C 2 121 ? 60.640  70.276 111.929 1.00 48.30  ? 121 ARG A C     1 
ATOM   2205 O O     . ARG C 2 121 ? 61.717  70.232 112.531 1.00 54.76  ? 121 ARG A O     1 
ATOM   2206 C CB    . ARG C 2 121 ? 59.674  68.543 110.387 1.00 48.02  ? 121 ARG A CB    1 
ATOM   2207 C CG    . ARG C 2 121 ? 60.938  68.743 109.594 1.00 67.19  ? 121 ARG A CG    1 
ATOM   2208 C CD    . ARG C 2 121 ? 61.723  67.461 109.542 1.00 87.96  ? 121 ARG A CD    1 
ATOM   2209 N NE    . ARG C 2 121 ? 61.616  66.833 108.230 1.00 100.00 ? 121 ARG A NE    1 
ATOM   2210 C CZ    . ARG C 2 121 ? 60.508  66.286 107.738 1.00 100.00 ? 121 ARG A CZ    1 
ATOM   2211 N NH1   . ARG C 2 121 ? 59.379  66.278 108.440 1.00 100.00 ? 121 ARG A NH1   1 
ATOM   2212 N NH2   . ARG C 2 121 ? 60.538  65.722 106.537 1.00 100.00 ? 121 ARG A NH2   1 
ATOM   2213 N N     . LYS C 2 122 ? 60.177  71.387 111.353 1.00 45.26  ? 122 LYS A N     1 
ATOM   2214 C CA    . LYS C 2 122 ? 60.937  72.635 111.385 1.00 39.70  ? 122 LYS A CA    1 
ATOM   2215 C C     . LYS C 2 122 ? 61.111  73.157 112.807 1.00 39.92  ? 122 LYS A C     1 
ATOM   2216 O O     . LYS C 2 122 ? 62.236  73.324 113.276 1.00 39.65  ? 122 LYS A O     1 
ATOM   2217 C CB    . LYS C 2 122 ? 60.263  73.699 110.497 1.00 52.86  ? 122 LYS A CB    1 
ATOM   2218 C CG    . LYS C 2 122 ? 59.240  74.602 111.185 1.00 57.13  ? 122 LYS A CG    1 
ATOM   2219 C CD    . LYS C 2 122 ? 58.792  75.750 110.280 1.00 58.90  ? 122 LYS A CD    1 
ATOM   2220 C CE    . LYS C 2 122 ? 59.669  76.990 110.450 1.00 62.20  ? 122 LYS A CE    1 
ATOM   2221 N NZ    . LYS C 2 122 ? 58.899  78.272 110.460 1.00 59.53  ? 122 LYS A NZ    1 
ATOM   2222 N N     . GLU C 2 123 ? 59.995  73.394 113.489 1.00 34.78  ? 123 GLU A N     1 
ATOM   2223 C CA    . GLU C 2 123 ? 60.000  73.891 114.857 1.00 35.48  ? 123 GLU A CA    1 
ATOM   2224 C C     . GLU C 2 123 ? 61.067  73.195 115.706 1.00 37.66  ? 123 GLU A C     1 
ATOM   2225 O O     . GLU C 2 123 ? 61.898  73.842 116.349 1.00 40.48  ? 123 GLU A O     1 
ATOM   2226 C CB    . GLU C 2 123 ? 58.633  73.645 115.492 1.00 36.62  ? 123 GLU A CB    1 
ATOM   2227 C CG    . GLU C 2 123 ? 57.506  74.539 114.976 1.00 46.46  ? 123 GLU A CG    1 
ATOM   2228 C CD    . GLU C 2 123 ? 56.416  74.770 116.027 1.00 51.23  ? 123 GLU A CD    1 
ATOM   2229 O OE1   . GLU C 2 123 ? 55.846  75.885 116.068 1.00 47.87  ? 123 GLU A OE1   1 
ATOM   2230 O OE2   . GLU C 2 123 ? 56.132  73.839 116.816 1.00 56.32  ? 123 GLU A OE2   1 
ATOM   2231 N N     . ASN C 2 124 ? 61.032  71.869 115.698 1.00 38.06  ? 124 ASN A N     1 
ATOM   2232 C CA    . ASN C 2 124 ? 61.955  71.069 116.487 1.00 43.72  ? 124 ASN A CA    1 
ATOM   2233 C C     . ASN C 2 124 ? 63.399  71.145 116.055 1.00 47.15  ? 124 ASN A C     1 
ATOM   2234 O O     . ASN C 2 124 ? 64.292  70.772 116.811 1.00 40.67  ? 124 ASN A O     1 
ATOM   2235 C CB    . ASN C 2 124 ? 61.517  69.609 116.487 1.00 42.31  ? 124 ASN A CB    1 
ATOM   2236 C CG    . ASN C 2 124 ? 60.505  69.320 117.564 1.00 55.47  ? 124 ASN A CG    1 
ATOM   2237 O OD1   . ASN C 2 124 ? 59.754  70.213 117.975 1.00 48.72  ? 124 ASN A OD1   1 
ATOM   2238 N ND2   . ASN C 2 124 ? 60.476  68.073 118.038 1.00 57.10  ? 124 ASN A ND2   1 
ATOM   2239 N N     . VAL C 2 125 ? 63.644  71.618 114.844 1.00 51.29  ? 125 VAL A N     1 
ATOM   2240 C CA    . VAL C 2 125 ? 65.022  71.707 114.406 1.00 58.97  ? 125 VAL A CA    1 
ATOM   2241 C C     . VAL C 2 125 ? 65.595  73.063 114.763 1.00 59.73  ? 125 VAL A C     1 
ATOM   2242 O O     . VAL C 2 125 ? 66.758  73.335 114.515 1.00 66.30  ? 125 VAL A O     1 
ATOM   2243 C CB    . VAL C 2 125 ? 65.156  71.479 112.899 1.00 61.98  ? 125 VAL A CB    1 
ATOM   2244 C CG1   . VAL C 2 125 ? 66.621  71.423 112.515 1.00 57.03  ? 125 VAL A CG1   1 
ATOM   2245 C CG2   . VAL C 2 125 ? 64.482  70.174 112.523 1.00 62.80  ? 125 VAL A CG2   1 
ATOM   2246 N N     . ASP C 2 126 ? 64.784  73.911 115.376 1.00 60.98  ? 126 ASP A N     1 
ATOM   2247 C CA    . ASP C 2 126 ? 65.253  75.231 115.746 1.00 57.70  ? 126 ASP A CA    1 
ATOM   2248 C C     . ASP C 2 126 ? 65.358  75.280 117.239 1.00 56.21  ? 126 ASP A C     1 
ATOM   2249 O O     . ASP C 2 126 ? 65.846  76.244 117.812 1.00 59.68  ? 126 ASP A O     1 
ATOM   2250 C CB    . ASP C 2 126 ? 64.269  76.281 115.273 1.00 68.07  ? 126 ASP A CB    1 
ATOM   2251 C CG    . ASP C 2 126 ? 63.854  76.066 113.845 1.00 78.23  ? 126 ASP A CG    1 
ATOM   2252 O OD1   . ASP C 2 126 ? 64.236  75.020 113.277 1.00 88.72  ? 126 ASP A OD1   1 
ATOM   2253 O OD2   . ASP C 2 126 ? 63.154  76.935 113.288 1.00 84.40  ? 126 ASP A OD2   1 
ATOM   2254 N N     . ALA C 2 127 ? 64.907  74.212 117.872 1.00 59.49  ? 127 ALA A N     1 
ATOM   2255 C CA    . ALA C 2 127 ? 64.944  74.149 119.312 1.00 65.18  ? 127 ALA A CA    1 
ATOM   2256 C C     . ALA C 2 127 ? 66.344  73.768 119.744 1.00 67.07  ? 127 ALA A C     1 
ATOM   2257 O O     . ALA C 2 127 ? 66.986  74.476 120.515 1.00 72.38  ? 127 ALA A O     1 
ATOM   2258 C CB    . ALA C 2 127 ? 63.939  73.126 119.809 1.00 71.01  ? 127 ALA A CB    1 
ATOM   2259 N N     . GLY C 2 128 ? 66.821  72.648 119.217 1.00 72.11  ? 128 GLY A N     1 
ATOM   2260 C CA    . GLY C 2 128 ? 68.141  72.162 119.573 1.00 83.90  ? 128 GLY A CA    1 
ATOM   2261 C C     . GLY C 2 128 ? 68.215  70.646 119.450 1.00 89.97  ? 128 GLY A C     1 
ATOM   2262 O O     . GLY C 2 128 ? 69.070  69.990 120.065 1.00 95.90  ? 128 GLY A O     1 
ATOM   2263 N N     . GLU C 2 129 ? 67.301  70.104 118.651 1.00 90.54  ? 129 GLU A N     1 
ATOM   2264 C CA    . GLU C 2 129 ? 67.219  68.663 118.411 1.00 82.53  ? 129 GLU A CA    1 
ATOM   2265 C C     . GLU C 2 129 ? 68.380  68.199 117.524 1.00 71.99  ? 129 GLU A C     1 
ATOM   2266 O O     . GLU C 2 129 ? 68.548  68.703 116.406 1.00 57.91  ? 129 GLU A O     1 
ATOM   2267 C CB    . GLU C 2 129 ? 65.881  68.312 117.730 1.00 84.90  ? 129 GLU A CB    1 
ATOM   2268 C CG    . GLU C 2 129 ? 65.032  67.267 118.468 1.00 71.17  ? 129 GLU A CG    1 
ATOM   2269 C CD    . GLU C 2 129 ? 64.128  66.472 117.529 1.00 67.94  ? 129 GLU A CD    1 
ATOM   2270 O OE1   . GLU C 2 129 ? 64.510  65.346 117.134 1.00 61.02  ? 129 GLU A OE1   1 
ATOM   2271 O OE2   . GLU C 2 129 ? 63.035  66.976 117.184 1.00 69.30  ? 129 GLU A OE2   1 
ATOM   2272 N N     . ARG C 2 130 ? 69.176  67.258 118.026 1.00 61.22  ? 130 ARG A N     1 
ATOM   2273 C CA    . ARG C 2 130 ? 70.290  66.722 117.260 1.00 55.22  ? 130 ARG A CA    1 
ATOM   2274 C C     . ARG C 2 130 ? 70.328  65.196 117.317 1.00 51.23  ? 130 ARG A C     1 
ATOM   2275 O O     . ARG C 2 130 ? 70.300  64.601 118.397 1.00 50.43  ? 130 ARG A O     1 
ATOM   2276 C CB    . ARG C 2 130 ? 71.609  67.292 117.760 1.00 59.52  ? 130 ARG A CB    1 
ATOM   2277 C CG    . ARG C 2 130 ? 72.459  67.882 116.657 1.00 70.17  ? 130 ARG A CG    1 
ATOM   2278 C CD    . ARG C 2 130 ? 73.913  67.607 116.908 1.00 82.43  ? 130 ARG A CD    1 
ATOM   2279 N NE    . ARG C 2 130 ? 74.628  68.727 117.521 1.00 99.47  ? 130 ARG A NE    1 
ATOM   2280 C CZ    . ARG C 2 130 ? 75.925  68.726 117.794 1.00 100.00 ? 130 ARG A CZ    1 
ATOM   2281 N NH1   . ARG C 2 130 ? 76.657  67.655 117.510 1.00 100.00 ? 130 ARG A NH1   1 
ATOM   2282 N NH2   . ARG C 2 130 ? 76.493  69.797 118.351 1.00 100.00 ? 130 ARG A NH2   1 
ATOM   2283 N N     . ALA C 2 131 ? 70.382  64.582 116.139 1.00 47.39  ? 131 ALA A N     1 
ATOM   2284 C CA    . ALA C 2 131 ? 70.413  63.133 116.018 1.00 47.93  ? 131 ALA A CA    1 
ATOM   2285 C C     . ALA C 2 131 ? 71.496  62.598 116.923 1.00 55.54  ? 131 ALA A C     1 
ATOM   2286 O O     . ALA C 2 131 ? 72.545  63.218 117.059 1.00 67.95  ? 131 ALA A O     1 
ATOM   2287 C CB    . ALA C 2 131 ? 70.690  62.741 114.588 1.00 42.77  ? 131 ALA A CB    1 
ATOM   2288 N N     . LYS C 2 132 ? 71.246  61.462 117.558 1.00 59.56  ? 132 LYS A N     1 
ATOM   2289 C CA    . LYS C 2 132 ? 72.247  60.879 118.431 1.00 64.76  ? 132 LYS A CA    1 
ATOM   2290 C C     . LYS C 2 132 ? 73.363  60.291 117.573 1.00 67.18  ? 132 LYS A C     1 
ATOM   2291 O O     . LYS C 2 132 ? 73.278  60.301 116.348 1.00 65.03  ? 132 LYS A O     1 
ATOM   2292 C CB    . LYS C 2 132 ? 71.640  59.804 119.334 1.00 73.63  ? 132 LYS A CB    1 
ATOM   2293 C CG    . LYS C 2 132 ? 70.163  59.506 119.129 1.00 90.99  ? 132 LYS A CG    1 
ATOM   2294 C CD    . LYS C 2 132 ? 69.736  58.268 119.945 1.00 100.00 ? 132 LYS A CD    1 
ATOM   2295 C CE    . LYS C 2 132 ? 69.541  57.003 119.077 1.00 100.00 ? 132 LYS A CE    1 
ATOM   2296 N NZ    . LYS C 2 132 ? 69.330  55.714 119.822 1.00 91.62  ? 132 LYS A NZ    1 
ATOM   2297 N N     . GLN C 2 133 ? 74.396  59.768 118.228 1.00 73.94  ? 133 GLN A N     1 
ATOM   2298 C CA    . GLN C 2 133 ? 75.559  59.212 117.547 1.00 78.29  ? 133 GLN A CA    1 
ATOM   2299 C C     . GLN C 2 133 ? 75.858  57.753 117.847 1.00 74.81  ? 133 GLN A C     1 
ATOM   2300 O O     . GLN C 2 133 ? 75.457  56.855 117.096 1.00 77.55  ? 133 GLN A O     1 
ATOM   2301 C CB    . GLN C 2 133 ? 76.812  60.038 117.863 1.00 85.30  ? 133 GLN A CB    1 
ATOM   2302 C CG    . GLN C 2 133 ? 76.657  61.533 117.617 1.00 89.33  ? 133 GLN A CG    1 
ATOM   2303 C CD    . GLN C 2 133 ? 76.912  61.896 116.185 1.00 99.38  ? 133 GLN A CD    1 
ATOM   2304 O OE1   . GLN C 2 133 ? 76.790  63.058 115.792 1.00 100.00 ? 133 GLN A OE1   1 
ATOM   2305 N NE2   . GLN C 2 133 ? 77.271  60.896 115.384 1.00 100.00 ? 133 GLN A NE2   1 
ATOM   2306 N N     . ALA C 2 134 ? 76.597  57.556 118.942 1.00 61.51  ? 134 ALA A N     1 
ATOM   2307 C CA    . ALA C 2 134 ? 77.043  56.261 119.445 1.00 58.38  ? 134 ALA A CA    1 
ATOM   2308 C C     . ALA C 2 134 ? 78.514  56.449 119.758 1.00 60.47  ? 134 ALA A C     1 
ATOM   2309 O O     . ALA C 2 134 ? 79.347  56.438 118.853 1.00 71.19  ? 134 ALA A O     1 
ATOM   2310 C CB    . ALA C 2 134 ? 76.871  55.154 118.395 1.00 58.00  ? 134 ALA A CB    1 
ATOM   2311 N N     . LEU C 2 135 ? 78.823  56.651 121.034 1.00 54.18  ? 135 LEU A N     1 
ATOM   2312 C CA    . LEU C 2 135 ? 80.198  56.846 121.471 1.00 41.75  ? 135 LEU A CA    1 
ATOM   2313 C C     . LEU C 2 135 ? 81.158  55.929 120.726 1.00 45.26  ? 135 LEU A C     1 
ATOM   2314 O O     . LEU C 2 135 ? 81.032  54.704 120.769 1.00 40.03  ? 135 LEU A O     1 
ATOM   2315 C CB    . LEU C 2 135 ? 80.312  56.597 122.968 1.00 46.77  ? 135 LEU A CB    1 
ATOM   2316 C CG    . LEU C 2 135 ? 81.321  57.508 123.664 1.00 35.33  ? 135 LEU A CG    1 
ATOM   2317 C CD1   . LEU C 2 135 ? 81.181  57.396 125.172 1.00 48.70  ? 135 LEU A CD1   1 
ATOM   2318 C CD2   . LEU C 2 135 ? 82.720  57.116 123.217 1.00 42.35  ? 135 LEU A CD2   1 
ATOM   2319 N N     . ALA C 2 136 ? 82.111  56.538 120.029 1.00 40.42  ? 136 ALA A N     1 
ATOM   2320 C CA    . ALA C 2 136 ? 83.078  55.785 119.260 1.00 33.79  ? 136 ALA A CA    1 
ATOM   2321 C C     . ALA C 2 136 ? 83.934  54.988 120.195 1.00 40.40  ? 136 ALA A C     1 
ATOM   2322 O O     . ALA C 2 136 ? 84.479  55.506 121.164 1.00 45.60  ? 136 ALA A O     1 
ATOM   2323 C CB    . ALA C 2 136 ? 83.948  56.715 118.441 1.00 40.83  ? 136 ALA A CB    1 
ATOM   2324 N N     . PHE C 2 137 ? 84.028  53.705 119.910 1.00 39.85  ? 137 PHE A N     1 
ATOM   2325 C CA    . PHE C 2 137 ? 84.864  52.841 120.707 1.00 38.53  ? 137 PHE A CA    1 
ATOM   2326 C C     . PHE C 2 137 ? 86.138  52.788 119.873 1.00 40.27  ? 137 PHE A C     1 
ATOM   2327 O O     . PHE C 2 137 ? 86.292  51.954 118.983 1.00 34.48  ? 137 PHE A O     1 
ATOM   2328 C CB    . PHE C 2 137 ? 84.217  51.466 120.836 1.00 48.25  ? 137 PHE A CB    1 
ATOM   2329 C CG    . PHE C 2 137 ? 85.065  50.481 121.553 1.00 45.02  ? 137 PHE A CG    1 
ATOM   2330 C CD1   . PHE C 2 137 ? 85.264  50.605 122.911 1.00 51.01  ? 137 PHE A CD1   1 
ATOM   2331 C CD2   . PHE C 2 137 ? 85.741  49.486 120.859 1.00 44.94  ? 137 PHE A CD2   1 
ATOM   2332 C CE1   . PHE C 2 137 ? 86.131  49.765 123.577 1.00 44.59  ? 137 PHE A CE1   1 
ATOM   2333 C CE2   . PHE C 2 137 ? 86.612  48.638 121.514 1.00 48.97  ? 137 PHE A CE2   1 
ATOM   2334 C CZ    . PHE C 2 137 ? 86.810  48.782 122.882 1.00 53.47  ? 137 PHE A CZ    1 
ATOM   2335 N N     . GLU C 2 138 ? 87.042  53.718 120.138 1.00 43.91  ? 138 GLU A N     1 
ATOM   2336 C CA    . GLU C 2 138 ? 88.278  53.798 119.371 1.00 52.47  ? 138 GLU A CA    1 
ATOM   2337 C C     . GLU C 2 138 ? 89.328  52.790 119.748 1.00 50.46  ? 138 GLU A C     1 
ATOM   2338 O O     . GLU C 2 138 ? 89.211  52.120 120.770 1.00 51.60  ? 138 GLU A O     1 
ATOM   2339 C CB    . GLU C 2 138 ? 88.867  55.190 119.500 1.00 61.86  ? 138 GLU A CB    1 
ATOM   2340 C CG    . GLU C 2 138 ? 87.901  56.268 119.130 1.00 60.02  ? 138 GLU A CG    1 
ATOM   2341 C CD    . GLU C 2 138 ? 88.551  57.303 118.272 1.00 65.65  ? 138 GLU A CD    1 
ATOM   2342 O OE1   . GLU C 2 138 ? 89.544  57.905 118.730 1.00 67.53  ? 138 GLU A OE1   1 
ATOM   2343 O OE2   . GLU C 2 138 ? 88.074  57.503 117.138 1.00 71.96  ? 138 GLU A OE2   1 
ATOM   2344 N N     . ARG C 2 139 ? 90.372  52.701 118.932 1.00 51.23  ? 139 ARG A N     1 
ATOM   2345 C CA    . ARG C 2 139 ? 91.422  51.750 119.224 1.00 58.00  ? 139 ARG A CA    1 
ATOM   2346 C C     . ARG C 2 139 ? 92.084  52.046 120.564 1.00 62.67  ? 139 ARG A C     1 
ATOM   2347 O O     . ARG C 2 139 ? 92.343  51.130 121.336 1.00 69.04  ? 139 ARG A O     1 
ATOM   2348 C CB    . ARG C 2 139 ? 92.465  51.743 118.123 1.00 58.61  ? 139 ARG A CB    1 
ATOM   2349 C CG    . ARG C 2 139 ? 93.273  50.476 118.126 1.00 62.09  ? 139 ARG A CG    1 
ATOM   2350 C CD    . ARG C 2 139 ? 94.564  50.678 118.880 1.00 65.17  ? 139 ARG A CD    1 
ATOM   2351 N NE    . ARG C 2 139 ? 95.323  49.439 119.016 1.00 66.97  ? 139 ARG A NE    1 
ATOM   2352 C CZ    . ARG C 2 139 ? 96.467  49.193 118.388 1.00 64.31  ? 139 ARG A CZ    1 
ATOM   2353 N NH1   . ARG C 2 139 ? 96.986  50.104 117.579 1.00 62.40  ? 139 ARG A NH1   1 
ATOM   2354 N NH2   . ARG C 2 139 ? 97.099  48.039 118.584 1.00 60.47  ? 139 ARG A NH2   1 
ATOM   2355 N N     . THR C 2 140 ? 92.365  53.319 120.835 1.00 69.02  ? 140 THR A N     1 
ATOM   2356 C CA    . THR C 2 140 ? 92.975  53.727 122.111 1.00 77.78  ? 140 THR A CA    1 
ATOM   2357 C C     . THR C 2 140 ? 92.171  53.112 123.223 1.00 75.24  ? 140 THR A C     1 
ATOM   2358 O O     . THR C 2 140 ? 92.704  52.602 124.208 1.00 75.51  ? 140 THR A O     1 
ATOM   2359 C CB    . THR C 2 140 ? 92.889  55.230 122.348 1.00 84.61  ? 140 THR A CB    1 
ATOM   2360 O OG1   . THR C 2 140 ? 92.357  55.854 121.185 1.00 87.77  ? 140 THR A OG1   1 
ATOM   2361 C CG2   . THR C 2 140 ? 94.258  55.803 122.668 1.00 95.95  ? 140 THR A CG2   1 
ATOM   2362 N N     . ASP C 2 141 ? 90.863  53.218 123.069 1.00 70.52  ? 141 ASP A N     1 
ATOM   2363 C CA    . ASP C 2 141 ? 89.955  52.655 124.031 1.00 67.12  ? 141 ASP A CA    1 
ATOM   2364 C C     . ASP C 2 141 ? 90.262  51.161 124.109 1.00 65.58  ? 141 ASP A C     1 
ATOM   2365 O O     . ASP C 2 141 ? 90.525  50.628 125.186 1.00 69.38  ? 141 ASP A O     1 
ATOM   2366 C CB    . ASP C 2 141 ? 88.532  52.919 123.559 1.00 62.94  ? 141 ASP A CB    1 
ATOM   2367 C CG    . ASP C 2 141 ? 88.305  54.387 123.258 1.00 68.04  ? 141 ASP A CG    1 
ATOM   2368 O OD1   . ASP C 2 141 ? 88.574  55.207 124.158 1.00 75.22  ? 141 ASP A OD1   1 
ATOM   2369 O OD2   . ASP C 2 141 ? 87.878  54.731 122.136 1.00 61.59  ? 141 ASP A OD2   1 
ATOM   2370 N N     . PHE C 2 142 ? 90.284  50.498 122.958 1.00 60.08  ? 142 PHE A N     1 
ATOM   2371 C CA    . PHE C 2 142 ? 90.557  49.066 122.914 1.00 56.12  ? 142 PHE A CA    1 
ATOM   2372 C C     . PHE C 2 142 ? 91.834  48.588 123.627 1.00 55.09  ? 142 PHE A C     1 
ATOM   2373 O O     . PHE C 2 142 ? 91.799  47.648 124.415 1.00 48.57  ? 142 PHE A O     1 
ATOM   2374 C CB    . PHE C 2 142 ? 90.605  48.589 121.480 1.00 54.26  ? 142 PHE A CB    1 
ATOM   2375 C CG    . PHE C 2 142 ? 90.641  47.124 121.377 1.00 56.25  ? 142 PHE A CG    1 
ATOM   2376 C CD1   . PHE C 2 142 ? 91.850  46.452 121.411 1.00 59.49  ? 142 PHE A CD1   1 
ATOM   2377 C CD2   . PHE C 2 142 ? 89.461  46.400 121.339 1.00 62.75  ? 142 PHE A CD2   1 
ATOM   2378 C CE1   . PHE C 2 142 ? 91.883  45.071 121.416 1.00 61.68  ? 142 PHE A CE1   1 
ATOM   2379 C CE2   . PHE C 2 142 ? 89.478  45.016 121.342 1.00 66.76  ? 142 PHE A CE2   1 
ATOM   2380 C CZ    . PHE C 2 142 ? 90.690  44.347 121.383 1.00 67.78  ? 142 PHE A CZ    1 
ATOM   2381 N N     . ASP C 2 143 ? 92.964  49.206 123.303 1.00 55.05  ? 143 ASP A N     1 
ATOM   2382 C CA    . ASP C 2 143 ? 94.242  48.875 123.930 1.00 63.96  ? 143 ASP A CA    1 
ATOM   2383 C C     . ASP C 2 143 ? 94.137  48.987 125.465 1.00 67.30  ? 143 ASP A C     1 
ATOM   2384 O O     . ASP C 2 143 ? 94.683  48.162 126.203 1.00 68.64  ? 143 ASP A O     1 
ATOM   2385 C CB    . ASP C 2 143 ? 95.327  49.844 123.434 1.00 75.72  ? 143 ASP A CB    1 
ATOM   2386 C CG    . ASP C 2 143 ? 96.148  49.282 122.286 1.00 81.19  ? 143 ASP A CG    1 
ATOM   2387 O OD1   . ASP C 2 143 ? 96.362  48.051 122.251 1.00 91.71  ? 143 ASP A OD1   1 
ATOM   2388 O OD2   . ASP C 2 143 ? 96.581  50.075 121.421 1.00 83.17  ? 143 ASP A OD2   1 
ATOM   2389 N N     . GLN C 2 144 ? 93.457  50.034 125.927 1.00 65.46  ? 144 GLN A N     1 
ATOM   2390 C CA    . GLN C 2 144 ? 93.253  50.295 127.351 1.00 63.44  ? 144 GLN A CA    1 
ATOM   2391 C C     . GLN C 2 144 ? 92.496  49.106 127.926 1.00 60.23  ? 144 GLN A C     1 
ATOM   2392 O O     . GLN C 2 144 ? 92.895  48.516 128.932 1.00 52.46  ? 144 GLN A O     1 
ATOM   2393 C CB    . GLN C 2 144 ? 92.426  51.578 127.513 1.00 76.53  ? 144 GLN A CB    1 
ATOM   2394 C CG    . GLN C 2 144 ? 92.541  52.333 128.847 1.00 89.13  ? 144 GLN A CG    1 
ATOM   2395 C CD    . GLN C 2 144 ? 91.476  53.432 128.981 1.00 98.63  ? 144 GLN A CD    1 
ATOM   2396 O OE1   . GLN C 2 144 ? 90.486  53.266 129.701 1.00 100.00 ? 144 GLN A OE1   1 
ATOM   2397 N NE2   . GLN C 2 144 ? 91.677  54.553 128.280 1.00 95.63  ? 144 GLN A NE2   1 
ATOM   2398 N N     . VAL C 2 145 ? 91.390  48.756 127.281 1.00 57.68  ? 145 VAL A N     1 
ATOM   2399 C CA    . VAL C 2 145 ? 90.614  47.627 127.746 1.00 57.89  ? 145 VAL A CA    1 
ATOM   2400 C C     . VAL C 2 145 ? 91.572  46.449 127.800 1.00 55.38  ? 145 VAL A C     1 
ATOM   2401 O O     . VAL C 2 145 ? 91.811  45.895 128.865 1.00 57.99  ? 145 VAL A O     1 
ATOM   2402 C CB    . VAL C 2 145 ? 89.436  47.300 126.795 1.00 56.29  ? 145 VAL A CB    1 
ATOM   2403 C CG1   . VAL C 2 145 ? 88.986  45.848 126.996 1.00 53.95  ? 145 VAL A CG1   1 
ATOM   2404 C CG2   . VAL C 2 145 ? 88.276  48.240 127.066 1.00 56.31  ? 145 VAL A CG2   1 
ATOM   2405 N N     . ARG C 2 146 ? 92.146  46.099 126.655 1.00 56.41  ? 146 ARG A N     1 
ATOM   2406 C CA    . ARG C 2 146 ? 93.077  44.978 126.585 1.00 63.66  ? 146 ARG A CA    1 
ATOM   2407 C C     . ARG C 2 146 ? 94.040  45.016 127.757 1.00 69.34  ? 146 ARG A C     1 
ATOM   2408 O O     . ARG C 2 146 ? 94.226  44.013 128.435 1.00 76.07  ? 146 ARG A O     1 
ATOM   2409 C CB    . ARG C 2 146 ? 93.869  45.018 125.282 1.00 71.27  ? 146 ARG A CB    1 
ATOM   2410 C CG    . ARG C 2 146 ? 95.165  44.233 125.326 1.00 73.33  ? 146 ARG A CG    1 
ATOM   2411 C CD    . ARG C 2 146 ? 96.013  44.540 124.111 1.00 84.94  ? 146 ARG A CD    1 
ATOM   2412 N NE    . ARG C 2 146 ? 95.709  43.646 122.997 1.00 93.51  ? 146 ARG A NE    1 
ATOM   2413 C CZ    . ARG C 2 146 ? 96.621  42.926 122.349 1.00 99.71  ? 146 ARG A CZ    1 
ATOM   2414 N NH1   . ARG C 2 146 ? 97.899  42.996 122.708 1.00 100.00 ? 146 ARG A NH1   1 
ATOM   2415 N NH2   . ARG C 2 146 ? 96.258  42.131 121.352 1.00 92.90  ? 146 ARG A NH2   1 
ATOM   2416 N N     . SER C 2 147 ? 94.642  46.178 127.992 1.00 71.42  ? 147 SER A N     1 
ATOM   2417 C CA    . SER C 2 147 ? 95.586  46.362 129.091 1.00 70.30  ? 147 SER A CA    1 
ATOM   2418 C C     . SER C 2 147 ? 95.117  45.859 130.474 1.00 72.02  ? 147 SER A C     1 
ATOM   2419 O O     . SER C 2 147 ? 95.943  45.424 131.279 1.00 78.87  ? 147 SER A O     1 
ATOM   2420 C CB    . SER C 2 147 ? 95.978  47.838 129.191 1.00 61.07  ? 147 SER A CB    1 
ATOM   2421 O OG    . SER C 2 147 ? 96.001  48.256 130.543 1.00 64.31  ? 147 SER A OG    1 
ATOM   2422 N N     . LEU C 2 148 ? 93.815  45.910 130.760 1.00 71.94  ? 148 LEU A N     1 
ATOM   2423 C CA    . LEU C 2 148 ? 93.304  45.442 132.062 1.00 69.21  ? 148 LEU A CA    1 
ATOM   2424 C C     . LEU C 2 148 ? 92.765  43.992 132.062 1.00 66.62  ? 148 LEU A C     1 
ATOM   2425 O O     . LEU C 2 148 ? 93.203  43.157 132.862 1.00 60.72  ? 148 LEU A O     1 
ATOM   2426 C CB    . LEU C 2 148 ? 92.221  46.406 132.591 1.00 66.71  ? 148 LEU A CB    1 
ATOM   2427 C CG    . LEU C 2 148 ? 92.623  47.821 133.044 1.00 58.82  ? 148 LEU A CG    1 
ATOM   2428 C CD1   . LEU C 2 148 ? 92.762  48.724 131.826 1.00 62.75  ? 148 LEU A CD1   1 
ATOM   2429 C CD2   . LEU C 2 148 ? 91.582  48.385 134.007 1.00 55.95  ? 148 LEU A CD2   1 
ATOM   2430 N N     . MET C 2 149 ? 91.816  43.685 131.183 1.00 68.85  ? 149 MET A N     1 
ATOM   2431 C CA    . MET C 2 149 ? 91.280  42.328 131.122 1.00 78.73  ? 149 MET A CA    1 
ATOM   2432 C C     . MET C 2 149 ? 92.380  41.386 130.616 1.00 78.02  ? 149 MET A C     1 
ATOM   2433 O O     . MET C 2 149 ? 92.276  40.170 130.721 1.00 77.35  ? 149 MET A O     1 
ATOM   2434 C CB    . MET C 2 149 ? 90.060  42.272 130.187 1.00 84.39  ? 149 MET A CB    1 
ATOM   2435 C CG    . MET C 2 149 ? 88.970  43.323 130.462 1.00 83.53  ? 149 MET A CG    1 
ATOM   2436 S SD    . MET C 2 149 ? 87.564  43.224 129.297 1.00 93.83  ? 149 MET A SD    1 
ATOM   2437 C CE    . MET C 2 149 ? 86.123  43.044 130.388 1.00 71.83  ? 149 MET A CE    1 
ATOM   2438 N N     . GLU C 2 150 ? 93.442  41.978 130.086 1.00 80.19  ? 150 GLU A N     1 
ATOM   2439 C CA    . GLU C 2 150 ? 94.588  41.251 129.547 1.00 81.06  ? 150 GLU A CA    1 
ATOM   2440 C C     . GLU C 2 150 ? 94.975  40.035 130.368 1.00 79.61  ? 150 GLU A C     1 
ATOM   2441 O O     . GLU C 2 150 ? 94.773  38.895 129.978 1.00 78.56  ? 150 GLU A O     1 
ATOM   2442 C CB    . GLU C 2 150 ? 95.805  42.179 129.495 1.00 88.81  ? 150 GLU A CB    1 
ATOM   2443 C CG    . GLU C 2 150 ? 96.592  42.174 128.192 1.00 95.93  ? 150 GLU A CG    1 
ATOM   2444 C CD    . GLU C 2 150 ? 97.742  43.174 128.218 1.00 98.82  ? 150 GLU A CD    1 
ATOM   2445 O OE1   . GLU C 2 150 ? 98.469  43.206 129.237 1.00 90.36  ? 150 GLU A OE1   1 
ATOM   2446 O OE2   . GLU C 2 150 ? 97.914  43.928 127.231 1.00 100.00 ? 150 GLU A OE2   1 
ATOM   2447 N N     . ASN C 2 151 ? 95.544  40.311 131.526 1.00 76.00  ? 151 ASN A N     1 
ATOM   2448 C CA    . ASN C 2 151 ? 96.036  39.278 132.407 1.00 80.99  ? 151 ASN A CA    1 
ATOM   2449 C C     . ASN C 2 151 ? 94.964  38.717 133.327 1.00 82.80  ? 151 ASN A C     1 
ATOM   2450 O O     . ASN C 2 151 ? 95.203  37.735 134.027 1.00 82.49  ? 151 ASN A O     1 
ATOM   2451 C CB    . ASN C 2 151 ? 97.185  39.876 133.206 1.00 85.95  ? 151 ASN A CB    1 
ATOM   2452 C CG    . ASN C 2 151 ? 97.615  41.224 132.652 1.00 83.04  ? 151 ASN A CG    1 
ATOM   2453 O OD1   . ASN C 2 151 ? 96.940  42.236 132.849 1.00 78.07  ? 151 ASN A OD1   1 
ATOM   2454 N ND2   . ASN C 2 151 ? 98.727  41.238 131.933 1.00 82.37  ? 151 ASN A ND2   1 
ATOM   2455 N N     . SER C 2 152 ? 93.786  39.334 133.333 1.00 81.80  ? 152 SER A N     1 
ATOM   2456 C CA    . SER C 2 152 ? 92.722  38.848 134.193 1.00 78.28  ? 152 SER A CA    1 
ATOM   2457 C C     . SER C 2 152 ? 92.362  37.464 133.706 1.00 75.67  ? 152 SER A C     1 
ATOM   2458 O O     . SER C 2 152 ? 92.336  37.219 132.505 1.00 74.27  ? 152 SER A O     1 
ATOM   2459 C CB    . SER C 2 152 ? 91.502  39.748 134.114 1.00 78.36  ? 152 SER A CB    1 
ATOM   2460 O OG    . SER C 2 152 ? 90.414  39.139 134.782 1.00 84.41  ? 152 SER A OG    1 
ATOM   2461 N N     . ASP C 2 153 ? 92.091  36.558 134.637 1.00 76.95  ? 153 ASP A N     1 
ATOM   2462 C CA    . ASP C 2 153 ? 91.762  35.182 134.284 1.00 77.52  ? 153 ASP A CA    1 
ATOM   2463 C C     . ASP C 2 153 ? 90.292  34.831 134.432 1.00 69.65  ? 153 ASP A C     1 
ATOM   2464 O O     . ASP C 2 153 ? 89.911  33.678 134.262 1.00 67.49  ? 153 ASP A O     1 
ATOM   2465 C CB    . ASP C 2 153 ? 92.601  34.213 135.124 1.00 89.00  ? 153 ASP A CB    1 
ATOM   2466 C CG    . ASP C 2 153 ? 93.939  33.886 134.478 1.00 97.56  ? 153 ASP A CG    1 
ATOM   2467 O OD1   . ASP C 2 153 ? 94.986  34.078 135.136 1.00 100.00 ? 153 ASP A OD1   1 
ATOM   2468 O OD2   . ASP C 2 153 ? 93.941  33.436 133.310 1.00 100.00 ? 153 ASP A OD2   1 
ATOM   2469 N N     . ARG C 2 154 ? 89.468  35.825 134.746 1.00 64.66  ? 154 ARG A N     1 
ATOM   2470 C CA    . ARG C 2 154 ? 88.032  35.606 134.913 1.00 55.48  ? 154 ARG A CA    1 
ATOM   2471 C C     . ARG C 2 154 ? 87.344  35.307 133.592 1.00 50.91  ? 154 ARG A C     1 
ATOM   2472 O O     . ARG C 2 154 ? 87.330  36.143 132.685 1.00 51.62  ? 154 ARG A O     1 
ATOM   2473 C CB    . ARG C 2 154 ? 87.379  36.826 135.550 1.00 55.99  ? 154 ARG A CB    1 
ATOM   2474 C CG    . ARG C 2 154 ? 87.930  37.161 136.910 1.00 51.41  ? 154 ARG A CG    1 
ATOM   2475 C CD    . ARG C 2 154 ? 87.558  38.556 137.299 1.00 53.67  ? 154 ARG A CD    1 
ATOM   2476 N NE    . ARG C 2 154 ? 86.256  38.945 136.762 1.00 68.57  ? 154 ARG A NE    1 
ATOM   2477 C CZ    . ARG C 2 154 ? 85.545  39.969 137.218 1.00 81.88  ? 154 ARG A CZ    1 
ATOM   2478 N NH1   . ARG C 2 154 ? 86.016  40.705 138.222 1.00 99.71  ? 154 ARG A NH1   1 
ATOM   2479 N NH2   . ARG C 2 154 ? 84.376  40.268 136.665 1.00 79.30  ? 154 ARG A NH2   1 
ATOM   2480 N N     . CYS C 2 155 ? 86.767  34.111 133.508 1.00 45.64  ? 155 CYS A N     1 
ATOM   2481 C CA    . CYS C 2 155 ? 86.078  33.617 132.316 1.00 48.38  ? 155 CYS A CA    1 
ATOM   2482 C C     . CYS C 2 155 ? 85.344  34.689 131.496 1.00 49.44  ? 155 CYS A C     1 
ATOM   2483 O O     . CYS C 2 155 ? 85.696  34.979 130.354 1.00 45.11  ? 155 CYS A O     1 
ATOM   2484 C CB    . CYS C 2 155 ? 85.112  32.506 132.733 1.00 45.71  ? 155 CYS A CB    1 
ATOM   2485 S SG    . CYS C 2 155 ? 83.765  32.252 131.586 1.00 69.37  ? 155 CYS A SG    1 
ATOM   2486 N N     . GLN C 2 156 ? 84.313  35.261 132.096 1.00 49.67  ? 156 GLN A N     1 
ATOM   2487 C CA    . GLN C 2 156 ? 83.519  36.304 131.473 1.00 46.42  ? 156 GLN A CA    1 
ATOM   2488 C C     . GLN C 2 156 ? 84.425  37.468 131.098 1.00 44.98  ? 156 GLN A C     1 
ATOM   2489 O O     . GLN C 2 156 ? 84.265  38.082 130.049 1.00 46.03  ? 156 GLN A O     1 
ATOM   2490 C CB    . GLN C 2 156 ? 82.462  36.793 132.461 1.00 51.35  ? 156 GLN A CB    1 
ATOM   2491 C CG    . GLN C 2 156 ? 83.002  37.798 133.479 1.00 54.85  ? 156 GLN A CG    1 
ATOM   2492 C CD    . GLN C 2 156 ? 83.171  37.228 134.878 1.00 60.45  ? 156 GLN A CD    1 
ATOM   2493 O OE1   . GLN C 2 156 ? 82.838  37.886 135.860 1.00 61.48  ? 156 GLN A OE1   1 
ATOM   2494 N NE2   . GLN C 2 156 ? 83.701  36.011 134.977 1.00 57.28  ? 156 GLN A NE2   1 
ATOM   2495 N N     . ASP C 2 157 ? 85.364  37.789 131.980 1.00 45.89  ? 157 ASP A N     1 
ATOM   2496 C CA    . ASP C 2 157 ? 86.277  38.884 131.721 1.00 43.37  ? 157 ASP A CA    1 
ATOM   2497 C C     . ASP C 2 157 ? 86.888  38.643 130.367 1.00 46.47  ? 157 ASP A C     1 
ATOM   2498 O O     . ASP C 2 157 ? 86.956  39.527 129.507 1.00 47.36  ? 157 ASP A O     1 
ATOM   2499 C CB    . ASP C 2 157 ? 87.380  38.918 132.774 1.00 44.85  ? 157 ASP A CB    1 
ATOM   2500 C CG    . ASP C 2 157 ? 87.680  40.320 133.242 1.00 55.67  ? 157 ASP A CG    1 
ATOM   2501 O OD1   . ASP C 2 157 ? 86.721  41.097 133.412 1.00 61.41  ? 157 ASP A OD1   1 
ATOM   2502 O OD2   . ASP C 2 157 ? 88.864  40.658 133.431 1.00 63.95  ? 157 ASP A OD2   1 
ATOM   2503 N N     . ILE C 2 158 ? 87.301  37.401 130.184 1.00 47.59  ? 158 ILE A N     1 
ATOM   2504 C CA    . ILE C 2 158 ? 87.941  36.980 128.956 1.00 48.80  ? 158 ILE A CA    1 
ATOM   2505 C C     . ILE C 2 158 ? 86.966  37.123 127.805 1.00 41.18  ? 158 ILE A C     1 
ATOM   2506 O O     . ILE C 2 158 ? 87.192  37.872 126.871 1.00 44.50  ? 158 ILE A O     1 
ATOM   2507 C CB    . ILE C 2 158 ? 88.429  35.519 129.082 1.00 52.23  ? 158 ILE A CB    1 
ATOM   2508 C CG1   . ILE C 2 158 ? 89.823  35.504 129.715 1.00 58.58  ? 158 ILE A CG1   1 
ATOM   2509 C CG2   . ILE C 2 158 ? 88.456  34.845 127.723 1.00 49.22  ? 158 ILE A CG2   1 
ATOM   2510 C CD1   . ILE C 2 158 ? 89.983  34.508 130.841 1.00 61.66  ? 158 ILE A CD1   1 
ATOM   2511 N N     . ARG C 2 159 ? 85.862  36.408 127.894 1.00 40.06  ? 159 ARG A N     1 
ATOM   2512 C CA    . ARG C 2 159 ? 84.858  36.486 126.860 1.00 33.03  ? 159 ARG A CA    1 
ATOM   2513 C C     . ARG C 2 159 ? 84.664  37.923 126.438 1.00 33.43  ? 159 ARG A C     1 
ATOM   2514 O O     . ARG C 2 159 ? 84.636  38.224 125.260 1.00 45.69  ? 159 ARG A O     1 
ATOM   2515 C CB    . ARG C 2 159 ? 83.539  35.964 127.385 1.00 34.31  ? 159 ARG A CB    1 
ATOM   2516 C CG    . ARG C 2 159 ? 82.518  35.802 126.321 1.00 31.67  ? 159 ARG A CG    1 
ATOM   2517 C CD    . ARG C 2 159 ? 81.193  35.655 126.958 1.00 31.88  ? 159 ARG A CD    1 
ATOM   2518 N NE    . ARG C 2 159 ? 80.924  36.792 127.820 1.00 41.49  ? 159 ARG A NE    1 
ATOM   2519 C CZ    . ARG C 2 159 ? 79.758  36.981 128.406 1.00 45.74  ? 159 ARG A CZ    1 
ATOM   2520 N NH1   . ARG C 2 159 ? 78.798  36.087 128.196 1.00 41.04  ? 159 ARG A NH1   1 
ATOM   2521 N NH2   . ARG C 2 159 ? 79.557  38.051 129.170 1.00 42.73  ? 159 ARG A NH2   1 
ATOM   2522 N N     . ASN C 2 160 ? 84.542  38.818 127.406 1.00 39.75  ? 160 ASN A N     1 
ATOM   2523 C CA    . ASN C 2 160 ? 84.321  40.222 127.107 1.00 45.17  ? 160 ASN A CA    1 
ATOM   2524 C C     . ASN C 2 160 ? 85.395  40.864 126.232 1.00 47.38  ? 160 ASN A C     1 
ATOM   2525 O O     . ASN C 2 160 ? 85.086  41.706 125.385 1.00 47.06  ? 160 ASN A O     1 
ATOM   2526 C CB    . ASN C 2 160 ? 84.143  40.986 128.416 1.00 41.44  ? 160 ASN A CB    1 
ATOM   2527 C CG    . ASN C 2 160 ? 82.850  40.640 129.084 1.00 41.78  ? 160 ASN A CG    1 
ATOM   2528 O OD1   . ASN C 2 160 ? 82.293  41.432 129.843 1.00 65.11  ? 160 ASN A OD1   1 
ATOM   2529 N ND2   . ASN C 2 160 ? 82.348  39.442 128.794 1.00 30.53  ? 160 ASN A ND2   1 
ATOM   2530 N N     . LEU C 2 161 ? 86.647  40.462 126.435 1.00 53.66  ? 161 LEU A N     1 
ATOM   2531 C CA    . LEU C 2 161 ? 87.776  40.982 125.657 1.00 56.87  ? 161 LEU A CA    1 
ATOM   2532 C C     . LEU C 2 161 ? 87.721  40.474 124.205 1.00 58.95  ? 161 LEU A C     1 
ATOM   2533 O O     . LEU C 2 161 ? 88.026  41.209 123.259 1.00 62.72  ? 161 LEU A O     1 
ATOM   2534 C CB    . LEU C 2 161 ? 89.095  40.543 126.306 1.00 59.93  ? 161 LEU A CB    1 
ATOM   2535 C CG    . LEU C 2 161 ? 90.136  41.617 126.650 1.00 70.53  ? 161 LEU A CG    1 
ATOM   2536 C CD1   . LEU C 2 161 ? 91.348  40.992 127.344 1.00 66.31  ? 161 LEU A CD1   1 
ATOM   2537 C CD2   . LEU C 2 161 ? 90.558  42.328 125.371 1.00 69.53  ? 161 LEU A CD2   1 
ATOM   2538 N N     . ALA C 2 162 ? 87.326  39.212 124.040 1.00 55.80  ? 162 ALA A N     1 
ATOM   2539 C CA    . ALA C 2 162 ? 87.216  38.590 122.718 1.00 54.44  ? 162 ALA A CA    1 
ATOM   2540 C C     . ALA C 2 162 ? 86.095  39.235 121.932 1.00 50.45  ? 162 ALA A C     1 
ATOM   2541 O O     . ALA C 2 162 ? 86.237  39.551 120.756 1.00 54.89  ? 162 ALA A O     1 
ATOM   2542 C CB    . ALA C 2 162 ? 86.943  37.087 122.859 1.00 58.38  ? 162 ALA A CB    1 
ATOM   2543 N N     . PHE C 2 163 ? 84.967  39.415 122.598 1.00 46.02  ? 163 PHE A N     1 
ATOM   2544 C CA    . PHE C 2 163 ? 83.824  40.021 121.957 1.00 45.67  ? 163 PHE A CA    1 
ATOM   2545 C C     . PHE C 2 163 ? 84.203  41.375 121.409 1.00 45.22  ? 163 PHE A C     1 
ATOM   2546 O O     . PHE C 2 163 ? 84.044  41.653 120.224 1.00 55.48  ? 163 PHE A O     1 
ATOM   2547 C CB    . PHE C 2 163 ? 82.702  40.198 122.951 1.00 41.05  ? 163 PHE A CB    1 
ATOM   2548 C CG    . PHE C 2 163 ? 81.670  41.170 122.502 1.00 46.80  ? 163 PHE A CG    1 
ATOM   2549 C CD1   . PHE C 2 163 ? 80.610  40.752 121.697 1.00 47.35  ? 163 PHE A CD1   1 
ATOM   2550 C CD2   . PHE C 2 163 ? 81.733  42.496 122.901 1.00 54.64  ? 163 PHE A CD2   1 
ATOM   2551 C CE1   . PHE C 2 163 ? 79.612  41.638 121.294 1.00 42.66  ? 163 PHE A CE1   1 
ATOM   2552 C CE2   . PHE C 2 163 ? 80.739  43.398 122.503 1.00 64.89  ? 163 PHE A CE2   1 
ATOM   2553 C CZ    . PHE C 2 163 ? 79.670  42.962 121.696 1.00 54.90  ? 163 PHE A CZ    1 
ATOM   2554 N N     . LEU C 2 164 ? 84.697  42.227 122.293 1.00 48.34  ? 164 LEU A N     1 
ATOM   2555 C CA    . LEU C 2 164 ? 85.091  43.562 121.894 1.00 51.52  ? 164 LEU A CA    1 
ATOM   2556 C C     . LEU C 2 164 ? 86.116  43.457 120.778 1.00 52.30  ? 164 LEU A C     1 
ATOM   2557 O O     . LEU C 2 164 ? 86.246  44.358 119.947 1.00 55.19  ? 164 LEU A O     1 
ATOM   2558 C CB    . LEU C 2 164 ? 85.648  44.326 123.104 1.00 48.90  ? 164 LEU A CB    1 
ATOM   2559 C CG    . LEU C 2 164 ? 84.574  44.692 124.145 1.00 48.13  ? 164 LEU A CG    1 
ATOM   2560 C CD1   . LEU C 2 164 ? 85.224  45.291 125.383 1.00 49.42  ? 164 LEU A CD1   1 
ATOM   2561 C CD2   . LEU C 2 164 ? 83.581  45.681 123.538 1.00 29.34  ? 164 LEU A CD2   1 
ATOM   2562 N N     . GLY C 2 165 ? 86.826  42.333 120.745 1.00 56.60  ? 165 GLY A N     1 
ATOM   2563 C CA    . GLY C 2 165 ? 87.828  42.118 119.709 1.00 60.95  ? 165 GLY A CA    1 
ATOM   2564 C C     . GLY C 2 165 ? 87.222  41.963 118.326 1.00 52.47  ? 165 GLY A C     1 
ATOM   2565 O O     . GLY C 2 165 ? 87.584  42.669 117.400 1.00 50.44  ? 165 GLY A O     1 
ATOM   2566 N N     . ILE C 2 166 ? 86.294  41.031 118.183 1.00 50.01  ? 166 ILE A N     1 
ATOM   2567 C CA    . ILE C 2 166 ? 85.642  40.827 116.905 1.00 50.62  ? 166 ILE A CA    1 
ATOM   2568 C C     . ILE C 2 166 ? 84.777  42.036 116.572 1.00 57.35  ? 166 ILE A C     1 
ATOM   2569 O O     . ILE C 2 166 ? 84.779  42.515 115.440 1.00 66.09  ? 166 ILE A O     1 
ATOM   2570 C CB    . ILE C 2 166 ? 84.746  39.567 116.916 1.00 43.56  ? 166 ILE A CB    1 
ATOM   2571 C CG1   . ILE C 2 166 ? 83.338  39.929 117.385 1.00 41.20  ? 166 ILE A CG1   1 
ATOM   2572 C CG2   . ILE C 2 166 ? 85.327  38.515 117.836 1.00 50.86  ? 166 ILE A CG2   1 
ATOM   2573 C CD1   . ILE C 2 166 ? 82.255  39.198 116.646 1.00 45.24  ? 166 ILE A CD1   1 
ATOM   2574 N N     . ALA C 2 167 ? 84.049  42.538 117.562 1.00 51.85  ? 167 ALA A N     1 
ATOM   2575 C CA    . ALA C 2 167 ? 83.178  43.669 117.321 1.00 45.81  ? 167 ALA A CA    1 
ATOM   2576 C C     . ALA C 2 167 ? 83.973  44.763 116.629 1.00 47.89  ? 167 ALA A C     1 
ATOM   2577 O O     . ALA C 2 167 ? 83.561  45.256 115.579 1.00 46.78  ? 167 ALA A O     1 
ATOM   2578 C CB    . ALA C 2 167 ? 82.597  44.171 118.626 1.00 34.95  ? 167 ALA A CB    1 
ATOM   2579 N N     . TYR C 2 168 ? 85.133  45.103 117.195 1.00 54.29  ? 168 TYR A N     1 
ATOM   2580 C CA    . TYR C 2 168 ? 86.007  46.156 116.655 1.00 64.86  ? 168 TYR A CA    1 
ATOM   2581 C C     . TYR C 2 168 ? 86.802  45.722 115.434 1.00 66.51  ? 168 TYR A C     1 
ATOM   2582 O O     . TYR C 2 168 ? 87.056  46.510 114.533 1.00 68.39  ? 168 TYR A O     1 
ATOM   2583 C CB    . TYR C 2 168 ? 87.003  46.628 117.727 1.00 68.89  ? 168 TYR A CB    1 
ATOM   2584 C CG    . TYR C 2 168 ? 87.986  47.717 117.282 1.00 76.25  ? 168 TYR A CG    1 
ATOM   2585 C CD1   . TYR C 2 168 ? 87.669  49.074 117.421 1.00 82.98  ? 168 TYR A CD1   1 
ATOM   2586 C CD2   . TYR C 2 168 ? 89.247  47.393 116.773 1.00 77.55  ? 168 TYR A CD2   1 
ATOM   2587 C CE1   . TYR C 2 168 ? 88.584  50.084 117.071 1.00 78.36  ? 168 TYR A CE1   1 
ATOM   2588 C CE2   . TYR C 2 168 ? 90.171  48.400 116.419 1.00 75.09  ? 168 TYR A CE2   1 
ATOM   2589 C CZ    . TYR C 2 168 ? 89.827  49.740 116.576 1.00 76.13  ? 168 TYR A CZ    1 
ATOM   2590 O OH    . TYR C 2 168 ? 90.718  50.741 116.254 1.00 64.79  ? 168 TYR A OH    1 
ATOM   2591 N N     . ASN C 2 169 ? 87.208  44.462 115.424 1.00 74.70  ? 169 ASN A N     1 
ATOM   2592 C CA    . ASN C 2 169 ? 87.996  43.905 114.334 1.00 76.73  ? 169 ASN A CA    1 
ATOM   2593 C C     . ASN C 2 169 ? 87.139  43.448 113.151 1.00 80.87  ? 169 ASN A C     1 
ATOM   2594 O O     . ASN C 2 169 ? 87.650  42.899 112.179 1.00 81.04  ? 169 ASN A O     1 
ATOM   2595 C CB    . ASN C 2 169 ? 88.802  42.726 114.869 1.00 73.44  ? 169 ASN A CB    1 
ATOM   2596 C CG    . ASN C 2 169 ? 90.032  42.437 114.048 1.00 67.32  ? 169 ASN A CG    1 
ATOM   2597 O OD1   . ASN C 2 169 ? 90.186  41.336 113.521 1.00 74.62  ? 169 ASN A OD1   1 
ATOM   2598 N ND2   . ASN C 2 169 ? 90.924  43.417 113.942 1.00 49.04  ? 169 ASN A ND2   1 
ATOM   2599 N N     . THR C 2 170 ? 85.837  43.686 113.222 1.00 78.15  ? 170 THR A N     1 
ATOM   2600 C CA    . THR C 2 170 ? 84.963  43.252 112.149 1.00 75.78  ? 170 THR A CA    1 
ATOM   2601 C C     . THR C 2 170 ? 83.922  44.285 111.785 1.00 73.29  ? 170 THR A C     1 
ATOM   2602 O O     . THR C 2 170 ? 83.243  44.164 110.764 1.00 72.10  ? 170 THR A O     1 
ATOM   2603 C CB    . THR C 2 170 ? 84.239  41.957 112.546 1.00 81.29  ? 170 THR A CB    1 
ATOM   2604 O OG1   . THR C 2 170 ? 83.257  42.243 113.557 1.00 79.07  ? 170 THR A OG1   1 
ATOM   2605 C CG2   . THR C 2 170 ? 85.250  40.929 113.067 1.00 75.09  ? 170 THR A CG2   1 
ATOM   2606 N N     . LEU C 2 171 ? 83.788  45.300 112.627 1.00 70.74  ? 171 LEU A N     1 
ATOM   2607 C CA    . LEU C 2 171 ? 82.808  46.343 112.375 1.00 69.76  ? 171 LEU A CA    1 
ATOM   2608 C C     . LEU C 2 171 ? 81.500  45.655 112.032 1.00 68.90  ? 171 LEU A C     1 
ATOM   2609 O O     . LEU C 2 171 ? 80.711  46.139 111.224 1.00 67.69  ? 171 LEU A O     1 
ATOM   2610 C CB    . LEU C 2 171 ? 83.243  47.222 111.204 1.00 62.79  ? 171 LEU A CB    1 
ATOM   2611 C CG    . LEU C 2 171 ? 84.641  47.829 111.283 1.00 54.64  ? 171 LEU A CG    1 
ATOM   2612 C CD1   . LEU C 2 171 ? 85.686  46.788 110.903 1.00 59.44  ? 171 LEU A CD1   1 
ATOM   2613 C CD2   . LEU C 2 171 ? 84.707  49.020 110.347 1.00 60.16  ? 171 LEU A CD2   1 
ATOM   2614 N N     . LEU C 2 172 ? 81.291  44.498 112.637 1.00 69.92  ? 172 LEU A N     1 
ATOM   2615 C CA    . LEU C 2 172 ? 80.076  43.760 112.391 1.00 72.75  ? 172 LEU A CA    1 
ATOM   2616 C C     . LEU C 2 172 ? 79.063  44.162 113.419 1.00 70.29  ? 172 LEU A C     1 
ATOM   2617 O O     . LEU C 2 172 ? 79.395  44.320 114.592 1.00 73.97  ? 172 LEU A O     1 
ATOM   2618 C CB    . LEU C 2 172 ? 80.336  42.268 112.494 1.00 81.86  ? 172 LEU A CB    1 
ATOM   2619 C CG    . LEU C 2 172 ? 81.329  41.774 111.448 1.00 90.14  ? 172 LEU A CG    1 
ATOM   2620 C CD1   . LEU C 2 172 ? 81.289  40.267 111.434 1.00 91.44  ? 172 LEU A CD1   1 
ATOM   2621 C CD2   . LEU C 2 172 ? 81.000  42.344 110.065 1.00 97.19  ? 172 LEU A CD2   1 
ATOM   2622 N N     . ARG C 2 173 ? 77.825  44.331 112.979 1.00 69.60  ? 173 ARG A N     1 
ATOM   2623 C CA    . ARG C 2 173 ? 76.768  44.703 113.898 1.00 74.42  ? 173 ARG A CA    1 
ATOM   2624 C C     . ARG C 2 173 ? 76.709  43.559 114.892 1.00 73.72  ? 173 ARG A C     1 
ATOM   2625 O O     . ARG C 2 173 ? 77.139  42.446 114.589 1.00 78.01  ? 173 ARG A O     1 
ATOM   2626 C CB    . ARG C 2 173 ? 75.441  44.857 113.153 1.00 82.04  ? 173 ARG A CB    1 
ATOM   2627 C CG    . ARG C 2 173 ? 75.611  45.205 111.677 1.00 91.20  ? 173 ARG A CG    1 
ATOM   2628 C CD    . ARG C 2 173 ? 75.072  46.599 111.334 1.00 98.42  ? 173 ARG A CD    1 
ATOM   2629 N NE    . ARG C 2 173 ? 74.755  46.727 109.909 1.00 100.00 ? 173 ARG A NE    1 
ATOM   2630 C CZ    . ARG C 2 173 ? 74.815  47.863 109.217 1.00 100.00 ? 173 ARG A CZ    1 
ATOM   2631 N NH1   . ARG C 2 173 ? 75.181  48.984 109.820 1.00 96.30  ? 173 ARG A NH1   1 
ATOM   2632 N NH2   . ARG C 2 173 ? 74.526  47.868 107.917 1.00 100.00 ? 173 ARG A NH2   1 
ATOM   2633 N N     . ILE C 2 174 ? 76.198  43.835 116.083 1.00 72.67  ? 174 ILE A N     1 
ATOM   2634 C CA    . ILE C 2 174 ? 76.117  42.817 117.126 1.00 67.87  ? 174 ILE A CA    1 
ATOM   2635 C C     . ILE C 2 174 ? 75.428  41.523 116.704 1.00 66.85  ? 174 ILE A C     1 
ATOM   2636 O O     . ILE C 2 174 ? 76.018  40.442 116.796 1.00 58.42  ? 174 ILE A O     1 
ATOM   2637 C CB    . ILE C 2 174 ? 75.380  43.348 118.381 1.00 60.73  ? 174 ILE A CB    1 
ATOM   2638 C CG1   . ILE C 2 174 ? 74.057  43.985 117.964 1.00 57.07  ? 174 ILE A CG1   1 
ATOM   2639 C CG2   . ILE C 2 174 ? 76.263  44.348 119.141 1.00 53.62  ? 174 ILE A CG2   1 
ATOM   2640 C CD1   . ILE C 2 174 ? 73.179  44.419 119.132 1.00 48.72  ? 174 ILE A CD1   1 
ATOM   2641 N N     . ALA C 2 175 ? 74.181  41.643 116.253 1.00 63.78  ? 175 ALA A N     1 
ATOM   2642 C CA    . ALA C 2 175 ? 73.391  40.487 115.847 1.00 63.47  ? 175 ALA A CA    1 
ATOM   2643 C C     . ALA C 2 175 ? 74.273  39.451 115.173 1.00 61.31  ? 175 ALA A C     1 
ATOM   2644 O O     . ALA C 2 175 ? 74.383  38.321 115.630 1.00 58.08  ? 175 ALA A O     1 
ATOM   2645 C CB    . ALA C 2 175 ? 72.289  40.920 114.920 1.00 64.58  ? 175 ALA A CB    1 
ATOM   2646 N N     . GLU C 2 176 ? 74.905  39.847 114.080 1.00 59.16  ? 176 GLU A N     1 
ATOM   2647 C CA    . GLU C 2 176 ? 75.792  38.950 113.365 1.00 65.15  ? 176 GLU A CA    1 
ATOM   2648 C C     . GLU C 2 176 ? 76.771  38.345 114.347 1.00 62.05  ? 176 GLU A C     1 
ATOM   2649 O O     . GLU C 2 176 ? 76.980  37.133 114.361 1.00 63.35  ? 176 GLU A O     1 
ATOM   2650 C CB    . GLU C 2 176 ? 76.563  39.719 112.295 1.00 76.74  ? 176 GLU A CB    1 
ATOM   2651 C CG    . GLU C 2 176 ? 75.699  40.170 111.140 1.00 86.66  ? 176 GLU A CG    1 
ATOM   2652 C CD    . GLU C 2 176 ? 75.567  41.676 111.064 1.00 93.88  ? 176 GLU A CD    1 
ATOM   2653 O OE1   . GLU C 2 176 ? 74.423  42.178 110.973 1.00 92.82  ? 176 GLU A OE1   1 
ATOM   2654 O OE2   . GLU C 2 176 ? 76.615  42.356 111.094 1.00 100.00 ? 176 GLU A OE2   1 
ATOM   2655 N N     . ILE C 2 177 ? 77.371  39.204 115.165 1.00 60.67  ? 177 ILE A N     1 
ATOM   2656 C CA    . ILE C 2 177 ? 78.346  38.775 116.158 1.00 52.76  ? 177 ILE A CA    1 
ATOM   2657 C C     . ILE C 2 177 ? 77.757  37.675 117.043 1.00 52.40  ? 177 ILE A C     1 
ATOM   2658 O O     . ILE C 2 177 ? 78.425  36.685 117.362 1.00 49.45  ? 177 ILE A O     1 
ATOM   2659 C CB    . ILE C 2 177 ? 78.769  39.966 117.029 1.00 46.40  ? 177 ILE A CB    1 
ATOM   2660 C CG1   . ILE C 2 177 ? 79.536  40.968 116.168 1.00 48.49  ? 177 ILE A CG1   1 
ATOM   2661 C CG2   . ILE C 2 177 ? 79.598  39.490 118.204 1.00 55.42  ? 177 ILE A CG2   1 
ATOM   2662 C CD1   . ILE C 2 177 ? 79.681  42.329 116.793 1.00 53.87  ? 177 ILE A CD1   1 
ATOM   2663 N N     . ALA C 2 178 ? 76.504  37.853 117.442 1.00 46.02  ? 178 ALA A N     1 
ATOM   2664 C CA    . ALA C 2 178 ? 75.847  36.868 118.279 1.00 47.37  ? 178 ALA A CA    1 
ATOM   2665 C C     . ALA C 2 178 ? 75.575  35.584 117.507 1.00 54.28  ? 178 ALA A C     1 
ATOM   2666 O O     . ALA C 2 178 ? 75.786  34.481 118.016 1.00 64.85  ? 178 ALA A O     1 
ATOM   2667 C CB    . ALA C 2 178 ? 74.537  37.439 118.818 1.00 48.66  ? 178 ALA A CB    1 
ATOM   2668 N N     . ARG C 2 179 ? 75.130  35.738 116.266 1.00 61.86  ? 179 ARG A N     1 
ATOM   2669 C CA    . ARG C 2 179 ? 74.780  34.606 115.420 1.00 60.07  ? 179 ARG A CA    1 
ATOM   2670 C C     . ARG C 2 179 ? 75.935  33.659 115.161 1.00 65.71  ? 179 ARG A C     1 
ATOM   2671 O O     . ARG C 2 179 ? 75.712  32.478 114.896 1.00 76.33  ? 179 ARG A O     1 
ATOM   2672 C CB    . ARG C 2 179 ? 74.259  35.092 114.071 1.00 57.84  ? 179 ARG A CB    1 
ATOM   2673 C CG    . ARG C 2 179 ? 72.896  35.715 114.113 1.00 65.54  ? 179 ARG A CG    1 
ATOM   2674 C CD    . ARG C 2 179 ? 72.833  36.851 113.121 1.00 75.24  ? 179 ARG A CD    1 
ATOM   2675 N NE    . ARG C 2 179 ? 72.496  36.388 111.780 1.00 74.05  ? 179 ARG A NE    1 
ATOM   2676 C CZ    . ARG C 2 179 ? 72.689  37.108 110.682 1.00 82.97  ? 179 ARG A CZ    1 
ATOM   2677 N NH1   . ARG C 2 179 ? 73.216  38.319 110.767 1.00 85.46  ? 179 ARG A NH1   1 
ATOM   2678 N NH2   . ARG C 2 179 ? 72.345  36.623 109.497 1.00 89.15  ? 179 ARG A NH2   1 
ATOM   2679 N N     . ILE C 2 180 ? 77.164  34.153 115.234 1.00 66.98  ? 180 ILE A N     1 
ATOM   2680 C CA    . ILE C 2 180 ? 78.293  33.282 114.935 1.00 68.33  ? 180 ILE A CA    1 
ATOM   2681 C C     . ILE C 2 180 ? 78.443  32.019 115.801 1.00 72.38  ? 180 ILE A C     1 
ATOM   2682 O O     . ILE C 2 180 ? 78.235  32.034 117.022 1.00 74.08  ? 180 ILE A O     1 
ATOM   2683 C CB    . ILE C 2 180 ? 79.621  34.088 114.871 1.00 65.62  ? 180 ILE A CB    1 
ATOM   2684 C CG1   . ILE C 2 180 ? 80.716  33.401 115.674 1.00 75.63  ? 180 ILE A CG1   1 
ATOM   2685 C CG2   . ILE C 2 180 ? 79.407  35.497 115.341 1.00 64.10  ? 180 ILE A CG2   1 
ATOM   2686 C CD1   . ILE C 2 180 ? 82.081  33.964 115.379 1.00 78.06  ? 180 ILE A CD1   1 
ATOM   2687 N N     . ARG C 2 181 ? 78.780  30.926 115.110 1.00 75.63  ? 181 ARG A N     1 
ATOM   2688 C CA    . ARG C 2 181 ? 78.963  29.590 115.672 1.00 74.51  ? 181 ARG A CA    1 
ATOM   2689 C C     . ARG C 2 181 ? 80.425  29.146 115.658 1.00 78.19  ? 181 ARG A C     1 
ATOM   2690 O O     . ARG C 2 181 ? 81.300  29.888 115.215 1.00 75.39  ? 181 ARG A O     1 
ATOM   2691 C CB    . ARG C 2 181 ? 78.143  28.581 114.871 1.00 72.11  ? 181 ARG A CB    1 
ATOM   2692 C CG    . ARG C 2 181 ? 76.795  29.099 114.414 1.00 71.46  ? 181 ARG A CG    1 
ATOM   2693 C CD    . ARG C 2 181 ? 75.705  28.575 115.323 1.00 79.87  ? 181 ARG A CD    1 
ATOM   2694 N NE    . ARG C 2 181 ? 74.662  27.853 114.603 1.00 80.38  ? 181 ARG A NE    1 
ATOM   2695 C CZ    . ARG C 2 181 ? 73.412  28.290 114.482 1.00 86.40  ? 181 ARG A CZ    1 
ATOM   2696 N NH1   . ARG C 2 181 ? 73.058  29.442 115.030 1.00 90.85  ? 181 ARG A NH1   1 
ATOM   2697 N NH2   . ARG C 2 181 ? 72.515  27.575 113.823 1.00 95.70  ? 181 ARG A NH2   1 
ATOM   2698 N N     . VAL C 2 182 ? 80.671  27.921 116.122 1.00 84.83  ? 182 VAL A N     1 
ATOM   2699 C CA    . VAL C 2 182 ? 82.030  27.377 116.191 1.00 90.40  ? 182 VAL A CA    1 
ATOM   2700 C C     . VAL C 2 182 ? 82.671  27.201 114.822 1.00 93.68  ? 182 VAL A C     1 
ATOM   2701 O O     . VAL C 2 182 ? 83.418  28.059 114.371 1.00 95.80  ? 182 VAL A O     1 
ATOM   2702 C CB    . VAL C 2 182 ? 82.083  25.998 116.935 1.00 94.68  ? 182 VAL A CB    1 
ATOM   2703 C CG1   . VAL C 2 182 ? 83.392  25.873 117.742 1.00 83.04  ? 182 VAL A CG1   1 
ATOM   2704 C CG2   . VAL C 2 182 ? 80.890  25.854 117.853 1.00 91.37  ? 182 VAL A CG2   1 
ATOM   2705 N N     . LYS C 2 183 ? 82.375  26.083 114.168 1.00 96.08  ? 183 LYS A N     1 
ATOM   2706 C CA    . LYS C 2 183 ? 82.934  25.771 112.853 1.00 93.77  ? 183 LYS A CA    1 
ATOM   2707 C C     . LYS C 2 183 ? 83.032  26.957 111.897 1.00 97.77  ? 183 LYS A C     1 
ATOM   2708 O O     . LYS C 2 183 ? 83.851  26.947 110.978 1.00 100.00 ? 183 LYS A O     1 
ATOM   2709 C CB    . LYS C 2 183 ? 82.123  24.657 112.195 1.00 90.27  ? 183 LYS A CB    1 
ATOM   2710 C CG    . LYS C 2 183 ? 80.634  24.775 112.437 1.00 85.11  ? 183 LYS A CG    1 
ATOM   2711 C CD    . LYS C 2 183 ? 79.974  25.576 111.339 1.00 73.05  ? 183 LYS A CD    1 
ATOM   2712 C CE    . LYS C 2 183 ? 78.527  25.831 111.673 1.00 74.92  ? 183 LYS A CE    1 
ATOM   2713 N NZ    . LYS C 2 183 ? 77.759  24.567 111.821 1.00 58.45  ? 183 LYS A NZ    1 
ATOM   2714 N N     . ASP C 2 184 ? 82.190  27.965 112.094 1.00 96.57  ? 184 ASP A N     1 
ATOM   2715 C CA    . ASP C 2 184 ? 82.229  29.148 111.243 1.00 93.75  ? 184 ASP A CA    1 
ATOM   2716 C C     . ASP C 2 184 ? 83.608  29.814 111.272 1.00 90.88  ? 184 ASP A C     1 
ATOM   2717 O O     . ASP C 2 184 ? 83.986  30.528 110.340 1.00 88.41  ? 184 ASP A O     1 
ATOM   2718 C CB    . ASP C 2 184 ? 81.164  30.146 111.686 1.00 94.43  ? 184 ASP A CB    1 
ATOM   2719 C CG    . ASP C 2 184 ? 79.887  30.003 110.905 1.00 97.45  ? 184 ASP A CG    1 
ATOM   2720 O OD1   . ASP C 2 184 ? 79.325  31.033 110.468 1.00 100.00 ? 184 ASP A OD1   1 
ATOM   2721 O OD2   . ASP C 2 184 ? 79.453  28.847 110.725 1.00 100.00 ? 184 ASP A OD2   1 
ATOM   2722 N N     . ILE C 2 185 ? 84.342  29.582 112.356 1.00 89.00  ? 185 ILE A N     1 
ATOM   2723 C CA    . ILE C 2 185 ? 85.683  30.134 112.539 1.00 92.79  ? 185 ILE A CA    1 
ATOM   2724 C C     . ILE C 2 185 ? 86.701  29.266 111.838 1.00 95.63  ? 185 ILE A C     1 
ATOM   2725 O O     . ILE C 2 185 ? 87.182  28.290 112.408 1.00 96.52  ? 185 ILE A O     1 
ATOM   2726 C CB    . ILE C 2 185 ? 86.119  30.168 114.012 1.00 90.16  ? 185 ILE A CB    1 
ATOM   2727 C CG1   . ILE C 2 185 ? 84.912  30.186 114.951 1.00 88.35  ? 185 ILE A CG1   1 
ATOM   2728 C CG2   . ILE C 2 185 ? 87.016  31.345 114.232 1.00 93.04  ? 185 ILE A CG2   1 
ATOM   2729 C CD1   . ILE C 2 185 ? 83.853  31.214 114.616 1.00 81.24  ? 185 ILE A CD1   1 
ATOM   2730 N N     . SER C 2 186 ? 87.043  29.632 110.610 1.00 100.00 ? 186 SER A N     1 
ATOM   2731 C CA    . SER C 2 186 ? 88.006  28.869 109.831 1.00 100.00 ? 186 SER A CA    1 
ATOM   2732 C C     . SER C 2 186 ? 89.380  29.525 109.870 1.00 100.00 ? 186 SER A C     1 
ATOM   2733 O O     . SER C 2 186 ? 89.565  30.609 109.322 1.00 100.00 ? 186 SER A O     1 
ATOM   2734 C CB    . SER C 2 186 ? 87.530  28.763 108.380 1.00 100.00 ? 186 SER A CB    1 
ATOM   2735 O OG    . SER C 2 186 ? 87.252  30.047 107.848 1.00 100.00 ? 186 SER A OG    1 
ATOM   2736 N N     . ARG C 2 187 ? 90.331  28.871 110.534 1.00 98.80  ? 187 ARG A N     1 
ATOM   2737 C CA    . ARG C 2 187 ? 91.698  29.380 110.621 1.00 97.32  ? 187 ARG A CA    1 
ATOM   2738 C C     . ARG C 2 187 ? 92.189  29.490 109.189 1.00 100.00 ? 187 ARG A C     1 
ATOM   2739 O O     . ARG C 2 187 ? 92.941  28.644 108.713 1.00 100.00 ? 187 ARG A O     1 
ATOM   2740 C CB    . ARG C 2 187 ? 92.582  28.398 111.386 1.00 95.88  ? 187 ARG A CB    1 
ATOM   2741 C CG    . ARG C 2 187 ? 93.018  28.889 112.748 1.00 94.56  ? 187 ARG A CG    1 
ATOM   2742 C CD    . ARG C 2 187 ? 91.834  29.023 113.699 1.00 98.94  ? 187 ARG A CD    1 
ATOM   2743 N NE    . ARG C 2 187 ? 90.901  27.894 113.632 1.00 100.00 ? 187 ARG A NE    1 
ATOM   2744 C CZ    . ARG C 2 187 ? 90.452  27.228 114.696 1.00 100.00 ? 187 ARG A CZ    1 
ATOM   2745 N NH1   . ARG C 2 187 ? 90.854  27.577 115.914 1.00 100.00 ? 187 ARG A NH1   1 
ATOM   2746 N NH2   . ARG C 2 187 ? 89.588  26.227 114.547 1.00 100.00 ? 187 ARG A NH2   1 
ATOM   2747 N N     . THR C 2 188 ? 91.776  30.546 108.505 1.00 100.00 ? 188 THR A N     1 
ATOM   2748 C CA    . THR C 2 188 ? 92.139  30.710 107.111 1.00 100.00 ? 188 THR A CA    1 
ATOM   2749 C C     . THR C 2 188 ? 93.236  31.735 106.944 1.00 100.00 ? 188 THR A C     1 
ATOM   2750 O O     . THR C 2 188 ? 93.047  32.918 107.238 1.00 100.00 ? 188 THR A O     1 
ATOM   2751 C CB    . THR C 2 188 ? 90.900  31.123 106.255 1.00 100.00 ? 188 THR A CB    1 
ATOM   2752 O OG1   . THR C 2 188 ? 90.035  29.992 106.075 1.00 98.81  ? 188 THR A OG1   1 
ATOM   2753 C CG2   . THR C 2 188 ? 91.333  31.629 104.887 1.00 100.00 ? 188 THR A CG2   1 
ATOM   2754 N N     . ASP C 2 189 ? 94.391  31.263 106.490 1.00 99.43  ? 189 ASP A N     1 
ATOM   2755 C CA    . ASP C 2 189 ? 95.519  32.136 106.245 1.00 100.00 ? 189 ASP A CA    1 
ATOM   2756 C C     . ASP C 2 189 ? 96.228  32.577 107.509 1.00 99.20  ? 189 ASP A C     1 
ATOM   2757 O O     . ASP C 2 189 ? 95.598  33.023 108.464 1.00 100.00 ? 189 ASP A O     1 
ATOM   2758 C CB    . ASP C 2 189 ? 95.048  33.371 105.468 1.00 100.00 ? 189 ASP A CB    1 
ATOM   2759 C CG    . ASP C 2 189 ? 95.807  33.575 104.173 1.00 100.00 ? 189 ASP A CG    1 
ATOM   2760 O OD1   . ASP C 2 189 ? 95.968  34.741 103.754 1.00 100.00 ? 189 ASP A OD1   1 
ATOM   2761 O OD2   . ASP C 2 189 ? 96.243  32.573 103.572 1.00 100.00 ? 189 ASP A OD2   1 
ATOM   2762 N N     . GLY C 2 190 ? 97.550  32.438 107.495 1.00 99.42  ? 190 GLY A N     1 
ATOM   2763 C CA    . GLY C 2 190 ? 98.375  32.849 108.615 1.00 100.00 ? 190 GLY A CA    1 
ATOM   2764 C C     . GLY C 2 190 ? 98.153  32.052 109.882 1.00 100.00 ? 190 GLY A C     1 
ATOM   2765 O O     . GLY C 2 190 ? 98.977  32.096 110.802 1.00 100.00 ? 190 GLY A O     1 
ATOM   2766 N N     . GLY C 2 191 ? 97.047  31.313 109.924 1.00 100.00 ? 191 GLY A N     1 
ATOM   2767 C CA    . GLY C 2 191 ? 96.724  30.523 111.098 1.00 100.00 ? 191 GLY A CA    1 
ATOM   2768 C C     . GLY C 2 191 ? 95.661  31.265 111.881 1.00 100.00 ? 191 GLY A C     1 
ATOM   2769 O O     . GLY C 2 191 ? 95.299  30.885 112.995 1.00 100.00 ? 191 GLY A O     1 
ATOM   2770 N N     . ARG C 2 192 ? 95.153  32.330 111.273 1.00 100.00 ? 192 ARG A N     1 
ATOM   2771 C CA    . ARG C 2 192 ? 94.142  33.166 111.892 1.00 99.08  ? 192 ARG A CA    1 
ATOM   2772 C C     . ARG C 2 192 ? 92.780  32.721 111.408 1.00 95.35  ? 192 ARG A C     1 
ATOM   2773 O O     . ARG C 2 192 ? 92.648  32.185 110.315 1.00 94.34  ? 192 ARG A O     1 
ATOM   2774 C CB    . ARG C 2 192 ? 94.408  34.629 111.538 1.00 100.00 ? 192 ARG A CB    1 
ATOM   2775 C CG    . ARG C 2 192 ? 95.873  35.023 111.733 1.00 99.18  ? 192 ARG A CG    1 
ATOM   2776 C CD    . ARG C 2 192 ? 96.194  36.346 111.070 1.00 98.23  ? 192 ARG A CD    1 
ATOM   2777 N NE    . ARG C 2 192 ? 97.211  36.232 110.028 1.00 100.00 ? 192 ARG A NE    1 
ATOM   2778 C CZ    . ARG C 2 192 ? 97.834  37.276 109.491 1.00 100.00 ? 192 ARG A CZ    1 
ATOM   2779 N NH1   . ARG C 2 192 ? 97.536  38.500 109.909 1.00 100.00 ? 192 ARG A NH1   1 
ATOM   2780 N NH2   . ARG C 2 192 ? 98.744  37.101 108.538 1.00 100.00 ? 192 ARG A NH2   1 
ATOM   2781 N N     . MET C 2 193 ? 91.770  32.947 112.233 1.00 94.63  ? 193 MET A N     1 
ATOM   2782 C CA    . MET C 2 193 ? 90.414  32.537 111.905 1.00 94.11  ? 193 MET A CA    1 
ATOM   2783 C C     . MET C 2 193 ? 89.826  33.240 110.694 1.00 87.54  ? 193 MET A C     1 
ATOM   2784 O O     . MET C 2 193 ? 90.505  33.993 110.002 1.00 84.12  ? 193 MET A O     1 
ATOM   2785 C CB    . MET C 2 193 ? 89.492  32.749 113.109 1.00 97.06  ? 193 MET A CB    1 
ATOM   2786 C CG    . MET C 2 193 ? 90.206  32.803 114.463 1.00 100.00 ? 193 MET A CG    1 
ATOM   2787 S SD    . MET C 2 193 ? 89.747  31.478 115.637 1.00 100.00 ? 193 MET A SD    1 
ATOM   2788 C CE    . MET C 2 193 ? 89.694  32.362 117.187 1.00 86.91  ? 193 MET A CE    1 
ATOM   2789 N N     . GLU C 2 210 ? 83.523  36.757 104.674 1.00 93.69  ? 210 GLU A N     1 
ATOM   2790 C CA    . GLU C 2 210 ? 84.385  36.020 105.573 1.00 97.06  ? 210 GLU A CA    1 
ATOM   2791 C C     . GLU C 2 210 ? 85.315  37.044 106.202 1.00 95.96  ? 210 GLU A C     1 
ATOM   2792 O O     . GLU C 2 210 ? 86.323  37.431 105.609 1.00 98.36  ? 210 GLU A O     1 
ATOM   2793 C CB    . GLU C 2 210 ? 85.205  34.977 104.816 1.00 100.00 ? 210 GLU A CB    1 
ATOM   2794 C CG    . GLU C 2 210 ? 84.420  33.770 104.331 1.00 100.00 ? 210 GLU A CG    1 
ATOM   2795 C CD    . GLU C 2 210 ? 85.105  33.109 103.159 1.00 100.00 ? 210 GLU A CD    1 
ATOM   2796 O OE1   . GLU C 2 210 ? 85.783  33.848 102.411 1.00 100.00 ? 210 GLU A OE1   1 
ATOM   2797 O OE2   . GLU C 2 210 ? 84.974  31.874 102.993 1.00 100.00 ? 210 GLU A OE2   1 
ATOM   2798 N N     . LYS C 2 211 ? 84.953  37.512 107.389 1.00 93.79  ? 211 LYS A N     1 
ATOM   2799 C CA    . LYS C 2 211 ? 85.780  38.483 108.094 1.00 87.60  ? 211 LYS A CA    1 
ATOM   2800 C C     . LYS C 2 211 ? 86.930  37.758 108.801 1.00 86.89  ? 211 LYS A C     1 
ATOM   2801 O O     . LYS C 2 211 ? 86.718  36.746 109.479 1.00 86.33  ? 211 LYS A O     1 
ATOM   2802 C CB    . LYS C 2 211 ? 84.931  39.264 109.098 1.00 81.39  ? 211 LYS A CB    1 
ATOM   2803 C CG    . LYS C 2 211 ? 84.917  40.768 108.861 1.00 76.77  ? 211 LYS A CG    1 
ATOM   2804 C CD    . LYS C 2 211 ? 83.576  41.259 108.320 1.00 73.23  ? 211 LYS A CD    1 
ATOM   2805 C CE    . LYS C 2 211 ? 83.618  42.759 108.055 1.00 73.63  ? 211 LYS A CE    1 
ATOM   2806 N NZ    . LYS C 2 211 ? 85.020  43.272 108.143 1.00 80.63  ? 211 LYS A NZ    1 
ATOM   2807 N N     . ALA C 2 212 ? 88.146  38.273 108.614 1.00 86.01  ? 212 ALA A N     1 
ATOM   2808 C CA    . ALA C 2 212 ? 89.355  37.691 109.196 1.00 86.24  ? 212 ALA A CA    1 
ATOM   2809 C C     . ALA C 2 212 ? 89.850  38.463 110.415 1.00 88.25  ? 212 ALA A C     1 
ATOM   2810 O O     . ALA C 2 212 ? 90.017  39.680 110.365 1.00 87.86  ? 212 ALA A O     1 
ATOM   2811 C CB    . ALA C 2 212 ? 90.453  37.629 108.147 1.00 91.10  ? 212 ALA A CB    1 
ATOM   2812 N N     . LEU C 2 213 ? 90.114  37.737 111.496 1.00 90.66  ? 213 LEU A N     1 
ATOM   2813 C CA    . LEU C 2 213 ? 90.567  38.344 112.743 1.00 86.87  ? 213 LEU A CA    1 
ATOM   2814 C C     . LEU C 2 213 ? 92.060  38.599 112.763 1.00 84.55  ? 213 LEU A C     1 
ATOM   2815 O O     . LEU C 2 213 ? 92.859  37.674 112.719 1.00 85.93  ? 213 LEU A O     1 
ATOM   2816 C CB    . LEU C 2 213 ? 90.180  37.466 113.936 1.00 87.23  ? 213 LEU A CB    1 
ATOM   2817 C CG    . LEU C 2 213 ? 88.685  37.171 114.117 1.00 87.47  ? 213 LEU A CG    1 
ATOM   2818 C CD1   . LEU C 2 213 ? 88.478  36.329 115.369 1.00 88.54  ? 213 LEU A CD1   1 
ATOM   2819 C CD2   . LEU C 2 213 ? 87.899  38.473 114.215 1.00 81.47  ? 213 LEU A CD2   1 
ATOM   2820 N N     . SER C 2 214 ? 92.403  39.879 112.836 1.00 86.23  ? 214 SER A N     1 
ATOM   2821 C CA    . SER C 2 214 ? 93.775  40.376 112.873 1.00 88.53  ? 214 SER A CA    1 
ATOM   2822 C C     . SER C 2 214 ? 94.854  39.357 113.183 1.00 90.39  ? 214 SER A C     1 
ATOM   2823 O O     . SER C 2 214 ? 95.498  38.823 112.280 1.00 99.89  ? 214 SER A O     1 
ATOM   2824 C CB    . SER C 2 214 ? 93.868  41.505 113.891 1.00 85.08  ? 214 SER A CB    1 
ATOM   2825 O OG    . SER C 2 214 ? 92.870  41.340 114.878 1.00 87.14  ? 214 SER A OG    1 
ATOM   2826 N N     . LEU C 2 215 ? 95.062  39.108 114.468 1.00 85.21  ? 215 LEU A N     1 
ATOM   2827 C CA    . LEU C 2 215 ? 96.076  38.168 114.889 1.00 81.01  ? 215 LEU A CA    1 
ATOM   2828 C C     . LEU C 2 215 ? 96.122  38.203 116.389 1.00 79.22  ? 215 LEU A C     1 
ATOM   2829 O O     . LEU C 2 215 ? 96.071  37.167 117.054 1.00 79.92  ? 215 LEU A O     1 
ATOM   2830 C CB    . LEU C 2 215 ? 97.431  38.584 114.327 1.00 83.16  ? 215 LEU A CB    1 
ATOM   2831 C CG    . LEU C 2 215 ? 98.288  37.409 113.894 1.00 89.87  ? 215 LEU A CG    1 
ATOM   2832 C CD1   . LEU C 2 215 ? 99.648  37.907 113.448 1.00 93.08  ? 215 LEU A CD1   1 
ATOM   2833 C CD2   . LEU C 2 215 ? 98.412  36.441 115.058 1.00 100.00 ? 215 LEU A CD2   1 
ATOM   2834 N N     . GLY C 2 216 ? 96.231  39.417 116.914 1.00 79.31  ? 216 GLY A N     1 
ATOM   2835 C CA    . GLY C 2 216 ? 96.260  39.594 118.348 1.00 79.84  ? 216 GLY A CA    1 
ATOM   2836 C C     . GLY C 2 216 ? 94.862  39.280 118.836 1.00 79.20  ? 216 GLY A C     1 
ATOM   2837 O O     . GLY C 2 216 ? 94.677  38.888 119.989 1.00 82.49  ? 216 GLY A O     1 
ATOM   2838 N N     . VAL C 2 217 ? 93.888  39.444 117.936 1.00 76.08  ? 217 VAL A N     1 
ATOM   2839 C CA    . VAL C 2 217 ? 92.473  39.194 118.217 1.00 68.93  ? 217 VAL A CA    1 
ATOM   2840 C C     . VAL C 2 217 ? 92.130  37.720 118.038 1.00 73.21  ? 217 VAL A C     1 
ATOM   2841 O O     . VAL C 2 217 ? 91.310  37.171 118.776 1.00 78.71  ? 217 VAL A O     1 
ATOM   2842 C CB    . VAL C 2 217 ? 91.570  40.034 117.298 1.00 58.05  ? 217 VAL A CB    1 
ATOM   2843 C CG1   . VAL C 2 217 ? 90.146  39.496 117.321 1.00 49.80  ? 217 VAL A CG1   1 
ATOM   2844 C CG2   . VAL C 2 217 ? 91.610  41.490 117.744 1.00 59.49  ? 217 VAL A CG2   1 
ATOM   2845 N N     . THR C 2 218 ? 92.730  37.090 117.034 1.00 73.28  ? 218 THR A N     1 
ATOM   2846 C CA    . THR C 2 218 ? 92.514  35.667 116.816 1.00 65.72  ? 218 THR A CA    1 
ATOM   2847 C C     . THR C 2 218 ? 92.993  35.019 118.110 1.00 61.24  ? 218 THR A C     1 
ATOM   2848 O O     . THR C 2 218 ? 92.373  34.089 118.621 1.00 52.41  ? 218 THR A O     1 
ATOM   2849 C CB    . THR C 2 218 ? 93.370  35.141 115.653 1.00 68.02  ? 218 THR A CB    1 
ATOM   2850 O OG1   . THR C 2 218 ? 93.021  35.838 114.453 1.00 69.06  ? 218 THR A OG1   1 
ATOM   2851 C CG2   . THR C 2 218 ? 93.132  33.659 115.446 1.00 60.51  ? 218 THR A CG2   1 
ATOM   2852 N N     . LYS C 2 219 ? 94.103  35.547 118.625 1.00 64.35  ? 219 LYS A N     1 
ATOM   2853 C CA    . LYS C 2 219 ? 94.733  35.090 119.867 1.00 66.69  ? 219 LYS A CA    1 
ATOM   2854 C C     . LYS C 2 219 ? 93.751  35.175 121.036 1.00 68.65  ? 219 LYS A C     1 
ATOM   2855 O O     . LYS C 2 219 ? 93.712  34.291 121.897 1.00 75.30  ? 219 LYS A O     1 
ATOM   2856 C CB    . LYS C 2 219 ? 95.966  35.951 120.171 1.00 63.28  ? 219 LYS A CB    1 
ATOM   2857 C CG    . LYS C 2 219 ? 97.113  35.198 120.811 1.00 70.10  ? 219 LYS A CG    1 
ATOM   2858 C CD    . LYS C 2 219 ? 98.180  34.860 119.786 1.00 80.44  ? 219 LYS A CD    1 
ATOM   2859 C CE    . LYS C 2 219 ? 98.543  33.388 119.833 1.00 86.53  ? 219 LYS A CE    1 
ATOM   2860 N NZ    . LYS C 2 219 ? 99.968  33.183 120.211 1.00 97.22  ? 219 LYS A NZ    1 
ATOM   2861 N N     . LEU C 2 220 ? 92.967  36.249 121.058 1.00 64.11  ? 220 LEU A N     1 
ATOM   2862 C CA    . LEU C 2 220 ? 91.976  36.467 122.104 1.00 57.01  ? 220 LEU A CA    1 
ATOM   2863 C C     . LEU C 2 220 ? 90.864  35.440 122.007 1.00 59.07  ? 220 LEU A C     1 
ATOM   2864 O O     . LEU C 2 220 ? 90.668  34.640 122.916 1.00 69.51  ? 220 LEU A O     1 
ATOM   2865 C CB    . LEU C 2 220 ? 91.372  37.867 121.991 1.00 54.45  ? 220 LEU A CB    1 
ATOM   2866 C CG    . LEU C 2 220 ? 92.305  39.064 122.208 1.00 62.98  ? 220 LEU A CG    1 
ATOM   2867 C CD1   . LEU C 2 220 ? 91.475  40.335 122.302 1.00 58.70  ? 220 LEU A CD1   1 
ATOM   2868 C CD2   . LEU C 2 220 ? 93.132  38.872 123.470 1.00 63.06  ? 220 LEU A CD2   1 
ATOM   2869 N N     . VAL C 2 221 ? 90.129  35.476 120.903 1.00 61.26  ? 221 VAL A N     1 
ATOM   2870 C CA    . VAL C 2 221 ? 89.028  34.550 120.690 1.00 63.79  ? 221 VAL A CA    1 
ATOM   2871 C C     . VAL C 2 221 ? 89.395  33.127 121.126 1.00 69.31  ? 221 VAL A C     1 
ATOM   2872 O O     . VAL C 2 221 ? 88.579  32.424 121.725 1.00 73.12  ? 221 VAL A O     1 
ATOM   2873 C CB    . VAL C 2 221 ? 88.595  34.546 119.199 1.00 65.09  ? 221 VAL A CB    1 
ATOM   2874 C CG1   . VAL C 2 221 ? 87.198  33.976 119.068 1.00 65.25  ? 221 VAL A CG1   1 
ATOM   2875 C CG2   . VAL C 2 221 ? 88.627  35.961 118.629 1.00 57.84  ? 221 VAL A CG2   1 
ATOM   2876 N N     . GLU C 2 222 ? 90.634  32.723 120.848 1.00 74.09  ? 222 GLU A N     1 
ATOM   2877 C CA    . GLU C 2 222 ? 91.121  31.380 121.191 1.00 76.14  ? 222 GLU A CA    1 
ATOM   2878 C C     . GLU C 2 222 ? 91.030  31.084 122.695 1.00 67.44  ? 222 GLU A C     1 
ATOM   2879 O O     . GLU C 2 222 ? 90.318  30.170 123.116 1.00 60.55  ? 222 GLU A O     1 
ATOM   2880 C CB    . GLU C 2 222 ? 92.574  31.203 120.696 1.00 87.62  ? 222 GLU A CB    1 
ATOM   2881 C CG    . GLU C 2 222 ? 92.724  30.995 119.157 1.00 100.00 ? 222 GLU A CG    1 
ATOM   2882 C CD    . GLU C 2 222 ? 94.173  31.136 118.638 1.00 100.00 ? 222 GLU A CD    1 
ATOM   2883 O OE1   . GLU C 2 222 ? 94.868  32.113 119.007 1.00 100.00 ? 222 GLU A OE1   1 
ATOM   2884 O OE2   . GLU C 2 222 ? 94.615  30.265 117.851 1.00 100.00 ? 222 GLU A OE2   1 
ATOM   2885 N N     . ARG C 2 223 ? 91.757  31.867 123.488 1.00 61.55  ? 223 ARG A N     1 
ATOM   2886 C CA    . ARG C 2 223 ? 91.765  31.728 124.943 1.00 54.98  ? 223 ARG A CA    1 
ATOM   2887 C C     . ARG C 2 223 ? 90.378  31.384 125.473 1.00 49.51  ? 223 ARG A C     1 
ATOM   2888 O O     . ARG C 2 223 ? 90.169  30.317 126.022 1.00 53.68  ? 223 ARG A O     1 
ATOM   2889 C CB    . ARG C 2 223 ? 92.247  33.023 125.588 1.00 49.83  ? 223 ARG A CB    1 
ATOM   2890 C CG    . ARG C 2 223 ? 91.911  33.144 127.051 1.00 61.27  ? 223 ARG A CG    1 
ATOM   2891 C CD    . ARG C 2 223 ? 93.151  33.478 127.859 1.00 78.80  ? 223 ARG A CD    1 
ATOM   2892 N NE    . ARG C 2 223 ? 93.346  34.919 127.969 1.00 93.99  ? 223 ARG A NE    1 
ATOM   2893 C CZ    . ARG C 2 223 ? 93.467  35.576 129.120 1.00 100.00 ? 223 ARG A CZ    1 
ATOM   2894 N NH1   . ARG C 2 223 ? 93.414  34.924 130.275 1.00 99.39  ? 223 ARG A NH1   1 
ATOM   2895 N NH2   . ARG C 2 223 ? 93.624  36.894 129.112 1.00 100.00 ? 223 ARG A NH2   1 
ATOM   2896 N N     . TRP C 2 224 ? 89.429  32.292 125.306 1.00 50.11  ? 224 TRP A N     1 
ATOM   2897 C CA    . TRP C 2 224 ? 88.064  32.054 125.755 1.00 58.33  ? 224 TRP A CA    1 
ATOM   2898 C C     . TRP C 2 224 ? 87.475  30.796 125.118 1.00 62.45  ? 224 TRP A C     1 
ATOM   2899 O O     . TRP C 2 224 ? 86.801  30.001 125.781 1.00 58.27  ? 224 TRP A O     1 
ATOM   2900 C CB    . TRP C 2 224 ? 87.172  33.254 125.397 1.00 70.33  ? 224 TRP A CB    1 
ATOM   2901 C CG    . TRP C 2 224 ? 85.779  32.881 124.888 1.00 75.04  ? 224 TRP A CG    1 
ATOM   2902 C CD1   . TRP C 2 224 ? 85.418  32.607 123.592 1.00 76.53  ? 224 TRP A CD1   1 
ATOM   2903 C CD2   . TRP C 2 224 ? 84.577  32.744 125.672 1.00 69.90  ? 224 TRP A CD2   1 
ATOM   2904 N NE1   . TRP C 2 224 ? 84.076  32.311 123.524 1.00 72.02  ? 224 TRP A NE1   1 
ATOM   2905 C CE2   . TRP C 2 224 ? 83.534  32.386 124.781 1.00 69.70  ? 224 TRP A CE2   1 
ATOM   2906 C CE3   . TRP C 2 224 ? 84.280  32.887 127.034 1.00 63.98  ? 224 TRP A CE3   1 
ATOM   2907 C CZ2   . TRP C 2 224 ? 82.218  32.172 125.210 1.00 64.49  ? 224 TRP A CZ2   1 
ATOM   2908 C CZ3   . TRP C 2 224 ? 82.971  32.674 127.459 1.00 65.96  ? 224 TRP A CZ3   1 
ATOM   2909 C CH2   . TRP C 2 224 ? 81.958  32.319 126.548 1.00 67.27  ? 224 TRP A CH2   1 
ATOM   2910 N N     . ILE C 2 225 ? 87.710  30.634 123.820 1.00 68.61  ? 225 ILE A N     1 
ATOM   2911 C CA    . ILE C 2 225 ? 87.167  29.491 123.104 1.00 78.11  ? 225 ILE A CA    1 
ATOM   2912 C C     . ILE C 2 225 ? 87.333  28.245 123.941 1.00 79.85  ? 225 ILE A C     1 
ATOM   2913 O O     . ILE C 2 225 ? 86.380  27.490 124.150 1.00 81.23  ? 225 ILE A O     1 
ATOM   2914 C CB    . ILE C 2 225 ? 87.863  29.298 121.739 1.00 82.77  ? 225 ILE A CB    1 
ATOM   2915 C CG1   . ILE C 2 225 ? 86.815  29.335 120.631 1.00 86.20  ? 225 ILE A CG1   1 
ATOM   2916 C CG2   . ILE C 2 225 ? 88.618  27.964 121.682 1.00 81.31  ? 225 ILE A CG2   1 
ATOM   2917 C CD1   . ILE C 2 225 ? 87.411  29.603 119.264 1.00 95.50  ? 225 ILE A CD1   1 
ATOM   2918 N N     . SER C 2 226 ? 88.553  28.046 124.428 1.00 79.04  ? 226 SER A N     1 
ATOM   2919 C CA    . SER C 2 226 ? 88.849  26.891 125.251 1.00 80.33  ? 226 SER A CA    1 
ATOM   2920 C C     . SER C 2 226 ? 88.301  27.149 126.655 1.00 84.03  ? 226 SER A C     1 
ATOM   2921 O O     . SER C 2 226 ? 87.566  26.322 127.205 1.00 85.51  ? 226 SER A O     1 
ATOM   2922 C CB    . SER C 2 226 ? 90.364  26.646 125.284 1.00 72.01  ? 226 SER A CB    1 
ATOM   2923 O OG    . SER C 2 226 ? 91.012  27.454 126.251 1.00 61.54  ? 226 SER A OG    1 
ATOM   2924 N N     . VAL C 2 227 ? 88.639  28.311 127.212 1.00 85.55  ? 227 VAL A N     1 
ATOM   2925 C CA    . VAL C 2 227 ? 88.202  28.711 128.548 1.00 79.82  ? 227 VAL A CA    1 
ATOM   2926 C C     . VAL C 2 227 ? 86.721  28.448 128.776 1.00 76.59  ? 227 VAL A C     1 
ATOM   2927 O O     . VAL C 2 227 ? 86.279  28.300 129.913 1.00 74.10  ? 227 VAL A O     1 
ATOM   2928 C CB    . VAL C 2 227 ? 88.485  30.206 128.798 1.00 78.03  ? 227 VAL A CB    1 
ATOM   2929 C CG1   . VAL C 2 227 ? 87.717  30.689 130.011 1.00 77.03  ? 227 VAL A CG1   1 
ATOM   2930 C CG2   . VAL C 2 227 ? 89.976  30.419 128.997 1.00 76.20  ? 227 VAL A CG2   1 
ATOM   2931 N N     . SER C 2 228 ? 85.957  28.376 127.694 1.00 76.27  ? 228 SER A N     1 
ATOM   2932 C CA    . SER C 2 228 ? 84.530  28.124 127.811 1.00 79.80  ? 228 SER A CA    1 
ATOM   2933 C C     . SER C 2 228 ? 84.142  26.723 127.359 1.00 81.11  ? 228 SER A C     1 
ATOM   2934 O O     . SER C 2 228 ? 83.051  26.242 127.679 1.00 76.21  ? 228 SER A O     1 
ATOM   2935 C CB    . SER C 2 228 ? 83.740  29.137 126.993 1.00 81.41  ? 228 SER A CB    1 
ATOM   2936 O OG    . SER C 2 228 ? 82.409  28.688 126.838 1.00 88.00  ? 228 SER A OG    1 
ATOM   2937 N N     . GLY C 2 229 ? 85.028  26.075 126.607 1.00 84.25  ? 229 GLY A N     1 
ATOM   2938 C CA    . GLY C 2 229 ? 84.744  24.737 126.124 1.00 87.14  ? 229 GLY A CA    1 
ATOM   2939 C C     . GLY C 2 229 ? 83.637  24.753 125.089 1.00 88.97  ? 229 GLY A C     1 
ATOM   2940 O O     . GLY C 2 229 ? 82.750  23.898 125.092 1.00 91.98  ? 229 GLY A O     1 
ATOM   2941 N N     . VAL C 2 230 ? 83.700  25.731 124.193 1.00 89.65  ? 230 VAL A N     1 
ATOM   2942 C CA    . VAL C 2 230 ? 82.701  25.888 123.140 1.00 82.87  ? 230 VAL A CA    1 
ATOM   2943 C C     . VAL C 2 230 ? 83.122  25.033 121.965 1.00 76.80  ? 230 VAL A C     1 
ATOM   2944 O O     . VAL C 2 230 ? 82.295  24.464 121.251 1.00 64.27  ? 230 VAL A O     1 
ATOM   2945 C CB    . VAL C 2 230 ? 82.635  27.342 122.656 1.00 83.23  ? 230 VAL A CB    1 
ATOM   2946 C CG1   . VAL C 2 230 ? 81.851  28.188 123.637 1.00 69.01  ? 230 VAL A CG1   1 
ATOM   2947 C CG2   . VAL C 2 230 ? 84.054  27.890 122.480 1.00 81.23  ? 230 VAL A CG2   1 
ATOM   2948 N N     . ALA C 2 231 ? 84.429  24.974 121.765 1.00 80.47  ? 231 ALA A N     1 
ATOM   2949 C CA    . ALA C 2 231 ? 84.990  24.200 120.688 1.00 88.20  ? 231 ALA A CA    1 
ATOM   2950 C C     . ALA C 2 231 ? 84.297  22.855 120.621 1.00 94.61  ? 231 ALA A C     1 
ATOM   2951 O O     . ALA C 2 231 ? 83.984  22.384 119.526 1.00 100.00 ? 231 ALA A O     1 
ATOM   2952 C CB    . ALA C 2 231 ? 86.484  24.003 120.914 1.00 79.87  ? 231 ALA A CB    1 
ATOM   2953 N N     . ASP C 2 232 ? 84.005  22.270 121.787 1.00 98.95  ? 232 ASP A N     1 
ATOM   2954 C CA    . ASP C 2 232 ? 83.401  20.931 121.837 1.00 100.00 ? 232 ASP A CA    1 
ATOM   2955 C C     . ASP C 2 232 ? 82.303  20.727 120.798 1.00 100.00 ? 232 ASP A C     1 
ATOM   2956 O O     . ASP C 2 232 ? 82.593  20.442 119.634 1.00 100.00 ? 232 ASP A O     1 
ATOM   2957 C CB    . ASP C 2 232 ? 82.817  20.620 123.213 1.00 100.00 ? 232 ASP A CB    1 
ATOM   2958 C CG    . ASP C 2 232 ? 83.870  20.430 124.279 1.00 100.00 ? 232 ASP A CG    1 
ATOM   2959 O OD1   . ASP C 2 232 ? 84.828  21.234 124.326 1.00 100.00 ? 232 ASP A OD1   1 
ATOM   2960 O OD2   . ASP C 2 232 ? 83.719  19.471 125.077 1.00 100.00 ? 232 ASP A OD2   1 
ATOM   2961 N N     . ASP C 2 233 ? 81.042  20.855 121.197 1.00 97.68  ? 233 ASP A N     1 
ATOM   2962 C CA    . ASP C 2 233 ? 79.987  20.672 120.217 1.00 95.56  ? 233 ASP A CA    1 
ATOM   2963 C C     . ASP C 2 233 ? 80.071  21.820 119.230 1.00 100.00 ? 233 ASP A C     1 
ATOM   2964 O O     . ASP C 2 233 ? 79.763  22.964 119.570 1.00 100.00 ? 233 ASP A O     1 
ATOM   2965 C CB    . ASP C 2 233 ? 78.605  20.667 120.859 1.00 90.03  ? 233 ASP A CB    1 
ATOM   2966 C CG    . ASP C 2 233 ? 77.515  20.340 119.862 1.00 87.93  ? 233 ASP A CG    1 
ATOM   2967 O OD1   . ASP C 2 233 ? 77.340  21.095 118.882 1.00 79.00  ? 233 ASP A OD1   1 
ATOM   2968 O OD2   . ASP C 2 233 ? 76.837  19.315 120.054 1.00 96.46  ? 233 ASP A OD2   1 
ATOM   2969 N N     . PRO C 2 234 ? 80.511  21.539 117.994 1.00 100.00 ? 234 PRO A N     1 
ATOM   2970 C CA    . PRO C 2 234 ? 80.583  22.658 117.053 1.00 94.74  ? 234 PRO A CA    1 
ATOM   2971 C C     . PRO C 2 234 ? 79.151  23.129 116.841 1.00 88.36  ? 234 PRO A C     1 
ATOM   2972 O O     . PRO C 2 234 ? 78.258  22.733 117.588 1.00 81.76  ? 234 PRO A O     1 
ATOM   2973 C CB    . PRO C 2 234 ? 81.210  22.045 115.798 1.00 97.30  ? 234 PRO A CB    1 
ATOM   2974 C CG    . PRO C 2 234 ? 80.996  20.571 115.929 1.00 100.00 ? 234 PRO A CG    1 
ATOM   2975 C CD    . PRO C 2 234 ? 80.926  20.260 117.391 1.00 100.00 ? 234 PRO A CD    1 
ATOM   2976 N N     . ASN C 2 235 ? 78.906  23.966 115.845 1.00 87.09  ? 235 ASN A N     1 
ATOM   2977 C CA    . ASN C 2 235 ? 77.541  24.434 115.632 1.00 94.25  ? 235 ASN A CA    1 
ATOM   2978 C C     . ASN C 2 235 ? 77.058  25.171 116.879 1.00 95.99  ? 235 ASN A C     1 
ATOM   2979 O O     . ASN C 2 235 ? 75.890  25.569 116.975 1.00 92.49  ? 235 ASN A O     1 
ATOM   2980 C CB    . ASN C 2 235 ? 76.604  23.255 115.346 1.00 97.73  ? 235 ASN A CB    1 
ATOM   2981 C CG    . ASN C 2 235 ? 77.352  21.960 115.115 1.00 100.00 ? 235 ASN A CG    1 
ATOM   2982 O OD1   . ASN C 2 235 ? 77.944  21.757 114.057 1.00 100.00 ? 235 ASN A OD1   1 
ATOM   2983 N ND2   . ASN C 2 235 ? 77.342  21.080 116.113 1.00 100.00 ? 235 ASN A ND2   1 
ATOM   2984 N N     . ASN C 2 236 ? 77.958  25.319 117.846 1.00 94.25  ? 236 ASN A N     1 
ATOM   2985 C CA    . ASN C 2 236 ? 77.647  26.038 119.070 1.00 91.54  ? 236 ASN A CA    1 
ATOM   2986 C C     . ASN C 2 236 ? 77.736  27.496 118.656 1.00 84.82  ? 236 ASN A C     1 
ATOM   2987 O O     . ASN C 2 236 ? 77.355  27.856 117.543 1.00 88.89  ? 236 ASN A O     1 
ATOM   2988 C CB    . ASN C 2 236 ? 78.693  25.746 120.150 1.00 91.06  ? 236 ASN A CB    1 
ATOM   2989 C CG    . ASN C 2 236 ? 78.237  24.701 121.144 1.00 83.70  ? 236 ASN A CG    1 
ATOM   2990 O OD1   . ASN C 2 236 ? 77.052  24.357 121.210 1.00 79.97  ? 236 ASN A OD1   1 
ATOM   2991 N ND2   . ASN C 2 236 ? 79.180  24.191 121.932 1.00 60.34  ? 236 ASN A ND2   1 
ATOM   2992 N N     . TYR C 2 237 ? 78.249  28.340 119.538 1.00 77.05  ? 237 TYR A N     1 
ATOM   2993 C CA    . TYR C 2 237 ? 78.393  29.741 119.204 1.00 70.86  ? 237 TYR A CA    1 
ATOM   2994 C C     . TYR C 2 237 ? 79.699  30.242 119.758 1.00 66.02  ? 237 TYR A C     1 
ATOM   2995 O O     . TYR C 2 237 ? 80.135  29.805 120.827 1.00 66.25  ? 237 TYR A O     1 
ATOM   2996 C CB    . TYR C 2 237 ? 77.261  30.544 119.800 1.00 76.83  ? 237 TYR A CB    1 
ATOM   2997 C CG    . TYR C 2 237 ? 75.941  30.317 119.128 1.00 78.03  ? 237 TYR A CG    1 
ATOM   2998 C CD1   . TYR C 2 237 ? 75.006  29.453 119.687 1.00 81.12  ? 237 TYR A CD1   1 
ATOM   2999 C CD2   . TYR C 2 237 ? 75.580  31.044 117.993 1.00 74.45  ? 237 TYR A CD2   1 
ATOM   3000 C CE1   . TYR C 2 237 ? 73.726  29.326 119.146 1.00 87.80  ? 237 TYR A CE1   1 
ATOM   3001 C CE2   . TYR C 2 237 ? 74.305  30.929 117.439 1.00 82.30  ? 237 TYR A CE2   1 
ATOM   3002 C CZ    . TYR C 2 237 ? 73.377  30.073 118.025 1.00 84.73  ? 237 TYR A CZ    1 
ATOM   3003 O OH    . TYR C 2 237 ? 72.089  30.001 117.532 1.00 84.00  ? 237 TYR A OH    1 
ATOM   3004 N N     . LEU C 2 238 ? 80.333  31.156 119.040 1.00 59.10  ? 238 LEU A N     1 
ATOM   3005 C CA    . LEU C 2 238 ? 81.586  31.677 119.517 1.00 61.82  ? 238 LEU A CA    1 
ATOM   3006 C C     . LEU C 2 238 ? 81.391  32.083 120.968 1.00 64.50  ? 238 LEU A C     1 
ATOM   3007 O O     . LEU C 2 238 ? 82.142  31.662 121.851 1.00 61.83  ? 238 LEU A O     1 
ATOM   3008 C CB    . LEU C 2 238 ? 82.009  32.886 118.691 1.00 65.34  ? 238 LEU A CB    1 
ATOM   3009 C CG    . LEU C 2 238 ? 83.494  32.907 118.300 1.00 71.42  ? 238 LEU A CG    1 
ATOM   3010 C CD1   . LEU C 2 238 ? 83.994  34.349 118.156 1.00 62.33  ? 238 LEU A CD1   1 
ATOM   3011 C CD2   . LEU C 2 238 ? 84.307  32.161 119.360 1.00 77.40  ? 238 LEU A CD2   1 
ATOM   3012 N N     . PHE C 2 239 ? 80.344  32.866 121.206 1.00 62.77  ? 239 PHE A N     1 
ATOM   3013 C CA    . PHE C 2 239 ? 80.044  33.365 122.540 1.00 67.62  ? 239 PHE A CA    1 
ATOM   3014 C C     . PHE C 2 239 ? 78.858  32.676 123.204 1.00 73.54  ? 239 PHE A C     1 
ATOM   3015 O O     . PHE C 2 239 ? 78.005  32.107 122.522 1.00 81.03  ? 239 PHE A O     1 
ATOM   3016 C CB    . PHE C 2 239 ? 79.797  34.873 122.456 1.00 67.49  ? 239 PHE A CB    1 
ATOM   3017 C CG    . PHE C 2 239 ? 80.994  35.648 121.989 1.00 65.72  ? 239 PHE A CG    1 
ATOM   3018 C CD1   . PHE C 2 239 ? 81.133  35.993 120.656 1.00 68.80  ? 239 PHE A CD1   1 
ATOM   3019 C CD2   . PHE C 2 239 ? 82.016  35.987 122.874 1.00 70.33  ? 239 PHE A CD2   1 
ATOM   3020 C CE1   . PHE C 2 239 ? 82.282  36.667 120.208 1.00 70.56  ? 239 PHE A CE1   1 
ATOM   3021 C CE2   . PHE C 2 239 ? 83.166  36.660 122.432 1.00 67.24  ? 239 PHE A CE2   1 
ATOM   3022 C CZ    . PHE C 2 239 ? 83.296  36.995 121.099 1.00 65.41  ? 239 PHE A CZ    1 
ATOM   3023 N N     . CYS C 2 240 ? 78.811  32.726 124.536 1.00 76.65  ? 240 CYS A N     1 
ATOM   3024 C CA    . CYS C 2 240 ? 77.715  32.118 125.293 1.00 71.97  ? 240 CYS A CA    1 
ATOM   3025 C C     . CYS C 2 240 ? 77.502  32.784 126.654 1.00 67.93  ? 240 CYS A C     1 
ATOM   3026 O O     . CYS C 2 240 ? 78.130  33.797 126.967 1.00 68.14  ? 240 CYS A O     1 
ATOM   3027 C CB    . CYS C 2 240 ? 77.977  30.625 125.487 1.00 72.28  ? 240 CYS A CB    1 
ATOM   3028 S SG    . CYS C 2 240 ? 79.271  30.278 126.672 1.00 73.86  ? 240 CYS A SG    1 
ATOM   3029 N N     . ARG C 2 241 ? 76.603  32.210 127.451 1.00 64.33  ? 241 ARG A N     1 
ATOM   3030 C CA    . ARG C 2 241 ? 76.280  32.709 128.792 1.00 59.10  ? 241 ARG A CA    1 
ATOM   3031 C C     . ARG C 2 241 ? 77.384  32.407 129.807 1.00 52.99  ? 241 ARG A C     1 
ATOM   3032 O O     . ARG C 2 241 ? 78.022  31.356 129.764 1.00 53.55  ? 241 ARG A O     1 
ATOM   3033 C CB    . ARG C 2 241 ? 74.976  32.074 129.292 1.00 63.60  ? 241 ARG A CB    1 
ATOM   3034 C CG    . ARG C 2 241 ? 73.833  33.055 129.601 1.00 64.61  ? 241 ARG A CG    1 
ATOM   3035 C CD    . ARG C 2 241 ? 73.246  32.843 131.004 1.00 51.33  ? 241 ARG A CD    1 
ATOM   3036 N NE    . ARG C 2 241 ? 71.825  32.500 130.993 1.00 59.35  ? 241 ARG A NE    1 
ATOM   3037 C CZ    . ARG C 2 241 ? 70.915  33.040 131.800 1.00 62.65  ? 241 ARG A CZ    1 
ATOM   3038 N NH1   . ARG C 2 241 ? 71.272  33.951 132.689 1.00 68.03  ? 241 ARG A NH1   1 
ATOM   3039 N NH2   . ARG C 2 241 ? 69.646  32.658 131.728 1.00 58.73  ? 241 ARG A NH2   1 
ATOM   3040 N N     . VAL C 2 242 ? 77.593  33.331 130.734 1.00 48.57  ? 242 VAL A N     1 
ATOM   3041 C CA    . VAL C 2 242 ? 78.613  33.152 131.747 1.00 45.92  ? 242 VAL A CA    1 
ATOM   3042 C C     . VAL C 2 242 ? 78.055  33.446 133.120 1.00 47.51  ? 242 VAL A C     1 
ATOM   3043 O O     . VAL C 2 242 ? 78.113  34.574 133.613 1.00 38.09  ? 242 VAL A O     1 
ATOM   3044 C CB    . VAL C 2 242 ? 79.828  34.052 131.500 1.00 53.91  ? 242 VAL A CB    1 
ATOM   3045 C CG1   . VAL C 2 242 ? 80.937  33.691 132.479 1.00 51.79  ? 242 VAL A CG1   1 
ATOM   3046 C CG2   . VAL C 2 242 ? 80.308  33.886 130.068 1.00 51.23  ? 242 VAL A CG2   1 
ATOM   3047 N N     . ARG C 2 243 ? 77.514  32.388 133.711 1.00 55.41  ? 243 ARG A N     1 
ATOM   3048 C CA    . ARG C 2 243 ? 76.920  32.387 135.033 1.00 56.52  ? 243 ARG A CA    1 
ATOM   3049 C C     . ARG C 2 243 ? 77.746  33.190 136.036 1.00 54.78  ? 243 ARG A C     1 
ATOM   3050 O O     . ARG C 2 243 ? 78.932  33.476 135.828 1.00 49.56  ? 243 ARG A O     1 
ATOM   3051 C CB    . ARG C 2 243 ? 76.770  30.934 135.512 1.00 60.25  ? 243 ARG A CB    1 
ATOM   3052 C CG    . ARG C 2 243 ? 75.513  30.190 135.028 1.00 56.50  ? 243 ARG A CG    1 
ATOM   3053 C CD    . ARG C 2 243 ? 75.748  29.428 133.725 1.00 69.80  ? 243 ARG A CD    1 
ATOM   3054 N NE    . ARG C 2 243 ? 74.545  28.860 133.087 1.00 80.62  ? 243 ARG A NE    1 
ATOM   3055 C CZ    . ARG C 2 243 ? 73.281  29.244 133.296 1.00 74.27  ? 243 ARG A CZ    1 
ATOM   3056 N NH1   . ARG C 2 243 ? 72.984  30.210 134.148 1.00 66.86  ? 243 ARG A NH1   1 
ATOM   3057 N NH2   . ARG C 2 243 ? 72.294  28.663 132.626 1.00 68.48  ? 243 ARG A NH2   1 
ATOM   3058 N N     . LYS C 2 244 ? 77.095  33.551 137.129 1.00 52.17  ? 244 LYS A N     1 
ATOM   3059 C CA    . LYS C 2 244 ? 77.732  34.325 138.163 1.00 48.37  ? 244 LYS A CA    1 
ATOM   3060 C C     . LYS C 2 244 ? 78.798  33.512 138.888 1.00 52.09  ? 244 LYS A C     1 
ATOM   3061 O O     . LYS C 2 244 ? 79.591  34.061 139.647 1.00 43.08  ? 244 LYS A O     1 
ATOM   3062 C CB    . LYS C 2 244 ? 76.658  34.849 139.108 1.00 38.84  ? 244 LYS A CB    1 
ATOM   3063 C CG    . LYS C 2 244 ? 77.012  34.791 140.548 1.00 49.06  ? 244 LYS A CG    1 
ATOM   3064 C CD    . LYS C 2 244 ? 75.794  34.433 141.351 1.00 49.96  ? 244 LYS A CD    1 
ATOM   3065 C CE    . LYS C 2 244 ? 75.460  35.528 142.346 1.00 52.43  ? 244 LYS A CE    1 
ATOM   3066 N NZ    . LYS C 2 244 ? 74.529  35.064 143.407 1.00 48.11  ? 244 LYS A NZ    1 
ATOM   3067 N N     . ASN C 2 245 ? 78.828  32.204 138.649 1.00 50.58  ? 245 ASN A N     1 
ATOM   3068 C CA    . ASN C 2 245 ? 79.838  31.367 139.287 1.00 49.57  ? 245 ASN A CA    1 
ATOM   3069 C C     . ASN C 2 245 ? 81.086  31.310 138.416 1.00 52.82  ? 245 ASN A C     1 
ATOM   3070 O O     . ASN C 2 245 ? 81.982  30.490 138.648 1.00 55.69  ? 245 ASN A O     1 
ATOM   3071 C CB    . ASN C 2 245 ? 79.323  29.955 139.498 1.00 44.39  ? 245 ASN A CB    1 
ATOM   3072 C CG    . ASN C 2 245 ? 79.100  29.261 138.216 1.00 53.06  ? 245 ASN A CG    1 
ATOM   3073 O OD1   . ASN C 2 245 ? 79.127  28.044 138.141 1.00 69.78  ? 245 ASN A OD1   1 
ATOM   3074 N ND2   . ASN C 2 245 ? 78.885  30.044 137.172 1.00 60.28  ? 245 ASN A ND2   1 
ATOM   3075 N N     . GLY C 2 246 ? 81.118  32.159 137.391 1.00 54.52  ? 246 GLY A N     1 
ATOM   3076 C CA    . GLY C 2 246 ? 82.271  32.228 136.509 1.00 53.64  ? 246 GLY A CA    1 
ATOM   3077 C C     . GLY C 2 246 ? 82.385  31.087 135.517 1.00 59.41  ? 246 GLY A C     1 
ATOM   3078 O O     . GLY C 2 246 ? 83.418  30.931 134.871 1.00 56.73  ? 246 GLY A O     1 
ATOM   3079 N N     . VAL C 2 247 ? 81.325  30.292 135.395 1.00 60.16  ? 247 VAL A N     1 
ATOM   3080 C CA    . VAL C 2 247 ? 81.299  29.158 134.477 1.00 61.50  ? 247 VAL A CA    1 
ATOM   3081 C C     . VAL C 2 247 ? 80.520  29.464 133.199 1.00 65.64  ? 247 VAL A C     1 
ATOM   3082 O O     . VAL C 2 247 ? 79.470  30.109 133.242 1.00 67.66  ? 247 VAL A O     1 
ATOM   3083 C CB    . VAL C 2 247 ? 80.667  27.935 135.139 1.00 59.50  ? 247 VAL A CB    1 
ATOM   3084 C CG1   . VAL C 2 247 ? 80.097  26.999 134.072 1.00 60.89  ? 247 VAL A CG1   1 
ATOM   3085 C CG2   . VAL C 2 247 ? 81.703  27.231 135.985 1.00 66.95  ? 247 VAL A CG2   1 
ATOM   3086 N N     . ALA C 2 248 ? 81.031  28.986 132.067 1.00 66.72  ? 248 ALA A N     1 
ATOM   3087 C CA    . ALA C 2 248 ? 80.385  29.225 130.779 1.00 70.37  ? 248 ALA A CA    1 
ATOM   3088 C C     . ALA C 2 248 ? 78.996  28.606 130.714 1.00 74.96  ? 248 ALA A C     1 
ATOM   3089 O O     . ALA C 2 248 ? 78.240  28.653 131.687 1.00 83.64  ? 248 ALA A O     1 
ATOM   3090 C CB    . ALA C 2 248 ? 81.256  28.677 129.652 1.00 68.40  ? 248 ALA A CB    1 
ATOM   3091 N N     . ALA C 2 249 ? 78.676  28.044 129.550 1.00 73.77  ? 249 ALA A N     1 
ATOM   3092 C CA    . ALA C 2 249 ? 77.403  27.383 129.274 1.00 69.48  ? 249 ALA A CA    1 
ATOM   3093 C C     . ALA C 2 249 ? 77.147  27.394 127.768 1.00 63.60  ? 249 ALA A C     1 
ATOM   3094 O O     . ALA C 2 249 ? 76.149  27.949 127.308 1.00 61.82  ? 249 ALA A O     1 
ATOM   3095 C CB    . ALA C 2 249 ? 76.250  28.081 130.003 1.00 66.95  ? 249 ALA A CB    1 
ATOM   3096 N N     . PRO C 2 250 ? 78.066  26.810 126.977 1.00 59.84  ? 250 PRO A N     1 
ATOM   3097 C CA    . PRO C 2 250 ? 77.905  26.767 125.518 1.00 62.38  ? 250 PRO A CA    1 
ATOM   3098 C C     . PRO C 2 250 ? 76.536  26.236 125.122 1.00 66.73  ? 250 PRO A C     1 
ATOM   3099 O O     . PRO C 2 250 ? 75.899  25.515 125.891 1.00 67.28  ? 250 PRO A O     1 
ATOM   3100 C CB    . PRO C 2 250 ? 79.036  25.854 125.058 1.00 63.88  ? 250 PRO A CB    1 
ATOM   3101 C CG    . PRO C 2 250 ? 80.092  26.027 126.114 1.00 70.23  ? 250 PRO A CG    1 
ATOM   3102 C CD    . PRO C 2 250 ? 79.331  26.187 127.407 1.00 66.52  ? 250 PRO A CD    1 
ATOM   3103 N N     . SER C 2 251 ? 76.089  26.599 123.923 1.00 71.77  ? 251 SER A N     1 
ATOM   3104 C CA    . SER C 2 251 ? 74.785  26.168 123.436 1.00 68.75  ? 251 SER A CA    1 
ATOM   3105 C C     . SER C 2 251 ? 74.718  26.095 121.914 1.00 69.23  ? 251 SER A C     1 
ATOM   3106 O O     . SER C 2 251 ? 75.695  26.329 121.210 1.00 64.23  ? 251 SER A O     1 
ATOM   3107 C CB    . SER C 2 251 ? 73.705  27.133 123.943 1.00 60.76  ? 251 SER A CB    1 
ATOM   3108 O OG    . SER C 2 251 ? 72.401  26.613 123.738 1.00 63.06  ? 251 SER A OG    1 
ATOM   3109 N N     . ALA C 2 252 ? 73.537  25.746 121.426 1.00 71.88  ? 252 ALA A N     1 
ATOM   3110 C CA    . ALA C 2 252 ? 73.251  25.661 120.003 1.00 70.51  ? 252 ALA A CA    1 
ATOM   3111 C C     . ALA C 2 252 ? 71.734  25.635 119.973 1.00 70.63  ? 252 ALA A C     1 
ATOM   3112 O O     . ALA C 2 252 ? 71.114  25.029 119.108 1.00 73.22  ? 252 ALA A O     1 
ATOM   3113 C CB    . ALA C 2 252 ? 73.828  24.391 119.407 1.00 67.32  ? 252 ALA A CB    1 
ATOM   3114 N N     . THR C 2 253 ? 71.155  26.303 120.962 1.00 74.05  ? 253 THR A N     1 
ATOM   3115 C CA    . THR C 2 253 ? 69.711  26.395 121.118 1.00 81.52  ? 253 THR A CA    1 
ATOM   3116 C C     . THR C 2 253 ? 69.363  27.773 121.680 1.00 84.58  ? 253 THR A C     1 
ATOM   3117 O O     . THR C 2 253 ? 68.273  28.303 121.448 1.00 80.35  ? 253 THR A O     1 
ATOM   3118 C CB    . THR C 2 253 ? 69.203  25.333 122.106 1.00 84.27  ? 253 THR A CB    1 
ATOM   3119 O OG1   . THR C 2 253 ? 68.931  25.950 123.372 1.00 87.57  ? 253 THR A OG1   1 
ATOM   3120 C CG2   . THR C 2 253 ? 70.255  24.244 122.315 1.00 89.24  ? 253 THR A CG2   1 
ATOM   3121 N N     . SER C 2 254 ? 70.311  28.334 122.428 1.00 87.68  ? 254 SER A N     1 
ATOM   3122 C CA    . SER C 2 254 ? 70.165  29.641 123.061 1.00 82.99  ? 254 SER A CA    1 
ATOM   3123 C C     . SER C 2 254 ? 70.893  30.752 122.315 1.00 84.99  ? 254 SER A C     1 
ATOM   3124 O O     . SER C 2 254 ? 72.091  30.655 122.026 1.00 74.31  ? 254 SER A O     1 
ATOM   3125 C CB    . SER C 2 254 ? 70.721  29.592 124.468 1.00 89.36  ? 254 SER A CB    1 
ATOM   3126 O OG    . SER C 2 254 ? 72.074  30.026 124.485 1.00 91.09  ? 254 SER A OG    1 
ATOM   3127 N N     . GLN C 2 255 ? 70.163  31.824 122.035 1.00 89.30  ? 255 GLN A N     1 
ATOM   3128 C CA    . GLN C 2 255 ? 70.707  32.976 121.323 1.00 91.39  ? 255 GLN A CA    1 
ATOM   3129 C C     . GLN C 2 255 ? 71.072  34.082 122.316 1.00 91.70  ? 255 GLN A C     1 
ATOM   3130 O O     . GLN C 2 255 ? 70.190  34.640 122.981 1.00 95.28  ? 255 GLN A O     1 
ATOM   3131 C CB    . GLN C 2 255 ? 69.668  33.491 120.316 1.00 92.96  ? 255 GLN A CB    1 
ATOM   3132 C CG    . GLN C 2 255 ? 68.662  32.424 119.857 1.00 100.00 ? 255 GLN A CG    1 
ATOM   3133 C CD    . GLN C 2 255 ? 68.717  32.159 118.354 1.00 100.00 ? 255 GLN A CD    1 
ATOM   3134 O OE1   . GLN C 2 255 ? 68.625  33.087 117.549 1.00 100.00 ? 255 GLN A OE1   1 
ATOM   3135 N NE2   . GLN C 2 255 ? 68.865  30.888 117.972 1.00 100.00 ? 255 GLN A NE2   1 
ATOM   3136 N N     . LEU C 2 256 ? 72.365  34.394 122.418 1.00 83.04  ? 256 LEU A N     1 
ATOM   3137 C CA    . LEU C 2 256 ? 72.836  35.431 123.341 1.00 69.02  ? 256 LEU A CA    1 
ATOM   3138 C C     . LEU C 2 256 ? 72.248  36.818 123.068 1.00 66.00  ? 256 LEU A C     1 
ATOM   3139 O O     . LEU C 2 256 ? 72.657  37.498 122.121 1.00 62.44  ? 256 LEU A O     1 
ATOM   3140 C CB    . LEU C 2 256 ? 74.361  35.507 123.308 1.00 63.02  ? 256 LEU A CB    1 
ATOM   3141 C CG    . LEU C 2 256 ? 75.047  35.573 124.681 1.00 63.78  ? 256 LEU A CG    1 
ATOM   3142 C CD1   . LEU C 2 256 ? 76.409  36.232 124.548 1.00 60.80  ? 256 LEU A CD1   1 
ATOM   3143 C CD2   . LEU C 2 256 ? 74.182  36.349 125.672 1.00 66.00  ? 256 LEU A CD2   1 
ATOM   3144 N N     . SER C 2 257 ? 71.313  37.236 123.925 1.00 61.71  ? 257 SER A N     1 
ATOM   3145 C CA    . SER C 2 257 ? 70.626  38.519 123.786 1.00 55.43  ? 257 SER A CA    1 
ATOM   3146 C C     . SER C 2 257 ? 71.556  39.609 123.300 1.00 53.35  ? 257 SER A C     1 
ATOM   3147 O O     . SER C 2 257 ? 72.659  39.762 123.815 1.00 52.48  ? 257 SER A O     1 
ATOM   3148 C CB    . SER C 2 257 ? 70.016  38.944 125.118 1.00 49.05  ? 257 SER A CB    1 
ATOM   3149 O OG    . SER C 2 257 ? 69.943  40.356 125.193 1.00 68.78  ? 257 SER A OG    1 
ATOM   3150 N N     . THR C 2 258 ? 71.110  40.364 122.302 1.00 45.02  ? 258 THR A N     1 
ATOM   3151 C CA    . THR C 2 258 ? 71.935  41.435 121.779 1.00 45.50  ? 258 THR A CA    1 
ATOM   3152 C C     . THR C 2 258 ? 72.167  42.339 122.947 1.00 42.39  ? 258 THR A C     1 
ATOM   3153 O O     . THR C 2 258 ? 73.275  42.855 123.138 1.00 43.82  ? 258 THR A O     1 
ATOM   3154 C CB    . THR C 2 258 ? 71.227  42.262 120.699 1.00 48.37  ? 258 THR A CB    1 
ATOM   3155 O OG1   . THR C 2 258 ? 69.819  42.281 120.960 1.00 56.54  ? 258 THR A OG1   1 
ATOM   3156 C CG2   . THR C 2 258 ? 71.501  41.686 119.312 1.00 37.33  ? 258 THR A CG2   1 
ATOM   3157 N N     . ARG C 2 259 ? 71.108  42.522 123.732 1.00 35.38  ? 259 ARG A N     1 
ATOM   3158 C CA    . ARG C 2 259 ? 71.205  43.376 124.897 1.00 38.61  ? 259 ARG A CA    1 
ATOM   3159 C C     . ARG C 2 259 ? 72.458  43.002 125.676 1.00 39.89  ? 259 ARG A C     1 
ATOM   3160 O O     . ARG C 2 259 ? 73.293  43.860 125.985 1.00 45.46  ? 259 ARG A O     1 
ATOM   3161 C CB    . ARG C 2 259 ? 69.969  43.239 125.781 1.00 31.28  ? 259 ARG A CB    1 
ATOM   3162 C CG    . ARG C 2 259 ? 69.912  44.296 126.880 1.00 26.12  ? 259 ARG A CG    1 
ATOM   3163 C CD    . ARG C 2 259 ? 68.805  45.300 126.627 1.00 24.78  ? 259 ARG A CD    1 
ATOM   3164 N NE    . ARG C 2 259 ? 68.868  46.436 127.541 1.00 23.47  ? 259 ARG A NE    1 
ATOM   3165 C CZ    . ARG C 2 259 ? 69.985  47.072 127.879 1.00 27.27  ? 259 ARG A CZ    1 
ATOM   3166 N NH1   . ARG C 2 259 ? 71.153  46.685 127.378 1.00 20.75  ? 259 ARG A NH1   1 
ATOM   3167 N NH2   . ARG C 2 259 ? 69.927  48.109 128.714 1.00 18.66  ? 259 ARG A NH2   1 
ATOM   3168 N N     . ALA C 2 260 ? 72.610  41.718 125.969 1.00 30.75  ? 260 ALA A N     1 
ATOM   3169 C CA    . ALA C 2 260 ? 73.788  41.290 126.700 1.00 35.15  ? 260 ALA A CA    1 
ATOM   3170 C C     . ALA C 2 260 ? 75.017  41.880 126.034 1.00 29.24  ? 260 ALA A C     1 
ATOM   3171 O O     . ALA C 2 260 ? 75.846  42.516 126.678 1.00 38.37  ? 260 ALA A O     1 
ATOM   3172 C CB    . ALA C 2 260 ? 73.872  39.774 126.725 1.00 19.85  ? 260 ALA A CB    1 
ATOM   3173 N N     . LEU C 2 261 ? 75.113  41.705 124.727 1.00 33.89  ? 261 LEU A N     1 
ATOM   3174 C CA    . LEU C 2 261 ? 76.268  42.213 124.011 1.00 37.42  ? 261 LEU A CA    1 
ATOM   3175 C C     . LEU C 2 261 ? 76.446  43.682 124.268 1.00 30.71  ? 261 LEU A C     1 
ATOM   3176 O O     . LEU C 2 261 ? 77.545  44.150 124.502 1.00 35.40  ? 261 LEU A O     1 
ATOM   3177 C CB    . LEU C 2 261 ? 76.123  41.962 122.516 1.00 38.58  ? 261 LEU A CB    1 
ATOM   3178 C CG    . LEU C 2 261 ? 76.247  40.465 122.240 1.00 46.25  ? 261 LEU A CG    1 
ATOM   3179 C CD1   . LEU C 2 261 ? 74.880  39.830 122.355 1.00 50.36  ? 261 LEU A CD1   1 
ATOM   3180 C CD2   . LEU C 2 261 ? 76.822  40.214 120.860 1.00 53.82  ? 261 LEU A CD2   1 
ATOM   3181 N N     . GLU C 2 262 ? 75.349  44.413 124.217 1.00 31.93  ? 262 GLU A N     1 
ATOM   3182 C CA    . GLU C 2 262 ? 75.400  45.848 124.447 1.00 39.68  ? 262 GLU A CA    1 
ATOM   3183 C C     . GLU C 2 262 ? 75.863  46.062 125.863 1.00 39.67  ? 262 GLU A C     1 
ATOM   3184 O O     . GLU C 2 262 ? 76.510  47.060 126.184 1.00 40.05  ? 262 GLU A O     1 
ATOM   3185 C CB    . GLU C 2 262 ? 74.011  46.482 124.280 1.00 51.04  ? 262 GLU A CB    1 
ATOM   3186 C CG    . GLU C 2 262 ? 73.295  46.192 122.962 1.00 53.07  ? 262 GLU A CG    1 
ATOM   3187 C CD    . GLU C 2 262 ? 71.924  46.854 122.900 1.00 55.52  ? 262 GLU A CD    1 
ATOM   3188 O OE1   . GLU C 2 262 ? 71.761  47.815 122.118 1.00 63.17  ? 262 GLU A OE1   1 
ATOM   3189 O OE2   . GLU C 2 262 ? 71.013  46.422 123.642 1.00 57.03  ? 262 GLU A OE2   1 
ATOM   3190 N N     . GLY C 2 263 ? 75.525  45.104 126.711 1.00 39.09  ? 263 GLY A N     1 
ATOM   3191 C CA    . GLY C 2 263 ? 75.899  45.221 128.103 1.00 42.72  ? 263 GLY A CA    1 
ATOM   3192 C C     . GLY C 2 263 ? 77.400  45.214 128.225 1.00 42.05  ? 263 GLY A C     1 
ATOM   3193 O O     . GLY C 2 263 ? 77.980  46.074 128.890 1.00 41.80  ? 263 GLY A O     1 
ATOM   3194 N N     . ILE C 2 264 ? 78.017  44.249 127.552 1.00 36.83  ? 264 ILE A N     1 
ATOM   3195 C CA    . ILE C 2 264 ? 79.453  44.092 127.579 1.00 33.48  ? 264 ILE A CA    1 
ATOM   3196 C C     . ILE C 2 264 ? 80.121  45.435 127.385 1.00 34.64  ? 264 ILE A C     1 
ATOM   3197 O O     . ILE C 2 264 ? 81.044  45.791 128.111 1.00 43.58  ? 264 ILE A O     1 
ATOM   3198 C CB    . ILE C 2 264 ? 79.897  43.122 126.486 1.00 30.34  ? 264 ILE A CB    1 
ATOM   3199 C CG1   . ILE C 2 264 ? 79.611  41.693 126.950 1.00 31.11  ? 264 ILE A CG1   1 
ATOM   3200 C CG2   . ILE C 2 264 ? 81.358  43.327 126.160 1.00 30.47  ? 264 ILE A CG2   1 
ATOM   3201 C CD1   . ILE C 2 264 ? 79.343  40.731 125.819 1.00 32.97  ? 264 ILE A CD1   1 
ATOM   3202 N N     . PHE C 2 265 ? 79.636  46.189 126.412 1.00 27.59  ? 265 PHE A N     1 
ATOM   3203 C CA    . PHE C 2 265 ? 80.202  47.494 126.128 1.00 34.05  ? 265 PHE A CA    1 
ATOM   3204 C C     . PHE C 2 265 ? 79.991  48.390 127.315 1.00 43.24  ? 265 PHE A C     1 
ATOM   3205 O O     . PHE C 2 265 ? 80.939  48.953 127.876 1.00 49.71  ? 265 PHE A O     1 
ATOM   3206 C CB    . PHE C 2 265 ? 79.509  48.128 124.939 1.00 39.00  ? 265 PHE A CB    1 
ATOM   3207 C CG    . PHE C 2 265 ? 80.180  47.867 123.627 1.00 36.47  ? 265 PHE A CG    1 
ATOM   3208 C CD1   . PHE C 2 265 ? 81.416  48.435 123.334 1.00 42.27  ? 265 PHE A CD1   1 
ATOM   3209 C CD2   . PHE C 2 265 ? 79.541  47.104 122.662 1.00 34.52  ? 265 PHE A CD2   1 
ATOM   3210 C CE1   . PHE C 2 265 ? 82.000  48.254 122.098 1.00 42.72  ? 265 PHE A CE1   1 
ATOM   3211 C CE2   . PHE C 2 265 ? 80.107  46.912 121.427 1.00 43.29  ? 265 PHE A CE2   1 
ATOM   3212 C CZ    . PHE C 2 265 ? 81.344  47.489 121.135 1.00 50.42  ? 265 PHE A CZ    1 
ATOM   3213 N N     . GLU C 2 266 ? 78.720  48.547 127.663 1.00 42.56  ? 266 GLU A N     1 
ATOM   3214 C CA    . GLU C 2 266 ? 78.349  49.365 128.787 1.00 44.90  ? 266 GLU A CA    1 
ATOM   3215 C C     . GLU C 2 266 ? 79.259  49.087 129.977 1.00 41.88  ? 266 GLU A C     1 
ATOM   3216 O O     . GLU C 2 266 ? 80.060  49.934 130.357 1.00 38.30  ? 266 GLU A O     1 
ATOM   3217 C CB    . GLU C 2 266 ? 76.913  49.076 129.168 1.00 51.96  ? 266 GLU A CB    1 
ATOM   3218 C CG    . GLU C 2 266 ? 75.906  49.790 128.294 1.00 78.55  ? 266 GLU A CG    1 
ATOM   3219 C CD    . GLU C 2 266 ? 74.506  49.733 128.872 1.00 90.36  ? 266 GLU A CD    1 
ATOM   3220 O OE1   . GLU C 2 266 ? 73.672  48.972 128.331 1.00 95.10  ? 266 GLU A OE1   1 
ATOM   3221 O OE2   . GLU C 2 266 ? 74.243  50.446 129.867 1.00 94.27  ? 266 GLU A OE2   1 
ATOM   3222 N N     . ALA C 2 267 ? 79.131  47.891 130.549 1.00 41.54  ? 267 ALA A N     1 
ATOM   3223 C CA    . ALA C 2 267 ? 79.916  47.485 131.709 1.00 31.49  ? 267 ALA A CA    1 
ATOM   3224 C C     . ALA C 2 267 ? 81.353  47.874 131.502 1.00 35.54  ? 267 ALA A C     1 
ATOM   3225 O O     . ALA C 2 267 ? 81.977  48.502 132.351 1.00 42.62  ? 267 ALA A O     1 
ATOM   3226 C CB    . ALA C 2 267 ? 79.815  45.981 131.908 1.00 31.40  ? 267 ALA A CB    1 
ATOM   3227 N N     . THR C 2 268 ? 81.875  47.511 130.346 1.00 34.65  ? 268 THR A N     1 
ATOM   3228 C CA    . THR C 2 268 ? 83.250  47.818 130.046 1.00 38.00  ? 268 THR A CA    1 
ATOM   3229 C C     . THR C 2 268 ? 83.499  49.302 130.249 1.00 38.33  ? 268 THR A C     1 
ATOM   3230 O O     . THR C 2 268 ? 84.523  49.703 130.786 1.00 41.58  ? 268 THR A O     1 
ATOM   3231 C CB    . THR C 2 268 ? 83.574  47.413 128.612 1.00 33.68  ? 268 THR A CB    1 
ATOM   3232 O OG1   . THR C 2 268 ? 83.479  45.990 128.508 1.00 28.30  ? 268 THR A OG1   1 
ATOM   3233 C CG2   . THR C 2 268 ? 84.969  47.840 128.231 1.00 28.84  ? 268 THR A CG2   1 
ATOM   3234 N N     . HIS C 2 269 ? 82.544  50.121 129.844 1.00 37.93  ? 269 HIS A N     1 
ATOM   3235 C CA    . HIS C 2 269 ? 82.713  51.552 129.997 1.00 40.83  ? 269 HIS A CA    1 
ATOM   3236 C C     . HIS C 2 269 ? 82.642  51.943 131.469 1.00 42.07  ? 269 HIS A C     1 
ATOM   3237 O O     . HIS C 2 269 ? 83.530  52.598 131.969 1.00 50.25  ? 269 HIS A O     1 
ATOM   3238 C CB    . HIS C 2 269 ? 81.652  52.292 129.197 1.00 38.70  ? 269 HIS A CB    1 
ATOM   3239 C CG    . HIS C 2 269 ? 81.622  53.756 129.471 1.00 49.29  ? 269 HIS A CG    1 
ATOM   3240 N ND1   . HIS C 2 269 ? 82.133  54.689 128.594 1.00 45.25  ? 269 HIS A ND1   1 
ATOM   3241 C CD2   . HIS C 2 269 ? 81.162  54.449 130.540 1.00 49.93  ? 269 HIS A CD2   1 
ATOM   3242 C CE1   . HIS C 2 269 ? 81.988  55.897 129.110 1.00 58.44  ? 269 HIS A CE1   1 
ATOM   3243 N NE2   . HIS C 2 269 ? 81.403  55.777 130.290 1.00 59.09  ? 269 HIS A NE2   1 
ATOM   3244 N N     . ARG C 2 270 ? 81.587  51.544 132.165 1.00 48.76  ? 270 ARG A N     1 
ATOM   3245 C CA    . ARG C 2 270 ? 81.447  51.855 133.589 1.00 55.54  ? 270 ARG A CA    1 
ATOM   3246 C C     . ARG C 2 270 ? 82.624  51.276 134.396 1.00 56.70  ? 270 ARG A C     1 
ATOM   3247 O O     . ARG C 2 270 ? 82.921  51.717 135.517 1.00 51.63  ? 270 ARG A O     1 
ATOM   3248 C CB    . ARG C 2 270 ? 80.126  51.279 134.109 1.00 51.33  ? 270 ARG A CB    1 
ATOM   3249 C CG    . ARG C 2 270 ? 79.706  51.776 135.474 1.00 56.34  ? 270 ARG A CG    1 
ATOM   3250 C CD    . ARG C 2 270 ? 78.817  50.749 136.143 1.00 72.81  ? 270 ARG A CD    1 
ATOM   3251 N NE    . ARG C 2 270 ? 79.336  49.398 135.949 1.00 88.38  ? 270 ARG A NE    1 
ATOM   3252 C CZ    . ARG C 2 270 ? 78.800  48.494 135.134 1.00 95.53  ? 270 ARG A CZ    1 
ATOM   3253 N NH1   . ARG C 2 270 ? 77.720  48.790 134.423 1.00 93.53  ? 270 ARG A NH1   1 
ATOM   3254 N NH2   . ARG C 2 270 ? 79.350  47.290 135.027 1.00 100.00 ? 270 ARG A NH2   1 
ATOM   3255 N N     . LEU C 2 271 ? 83.287  50.285 133.810 1.00 52.75  ? 271 LEU A N     1 
ATOM   3256 C CA    . LEU C 2 271 ? 84.422  49.629 134.442 1.00 48.51  ? 271 LEU A CA    1 
ATOM   3257 C C     . LEU C 2 271 ? 85.643  50.518 134.331 1.00 50.30  ? 271 LEU A C     1 
ATOM   3258 O O     . LEU C 2 271 ? 86.570  50.413 135.120 1.00 56.47  ? 271 LEU A O     1 
ATOM   3259 C CB    . LEU C 2 271 ? 84.700  48.281 133.757 1.00 50.36  ? 271 LEU A CB    1 
ATOM   3260 C CG    . LEU C 2 271 ? 86.087  47.625 133.855 1.00 44.93  ? 271 LEU A CG    1 
ATOM   3261 C CD1   . LEU C 2 271 ? 87.104  48.398 133.035 1.00 43.45  ? 271 LEU A CD1   1 
ATOM   3262 C CD2   . LEU C 2 271 ? 86.511  47.542 135.297 1.00 38.16  ? 271 LEU A CD2   1 
ATOM   3263 N N     . ILE C 2 272 ? 85.644  51.377 133.323 1.00 53.23  ? 272 ILE A N     1 
ATOM   3264 C CA    . ILE C 2 272 ? 86.760  52.286 133.077 1.00 58.88  ? 272 ILE A CA    1 
ATOM   3265 C C     . ILE C 2 272 ? 86.426  53.749 133.381 1.00 68.54  ? 272 ILE A C     1 
ATOM   3266 O O     . ILE C 2 272 ? 87.323  54.551 133.645 1.00 74.22  ? 272 ILE A O     1 
ATOM   3267 C CB    . ILE C 2 272 ? 87.228  52.184 131.594 1.00 56.52  ? 272 ILE A CB    1 
ATOM   3268 C CG1   . ILE C 2 272 ? 88.175  50.997 131.426 1.00 46.11  ? 272 ILE A CG1   1 
ATOM   3269 C CG2   . ILE C 2 272 ? 87.911  53.477 131.146 1.00 40.31  ? 272 ILE A CG2   1 
ATOM   3270 C CD1   . ILE C 2 272 ? 88.469  50.683 129.971 1.00 42.07  ? 272 ILE A CD1   1 
ATOM   3271 N N     . TYR C 2 273 ? 85.141  54.089 133.347 1.00 72.70  ? 273 TYR A N     1 
ATOM   3272 C CA    . TYR C 2 273 ? 84.698  55.456 133.584 1.00 68.74  ? 273 TYR A CA    1 
ATOM   3273 C C     . TYR C 2 273 ? 83.697  55.537 134.699 1.00 68.98  ? 273 TYR A C     1 
ATOM   3274 O O     . TYR C 2 273 ? 82.959  56.507 134.795 1.00 73.14  ? 273 TYR A O     1 
ATOM   3275 C CB    . TYR C 2 273 ? 84.078  56.031 132.318 1.00 65.95  ? 273 TYR A CB    1 
ATOM   3276 C CG    . TYR C 2 273 ? 85.123  56.477 131.357 1.00 71.80  ? 273 TYR A CG    1 
ATOM   3277 C CD1   . TYR C 2 273 ? 85.251  55.886 130.106 1.00 74.53  ? 273 TYR A CD1   1 
ATOM   3278 C CD2   . TYR C 2 273 ? 86.032  57.458 131.723 1.00 82.46  ? 273 TYR A CD2   1 
ATOM   3279 C CE1   . TYR C 2 273 ? 86.269  56.263 129.236 1.00 85.21  ? 273 TYR A CE1   1 
ATOM   3280 C CE2   . TYR C 2 273 ? 87.054  57.846 130.869 1.00 95.07  ? 273 TYR A CE2   1 
ATOM   3281 C CZ    . TYR C 2 273 ? 87.169  57.245 129.623 1.00 95.34  ? 273 TYR A CZ    1 
ATOM   3282 O OH    . TYR C 2 273 ? 88.182  57.624 128.762 1.00 100.00 ? 273 TYR A OH    1 
ATOM   3283 N N     . GLY C 2 274 ? 83.671  54.510 135.536 1.00 72.72  ? 274 GLY A N     1 
ATOM   3284 C CA    . GLY C 2 274 ? 82.743  54.490 136.649 1.00 76.25  ? 274 GLY A CA    1 
ATOM   3285 C C     . GLY C 2 274 ? 81.278  54.554 136.265 1.00 77.36  ? 274 GLY A C     1 
ATOM   3286 O O     . GLY C 2 274 ? 80.912  54.464 135.090 1.00 76.92  ? 274 GLY A O     1 
ATOM   3287 N N     . ALA C 2 275 ? 80.439  54.727 137.278 1.00 78.32  ? 275 ALA A N     1 
ATOM   3288 C CA    . ALA C 2 275 ? 79.006  54.798 137.092 1.00 81.29  ? 275 ALA A CA    1 
ATOM   3289 C C     . ALA C 2 275 ? 78.645  55.763 135.982 1.00 87.69  ? 275 ALA A C     1 
ATOM   3290 O O     . ALA C 2 275 ? 79.336  56.753 135.744 1.00 88.65  ? 275 ALA A O     1 
ATOM   3291 C CB    . ALA C 2 275 ? 78.335  55.219 138.388 1.00 87.59  ? 275 ALA A CB    1 
ATOM   3292 N N     . LYS C 2 276 ? 77.547  55.451 135.305 1.00 94.25  ? 276 LYS A N     1 
ATOM   3293 C CA    . LYS C 2 276 ? 77.043  56.261 134.212 1.00 92.08  ? 276 LYS A CA    1 
ATOM   3294 C C     . LYS C 2 276 ? 77.050  57.736 134.582 1.00 92.03  ? 276 LYS A C     1 
ATOM   3295 O O     . LYS C 2 276 ? 77.266  58.105 135.738 1.00 94.25  ? 276 LYS A O     1 
ATOM   3296 C CB    . LYS C 2 276 ? 75.632  55.803 133.845 1.00 91.99  ? 276 LYS A CB    1 
ATOM   3297 C CG    . LYS C 2 276 ? 75.578  54.352 133.371 1.00 97.66  ? 276 LYS A CG    1 
ATOM   3298 C CD    . LYS C 2 276 ? 74.773  53.454 134.318 1.00 100.00 ? 276 LYS A CD    1 
ATOM   3299 C CE    . LYS C 2 276 ? 75.361  52.035 134.393 1.00 100.00 ? 276 LYS A CE    1 
ATOM   3300 N NZ    . LYS C 2 276 ? 74.329  50.938 134.364 1.00 100.00 ? 276 LYS A NZ    1 
ATOM   3301 N N     . ASP C 2 277 ? 76.805  58.578 133.589 1.00 91.81  ? 277 ASP A N     1 
ATOM   3302 C CA    . ASP C 2 277 ? 76.818  60.019 133.792 1.00 93.78  ? 277 ASP A CA    1 
ATOM   3303 C C     . ASP C 2 277 ? 75.476  60.517 134.290 1.00 93.27  ? 277 ASP A C     1 
ATOM   3304 O O     . ASP C 2 277 ? 75.355  61.656 134.765 1.00 91.31  ? 277 ASP A O     1 
ATOM   3305 C CB    . ASP C 2 277 ? 77.183  60.713 132.477 1.00 97.79  ? 277 ASP A CB    1 
ATOM   3306 C CG    . ASP C 2 277 ? 78.270  59.966 131.705 1.00 100.00 ? 277 ASP A CG    1 
ATOM   3307 O OD1   . ASP C 2 277 ? 78.714  58.896 132.175 1.00 100.00 ? 277 ASP A OD1   1 
ATOM   3308 O OD2   . ASP C 2 277 ? 78.688  60.447 130.628 1.00 100.00 ? 277 ASP A OD2   1 
ATOM   3309 N N     . ASP C 2 278 ? 74.483  59.637 134.180 1.00 93.64  ? 278 ASP A N     1 
ATOM   3310 C CA    . ASP C 2 278 ? 73.111  59.913 134.588 1.00 99.38  ? 278 ASP A CA    1 
ATOM   3311 C C     . ASP C 2 278 ? 72.408  60.870 133.625 1.00 100.00 ? 278 ASP A C     1 
ATOM   3312 O O     . ASP C 2 278 ? 72.091  60.500 132.487 1.00 100.00 ? 278 ASP A O     1 
ATOM   3313 C CB    . ASP C 2 278 ? 73.065  60.472 136.020 1.00 100.00 ? 278 ASP A CB    1 
ATOM   3314 C CG    . ASP C 2 278 ? 71.677  60.355 136.651 1.00 100.00 ? 278 ASP A CG    1 
ATOM   3315 O OD1   . ASP C 2 278 ? 70.723  59.967 135.938 1.00 100.00 ? 278 ASP A OD1   1 
ATOM   3316 O OD2   . ASP C 2 278 ? 71.535  60.650 137.858 1.00 100.00 ? 278 ASP A OD2   1 
ATOM   3317 N N     . SER C 2 279 ? 72.171  62.097 134.087 1.00 100.00 ? 279 SER A N     1 
ATOM   3318 C CA    . SER C 2 279 ? 71.488  63.107 133.291 1.00 100.00 ? 279 SER A CA    1 
ATOM   3319 C C     . SER C 2 279 ? 70.334  62.455 132.537 1.00 100.00 ? 279 SER A C     1 
ATOM   3320 O O     . SER C 2 279 ? 69.678  61.541 133.051 1.00 100.00 ? 279 SER A O     1 
ATOM   3321 C CB    . SER C 2 279 ? 72.462  63.782 132.309 1.00 99.99  ? 279 SER A CB    1 
ATOM   3322 O OG    . SER C 2 279 ? 73.170  62.842 131.522 1.00 100.00 ? 279 SER A OG    1 
ATOM   3323 N N     . GLY C 2 280 ? 70.086  62.919 131.321 1.00 99.20  ? 280 GLY A N     1 
ATOM   3324 C CA    . GLY C 2 280 ? 69.009  62.349 130.542 1.00 100.00 ? 280 GLY A CA    1 
ATOM   3325 C C     . GLY C 2 280 ? 69.541  61.925 129.196 1.00 100.00 ? 280 GLY A C     1 
ATOM   3326 O O     . GLY C 2 280 ? 69.057  60.968 128.590 1.00 99.70  ? 280 GLY A O     1 
ATOM   3327 N N     . GLN C 2 281 ? 70.564  62.641 128.742 1.00 100.00 ? 281 GLN A N     1 
ATOM   3328 C CA    . GLN C 2 281 ? 71.193  62.378 127.456 1.00 100.00 ? 281 GLN A CA    1 
ATOM   3329 C C     . GLN C 2 281 ? 71.294  60.886 127.120 1.00 100.00 ? 281 GLN A C     1 
ATOM   3330 O O     . GLN C 2 281 ? 71.224  60.023 128.011 1.00 100.00 ? 281 GLN A O     1 
ATOM   3331 C CB    . GLN C 2 281 ? 72.589  63.011 127.432 1.00 100.00 ? 281 GLN A CB    1 
ATOM   3332 C CG    . GLN C 2 281 ? 73.167  63.195 126.032 1.00 100.00 ? 281 GLN A CG    1 
ATOM   3333 C CD    . GLN C 2 281 ? 74.613  62.745 125.928 1.00 100.00 ? 281 GLN A CD    1 
ATOM   3334 O OE1   . GLN C 2 281 ? 74.981  61.968 125.038 1.00 100.00 ? 281 GLN A OE1   1 
ATOM   3335 N NE2   . GLN C 2 281 ? 75.444  63.233 126.834 1.00 100.00 ? 281 GLN A NE2   1 
ATOM   3336 N N     . ARG C 2 282 ? 71.439  60.602 125.824 1.00 100.00 ? 282 ARG A N     1 
ATOM   3337 C CA    . ARG C 2 282 ? 71.581  59.241 125.312 1.00 100.00 ? 282 ARG A CA    1 
ATOM   3338 C C     . ARG C 2 282 ? 72.943  59.100 124.600 1.00 100.00 ? 282 ARG A C     1 
ATOM   3339 O O     . ARG C 2 282 ? 73.313  59.953 123.784 1.00 100.00 ? 282 ARG A O     1 
ATOM   3340 C CB    . ARG C 2 282 ? 70.439  58.938 124.339 1.00 96.47  ? 282 ARG A CB    1 
ATOM   3341 C CG    . ARG C 2 282 ? 69.933  57.501 124.380 1.00 96.54  ? 282 ARG A CG    1 
ATOM   3342 C CD    . ARG C 2 282 ? 69.959  56.902 122.981 1.00 97.70  ? 282 ARG A CD    1 
ATOM   3343 N NE    . ARG C 2 282 ? 68.920  55.898 122.721 1.00 100.00 ? 282 ARG A NE    1 
ATOM   3344 C CZ    . ARG C 2 282 ? 67.618  56.069 122.942 1.00 99.03  ? 282 ARG A CZ    1 
ATOM   3345 N NH1   . ARG C 2 282 ? 67.169  57.214 123.440 1.00 100.00 ? 282 ARG A NH1   1 
ATOM   3346 N NH2   . ARG C 2 282 ? 66.759  55.102 122.638 1.00 84.29  ? 282 ARG A NH2   1 
ATOM   3347 N N     . TYR C 2 283 ? 73.664  58.022 124.931 1.00 100.00 ? 283 TYR A N     1 
ATOM   3348 C CA    . TYR C 2 283 ? 74.998  57.680 124.399 1.00 95.78  ? 283 TYR A CA    1 
ATOM   3349 C C     . TYR C 2 283 ? 76.144  58.280 125.237 1.00 91.02  ? 283 TYR A C     1 
ATOM   3350 O O     . TYR C 2 283 ? 77.067  58.894 124.694 1.00 91.97  ? 283 TYR A O     1 
ATOM   3351 C CB    . TYR C 2 283 ? 75.150  58.117 122.930 1.00 96.78  ? 283 TYR A CB    1 
ATOM   3352 C CG    . TYR C 2 283 ? 74.452  57.237 121.903 1.00 94.57  ? 283 TYR A CG    1 
ATOM   3353 C CD1   . TYR C 2 283 ? 73.503  57.771 121.032 1.00 94.63  ? 283 TYR A CD1   1 
ATOM   3354 C CD2   . TYR C 2 283 ? 74.778  55.890 121.763 1.00 99.97  ? 283 TYR A CD2   1 
ATOM   3355 C CE1   . TYR C 2 283 ? 72.898  56.988 120.039 1.00 85.70  ? 283 TYR A CE1   1 
ATOM   3356 C CE2   . TYR C 2 283 ? 74.174  55.094 120.766 1.00 94.75  ? 283 TYR A CE2   1 
ATOM   3357 C CZ    . TYR C 2 283 ? 73.236  55.657 119.909 1.00 85.09  ? 283 TYR A CZ    1 
ATOM   3358 O OH    . TYR C 2 283 ? 72.643  54.911 118.915 1.00 75.46  ? 283 TYR A OH    1 
ATOM   3359 N N     . LEU C 2 284 ? 76.076  58.098 126.557 1.00 82.31  ? 284 LEU A N     1 
ATOM   3360 C CA    . LEU C 2 284 ? 77.104  58.601 127.467 1.00 66.30  ? 284 LEU A CA    1 
ATOM   3361 C C     . LEU C 2 284 ? 78.010  57.432 127.833 1.00 59.14  ? 284 LEU A C     1 
ATOM   3362 O O     . LEU C 2 284 ? 78.836  57.517 128.740 1.00 63.36  ? 284 LEU A O     1 
ATOM   3363 C CB    . LEU C 2 284 ? 76.467  59.187 128.729 1.00 60.49  ? 284 LEU A CB    1 
ATOM   3364 C CG    . LEU C 2 284 ? 75.887  60.591 128.558 1.00 60.30  ? 284 LEU A CG    1 
ATOM   3365 C CD1   . LEU C 2 284 ? 74.740  60.787 129.532 1.00 60.90  ? 284 LEU A CD1   1 
ATOM   3366 C CD2   . LEU C 2 284 ? 76.978  61.634 128.785 1.00 68.76  ? 284 LEU A CD2   1 
ATOM   3367 N N     . ALA C 2 285 ? 77.832  56.336 127.104 1.00 45.79  ? 285 ALA A N     1 
ATOM   3368 C CA    . ALA C 2 285 ? 78.611  55.124 127.289 1.00 43.74  ? 285 ALA A CA    1 
ATOM   3369 C C     . ALA C 2 285 ? 78.651  54.439 125.941 1.00 47.40  ? 285 ALA A C     1 
ATOM   3370 O O     . ALA C 2 285 ? 78.172  54.991 124.953 1.00 60.32  ? 285 ALA A O     1 
ATOM   3371 C CB    . ALA C 2 285 ? 77.959  54.228 128.301 1.00 42.05  ? 285 ALA A CB    1 
ATOM   3372 N N     . TRP C 2 286 ? 79.219  53.244 125.873 1.00 45.96  ? 286 TRP A N     1 
ATOM   3373 C CA    . TRP C 2 286 ? 79.263  52.577 124.585 1.00 47.32  ? 286 TRP A CA    1 
ATOM   3374 C C     . TRP C 2 286 ? 78.069  51.704 124.359 1.00 48.37  ? 286 TRP A C     1 
ATOM   3375 O O     . TRP C 2 286 ? 77.552  51.060 125.287 1.00 37.66  ? 286 TRP A O     1 
ATOM   3376 C CB    . TRP C 2 286 ? 80.482  51.706 124.442 1.00 48.54  ? 286 TRP A CB    1 
ATOM   3377 C CG    . TRP C 2 286 ? 81.710  52.426 124.544 1.00 52.08  ? 286 TRP A CG    1 
ATOM   3378 C CD1   . TRP C 2 286 ? 82.121  53.463 123.774 1.00 53.90  ? 286 TRP A CD1   1 
ATOM   3379 C CD2   . TRP C 2 286 ? 82.755  52.147 125.453 1.00 62.13  ? 286 TRP A CD2   1 
ATOM   3380 N NE1   . TRP C 2 286 ? 83.377  53.851 124.147 1.00 55.39  ? 286 TRP A NE1   1 
ATOM   3381 C CE2   . TRP C 2 286 ? 83.791  53.057 125.182 1.00 59.32  ? 286 TRP A CE2   1 
ATOM   3382 C CE3   . TRP C 2 286 ? 82.919  51.208 126.477 1.00 64.68  ? 286 TRP A CE3   1 
ATOM   3383 C CZ2   . TRP C 2 286 ? 84.979  53.058 125.896 1.00 62.06  ? 286 TRP A CZ2   1 
ATOM   3384 C CZ3   . TRP C 2 286 ? 84.097  51.206 127.187 1.00 72.18  ? 286 TRP A CZ3   1 
ATOM   3385 C CH2   . TRP C 2 286 ? 85.116  52.126 126.896 1.00 73.46  ? 286 TRP A CH2   1 
ATOM   3386 N N     . SER C 2 287 ? 77.662  51.682 123.093 1.00 50.65  ? 287 SER A N     1 
ATOM   3387 C CA    . SER C 2 287 ? 76.538  50.895 122.631 1.00 50.80  ? 287 SER A CA    1 
ATOM   3388 C C     . SER C 2 287 ? 77.044  49.861 121.636 1.00 45.59  ? 287 SER A C     1 
ATOM   3389 O O     . SER C 2 287 ? 78.183  49.926 121.160 1.00 42.87  ? 287 SER A O     1 
ATOM   3390 C CB    . SER C 2 287 ? 75.527  51.806 121.954 1.00 55.76  ? 287 SER A CB    1 
ATOM   3391 O OG    . SER C 2 287 ? 76.166  52.544 120.930 1.00 70.18  ? 287 SER A OG    1 
ATOM   3392 N N     . GLY C 2 288 ? 76.179  48.916 121.314 1.00 40.81  ? 288 GLY A N     1 
ATOM   3393 C CA    . GLY C 2 288 ? 76.556  47.858 120.403 1.00 49.27  ? 288 GLY A CA    1 
ATOM   3394 C C     . GLY C 2 288 ? 77.409  48.241 119.212 1.00 51.28  ? 288 GLY A C     1 
ATOM   3395 O O     . GLY C 2 288 ? 78.314  47.504 118.822 1.00 53.71  ? 288 GLY A O     1 
ATOM   3396 N N     . HIS C 2 289 ? 77.156  49.408 118.646 1.00 51.39  ? 289 HIS A N     1 
ATOM   3397 C CA    . HIS C 2 289 ? 77.905  49.802 117.461 1.00 61.32  ? 289 HIS A CA    1 
ATOM   3398 C C     . HIS C 2 289 ? 79.137  50.647 117.701 1.00 56.19  ? 289 HIS A C     1 
ATOM   3399 O O     . HIS C 2 289 ? 79.916  50.883 116.780 1.00 49.54  ? 289 HIS A O     1 
ATOM   3400 C CB    . HIS C 2 289 ? 77.008  50.551 116.496 1.00 76.64  ? 289 HIS A CB    1 
ATOM   3401 C CG    . HIS C 2 289 ? 76.103  49.684 115.669 1.00 89.74  ? 289 HIS A CG    1 
ATOM   3402 N ND1   . HIS C 2 289 ? 75.371  50.190 114.621 1.00 88.67  ? 289 HIS A ND1   1 
ATOM   3403 C CD2   . HIS C 2 289 ? 75.813  48.360 115.733 1.00 89.85  ? 289 HIS A CD2   1 
ATOM   3404 C CE1   . HIS C 2 289 ? 74.664  49.218 114.065 1.00 92.81  ? 289 HIS A CE1   1 
ATOM   3405 N NE2   . HIS C 2 289 ? 74.915  48.102 114.720 1.00 94.59  ? 289 HIS A NE2   1 
ATOM   3406 N N     . SER C 2 290 ? 79.284  51.135 118.924 1.00 55.68  ? 290 SER A N     1 
ATOM   3407 C CA    . SER C 2 290 ? 80.441  51.934 119.299 1.00 51.60  ? 290 SER A CA    1 
ATOM   3408 C C     . SER C 2 290 ? 81.697  51.391 118.608 1.00 51.97  ? 290 SER A C     1 
ATOM   3409 O O     . SER C 2 290 ? 82.614  52.148 118.293 1.00 51.48  ? 290 SER A O     1 
ATOM   3410 C CB    . SER C 2 290 ? 80.641  51.876 120.819 1.00 51.46  ? 290 SER A CB    1 
ATOM   3411 O OG    . SER C 2 290 ? 79.657  52.620 121.519 1.00 48.18  ? 290 SER A OG    1 
ATOM   3412 N N     . ALA C 2 291 ? 81.729  50.078 118.379 1.00 55.13  ? 291 ALA A N     1 
ATOM   3413 C CA    . ALA C 2 291 ? 82.876  49.429 117.745 1.00 53.53  ? 291 ALA A CA    1 
ATOM   3414 C C     . ALA C 2 291 ? 83.012  49.856 116.291 1.00 54.10  ? 291 ALA A C     1 
ATOM   3415 O O     . ALA C 2 291 ? 84.019  50.437 115.894 1.00 51.41  ? 291 ALA A O     1 
ATOM   3416 C CB    . ALA C 2 291 ? 82.729  47.924 117.833 1.00 48.55  ? 291 ALA A CB    1 
ATOM   3417 N N     . ARG C 2 292 ? 82.001  49.545 115.493 1.00 52.45  ? 292 ARG A N     1 
ATOM   3418 C CA    . ARG C 2 292 ? 82.027  49.935 114.099 1.00 52.21  ? 292 ARG A CA    1 
ATOM   3419 C C     . ARG C 2 292 ? 82.475  51.397 114.014 1.00 49.56  ? 292 ARG A C     1 
ATOM   3420 O O     . ARG C 2 292 ? 83.478  51.715 113.371 1.00 48.15  ? 292 ARG A O     1 
ATOM   3421 C CB    . ARG C 2 292 ? 80.638  49.757 113.505 1.00 51.92  ? 292 ARG A CB    1 
ATOM   3422 C CG    . ARG C 2 292 ? 80.039  48.425 113.865 1.00 44.56  ? 292 ARG A CG    1 
ATOM   3423 C CD    . ARG C 2 292 ? 78.650  48.291 113.334 1.00 53.00  ? 292 ARG A CD    1 
ATOM   3424 N NE    . ARG C 2 292 ? 78.661  47.910 111.932 1.00 59.82  ? 292 ARG A NE    1 
ATOM   3425 C CZ    . ARG C 2 292 ? 78.070  48.615 110.980 1.00 66.38  ? 292 ARG A CZ    1 
ATOM   3426 N NH1   . ARG C 2 292 ? 77.430  49.733 111.297 1.00 67.11  ? 292 ARG A NH1   1 
ATOM   3427 N NH2   . ARG C 2 292 ? 78.099  48.197 109.722 1.00 61.32  ? 292 ARG A NH2   1 
ATOM   3428 N N     . VAL C 2 293 ? 81.745  52.278 114.688 1.00 38.92  ? 293 VAL A N     1 
ATOM   3429 C CA    . VAL C 2 293 ? 82.096  53.690 114.672 1.00 32.78  ? 293 VAL A CA    1 
ATOM   3430 C C     . VAL C 2 293 ? 83.588  53.849 114.959 1.00 34.66  ? 293 VAL A C     1 
ATOM   3431 O O     . VAL C 2 293 ? 84.316  54.482 114.220 1.00 43.15  ? 293 VAL A O     1 
ATOM   3432 C CB    . VAL C 2 293 ? 81.305  54.492 115.736 1.00 26.34  ? 293 VAL A CB    1 
ATOM   3433 C CG1   . VAL C 2 293 ? 81.749  55.939 115.724 1.00 26.31  ? 293 VAL A CG1   1 
ATOM   3434 C CG2   . VAL C 2 293 ? 79.812  54.391 115.474 1.00 25.27  ? 293 VAL A CG2   1 
ATOM   3435 N N     . GLY C 2 294 ? 84.039  53.244 116.044 1.00 47.43  ? 294 GLY A N     1 
ATOM   3436 C CA    . GLY C 2 294 ? 85.429  53.356 116.429 1.00 49.76  ? 294 GLY A CA    1 
ATOM   3437 C C     . GLY C 2 294 ? 86.393  53.012 115.323 1.00 48.47  ? 294 GLY A C     1 
ATOM   3438 O O     . GLY C 2 294 ? 87.363  53.737 115.102 1.00 43.14  ? 294 GLY A O     1 
ATOM   3439 N N     . ALA C 2 295 ? 86.135  51.895 114.646 1.00 53.98  ? 295 ALA A N     1 
ATOM   3440 C CA    . ALA C 2 295 ? 86.991  51.439 113.553 1.00 59.91  ? 295 ALA A CA    1 
ATOM   3441 C C     . ALA C 2 295 ? 87.041  52.465 112.431 1.00 60.86  ? 295 ALA A C     1 
ATOM   3442 O O     . ALA C 2 295 ? 88.098  53.017 112.144 1.00 67.57  ? 295 ALA A O     1 
ATOM   3443 C CB    . ALA C 2 295 ? 86.499  50.101 113.024 1.00 49.72  ? 295 ALA A CB    1 
ATOM   3444 N N     . ALA C 2 296 ? 85.899  52.724 111.803 1.00 58.15  ? 296 ALA A N     1 
ATOM   3445 C CA    . ALA C 2 296 ? 85.828  53.707 110.722 1.00 55.52  ? 296 ALA A CA    1 
ATOM   3446 C C     . ALA C 2 296 ? 86.679  54.932 111.059 1.00 57.05  ? 296 ALA A C     1 
ATOM   3447 O O     . ALA C 2 296 ? 87.489  55.403 110.269 1.00 56.78  ? 296 ALA A O     1 
ATOM   3448 C CB    . ALA C 2 296 ? 84.377  54.128 110.505 1.00 40.35  ? 296 ALA A CB    1 
ATOM   3449 N N     . ARG C 2 297 ? 86.489  55.416 112.275 1.00 64.23  ? 297 ARG A N     1 
ATOM   3450 C CA    . ARG C 2 297 ? 87.182  56.584 112.783 1.00 66.33  ? 297 ARG A CA    1 
ATOM   3451 C C     . ARG C 2 297 ? 88.692  56.504 112.647 1.00 61.90  ? 297 ARG A C     1 
ATOM   3452 O O     . ARG C 2 297 ? 89.283  57.183 111.817 1.00 62.61  ? 297 ARG A O     1 
ATOM   3453 C CB    . ARG C 2 297 ? 86.816  56.788 114.259 1.00 75.83  ? 297 ARG A CB    1 
ATOM   3454 C CG    . ARG C 2 297 ? 85.369  57.173 114.494 1.00 83.00  ? 297 ARG A CG    1 
ATOM   3455 C CD    . ARG C 2 297 ? 85.193  58.669 114.332 1.00 94.70  ? 297 ARG A CD    1 
ATOM   3456 N NE    . ARG C 2 297 ? 86.443  59.372 114.610 1.00 100.00 ? 297 ARG A NE    1 
ATOM   3457 C CZ    . ARG C 2 297 ? 86.657  60.121 115.686 1.00 100.00 ? 297 ARG A CZ    1 
ATOM   3458 N NH1   . ARG C 2 297 ? 85.704  60.270 116.599 1.00 100.00 ? 297 ARG A NH1   1 
ATOM   3459 N NH2   . ARG C 2 297 ? 87.833  60.710 115.858 1.00 100.00 ? 297 ARG A NH2   1 
ATOM   3460 N N     . ASP C 2 298 ? 89.311  55.671 113.474 1.00 63.41  ? 298 ASP A N     1 
ATOM   3461 C CA    . ASP C 2 298 ? 90.761  55.540 113.457 1.00 70.67  ? 298 ASP A CA    1 
ATOM   3462 C C     . ASP C 2 298 ? 91.231  55.055 112.093 1.00 68.81  ? 298 ASP A C     1 
ATOM   3463 O O     . ASP C 2 298 ? 92.395  55.241 111.725 1.00 57.94  ? 298 ASP A O     1 
ATOM   3464 C CB    . ASP C 2 298 ? 91.275  54.558 114.541 1.00 78.06  ? 298 ASP A CB    1 
ATOM   3465 C CG    . ASP C 2 298 ? 90.311  54.365 115.706 1.00 70.46  ? 298 ASP A CG    1 
ATOM   3466 O OD1   . ASP C 2 298 ? 89.805  55.363 116.255 1.00 83.18  ? 298 ASP A OD1   1 
ATOM   3467 O OD2   . ASP C 2 298 ? 90.074  53.198 116.085 1.00 68.07  ? 298 ASP A OD2   1 
ATOM   3468 N N     . MET C 2 299 ? 90.314  54.435 111.357 1.00 68.95  ? 299 MET A N     1 
ATOM   3469 C CA    . MET C 2 299 ? 90.586  53.888 110.033 1.00 74.42  ? 299 MET A CA    1 
ATOM   3470 C C     . MET C 2 299 ? 90.863  55.016 109.056 1.00 80.60  ? 299 MET A C     1 
ATOM   3471 O O     . MET C 2 299 ? 91.926  55.093 108.437 1.00 85.63  ? 299 MET A O     1 
ATOM   3472 C CB    . MET C 2 299 ? 89.369  53.107 109.555 1.00 77.13  ? 299 MET A CB    1 
ATOM   3473 C CG    . MET C 2 299 ? 89.595  52.163 108.393 1.00 77.57  ? 299 MET A CG    1 
ATOM   3474 S SD    . MET C 2 299 ? 88.057  51.265 108.079 1.00 91.29  ? 299 MET A SD    1 
ATOM   3475 C CE    . MET C 2 299 ? 88.644  49.623 107.814 1.00 73.47  ? 299 MET A CE    1 
ATOM   3476 N N     . ALA C 2 300 ? 89.882  55.895 108.926 1.00 82.85  ? 300 ALA A N     1 
ATOM   3477 C CA    . ALA C 2 300 ? 89.993  57.027 108.029 1.00 85.94  ? 300 ALA A CA    1 
ATOM   3478 C C     . ALA C 2 300 ? 91.052  57.972 108.566 1.00 85.17  ? 300 ALA A C     1 
ATOM   3479 O O     . ALA C 2 300 ? 91.722  58.674 107.810 1.00 90.02  ? 300 ALA A O     1 
ATOM   3480 C CB    . ALA C 2 300 ? 88.650  57.741 107.929 1.00 96.37  ? 300 ALA A CB    1 
ATOM   3481 N N     . ARG C 2 301 ? 91.212  57.963 109.883 1.00 88.08  ? 301 ARG A N     1 
ATOM   3482 C CA    . ARG C 2 301 ? 92.175  58.834 110.537 1.00 94.36  ? 301 ARG A CA    1 
ATOM   3483 C C     . ARG C 2 301 ? 93.577  58.616 109.985 1.00 96.43  ? 301 ARG A C     1 
ATOM   3484 O O     . ARG C 2 301 ? 94.333  59.571 109.793 1.00 97.88  ? 301 ARG A O     1 
ATOM   3485 C CB    . ARG C 2 301 ? 92.162  58.591 112.045 1.00 95.82  ? 301 ARG A CB    1 
ATOM   3486 C CG    . ARG C 2 301 ? 92.275  59.860 112.865 1.00 93.45  ? 301 ARG A CG    1 
ATOM   3487 C CD    . ARG C 2 301 ? 93.019  59.611 114.159 1.00 87.49  ? 301 ARG A CD    1 
ATOM   3488 N NE    . ARG C 2 301 ? 92.172  59.856 115.320 1.00 85.79  ? 301 ARG A NE    1 
ATOM   3489 C CZ    . ARG C 2 301 ? 91.119  59.116 115.645 1.00 78.87  ? 301 ARG A CZ    1 
ATOM   3490 N NH1   . ARG C 2 301 ? 90.774  58.076 114.903 1.00 76.83  ? 301 ARG A NH1   1 
ATOM   3491 N NH2   . ARG C 2 301 ? 90.411  59.419 116.720 1.00 80.27  ? 301 ARG A NH2   1 
ATOM   3492 N N     . ALA C 2 302 ? 93.917  57.352 109.740 1.00 98.36  ? 302 ALA A N     1 
ATOM   3493 C CA    . ALA C 2 302 ? 95.219  56.996 109.194 1.00 98.20  ? 302 ALA A CA    1 
ATOM   3494 C C     . ALA C 2 302 ? 95.148  56.963 107.674 1.00 97.90  ? 302 ALA A C     1 
ATOM   3495 O O     . ALA C 2 302 ? 94.317  57.647 107.076 1.00 100.00 ? 302 ALA A O     1 
ATOM   3496 C CB    . ALA C 2 302 ? 95.664  55.647 109.732 1.00 100.00 ? 302 ALA A CB    1 
ATOM   3497 N N     . GLY C 2 303 ? 96.003  56.155 107.052 1.00 95.30  ? 303 GLY A N     1 
ATOM   3498 C CA    . GLY C 2 303 ? 96.034  56.084 105.600 1.00 100.00 ? 303 GLY A CA    1 
ATOM   3499 C C     . GLY C 2 303 ? 95.086  55.067 104.999 1.00 100.00 ? 303 GLY A C     1 
ATOM   3500 O O     . GLY C 2 303 ? 95.465  53.913 104.776 1.00 97.42  ? 303 GLY A O     1 
ATOM   3501 N N     . VAL C 2 304 ? 93.863  55.502 104.705 1.00 100.00 ? 304 VAL A N     1 
ATOM   3502 C CA    . VAL C 2 304 ? 92.866  54.602 104.153 1.00 99.39  ? 304 VAL A CA    1 
ATOM   3503 C C     . VAL C 2 304 ? 91.886  55.273 103.188 1.00 100.00 ? 304 VAL A C     1 
ATOM   3504 O O     . VAL C 2 304 ? 91.521  56.440 103.362 1.00 100.00 ? 304 VAL A O     1 
ATOM   3505 C CB    . VAL C 2 304 ? 92.077  53.927 105.303 1.00 98.63  ? 304 VAL A CB    1 
ATOM   3506 C CG1   . VAL C 2 304 ? 90.727  53.454 104.816 1.00 100.00 ? 304 VAL A CG1   1 
ATOM   3507 C CG2   . VAL C 2 304 ? 92.869  52.762 105.851 1.00 100.00 ? 304 VAL A CG2   1 
ATOM   3508 N N     . SER C 2 305 ? 91.474  54.511 102.172 1.00 100.00 ? 305 SER A N     1 
ATOM   3509 C CA    . SER C 2 305 ? 90.515  54.963 101.162 1.00 93.34  ? 305 SER A CA    1 
ATOM   3510 C C     . SER C 2 305 ? 89.129  55.043 101.799 1.00 95.28  ? 305 SER A C     1 
ATOM   3511 O O     . SER C 2 305 ? 88.988  54.895 103.007 1.00 100.00 ? 305 SER A O     1 
ATOM   3512 C CB    . SER C 2 305 ? 90.465  53.967 100.011 1.00 89.02  ? 305 SER A CB    1 
ATOM   3513 O OG    . SER C 2 305 ? 89.880  52.758 100.464 1.00 74.41  ? 305 SER A OG    1 
ATOM   3514 N N     . ILE C 2 306 ? 88.097  55.276 100.997 1.00 97.23  ? 306 ILE A N     1 
ATOM   3515 C CA    . ILE C 2 306 ? 86.739  55.358 101.550 1.00 100.00 ? 306 ILE A CA    1 
ATOM   3516 C C     . ILE C 2 306 ? 85.946  54.040 101.549 1.00 100.00 ? 306 ILE A C     1 
ATOM   3517 O O     . ILE C 2 306 ? 85.033  53.862 102.361 1.00 100.00 ? 306 ILE A O     1 
ATOM   3518 C CB    . ILE C 2 306 ? 85.892  56.453 100.831 1.00 100.00 ? 306 ILE A CB    1 
ATOM   3519 C CG1   . ILE C 2 306 ? 84.644  56.776 101.667 1.00 97.19  ? 306 ILE A CG1   1 
ATOM   3520 C CG2   . ILE C 2 306 ? 85.498  55.985 99.419  1.00 100.00 ? 306 ILE A CG2   1 
ATOM   3521 C CD1   . ILE C 2 306 ? 84.921  57.607 102.900 1.00 85.98  ? 306 ILE A CD1   1 
ATOM   3522 N N     . PRO C 2 307 ? 86.262  53.111 100.626 1.00 96.48  ? 307 PRO A N     1 
ATOM   3523 C CA    . PRO C 2 307 ? 85.525  51.845 100.612 1.00 93.93  ? 307 PRO A CA    1 
ATOM   3524 C C     . PRO C 2 307 ? 85.851  51.070 101.874 1.00 96.12  ? 307 PRO A C     1 
ATOM   3525 O O     . PRO C 2 307 ? 85.034  50.329 102.400 1.00 95.61  ? 307 PRO A O     1 
ATOM   3526 C CB    . PRO C 2 307 ? 86.040  51.128 99.363  1.00 95.91  ? 307 PRO A CB    1 
ATOM   3527 C CG    . PRO C 2 307 ? 86.772  52.158 98.581  1.00 99.86  ? 307 PRO A CG    1 
ATOM   3528 C CD    . PRO C 2 307 ? 87.271  53.163 99.559  1.00 96.22  ? 307 PRO A CD    1 
ATOM   3529 N N     . GLU C 2 308 ? 87.067  51.244 102.363 1.00 96.60  ? 308 GLU A N     1 
ATOM   3530 C CA    . GLU C 2 308 ? 87.453  50.556 103.571 1.00 98.18  ? 308 GLU A CA    1 
ATOM   3531 C C     . GLU C 2 308 ? 86.458  50.982 104.651 1.00 98.55  ? 308 GLU A C     1 
ATOM   3532 O O     . GLU C 2 308 ? 85.930  50.143 105.387 1.00 100.00 ? 308 GLU A O     1 
ATOM   3533 C CB    . GLU C 2 308 ? 88.888  50.938 103.950 1.00 100.00 ? 308 GLU A CB    1 
ATOM   3534 C CG    . GLU C 2 308 ? 89.957  50.504 102.938 1.00 100.00 ? 308 GLU A CG    1 
ATOM   3535 C CD    . GLU C 2 308 ? 89.373  49.792 101.729 1.00 100.00 ? 308 GLU A CD    1 
ATOM   3536 O OE1   . GLU C 2 308 ? 88.956  50.487 100.776 1.00 100.00 ? 308 GLU A OE1   1 
ATOM   3537 O OE2   . GLU C 2 308 ? 89.322  48.542 101.734 1.00 100.00 ? 308 GLU A OE2   1 
ATOM   3538 N N     . ILE C 2 309 ? 86.179  52.283 104.720 1.00 93.17  ? 309 ILE A N     1 
ATOM   3539 C CA    . ILE C 2 309 ? 85.244  52.798 105.708 1.00 93.31  ? 309 ILE A CA    1 
ATOM   3540 C C     . ILE C 2 309 ? 83.823  52.305 105.408 1.00 94.92  ? 309 ILE A C     1 
ATOM   3541 O O     . ILE C 2 309 ? 82.944  52.390 106.261 1.00 100.00 ? 309 ILE A O     1 
ATOM   3542 C CB    . ILE C 2 309 ? 85.288  54.363 105.758 1.00 93.35  ? 309 ILE A CB    1 
ATOM   3543 C CG1   . ILE C 2 309 ? 86.010  54.826 107.028 1.00 90.22  ? 309 ILE A CG1   1 
ATOM   3544 C CG2   . ILE C 2 309 ? 83.872  54.953 105.762 1.00 100.00 ? 309 ILE A CG2   1 
ATOM   3545 C CD1   . ILE C 2 309 ? 87.510  54.690 106.970 1.00 80.85  ? 309 ILE A CD1   1 
ATOM   3546 N N     . MET C 2 310 ? 83.599  51.778 104.206 1.00 96.71  ? 310 MET A N     1 
ATOM   3547 C CA    . MET C 2 310 ? 82.271  51.280 103.827 1.00 94.99  ? 310 MET A CA    1 
ATOM   3548 C C     . MET C 2 310 ? 82.218  49.748 103.679 1.00 91.64  ? 310 MET A C     1 
ATOM   3549 O O     . MET C 2 310 ? 81.439  49.075 104.352 1.00 100.00 ? 310 MET A O     1 
ATOM   3550 C CB    . MET C 2 310 ? 81.818  51.982 102.538 1.00 95.26  ? 310 MET A CB    1 
ATOM   3551 C CG    . MET C 2 310 ? 81.271  51.078 101.455 1.00 100.00 ? 310 MET A CG    1 
ATOM   3552 S SD    . MET C 2 310 ? 82.243  51.180 99.928  1.00 100.00 ? 310 MET A SD    1 
ATOM   3553 C CE    . MET C 2 310 ? 80.947  51.064 98.717  1.00 99.17  ? 310 MET A CE    1 
ATOM   3554 N N     . GLN C 2 311 ? 83.021  49.221 102.768 1.00 84.80  ? 311 GLN A N     1 
ATOM   3555 C CA    . GLN C 2 311 ? 83.147  47.787 102.517 1.00 84.46  ? 311 GLN A CA    1 
ATOM   3556 C C     . GLN C 2 311 ? 83.100  46.875 103.767 1.00 85.20  ? 311 GLN A C     1 
ATOM   3557 O O     . GLN C 2 311 ? 82.445  45.829 103.762 1.00 83.06  ? 311 GLN A O     1 
ATOM   3558 C CB    . GLN C 2 311 ? 84.460  47.554 101.766 1.00 87.96  ? 311 GLN A CB    1 
ATOM   3559 C CG    . GLN C 2 311 ? 84.442  46.386 100.811 1.00 94.91  ? 311 GLN A CG    1 
ATOM   3560 C CD    . GLN C 2 311 ? 84.973  45.125 101.454 1.00 100.00 ? 311 GLN A CD    1 
ATOM   3561 O OE1   . GLN C 2 311 ? 85.053  44.067 100.819 1.00 100.00 ? 311 GLN A OE1   1 
ATOM   3562 N NE2   . GLN C 2 311 ? 85.342  45.228 102.728 1.00 100.00 ? 311 GLN A NE2   1 
ATOM   3563 N N     . ALA C 2 312 ? 83.801  47.275 104.827 1.00 86.21  ? 312 ALA A N     1 
ATOM   3564 C CA    . ALA C 2 312 ? 83.871  46.501 106.075 1.00 83.35  ? 312 ALA A CA    1 
ATOM   3565 C C     . ALA C 2 312 ? 82.543  46.367 106.823 1.00 80.00  ? 312 ALA A C     1 
ATOM   3566 O O     . ALA C 2 312 ? 82.032  45.257 107.013 1.00 79.47  ? 312 ALA A O     1 
ATOM   3567 C CB    . ALA C 2 312 ? 84.919  47.118 106.995 1.00 84.36  ? 312 ALA A CB    1 
ATOM   3568 N N     . GLY C 2 313 ? 82.005  47.493 107.277 1.00 74.80  ? 313 GLY A N     1 
ATOM   3569 C CA    . GLY C 2 313 ? 80.744  47.460 107.982 1.00 77.44  ? 313 GLY A CA    1 
ATOM   3570 C C     . GLY C 2 313 ? 79.655  46.925 107.071 1.00 79.91  ? 313 GLY A C     1 
ATOM   3571 O O     . GLY C 2 313 ? 79.149  45.825 107.283 1.00 87.86  ? 313 GLY A O     1 
ATOM   3572 N N     . GLY C 2 314 ? 79.302  47.697 106.048 1.00 80.21  ? 314 GLY A N     1 
ATOM   3573 C CA    . GLY C 2 314 ? 78.261  47.283 105.124 1.00 78.74  ? 314 GLY A CA    1 
ATOM   3574 C C     . GLY C 2 314 ? 77.317  48.450 104.936 1.00 79.20  ? 314 GLY A C     1 
ATOM   3575 O O     . GLY C 2 314 ? 76.117  48.351 105.198 1.00 80.94  ? 314 GLY A O     1 
ATOM   3576 N N     . TRP C 2 315 ? 77.874  49.575 104.506 1.00 76.57  ? 315 TRP A N     1 
ATOM   3577 C CA    . TRP C 2 315 ? 77.080  50.761 104.292 1.00 78.50  ? 315 TRP A CA    1 
ATOM   3578 C C     . TRP C 2 315 ? 76.653  50.930 102.855 1.00 80.99  ? 315 TRP A C     1 
ATOM   3579 O O     . TRP C 2 315 ? 76.971  50.109 101.996 1.00 76.31  ? 315 TRP A O     1 
ATOM   3580 C CB    . TRP C 2 315 ? 77.852  51.984 104.736 1.00 86.55  ? 315 TRP A CB    1 
ATOM   3581 C CG    . TRP C 2 315 ? 77.834  52.122 106.187 1.00 91.32  ? 315 TRP A CG    1 
ATOM   3582 C CD1   . TRP C 2 315 ? 76.822  52.622 106.943 1.00 96.07  ? 315 TRP A CD1   1 
ATOM   3583 C CD2   . TRP C 2 315 ? 78.860  51.722 107.092 1.00 94.26  ? 315 TRP A CD2   1 
ATOM   3584 N NE1   . TRP C 2 315 ? 77.153  52.556 108.271 1.00 100.00 ? 315 TRP A NE1   1 
ATOM   3585 C CE2   . TRP C 2 315 ? 78.401  52.007 108.394 1.00 95.90  ? 315 TRP A CE2   1 
ATOM   3586 C CE3   . TRP C 2 315 ? 80.126  51.147 106.933 1.00 99.31  ? 315 TRP A CE3   1 
ATOM   3587 C CZ2   . TRP C 2 315 ? 79.164  51.738 109.535 1.00 96.09  ? 315 TRP A CZ2   1 
ATOM   3588 C CZ3   . TRP C 2 315 ? 80.889  50.878 108.072 1.00 99.69  ? 315 TRP A CZ3   1 
ATOM   3589 C CH2   . TRP C 2 315 ? 80.404  51.175 109.354 1.00 90.42  ? 315 TRP A CH2   1 
ATOM   3590 N N     . THR C 2 316 ? 75.941  52.022 102.604 1.00 88.38  ? 316 THR A N     1 
ATOM   3591 C CA    . THR C 2 316 ? 75.421  52.327 101.282 1.00 97.25  ? 316 THR A CA    1 
ATOM   3592 C C     . THR C 2 316 ? 76.244  53.339 100.465 1.00 97.85  ? 316 THR A C     1 
ATOM   3593 O O     . THR C 2 316 ? 76.920  54.218 101.015 1.00 100.00 ? 316 THR A O     1 
ATOM   3594 C CB    . THR C 2 316 ? 73.952  52.800 101.416 1.00 100.00 ? 316 THR A CB    1 
ATOM   3595 O OG1   . THR C 2 316 ? 73.119  52.029 100.535 1.00 100.00 ? 316 THR A OG1   1 
ATOM   3596 C CG2   . THR C 2 316 ? 73.831  54.304 101.137 1.00 100.00 ? 316 THR A CG2   1 
ATOM   3597 N N     . ARG C 2 326 ? 82.922  61.902 111.532 1.00 94.43  ? 326 ARG A N     1 
ATOM   3598 C CA    . ARG C 2 326 ? 84.298  61.789 111.119 1.00 87.09  ? 326 ARG A CA    1 
ATOM   3599 C C     . ARG C 2 326 ? 84.884  63.176 110.914 1.00 91.25  ? 326 ARG A C     1 
ATOM   3600 O O     . ARG C 2 326 ? 86.097  63.324 110.849 1.00 97.87  ? 326 ARG A O     1 
ATOM   3601 C CB    . ARG C 2 326 ? 84.398  60.985 109.832 1.00 82.35  ? 326 ARG A CB    1 
ATOM   3602 C CG    . ARG C 2 326 ? 85.809  60.621 109.458 1.00 87.62  ? 326 ARG A CG    1 
ATOM   3603 C CD    . ARG C 2 326 ? 86.293  61.461 108.284 1.00 100.00 ? 326 ARG A CD    1 
ATOM   3604 N NE    . ARG C 2 326 ? 86.871  62.744 108.690 1.00 100.00 ? 326 ARG A NE    1 
ATOM   3605 C CZ    . ARG C 2 326 ? 86.721  63.877 108.011 1.00 99.79  ? 326 ARG A CZ    1 
ATOM   3606 N NH1   . ARG C 2 326 ? 86.041  63.881 106.873 1.00 100.00 ? 326 ARG A NH1   1 
ATOM   3607 N NH2   . ARG C 2 326 ? 87.258  65.000 108.463 1.00 94.54  ? 326 ARG A NH2   1 
ATOM   3608 N N     . ASN C 2 327 ? 84.035  64.197 110.810 1.00 92.45  ? 327 ASN A N     1 
ATOM   3609 C CA    . ASN C 2 327 ? 84.551  65.549 110.642 1.00 94.88  ? 327 ASN A CA    1 
ATOM   3610 C C     . ASN C 2 327 ? 85.464  65.859 111.829 1.00 98.29  ? 327 ASN A C     1 
ATOM   3611 O O     . ASN C 2 327 ? 86.424  66.622 111.703 1.00 100.00 ? 327 ASN A O     1 
ATOM   3612 C CB    . ASN C 2 327 ? 83.412  66.573 110.581 1.00 99.06  ? 327 ASN A CB    1 
ATOM   3613 C CG    . ASN C 2 327 ? 83.916  68.001 110.330 1.00 100.00 ? 327 ASN A CG    1 
ATOM   3614 O OD1   . ASN C 2 327 ? 84.204  68.388 109.189 1.00 100.00 ? 327 ASN A OD1   1 
ATOM   3615 N ND2   . ASN C 2 327 ? 84.023  68.788 111.400 1.00 100.00 ? 327 ASN A ND2   1 
ATOM   3616 N N     . LEU C 2 328 ? 85.162  65.257 112.978 1.00 96.95  ? 328 LEU A N     1 
ATOM   3617 C CA    . LEU C 2 328 ? 85.954  65.448 114.191 1.00 99.30  ? 328 LEU A CA    1 
ATOM   3618 C C     . LEU C 2 328 ? 87.453  65.228 113.934 1.00 100.00 ? 328 LEU A C     1 
ATOM   3619 O O     . LEU C 2 328 ? 88.306  65.724 114.686 1.00 100.00 ? 328 LEU A O     1 
ATOM   3620 C CB    . LEU C 2 328 ? 85.469  64.485 115.285 1.00 100.00 ? 328 LEU A CB    1 
ATOM   3621 C CG    . LEU C 2 328 ? 85.361  64.954 116.753 1.00 100.00 ? 328 LEU A CG    1 
ATOM   3622 C CD1   . LEU C 2 328 ? 85.296  63.729 117.671 1.00 100.00 ? 328 LEU A CD1   1 
ATOM   3623 C CD2   . LEU C 2 328 ? 86.553  65.838 117.151 1.00 100.00 ? 328 LEU A CD2   1 
ATOM   3624 N N     . ASP C 2 329 ? 87.762  64.473 112.877 1.00 100.00 ? 329 ASP A N     1 
ATOM   3625 C CA    . ASP C 2 329 ? 89.145  64.177 112.491 1.00 100.00 ? 329 ASP A CA    1 
ATOM   3626 C C     . ASP C 2 329 ? 89.725  65.428 111.833 1.00 100.00 ? 329 ASP A C     1 
ATOM   3627 O O     . ASP C 2 329 ? 89.281  66.540 112.129 1.00 100.00 ? 329 ASP A O     1 
ATOM   3628 C CB    . ASP C 2 329 ? 89.197  62.999 111.500 1.00 98.83  ? 329 ASP A CB    1 
ATOM   3629 C CG    . ASP C 2 329 ? 89.022  61.642 112.180 1.00 90.32  ? 329 ASP A CG    1 
ATOM   3630 O OD1   . ASP C 2 329 ? 88.525  61.594 113.326 1.00 79.34  ? 329 ASP A OD1   1 
ATOM   3631 O OD2   . ASP C 2 329 ? 89.384  60.620 111.555 1.00 81.50  ? 329 ASP A OD2   1 
ATOM   3632 N N     . SER C 2 330 ? 90.689  65.264 110.927 1.00 100.00 ? 330 SER A N     1 
ATOM   3633 C CA    . SER C 2 330 ? 91.278  66.438 110.299 1.00 95.17  ? 330 SER A CA    1 
ATOM   3634 C C     . SER C 2 330 ? 90.959  66.561 108.829 1.00 89.36  ? 330 SER A C     1 
ATOM   3635 O O     . SER C 2 330 ? 91.233  67.589 108.215 1.00 88.43  ? 330 SER A O     1 
ATOM   3636 C CB    . SER C 2 330 ? 92.795  66.468 110.524 1.00 99.69  ? 330 SER A CB    1 
ATOM   3637 O OG    . SER C 2 330 ? 93.116  67.253 111.667 1.00 98.50  ? 330 SER A OG    1 
ATOM   3638 N N     . GLU C 2 331 ? 90.382  65.512 108.261 1.00 88.51  ? 331 GLU A N     1 
ATOM   3639 C CA    . GLU C 2 331 ? 90.001  65.551 106.861 1.00 93.38  ? 331 GLU A CA    1 
ATOM   3640 C C     . GLU C 2 331 ? 88.791  66.487 106.758 1.00 93.41  ? 331 GLU A C     1 
ATOM   3641 O O     . GLU C 2 331 ? 87.686  66.068 106.407 1.00 91.59  ? 331 GLU A O     1 
ATOM   3642 C CB    . GLU C 2 331 ? 89.647  64.144 106.395 1.00 95.44  ? 331 GLU A CB    1 
ATOM   3643 C CG    . GLU C 2 331 ? 90.836  63.197 106.418 1.00 99.29  ? 331 GLU A CG    1 
ATOM   3644 C CD    . GLU C 2 331 ? 91.473  63.023 105.046 1.00 100.00 ? 331 GLU A CD    1 
ATOM   3645 O OE1   . GLU C 2 331 ? 91.726  61.862 104.646 1.00 100.00 ? 331 GLU A OE1   1 
ATOM   3646 O OE2   . GLU C 2 331 ? 91.719  64.044 104.364 1.00 100.00 ? 331 GLU A OE2   1 
ATOM   3647 N N     . THR C 2 332 ? 89.028  67.763 107.064 1.00 89.98  ? 332 THR A N     1 
ATOM   3648 C CA    . THR C 2 332 ? 87.993  68.784 107.068 1.00 79.54  ? 332 THR A CA    1 
ATOM   3649 C C     . THR C 2 332 ? 87.508  69.300 105.738 1.00 75.82  ? 332 THR A C     1 
ATOM   3650 O O     . THR C 2 332 ? 86.407  69.827 105.672 1.00 83.53  ? 332 THR A O     1 
ATOM   3651 C CB    . THR C 2 332 ? 88.429  69.984 107.879 1.00 82.16  ? 332 THR A CB    1 
ATOM   3652 O OG1   . THR C 2 332 ? 89.774  69.785 108.323 1.00 79.25  ? 332 THR A OG1   1 
ATOM   3653 C CG2   . THR C 2 332 ? 87.510  70.162 109.073 1.00 89.23  ? 332 THR A CG2   1 
ATOM   3654 N N     . GLY C 2 333 ? 88.313  69.197 104.686 1.00 68.83  ? 333 GLY A N     1 
ATOM   3655 C CA    . GLY C 2 333 ? 87.835  69.661 103.397 1.00 61.00  ? 333 GLY A CA    1 
ATOM   3656 C C     . GLY C 2 333 ? 88.702  70.552 102.531 1.00 53.61  ? 333 GLY A C     1 
ATOM   3657 O O     . GLY C 2 333 ? 89.835  70.872 102.865 1.00 57.81  ? 333 GLY A O     1 
ATOM   3658 N N     . ALA C 2 334 ? 88.123  70.953 101.404 1.00 47.31  ? 334 ALA A N     1 
ATOM   3659 C CA    . ALA C 2 334 ? 88.775  71.796 100.417 1.00 45.79  ? 334 ALA A CA    1 
ATOM   3660 C C     . ALA C 2 334 ? 89.114  73.174 100.935 1.00 47.00  ? 334 ALA A C     1 
ATOM   3661 O O     . ALA C 2 334 ? 90.279  73.492 101.112 1.00 54.87  ? 334 ALA A O     1 
ATOM   3662 C CB    . ALA C 2 334 ? 87.892  71.924 99.183  1.00 38.58  ? 334 ALA A CB    1 
ATOM   3663 N N     . MET C 2 335 ? 88.095  73.989 101.191 1.00 42.83  ? 335 MET A N     1 
ATOM   3664 C CA    . MET C 2 335 ? 88.312  75.350 101.662 1.00 37.29  ? 335 MET A CA    1 
ATOM   3665 C C     . MET C 2 335 ? 89.421  75.478 102.721 1.00 40.47  ? 335 MET A C     1 
ATOM   3666 O O     . MET C 2 335 ? 90.113  76.489 102.773 1.00 37.73  ? 335 MET A O     1 
ATOM   3667 C CB    . MET C 2 335 ? 87.001  75.934 102.187 1.00 35.73  ? 335 MET A CB    1 
ATOM   3668 C CG    . MET C 2 335 ? 86.154  76.626 101.125 1.00 37.27  ? 335 MET A CG    1 
ATOM   3669 S SD    . MET C 2 335 ? 87.152  77.465 99.923  1.00 31.75  ? 335 MET A SD    1 
ATOM   3670 C CE    . MET C 2 335 ? 85.916  78.629 99.170  1.00 23.74  ? 335 MET A CE    1 
ATOM   3671 N N     . VAL C 2 336 ? 89.592  74.461 103.562 1.00 42.02  ? 336 VAL A N     1 
ATOM   3672 C CA    . VAL C 2 336 ? 90.642  74.501 104.576 1.00 33.88  ? 336 VAL A CA    1 
ATOM   3673 C C     . VAL C 2 336 ? 91.965  74.228 103.864 1.00 35.68  ? 336 VAL A C     1 
ATOM   3674 O O     . VAL C 2 336 ? 92.977  74.857 104.126 1.00 40.78  ? 336 VAL A O     1 
ATOM   3675 C CB    . VAL C 2 336 ? 90.406  73.434 105.669 1.00 31.74  ? 336 VAL A CB    1 
ATOM   3676 C CG1   . VAL C 2 336 ? 91.666  73.214 106.460 1.00 20.44  ? 336 VAL A CG1   1 
ATOM   3677 C CG2   . VAL C 2 336 ? 89.278  73.881 106.593 1.00 29.37  ? 336 VAL A CG2   1 
ATOM   3678 N N     . ARG C 2 337 ? 91.940  73.272 102.952 1.00 42.59  ? 337 ARG A N     1 
ATOM   3679 C CA    . ARG C 2 337 ? 93.105  72.890 102.156 1.00 49.54  ? 337 ARG A CA    1 
ATOM   3680 C C     . ARG C 2 337 ? 93.593  74.121 101.401 1.00 46.38  ? 337 ARG A C     1 
ATOM   3681 O O     . ARG C 2 337 ? 94.751  74.523 101.497 1.00 50.73  ? 337 ARG A O     1 
ATOM   3682 C CB    . ARG C 2 337 ? 92.687  71.811 101.146 1.00 58.55  ? 337 ARG A CB    1 
ATOM   3683 C CG    . ARG C 2 337 ? 93.756  70.811 100.750 1.00 72.65  ? 337 ARG A CG    1 
ATOM   3684 C CD    . ARG C 2 337 ? 93.123  69.588 100.101 1.00 77.01  ? 337 ARG A CD    1 
ATOM   3685 N NE    . ARG C 2 337 ? 92.705  69.843 98.718  1.00 93.03  ? 337 ARG A NE    1 
ATOM   3686 C CZ    . ARG C 2 337 ? 91.598  69.358 98.171  1.00 92.39  ? 337 ARG A CZ    1 
ATOM   3687 N NH1   . ARG C 2 337 ? 90.794  68.600 98.896  1.00 84.74  ? 337 ARG A NH1   1 
ATOM   3688 N NH2   . ARG C 2 337 ? 91.302  69.617 96.900  1.00 93.65  ? 337 ARG A NH2   1 
ATOM   3689 N N     . LEU C 2 338 ? 92.683  74.690 100.626 1.00 46.46  ? 338 LEU A N     1 
ATOM   3690 C CA    . LEU C 2 338 ? 92.947  75.875 99.836  1.00 45.30  ? 338 LEU A CA    1 
ATOM   3691 C C     . LEU C 2 338 ? 93.527  76.953 100.741 1.00 45.18  ? 338 LEU A C     1 
ATOM   3692 O O     . LEU C 2 338 ? 94.635  77.438 100.496 1.00 39.60  ? 338 LEU A O     1 
ATOM   3693 C CB    . LEU C 2 338 ? 91.642  76.370 99.199  1.00 53.88  ? 338 LEU A CB    1 
ATOM   3694 C CG    . LEU C 2 338 ? 91.563  76.547 97.676  1.00 57.47  ? 338 LEU A CG    1 
ATOM   3695 C CD1   . LEU C 2 338 ? 91.837  75.234 96.957  1.00 68.88  ? 338 LEU A CD1   1 
ATOM   3696 C CD2   . LEU C 2 338 ? 90.179  77.080 97.320  1.00 64.45  ? 338 LEU A CD2   1 
ATOM   3697 N N     . LEU C 2 339 ? 92.777  77.324 101.780 1.00 45.95  ? 339 LEU A N     1 
ATOM   3698 C CA    . LEU C 2 339 ? 93.226  78.345 102.724 1.00 47.52  ? 339 LEU A CA    1 
ATOM   3699 C C     . LEU C 2 339 ? 94.609  77.927 103.251 1.00 53.33  ? 339 LEU A C     1 
ATOM   3700 O O     . LEU C 2 339 ? 95.585  78.577 102.912 1.00 61.88  ? 339 LEU A O     1 
ATOM   3701 C CB    . LEU C 2 339 ? 92.212  78.513 103.865 1.00 39.59  ? 339 LEU A CB    1 
ATOM   3702 C CG    . LEU C 2 339 ? 91.291  79.756 103.996 1.00 37.28  ? 339 LEU A CG    1 
ATOM   3703 C CD1   . LEU C 2 339 ? 91.456  80.717 102.836 1.00 28.23  ? 339 LEU A CD1   1 
ATOM   3704 C CD2   . LEU C 2 339 ? 89.838  79.294 104.108 1.00 34.80  ? 339 LEU A CD2   1 
ATOM   3705 N N     . GLU C 2 340 ? 94.673  76.853 104.051 1.00 59.27  ? 340 GLU A N     1 
ATOM   3706 C CA    . GLU C 2 340 ? 95.917  76.280 104.610 1.00 61.72  ? 340 GLU A CA    1 
ATOM   3707 C C     . GLU C 2 340 ? 95.709  75.681 106.008 1.00 58.31  ? 340 GLU A C     1 
ATOM   3708 O O     . GLU C 2 340 ? 94.898  76.177 106.792 1.00 65.71  ? 340 GLU A O     1 
ATOM   3709 C CB    . GLU C 2 340 ? 97.031  77.327 104.723 1.00 75.07  ? 340 GLU A CB    1 
ATOM   3710 C CG    . GLU C 2 340 ? 97.808  77.645 103.435 1.00 85.41  ? 340 GLU A CG    1 
ATOM   3711 C CD    . GLU C 2 340 ? 98.187  76.423 102.629 1.00 88.75  ? 340 GLU A CD    1 
ATOM   3712 O OE1   . GLU C 2 340 ? 97.286  75.804 102.009 1.00 82.39  ? 340 GLU A OE1   1 
ATOM   3713 O OE2   . GLU C 2 340 ? 99.399  76.098 102.617 1.00 100.00 ? 340 GLU A OE2   1 
ATOM   3714 N N     . THR D 2 19  ? 32.284  48.738 81.580  1.00 61.75  ? 19  THR B N     1 
ATOM   3715 C CA    . THR D 2 19  ? 33.022  47.664 82.236  1.00 70.66  ? 19  THR B CA    1 
ATOM   3716 C C     . THR D 2 19  ? 33.611  46.627 81.268  1.00 67.74  ? 19  THR B C     1 
ATOM   3717 O O     . THR D 2 19  ? 34.800  46.678 80.955  1.00 72.94  ? 19  THR B O     1 
ATOM   3718 C CB    . THR D 2 19  ? 32.129  46.947 83.280  1.00 78.55  ? 19  THR B CB    1 
ATOM   3719 O OG1   . THR D 2 19  ? 31.436  47.925 84.066  1.00 89.88  ? 19  THR B OG1   1 
ATOM   3720 C CG2   . THR D 2 19  ? 32.968  46.075 84.204  1.00 76.38  ? 19  THR B CG2   1 
ATOM   3721 N N     . SER D 2 20  ? 32.780  45.699 80.791  1.00 65.97  ? 20  SER B N     1 
ATOM   3722 C CA    . SER D 2 20  ? 33.218  44.629 79.889  1.00 60.56  ? 20  SER B CA    1 
ATOM   3723 C C     . SER D 2 20  ? 33.355  44.989 78.417  1.00 57.78  ? 20  SER B C     1 
ATOM   3724 O O     . SER D 2 20  ? 33.803  44.170 77.621  1.00 50.90  ? 20  SER B O     1 
ATOM   3725 C CB    . SER D 2 20  ? 32.274  43.434 80.016  1.00 70.29  ? 20  SER B CB    1 
ATOM   3726 O OG    . SER D 2 20  ? 32.955  42.212 79.789  1.00 83.19  ? 20  SER B OG    1 
ATOM   3727 N N     . ASP D 2 21  ? 32.956  46.203 78.062  1.00 65.10  ? 21  ASP B N     1 
ATOM   3728 C CA    . ASP D 2 21  ? 33.052  46.678 76.681  1.00 69.64  ? 21  ASP B CA    1 
ATOM   3729 C C     . ASP D 2 21  ? 34.356  47.458 76.527  1.00 66.09  ? 21  ASP B C     1 
ATOM   3730 O O     . ASP D 2 21  ? 35.015  47.389 75.485  1.00 68.39  ? 21  ASP B O     1 
ATOM   3731 C CB    . ASP D 2 21  ? 31.863  47.586 76.330  1.00 81.38  ? 21  ASP B CB    1 
ATOM   3732 C CG    . ASP D 2 21  ? 30.798  46.873 75.499  1.00 91.59  ? 21  ASP B CG    1 
ATOM   3733 O OD1   . ASP D 2 21  ? 31.161  46.050 74.626  1.00 89.27  ? 21  ASP B OD1   1 
ATOM   3734 O OD2   . ASP D 2 21  ? 29.596  47.143 75.719  1.00 100.00 ? 21  ASP B OD2   1 
ATOM   3735 N N     . GLU D 2 22  ? 34.721  48.195 77.575  1.00 56.16  ? 22  GLU B N     1 
ATOM   3736 C CA    . GLU D 2 22  ? 35.951  48.976 77.571  1.00 51.95  ? 22  GLU B CA    1 
ATOM   3737 C C     . GLU D 2 22  ? 37.095  48.041 77.782  1.00 44.23  ? 22  GLU B C     1 
ATOM   3738 O O     . GLU D 2 22  ? 38.123  48.130 77.133  1.00 42.07  ? 22  GLU B O     1 
ATOM   3739 C CB    . GLU D 2 22  ? 35.965  49.968 78.711  1.00 60.86  ? 22  GLU B CB    1 
ATOM   3740 C CG    . GLU D 2 22  ? 34.809  50.923 78.670  1.00 87.46  ? 22  GLU B CG    1 
ATOM   3741 C CD    . GLU D 2 22  ? 33.906  50.789 79.878  1.00 100.00 ? 22  GLU B CD    1 
ATOM   3742 O OE1   . GLU D 2 22  ? 34.315  50.136 80.866  1.00 100.00 ? 22  GLU B OE1   1 
ATOM   3743 O OE2   . GLU D 2 22  ? 32.785  51.341 79.840  1.00 100.00 ? 22  GLU B OE2   1 
ATOM   3744 N N     . VAL D 2 23  ? 36.912  47.148 78.735  1.00 41.20  ? 23  VAL B N     1 
ATOM   3745 C CA    . VAL D 2 23  ? 37.925  46.165 79.045  1.00 49.70  ? 23  VAL B CA    1 
ATOM   3746 C C     . VAL D 2 23  ? 38.267  45.386 77.779  1.00 56.34  ? 23  VAL B C     1 
ATOM   3747 O O     . VAL D 2 23  ? 39.413  45.370 77.340  1.00 63.06  ? 23  VAL B O     1 
ATOM   3748 C CB    . VAL D 2 23  ? 37.412  45.214 80.133  1.00 47.19  ? 23  VAL B CB    1 
ATOM   3749 C CG1   . VAL D 2 23  ? 37.989  43.832 79.949  1.00 41.16  ? 23  VAL B CG1   1 
ATOM   3750 C CG2   . VAL D 2 23  ? 37.760  45.774 81.495  1.00 39.53  ? 23  VAL B CG2   1 
ATOM   3751 N N     . ARG D 2 24  ? 37.264  44.746 77.190  1.00 61.45  ? 24  ARG B N     1 
ATOM   3752 C CA    . ARG D 2 24  ? 37.455  43.966 75.966  1.00 62.84  ? 24  ARG B CA    1 
ATOM   3753 C C     . ARG D 2 24  ? 38.102  44.841 74.897  1.00 54.80  ? 24  ARG B C     1 
ATOM   3754 O O     . ARG D 2 24  ? 38.847  44.360 74.044  1.00 52.81  ? 24  ARG B O     1 
ATOM   3755 C CB    . ARG D 2 24  ? 36.098  43.427 75.459  1.00 79.74  ? 24  ARG B CB    1 
ATOM   3756 C CG    . ARG D 2 24  ? 36.160  42.127 74.622  1.00 90.93  ? 24  ARG B CG    1 
ATOM   3757 C CD    . ARG D 2 24  ? 35.278  40.991 75.210  1.00 100.00 ? 24  ARG B CD    1 
ATOM   3758 N NE    . ARG D 2 24  ? 35.134  39.852 74.291  1.00 100.00 ? 24  ARG B NE    1 
ATOM   3759 C CZ    . ARG D 2 24  ? 35.094  38.570 74.655  1.00 98.09  ? 24  ARG B CZ    1 
ATOM   3760 N NH1   . ARG D 2 24  ? 35.181  38.226 75.936  1.00 93.29  ? 24  ARG B NH1   1 
ATOM   3761 N NH2   . ARG D 2 24  ? 34.979  37.628 73.725  1.00 94.10  ? 24  ARG B NH2   1 
ATOM   3762 N N     . LYS D 2 25  ? 37.827  46.137 74.952  1.00 51.46  ? 25  LYS B N     1 
ATOM   3763 C CA    . LYS D 2 25  ? 38.384  47.039 73.955  1.00 54.38  ? 25  LYS B CA    1 
ATOM   3764 C C     . LYS D 2 25  ? 39.841  47.304 74.222  1.00 51.18  ? 25  LYS B C     1 
ATOM   3765 O O     . LYS D 2 25  ? 40.660  47.299 73.304  1.00 51.94  ? 25  LYS B O     1 
ATOM   3766 C CB    . LYS D 2 25  ? 37.625  48.368 73.932  1.00 58.44  ? 25  LYS B CB    1 
ATOM   3767 C CG    . LYS D 2 25  ? 38.063  49.288 72.799  1.00 68.87  ? 25  LYS B CG    1 
ATOM   3768 C CD    . LYS D 2 25  ? 37.727  50.732 73.126  1.00 83.65  ? 25  LYS B CD    1 
ATOM   3769 C CE    . LYS D 2 25  ? 38.687  51.704 72.466  1.00 81.86  ? 25  LYS B CE    1 
ATOM   3770 N NZ    . LYS D 2 25  ? 38.102  53.070 72.500  1.00 88.83  ? 25  LYS B NZ    1 
ATOM   3771 N N     . ASN D 2 26  ? 40.148  47.535 75.492  1.00 52.90  ? 26  ASN B N     1 
ATOM   3772 C CA    . ASN D 2 26  ? 41.498  47.826 75.937  1.00 44.93  ? 26  ASN B CA    1 
ATOM   3773 C C     . ASN D 2 26  ? 42.497  46.741 75.629  1.00 48.82  ? 26  ASN B C     1 
ATOM   3774 O O     . ASN D 2 26  ? 43.689  47.016 75.504  1.00 52.91  ? 26  ASN B O     1 
ATOM   3775 C CB    . ASN D 2 26  ? 41.479  48.080 77.415  1.00 34.05  ? 26  ASN B CB    1 
ATOM   3776 C CG    . ASN D 2 26  ? 41.070  49.454 77.710  1.00 28.54  ? 26  ASN B CG    1 
ATOM   3777 O OD1   . ASN D 2 26  ? 41.131  50.303 76.828  1.00 40.59  ? 26  ASN B OD1   1 
ATOM   3778 N ND2   . ASN D 2 26  ? 40.637  49.710 78.932  1.00 40.66  ? 26  ASN B ND2   1 
ATOM   3779 N N     . LEU D 2 27  ? 42.000  45.510 75.525  1.00 50.43  ? 27  LEU B N     1 
ATOM   3780 C CA    . LEU D 2 27  ? 42.814  44.335 75.208  1.00 55.23  ? 27  LEU B CA    1 
ATOM   3781 C C     . LEU D 2 27  ? 43.072  44.275 73.709  1.00 55.55  ? 27  LEU B C     1 
ATOM   3782 O O     . LEU D 2 27  ? 44.147  43.857 73.275  1.00 65.88  ? 27  LEU B O     1 
ATOM   3783 C CB    . LEU D 2 27  ? 42.090  43.048 75.633  1.00 60.46  ? 27  LEU B CB    1 
ATOM   3784 C CG    . LEU D 2 27  ? 42.331  42.428 77.012  1.00 58.04  ? 27  LEU B CG    1 
ATOM   3785 C CD1   . LEU D 2 27  ? 43.779  42.620 77.439  1.00 62.49  ? 27  LEU B CD1   1 
ATOM   3786 C CD2   . LEU D 2 27  ? 41.370  43.057 78.007  1.00 59.74  ? 27  LEU B CD2   1 
ATOM   3787 N N     . MET D 2 28  ? 42.070  44.670 72.926  1.00 57.31  ? 28  MET B N     1 
ATOM   3788 C CA    . MET D 2 28  ? 42.198  44.673 71.475  1.00 61.65  ? 28  MET B CA    1 
ATOM   3789 C C     . MET D 2 28  ? 43.254  45.700 71.054  1.00 62.59  ? 28  MET B C     1 
ATOM   3790 O O     . MET D 2 28  ? 44.102  45.416 70.210  1.00 63.99  ? 28  MET B O     1 
ATOM   3791 C CB    . MET D 2 28  ? 40.853  45.004 70.823  1.00 69.51  ? 28  MET B CB    1 
ATOM   3792 C CG    . MET D 2 28  ? 40.403  43.998 69.763  1.00 79.07  ? 28  MET B CG    1 
ATOM   3793 S SD    . MET D 2 28  ? 39.391  42.634 70.409  1.00 92.95  ? 28  MET B SD    1 
ATOM   3794 C CE    . MET D 2 28  ? 40.071  41.234 69.497  1.00 87.93  ? 28  MET B CE    1 
ATOM   3795 N N     . ASP D 2 29  ? 43.211  46.889 71.649  1.00 55.85  ? 29  ASP B N     1 
ATOM   3796 C CA    . ASP D 2 29  ? 44.174  47.937 71.324  1.00 53.53  ? 29  ASP B CA    1 
ATOM   3797 C C     . ASP D 2 29  ? 45.610  47.514 71.669  1.00 49.87  ? 29  ASP B C     1 
ATOM   3798 O O     . ASP D 2 29  ? 46.542  47.720 70.884  1.00 47.70  ? 29  ASP B O     1 
ATOM   3799 C CB    . ASP D 2 29  ? 43.801  49.216 72.077  1.00 58.29  ? 29  ASP B CB    1 
ATOM   3800 C CG    . ASP D 2 29  ? 42.353  49.616 71.851  1.00 63.26  ? 29  ASP B CG    1 
ATOM   3801 O OD1   . ASP D 2 29  ? 41.728  49.067 70.914  1.00 59.20  ? 29  ASP B OD1   1 
ATOM   3802 O OD2   . ASP D 2 29  ? 41.842  50.474 72.602  1.00 52.51  ? 29  ASP B OD2   1 
ATOM   3803 N N     . MET D 2 30  ? 45.764  46.914 72.847  1.00 48.20  ? 30  MET B N     1 
ATOM   3804 C CA    . MET D 2 30  ? 47.051  46.435 73.359  1.00 44.55  ? 30  MET B CA    1 
ATOM   3805 C C     . MET D 2 30  ? 47.590  45.307 72.496  1.00 44.52  ? 30  MET B C     1 
ATOM   3806 O O     . MET D 2 30  ? 48.684  45.388 71.931  1.00 43.08  ? 30  MET B O     1 
ATOM   3807 C CB    . MET D 2 30  ? 46.885  45.939 74.790  1.00 33.37  ? 30  MET B CB    1 
ATOM   3808 C CG    . MET D 2 30  ? 48.188  45.721 75.517  1.00 39.74  ? 30  MET B CG    1 
ATOM   3809 S SD    . MET D 2 30  ? 48.257  44.059 76.179  1.00 68.02  ? 30  MET B SD    1 
ATOM   3810 C CE    . MET D 2 30  ? 47.812  44.306 77.849  1.00 47.71  ? 30  MET B CE    1 
ATOM   3811 N N     . PHE D 2 31  ? 46.831  44.231 72.421  1.00 41.65  ? 31  PHE B N     1 
ATOM   3812 C CA    . PHE D 2 31  ? 47.243  43.136 71.579  1.00 47.63  ? 31  PHE B CA    1 
ATOM   3813 C C     . PHE D 2 31  ? 47.485  43.688 70.161  1.00 47.90  ? 31  PHE B C     1 
ATOM   3814 O O     . PHE D 2 31  ? 48.332  43.175 69.431  1.00 53.50  ? 31  PHE B O     1 
ATOM   3815 C CB    . PHE D 2 31  ? 46.152  42.064 71.576  1.00 52.35  ? 31  PHE B CB    1 
ATOM   3816 C CG    . PHE D 2 31  ? 46.189  41.159 70.378  1.00 60.64  ? 31  PHE B CG    1 
ATOM   3817 C CD1   . PHE D 2 31  ? 47.056  40.076 70.335  1.00 61.51  ? 31  PHE B CD1   1 
ATOM   3818 C CD2   . PHE D 2 31  ? 45.352  41.388 69.289  1.00 59.05  ? 31  PHE B CD2   1 
ATOM   3819 C CE1   . PHE D 2 31  ? 47.090  39.233 69.219  1.00 65.98  ? 31  PHE B CE1   1 
ATOM   3820 C CE2   . PHE D 2 31  ? 45.379  40.552 68.171  1.00 62.14  ? 31  PHE B CE2   1 
ATOM   3821 C CZ    . PHE D 2 31  ? 46.248  39.472 68.135  1.00 63.28  ? 31  PHE B CZ    1 
ATOM   3822 N N     . ARG D 2 32  ? 46.763  44.744 69.779  1.00 52.29  ? 32  ARG B N     1 
ATOM   3823 C CA    . ARG D 2 32  ? 46.910  45.335 68.440  1.00 51.17  ? 32  ARG B CA    1 
ATOM   3824 C C     . ARG D 2 32  ? 48.276  45.965 68.211  1.00 51.04  ? 32  ARG B C     1 
ATOM   3825 O O     . ARG D 2 32  ? 48.795  45.954 67.093  1.00 50.19  ? 32  ARG B O     1 
ATOM   3826 C CB    . ARG D 2 32  ? 45.831  46.393 68.197  1.00 55.89  ? 32  ARG B CB    1 
ATOM   3827 C CG    . ARG D 2 32  ? 45.886  47.045 66.817  1.00 50.60  ? 32  ARG B CG    1 
ATOM   3828 C CD    . ARG D 2 32  ? 44.907  48.207 66.727  1.00 41.90  ? 32  ARG B CD    1 
ATOM   3829 N NE    . ARG D 2 32  ? 45.051  49.090 67.883  1.00 48.54  ? 32  ARG B NE    1 
ATOM   3830 C CZ    . ARG D 2 32  ? 44.517  50.302 67.978  1.00 47.19  ? 32  ARG B CZ    1 
ATOM   3831 N NH1   . ARG D 2 32  ? 43.795  50.798 66.984  1.00 39.58  ? 32  ARG B NH1   1 
ATOM   3832 N NH2   . ARG D 2 32  ? 44.734  51.030 69.065  1.00 49.85  ? 32  ARG B NH2   1 
ATOM   3833 N N     . ASP D 2 33  ? 48.829  46.542 69.272  1.00 48.90  ? 33  ASP B N     1 
ATOM   3834 C CA    . ASP D 2 33  ? 50.140  47.168 69.224  1.00 44.01  ? 33  ASP B CA    1 
ATOM   3835 C C     . ASP D 2 33  ? 51.098  46.466 70.180  1.00 47.61  ? 33  ASP B C     1 
ATOM   3836 O O     . ASP D 2 33  ? 51.706  47.109 71.030  1.00 46.72  ? 33  ASP B O     1 
ATOM   3837 C CB    . ASP D 2 33  ? 50.022  48.640 69.605  1.00 47.42  ? 33  ASP B CB    1 
ATOM   3838 C CG    . ASP D 2 33  ? 49.741  49.527 68.410  1.00 47.61  ? 33  ASP B CG    1 
ATOM   3839 O OD1   . ASP D 2 33  ? 50.667  49.743 67.604  1.00 49.52  ? 33  ASP B OD1   1 
ATOM   3840 O OD2   . ASP D 2 33  ? 48.599  50.006 68.268  1.00 50.79  ? 33  ASP B OD2   1 
ATOM   3841 N N     . ARG D 2 34  ? 51.216  45.145 70.049  1.00 53.38  ? 34  ARG B N     1 
ATOM   3842 C CA    . ARG D 2 34  ? 52.107  44.359 70.911  1.00 47.60  ? 34  ARG B CA    1 
ATOM   3843 C C     . ARG D 2 34  ? 53.537  44.581 70.496  1.00 39.78  ? 34  ARG B C     1 
ATOM   3844 O O     . ARG D 2 34  ? 54.463  44.313 71.264  1.00 43.46  ? 34  ARG B O     1 
ATOM   3845 C CB    . ARG D 2 34  ? 51.800  42.853 70.832  1.00 48.90  ? 34  ARG B CB    1 
ATOM   3846 C CG    . ARG D 2 34  ? 51.140  42.395 69.547  1.00 58.31  ? 34  ARG B CG    1 
ATOM   3847 C CD    . ARG D 2 34  ? 51.812  41.176 68.925  1.00 66.82  ? 34  ARG B CD    1 
ATOM   3848 N NE    . ARG D 2 34  ? 51.766  41.256 67.464  1.00 92.12  ? 34  ARG B NE    1 
ATOM   3849 C CZ    . ARG D 2 34  ? 50.776  40.782 66.712  1.00 97.98  ? 34  ARG B CZ    1 
ATOM   3850 N NH1   . ARG D 2 34  ? 49.735  40.183 67.279  1.00 96.78  ? 34  ARG B NH1   1 
ATOM   3851 N NH2   . ARG D 2 34  ? 50.821  40.927 65.388  1.00 100.00 ? 34  ARG B NH2   1 
ATOM   3852 N N     . GLN D 2 35  ? 53.708  45.086 69.279  1.00 31.23  ? 35  GLN B N     1 
ATOM   3853 C CA    . GLN D 2 35  ? 55.032  45.344 68.740  1.00 30.22  ? 35  GLN B CA    1 
ATOM   3854 C C     . GLN D 2 35  ? 55.669  46.468 69.529  1.00 28.89  ? 35  GLN B C     1 
ATOM   3855 O O     . GLN D 2 35  ? 56.845  46.751 69.389  1.00 36.31  ? 35  GLN B O     1 
ATOM   3856 C CB    . GLN D 2 35  ? 54.952  45.727 67.271  1.00 27.19  ? 35  GLN B CB    1 
ATOM   3857 C CG    . GLN D 2 35  ? 55.615  44.725 66.357  1.00 46.96  ? 35  GLN B CG    1 
ATOM   3858 C CD    . GLN D 2 35  ? 56.517  43.763 67.105  1.00 56.66  ? 35  GLN B CD    1 
ATOM   3859 O OE1   . GLN D 2 35  ? 57.670  44.077 67.399  1.00 59.63  ? 35  GLN B OE1   1 
ATOM   3860 N NE2   . GLN D 2 35  ? 55.986  42.586 67.428  1.00 61.06  ? 35  GLN B NE2   1 
ATOM   3861 N N     . ALA D 2 36  ? 54.875  47.096 70.382  1.00 28.40  ? 36  ALA B N     1 
ATOM   3862 C CA    . ALA D 2 36  ? 55.364  48.173 71.216  1.00 29.81  ? 36  ALA B CA    1 
ATOM   3863 C C     . ALA D 2 36  ? 55.876  47.560 72.509  1.00 29.44  ? 36  ALA B C     1 
ATOM   3864 O O     . ALA D 2 36  ? 56.270  48.269 73.428  1.00 31.03  ? 36  ALA B O     1 
ATOM   3865 C CB    . ALA D 2 36  ? 54.242  49.155 71.510  1.00 40.14  ? 36  ALA B CB    1 
ATOM   3866 N N     . PHE D 2 37  ? 55.875  46.231 72.562  1.00 35.64  ? 37  PHE B N     1 
ATOM   3867 C CA    . PHE D 2 37  ? 56.345  45.495 73.737  1.00 36.81  ? 37  PHE B CA    1 
ATOM   3868 C C     . PHE D 2 37  ? 57.400  44.490 73.305  1.00 36.19  ? 37  PHE B C     1 
ATOM   3869 O O     . PHE D 2 37  ? 57.349  43.978 72.179  1.00 39.02  ? 37  PHE B O     1 
ATOM   3870 C CB    . PHE D 2 37  ? 55.196  44.724 74.405  1.00 44.54  ? 37  PHE B CB    1 
ATOM   3871 C CG    . PHE D 2 37  ? 54.251  45.590 75.183  1.00 52.60  ? 37  PHE B CG    1 
ATOM   3872 C CD1   . PHE D 2 37  ? 52.974  45.868 74.695  1.00 50.11  ? 37  PHE B CD1   1 
ATOM   3873 C CD2   . PHE D 2 37  ? 54.644  46.144 76.393  1.00 47.95  ? 37  PHE B CD2   1 
ATOM   3874 C CE1   . PHE D 2 37  ? 52.108  46.688 75.399  1.00 38.97  ? 37  PHE B CE1   1 
ATOM   3875 C CE2   . PHE D 2 37  ? 53.790  46.964 77.105  1.00 41.95  ? 37  PHE B CE2   1 
ATOM   3876 C CZ    . PHE D 2 37  ? 52.517  47.238 76.609  1.00 47.07  ? 37  PHE B CZ    1 
ATOM   3877 N N     . SER D 2 38  ? 58.352  44.219 74.192  1.00 40.97  ? 38  SER B N     1 
ATOM   3878 C CA    . SER D 2 38  ? 59.401  43.245 73.909  1.00 35.89  ? 38  SER B CA    1 
ATOM   3879 C C     . SER D 2 38  ? 58.756  41.896 73.607  1.00 40.33  ? 38  SER B C     1 
ATOM   3880 O O     . SER D 2 38  ? 57.825  41.474 74.299  1.00 39.29  ? 38  SER B O     1 
ATOM   3881 C CB    . SER D 2 38  ? 60.325  43.093 75.110  1.00 33.26  ? 38  SER B CB    1 
ATOM   3882 O OG    . SER D 2 38  ? 60.680  41.733 75.283  1.00 37.51  ? 38  SER B OG    1 
ATOM   3883 N N     . GLU D 2 39  ? 59.263  41.219 72.583  1.00 47.52  ? 39  GLU B N     1 
ATOM   3884 C CA    . GLU D 2 39  ? 58.728  39.920 72.172  1.00 51.39  ? 39  GLU B CA    1 
ATOM   3885 C C     . GLU D 2 39  ? 58.683  39.001 73.370  1.00 48.16  ? 39  GLU B C     1 
ATOM   3886 O O     . GLU D 2 39  ? 57.741  38.229 73.546  1.00 50.96  ? 39  GLU B O     1 
ATOM   3887 C CB    . GLU D 2 39  ? 59.609  39.291 71.093  1.00 49.21  ? 39  GLU B CB    1 
ATOM   3888 C CG    . GLU D 2 39  ? 59.972  40.248 69.968  1.00 76.28  ? 39  GLU B CG    1 
ATOM   3889 C CD    . GLU D 2 39  ? 61.034  41.248 70.376  1.00 78.03  ? 39  GLU B CD    1 
ATOM   3890 O OE1   . GLU D 2 39  ? 62.163  40.805 70.677  1.00 80.85  ? 39  GLU B OE1   1 
ATOM   3891 O OE2   . GLU D 2 39  ? 60.740  42.467 70.397  1.00 74.65  ? 39  GLU B OE2   1 
ATOM   3892 N N     . HIS D 2 40  ? 59.719  39.101 74.193  1.00 41.32  ? 40  HIS B N     1 
ATOM   3893 C CA    . HIS D 2 40  ? 59.837  38.291 75.385  1.00 36.92  ? 40  HIS B CA    1 
ATOM   3894 C C     . HIS D 2 40  ? 58.746  38.640 76.384  1.00 39.07  ? 40  HIS B C     1 
ATOM   3895 O O     . HIS D 2 40  ? 58.144  37.747 76.989  1.00 37.90  ? 40  HIS B O     1 
ATOM   3896 C CB    . HIS D 2 40  ? 61.217  38.509 76.002  1.00 34.75  ? 40  HIS B CB    1 
ATOM   3897 C CG    . HIS D 2 40  ? 62.349  38.203 75.067  1.00 24.34  ? 40  HIS B CG    1 
ATOM   3898 N ND1   . HIS D 2 40  ? 63.321  39.131 74.746  1.00 20.70  ? 40  HIS B ND1   1 
ATOM   3899 C CD2   . HIS D 2 40  ? 62.697  37.064 74.422  1.00 15.03  ? 40  HIS B CD2   1 
ATOM   3900 C CE1   . HIS D 2 40  ? 64.214  38.579 73.950  1.00 16.45  ? 40  HIS B CE1   1 
ATOM   3901 N NE2   . HIS D 2 40  ? 63.860  37.321 73.738  1.00 20.01  ? 40  HIS B NE2   1 
ATOM   3902 N N     . THR D 2 41  ? 58.499  39.939 76.557  1.00 43.00  ? 41  THR B N     1 
ATOM   3903 C CA    . THR D 2 41  ? 57.472  40.392 77.492  1.00 33.74  ? 41  THR B CA    1 
ATOM   3904 C C     . THR D 2 41  ? 56.221  39.619 77.151  1.00 29.40  ? 41  THR B C     1 
ATOM   3905 O O     . THR D 2 41  ? 55.606  38.968 78.008  1.00 22.53  ? 41  THR B O     1 
ATOM   3906 C CB    . THR D 2 41  ? 57.170  41.899 77.353  1.00 34.55  ? 41  THR B CB    1 
ATOM   3907 O OG1   . THR D 2 41  ? 58.389  42.641 77.456  1.00 36.42  ? 41  THR B OG1   1 
ATOM   3908 C CG2   . THR D 2 41  ? 56.211  42.351 78.455  1.00 38.42  ? 41  THR B CG2   1 
ATOM   3909 N N     . TRP D 2 42  ? 55.872  39.648 75.870  1.00 26.67  ? 42  TRP B N     1 
ATOM   3910 C CA    . TRP D 2 42  ? 54.679  38.952 75.451  1.00 35.48  ? 42  TRP B CA    1 
ATOM   3911 C C     . TRP D 2 42  ? 54.814  37.476 75.708  1.00 36.15  ? 42  TRP B C     1 
ATOM   3912 O O     . TRP D 2 42  ? 53.865  36.844 76.184  1.00 41.76  ? 42  TRP B O     1 
ATOM   3913 C CB    . TRP D 2 42  ? 54.362  39.240 73.974  1.00 41.28  ? 42  TRP B CB    1 
ATOM   3914 C CG    . TRP D 2 42  ? 53.291  40.314 73.857  1.00 54.41  ? 42  TRP B CG    1 
ATOM   3915 C CD1   . TRP D 2 42  ? 53.423  41.641 74.167  1.00 60.12  ? 42  TRP B CD1   1 
ATOM   3916 C CD2   . TRP D 2 42  ? 51.913  40.126 73.516  1.00 54.59  ? 42  TRP B CD2   1 
ATOM   3917 N NE1   . TRP D 2 42  ? 52.217  42.283 74.046  1.00 62.56  ? 42  TRP B NE1   1 
ATOM   3918 C CE2   . TRP D 2 42  ? 51.272  41.378 73.647  1.00 57.29  ? 42  TRP B CE2   1 
ATOM   3919 C CE3   . TRP D 2 42  ? 51.159  39.022 73.113  1.00 57.28  ? 42  TRP B CE3   1 
ATOM   3920 C CZ2   . TRP D 2 42  ? 49.916  41.556 73.392  1.00 55.33  ? 42  TRP B CZ2   1 
ATOM   3921 C CZ3   . TRP D 2 42  ? 49.813  39.201 72.860  1.00 71.17  ? 42  TRP B CZ3   1 
ATOM   3922 C CH2   . TRP D 2 42  ? 49.204  40.459 72.999  1.00 65.05  ? 42  TRP B CH2   1 
ATOM   3923 N N     . LYS D 2 43  ? 56.001  36.939 75.437  1.00 31.81  ? 43  LYS B N     1 
ATOM   3924 C CA    . LYS D 2 43  ? 56.249  35.518 75.626  1.00 28.64  ? 43  LYS B CA    1 
ATOM   3925 C C     . LYS D 2 43  ? 55.941  35.087 77.039  1.00 29.93  ? 43  LYS B C     1 
ATOM   3926 O O     . LYS D 2 43  ? 55.205  34.119 77.250  1.00 23.99  ? 43  LYS B O     1 
ATOM   3927 C CB    . LYS D 2 43  ? 57.701  35.183 75.288  1.00 39.01  ? 43  LYS B CB    1 
ATOM   3928 C CG    . LYS D 2 43  ? 57.875  34.504 73.931  1.00 58.24  ? 43  LYS B CG    1 
ATOM   3929 C CD    . LYS D 2 43  ? 57.921  35.498 72.765  1.00 60.77  ? 43  LYS B CD    1 
ATOM   3930 C CE    . LYS D 2 43  ? 57.228  34.934 71.524  1.00 76.95  ? 43  LYS B CE    1 
ATOM   3931 N NZ    . LYS D 2 43  ? 58.165  34.649 70.388  1.00 85.35  ? 43  LYS B NZ    1 
ATOM   3932 N N     . MET D 2 44  ? 56.495  35.822 78.003  1.00 30.83  ? 44  MET B N     1 
ATOM   3933 C CA    . MET D 2 44  ? 56.299  35.510 79.412  1.00 27.68  ? 44  MET B CA    1 
ATOM   3934 C C     . MET D 2 44  ? 54.852  35.686 79.789  1.00 26.44  ? 44  MET B C     1 
ATOM   3935 O O     . MET D 2 44  ? 54.318  34.916 80.583  1.00 29.36  ? 44  MET B O     1 
ATOM   3936 C CB    . MET D 2 44  ? 57.200  36.384 80.283  1.00 20.57  ? 44  MET B CB    1 
ATOM   3937 C CG    . MET D 2 44  ? 58.614  35.833 80.390  1.00 17.79  ? 44  MET B CG    1 
ATOM   3938 S SD    . MET D 2 44  ? 58.644  34.017 80.312  1.00 25.35  ? 44  MET B SD    1 
ATOM   3939 C CE    . MET D 2 44  ? 57.840  33.610 81.859  1.00 35.50  ? 44  MET B CE    1 
ATOM   3940 N N     . LEU D 2 45  ? 54.223  36.694 79.191  1.00 29.38  ? 45  LEU B N     1 
ATOM   3941 C CA    . LEU D 2 45  ? 52.810  36.971 79.412  1.00 27.96  ? 45  LEU B CA    1 
ATOM   3942 C C     . LEU D 2 45  ? 52.002  35.713 79.127  1.00 28.21  ? 45  LEU B C     1 
ATOM   3943 O O     . LEU D 2 45  ? 51.353  35.148 80.010  1.00 35.85  ? 45  LEU B O     1 
ATOM   3944 C CB    . LEU D 2 45  ? 52.328  38.062 78.468  1.00 24.03  ? 45  LEU B CB    1 
ATOM   3945 C CG    . LEU D 2 45  ? 51.422  39.090 79.145  1.00 40.13  ? 45  LEU B CG    1 
ATOM   3946 C CD1   . LEU D 2 45  ? 50.707  39.977 78.130  1.00 15.51  ? 45  LEU B CD1   1 
ATOM   3947 C CD2   . LEU D 2 45  ? 50.421  38.336 80.010  1.00 34.40  ? 45  LEU B CD2   1 
ATOM   3948 N N     . LEU D 2 46  ? 52.075  35.264 77.882  1.00 21.83  ? 46  LEU B N     1 
ATOM   3949 C CA    . LEU D 2 46  ? 51.354  34.086 77.455  1.00 22.61  ? 46  LEU B CA    1 
ATOM   3950 C C     . LEU D 2 46  ? 51.773  32.865 78.243  1.00 26.45  ? 46  LEU B C     1 
ATOM   3951 O O     . LEU D 2 46  ? 51.005  31.899 78.389  1.00 32.88  ? 46  LEU B O     1 
ATOM   3952 C CB    . LEU D 2 46  ? 51.586  33.870 75.954  1.00 28.07  ? 46  LEU B CB    1 
ATOM   3953 C CG    . LEU D 2 46  ? 51.221  35.087 75.070  1.00 33.99  ? 46  LEU B CG    1 
ATOM   3954 C CD1   . LEU D 2 46  ? 51.080  34.672 73.615  1.00 35.98  ? 46  LEU B CD1   1 
ATOM   3955 C CD2   . LEU D 2 46  ? 49.913  35.710 75.549  1.00 24.45  ? 46  LEU B CD2   1 
ATOM   3956 N N     . SER D 2 47  ? 52.985  32.913 78.776  1.00 22.28  ? 47  SER B N     1 
ATOM   3957 C CA    . SER D 2 47  ? 53.475  31.770 79.526  1.00 19.89  ? 47  SER B CA    1 
ATOM   3958 C C     . SER D 2 47  ? 52.816  31.695 80.873  1.00 18.45  ? 47  SER B C     1 
ATOM   3959 O O     . SER D 2 47  ? 52.285  30.665 81.272  1.00 19.88  ? 47  SER B O     1 
ATOM   3960 C CB    . SER D 2 47  ? 54.980  31.853 79.720  1.00 14.72  ? 47  SER B CB    1 
ATOM   3961 O OG    . SER D 2 47  ? 55.406  30.810 80.581  1.00 30.27  ? 47  SER B OG    1 
ATOM   3962 N N     . VAL D 2 48  ? 52.873  32.821 81.565  1.00 24.34  ? 48  VAL B N     1 
ATOM   3963 C CA    . VAL D 2 48  ? 52.303  32.968 82.889  1.00 24.06  ? 48  VAL B CA    1 
ATOM   3964 C C     . VAL D 2 48  ? 50.833  32.635 82.848  1.00 22.63  ? 48  VAL B C     1 
ATOM   3965 O O     . VAL D 2 48  ? 50.367  31.804 83.611  1.00 34.15  ? 48  VAL B O     1 
ATOM   3966 C CB    . VAL D 2 48  ? 52.463  34.394 83.372  1.00 20.76  ? 48  VAL B CB    1 
ATOM   3967 C CG1   . VAL D 2 48  ? 51.590  34.619 84.598  1.00 25.72  ? 48  VAL B CG1   1 
ATOM   3968 C CG2   . VAL D 2 48  ? 53.942  34.670 83.647  1.00 10.52  ? 48  VAL B CG2   1 
ATOM   3969 N N     . CYS D 2 49  ? 50.106  33.287 81.952  1.00 18.43  ? 49  CYS B N     1 
ATOM   3970 C CA    . CYS D 2 49  ? 48.690  33.022 81.792  1.00 15.86  ? 49  CYS B CA    1 
ATOM   3971 C C     . CYS D 2 49  ? 48.452  31.546 81.563  1.00 28.00  ? 49  CYS B C     1 
ATOM   3972 O O     . CYS D 2 49  ? 47.597  30.950 82.202  1.00 35.23  ? 49  CYS B O     1 
ATOM   3973 C CB    . CYS D 2 49  ? 48.158  33.798 80.620  1.00 11.29  ? 49  CYS B CB    1 
ATOM   3974 S SG    . CYS D 2 49  ? 48.193  35.569 80.951  1.00 45.72  ? 49  CYS B SG    1 
ATOM   3975 N N     . ARG D 2 50  ? 49.203  30.949 80.649  1.00 33.40  ? 50  ARG B N     1 
ATOM   3976 C CA    . ARG D 2 50  ? 49.036  29.523 80.401  1.00 29.98  ? 50  ARG B CA    1 
ATOM   3977 C C     . ARG D 2 50  ? 49.231  28.745 81.696  1.00 30.76  ? 50  ARG B C     1 
ATOM   3978 O O     . ARG D 2 50  ? 48.510  27.803 81.999  1.00 28.68  ? 50  ARG B O     1 
ATOM   3979 C CB    . ARG D 2 50  ? 50.025  29.055 79.343  1.00 40.28  ? 50  ARG B CB    1 
ATOM   3980 C CG    . ARG D 2 50  ? 49.501  29.276 77.937  1.00 43.98  ? 50  ARG B CG    1 
ATOM   3981 C CD    . ARG D 2 50  ? 50.257  28.449 76.935  1.00 52.27  ? 50  ARG B CD    1 
ATOM   3982 N NE    . ARG D 2 50  ? 51.215  29.290 76.228  1.00 51.85  ? 50  ARG B NE    1 
ATOM   3983 C CZ    . ARG D 2 50  ? 52.524  29.248 76.427  1.00 41.86  ? 50  ARG B CZ    1 
ATOM   3984 N NH1   . ARG D 2 50  ? 53.035  28.407 77.321  1.00 33.88  ? 50  ARG B NH1   1 
ATOM   3985 N NH2   . ARG D 2 50  ? 53.318  30.060 75.748  1.00 44.48  ? 50  ARG B NH2   1 
ATOM   3986 N N     . SER D 2 51  ? 50.198  29.167 82.488  1.00 32.35  ? 51  SER B N     1 
ATOM   3987 C CA    . SER D 2 51  ? 50.432  28.490 83.740  1.00 21.28  ? 51  SER B CA    1 
ATOM   3988 C C     . SER D 2 51  ? 49.235  28.744 84.616  1.00 15.17  ? 51  SER B C     1 
ATOM   3989 O O     . SER D 2 51  ? 48.598  27.832 85.102  1.00 18.01  ? 51  SER B O     1 
ATOM   3990 C CB    . SER D 2 51  ? 51.666  29.055 84.428  1.00 26.48  ? 51  SER B CB    1 
ATOM   3991 O OG    . SER D 2 51  ? 51.656  28.724 85.807  1.00 36.99  ? 51  SER B OG    1 
ATOM   3992 N N     . TRP D 2 52  ? 48.940  30.018 84.806  1.00 19.11  ? 52  TRP B N     1 
ATOM   3993 C CA    . TRP D 2 52  ? 47.850  30.459 85.656  1.00 18.61  ? 52  TRP B CA    1 
ATOM   3994 C C     . TRP D 2 52  ? 46.530  29.857 85.268  1.00 25.11  ? 52  TRP B C     1 
ATOM   3995 O O     . TRP D 2 52  ? 45.953  29.084 86.030  1.00 35.22  ? 52  TRP B O     1 
ATOM   3996 C CB    . TRP D 2 52  ? 47.775  31.976 85.609  1.00 19.90  ? 52  TRP B CB    1 
ATOM   3997 C CG    . TRP D 2 52  ? 46.447  32.581 85.903  1.00 24.77  ? 52  TRP B CG    1 
ATOM   3998 C CD1   . TRP D 2 52  ? 45.663  33.284 85.038  1.00 31.77  ? 52  TRP B CD1   1 
ATOM   3999 C CD2   . TRP D 2 52  ? 45.841  32.704 87.183  1.00 24.35  ? 52  TRP B CD2   1 
ATOM   4000 N NE1   . TRP D 2 52  ? 44.613  33.854 85.708  1.00 25.22  ? 52  TRP B NE1   1 
ATOM   4001 C CE2   . TRP D 2 52  ? 44.696  33.513 87.030  1.00 29.94  ? 52  TRP B CE2   1 
ATOM   4002 C CE3   . TRP D 2 52  ? 46.159  32.214 88.456  1.00 27.22  ? 52  TRP B CE3   1 
ATOM   4003 C CZ2   . TRP D 2 52  ? 43.868  33.845 88.098  1.00 30.71  ? 52  TRP B CZ2   1 
ATOM   4004 C CZ3   . TRP D 2 52  ? 45.337  32.544 89.524  1.00 22.30  ? 52  TRP B CZ3   1 
ATOM   4005 C CH2   . TRP D 2 52  ? 44.201  33.356 89.336  1.00 27.46  ? 52  TRP B CH2   1 
ATOM   4006 N N     . ALA D 2 53  ? 46.052  30.214 84.082  1.00 30.44  ? 53  ALA B N     1 
ATOM   4007 C CA    . ALA D 2 53  ? 44.784  29.691 83.591  1.00 28.92  ? 53  ALA B CA    1 
ATOM   4008 C C     . ALA D 2 53  ? 44.711  28.189 83.790  1.00 33.60  ? 53  ALA B C     1 
ATOM   4009 O O     . ALA D 2 53  ? 43.631  27.629 83.824  1.00 48.62  ? 53  ALA B O     1 
ATOM   4010 C CB    . ALA D 2 53  ? 44.611  30.016 82.129  1.00 21.03  ? 53  ALA B CB    1 
ATOM   4011 N N     . ALA D 2 54  ? 45.853  27.527 83.929  1.00 30.34  ? 54  ALA B N     1 
ATOM   4012 C CA    . ALA D 2 54  ? 45.839  26.079 84.136  1.00 25.64  ? 54  ALA B CA    1 
ATOM   4013 C C     . ALA D 2 54  ? 45.372  25.795 85.545  1.00 28.94  ? 54  ALA B C     1 
ATOM   4014 O O     . ALA D 2 54  ? 44.366  25.143 85.773  1.00 38.56  ? 54  ALA B O     1 
ATOM   4015 C CB    . ALA D 2 54  ? 47.226  25.512 83.930  1.00 31.32  ? 54  ALA B CB    1 
ATOM   4016 N N     . TRP D 2 55  ? 46.130  26.328 86.486  1.00 32.13  ? 55  TRP B N     1 
ATOM   4017 C CA    . TRP D 2 55  ? 45.871  26.171 87.901  1.00 32.35  ? 55  TRP B CA    1 
ATOM   4018 C C     . TRP D 2 55  ? 44.418  26.509 88.235  1.00 29.85  ? 55  TRP B C     1 
ATOM   4019 O O     . TRP D 2 55  ? 43.807  25.920 89.121  1.00 26.64  ? 55  TRP B O     1 
ATOM   4020 C CB    . TRP D 2 55  ? 46.824  27.084 88.648  1.00 26.70  ? 55  TRP B CB    1 
ATOM   4021 C CG    . TRP D 2 55  ? 46.683  26.974 90.074  1.00 31.52  ? 55  TRP B CG    1 
ATOM   4022 C CD1   . TRP D 2 55  ? 47.383  26.156 90.894  1.00 27.45  ? 55  TRP B CD1   1 
ATOM   4023 C CD2   . TRP D 2 55  ? 45.780  27.711 90.898  1.00 27.39  ? 55  TRP B CD2   1 
ATOM   4024 N NE1   . TRP D 2 55  ? 46.977  26.336 92.189  1.00 37.28  ? 55  TRP B NE1   1 
ATOM   4025 C CE2   . TRP D 2 55  ? 45.992  27.287 92.221  1.00 24.29  ? 55  TRP B CE2   1 
ATOM   4026 C CE3   . TRP D 2 55  ? 44.810  28.692 90.647  1.00 35.61  ? 55  TRP B CE3   1 
ATOM   4027 C CZ2   . TRP D 2 55  ? 45.269  27.810 93.303  1.00 30.50  ? 55  TRP B CZ2   1 
ATOM   4028 C CZ3   . TRP D 2 55  ? 44.086  29.221 91.728  1.00 33.03  ? 55  TRP B CZ3   1 
ATOM   4029 C CH2   . TRP D 2 55  ? 44.322  28.774 93.036  1.00 36.14  ? 55  TRP B CH2   1 
ATOM   4030 N N     . CYS D 2 56  ? 43.877  27.457 87.488  1.00 20.97  ? 56  CYS B N     1 
ATOM   4031 C CA    . CYS D 2 56  ? 42.511  27.901 87.653  1.00 23.42  ? 56  CYS B CA    1 
ATOM   4032 C C     . CYS D 2 56  ? 41.612  26.780 87.215  1.00 24.71  ? 56  CYS B C     1 
ATOM   4033 O O     . CYS D 2 56  ? 40.665  26.418 87.891  1.00 32.56  ? 56  CYS B O     1 
ATOM   4034 C CB    . CYS D 2 56  ? 42.245  29.096 86.752  1.00 5.11   ? 56  CYS B CB    1 
ATOM   4035 S SG    . CYS D 2 56  ? 42.570  30.659 87.533  1.00 25.13  ? 56  CYS B SG    1 
ATOM   4036 N N     . LYS D 2 57  ? 41.905  26.241 86.046  1.00 27.64  ? 57  LYS B N     1 
ATOM   4037 C CA    . LYS D 2 57  ? 41.086  25.166 85.517  1.00 38.58  ? 57  LYS B CA    1 
ATOM   4038 C C     . LYS D 2 57  ? 41.104  24.018 86.496  1.00 38.24  ? 57  LYS B C     1 
ATOM   4039 O O     . LYS D 2 57  ? 40.071  23.516 86.932  1.00 48.18  ? 57  LYS B O     1 
ATOM   4040 C CB    . LYS D 2 57  ? 41.622  24.681 84.167  1.00 33.43  ? 57  LYS B CB    1 
ATOM   4041 C CG    . LYS D 2 57  ? 40.540  24.178 83.235  1.00 45.28  ? 57  LYS B CG    1 
ATOM   4042 C CD    . LYS D 2 57  ? 41.066  23.066 82.353  1.00 60.60  ? 57  LYS B CD    1 
ATOM   4043 C CE    . LYS D 2 57  ? 39.941  22.211 81.802  1.00 71.27  ? 57  LYS B CE    1 
ATOM   4044 N NZ    . LYS D 2 57  ? 40.477  21.016 81.086  1.00 70.64  ? 57  LYS B NZ    1 
ATOM   4045 N N     . LEU D 2 58  ? 42.309  23.648 86.882  1.00 39.19  ? 58  LEU B N     1 
ATOM   4046 C CA    . LEU D 2 58  ? 42.501  22.535 87.777  1.00 39.53  ? 58  LEU B CA    1 
ATOM   4047 C C     . LEU D 2 58  ? 41.747  22.759 89.069  1.00 39.73  ? 58  LEU B C     1 
ATOM   4048 O O     . LEU D 2 58  ? 41.306  21.820 89.709  1.00 41.06  ? 58  LEU B O     1 
ATOM   4049 C CB    . LEU D 2 58  ? 43.997  22.370 88.027  1.00 55.21  ? 58  LEU B CB    1 
ATOM   4050 C CG    . LEU D 2 58  ? 44.490  21.636 89.268  1.00 59.09  ? 58  LEU B CG    1 
ATOM   4051 C CD1   . LEU D 2 58  ? 45.037  20.275 88.862  1.00 63.38  ? 58  LEU B CD1   1 
ATOM   4052 C CD2   . LEU D 2 58  ? 45.581  22.472 89.946  1.00 73.69  ? 58  LEU B CD2   1 
ATOM   4053 N N     . ASN D 2 59  ? 41.565  24.021 89.428  1.00 44.20  ? 59  ASN B N     1 
ATOM   4054 C CA    . ASN D 2 59  ? 40.883  24.353 90.664  1.00 38.19  ? 59  ASN B CA    1 
ATOM   4055 C C     . ASN D 2 59  ? 39.496  24.894 90.459  1.00 41.71  ? 59  ASN B C     1 
ATOM   4056 O O     . ASN D 2 59  ? 38.853  25.366 91.398  1.00 43.93  ? 59  ASN B O     1 
ATOM   4057 C CB    . ASN D 2 59  ? 41.714  25.356 91.435  1.00 36.95  ? 59  ASN B CB    1 
ATOM   4058 C CG    . ASN D 2 59  ? 42.648  24.682 92.375  1.00 47.83  ? 59  ASN B CG    1 
ATOM   4059 O OD1   . ASN D 2 59  ? 42.258  24.328 93.482  1.00 66.75  ? 59  ASN B OD1   1 
ATOM   4060 N ND2   . ASN D 2 59  ? 43.890  24.464 91.943  1.00 50.26  ? 59  ASN B ND2   1 
ATOM   4061 N N     . ASN D 2 60  ? 39.030  24.818 89.224  1.00 44.83  ? 60  ASN B N     1 
ATOM   4062 C CA    . ASN D 2 60  ? 37.708  25.310 88.906  1.00 48.86  ? 60  ASN B CA    1 
ATOM   4063 C C     . ASN D 2 60  ? 37.518  26.731 89.428  1.00 42.06  ? 60  ASN B C     1 
ATOM   4064 O O     . ASN D 2 60  ? 36.795  26.948 90.391  1.00 42.62  ? 60  ASN B O     1 
ATOM   4065 C CB    . ASN D 2 60  ? 36.670  24.392 89.535  1.00 64.25  ? 60  ASN B CB    1 
ATOM   4066 C CG    . ASN D 2 60  ? 35.376  24.393 88.780  1.00 78.66  ? 60  ASN B CG    1 
ATOM   4067 O OD1   . ASN D 2 60  ? 34.347  23.935 89.284  1.00 83.40  ? 60  ASN B OD1   1 
ATOM   4068 N ND2   . ASN D 2 60  ? 35.411  24.911 87.553  1.00 80.24  ? 60  ASN B ND2   1 
ATOM   4069 N N     . ARG D 2 61  ? 38.181  27.692 88.800  1.00 38.70  ? 61  ARG B N     1 
ATOM   4070 C CA    . ARG D 2 61  ? 38.071  29.087 89.214  1.00 31.17  ? 61  ARG B CA    1 
ATOM   4071 C C     . ARG D 2 61  ? 38.094  29.937 87.958  1.00 33.10  ? 61  ARG B C     1 
ATOM   4072 O O     . ARG D 2 61  ? 38.703  29.548 86.967  1.00 49.21  ? 61  ARG B O     1 
ATOM   4073 C CB    . ARG D 2 61  ? 39.246  29.471 90.113  1.00 27.03  ? 61  ARG B CB    1 
ATOM   4074 C CG    . ARG D 2 61  ? 39.638  28.425 91.145  1.00 21.43  ? 61  ARG B CG    1 
ATOM   4075 C CD    . ARG D 2 61  ? 38.600  28.317 92.246  1.00 29.40  ? 61  ARG B CD    1 
ATOM   4076 N NE    . ARG D 2 61  ? 38.237  29.620 92.783  1.00 28.18  ? 61  ARG B NE    1 
ATOM   4077 C CZ    . ARG D 2 61  ? 37.580  29.780 93.927  1.00 28.11  ? 61  ARG B CZ    1 
ATOM   4078 N NH1   . ARG D 2 61  ? 37.226  28.721 94.633  1.00 36.04  ? 61  ARG B NH1   1 
ATOM   4079 N NH2   . ARG D 2 61  ? 37.283  30.988 94.375  1.00 25.30  ? 61  ARG B NH2   1 
ATOM   4080 N N     . LYS D 2 62  ? 37.418  31.079 87.975  1.00 28.77  ? 62  LYS B N     1 
ATOM   4081 C CA    . LYS D 2 62  ? 37.409  31.934 86.794  1.00 33.10  ? 62  LYS B CA    1 
ATOM   4082 C C     . LYS D 2 62  ? 38.796  32.548 86.714  1.00 40.67  ? 62  LYS B C     1 
ATOM   4083 O O     . LYS D 2 62  ? 39.189  33.317 87.590  1.00 46.64  ? 62  LYS B O     1 
ATOM   4084 C CB    . LYS D 2 62  ? 36.356  33.025 86.931  1.00 37.36  ? 62  LYS B CB    1 
ATOM   4085 C CG    . LYS D 2 62  ? 36.749  34.370 86.352  1.00 54.29  ? 62  LYS B CG    1 
ATOM   4086 C CD    . LYS D 2 62  ? 36.800  35.447 87.429  1.00 74.18  ? 62  LYS B CD    1 
ATOM   4087 C CE    . LYS D 2 62  ? 35.439  36.122 87.633  1.00 92.24  ? 62  LYS B CE    1 
ATOM   4088 N NZ    . LYS D 2 62  ? 34.840  36.694 86.374  1.00 100.00 ? 62  LYS B NZ    1 
ATOM   4089 N N     . TRP D 2 63  ? 39.534  32.215 85.662  1.00 38.45  ? 63  TRP B N     1 
ATOM   4090 C CA    . TRP D 2 63  ? 40.894  32.709 85.526  1.00 34.44  ? 63  TRP B CA    1 
ATOM   4091 C C     . TRP D 2 63  ? 41.025  34.220 85.322  1.00 31.46  ? 63  TRP B C     1 
ATOM   4092 O O     . TRP D 2 63  ? 41.987  34.836 85.795  1.00 36.14  ? 63  TRP B O     1 
ATOM   4093 C CB    . TRP D 2 63  ? 41.616  31.920 84.417  1.00 45.45  ? 63  TRP B CB    1 
ATOM   4094 C CG    . TRP D 2 63  ? 41.427  32.459 83.041  1.00 59.67  ? 63  TRP B CG    1 
ATOM   4095 C CD1   . TRP D 2 63  ? 40.412  32.164 82.173  1.00 62.81  ? 63  TRP B CD1   1 
ATOM   4096 C CD2   . TRP D 2 63  ? 42.251  33.428 82.382  1.00 65.47  ? 63  TRP B CD2   1 
ATOM   4097 N NE1   . TRP D 2 63  ? 40.553  32.896 81.017  1.00 55.83  ? 63  TRP B NE1   1 
ATOM   4098 C CE2   . TRP D 2 63  ? 41.674  33.678 81.119  1.00 60.64  ? 63  TRP B CE2   1 
ATOM   4099 C CE3   . TRP D 2 63  ? 43.425  34.111 82.741  1.00 67.42  ? 63  TRP B CE3   1 
ATOM   4100 C CZ2   . TRP D 2 63  ? 42.227  34.585 80.210  1.00 61.74  ? 63  TRP B CZ2   1 
ATOM   4101 C CZ3   . TRP D 2 63  ? 43.976  35.017 81.832  1.00 59.66  ? 63  TRP B CZ3   1 
ATOM   4102 C CH2   . TRP D 2 63  ? 43.374  35.242 80.581  1.00 54.44  ? 63  TRP B CH2   1 
ATOM   4103 N N     . PHE D 2 64  ? 40.062  34.827 84.642  1.00 28.64  ? 64  PHE B N     1 
ATOM   4104 C CA    . PHE D 2 64  ? 40.116  36.266 84.403  1.00 32.05  ? 64  PHE B CA    1 
ATOM   4105 C C     . PHE D 2 64  ? 38.731  36.849 84.412  1.00 29.38  ? 64  PHE B C     1 
ATOM   4106 O O     . PHE D 2 64  ? 37.866  36.396 83.666  1.00 32.76  ? 64  PHE B O     1 
ATOM   4107 C CB    . PHE D 2 64  ? 40.743  36.570 83.053  1.00 35.02  ? 64  PHE B CB    1 
ATOM   4108 C CG    . PHE D 2 64  ? 40.986  38.031 82.816  1.00 40.58  ? 64  PHE B CG    1 
ATOM   4109 C CD1   . PHE D 2 64  ? 42.081  38.680 83.400  1.00 46.65  ? 64  PHE B CD1   1 
ATOM   4110 C CD2   . PHE D 2 64  ? 40.145  38.757 81.980  1.00 42.61  ? 64  PHE B CD2   1 
ATOM   4111 C CE1   . PHE D 2 64  ? 42.341  40.048 83.147  1.00 43.55  ? 64  PHE B CE1   1 
ATOM   4112 C CE2   . PHE D 2 64  ? 40.388  40.122 81.716  1.00 41.56  ? 64  PHE B CE2   1 
ATOM   4113 C CZ    . PHE D 2 64  ? 41.491  40.769 82.303  1.00 35.33  ? 64  PHE B CZ    1 
ATOM   4114 N N     . PRO D 2 65  ? 38.508  37.882 85.229  1.00 22.67  ? 65  PRO B N     1 
ATOM   4115 C CA    . PRO D 2 65  ? 39.452  38.529 86.146  1.00 28.12  ? 65  PRO B CA    1 
ATOM   4116 C C     . PRO D 2 65  ? 39.802  37.734 87.398  1.00 30.27  ? 65  PRO B C     1 
ATOM   4117 O O     . PRO D 2 65  ? 38.916  37.354 88.170  1.00 39.54  ? 65  PRO B O     1 
ATOM   4118 C CB    . PRO D 2 65  ? 38.754  39.848 86.495  1.00 25.20  ? 65  PRO B CB    1 
ATOM   4119 C CG    . PRO D 2 65  ? 37.634  39.962 85.520  1.00 21.98  ? 65  PRO B CG    1 
ATOM   4120 C CD    . PRO D 2 65  ? 37.224  38.563 85.240  1.00 12.19  ? 65  PRO B CD    1 
ATOM   4121 N N     . ALA D 2 66  ? 41.100  37.500 87.602  1.00 32.02  ? 66  ALA B N     1 
ATOM   4122 C CA    . ALA D 2 66  ? 41.574  36.750 88.763  1.00 28.50  ? 66  ALA B CA    1 
ATOM   4123 C C     . ALA D 2 66  ? 41.034  37.403 90.025  1.00 26.92  ? 66  ALA B C     1 
ATOM   4124 O O     . ALA D 2 66  ? 40.879  38.624 90.064  1.00 31.32  ? 66  ALA B O     1 
ATOM   4125 C CB    . ALA D 2 66  ? 43.081  36.747 88.789  1.00 19.45  ? 66  ALA B CB    1 
ATOM   4126 N N     . GLU D 2 67  ? 40.733  36.588 91.035  1.00 27.47  ? 67  GLU B N     1 
ATOM   4127 C CA    . GLU D 2 67  ? 40.230  37.070 92.314  1.00 26.32  ? 67  GLU B CA    1 
ATOM   4128 C C     . GLU D 2 67  ? 41.466  36.897 93.179  1.00 28.37  ? 67  GLU B C     1 
ATOM   4129 O O     . GLU D 2 67  ? 42.092  35.826 93.167  1.00 24.39  ? 67  GLU B O     1 
ATOM   4130 C CB    . GLU D 2 67  ? 39.073  36.199 92.836  1.00 36.67  ? 67  GLU B CB    1 
ATOM   4131 C CG    . GLU D 2 67  ? 38.003  36.962 93.640  1.00 44.21  ? 67  GLU B CG    1 
ATOM   4132 C CD    . GLU D 2 67  ? 38.499  37.537 94.987  1.00 56.44  ? 67  GLU B CD    1 
ATOM   4133 O OE1   . GLU D 2 67  ? 38.922  36.782 95.900  1.00 32.96  ? 67  GLU B OE1   1 
ATOM   4134 O OE2   . GLU D 2 67  ? 38.452  38.773 95.134  1.00 55.90  ? 67  GLU B OE2   1 
ATOM   4135 N N     . PRO D 2 68  ? 41.850  37.962 93.913  1.00 29.44  ? 68  PRO B N     1 
ATOM   4136 C CA    . PRO D 2 68  ? 43.002  38.079 94.824  1.00 27.28  ? 68  PRO B CA    1 
ATOM   4137 C C     . PRO D 2 68  ? 43.259  36.810 95.617  1.00 29.72  ? 68  PRO B C     1 
ATOM   4138 O O     . PRO D 2 68  ? 44.380  36.273 95.633  1.00 34.94  ? 68  PRO B O     1 
ATOM   4139 C CB    . PRO D 2 68  ? 42.637  39.247 95.734  1.00 28.78  ? 68  PRO B CB    1 
ATOM   4140 C CG    . PRO D 2 68  ? 41.643  40.071 94.951  1.00 17.37  ? 68  PRO B CG    1 
ATOM   4141 C CD    . PRO D 2 68  ? 41.049  39.200 93.867  1.00 26.80  ? 68  PRO B CD    1 
ATOM   4142 N N     . GLU D 2 69  ? 42.205  36.350 96.274  1.00 19.96  ? 69  GLU B N     1 
ATOM   4143 C CA    . GLU D 2 69  ? 42.276  35.144 97.052  1.00 27.51  ? 69  GLU B CA    1 
ATOM   4144 C C     . GLU D 2 69  ? 42.829  34.047 96.168  1.00 31.50  ? 69  GLU B C     1 
ATOM   4145 O O     . GLU D 2 69  ? 43.728  33.309 96.561  1.00 32.51  ? 69  GLU B O     1 
ATOM   4146 C CB    . GLU D 2 69  ? 40.880  34.781 97.549  1.00 27.86  ? 69  GLU B CB    1 
ATOM   4147 C CG    . GLU D 2 69  ? 40.355  35.734 98.601  1.00 31.47  ? 69  GLU B CG    1 
ATOM   4148 C CD    . GLU D 2 69  ? 41.312  35.859 99.786  1.00 37.76  ? 69  GLU B CD    1 
ATOM   4149 O OE1   . GLU D 2 69  ? 41.568  36.991 100.254 1.00 30.40  ? 69  GLU B OE1   1 
ATOM   4150 O OE2   . GLU D 2 69  ? 41.819  34.813 100.252 1.00 26.46  ? 69  GLU B OE2   1 
ATOM   4151 N N     . ASP D 2 70  ? 42.312  33.964 94.951  1.00 26.90  ? 70  ASP B N     1 
ATOM   4152 C CA    . ASP D 2 70  ? 42.752  32.929 94.052  1.00 27.71  ? 70  ASP B CA    1 
ATOM   4153 C C     . ASP D 2 70  ? 44.184  33.192 93.608  1.00 26.92  ? 70  ASP B C     1 
ATOM   4154 O O     . ASP D 2 70  ? 44.956  32.252 93.382  1.00 28.37  ? 70  ASP B O     1 
ATOM   4155 C CB    . ASP D 2 70  ? 41.781  32.827 92.877  1.00 34.72  ? 70  ASP B CB    1 
ATOM   4156 C CG    . ASP D 2 70  ? 40.446  32.211 93.287  1.00 36.83  ? 70  ASP B CG    1 
ATOM   4157 O OD1   . ASP D 2 70  ? 39.481  32.973 93.484  1.00 48.98  ? 70  ASP B OD1   1 
ATOM   4158 O OD2   . ASP D 2 70  ? 40.357  30.973 93.423  1.00 47.45  ? 70  ASP B OD2   1 
ATOM   4159 N N     . VAL D 2 71  ? 44.556  34.461 93.492  1.00 15.06  ? 71  VAL B N     1 
ATOM   4160 C CA    . VAL D 2 71  ? 45.934  34.758 93.105  1.00 20.74  ? 71  VAL B CA    1 
ATOM   4161 C C     . VAL D 2 71  ? 46.908  34.336 94.222  1.00 23.37  ? 71  VAL B C     1 
ATOM   4162 O O     . VAL D 2 71  ? 48.005  33.847 93.956  1.00 27.70  ? 71  VAL B O     1 
ATOM   4163 C CB    . VAL D 2 71  ? 46.118  36.242 92.800  1.00 19.99  ? 71  VAL B CB    1 
ATOM   4164 C CG1   . VAL D 2 71  ? 47.571  36.530 92.518  1.00 21.38  ? 71  VAL B CG1   1 
ATOM   4165 C CG2   . VAL D 2 71  ? 45.263  36.622 91.587  1.00 22.88  ? 71  VAL B CG2   1 
ATOM   4166 N N     . ARG D 2 72  ? 46.487  34.519 95.471  1.00 22.57  ? 72  ARG B N     1 
ATOM   4167 C CA    . ARG D 2 72  ? 47.269  34.154 96.654  1.00 17.33  ? 72  ARG B CA    1 
ATOM   4168 C C     . ARG D 2 72  ? 47.639  32.664 96.679  1.00 20.11  ? 72  ARG B C     1 
ATOM   4169 O O     . ARG D 2 72  ? 48.801  32.303 96.859  1.00 34.42  ? 72  ARG B O     1 
ATOM   4170 C CB    . ARG D 2 72  ? 46.469  34.493 97.920  1.00 20.90  ? 72  ARG B CB    1 
ATOM   4171 C CG    . ARG D 2 72  ? 47.210  35.349 98.940  1.00 23.04  ? 72  ARG B CG    1 
ATOM   4172 C CD    . ARG D 2 72  ? 46.444  35.479 100.266 1.00 26.29  ? 72  ARG B CD    1 
ATOM   4173 N NE    . ARG D 2 72  ? 46.403  34.237 101.047 1.00 34.55  ? 72  ARG B NE    1 
ATOM   4174 C CZ    . ARG D 2 72  ? 47.296  33.913 101.982 1.00 32.05  ? 72  ARG B CZ    1 
ATOM   4175 N NH1   . ARG D 2 72  ? 48.286  34.744 102.235 1.00 46.78  ? 72  ARG B NH1   1 
ATOM   4176 N NH2   . ARG D 2 72  ? 47.203  32.780 102.670 1.00 27.63  ? 72  ARG B NH2   1 
ATOM   4177 N N     . ASP D 2 73  ? 46.648  31.798 96.518  1.00 23.59  ? 73  ASP B N     1 
ATOM   4178 C CA    . ASP D 2 73  ? 46.888  30.359 96.541  1.00 27.59  ? 73  ASP B CA    1 
ATOM   4179 C C     . ASP D 2 73  ? 47.779  29.973 95.412  1.00 23.56  ? 73  ASP B C     1 
ATOM   4180 O O     . ASP D 2 73  ? 48.646  29.115 95.547  1.00 30.33  ? 73  ASP B O     1 
ATOM   4181 C CB    . ASP D 2 73  ? 45.584  29.584 96.399  1.00 39.34  ? 73  ASP B CB    1 
ATOM   4182 C CG    . ASP D 2 73  ? 44.407  30.349 96.910  1.00 49.23  ? 73  ASP B CG    1 
ATOM   4183 O OD1   . ASP D 2 73  ? 44.292  30.486 98.140  1.00 58.81  ? 73  ASP B OD1   1 
ATOM   4184 O OD2   . ASP D 2 73  ? 43.597  30.811 96.086  1.00 62.37  ? 73  ASP B OD2   1 
ATOM   4185 N N     . TYR D 2 74  ? 47.537  30.605 94.280  1.00 21.06  ? 74  TYR B N     1 
ATOM   4186 C CA    . TYR D 2 74  ? 48.322  30.305 93.107  1.00 18.43  ? 74  TYR B CA    1 
ATOM   4187 C C     . TYR D 2 74  ? 49.780  30.493 93.434  1.00 17.59  ? 74  TYR B C     1 
ATOM   4188 O O     . TYR D 2 74  ? 50.572  29.568 93.301  1.00 19.31  ? 74  TYR B O     1 
ATOM   4189 C CB    . TYR D 2 74  ? 47.926  31.233 91.980  1.00 14.39  ? 74  TYR B CB    1 
ATOM   4190 C CG    . TYR D 2 74  ? 48.785  31.097 90.765  1.00 24.07  ? 74  TYR B CG    1 
ATOM   4191 C CD1   . TYR D 2 74  ? 49.110  29.843 90.245  1.00 26.00  ? 74  TYR B CD1   1 
ATOM   4192 C CD2   . TYR D 2 74  ? 49.277  32.227 90.127  1.00 20.49  ? 74  TYR B CD2   1 
ATOM   4193 C CE1   . TYR D 2 74  ? 49.903  29.729 89.113  1.00 22.48  ? 74  TYR B CE1   1 
ATOM   4194 C CE2   . TYR D 2 74  ? 50.070  32.129 88.997  1.00 24.86  ? 74  TYR B CE2   1 
ATOM   4195 C CZ    . TYR D 2 74  ? 50.378  30.883 88.491  1.00 21.77  ? 74  TYR B CZ    1 
ATOM   4196 O OH    . TYR D 2 74  ? 51.119  30.814 87.340  1.00 33.63  ? 74  TYR B OH    1 
ATOM   4197 N N     . LEU D 2 75  ? 50.118  31.703 93.877  1.00 18.04  ? 75  LEU B N     1 
ATOM   4198 C CA    . LEU D 2 75  ? 51.486  32.078 94.233  1.00 16.18  ? 75  LEU B CA    1 
ATOM   4199 C C     . LEU D 2 75  ? 52.067  31.229 95.332  1.00 17.95  ? 75  LEU B C     1 
ATOM   4200 O O     . LEU D 2 75  ? 53.248  30.886 95.308  1.00 16.03  ? 75  LEU B O     1 
ATOM   4201 C CB    . LEU D 2 75  ? 51.544  33.538 94.671  1.00 17.43  ? 75  LEU B CB    1 
ATOM   4202 C CG    . LEU D 2 75  ? 51.029  34.633 93.727  1.00 18.99  ? 75  LEU B CG    1 
ATOM   4203 C CD1   . LEU D 2 75  ? 51.175  35.981 94.431  1.00 16.03  ? 75  LEU B CD1   1 
ATOM   4204 C CD2   . LEU D 2 75  ? 51.808  34.616 92.417  1.00 10.02  ? 75  LEU B CD2   1 
ATOM   4205 N N     . LEU D 2 76  ? 51.233  30.916 96.312  1.00 25.11  ? 76  LEU B N     1 
ATOM   4206 C CA    . LEU D 2 76  ? 51.655  30.079 97.421  1.00 24.87  ? 76  LEU B CA    1 
ATOM   4207 C C     . LEU D 2 76  ? 51.948  28.702 96.868  1.00 19.38  ? 76  LEU B C     1 
ATOM   4208 O O     . LEU D 2 76  ? 52.821  27.994 97.364  1.00 31.03  ? 76  LEU B O     1 
ATOM   4209 C CB    . LEU D 2 76  ? 50.546  29.997 98.462  1.00 12.65  ? 76  LEU B CB    1 
ATOM   4210 C CG    . LEU D 2 76  ? 50.415  31.275 99.277  1.00 11.88  ? 76  LEU B CG    1 
ATOM   4211 C CD1   . LEU D 2 76  ? 49.200  31.198 100.161 1.00 16.90  ? 76  LEU B CD1   1 
ATOM   4212 C CD2   . LEU D 2 76  ? 51.656  31.453 100.132 1.00 17.99  ? 76  LEU B CD2   1 
ATOM   4213 N N     . TYR D 2 77  ? 51.218  28.359 95.813  1.00 18.81  ? 77  TYR B N     1 
ATOM   4214 C CA    . TYR D 2 77  ? 51.336  27.075 95.136  1.00 19.89  ? 77  TYR B CA    1 
ATOM   4215 C C     . TYR D 2 77  ? 52.608  27.079 94.311  1.00 23.05  ? 77  TYR B C     1 
ATOM   4216 O O     . TYR D 2 77  ? 53.220  26.044 94.104  1.00 24.03  ? 77  TYR B O     1 
ATOM   4217 C CB    . TYR D 2 77  ? 50.119  26.856 94.231  1.00 16.53  ? 77  TYR B CB    1 
ATOM   4218 C CG    . TYR D 2 77  ? 50.403  26.101 92.958  1.00 26.57  ? 77  TYR B CG    1 
ATOM   4219 C CD1   . TYR D 2 77  ? 50.521  24.718 92.976  1.00 31.13  ? 77  TYR B CD1   1 
ATOM   4220 C CD2   . TYR D 2 77  ? 50.557  26.764 91.737  1.00 26.74  ? 77  TYR B CD2   1 
ATOM   4221 C CE1   . TYR D 2 77  ? 50.789  24.000 91.821  1.00 21.14  ? 77  TYR B CE1   1 
ATOM   4222 C CE2   . TYR D 2 77  ? 50.828  26.053 90.560  1.00 18.36  ? 77  TYR B CE2   1 
ATOM   4223 C CZ    . TYR D 2 77  ? 50.943  24.666 90.620  1.00 20.74  ? 77  TYR B CZ    1 
ATOM   4224 O OH    . TYR D 2 77  ? 51.228  23.929 89.501  1.00 38.27  ? 77  TYR B OH    1 
ATOM   4225 N N     . LEU D 2 78  ? 53.000  28.252 93.828  1.00 26.46  ? 78  LEU B N     1 
ATOM   4226 C CA    . LEU D 2 78  ? 54.221  28.345 93.038  1.00 22.01  ? 78  LEU B CA    1 
ATOM   4227 C C     . LEU D 2 78  ? 55.367  28.186 94.016  1.00 28.21  ? 78  LEU B C     1 
ATOM   4228 O O     . LEU D 2 78  ? 56.317  27.447 93.772  1.00 34.00  ? 78  LEU B O     1 
ATOM   4229 C CB    . LEU D 2 78  ? 54.350  29.711 92.366  1.00 15.45  ? 78  LEU B CB    1 
ATOM   4230 C CG    . LEU D 2 78  ? 53.343  30.093 91.290  1.00 20.35  ? 78  LEU B CG    1 
ATOM   4231 C CD1   . LEU D 2 78  ? 53.701  31.472 90.771  1.00 14.50  ? 78  LEU B CD1   1 
ATOM   4232 C CD2   . LEU D 2 78  ? 53.348  29.079 90.157  1.00 22.94  ? 78  LEU B CD2   1 
ATOM   4233 N N     . GLN D 2 79  ? 55.261  28.892 95.134  1.00 32.40  ? 79  GLN B N     1 
ATOM   4234 C CA    . GLN D 2 79  ? 56.287  28.856 96.164  1.00 32.38  ? 79  GLN B CA    1 
ATOM   4235 C C     . GLN D 2 79  ? 56.576  27.454 96.685  1.00 30.17  ? 79  GLN B C     1 
ATOM   4236 O O     . GLN D 2 79  ? 57.712  27.138 97.046  1.00 36.86  ? 79  GLN B O     1 
ATOM   4237 C CB    . GLN D 2 79  ? 55.880  29.760 97.319  1.00 34.64  ? 79  GLN B CB    1 
ATOM   4238 C CG    . GLN D 2 79  ? 56.759  29.636 98.542  1.00 49.50  ? 79  GLN B CG    1 
ATOM   4239 C CD    . GLN D 2 79  ? 56.019  29.991 99.808  1.00 57.78  ? 79  GLN B CD    1 
ATOM   4240 O OE1   . GLN D 2 79  ? 55.114  29.268 100.240 1.00 64.37  ? 79  GLN B OE1   1 
ATOM   4241 N NE2   . GLN D 2 79  ? 56.394  31.114 100.409 1.00 65.53  ? 79  GLN B NE2   1 
ATOM   4242 N N     . ALA D 2 80  ? 55.549  26.614 96.714  1.00 29.19  ? 80  ALA B N     1 
ATOM   4243 C CA    . ALA D 2 80  ? 55.701  25.247 97.194  1.00 31.97  ? 80  ALA B CA    1 
ATOM   4244 C C     . ALA D 2 80  ? 56.326  24.329 96.145  1.00 36.64  ? 80  ALA B C     1 
ATOM   4245 O O     . ALA D 2 80  ? 56.986  23.353 96.492  1.00 49.28  ? 80  ALA B O     1 
ATOM   4246 C CB    . ALA D 2 80  ? 54.346  24.698 97.640  1.00 23.19  ? 80  ALA B CB    1 
ATOM   4247 N N     . ARG D 2 81  ? 56.112  24.641 94.866  1.00 39.33  ? 81  ARG B N     1 
ATOM   4248 C CA    . ARG D 2 81  ? 56.679  23.848 93.764  1.00 34.70  ? 81  ARG B CA    1 
ATOM   4249 C C     . ARG D 2 81  ? 58.193  24.105 93.655  1.00 40.41  ? 81  ARG B C     1 
ATOM   4250 O O     . ARG D 2 81  ? 58.840  23.616 92.723  1.00 43.65  ? 81  ARG B O     1 
ATOM   4251 C CB    . ARG D 2 81  ? 56.054  24.223 92.408  1.00 32.83  ? 81  ARG B CB    1 
ATOM   4252 C CG    . ARG D 2 81  ? 54.549  24.261 92.319  1.00 31.80  ? 81  ARG B CG    1 
ATOM   4253 C CD    . ARG D 2 81  ? 54.110  23.947 90.893  1.00 40.21  ? 81  ARG B CD    1 
ATOM   4254 N NE    . ARG D 2 81  ? 55.205  24.070 89.936  1.00 41.86  ? 81  ARG B NE    1 
ATOM   4255 C CZ    . ARG D 2 81  ? 55.541  25.208 89.346  1.00 48.40  ? 81  ARG B CZ    1 
ATOM   4256 N NH1   . ARG D 2 81  ? 54.857  26.309 89.623  1.00 49.42  ? 81  ARG B NH1   1 
ATOM   4257 N NH2   . ARG D 2 81  ? 56.567  25.254 88.498  1.00 57.96  ? 81  ARG B NH2   1 
ATOM   4258 N N     . GLY D 2 82  ? 58.732  24.920 94.566  1.00 39.41  ? 82  GLY B N     1 
ATOM   4259 C CA    . GLY D 2 82  ? 60.162  25.205 94.574  1.00 32.02  ? 82  GLY B CA    1 
ATOM   4260 C C     . GLY D 2 82  ? 60.649  26.382 93.756  1.00 28.16  ? 82  GLY B C     1 
ATOM   4261 O O     . GLY D 2 82  ? 61.846  26.690 93.734  1.00 35.52  ? 82  GLY B O     1 
ATOM   4262 N N     . LEU D 2 83  ? 59.728  27.067 93.096  1.00 26.81  ? 83  LEU B N     1 
ATOM   4263 C CA    . LEU D 2 83  ? 60.113  28.185 92.252  1.00 26.34  ? 83  LEU B CA    1 
ATOM   4264 C C     . LEU D 2 83  ? 60.816  29.294 93.065  1.00 27.60  ? 83  LEU B C     1 
ATOM   4265 O O     . LEU D 2 83  ? 60.589  29.419 94.272  1.00 21.96  ? 83  LEU B O     1 
ATOM   4266 C CB    . LEU D 2 83  ? 58.880  28.699 91.486  1.00 21.31  ? 83  LEU B CB    1 
ATOM   4267 C CG    . LEU D 2 83  ? 58.416  27.921 90.233  1.00 18.20  ? 83  LEU B CG    1 
ATOM   4268 C CD1   . LEU D 2 83  ? 58.342  28.922 89.103  1.00 25.59  ? 83  LEU B CD1   1 
ATOM   4269 C CD2   . LEU D 2 83  ? 59.350  26.775 89.830  1.00 9.82   ? 83  LEU B CD2   1 
ATOM   4270 N N     . ALA D 2 84  ? 61.676  30.060 92.387  1.00 23.85  ? 84  ALA B N     1 
ATOM   4271 C CA    . ALA D 2 84  ? 62.456  31.134 92.985  1.00 19.15  ? 84  ALA B CA    1 
ATOM   4272 C C     . ALA D 2 84  ? 61.693  32.436 93.024  1.00 22.79  ? 84  ALA B C     1 
ATOM   4273 O O     . ALA D 2 84  ? 60.992  32.779 92.080  1.00 37.26  ? 84  ALA B O     1 
ATOM   4274 C CB    . ALA D 2 84  ? 63.738  31.318 92.207  1.00 17.85  ? 84  ALA B CB    1 
ATOM   4275 N N     . VAL D 2 85  ? 61.855  33.173 94.118  1.00 20.36  ? 85  VAL B N     1 
ATOM   4276 C CA    . VAL D 2 85  ? 61.178  34.463 94.314  1.00 21.13  ? 85  VAL B CA    1 
ATOM   4277 C C     . VAL D 2 85  ? 60.972  35.292 93.047  1.00 26.15  ? 85  VAL B C     1 
ATOM   4278 O O     . VAL D 2 85  ? 59.854  35.690 92.714  1.00 33.01  ? 85  VAL B O     1 
ATOM   4279 C CB    . VAL D 2 85  ? 61.943  35.344 95.340  1.00 21.63  ? 85  VAL B CB    1 
ATOM   4280 C CG1   . VAL D 2 85  ? 61.099  36.533 95.751  1.00 15.26  ? 85  VAL B CG1   1 
ATOM   4281 C CG2   . VAL D 2 85  ? 62.300  34.512 96.566  1.00 18.82  ? 85  VAL B CG2   1 
ATOM   4282 N N     . LYS D 2 86  ? 62.062  35.553 92.344  1.00 31.91  ? 86  LYS B N     1 
ATOM   4283 C CA    . LYS D 2 86  ? 61.990  36.346 91.138  1.00 24.74  ? 86  LYS B CA    1 
ATOM   4284 C C     . LYS D 2 86  ? 60.966  35.809 90.157  1.00 27.99  ? 86  LYS B C     1 
ATOM   4285 O O     . LYS D 2 86  ? 60.214  36.569 89.548  1.00 30.23  ? 86  LYS B O     1 
ATOM   4286 C CB    . LYS D 2 86  ? 63.363  36.399 90.479  1.00 18.55  ? 86  LYS B CB    1 
ATOM   4287 C CG    . LYS D 2 86  ? 64.148  37.643 90.826  1.00 26.44  ? 86  LYS B CG    1 
ATOM   4288 C CD    . LYS D 2 86  ? 64.711  38.319 89.586  1.00 42.07  ? 86  LYS B CD    1 
ATOM   4289 C CE    . LYS D 2 86  ? 64.160  39.735 89.413  1.00 52.47  ? 86  LYS B CE    1 
ATOM   4290 N NZ    . LYS D 2 86  ? 65.207  40.777 89.659  1.00 53.21  ? 86  LYS B NZ    1 
ATOM   4291 N N     . THR D 2 87  ? 60.930  34.493 89.992  1.00 30.77  ? 87  THR B N     1 
ATOM   4292 C CA    . THR D 2 87  ? 59.976  33.939 89.042  1.00 32.34  ? 87  THR B CA    1 
ATOM   4293 C C     . THR D 2 87  ? 58.573  34.221 89.550  1.00 25.44  ? 87  THR B C     1 
ATOM   4294 O O     . THR D 2 87  ? 57.710  34.672 88.805  1.00 32.14  ? 87  THR B O     1 
ATOM   4295 C CB    . THR D 2 87  ? 60.232  32.420 88.768  1.00 29.80  ? 87  THR B CB    1 
ATOM   4296 O OG1   . THR D 2 87  ? 59.082  31.649 89.133  1.00 28.15  ? 87  THR B OG1   1 
ATOM   4297 C CG2   . THR D 2 87  ? 61.470  31.945 89.516  1.00 24.89  ? 87  THR B CG2   1 
ATOM   4298 N N     . ILE D 2 88  ? 58.338  34.011 90.833  1.00 19.71  ? 88  ILE B N     1 
ATOM   4299 C CA    . ILE D 2 88  ? 57.007  34.305 91.345  1.00 27.80  ? 88  ILE B CA    1 
ATOM   4300 C C     . ILE D 2 88  ? 56.621  35.763 91.070  1.00 27.18  ? 88  ILE B C     1 
ATOM   4301 O O     . ILE D 2 88  ? 55.516  36.046 90.599  1.00 25.77  ? 88  ILE B O     1 
ATOM   4302 C CB    . ILE D 2 88  ? 56.896  33.986 92.867  1.00 29.53  ? 88  ILE B CB    1 
ATOM   4303 C CG1   . ILE D 2 88  ? 57.022  32.470 93.065  1.00 25.06  ? 88  ILE B CG1   1 
ATOM   4304 C CG2   . ILE D 2 88  ? 55.544  34.479 93.440  1.00 18.25  ? 88  ILE B CG2   1 
ATOM   4305 C CD1   . ILE D 2 88  ? 57.424  32.062 94.480  1.00 17.38  ? 88  ILE B CD1   1 
ATOM   4306 N N     . GLN D 2 89  ? 57.530  36.687 91.349  1.00 19.38  ? 89  GLN B N     1 
ATOM   4307 C CA    . GLN D 2 89  ? 57.226  38.087 91.110  1.00 16.61  ? 89  GLN B CA    1 
ATOM   4308 C C     . GLN D 2 89  ? 56.894  38.326 89.660  1.00 14.28  ? 89  GLN B C     1 
ATOM   4309 O O     . GLN D 2 89  ? 56.252  39.302 89.314  1.00 23.08  ? 89  GLN B O     1 
ATOM   4310 C CB    . GLN D 2 89  ? 58.407  38.927 91.530  1.00 18.42  ? 89  GLN B CB    1 
ATOM   4311 C CG    . GLN D 2 89  ? 59.025  38.380 92.809  1.00 40.04  ? 89  GLN B CG    1 
ATOM   4312 C CD    . GLN D 2 89  ? 60.047  39.311 93.431  1.00 46.51  ? 89  GLN B CD    1 
ATOM   4313 O OE1   . GLN D 2 89  ? 61.250  39.151 93.226  1.00 53.12  ? 89  GLN B OE1   1 
ATOM   4314 N NE2   . GLN D 2 89  ? 59.575  40.286 94.209  1.00 47.17  ? 89  GLN B NE2   1 
ATOM   4315 N N     . GLN D 2 90  ? 57.345  37.425 88.803  1.00 14.20  ? 90  GLN B N     1 
ATOM   4316 C CA    . GLN D 2 90  ? 57.052  37.541 87.380  1.00 23.14  ? 90  GLN B CA    1 
ATOM   4317 C C     . GLN D 2 90  ? 55.618  37.122 87.171  1.00 26.13  ? 90  GLN B C     1 
ATOM   4318 O O     . GLN D 2 90  ? 54.818  37.850 86.597  1.00 29.75  ? 90  GLN B O     1 
ATOM   4319 C CB    . GLN D 2 90  ? 57.932  36.599 86.548  1.00 31.07  ? 90  GLN B CB    1 
ATOM   4320 C CG    . GLN D 2 90  ? 58.734  37.276 85.440  1.00 44.35  ? 90  GLN B CG    1 
ATOM   4321 C CD    . GLN D 2 90  ? 58.017  37.319 84.106  1.00 34.44  ? 90  GLN B CD    1 
ATOM   4322 O OE1   . GLN D 2 90  ? 57.973  38.361 83.451  1.00 23.11  ? 90  GLN B OE1   1 
ATOM   4323 N NE2   . GLN D 2 90  ? 57.459  36.187 83.693  1.00 43.14  ? 90  GLN B NE2   1 
ATOM   4324 N N     . HIS D 2 91  ? 55.312  35.918 87.630  1.00 19.72  ? 91  HIS B N     1 
ATOM   4325 C CA    . HIS D 2 91  ? 53.973  35.403 87.474  1.00 21.24  ? 91  HIS B CA    1 
ATOM   4326 C C     . HIS D 2 91  ? 53.034  36.468 88.009  1.00 24.42  ? 91  HIS B C     1 
ATOM   4327 O O     . HIS D 2 91  ? 52.078  36.856 87.338  1.00 32.44  ? 91  HIS B O     1 
ATOM   4328 C CB    . HIS D 2 91  ? 53.834  34.083 88.225  1.00 11.40  ? 91  HIS B CB    1 
ATOM   4329 C CG    . HIS D 2 91  ? 54.342  32.904 87.451  1.00 23.19  ? 91  HIS B CG    1 
ATOM   4330 N ND1   . HIS D 2 91  ? 53.605  31.755 87.272  1.00 41.02  ? 91  HIS B ND1   1 
ATOM   4331 C CD2   . HIS D 2 91  ? 55.495  32.722 86.764  1.00 34.87  ? 91  HIS B CD2   1 
ATOM   4332 C CE1   . HIS D 2 91  ? 54.282  30.912 86.507  1.00 39.67  ? 91  HIS B CE1   1 
ATOM   4333 N NE2   . HIS D 2 91  ? 55.430  31.477 86.185  1.00 42.55  ? 91  HIS B NE2   1 
ATOM   4334 N N     . LEU D 2 92  ? 53.334  36.980 89.196  1.00 21.48  ? 92  LEU B N     1 
ATOM   4335 C CA    . LEU D 2 92  ? 52.494  38.007 89.773  1.00 17.35  ? 92  LEU B CA    1 
ATOM   4336 C C     . LEU D 2 92  ? 52.555  39.229 88.878  1.00 25.96  ? 92  LEU B C     1 
ATOM   4337 O O     . LEU D 2 92  ? 51.540  39.868 88.604  1.00 38.65  ? 92  LEU B O     1 
ATOM   4338 C CB    . LEU D 2 92  ? 52.967  38.370 91.179  1.00 19.91  ? 92  LEU B CB    1 
ATOM   4339 C CG    . LEU D 2 92  ? 52.436  39.686 91.788  1.00 23.98  ? 92  LEU B CG    1 
ATOM   4340 C CD1   . LEU D 2 92  ? 50.927  39.834 91.586  1.00 25.96  ? 92  LEU B CD1   1 
ATOM   4341 C CD2   . LEU D 2 92  ? 52.755  39.721 93.269  1.00 14.01  ? 92  LEU B CD2   1 
ATOM   4342 N N     . GLY D 2 93  ? 53.753  39.539 88.408  1.00 25.69  ? 93  GLY B N     1 
ATOM   4343 C CA    . GLY D 2 93  ? 53.912  40.695 87.552  1.00 23.33  ? 93  GLY B CA    1 
ATOM   4344 C C     . GLY D 2 93  ? 53.084  40.667 86.281  1.00 25.84  ? 93  GLY B C     1 
ATOM   4345 O O     . GLY D 2 93  ? 52.448  41.649 85.943  1.00 24.56  ? 93  GLY B O     1 
ATOM   4346 N N     . GLN D 2 94  ? 53.088  39.542 85.577  1.00 29.99  ? 94  GLN B N     1 
ATOM   4347 C CA    . GLN D 2 94  ? 52.345  39.412 84.325  1.00 30.63  ? 94  GLN B CA    1 
ATOM   4348 C C     . GLN D 2 94  ? 50.859  39.636 84.543  1.00 29.20  ? 94  GLN B C     1 
ATOM   4349 O O     . GLN D 2 94  ? 50.220  40.402 83.817  1.00 31.34  ? 94  GLN B O     1 
ATOM   4350 C CB    . GLN D 2 94  ? 52.570  38.023 83.729  1.00 32.47  ? 94  GLN B CB    1 
ATOM   4351 C CG    . GLN D 2 94  ? 53.057  38.066 82.315  1.00 37.42  ? 94  GLN B CG    1 
ATOM   4352 C CD    . GLN D 2 94  ? 54.273  38.940 82.164  1.00 35.41  ? 94  GLN B CD    1 
ATOM   4353 O OE1   . GLN D 2 94  ? 54.238  39.982 81.502  1.00 29.88  ? 94  GLN B OE1   1 
ATOM   4354 N NE2   . GLN D 2 94  ? 55.367  38.519 82.776  1.00 41.90  ? 94  GLN B NE2   1 
ATOM   4355 N N     . LEU D 2 95  ? 50.313  38.960 85.547  1.00 24.96  ? 95  LEU B N     1 
ATOM   4356 C CA    . LEU D 2 95  ? 48.904  39.099 85.861  1.00 20.15  ? 95  LEU B CA    1 
ATOM   4357 C C     . LEU D 2 95  ? 48.657  40.564 86.085  1.00 15.30  ? 95  LEU B C     1 
ATOM   4358 O O     . LEU D 2 95  ? 47.752  41.152 85.520  1.00 17.40  ? 95  LEU B O     1 
ATOM   4359 C CB    . LEU D 2 95  ? 48.571  38.362 87.146  1.00 22.44  ? 95  LEU B CB    1 
ATOM   4360 C CG    . LEU D 2 95  ? 47.831  37.026 87.137  1.00 35.20  ? 95  LEU B CG    1 
ATOM   4361 C CD1   . LEU D 2 95  ? 47.788  36.351 85.754  1.00 25.58  ? 95  LEU B CD1   1 
ATOM   4362 C CD2   . LEU D 2 95  ? 48.564  36.160 88.139  1.00 36.95  ? 95  LEU B CD2   1 
ATOM   4363 N N     . ASN D 2 96  ? 49.488  41.154 86.933  1.00 19.86  ? 96  ASN B N     1 
ATOM   4364 C CA    . ASN D 2 96  ? 49.350  42.558 87.268  1.00 24.12  ? 96  ASN B CA    1 
ATOM   4365 C C     . ASN D 2 96  ? 49.200  43.428 86.025  1.00 29.06  ? 96  ASN B C     1 
ATOM   4366 O O     . ASN D 2 96  ? 48.403  44.360 86.017  1.00 33.77  ? 96  ASN B O     1 
ATOM   4367 C CB    . ASN D 2 96  ? 50.547  43.017 88.110  1.00 22.44  ? 96  ASN B CB    1 
ATOM   4368 C CG    . ASN D 2 96  ? 50.277  42.946 89.606  1.00 27.71  ? 96  ASN B CG    1 
ATOM   4369 O OD1   . ASN D 2 96  ? 50.846  43.702 90.389  1.00 31.15  ? 96  ASN B OD1   1 
ATOM   4370 N ND2   . ASN D 2 96  ? 49.405  42.031 90.007  1.00 23.94  ? 96  ASN B ND2   1 
ATOM   4371 N N     . MET D 2 97  ? 49.956  43.116 84.976  1.00 31.87  ? 97  MET B N     1 
ATOM   4372 C CA    . MET D 2 97  ? 49.895  43.901 83.743  1.00 32.68  ? 97  MET B CA    1 
ATOM   4373 C C     . MET D 2 97  ? 48.679  43.536 82.924  1.00 31.07  ? 97  MET B C     1 
ATOM   4374 O O     . MET D 2 97  ? 48.077  44.384 82.295  1.00 39.16  ? 97  MET B O     1 
ATOM   4375 C CB    . MET D 2 97  ? 51.144  43.701 82.884  1.00 32.19  ? 97  MET B CB    1 
ATOM   4376 C CG    . MET D 2 97  ? 50.889  43.829 81.391  1.00 31.28  ? 97  MET B CG    1 
ATOM   4377 S SD    . MET D 2 97  ? 52.348  44.262 80.399  1.00 52.13  ? 97  MET B SD    1 
ATOM   4378 C CE    . MET D 2 97  ? 52.322  42.962 79.151  1.00 18.19  ? 97  MET B CE    1 
ATOM   4379 N N     . LEU D 2 98  ? 48.315  42.267 82.921  1.00 31.29  ? 98  LEU B N     1 
ATOM   4380 C CA    . LEU D 2 98  ? 47.139  41.859 82.174  1.00 29.56  ? 98  LEU B CA    1 
ATOM   4381 C C     . LEU D 2 98  ? 45.890  42.629 82.626  1.00 27.02  ? 98  LEU B C     1 
ATOM   4382 O O     . LEU D 2 98  ? 45.057  42.992 81.812  1.00 35.46  ? 98  LEU B O     1 
ATOM   4383 C CB    . LEU D 2 98  ? 46.894  40.362 82.341  1.00 31.62  ? 98  LEU B CB    1 
ATOM   4384 C CG    . LEU D 2 98  ? 45.594  39.891 81.684  1.00 41.36  ? 98  LEU B CG    1 
ATOM   4385 C CD1   . LEU D 2 98  ? 45.603  40.242 80.192  1.00 35.42  ? 98  LEU B CD1   1 
ATOM   4386 C CD2   . LEU D 2 98  ? 45.442  38.392 81.890  1.00 37.00  ? 98  LEU B CD2   1 
ATOM   4387 N N     . HIS D 2 99  ? 45.757  42.877 83.925  1.00 29.10  ? 99  HIS B N     1 
ATOM   4388 C CA    . HIS D 2 99  ? 44.599  43.604 84.466  1.00 29.23  ? 99  HIS B CA    1 
ATOM   4389 C C     . HIS D 2 99  ? 44.712  45.132 84.334  1.00 31.16  ? 99  HIS B C     1 
ATOM   4390 O O     . HIS D 2 99  ? 43.781  45.798 83.917  1.00 35.36  ? 99  HIS B O     1 
ATOM   4391 C CB    . HIS D 2 99  ? 44.406  43.264 85.949  1.00 30.87  ? 99  HIS B CB    1 
ATOM   4392 C CG    . HIS D 2 99  ? 43.844  41.895 86.201  1.00 24.91  ? 99  HIS B CG    1 
ATOM   4393 N ND1   . HIS D 2 99  ? 44.562  40.744 85.979  1.00 34.16  ? 99  HIS B ND1   1 
ATOM   4394 C CD2   . HIS D 2 99  ? 42.644  41.504 86.691  1.00 24.11  ? 99  HIS B CD2   1 
ATOM   4395 C CE1   . HIS D 2 99  ? 43.828  39.695 86.319  1.00 29.69  ? 99  HIS B CE1   1 
ATOM   4396 N NE2   . HIS D 2 99  ? 42.663  40.129 86.752  1.00 36.90  ? 99  HIS B NE2   1 
ATOM   4397 N N     . ARG D 2 100 ? 45.852  45.688 84.723  1.00 37.36  ? 100 ARG B N     1 
ATOM   4398 C CA    . ARG D 2 100 ? 46.057  47.132 84.641  1.00 34.87  ? 100 ARG B CA    1 
ATOM   4399 C C     . ARG D 2 100 ? 45.872  47.647 83.230  1.00 36.21  ? 100 ARG B C     1 
ATOM   4400 O O     . ARG D 2 100 ? 45.205  48.658 83.003  1.00 49.48  ? 100 ARG B O     1 
ATOM   4401 C CB    . ARG D 2 100 ? 47.466  47.530 85.108  1.00 30.76  ? 100 ARG B CB    1 
ATOM   4402 C CG    . ARG D 2 100 ? 47.548  48.970 85.628  1.00 51.54  ? 100 ARG B CG    1 
ATOM   4403 C CD    . ARG D 2 100 ? 48.609  49.815 84.925  1.00 57.80  ? 100 ARG B CD    1 
ATOM   4404 N NE    . ARG D 2 100 ? 49.754  49.019 84.518  1.00 52.62  ? 100 ARG B NE    1 
ATOM   4405 C CZ    . ARG D 2 100 ? 50.800  49.504 83.863  1.00 48.09  ? 100 ARG B CZ    1 
ATOM   4406 N NH1   . ARG D 2 100 ? 50.863  50.790 83.532  1.00 42.64  ? 100 ARG B NH1   1 
ATOM   4407 N NH2   . ARG D 2 100 ? 51.778  48.682 83.526  1.00 52.51  ? 100 ARG B NH2   1 
ATOM   4408 N N     . ARG D 2 101 ? 46.498  46.971 82.277  1.00 32.30  ? 101 ARG B N     1 
ATOM   4409 C CA    . ARG D 2 101 ? 46.400  47.390 80.893  1.00 36.05  ? 101 ARG B CA    1 
ATOM   4410 C C     . ARG D 2 101 ? 45.077  46.960 80.289  1.00 37.40  ? 101 ARG B C     1 
ATOM   4411 O O     . ARG D 2 101 ? 44.925  46.886 79.075  1.00 41.98  ? 101 ARG B O     1 
ATOM   4412 C CB    . ARG D 2 101 ? 47.567  46.826 80.085  1.00 33.93  ? 101 ARG B CB    1 
ATOM   4413 C CG    . ARG D 2 101 ? 48.817  47.692 80.139  1.00 35.41  ? 101 ARG B CG    1 
ATOM   4414 C CD    . ARG D 2 101 ? 49.655  47.506 78.890  1.00 46.94  ? 101 ARG B CD    1 
ATOM   4415 N NE    . ARG D 2 101 ? 50.277  48.751 78.457  1.00 48.66  ? 101 ARG B NE    1 
ATOM   4416 C CZ    . ARG D 2 101 ? 51.237  49.362 79.136  1.00 36.69  ? 101 ARG B CZ    1 
ATOM   4417 N NH1   . ARG D 2 101 ? 51.672  48.831 80.270  1.00 36.75  ? 101 ARG B NH1   1 
ATOM   4418 N NH2   . ARG D 2 101 ? 51.747  50.499 78.687  1.00 42.33  ? 101 ARG B NH2   1 
ATOM   4419 N N     . SER D 2 102 ? 44.114  46.681 81.159  1.00 46.06  ? 102 SER B N     1 
ATOM   4420 C CA    . SER D 2 102 ? 42.773  46.279 80.747  1.00 44.85  ? 102 SER B CA    1 
ATOM   4421 C C     . SER D 2 102 ? 41.739  47.099 81.521  1.00 46.10  ? 102 SER B C     1 
ATOM   4422 O O     . SER D 2 102 ? 40.583  46.708 81.625  1.00 56.61  ? 102 SER B O     1 
ATOM   4423 C CB    . SER D 2 102 ? 42.561  44.791 81.023  1.00 39.50  ? 102 SER B CB    1 
ATOM   4424 O OG    . SER D 2 102 ? 43.032  44.015 79.942  1.00 50.86  ? 102 SER B OG    1 
ATOM   4425 N N     . GLY D 2 103 ? 42.170  48.236 82.064  1.00 50.33  ? 103 GLY B N     1 
ATOM   4426 C CA    . GLY D 2 103 ? 41.283  49.097 82.833  1.00 53.27  ? 103 GLY B CA    1 
ATOM   4427 C C     . GLY D 2 103 ? 41.075  48.555 84.238  1.00 46.03  ? 103 GLY B C     1 
ATOM   4428 O O     . GLY D 2 103 ? 41.047  49.306 85.216  1.00 45.37  ? 103 GLY B O     1 
ATOM   4429 N N     . LEU D 2 104 ? 40.931  47.237 84.329  1.00 41.39  ? 104 LEU B N     1 
ATOM   4430 C CA    . LEU D 2 104 ? 40.727  46.548 85.591  1.00 44.68  ? 104 LEU B CA    1 
ATOM   4431 C C     . LEU D 2 104 ? 41.833  46.849 86.593  1.00 51.51  ? 104 LEU B C     1 
ATOM   4432 O O     . LEU D 2 104 ? 42.889  47.361 86.226  1.00 58.95  ? 104 LEU B O     1 
ATOM   4433 C CB    . LEU D 2 104 ? 40.677  45.045 85.340  1.00 36.08  ? 104 LEU B CB    1 
ATOM   4434 C CG    . LEU D 2 104 ? 39.461  44.613 84.528  1.00 41.63  ? 104 LEU B CG    1 
ATOM   4435 C CD1   . LEU D 2 104 ? 39.837  43.536 83.527  1.00 51.78  ? 104 LEU B CD1   1 
ATOM   4436 C CD2   . LEU D 2 104 ? 38.402  44.112 85.479  1.00 62.62  ? 104 LEU B CD2   1 
ATOM   4437 N N     . PRO D 2 105 ? 41.590  46.564 87.883  1.00 51.16  ? 105 PRO B N     1 
ATOM   4438 C CA    . PRO D 2 105 ? 42.585  46.801 88.927  1.00 49.01  ? 105 PRO B CA    1 
ATOM   4439 C C     . PRO D 2 105 ? 43.428  45.528 89.109  1.00 50.48  ? 105 PRO B C     1 
ATOM   4440 O O     . PRO D 2 105 ? 42.926  44.408 88.920  1.00 48.29  ? 105 PRO B O     1 
ATOM   4441 C CB    . PRO D 2 105 ? 41.739  47.137 90.152  1.00 39.28  ? 105 PRO B CB    1 
ATOM   4442 C CG    . PRO D 2 105 ? 40.314  46.800 89.768  1.00 45.88  ? 105 PRO B CG    1 
ATOM   4443 C CD    . PRO D 2 105 ? 40.347  46.063 88.471  1.00 47.09  ? 105 PRO B CD    1 
ATOM   4444 N N     . ARG D 2 106 ? 44.704  45.718 89.454  1.00 48.49  ? 106 ARG B N     1 
ATOM   4445 C CA    . ARG D 2 106 ? 45.674  44.636 89.638  1.00 40.59  ? 106 ARG B CA    1 
ATOM   4446 C C     . ARG D 2 106 ? 45.556  43.845 90.946  1.00 38.68  ? 106 ARG B C     1 
ATOM   4447 O O     . ARG D 2 106 ? 45.126  44.370 91.975  1.00 38.13  ? 106 ARG B O     1 
ATOM   4448 C CB    . ARG D 2 106 ? 47.097  45.207 89.543  1.00 46.78  ? 106 ARG B CB    1 
ATOM   4449 C CG    . ARG D 2 106 ? 47.240  46.410 88.613  1.00 40.70  ? 106 ARG B CG    1 
ATOM   4450 C CD    . ARG D 2 106 ? 48.352  47.374 89.044  1.00 29.05  ? 106 ARG B CD    1 
ATOM   4451 N NE    . ARG D 2 106 ? 49.287  46.739 89.954  1.00 28.82  ? 106 ARG B NE    1 
ATOM   4452 C CZ    . ARG D 2 106 ? 49.908  47.387 90.927  1.00 37.33  ? 106 ARG B CZ    1 
ATOM   4453 N NH1   . ARG D 2 106 ? 49.682  48.680 91.097  1.00 56.51  ? 106 ARG B NH1   1 
ATOM   4454 N NH2   . ARG D 2 106 ? 50.733  46.746 91.741  1.00 39.26  ? 106 ARG B NH2   1 
ATOM   4455 N N     . PRO D 2 107 ? 45.962  42.563 90.922  1.00 39.67  ? 107 PRO B N     1 
ATOM   4456 C CA    . PRO D 2 107 ? 45.887  41.744 92.135  1.00 40.29  ? 107 PRO B CA    1 
ATOM   4457 C C     . PRO D 2 107 ? 46.812  42.241 93.247  1.00 31.33  ? 107 PRO B C     1 
ATOM   4458 O O     . PRO D 2 107 ? 46.585  41.952 94.420  1.00 37.64  ? 107 PRO B O     1 
ATOM   4459 C CB    . PRO D 2 107 ? 46.282  40.345 91.647  1.00 45.37  ? 107 PRO B CB    1 
ATOM   4460 C CG    . PRO D 2 107 ? 46.087  40.382 90.167  1.00 25.89  ? 107 PRO B CG    1 
ATOM   4461 C CD    . PRO D 2 107 ? 46.475  41.780 89.788  1.00 38.44  ? 107 PRO B CD    1 
ATOM   4462 N N     . SER D 2 108 ? 47.859  42.973 92.875  1.00 32.16  ? 108 SER B N     1 
ATOM   4463 C CA    . SER D 2 108 ? 48.810  43.486 93.851  1.00 25.84  ? 108 SER B CA    1 
ATOM   4464 C C     . SER D 2 108 ? 48.176  44.632 94.605  1.00 30.15  ? 108 SER B C     1 
ATOM   4465 O O     . SER D 2 108 ? 48.676  45.088 95.640  1.00 38.73  ? 108 SER B O     1 
ATOM   4466 C CB    . SER D 2 108 ? 50.070  43.951 93.147  1.00 13.97  ? 108 SER B CB    1 
ATOM   4467 O OG    . SER D 2 108 ? 50.888  42.826 92.897  1.00 40.42  ? 108 SER B OG    1 
ATOM   4468 N N     . ASP D 2 109 ? 47.053  45.087 94.074  1.00 30.92  ? 109 ASP B N     1 
ATOM   4469 C CA    . ASP D 2 109 ? 46.317  46.167 94.682  1.00 37.49  ? 109 ASP B CA    1 
ATOM   4470 C C     . ASP D 2 109 ? 45.412  45.594 95.788  1.00 41.39  ? 109 ASP B C     1 
ATOM   4471 O O     . ASP D 2 109 ? 44.468  46.244 96.238  1.00 39.92  ? 109 ASP B O     1 
ATOM   4472 C CB    . ASP D 2 109 ? 45.505  46.907 93.604  1.00 32.23  ? 109 ASP B CB    1 
ATOM   4473 C CG    . ASP D 2 109 ? 46.404  47.635 92.594  1.00 49.25  ? 109 ASP B CG    1 
ATOM   4474 O OD1   . ASP D 2 109 ? 45.939  47.917 91.462  1.00 50.72  ? 109 ASP B OD1   1 
ATOM   4475 O OD2   . ASP D 2 109 ? 47.579  47.920 92.938  1.00 48.88  ? 109 ASP B OD2   1 
ATOM   4476 N N     . SER D 2 110 ? 45.719  44.375 96.232  1.00 40.02  ? 110 SER B N     1 
ATOM   4477 C CA    . SER D 2 110 ? 44.946  43.729 97.290  1.00 35.63  ? 110 SER B CA    1 
ATOM   4478 C C     . SER D 2 110 ? 45.866  43.331 98.417  1.00 31.38  ? 110 SER B C     1 
ATOM   4479 O O     . SER D 2 110 ? 46.931  42.755 98.181  1.00 32.34  ? 110 SER B O     1 
ATOM   4480 C CB    . SER D 2 110 ? 44.251  42.457 96.797  1.00 34.53  ? 110 SER B CB    1 
ATOM   4481 O OG    . SER D 2 110 ? 44.320  42.320 95.396  1.00 70.41  ? 110 SER B OG    1 
ATOM   4482 N N     . ASN D 2 111 ? 45.445  43.609 99.643  1.00 27.42  ? 111 ASN B N     1 
ATOM   4483 C CA    . ASN D 2 111 ? 46.273  43.250 100.773 1.00 32.26  ? 111 ASN B CA    1 
ATOM   4484 C C     . ASN D 2 111 ? 46.608  41.774 100.751 1.00 32.55  ? 111 ASN B C     1 
ATOM   4485 O O     . ASN D 2 111 ? 47.711  41.401 101.118 1.00 43.62  ? 111 ASN B O     1 
ATOM   4486 C CB    . ASN D 2 111 ? 45.596  43.625 102.086 1.00 25.67  ? 111 ASN B CB    1 
ATOM   4487 C CG    . ASN D 2 111 ? 45.968  45.016 102.528 1.00 28.36  ? 111 ASN B CG    1 
ATOM   4488 O OD1   . ASN D 2 111 ? 47.097  45.453 102.337 1.00 35.35  ? 111 ASN B OD1   1 
ATOM   4489 N ND2   . ASN D 2 111 ? 45.020  45.724 103.111 1.00 44.72  ? 111 ASN B ND2   1 
ATOM   4490 N N     . ALA D 2 112 ? 45.697  40.926 100.284 1.00 25.86  ? 112 ALA B N     1 
ATOM   4491 C CA    . ALA D 2 112 ? 46.001  39.498 100.279 1.00 19.10  ? 112 ALA B CA    1 
ATOM   4492 C C     . ALA D 2 112 ? 47.176  39.165 99.375  1.00 18.74  ? 112 ALA B C     1 
ATOM   4493 O O     . ALA D 2 112 ? 48.080  38.437 99.785  1.00 31.77  ? 112 ALA B O     1 
ATOM   4494 C CB    . ALA D 2 112 ? 44.768  38.675 99.881  1.00 6.16   ? 112 ALA B CB    1 
ATOM   4495 N N     . VAL D 2 113 ? 47.172  39.693 98.151  1.00 19.78  ? 113 VAL B N     1 
ATOM   4496 C CA    . VAL D 2 113 ? 48.274  39.426 97.222  1.00 21.24  ? 113 VAL B CA    1 
ATOM   4497 C C     . VAL D 2 113 ? 49.543  40.140 97.646  1.00 22.79  ? 113 VAL B C     1 
ATOM   4498 O O     . VAL D 2 113 ? 50.574  39.497 97.857  1.00 22.69  ? 113 VAL B O     1 
ATOM   4499 C CB    . VAL D 2 113 ? 47.951  39.871 95.819  1.00 18.43  ? 113 VAL B CB    1 
ATOM   4500 C CG1   . VAL D 2 113 ? 49.213  39.893 94.992  1.00 20.11  ? 113 VAL B CG1   1 
ATOM   4501 C CG2   . VAL D 2 113 ? 46.924  38.935 95.214  1.00 13.47  ? 113 VAL B CG2   1 
ATOM   4502 N N     . SER D 2 114 ? 49.448  41.464 97.775  1.00 14.89  ? 114 SER B N     1 
ATOM   4503 C CA    . SER D 2 114 ? 50.578  42.284 98.196  1.00 15.84  ? 114 SER B CA    1 
ATOM   4504 C C     . SER D 2 114 ? 51.250  41.684 99.416  1.00 16.98  ? 114 SER B C     1 
ATOM   4505 O O     . SER D 2 114 ? 52.474  41.628 99.500  1.00 39.58  ? 114 SER B O     1 
ATOM   4506 C CB    . SER D 2 114 ? 50.131  43.696 98.550  1.00 8.36   ? 114 SER B CB    1 
ATOM   4507 O OG    . SER D 2 114 ? 48.885  44.002 97.965  1.00 39.10  ? 114 SER B OG    1 
ATOM   4508 N N     . LEU D 2 115 ? 50.457  41.202 100.358 1.00 11.56  ? 115 LEU B N     1 
ATOM   4509 C CA    . LEU D 2 115 ? 51.037  40.647 101.562 1.00 11.42  ? 115 LEU B CA    1 
ATOM   4510 C C     . LEU D 2 115 ? 51.523  39.248 101.389 1.00 13.96  ? 115 LEU B C     1 
ATOM   4511 O O     . LEU D 2 115 ? 52.531  38.869 101.979 1.00 17.45  ? 115 LEU B O     1 
ATOM   4512 C CB    . LEU D 2 115 ? 50.042  40.682 102.719 1.00 12.18  ? 115 LEU B CB    1 
ATOM   4513 C CG    . LEU D 2 115 ? 49.575  42.081 103.156 1.00 13.88  ? 115 LEU B CG    1 
ATOM   4514 C CD1   . LEU D 2 115 ? 48.273  41.933 103.898 1.00 15.31  ? 115 LEU B CD1   1 
ATOM   4515 C CD2   . LEU D 2 115 ? 50.612  42.782 104.041 1.00 30.08  ? 115 LEU B CD2   1 
ATOM   4516 N N     . VAL D 2 116 ? 50.827  38.448 100.593 1.00 18.24  ? 116 VAL B N     1 
ATOM   4517 C CA    . VAL D 2 116 ? 51.332  37.094 100.486 1.00 11.13  ? 116 VAL B CA    1 
ATOM   4518 C C     . VAL D 2 116 ? 52.699  37.215 99.860  1.00 15.52  ? 116 VAL B C     1 
ATOM   4519 O O     . VAL D 2 116 ? 53.642  36.599 100.323 1.00 23.33  ? 116 VAL B O     1 
ATOM   4520 C CB    . VAL D 2 116 ? 50.447  36.154 99.631  1.00 3.23   ? 116 VAL B CB    1 
ATOM   4521 C CG1   . VAL D 2 116 ? 50.633  36.404 98.130  1.00 5.97   ? 116 VAL B CG1   1 
ATOM   4522 C CG2   . VAL D 2 116 ? 50.832  34.721 99.960  1.00 6.59   ? 116 VAL B CG2   1 
ATOM   4523 N N     . MET D 2 117 ? 52.805  38.063 98.841  1.00 18.63  ? 117 MET B N     1 
ATOM   4524 C CA    . MET D 2 117 ? 54.061  38.245 98.130  1.00 21.93  ? 117 MET B CA    1 
ATOM   4525 C C     . MET D 2 117 ? 55.248  38.528 99.051  1.00 32.59  ? 117 MET B C     1 
ATOM   4526 O O     . MET D 2 117 ? 56.301  37.888 98.914  1.00 40.03  ? 117 MET B O     1 
ATOM   4527 C CB    . MET D 2 117 ? 53.924  39.350 97.077  1.00 16.71  ? 117 MET B CB    1 
ATOM   4528 C CG    . MET D 2 117 ? 55.026  39.327 96.026  1.00 29.53  ? 117 MET B CG    1 
ATOM   4529 S SD    . MET D 2 117 ? 55.232  37.728 95.196  1.00 33.15  ? 117 MET B SD    1 
ATOM   4530 C CE    . MET D 2 117 ? 56.850  37.277 95.741  1.00 34.95  ? 117 MET B CE    1 
ATOM   4531 N N     . ARG D 2 118 ? 55.092  39.474 99.976  1.00 28.26  ? 118 ARG B N     1 
ATOM   4532 C CA    . ARG D 2 118 ? 56.169  39.790 100.908 1.00 13.39  ? 118 ARG B CA    1 
ATOM   4533 C C     . ARG D 2 118 ? 56.495  38.611 101.795 1.00 17.21  ? 118 ARG B C     1 
ATOM   4534 O O     . ARG D 2 118 ? 57.637  38.218 101.924 1.00 28.35  ? 118 ARG B O     1 
ATOM   4535 C CB    . ARG D 2 118 ? 55.779  40.951 101.796 1.00 5.28   ? 118 ARG B CB    1 
ATOM   4536 C CG    . ARG D 2 118 ? 55.661  42.252 101.072 1.00 10.76  ? 118 ARG B CG    1 
ATOM   4537 C CD    . ARG D 2 118 ? 55.231  43.340 102.030 1.00 29.35  ? 118 ARG B CD    1 
ATOM   4538 N NE    . ARG D 2 118 ? 56.293  44.308 102.289 1.00 47.21  ? 118 ARG B NE    1 
ATOM   4539 C CZ    . ARG D 2 118 ? 57.106  44.255 103.338 1.00 49.67  ? 118 ARG B CZ    1 
ATOM   4540 N NH1   . ARG D 2 118 ? 56.986  43.284 104.227 1.00 48.59  ? 118 ARG B NH1   1 
ATOM   4541 N NH2   . ARG D 2 118 ? 58.033  45.186 103.511 1.00 58.00  ? 118 ARG B NH2   1 
ATOM   4542 N N     . ARG D 2 119 ? 55.474  38.067 102.433 1.00 22.43  ? 119 ARG B N     1 
ATOM   4543 C CA    . ARG D 2 119 ? 55.644  36.924 103.308 1.00 23.14  ? 119 ARG B CA    1 
ATOM   4544 C C     . ARG D 2 119 ? 56.503  35.889 102.609 1.00 26.12  ? 119 ARG B C     1 
ATOM   4545 O O     . ARG D 2 119 ? 57.465  35.380 103.175 1.00 24.25  ? 119 ARG B O     1 
ATOM   4546 C CB    . ARG D 2 119 ? 54.271  36.336 103.624 1.00 24.64  ? 119 ARG B CB    1 
ATOM   4547 C CG    . ARG D 2 119 ? 54.265  34.865 103.965 1.00 29.13  ? 119 ARG B CG    1 
ATOM   4548 C CD    . ARG D 2 119 ? 53.156  34.594 104.955 1.00 33.37  ? 119 ARG B CD    1 
ATOM   4549 N NE    . ARG D 2 119 ? 53.146  33.216 105.423 1.00 42.39  ? 119 ARG B NE    1 
ATOM   4550 C CZ    . ARG D 2 119 ? 52.032  32.521 105.603 1.00 50.95  ? 119 ARG B CZ    1 
ATOM   4551 N NH1   . ARG D 2 119 ? 50.861  33.086 105.349 1.00 49.24  ? 119 ARG B NH1   1 
ATOM   4552 N NH2   . ARG D 2 119 ? 52.081  31.277 106.046 1.00 54.77  ? 119 ARG B NH2   1 
ATOM   4553 N N     . ILE D 2 120 ? 56.124  35.598 101.367 1.00 29.45  ? 120 ILE B N     1 
ATOM   4554 C CA    . ILE D 2 120 ? 56.799  34.624 100.518 1.00 29.54  ? 120 ILE B CA    1 
ATOM   4555 C C     . ILE D 2 120 ? 58.240  35.022 100.295 1.00 32.68  ? 120 ILE B C     1 
ATOM   4556 O O     . ILE D 2 120 ? 59.153  34.257 100.581 1.00 36.12  ? 120 ILE B O     1 
ATOM   4557 C CB    . ILE D 2 120 ? 56.124  34.528 99.130  1.00 25.18  ? 120 ILE B CB    1 
ATOM   4558 C CG1   . ILE D 2 120 ? 54.854  33.689 99.230  1.00 24.29  ? 120 ILE B CG1   1 
ATOM   4559 C CG2   . ILE D 2 120 ? 57.083  33.921 98.113  1.00 15.78  ? 120 ILE B CG2   1 
ATOM   4560 C CD1   . ILE D 2 120 ? 54.110  33.546 97.914  1.00 22.07  ? 120 ILE B CD1   1 
ATOM   4561 N N     . ARG D 2 121 ? 58.441  36.214 99.756  1.00 30.13  ? 121 ARG B N     1 
ATOM   4562 C CA    . ARG D 2 121 ? 59.787  36.691 99.504  1.00 31.64  ? 121 ARG B CA    1 
ATOM   4563 C C     . ARG D 2 121 ? 60.603  36.627 100.794 1.00 28.08  ? 121 ARG B C     1 
ATOM   4564 O O     . ARG D 2 121 ? 61.771  36.262 100.784 1.00 34.19  ? 121 ARG B O     1 
ATOM   4565 C CB    . ARG D 2 121 ? 59.715  38.116 98.954  1.00 33.95  ? 121 ARG B CB    1 
ATOM   4566 C CG    . ARG D 2 121 ? 60.977  38.958 99.080  1.00 45.17  ? 121 ARG B CG    1 
ATOM   4567 C CD    . ARG D 2 121 ? 60.695  40.422 98.653  1.00 75.81  ? 121 ARG B CD    1 
ATOM   4568 N NE    . ARG D 2 121 ? 60.855  41.396 99.744  1.00 91.48  ? 121 ARG B NE    1 
ATOM   4569 C CZ    . ARG D 2 121 ? 60.139  41.406 100.869 1.00 91.21  ? 121 ARG B CZ    1 
ATOM   4570 N NH1   . ARG D 2 121 ? 59.198  40.492 101.072 1.00 96.58  ? 121 ARG B NH1   1 
ATOM   4571 N NH2   . ARG D 2 121 ? 60.375  42.319 101.804 1.00 84.73  ? 121 ARG B NH2   1 
ATOM   4572 N N     . LYS D 2 122 ? 59.975  36.932 101.921 1.00 32.09  ? 122 LYS B N     1 
ATOM   4573 C CA    . LYS D 2 122 ? 60.688  36.900 103.195 1.00 30.52  ? 122 LYS B CA    1 
ATOM   4574 C C     . LYS D 2 122 ? 60.928  35.482 103.640 1.00 37.39  ? 122 LYS B C     1 
ATOM   4575 O O     . LYS D 2 122 ? 61.931  35.177 104.256 1.00 40.90  ? 122 LYS B O     1 
ATOM   4576 C CB    . LYS D 2 122 ? 59.900  37.641 104.267 1.00 22.91  ? 122 LYS B CB    1 
ATOM   4577 C CG    . LYS D 2 122 ? 59.731  39.110 103.941 1.00 28.58  ? 122 LYS B CG    1 
ATOM   4578 C CD    . LYS D 2 122 ? 59.515  40.001 105.160 1.00 29.81  ? 122 LYS B CD    1 
ATOM   4579 C CE    . LYS D 2 122 ? 60.082  39.408 106.444 1.00 35.85  ? 122 LYS B CE    1 
ATOM   4580 N NZ    . LYS D 2 122 ? 60.362  40.490 107.439 1.00 47.95  ? 122 LYS B NZ    1 
ATOM   4581 N N     . GLU D 2 123 ? 59.993  34.609 103.304 1.00 46.59  ? 123 GLU B N     1 
ATOM   4582 C CA    . GLU D 2 123 ? 60.099  33.205 103.667 1.00 48.03  ? 123 GLU B CA    1 
ATOM   4583 C C     . GLU D 2 123 ? 61.275  32.549 102.932 1.00 48.27  ? 123 GLU B C     1 
ATOM   4584 O O     . GLU D 2 123 ? 62.069  31.853 103.547 1.00 56.32  ? 123 GLU B O     1 
ATOM   4585 C CB    . GLU D 2 123 ? 58.802  32.462 103.301 1.00 50.40  ? 123 GLU B CB    1 
ATOM   4586 C CG    . GLU D 2 123 ? 57.670  32.530 104.315 1.00 52.04  ? 123 GLU B CG    1 
ATOM   4587 C CD    . GLU D 2 123 ? 56.597  31.474 104.039 1.00 63.04  ? 123 GLU B CD    1 
ATOM   4588 O OE1   . GLU D 2 123 ? 56.701  30.351 104.574 1.00 71.57  ? 123 GLU B OE1   1 
ATOM   4589 O OE2   . GLU D 2 123 ? 55.649  31.757 103.276 1.00 71.40  ? 123 GLU B OE2   1 
ATOM   4590 N N     . ASN D 2 124 ? 61.390  32.794 101.626 1.00 47.74  ? 124 ASN B N     1 
ATOM   4591 C CA    . ASN D 2 124 ? 62.441  32.186 100.801 1.00 41.81  ? 124 ASN B CA    1 
ATOM   4592 C C     . ASN D 2 124 ? 63.830  32.701 101.109 1.00 42.90  ? 124 ASN B C     1 
ATOM   4593 O O     . ASN D 2 124 ? 64.776  31.918 101.266 1.00 39.01  ? 124 ASN B O     1 
ATOM   4594 C CB    . ASN D 2 124 ? 62.152  32.422 99.323  1.00 32.39  ? 124 ASN B CB    1 
ATOM   4595 C CG    . ASN D 2 124 ? 61.087  31.517 98.806  1.00 32.19  ? 124 ASN B CG    1 
ATOM   4596 O OD1   . ASN D 2 124 ? 60.178  31.132 99.545  1.00 37.79  ? 124 ASN B OD1   1 
ATOM   4597 N ND2   . ASN D 2 124 ? 61.181  31.159 97.537  1.00 31.43  ? 124 ASN B ND2   1 
ATOM   4598 N N     . VAL D 2 125 ? 63.944  34.024 101.144 1.00 38.86  ? 125 VAL B N     1 
ATOM   4599 C CA    . VAL D 2 125 ? 65.190  34.685 101.452 1.00 40.47  ? 125 VAL B CA    1 
ATOM   4600 C C     . VAL D 2 125 ? 65.663  34.228 102.840 1.00 47.77  ? 125 VAL B C     1 
ATOM   4601 O O     . VAL D 2 125 ? 66.824  33.871 103.020 1.00 51.77  ? 125 VAL B O     1 
ATOM   4602 C CB    . VAL D 2 125 ? 64.997  36.200 101.440 1.00 37.81  ? 125 VAL B CB    1 
ATOM   4603 C CG1   . VAL D 2 125 ? 65.789  36.831 102.562 1.00 41.89  ? 125 VAL B CG1   1 
ATOM   4604 C CG2   . VAL D 2 125 ? 65.414  36.765 100.097 1.00 29.78  ? 125 VAL B CG2   1 
ATOM   4605 N N     . ASP D 2 126 ? 64.763  34.241 103.820 1.00 52.03  ? 126 ASP B N     1 
ATOM   4606 C CA    . ASP D 2 126 ? 65.106  33.808 105.175 1.00 48.90  ? 126 ASP B CA    1 
ATOM   4607 C C     . ASP D 2 126 ? 65.711  32.405 105.168 1.00 49.96  ? 126 ASP B C     1 
ATOM   4608 O O     . ASP D 2 126 ? 66.535  32.073 106.016 1.00 60.47  ? 126 ASP B O     1 
ATOM   4609 C CB    . ASP D 2 126 ? 63.861  33.798 106.060 1.00 57.10  ? 126 ASP B CB    1 
ATOM   4610 C CG    . ASP D 2 126 ? 63.554  35.152 106.639 1.00 64.99  ? 126 ASP B CG    1 
ATOM   4611 O OD1   . ASP D 2 126 ? 64.217  36.122 106.227 1.00 66.17  ? 126 ASP B OD1   1 
ATOM   4612 O OD2   . ASP D 2 126 ? 62.656  35.252 107.502 1.00 75.88  ? 126 ASP B OD2   1 
ATOM   4613 N N     . ALA D 2 127 ? 65.273  31.576 104.224 1.00 49.85  ? 127 ALA B N     1 
ATOM   4614 C CA    . ALA D 2 127 ? 65.775  30.212 104.101 1.00 50.13  ? 127 ALA B CA    1 
ATOM   4615 C C     . ALA D 2 127 ? 67.066  30.176 103.306 1.00 56.81  ? 127 ALA B C     1 
ATOM   4616 O O     . ALA D 2 127 ? 67.670  29.122 103.142 1.00 66.07  ? 127 ALA B O     1 
ATOM   4617 C CB    . ALA D 2 127 ? 64.747  29.327 103.445 1.00 54.84  ? 127 ALA B CB    1 
ATOM   4618 N N     . GLY D 2 128 ? 67.475  31.327 102.786 1.00 56.82  ? 128 GLY B N     1 
ATOM   4619 C CA    . GLY D 2 128 ? 68.732  31.380 102.068 1.00 57.73  ? 128 GLY B CA    1 
ATOM   4620 C C     . GLY D 2 128 ? 68.664  31.487 100.568 1.00 60.16  ? 128 GLY B C     1 
ATOM   4621 O O     . GLY D 2 128 ? 69.683  31.368 99.895  1.00 66.49  ? 128 GLY B O     1 
ATOM   4622 N N     . GLU D 2 129 ? 67.473  31.697 100.029 1.00 56.07  ? 129 GLU B N     1 
ATOM   4623 C CA    . GLU D 2 129 ? 67.351  31.825 98.590  1.00 54.68  ? 129 GLU B CA    1 
ATOM   4624 C C     . GLU D 2 129 ? 68.116  33.043 98.131  1.00 53.23  ? 129 GLU B C     1 
ATOM   4625 O O     . GLU D 2 129 ? 68.091  34.081 98.784  1.00 49.02  ? 129 GLU B O     1 
ATOM   4626 C CB    . GLU D 2 129 ? 65.890  31.953 98.167  1.00 66.94  ? 129 GLU B CB    1 
ATOM   4627 C CG    . GLU D 2 129 ? 65.566  31.095 96.950  1.00 70.53  ? 129 GLU B CG    1 
ATOM   4628 C CD    . GLU D 2 129 ? 64.421  31.629 96.105  1.00 69.03  ? 129 GLU B CD    1 
ATOM   4629 O OE1   . GLU D 2 129 ? 63.362  30.961 96.053  1.00 72.36  ? 129 GLU B OE1   1 
ATOM   4630 O OE2   . GLU D 2 129 ? 64.585  32.705 95.485  1.00 62.34  ? 129 GLU B OE2   1 
ATOM   4631 N N     . ARG D 2 130 ? 68.806  32.921 97.006  1.00 62.13  ? 130 ARG B N     1 
ATOM   4632 C CA    . ARG D 2 130 ? 69.574  34.052 96.491  1.00 68.85  ? 130 ARG B CA    1 
ATOM   4633 C C     . ARG D 2 130 ? 69.529  34.133 94.971  1.00 62.13  ? 130 ARG B C     1 
ATOM   4634 O O     . ARG D 2 130 ? 69.533  33.106 94.285  1.00 60.43  ? 130 ARG B O     1 
ATOM   4635 C CB    . ARG D 2 130 ? 71.026  33.962 96.961  1.00 84.11  ? 130 ARG B CB    1 
ATOM   4636 C CG    . ARG D 2 130 ? 71.246  32.963 98.085  1.00 89.72  ? 130 ARG B CG    1 
ATOM   4637 C CD    . ARG D 2 130 ? 71.289  31.538 97.557  1.00 99.34  ? 130 ARG B CD    1 
ATOM   4638 N NE    . ARG D 2 130 ? 71.975  30.645 98.488  1.00 100.00 ? 130 ARG B NE    1 
ATOM   4639 C CZ    . ARG D 2 130 ? 72.701  29.592 98.119  1.00 100.00 ? 130 ARG B CZ    1 
ATOM   4640 N NH1   . ARG D 2 130 ? 72.837  29.296 96.833  1.00 100.00 ? 130 ARG B NH1   1 
ATOM   4641 N NH2   . ARG D 2 130 ? 73.298  28.838 99.038  1.00 100.00 ? 130 ARG B NH2   1 
ATOM   4642 N N     . ALA D 2 131 ? 69.490  35.355 94.451  1.00 51.30  ? 131 ALA B N     1 
ATOM   4643 C CA    . ALA D 2 131 ? 69.433  35.548 93.014  1.00 50.94  ? 131 ALA B CA    1 
ATOM   4644 C C     . ALA D 2 131 ? 70.832  35.369 92.463  1.00 57.34  ? 131 ALA B C     1 
ATOM   4645 O O     . ALA D 2 131 ? 71.643  36.297 92.534  1.00 68.99  ? 131 ALA B O     1 
ATOM   4646 C CB    . ALA D 2 131 ? 68.922  36.942 92.683  1.00 45.63  ? 131 ALA B CB    1 
ATOM   4647 N N     . LYS D 2 132 ? 71.115  34.193 91.908  1.00 49.83  ? 132 LYS B N     1 
ATOM   4648 C CA    . LYS D 2 132 ? 72.433  33.915 91.354  1.00 42.01  ? 132 LYS B CA    1 
ATOM   4649 C C     . LYS D 2 132 ? 72.929  34.891 90.265  1.00 47.05  ? 132 LYS B C     1 
ATOM   4650 O O     . LYS D 2 132 ? 72.217  35.815 89.829  1.00 36.10  ? 132 LYS B O     1 
ATOM   4651 C CB    . LYS D 2 132 ? 72.472  32.478 90.842  1.00 37.01  ? 132 LYS B CB    1 
ATOM   4652 C CG    . LYS D 2 132 ? 71.708  31.508 91.742  1.00 45.77  ? 132 LYS B CG    1 
ATOM   4653 C CD    . LYS D 2 132 ? 72.573  30.362 92.220  1.00 52.61  ? 132 LYS B CD    1 
ATOM   4654 C CE    . LYS D 2 132 ? 72.499  29.195 91.253  1.00 57.03  ? 132 LYS B CE    1 
ATOM   4655 N NZ    . LYS D 2 132 ? 73.847  28.840 90.725  1.00 67.13  ? 132 LYS B NZ    1 
ATOM   4656 N N     . GLN D 2 133 ? 74.178  34.677 89.859  1.00 46.70  ? 133 GLN B N     1 
ATOM   4657 C CA    . GLN D 2 133 ? 74.849  35.498 88.857  1.00 43.94  ? 133 GLN B CA    1 
ATOM   4658 C C     . GLN D 2 133 ? 75.642  34.547 87.953  1.00 43.24  ? 133 GLN B C     1 
ATOM   4659 O O     . GLN D 2 133 ? 76.180  33.545 88.421  1.00 50.75  ? 133 GLN B O     1 
ATOM   4660 C CB    . GLN D 2 133 ? 75.808  36.460 89.552  1.00 36.47  ? 133 GLN B CB    1 
ATOM   4661 C CG    . GLN D 2 133 ? 75.745  37.895 89.080  1.00 44.58  ? 133 GLN B CG    1 
ATOM   4662 C CD    . GLN D 2 133 ? 76.961  38.679 89.528  1.00 57.75  ? 133 GLN B CD    1 
ATOM   4663 O OE1   . GLN D 2 133 ? 77.602  38.335 90.524  1.00 66.35  ? 133 GLN B OE1   1 
ATOM   4664 N NE2   . GLN D 2 133 ? 77.290  39.734 88.796  1.00 63.26  ? 133 GLN B NE2   1 
ATOM   4665 N N     . ALA D 2 134 ? 75.719  34.849 86.663  1.00 41.08  ? 134 ALA B N     1 
ATOM   4666 C CA    . ALA D 2 134 ? 76.442  33.973 85.746  1.00 34.51  ? 134 ALA B CA    1 
ATOM   4667 C C     . ALA D 2 134 ? 77.878  33.727 86.215  1.00 32.76  ? 134 ALA B C     1 
ATOM   4668 O O     . ALA D 2 134 ? 78.499  34.602 86.832  1.00 34.18  ? 134 ALA B O     1 
ATOM   4669 C CB    . ALA D 2 134 ? 76.435  34.571 84.328  1.00 20.17  ? 134 ALA B CB    1 
ATOM   4670 N N     . LEU D 2 135 ? 78.385  32.526 85.937  1.00 31.51  ? 135 LEU B N     1 
ATOM   4671 C CA    . LEU D 2 135 ? 79.754  32.157 86.286  1.00 27.03  ? 135 LEU B CA    1 
ATOM   4672 C C     . LEU D 2 135 ? 80.644  33.056 85.428  1.00 31.39  ? 135 LEU B C     1 
ATOM   4673 O O     . LEU D 2 135 ? 80.508  33.074 84.194  1.00 35.12  ? 135 LEU B O     1 
ATOM   4674 C CB    . LEU D 2 135 ? 79.987  30.689 85.947  1.00 23.45  ? 135 LEU B CB    1 
ATOM   4675 C CG    . LEU D 2 135 ? 81.412  30.154 85.978  1.00 19.31  ? 135 LEU B CG    1 
ATOM   4676 C CD1   . LEU D 2 135 ? 82.036  30.498 87.312  1.00 12.65  ? 135 LEU B CD1   1 
ATOM   4677 C CD2   . LEU D 2 135 ? 81.400  28.649 85.754  1.00 17.77  ? 135 LEU B CD2   1 
ATOM   4678 N N     . ALA D 2 136 ? 81.537  33.811 86.066  1.00 30.58  ? 136 ALA B N     1 
ATOM   4679 C CA    . ALA D 2 136 ? 82.390  34.763 85.346  1.00 31.41  ? 136 ALA B CA    1 
ATOM   4680 C C     . ALA D 2 136 ? 83.423  34.223 84.355  1.00 30.95  ? 136 ALA B C     1 
ATOM   4681 O O     . ALA D 2 136 ? 83.994  33.144 84.545  1.00 37.16  ? 136 ALA B O     1 
ATOM   4682 C CB    . ALA D 2 136 ? 83.075  35.692 86.342  1.00 16.98  ? 136 ALA B CB    1 
ATOM   4683 N N     . PHE D 2 137 ? 83.659  35.019 83.311  1.00 26.72  ? 137 PHE B N     1 
ATOM   4684 C CA    . PHE D 2 137 ? 84.615  34.713 82.258  1.00 21.30  ? 137 PHE B CA    1 
ATOM   4685 C C     . PHE D 2 137 ? 85.519  35.940 82.247  1.00 18.70  ? 137 PHE B C     1 
ATOM   4686 O O     . PHE D 2 137 ? 85.292  36.896 81.508  1.00 21.52  ? 137 PHE B O     1 
ATOM   4687 C CB    . PHE D 2 137 ? 83.902  34.559 80.916  1.00 10.54  ? 137 PHE B CB    1 
ATOM   4688 C CG    . PHE D 2 137 ? 84.820  34.159 79.771  1.00 19.94  ? 137 PHE B CG    1 
ATOM   4689 C CD1   . PHE D 2 137 ? 85.115  32.819 79.526  1.00 34.54  ? 137 PHE B CD1   1 
ATOM   4690 C CD2   . PHE D 2 137 ? 85.375  35.119 78.924  1.00 27.65  ? 137 PHE B CD2   1 
ATOM   4691 C CE1   . PHE D 2 137 ? 85.945  32.442 78.455  1.00 31.18  ? 137 PHE B CE1   1 
ATOM   4692 C CE2   . PHE D 2 137 ? 86.207  34.750 77.847  1.00 22.19  ? 137 PHE B CE2   1 
ATOM   4693 C CZ    . PHE D 2 137 ? 86.490  33.414 77.616  1.00 18.70  ? 137 PHE B CZ    1 
ATOM   4694 N N     . GLU D 2 138 ? 86.528  35.905 83.112  1.00 19.95  ? 138 GLU B N     1 
ATOM   4695 C CA    . GLU D 2 138 ? 87.475  36.996 83.278  1.00 21.67  ? 138 GLU B CA    1 
ATOM   4696 C C     . GLU D 2 138 ? 88.626  36.943 82.310  1.00 27.16  ? 138 GLU B C     1 
ATOM   4697 O O     . GLU D 2 138 ? 88.781  35.971 81.573  1.00 28.36  ? 138 GLU B O     1 
ATOM   4698 C CB    . GLU D 2 138 ? 88.017  37.000 84.702  1.00 19.93  ? 138 GLU B CB    1 
ATOM   4699 C CG    . GLU D 2 138 ? 86.957  37.309 85.743  1.00 35.82  ? 138 GLU B CG    1 
ATOM   4700 C CD    . GLU D 2 138 ? 86.943  36.301 86.871  1.00 56.85  ? 138 GLU B CD    1 
ATOM   4701 O OE1   . GLU D 2 138 ? 87.334  35.133 86.629  1.00 50.57  ? 138 GLU B OE1   1 
ATOM   4702 O OE2   . GLU D 2 138 ? 86.542  36.681 87.996  1.00 66.77  ? 138 GLU B OE2   1 
ATOM   4703 N N     . ARG D 2 139 ? 89.439  37.991 82.324  1.00 24.88  ? 139 ARG B N     1 
ATOM   4704 C CA    . ARG D 2 139 ? 90.572  38.068 81.414  1.00 27.94  ? 139 ARG B CA    1 
ATOM   4705 C C     . ARG D 2 139 ? 91.411  36.807 81.366  1.00 29.78  ? 139 ARG B C     1 
ATOM   4706 O O     . ARG D 2 139 ? 91.834  36.385 80.295  1.00 34.10  ? 139 ARG B O     1 
ATOM   4707 C CB    . ARG D 2 139 ? 91.477  39.233 81.782  1.00 15.14  ? 139 ARG B CB    1 
ATOM   4708 C CG    . ARG D 2 139 ? 92.762  39.317 80.969  1.00 34.89  ? 139 ARG B CG    1 
ATOM   4709 C CD    . ARG D 2 139 ? 92.560  39.969 79.603  1.00 39.54  ? 139 ARG B CD    1 
ATOM   4710 N NE    . ARG D 2 139 ? 93.355  41.191 79.454  1.00 47.01  ? 139 ARG B NE    1 
ATOM   4711 C CZ    . ARG D 2 139 ? 94.570  41.248 78.908  1.00 54.60  ? 139 ARG B CZ    1 
ATOM   4712 N NH1   . ARG D 2 139 ? 95.154  40.159 78.428  1.00 59.22  ? 139 ARG B NH1   1 
ATOM   4713 N NH2   . ARG D 2 139 ? 95.198  42.411 78.819  1.00 62.32  ? 139 ARG B NH2   1 
ATOM   4714 N N     . THR D 2 140 ? 91.657  36.203 82.521  1.00 22.51  ? 140 THR B N     1 
ATOM   4715 C CA    . THR D 2 140 ? 92.475  35.000 82.541  1.00 21.43  ? 140 THR B CA    1 
ATOM   4716 C C     . THR D 2 140 ? 91.835  33.927 81.661  1.00 24.73  ? 140 THR B C     1 
ATOM   4717 O O     . THR D 2 140 ? 92.509  33.265 80.862  1.00 24.85  ? 140 THR B O     1 
ATOM   4718 C CB    . THR D 2 140 ? 92.673  34.469 84.002  1.00 25.87  ? 140 THR B CB    1 
ATOM   4719 O OG1   . THR D 2 140 ? 93.191  35.519 84.829  1.00 34.85  ? 140 THR B OG1   1 
ATOM   4720 C CG2   . THR D 2 140 ? 93.664  33.320 84.036  1.00 20.90  ? 140 THR B CG2   1 
ATOM   4721 N N     . ASP D 2 141 ? 90.526  33.774 81.794  1.00 14.42  ? 141 ASP B N     1 
ATOM   4722 C CA    . ASP D 2 141 ? 89.843  32.771 81.019  1.00 18.29  ? 141 ASP B CA    1 
ATOM   4723 C C     . ASP D 2 141 ? 90.006  33.095 79.559  1.00 19.72  ? 141 ASP B C     1 
ATOM   4724 O O     . ASP D 2 141 ? 90.383  32.253 78.767  1.00 25.25  ? 141 ASP B O     1 
ATOM   4725 C CB    . ASP D 2 141 ? 88.368  32.727 81.394  1.00 28.77  ? 141 ASP B CB    1 
ATOM   4726 C CG    . ASP D 2 141 ? 88.156  32.693 82.893  1.00 33.95  ? 141 ASP B CG    1 
ATOM   4727 O OD1   . ASP D 2 141 ? 88.354  31.629 83.523  1.00 31.70  ? 141 ASP B OD1   1 
ATOM   4728 O OD2   . ASP D 2 141 ? 87.801  33.745 83.454  1.00 33.87  ? 141 ASP B OD2   1 
ATOM   4729 N N     . PHE D 2 142 ? 89.744  34.339 79.204  1.00 19.47  ? 142 PHE B N     1 
ATOM   4730 C CA    . PHE D 2 142 ? 89.865  34.739 77.814  1.00 26.02  ? 142 PHE B CA    1 
ATOM   4731 C C     . PHE D 2 142 ? 91.197  34.323 77.227  1.00 23.65  ? 142 PHE B C     1 
ATOM   4732 O O     . PHE D 2 142 ? 91.261  33.576 76.257  1.00 21.43  ? 142 PHE B O     1 
ATOM   4733 C CB    . PHE D 2 142 ? 89.735  36.252 77.676  1.00 32.26  ? 142 PHE B CB    1 
ATOM   4734 C CG    . PHE D 2 142 ? 89.818  36.727 76.260  1.00 38.28  ? 142 PHE B CG    1 
ATOM   4735 C CD1   . PHE D 2 142 ? 89.424  35.894 75.215  1.00 40.43  ? 142 PHE B CD1   1 
ATOM   4736 C CD2   . PHE D 2 142 ? 90.284  37.996 75.965  1.00 40.45  ? 142 PHE B CD2   1 
ATOM   4737 C CE1   . PHE D 2 142 ? 89.496  36.315 73.899  1.00 43.99  ? 142 PHE B CE1   1 
ATOM   4738 C CE2   . PHE D 2 142 ? 90.360  38.427 74.650  1.00 44.92  ? 142 PHE B CE2   1 
ATOM   4739 C CZ    . PHE D 2 142 ? 89.960  37.582 73.613  1.00 45.62  ? 142 PHE B CZ    1 
ATOM   4740 N N     . ASP D 2 143 ? 92.254  34.843 77.832  1.00 24.98  ? 143 ASP B N     1 
ATOM   4741 C CA    . ASP D 2 143 ? 93.616  34.578 77.416  1.00 26.29  ? 143 ASP B CA    1 
ATOM   4742 C C     . ASP D 2 143 ? 93.923  33.119 77.411  1.00 24.48  ? 143 ASP B C     1 
ATOM   4743 O O     . ASP D 2 143 ? 94.588  32.619 76.509  1.00 33.10  ? 143 ASP B O     1 
ATOM   4744 C CB    . ASP D 2 143 ? 94.573  35.284 78.346  1.00 35.98  ? 143 ASP B CB    1 
ATOM   4745 C CG    . ASP D 2 143 ? 94.624  36.761 78.087  1.00 47.50  ? 143 ASP B CG    1 
ATOM   4746 O OD1   . ASP D 2 143 ? 94.678  37.145 76.897  1.00 54.65  ? 143 ASP B OD1   1 
ATOM   4747 O OD2   . ASP D 2 143 ? 94.605  37.534 79.065  1.00 52.24  ? 143 ASP B OD2   1 
ATOM   4748 N N     . GLN D 2 144 ? 93.441  32.431 78.430  1.00 15.60  ? 144 GLN B N     1 
ATOM   4749 C CA    . GLN D 2 144 ? 93.688  31.012 78.501  1.00 18.20  ? 144 GLN B CA    1 
ATOM   4750 C C     . GLN D 2 144 ? 92.994  30.391 77.303  1.00 14.71  ? 144 GLN B C     1 
ATOM   4751 O O     . GLN D 2 144 ? 93.532  29.535 76.624  1.00 25.46  ? 144 GLN B O     1 
ATOM   4752 C CB    . GLN D 2 144 ? 93.118  30.448 79.796  1.00 21.86  ? 144 GLN B CB    1 
ATOM   4753 C CG    . GLN D 2 144 ? 94.144  30.313 80.901  1.00 27.05  ? 144 GLN B CG    1 
ATOM   4754 C CD    . GLN D 2 144 ? 93.522  29.998 82.241  1.00 38.17  ? 144 GLN B CD    1 
ATOM   4755 O OE1   . GLN D 2 144 ? 92.322  29.747 82.341  1.00 56.96  ? 144 GLN B OE1   1 
ATOM   4756 N NE2   . GLN D 2 144 ? 94.335  30.010 83.288  1.00 44.14  ? 144 GLN B NE2   1 
ATOM   4757 N N     . VAL D 2 145 ? 91.795  30.876 77.020  1.00 22.52  ? 145 VAL B N     1 
ATOM   4758 C CA    . VAL D 2 145 ? 91.009  30.357 75.920  1.00 20.63  ? 145 VAL B CA    1 
ATOM   4759 C C     . VAL D 2 145 ? 91.678  30.727 74.589  1.00 25.58  ? 145 VAL B C     1 
ATOM   4760 O O     . VAL D 2 145 ? 91.877  29.872 73.727  1.00 29.20  ? 145 VAL B O     1 
ATOM   4761 C CB    . VAL D 2 145 ? 89.544  30.913 75.995  1.00 22.55  ? 145 VAL B CB    1 
ATOM   4762 C CG1   . VAL D 2 145 ? 88.707  30.367 74.858  1.00 18.33  ? 145 VAL B CG1   1 
ATOM   4763 C CG2   . VAL D 2 145 ? 88.895  30.523 77.323  1.00 20.95  ? 145 VAL B CG2   1 
ATOM   4764 N N     . ARG D 2 146 ? 92.036  31.999 74.436  1.00 26.29  ? 146 ARG B N     1 
ATOM   4765 C CA    . ARG D 2 146 ? 92.677  32.482 73.215  1.00 22.47  ? 146 ARG B CA    1 
ATOM   4766 C C     . ARG D 2 146 ? 93.918  31.668 72.909  1.00 31.74  ? 146 ARG B C     1 
ATOM   4767 O O     . ARG D 2 146 ? 93.993  31.000 71.878  1.00 47.30  ? 146 ARG B O     1 
ATOM   4768 C CB    . ARG D 2 146 ? 93.073  33.943 73.364  1.00 22.73  ? 146 ARG B CB    1 
ATOM   4769 C CG    . ARG D 2 146 ? 93.570  34.558 72.084  1.00 28.53  ? 146 ARG B CG    1 
ATOM   4770 C CD    . ARG D 2 146 ? 93.205  36.017 72.028  1.00 42.11  ? 146 ARG B CD    1 
ATOM   4771 N NE    . ARG D 2 146 ? 93.816  36.760 73.123  1.00 50.05  ? 146 ARG B NE    1 
ATOM   4772 C CZ    . ARG D 2 146 ? 94.098  38.057 73.075  1.00 57.87  ? 146 ARG B CZ    1 
ATOM   4773 N NH1   . ARG D 2 146 ? 93.827  38.755 71.977  1.00 56.79  ? 146 ARG B NH1   1 
ATOM   4774 N NH2   . ARG D 2 146 ? 94.640  38.652 74.129  1.00 60.86  ? 146 ARG B NH2   1 
ATOM   4775 N N     . SER D 2 147 ? 94.883  31.738 73.824  1.00 35.10  ? 147 SER B N     1 
ATOM   4776 C CA    . SER D 2 147 ? 96.156  31.022 73.731  1.00 30.89  ? 147 SER B CA    1 
ATOM   4777 C C     . SER D 2 147 ? 96.045  29.617 73.132  1.00 32.25  ? 147 SER B C     1 
ATOM   4778 O O     . SER D 2 147 ? 96.948  29.145 72.435  1.00 29.72  ? 147 SER B O     1 
ATOM   4779 C CB    . SER D 2 147 ? 96.776  30.919 75.124  1.00 33.54  ? 147 SER B CB    1 
ATOM   4780 O OG    . SER D 2 147 ? 96.226  29.826 75.844  1.00 30.84  ? 147 SER B OG    1 
ATOM   4781 N N     . LEU D 2 148 ? 94.918  28.973 73.415  1.00 28.83  ? 148 LEU B N     1 
ATOM   4782 C CA    . LEU D 2 148 ? 94.620  27.628 72.957  1.00 20.95  ? 148 LEU B CA    1 
ATOM   4783 C C     . LEU D 2 148 ? 94.078  27.506 71.531  1.00 32.17  ? 148 LEU B C     1 
ATOM   4784 O O     . LEU D 2 148 ? 94.657  26.810 70.684  1.00 38.41  ? 148 LEU B O     1 
ATOM   4785 C CB    . LEU D 2 148 ? 93.599  27.004 73.901  1.00 17.54  ? 148 LEU B CB    1 
ATOM   4786 C CG    . LEU D 2 148 ? 94.164  26.190 75.059  1.00 26.74  ? 148 LEU B CG    1 
ATOM   4787 C CD1   . LEU D 2 148 ? 93.027  25.596 75.850  1.00 21.70  ? 148 LEU B CD1   1 
ATOM   4788 C CD2   . LEU D 2 148 ? 95.074  25.091 74.542  1.00 25.26  ? 148 LEU B CD2   1 
ATOM   4789 N N     . MET D 2 149 ? 92.953  28.165 71.273  1.00 33.37  ? 149 MET B N     1 
ATOM   4790 C CA    . MET D 2 149 ? 92.327  28.051 69.973  1.00 32.56  ? 149 MET B CA    1 
ATOM   4791 C C     . MET D 2 149 ? 92.841  29.024 68.967  1.00 35.96  ? 149 MET B C     1 
ATOM   4792 O O     . MET D 2 149 ? 92.490  28.945 67.789  1.00 49.10  ? 149 MET B O     1 
ATOM   4793 C CB    . MET D 2 149 ? 90.820  28.195 70.077  1.00 33.14  ? 149 MET B CB    1 
ATOM   4794 C CG    . MET D 2 149 ? 90.343  28.837 71.337  1.00 47.16  ? 149 MET B CG    1 
ATOM   4795 S SD    . MET D 2 149 ? 88.575  28.600 71.520  1.00 46.94  ? 149 MET B SD    1 
ATOM   4796 C CE    . MET D 2 149 ? 88.408  26.984 70.701  1.00 57.27  ? 149 MET B CE    1 
ATOM   4797 N N     . GLU D 2 150 ? 93.675  29.946 69.410  1.00 32.56  ? 150 GLU B N     1 
ATOM   4798 C CA    . GLU D 2 150 ? 94.218  30.902 68.471  1.00 38.50  ? 150 GLU B CA    1 
ATOM   4799 C C     . GLU D 2 150 ? 94.973  30.201 67.330  1.00 45.87  ? 150 GLU B C     1 
ATOM   4800 O O     . GLU D 2 150 ? 94.880  30.616 66.178  1.00 52.06  ? 150 GLU B O     1 
ATOM   4801 C CB    . GLU D 2 150 ? 95.164  31.850 69.184  1.00 38.36  ? 150 GLU B CB    1 
ATOM   4802 C CG    . GLU D 2 150 ? 96.601  31.398 69.129  1.00 47.12  ? 150 GLU B CG    1 
ATOM   4803 C CD    . GLU D 2 150 ? 97.415  31.948 70.252  1.00 55.65  ? 150 GLU B CD    1 
ATOM   4804 O OE1   . GLU D 2 150 ? 97.606  33.185 70.271  1.00 44.48  ? 150 GLU B OE1   1 
ATOM   4805 O OE2   . GLU D 2 150 ? 97.861  31.140 71.103  1.00 60.36  ? 150 GLU B OE2   1 
ATOM   4806 N N     . ASN D 2 151 ? 95.717  29.140 67.643  1.00 50.17  ? 151 ASN B N     1 
ATOM   4807 C CA    . ASN D 2 151 ? 96.491  28.429 66.620  1.00 48.87  ? 151 ASN B CA    1 
ATOM   4808 C C     . ASN D 2 151 ? 95.653  27.463 65.769  1.00 44.41  ? 151 ASN B C     1 
ATOM   4809 O O     . ASN D 2 151 ? 96.208  26.646 65.034  1.00 48.27  ? 151 ASN B O     1 
ATOM   4810 C CB    . ASN D 2 151 ? 97.683  27.663 67.257  1.00 36.35  ? 151 ASN B CB    1 
ATOM   4811 C CG    . ASN D 2 151 ? 97.617  27.604 68.805  1.00 52.23  ? 151 ASN B CG    1 
ATOM   4812 O OD1   . ASN D 2 151 ? 97.101  26.636 69.398  1.00 47.89  ? 151 ASN B OD1   1 
ATOM   4813 N ND2   . ASN D 2 151 ? 98.153  28.639 69.455  1.00 32.08  ? 151 ASN B ND2   1 
ATOM   4814 N N     . SER D 2 152 ? 94.325  27.569 65.852  1.00 37.22  ? 152 SER B N     1 
ATOM   4815 C CA    . SER D 2 152 ? 93.440  26.681 65.100  1.00 30.67  ? 152 SER B CA    1 
ATOM   4816 C C     . SER D 2 152 ? 92.860  27.275 63.826  1.00 34.28  ? 152 SER B C     1 
ATOM   4817 O O     . SER D 2 152 ? 92.340  28.380 63.808  1.00 36.95  ? 152 SER B O     1 
ATOM   4818 C CB    . SER D 2 152 ? 92.290  26.197 65.975  1.00 29.07  ? 152 SER B CB    1 
ATOM   4819 O OG    . SER D 2 152 ? 91.328  25.516 65.188  1.00 29.37  ? 152 SER B OG    1 
ATOM   4820 N N     . ASP D 2 153 ? 92.929  26.490 62.763  1.00 44.01  ? 153 ASP B N     1 
ATOM   4821 C CA    . ASP D 2 153 ? 92.442  26.891 61.457  1.00 39.73  ? 153 ASP B CA    1 
ATOM   4822 C C     . ASP D 2 153 ? 90.966  26.529 61.308  1.00 38.33  ? 153 ASP B C     1 
ATOM   4823 O O     . ASP D 2 153 ? 90.308  27.035 60.411  1.00 32.35  ? 153 ASP B O     1 
ATOM   4824 C CB    . ASP D 2 153 ? 93.281  26.201 60.371  1.00 51.71  ? 153 ASP B CB    1 
ATOM   4825 C CG    . ASP D 2 153 ? 94.439  25.367 60.953  1.00 63.83  ? 153 ASP B CG    1 
ATOM   4826 O OD1   . ASP D 2 153 ? 95.603  25.831 60.897  1.00 65.61  ? 153 ASP B OD1   1 
ATOM   4827 O OD2   . ASP D 2 153 ? 94.189  24.248 61.469  1.00 57.32  ? 153 ASP B OD2   1 
ATOM   4828 N N     . ARG D 2 154 ? 90.457  25.666 62.200  1.00 41.84  ? 154 ARG B N     1 
ATOM   4829 C CA    . ARG D 2 154 ? 89.053  25.236 62.192  1.00 32.08  ? 154 ARG B CA    1 
ATOM   4830 C C     . ARG D 2 154 ? 88.186  26.474 62.203  1.00 36.44  ? 154 ARG B C     1 
ATOM   4831 O O     . ARG D 2 154 ? 88.307  27.336 63.071  1.00 35.59  ? 154 ARG B O     1 
ATOM   4832 C CB    . ARG D 2 154 ? 88.707  24.356 63.411  1.00 21.64  ? 154 ARG B CB    1 
ATOM   4833 C CG    . ARG D 2 154 ? 87.815  23.149 63.075  1.00 32.93  ? 154 ARG B CG    1 
ATOM   4834 C CD    . ARG D 2 154 ? 87.315  22.397 64.314  1.00 44.40  ? 154 ARG B CD    1 
ATOM   4835 N NE    . ARG D 2 154 ? 86.241  23.106 65.015  1.00 75.24  ? 154 ARG B NE    1 
ATOM   4836 C CZ    . ARG D 2 154 ? 86.153  23.218 66.339  1.00 84.30  ? 154 ARG B CZ    1 
ATOM   4837 N NH1   . ARG D 2 154 ? 87.073  22.661 67.120  1.00 86.67  ? 154 ARG B NH1   1 
ATOM   4838 N NH2   . ARG D 2 154 ? 85.167  23.920 66.889  1.00 85.10  ? 154 ARG B NH2   1 
ATOM   4839 N N     . CYS D 2 155 ? 87.322  26.543 61.204  1.00 45.45  ? 155 CYS B N     1 
ATOM   4840 C CA    . CYS D 2 155 ? 86.421  27.658 60.993  1.00 47.36  ? 155 CYS B CA    1 
ATOM   4841 C C     . CYS D 2 155 ? 85.482  27.926 62.171  1.00 46.48  ? 155 CYS B C     1 
ATOM   4842 O O     . CYS D 2 155 ? 85.160  29.086 62.459  1.00 45.58  ? 155 CYS B O     1 
ATOM   4843 C CB    . CYS D 2 155 ? 85.629  27.405 59.706  1.00 57.28  ? 155 CYS B CB    1 
ATOM   4844 S SG    . CYS D 2 155 ? 84.678  28.818 59.100  1.00 65.79  ? 155 CYS B SG    1 
ATOM   4845 N N     . GLN D 2 156 ? 85.036  26.872 62.843  1.00 39.39  ? 156 GLN B N     1 
ATOM   4846 C CA    . GLN D 2 156 ? 84.160  27.071 63.982  1.00 26.35  ? 156 GLN B CA    1 
ATOM   4847 C C     . GLN D 2 156 ? 84.946  27.695 65.128  1.00 29.95  ? 156 GLN B C     1 
ATOM   4848 O O     . GLN D 2 156 ? 84.401  28.458 65.925  1.00 42.23  ? 156 GLN B O     1 
ATOM   4849 C CB    . GLN D 2 156 ? 83.580  25.746 64.421  1.00 36.72  ? 156 GLN B CB    1 
ATOM   4850 C CG    . GLN D 2 156 ? 82.083  25.759 64.456  1.00 41.52  ? 156 GLN B CG    1 
ATOM   4851 C CD    . GLN D 2 156 ? 81.592  25.548 65.840  1.00 40.97  ? 156 GLN B CD    1 
ATOM   4852 O OE1   . GLN D 2 156 ? 82.251  24.898 66.651  1.00 43.23  ? 156 GLN B OE1   1 
ATOM   4853 N NE2   . GLN D 2 156 ? 80.436  26.098 66.139  1.00 45.58  ? 156 GLN B NE2   1 
ATOM   4854 N N     . ASP D 2 157 ? 86.242  27.385 65.178  1.00 28.20  ? 157 ASP B N     1 
ATOM   4855 C CA    . ASP D 2 157 ? 87.148  27.883 66.206  1.00 16.50  ? 157 ASP B CA    1 
ATOM   4856 C C     . ASP D 2 157 ? 87.492  29.345 66.042  1.00 13.83  ? 157 ASP B C     1 
ATOM   4857 O O     . ASP D 2 157 ? 87.584  30.095 67.010  1.00 25.55  ? 157 ASP B O     1 
ATOM   4858 C CB    . ASP D 2 157 ? 88.410  27.047 66.202  1.00 23.23  ? 157 ASP B CB    1 
ATOM   4859 C CG    . ASP D 2 157 ? 88.217  25.712 66.885  1.00 41.99  ? 157 ASP B CG    1 
ATOM   4860 O OD1   . ASP D 2 157 ? 87.273  25.586 67.703  1.00 45.41  ? 157 ASP B OD1   1 
ATOM   4861 O OD2   . ASP D 2 157 ? 89.003  24.785 66.603  1.00 58.27  ? 157 ASP B OD2   1 
ATOM   4862 N N     . ILE D 2 158 ? 87.691  29.747 64.805  1.00 16.13  ? 158 ILE B N     1 
ATOM   4863 C CA    . ILE D 2 158 ? 88.003  31.131 64.506  1.00 21.99  ? 158 ILE B CA    1 
ATOM   4864 C C     . ILE D 2 158 ? 86.836  32.054 64.895  1.00 32.92  ? 158 ILE B C     1 
ATOM   4865 O O     . ILE D 2 158 ? 87.048  33.195 65.302  1.00 39.14  ? 158 ILE B O     1 
ATOM   4866 C CB    . ILE D 2 158 ? 88.310  31.284 63.007  1.00 18.58  ? 158 ILE B CB    1 
ATOM   4867 C CG1   . ILE D 2 158 ? 89.141  30.087 62.536  1.00 17.93  ? 158 ILE B CG1   1 
ATOM   4868 C CG2   . ILE D 2 158 ? 88.976  32.620 62.739  1.00 23.06  ? 158 ILE B CG2   1 
ATOM   4869 C CD1   . ILE D 2 158 ? 90.417  30.433 61.822  1.00 25.63  ? 158 ILE B CD1   1 
ATOM   4870 N N     . ARG D 2 159 ? 85.606  31.558 64.789  1.00 32.56  ? 159 ARG B N     1 
ATOM   4871 C CA    . ARG D 2 159 ? 84.446  32.370 65.133  1.00 20.36  ? 159 ARG B CA    1 
ATOM   4872 C C     . ARG D 2 159 ? 84.300  32.523 66.637  1.00 26.13  ? 159 ARG B C     1 
ATOM   4873 O O     . ARG D 2 159 ? 84.328  33.641 67.169  1.00 23.74  ? 159 ARG B O     1 
ATOM   4874 C CB    . ARG D 2 159 ? 83.169  31.744 64.588  1.00 24.63  ? 159 ARG B CB    1 
ATOM   4875 C CG    . ARG D 2 159 ? 81.937  32.613 64.852  1.00 30.98  ? 159 ARG B CG    1 
ATOM   4876 C CD    . ARG D 2 159 ? 80.612  31.877 64.624  1.00 23.91  ? 159 ARG B CD    1 
ATOM   4877 N NE    . ARG D 2 159 ? 80.524  30.602 65.343  1.00 13.82  ? 159 ARG B NE    1 
ATOM   4878 C CZ    . ARG D 2 159 ? 79.574  29.697 65.143  1.00 24.95  ? 159 ARG B CZ    1 
ATOM   4879 N NH1   . ARG D 2 159 ? 78.615  29.914 64.244  1.00 13.50  ? 159 ARG B NH1   1 
ATOM   4880 N NH2   . ARG D 2 159 ? 79.598  28.573 65.840  1.00 16.16  ? 159 ARG B NH2   1 
ATOM   4881 N N     . ASN D 2 160 ? 84.106  31.393 67.310  1.00 16.36  ? 160 ASN B N     1 
ATOM   4882 C CA    . ASN D 2 160 ? 83.953  31.394 68.752  1.00 23.25  ? 160 ASN B CA    1 
ATOM   4883 C C     . ASN D 2 160 ? 84.969  32.287 69.431  1.00 23.71  ? 160 ASN B C     1 
ATOM   4884 O O     . ASN D 2 160 ? 84.651  33.043 70.355  1.00 28.47  ? 160 ASN B O     1 
ATOM   4885 C CB    . ASN D 2 160 ? 84.085  29.982 69.269  1.00 23.17  ? 160 ASN B CB    1 
ATOM   4886 C CG    . ASN D 2 160 ? 83.007  29.088 68.717  1.00 36.51  ? 160 ASN B CG    1 
ATOM   4887 O OD1   . ASN D 2 160 ? 82.237  29.506 67.843  1.00 28.12  ? 160 ASN B OD1   1 
ATOM   4888 N ND2   . ASN D 2 160 ? 82.935  27.858 69.208  1.00 36.43  ? 160 ASN B ND2   1 
ATOM   4889 N N     . LEU D 2 161 ? 86.205  32.208 68.973  1.00 17.25  ? 161 LEU B N     1 
ATOM   4890 C CA    . LEU D 2 161 ? 87.224  33.047 69.575  1.00 19.21  ? 161 LEU B CA    1 
ATOM   4891 C C     . LEU D 2 161 ? 86.910  34.491 69.273  1.00 16.57  ? 161 LEU B C     1 
ATOM   4892 O O     . LEU D 2 161 ? 87.123  35.355 70.100  1.00 25.60  ? 161 LEU B O     1 
ATOM   4893 C CB    . LEU D 2 161 ? 88.612  32.699 69.042  1.00 20.47  ? 161 LEU B CB    1 
ATOM   4894 C CG    . LEU D 2 161 ? 89.764  33.381 69.801  1.00 26.62  ? 161 LEU B CG    1 
ATOM   4895 C CD1   . LEU D 2 161 ? 89.476  33.439 71.298  1.00 29.28  ? 161 LEU B CD1   1 
ATOM   4896 C CD2   . LEU D 2 161 ? 91.048  32.619 69.549  1.00 16.59  ? 161 LEU B CD2   1 
ATOM   4897 N N     . ALA D 2 162 ? 86.394  34.756 68.080  1.00 25.36  ? 162 ALA B N     1 
ATOM   4898 C CA    . ALA D 2 162 ? 86.053  36.124 67.697  1.00 16.03  ? 162 ALA B CA    1 
ATOM   4899 C C     . ALA D 2 162 ? 84.971  36.606 68.633  1.00 17.37  ? 162 ALA B C     1 
ATOM   4900 O O     . ALA D 2 162 ? 85.106  37.646 69.268  1.00 9.72   ? 162 ALA B O     1 
ATOM   4901 C CB    . ALA D 2 162 ? 85.557  36.156 66.272  1.00 17.72  ? 162 ALA B CB    1 
ATOM   4902 N N     . PHE D 2 163 ? 83.907  35.815 68.712  1.00 14.05  ? 163 PHE B N     1 
ATOM   4903 C CA    . PHE D 2 163 ? 82.774  36.091 69.569  1.00 13.68  ? 163 PHE B CA    1 
ATOM   4904 C C     . PHE D 2 163 ? 83.222  36.402 70.985  1.00 20.86  ? 163 PHE B C     1 
ATOM   4905 O O     . PHE D 2 163 ? 82.986  37.506 71.490  1.00 23.63  ? 163 PHE B O     1 
ATOM   4906 C CB    . PHE D 2 163 ? 81.859  34.884 69.608  1.00 17.53  ? 163 PHE B CB    1 
ATOM   4907 C CG    . PHE D 2 163 ? 80.830  34.943 70.697  1.00 25.59  ? 163 PHE B CG    1 
ATOM   4908 C CD1   . PHE D 2 163 ? 80.061  36.085 70.885  1.00 28.64  ? 163 PHE B CD1   1 
ATOM   4909 C CD2   . PHE D 2 163 ? 80.605  33.845 71.523  1.00 34.08  ? 163 PHE B CD2   1 
ATOM   4910 C CE1   . PHE D 2 163 ? 79.080  36.140 71.881  1.00 26.48  ? 163 PHE B CE1   1 
ATOM   4911 C CE2   . PHE D 2 163 ? 79.622  33.889 72.524  1.00 18.49  ? 163 PHE B CE2   1 
ATOM   4912 C CZ    . PHE D 2 163 ? 78.860  35.047 72.696  1.00 22.65  ? 163 PHE B CZ    1 
ATOM   4913 N N     . LEU D 2 164 ? 83.846  35.419 71.630  1.00 18.59  ? 164 LEU B N     1 
ATOM   4914 C CA    . LEU D 2 164 ? 84.323  35.606 72.987  1.00 15.43  ? 164 LEU B CA    1 
ATOM   4915 C C     . LEU D 2 164 ? 85.183  36.864 73.106  1.00 18.92  ? 164 LEU B C     1 
ATOM   4916 O O     . LEU D 2 164 ? 85.267  37.478 74.149  1.00 24.87  ? 164 LEU B O     1 
ATOM   4917 C CB    . LEU D 2 164 ? 85.113  34.387 73.400  1.00 6.69   ? 164 LEU B CB    1 
ATOM   4918 C CG    . LEU D 2 164 ? 84.243  33.143 73.333  1.00 15.14  ? 164 LEU B CG    1 
ATOM   4919 C CD1   . LEU D 2 164 ? 85.070  31.954 72.934  1.00 21.31  ? 164 LEU B CD1   1 
ATOM   4920 C CD2   . LEU D 2 164 ? 83.615  32.921 74.674  1.00 8.37   ? 164 LEU B CD2   1 
ATOM   4921 N N     . GLY D 2 165 ? 85.811  37.271 72.017  1.00 26.92  ? 165 GLY B N     1 
ATOM   4922 C CA    . GLY D 2 165 ? 86.633  38.464 72.071  1.00 26.68  ? 165 GLY B CA    1 
ATOM   4923 C C     . GLY D 2 165 ? 85.768  39.707 72.116  1.00 32.50  ? 165 GLY B C     1 
ATOM   4924 O O     . GLY D 2 165 ? 86.000  40.597 72.928  1.00 34.76  ? 165 GLY B O     1 
ATOM   4925 N N     . ILE D 2 166 ? 84.774  39.774 71.236  1.00 34.42  ? 166 ILE B N     1 
ATOM   4926 C CA    . ILE D 2 166 ? 83.868  40.910 71.197  1.00 33.44  ? 166 ILE B CA    1 
ATOM   4927 C C     . ILE D 2 166 ? 83.100  40.904 72.507  1.00 33.08  ? 166 ILE B C     1 
ATOM   4928 O O     . ILE D 2 166 ? 82.899  41.940 73.156  1.00 19.11  ? 166 ILE B O     1 
ATOM   4929 C CB    . ILE D 2 166 ? 82.870  40.759 70.056  1.00 23.60  ? 166 ILE B CB    1 
ATOM   4930 C CG1   . ILE D 2 166 ? 83.238  41.724 68.937  1.00 30.31  ? 166 ILE B CG1   1 
ATOM   4931 C CG2   . ILE D 2 166 ? 81.458  41.019 70.552  1.00 23.58  ? 166 ILE B CG2   1 
ATOM   4932 C CD1   . ILE D 2 166 ? 83.259  41.082 67.598  1.00 22.11  ? 166 ILE B CD1   1 
ATOM   4933 N N     . ALA D 2 167 ? 82.669  39.708 72.884  1.00 17.93  ? 167 ALA B N     1 
ATOM   4934 C CA    . ALA D 2 167 ? 81.910  39.546 74.111  1.00 21.09  ? 167 ALA B CA    1 
ATOM   4935 C C     . ALA D 2 167 ? 82.601  40.349 75.193  1.00 20.18  ? 167 ALA B C     1 
ATOM   4936 O O     . ALA D 2 167 ? 82.156  41.433 75.550  1.00 28.40  ? 167 ALA B O     1 
ATOM   4937 C CB    . ALA D 2 167 ? 81.820  38.037 74.518  1.00 7.13   ? 167 ALA B CB    1 
ATOM   4938 N N     . TYR D 2 168 ? 83.704  39.801 75.698  1.00 32.16  ? 168 TYR B N     1 
ATOM   4939 C CA    . TYR D 2 168 ? 84.517  40.406 76.761  1.00 28.72  ? 168 TYR B CA    1 
ATOM   4940 C C     . TYR D 2 168 ? 84.830  41.878 76.532  1.00 26.45  ? 168 TYR B C     1 
ATOM   4941 O O     . TYR D 2 168 ? 84.584  42.724 77.384  1.00 27.36  ? 168 TYR B O     1 
ATOM   4942 C CB    . TYR D 2 168 ? 85.847  39.637 76.900  1.00 28.23  ? 168 TYR B CB    1 
ATOM   4943 C CG    . TYR D 2 168 ? 86.707  40.061 78.088  1.00 31.63  ? 168 TYR B CG    1 
ATOM   4944 C CD1   . TYR D 2 168 ? 86.410  39.617 79.378  1.00 40.29  ? 168 TYR B CD1   1 
ATOM   4945 C CD2   . TYR D 2 168 ? 87.788  40.937 77.931  1.00 32.79  ? 168 TYR B CD2   1 
ATOM   4946 C CE1   . TYR D 2 168 ? 87.158  40.034 80.483  1.00 29.37  ? 168 TYR B CE1   1 
ATOM   4947 C CE2   . TYR D 2 168 ? 88.543  41.361 79.031  1.00 31.05  ? 168 TYR B CE2   1 
ATOM   4948 C CZ    . TYR D 2 168 ? 88.217  40.907 80.304  1.00 30.64  ? 168 TYR B CZ    1 
ATOM   4949 O OH    . TYR D 2 168 ? 88.925  41.352 81.398  1.00 44.69  ? 168 TYR B OH    1 
ATOM   4950 N N     . ASN D 2 169 ? 85.391  42.158 75.368  1.00 26.49  ? 169 ASN B N     1 
ATOM   4951 C CA    . ASN D 2 169 ? 85.780  43.496 75.008  1.00 22.13  ? 169 ASN B CA    1 
ATOM   4952 C C     . ASN D 2 169 ? 84.661  44.494 75.196  1.00 24.55  ? 169 ASN B C     1 
ATOM   4953 O O     . ASN D 2 169 ? 84.803  45.464 75.932  1.00 27.40  ? 169 ASN B O     1 
ATOM   4954 C CB    . ASN D 2 169 ? 86.252  43.512 73.554  1.00 27.94  ? 169 ASN B CB    1 
ATOM   4955 C CG    . ASN D 2 169 ? 87.485  44.354 73.358  1.00 36.29  ? 169 ASN B CG    1 
ATOM   4956 O OD1   . ASN D 2 169 ? 87.719  45.328 74.076  1.00 46.57  ? 169 ASN B OD1   1 
ATOM   4957 N ND2   . ASN D 2 169 ? 88.288  43.984 72.381  1.00 34.35  ? 169 ASN B ND2   1 
ATOM   4958 N N     . THR D 2 170 ? 83.548  44.237 74.526  1.00 26.13  ? 170 THR B N     1 
ATOM   4959 C CA    . THR D 2 170 ? 82.390  45.120 74.545  1.00 24.91  ? 170 THR B CA    1 
ATOM   4960 C C     . THR D 2 170 ? 81.385  44.952 75.692  1.00 24.57  ? 170 THR B C     1 
ATOM   4961 O O     . THR D 2 170 ? 80.553  45.820 75.914  1.00 28.42  ? 170 THR B O     1 
ATOM   4962 C CB    . THR D 2 170 ? 81.633  44.966 73.231  1.00 29.31  ? 170 THR B CB    1 
ATOM   4963 O OG1   . THR D 2 170 ? 80.814  43.794 73.311  1.00 18.86  ? 170 THR B OG1   1 
ATOM   4964 C CG2   . THR D 2 170 ? 82.623  44.825 72.042  1.00 8.61   ? 170 THR B CG2   1 
ATOM   4965 N N     . LEU D 2 171 ? 81.467  43.844 76.421  1.00 31.13  ? 171 LEU B N     1 
ATOM   4966 C CA    . LEU D 2 171 ? 80.531  43.547 77.511  1.00 27.69  ? 171 LEU B CA    1 
ATOM   4967 C C     . LEU D 2 171 ? 79.093  43.515 77.027  1.00 31.52  ? 171 LEU B C     1 
ATOM   4968 O O     . LEU D 2 171 ? 78.170  43.472 77.818  1.00 32.61  ? 171 LEU B O     1 
ATOM   4969 C CB    . LEU D 2 171 ? 80.619  44.584 78.607  1.00 21.11  ? 171 LEU B CB    1 
ATOM   4970 C CG    . LEU D 2 171 ? 81.846  44.511 79.501  1.00 26.30  ? 171 LEU B CG    1 
ATOM   4971 C CD1   . LEU D 2 171 ? 82.968  45.303 78.864  1.00 13.60  ? 171 LEU B CD1   1 
ATOM   4972 C CD2   . LEU D 2 171 ? 81.513  45.077 80.869  1.00 22.02  ? 171 LEU B CD2   1 
ATOM   4973 N N     . LEU D 2 172 ? 78.911  43.540 75.714  1.00 36.06  ? 172 LEU B N     1 
ATOM   4974 C CA    . LEU D 2 172 ? 77.583  43.519 75.095  1.00 28.94  ? 172 LEU B CA    1 
ATOM   4975 C C     . LEU D 2 172 ? 76.774  42.276 75.407  1.00 24.87  ? 172 LEU B C     1 
ATOM   4976 O O     . LEU D 2 172 ? 77.308  41.169 75.425  1.00 30.93  ? 172 LEU B O     1 
ATOM   4977 C CB    . LEU D 2 172 ? 77.711  43.631 73.577  1.00 20.43  ? 172 LEU B CB    1 
ATOM   4978 C CG    . LEU D 2 172 ? 78.058  45.022 73.077  1.00 20.55  ? 172 LEU B CG    1 
ATOM   4979 C CD1   . LEU D 2 172 ? 78.355  44.933 71.606  1.00 24.44  ? 172 LEU B CD1   1 
ATOM   4980 C CD2   . LEU D 2 172 ? 76.908  45.977 73.330  1.00 18.50  ? 172 LEU B CD2   1 
ATOM   4981 N N     . ARG D 2 173 ? 75.482  42.459 75.655  1.00 24.82  ? 173 ARG B N     1 
ATOM   4982 C CA    . ARG D 2 173 ? 74.621  41.318 75.919  1.00 21.95  ? 173 ARG B CA    1 
ATOM   4983 C C     . ARG D 2 173 ? 74.662  40.530 74.612  1.00 27.66  ? 173 ARG B C     1 
ATOM   4984 O O     . ARG D 2 173 ? 74.931  41.102 73.555  1.00 26.47  ? 173 ARG B O     1 
ATOM   4985 C CB    . ARG D 2 173 ? 73.188  41.762 76.207  1.00 24.44  ? 173 ARG B CB    1 
ATOM   4986 C CG    . ARG D 2 173 ? 72.938  42.272 77.624  1.00 26.81  ? 173 ARG B CG    1 
ATOM   4987 C CD    . ARG D 2 173 ? 71.705  43.171 77.682  1.00 16.17  ? 173 ARG B CD    1 
ATOM   4988 N NE    . ARG D 2 173 ? 71.743  44.021 78.865  1.00 38.40  ? 173 ARG B NE    1 
ATOM   4989 C CZ    . ARG D 2 173 ? 71.827  45.347 78.841  1.00 36.88  ? 173 ARG B CZ    1 
ATOM   4990 N NH1   . ARG D 2 173 ? 71.879  45.995 77.689  1.00 36.37  ? 173 ARG B NH1   1 
ATOM   4991 N NH2   . ARG D 2 173 ? 71.903  46.027 79.973  1.00 40.61  ? 173 ARG B NH2   1 
ATOM   4992 N N     . ILE D 2 174 ? 74.396  39.231 74.680  1.00 27.22  ? 174 ILE B N     1 
ATOM   4993 C CA    . ILE D 2 174 ? 74.449  38.394 73.489  1.00 20.51  ? 174 ILE B CA    1 
ATOM   4994 C C     . ILE D 2 174 ? 73.490  38.758 72.358  1.00 18.21  ? 174 ILE B C     1 
ATOM   4995 O O     . ILE D 2 174 ? 73.869  38.737 71.201  1.00 25.09  ? 174 ILE B O     1 
ATOM   4996 C CB    . ILE D 2 174 ? 74.287  36.898 73.854  1.00 31.54  ? 174 ILE B CB    1 
ATOM   4997 C CG1   . ILE D 2 174 ? 72.991  36.672 74.644  1.00 32.49  ? 174 ILE B CG1   1 
ATOM   4998 C CG2   . ILE D 2 174 ? 75.501  36.440 74.656  1.00 17.85  ? 174 ILE B CG2   1 
ATOM   4999 C CD1   . ILE D 2 174 ? 72.762  35.212 75.056  1.00 25.10  ? 174 ILE B CD1   1 
ATOM   5000 N N     . ALA D 2 175 ? 72.247  39.093 72.658  1.00 29.64  ? 175 ALA B N     1 
ATOM   5001 C CA    . ALA D 2 175 ? 71.324  39.465 71.578  1.00 29.42  ? 175 ALA B CA    1 
ATOM   5002 C C     . ALA D 2 175 ? 71.833  40.722 70.867  1.00 26.86  ? 175 ALA B C     1 
ATOM   5003 O O     . ALA D 2 175 ? 71.563  40.946 69.686  1.00 26.11  ? 175 ALA B O     1 
ATOM   5004 C CB    . ALA D 2 175 ? 69.919  39.724 72.133  1.00 31.49  ? 175 ALA B CB    1 
ATOM   5005 N N     . GLU D 2 176 ? 72.571  41.547 71.596  1.00 24.27  ? 176 GLU B N     1 
ATOM   5006 C CA    . GLU D 2 176 ? 73.102  42.781 71.024  1.00 27.20  ? 176 GLU B CA    1 
ATOM   5007 C C     . GLU D 2 176 ? 74.248  42.462 70.099  1.00 31.76  ? 176 GLU B C     1 
ATOM   5008 O O     . GLU D 2 176 ? 74.523  43.182 69.142  1.00 39.45  ? 176 GLU B O     1 
ATOM   5009 C CB    . GLU D 2 176 ? 73.584  43.707 72.132  1.00 18.00  ? 176 GLU B CB    1 
ATOM   5010 C CG    . GLU D 2 176 ? 72.554  43.876 73.215  1.00 27.74  ? 176 GLU B CG    1 
ATOM   5011 C CD    . GLU D 2 176 ? 72.941  44.904 74.230  1.00 42.22  ? 176 GLU B CD    1 
ATOM   5012 O OE1   . GLU D 2 176 ? 74.128  45.298 74.243  1.00 43.00  ? 176 GLU B OE1   1 
ATOM   5013 O OE2   . GLU D 2 176 ? 72.050  45.309 75.009  1.00 55.68  ? 176 GLU B OE2   1 
ATOM   5014 N N     . ILE D 2 177 ? 74.915  41.364 70.403  1.00 36.91  ? 177 ILE B N     1 
ATOM   5015 C CA    . ILE D 2 177 ? 76.029  40.944 69.596  1.00 34.90  ? 177 ILE B CA    1 
ATOM   5016 C C     . ILE D 2 177 ? 75.475  40.316 68.328  1.00 28.34  ? 177 ILE B C     1 
ATOM   5017 O O     . ILE D 2 177 ? 75.887  40.666 67.225  1.00 35.86  ? 177 ILE B O     1 
ATOM   5018 C CB    . ILE D 2 177 ? 76.932  39.918 70.357  1.00 36.11  ? 177 ILE B CB    1 
ATOM   5019 C CG1   . ILE D 2 177 ? 77.580  40.585 71.580  1.00 30.42  ? 177 ILE B CG1   1 
ATOM   5020 C CG2   . ILE D 2 177 ? 78.033  39.403 69.429  1.00 42.96  ? 177 ILE B CG2   1 
ATOM   5021 C CD1   . ILE D 2 177 ? 78.000  39.603 72.637  1.00 21.95  ? 177 ILE B CD1   1 
ATOM   5022 N N     . ALA D 2 178 ? 74.505  39.426 68.482  1.00 15.01  ? 178 ALA B N     1 
ATOM   5023 C CA    . ALA D 2 178 ? 73.948  38.738 67.333  1.00 19.90  ? 178 ALA B CA    1 
ATOM   5024 C C     . ALA D 2 178 ? 73.348  39.651 66.251  1.00 25.71  ? 178 ALA B C     1 
ATOM   5025 O O     . ALA D 2 178 ? 73.056  39.193 65.140  1.00 31.11  ? 178 ALA B O     1 
ATOM   5026 C CB    . ALA D 2 178 ? 72.925  37.708 67.804  1.00 7.79   ? 178 ALA B CB    1 
ATOM   5027 N N     . ARG D 2 179 ? 73.200  40.936 66.564  1.00 29.12  ? 179 ARG B N     1 
ATOM   5028 C CA    . ARG D 2 179 ? 72.631  41.904 65.622  1.00 34.14  ? 179 ARG B CA    1 
ATOM   5029 C C     . ARG D 2 179 ? 73.664  42.790 64.926  1.00 40.11  ? 179 ARG B C     1 
ATOM   5030 O O     . ARG D 2 179 ? 73.314  43.608 64.075  1.00 48.72  ? 179 ARG B O     1 
ATOM   5031 C CB    . ARG D 2 179 ? 71.622  42.813 66.340  1.00 38.32  ? 179 ARG B CB    1 
ATOM   5032 C CG    . ARG D 2 179 ? 70.341  42.126 66.769  1.00 37.25  ? 179 ARG B CG    1 
ATOM   5033 C CD    . ARG D 2 179 ? 69.229  43.132 67.115  1.00 42.21  ? 179 ARG B CD    1 
ATOM   5034 N NE    . ARG D 2 179 ? 69.623  44.132 68.112  1.00 37.66  ? 179 ARG B NE    1 
ATOM   5035 C CZ    . ARG D 2 179 ? 69.339  44.069 69.414  1.00 36.23  ? 179 ARG B CZ    1 
ATOM   5036 N NH1   . ARG D 2 179 ? 68.649  43.046 69.907  1.00 30.12  ? 179 ARG B NH1   1 
ATOM   5037 N NH2   . ARG D 2 179 ? 69.761  45.027 70.232  1.00 22.60  ? 179 ARG B NH2   1 
ATOM   5038 N N     . ILE D 2 180 ? 74.929  42.650 65.298  1.00 41.47  ? 180 ILE B N     1 
ATOM   5039 C CA    . ILE D 2 180 ? 75.983  43.463 64.702  1.00 48.10  ? 180 ILE B CA    1 
ATOM   5040 C C     . ILE D 2 180 ? 76.096  43.301 63.195  1.00 58.25  ? 180 ILE B C     1 
ATOM   5041 O O     . ILE D 2 180 ? 76.536  42.258 62.700  1.00 67.13  ? 180 ILE B O     1 
ATOM   5042 C CB    . ILE D 2 180 ? 77.341  43.135 65.302  1.00 43.34  ? 180 ILE B CB    1 
ATOM   5043 C CG1   . ILE D 2 180 ? 77.458  43.807 66.657  1.00 38.00  ? 180 ILE B CG1   1 
ATOM   5044 C CG2   . ILE D 2 180 ? 78.457  43.610 64.388  1.00 42.06  ? 180 ILE B CG2   1 
ATOM   5045 C CD1   . ILE D 2 180 ? 78.181  42.961 67.648  1.00 49.44  ? 180 ILE B CD1   1 
ATOM   5046 N N     . ARG D 2 181 ? 75.699  44.336 62.462  1.00 61.26  ? 181 ARG B N     1 
ATOM   5047 C CA    . ARG D 2 181 ? 75.791  44.276 61.017  1.00 51.76  ? 181 ARG B CA    1 
ATOM   5048 C C     . ARG D 2 181 ? 77.208  44.486 60.519  1.00 43.64  ? 181 ARG B C     1 
ATOM   5049 O O     . ARG D 2 181 ? 77.995  45.254 61.088  1.00 38.79  ? 181 ARG B O     1 
ATOM   5050 C CB    . ARG D 2 181 ? 74.793  45.243 60.342  1.00 56.26  ? 181 ARG B CB    1 
ATOM   5051 C CG    . ARG D 2 181 ? 73.311  44.813 60.524  1.00 54.86  ? 181 ARG B CG    1 
ATOM   5052 C CD    . ARG D 2 181 ? 72.387  45.359 59.433  1.00 53.74  ? 181 ARG B CD    1 
ATOM   5053 N NE    . ARG D 2 181 ? 71.018  44.833 59.492  1.00 51.08  ? 181 ARG B NE    1 
ATOM   5054 C CZ    . ARG D 2 181 ? 70.639  43.637 59.037  1.00 56.03  ? 181 ARG B CZ    1 
ATOM   5055 N NH1   . ARG D 2 181 ? 71.518  42.824 58.482  1.00 54.97  ? 181 ARG B NH1   1 
ATOM   5056 N NH2   . ARG D 2 181 ? 69.365  43.259 59.115  1.00 55.32  ? 181 ARG B NH2   1 
ATOM   5057 N N     . VAL D 2 182 ? 77.558  43.738 59.483  1.00 35.18  ? 182 VAL B N     1 
ATOM   5058 C CA    . VAL D 2 182 ? 78.885  43.855 58.922  1.00 32.90  ? 182 VAL B CA    1 
ATOM   5059 C C     . VAL D 2 182 ? 79.026  45.335 58.596  1.00 36.75  ? 182 VAL B C     1 
ATOM   5060 O O     . VAL D 2 182 ? 80.113  45.909 58.668  1.00 34.61  ? 182 VAL B O     1 
ATOM   5061 C CB    . VAL D 2 182 ? 79.007  42.996 57.649  1.00 33.31  ? 182 VAL B CB    1 
ATOM   5062 C CG1   . VAL D 2 182 ? 80.337  43.244 56.979  1.00 34.43  ? 182 VAL B CG1   1 
ATOM   5063 C CG2   . VAL D 2 182 ? 78.874  41.516 57.996  1.00 24.64  ? 182 VAL B CG2   1 
ATOM   5064 N N     . LYS D 2 183 ? 77.900  45.953 58.257  1.00 38.84  ? 183 LYS B N     1 
ATOM   5065 C CA    . LYS D 2 183 ? 77.869  47.370 57.931  1.00 39.71  ? 183 LYS B CA    1 
ATOM   5066 C C     . LYS D 2 183 ? 78.160  48.180 59.182  1.00 45.39  ? 183 LYS B C     1 
ATOM   5067 O O     . LYS D 2 183 ? 78.678  49.293 59.110  1.00 48.80  ? 183 LYS B O     1 
ATOM   5068 C CB    . LYS D 2 183 ? 76.496  47.749 57.364  1.00 46.32  ? 183 LYS B CB    1 
ATOM   5069 C CG    . LYS D 2 183 ? 75.363  47.790 58.390  1.00 51.70  ? 183 LYS B CG    1 
ATOM   5070 C CD    . LYS D 2 183 ? 74.034  47.356 57.790  1.00 53.79  ? 183 LYS B CD    1 
ATOM   5071 C CE    . LYS D 2 183 ? 73.547  48.347 56.760  1.00 57.83  ? 183 LYS B CE    1 
ATOM   5072 N NZ    . LYS D 2 183 ? 72.140  48.768 56.999  1.00 54.90  ? 183 LYS B NZ    1 
ATOM   5073 N N     . ASP D 2 184 ? 77.824  47.610 60.335  1.00 53.65  ? 184 ASP B N     1 
ATOM   5074 C CA    . ASP D 2 184 ? 78.034  48.277 61.619  1.00 52.31  ? 184 ASP B CA    1 
ATOM   5075 C C     . ASP D 2 184 ? 79.492  48.396 61.979  1.00 46.47  ? 184 ASP B C     1 
ATOM   5076 O O     . ASP D 2 184 ? 79.871  49.260 62.763  1.00 44.63  ? 184 ASP B O     1 
ATOM   5077 C CB    . ASP D 2 184 ? 77.315  47.532 62.739  1.00 54.24  ? 184 ASP B CB    1 
ATOM   5078 C CG    . ASP D 2 184 ? 75.826  47.820 62.766  1.00 60.14  ? 184 ASP B CG    1 
ATOM   5079 O OD1   . ASP D 2 184 ? 75.448  48.930 63.188  1.00 75.28  ? 184 ASP B OD1   1 
ATOM   5080 O OD2   . ASP D 2 184 ? 75.026  46.953 62.366  1.00 43.78  ? 184 ASP B OD2   1 
ATOM   5081 N N     . ILE D 2 185 ? 80.303  47.517 61.402  1.00 47.28  ? 185 ILE B N     1 
ATOM   5082 C CA    . ILE D 2 185 ? 81.735  47.505 61.663  1.00 51.46  ? 185 ILE B CA    1 
ATOM   5083 C C     . ILE D 2 185 ? 82.437  48.719 61.064  1.00 49.08  ? 185 ILE B C     1 
ATOM   5084 O O     . ILE D 2 185 ? 82.193  49.092 59.919  1.00 52.93  ? 185 ILE B O     1 
ATOM   5085 C CB    . ILE D 2 185 ? 82.398  46.225 61.112  1.00 53.16  ? 185 ILE B CB    1 
ATOM   5086 C CG1   . ILE D 2 185 ? 81.631  44.986 61.593  1.00 46.83  ? 185 ILE B CG1   1 
ATOM   5087 C CG2   . ILE D 2 185 ? 83.857  46.192 61.545  1.00 53.87  ? 185 ILE B CG2   1 
ATOM   5088 C CD1   . ILE D 2 185 ? 82.393  43.694 61.481  1.00 38.68  ? 185 ILE B CD1   1 
ATOM   5089 N N     . SER D 2 186 ? 83.314  49.328 61.853  1.00 49.09  ? 186 SER B N     1 
ATOM   5090 C CA    . SER D 2 186 ? 84.051  50.512 61.434  1.00 55.47  ? 186 SER B CA    1 
ATOM   5091 C C     . SER D 2 186 ? 85.397  50.539 62.164  1.00 61.63  ? 186 SER B C     1 
ATOM   5092 O O     . SER D 2 186 ? 85.454  50.248 63.351  1.00 69.58  ? 186 SER B O     1 
ATOM   5093 C CB    . SER D 2 186 ? 83.250  51.762 61.795  1.00 54.35  ? 186 SER B CB    1 
ATOM   5094 O OG    . SER D 2 186 ? 83.354  52.745 60.789  1.00 80.94  ? 186 SER B OG    1 
ATOM   5095 N N     . ARG D 2 187 ? 86.478  50.883 61.466  1.00 61.42  ? 187 ARG B N     1 
ATOM   5096 C CA    . ARG D 2 187 ? 87.803  50.927 62.094  1.00 59.05  ? 187 ARG B CA    1 
ATOM   5097 C C     . ARG D 2 187 ? 88.178  52.369 62.425  1.00 60.80  ? 187 ARG B C     1 
ATOM   5098 O O     . ARG D 2 187 ? 87.745  53.300 61.739  1.00 65.90  ? 187 ARG B O     1 
ATOM   5099 C CB    . ARG D 2 187 ? 88.881  50.329 61.168  1.00 57.56  ? 187 ARG B CB    1 
ATOM   5100 C CG    . ARG D 2 187 ? 88.875  48.805 61.035  1.00 63.27  ? 187 ARG B CG    1 
ATOM   5101 C CD    . ARG D 2 187 ? 89.165  48.395 59.593  1.00 70.58  ? 187 ARG B CD    1 
ATOM   5102 N NE    . ARG D 2 187 ? 88.348  47.269 59.142  1.00 83.14  ? 187 ARG B NE    1 
ATOM   5103 C CZ    . ARG D 2 187 ? 87.258  47.383 58.385  1.00 86.24  ? 187 ARG B CZ    1 
ATOM   5104 N NH1   . ARG D 2 187 ? 86.847  48.571 57.957  1.00 80.39  ? 187 ARG B NH1   1 
ATOM   5105 N NH2   . ARG D 2 187 ? 86.577  46.297 58.046  1.00 83.70  ? 187 ARG B NH2   1 
ATOM   5106 N N     . THR D 2 188 ? 88.971  52.546 63.482  1.00 55.50  ? 188 THR B N     1 
ATOM   5107 C CA    . THR D 2 188 ? 89.425  53.869 63.898  1.00 56.95  ? 188 THR B CA    1 
ATOM   5108 C C     . THR D 2 188 ? 90.598  54.217 62.993  1.00 68.03  ? 188 THR B C     1 
ATOM   5109 O O     . THR D 2 188 ? 90.971  53.413 62.142  1.00 72.76  ? 188 THR B O     1 
ATOM   5110 C CB    . THR D 2 188 ? 89.906  53.855 65.351  1.00 57.43  ? 188 THR B CB    1 
ATOM   5111 O OG1   . THR D 2 188 ? 91.087  53.053 65.454  1.00 60.53  ? 188 THR B OG1   1 
ATOM   5112 C CG2   . THR D 2 188 ? 88.841  53.274 66.261  1.00 61.18  ? 188 THR B CG2   1 
ATOM   5113 N N     . ASP D 2 189 ? 91.190  55.398 63.163  1.00 78.83  ? 189 ASP B N     1 
ATOM   5114 C CA    . ASP D 2 189 ? 92.328  55.777 62.322  1.00 85.01  ? 189 ASP B CA    1 
ATOM   5115 C C     . ASP D 2 189 ? 93.602  55.149 62.882  1.00 84.71  ? 189 ASP B C     1 
ATOM   5116 O O     . ASP D 2 189 ? 94.654  55.166 62.239  1.00 91.35  ? 189 ASP B O     1 
ATOM   5117 C CB    . ASP D 2 189 ? 92.478  57.300 62.252  1.00 92.77  ? 189 ASP B CB    1 
ATOM   5118 C CG    . ASP D 2 189 ? 91.523  57.936 61.256  1.00 97.50  ? 189 ASP B CG    1 
ATOM   5119 O OD1   . ASP D 2 189 ? 91.491  57.486 60.086  1.00 99.17  ? 189 ASP B OD1   1 
ATOM   5120 O OD2   . ASP D 2 189 ? 90.805  58.882 61.653  1.00 95.66  ? 189 ASP B OD2   1 
ATOM   5121 N N     . GLY D 2 190 ? 93.484  54.609 64.094  1.00 79.02  ? 190 GLY B N     1 
ATOM   5122 C CA    . GLY D 2 190 ? 94.594  53.946 64.749  1.00 64.46  ? 190 GLY B CA    1 
ATOM   5123 C C     . GLY D 2 190 ? 94.572  52.466 64.408  1.00 62.05  ? 190 GLY B C     1 
ATOM   5124 O O     . GLY D 2 190 ? 95.494  51.733 64.771  1.00 61.76  ? 190 GLY B O     1 
ATOM   5125 N N     . GLY D 2 191 ? 93.503  52.023 63.738  1.00 61.55  ? 191 GLY B N     1 
ATOM   5126 C CA    . GLY D 2 191 ? 93.390  50.626 63.326  1.00 60.55  ? 191 GLY B CA    1 
ATOM   5127 C C     . GLY D 2 191 ? 92.254  49.811 63.937  1.00 55.88  ? 191 GLY B C     1 
ATOM   5128 O O     . GLY D 2 191 ? 91.581  49.042 63.237  1.00 56.38  ? 191 GLY B O     1 
ATOM   5129 N N     . ARG D 2 192 ? 92.078  49.972 65.247  1.00 46.92  ? 192 ARG B N     1 
ATOM   5130 C CA    . ARG D 2 192 ? 91.060  49.294 66.033  1.00 39.44  ? 192 ARG B CA    1 
ATOM   5131 C C     . ARG D 2 192 ? 89.680  49.299 65.401  1.00 43.07  ? 192 ARG B C     1 
ATOM   5132 O O     . ARG D 2 192 ? 89.251  50.299 64.827  1.00 39.90  ? 192 ARG B O     1 
ATOM   5133 C CB    . ARG D 2 192 ? 90.958  49.948 67.399  1.00 29.29  ? 192 ARG B CB    1 
ATOM   5134 C CG    . ARG D 2 192 ? 92.155  49.754 68.253  1.00 22.96  ? 192 ARG B CG    1 
ATOM   5135 C CD    . ARG D 2 192 ? 92.245  50.875 69.228  1.00 36.57  ? 192 ARG B CD    1 
ATOM   5136 N NE    . ARG D 2 192 ? 93.490  51.583 69.026  1.00 54.45  ? 192 ARG B NE    1 
ATOM   5137 C CZ    . ARG D 2 192 ? 94.642  51.233 69.584  1.00 63.41  ? 192 ARG B CZ    1 
ATOM   5138 N NH1   . ARG D 2 192 ? 94.707  50.172 70.386  1.00 70.57  ? 192 ARG B NH1   1 
ATOM   5139 N NH2   . ARG D 2 192 ? 95.732  51.940 69.324  1.00 71.72  ? 192 ARG B NH2   1 
ATOM   5140 N N     . MET D 2 193 ? 88.974  48.185 65.531  1.00 37.02  ? 193 MET B N     1 
ATOM   5141 C CA    . MET D 2 193 ? 87.649  48.106 64.971  1.00 34.53  ? 193 MET B CA    1 
ATOM   5142 C C     . MET D 2 193 ? 86.678  48.817 65.880  1.00 32.80  ? 193 MET B C     1 
ATOM   5143 O O     . MET D 2 193 ? 86.982  49.138 67.023  1.00 29.95  ? 193 MET B O     1 
ATOM   5144 C CB    . MET D 2 193 ? 87.223  46.660 64.809  1.00 31.68  ? 193 MET B CB    1 
ATOM   5145 C CG    . MET D 2 193 ? 87.361  46.152 63.391  1.00 43.96  ? 193 MET B CG    1 
ATOM   5146 S SD    . MET D 2 193 ? 86.632  44.512 63.186  1.00 58.40  ? 193 MET B SD    1 
ATOM   5147 C CE    . MET D 2 193 ? 88.045  43.537 62.749  1.00 60.99  ? 193 MET B CE    1 
ATOM   5148 N N     . LEU D 2 194 ? 85.487  49.043 65.362  1.00 37.35  ? 194 LEU B N     1 
ATOM   5149 C CA    . LEU D 2 194 ? 84.451  49.721 66.111  1.00 37.92  ? 194 LEU B CA    1 
ATOM   5150 C C     . LEU D 2 194 ? 83.121  49.167 65.669  1.00 40.49  ? 194 LEU B C     1 
ATOM   5151 O O     . LEU D 2 194 ? 82.866  48.980 64.486  1.00 42.22  ? 194 LEU B O     1 
ATOM   5152 C CB    . LEU D 2 194 ? 84.487  51.209 65.842  1.00 37.05  ? 194 LEU B CB    1 
ATOM   5153 C CG    . LEU D 2 194 ? 85.060  52.030 66.977  1.00 41.24  ? 194 LEU B CG    1 
ATOM   5154 C CD1   . LEU D 2 194 ? 85.659  53.316 66.422  1.00 28.38  ? 194 LEU B CD1   1 
ATOM   5155 C CD2   . LEU D 2 194 ? 83.955  52.310 67.977  1.00 47.23  ? 194 LEU B CD2   1 
ATOM   5156 N N     . ILE D 2 195 ? 82.273  48.878 66.632  1.00 42.69  ? 195 ILE B N     1 
ATOM   5157 C CA    . ILE D 2 195 ? 80.972  48.340 66.306  1.00 41.79  ? 195 ILE B CA    1 
ATOM   5158 C C     . ILE D 2 195 ? 79.913  49.342 66.729  1.00 45.26  ? 195 ILE B C     1 
ATOM   5159 O O     . ILE D 2 195 ? 79.974  49.883 67.834  1.00 47.01  ? 195 ILE B O     1 
ATOM   5160 C CB    . ILE D 2 195 ? 80.776  47.014 67.042  1.00 44.71  ? 195 ILE B CB    1 
ATOM   5161 C CG1   . ILE D 2 195 ? 82.049  46.170 66.879  1.00 46.60  ? 195 ILE B CG1   1 
ATOM   5162 C CG2   . ILE D 2 195 ? 79.522  46.318 66.548  1.00 44.55  ? 195 ILE B CG2   1 
ATOM   5163 C CD1   . ILE D 2 195 ? 81.872  44.679 67.136  1.00 59.35  ? 195 ILE B CD1   1 
ATOM   5164 N N     . HIS D 2 196 ? 78.964  49.631 65.845  1.00 48.62  ? 196 HIS B N     1 
ATOM   5165 C CA    . HIS D 2 196 ? 77.920  50.574 66.221  1.00 52.07  ? 196 HIS B CA    1 
ATOM   5166 C C     . HIS D 2 196 ? 76.699  49.822 66.686  1.00 53.29  ? 196 HIS B C     1 
ATOM   5167 O O     . HIS D 2 196 ? 76.275  48.830 66.071  1.00 49.30  ? 196 HIS B O     1 
ATOM   5168 C CB    . HIS D 2 196 ? 77.504  51.490 65.073  1.00 61.60  ? 196 HIS B CB    1 
ATOM   5169 C CG    . HIS D 2 196 ? 76.331  52.368 65.402  1.00 64.69  ? 196 HIS B CG    1 
ATOM   5170 N ND1   . HIS D 2 196 ? 75.031  52.017 65.100  1.00 61.54  ? 196 HIS B ND1   1 
ATOM   5171 C CD2   . HIS D 2 196 ? 76.263  53.579 66.006  1.00 63.13  ? 196 HIS B CD2   1 
ATOM   5172 C CE1   . HIS D 2 196 ? 74.213  52.975 65.503  1.00 64.37  ? 196 HIS B CE1   1 
ATOM   5173 N NE2   . HIS D 2 196 ? 74.935  53.932 66.056  1.00 64.80  ? 196 HIS B NE2   1 
ATOM   5174 N N     . ILE D 2 197 ? 76.122  50.311 67.770  1.00 47.71  ? 197 ILE B N     1 
ATOM   5175 C CA    . ILE D 2 197 ? 74.948  49.682 68.319  1.00 49.14  ? 197 ILE B CA    1 
ATOM   5176 C C     . ILE D 2 197 ? 73.856  50.704 68.556  1.00 51.33  ? 197 ILE B C     1 
ATOM   5177 O O     . ILE D 2 197 ? 74.062  51.706 69.246  1.00 59.11  ? 197 ILE B O     1 
ATOM   5178 C CB    . ILE D 2 197 ? 75.294  48.959 69.624  1.00 44.59  ? 197 ILE B CB    1 
ATOM   5179 C CG1   . ILE D 2 197 ? 76.316  47.863 69.332  1.00 34.56  ? 197 ILE B CG1   1 
ATOM   5180 C CG2   . ILE D 2 197 ? 74.049  48.340 70.241  1.00 49.27  ? 197 ILE B CG2   1 
ATOM   5181 C CD1   . ILE D 2 197 ? 77.692  48.167 69.871  1.00 58.74  ? 197 ILE B CD1   1 
ATOM   5182 N N     . GLY D 2 198 ? 72.698  50.440 67.954  1.00 54.62  ? 198 GLY B N     1 
ATOM   5183 C CA    . GLY D 2 198 ? 71.553  51.320 68.095  1.00 54.91  ? 198 GLY B CA    1 
ATOM   5184 C C     . GLY D 2 198 ? 70.568  50.758 69.094  1.00 49.76  ? 198 GLY B C     1 
ATOM   5185 O O     . GLY D 2 198 ? 70.193  51.424 70.055  1.00 54.38  ? 198 GLY B O     1 
ATOM   5186 N N     . ARG D 2 199 ? 70.149  49.520 68.880  1.00 47.42  ? 199 ARG B N     1 
ATOM   5187 C CA    . ARG D 2 199 ? 69.200  48.899 69.787  1.00 56.02  ? 199 ARG B CA    1 
ATOM   5188 C C     . ARG D 2 199 ? 69.910  48.099 70.858  1.00 58.76  ? 199 ARG B C     1 
ATOM   5189 O O     . ARG D 2 199 ? 70.970  47.530 70.620  1.00 66.54  ? 199 ARG B O     1 
ATOM   5190 C CB    . ARG D 2 199 ? 68.250  47.976 69.027  1.00 59.53  ? 199 ARG B CB    1 
ATOM   5191 C CG    . ARG D 2 199 ? 67.392  47.102 69.934  1.00 58.98  ? 199 ARG B CG    1 
ATOM   5192 C CD    . ARG D 2 199 ? 66.016  46.876 69.341  1.00 76.83  ? 199 ARG B CD    1 
ATOM   5193 N NE    . ARG D 2 199 ? 66.018  45.831 68.319  1.00 83.31  ? 199 ARG B NE    1 
ATOM   5194 C CZ    . ARG D 2 199 ? 65.456  44.638 68.481  1.00 83.42  ? 199 ARG B CZ    1 
ATOM   5195 N NH1   . ARG D 2 199 ? 64.851  44.347 69.624  1.00 85.48  ? 199 ARG B NH1   1 
ATOM   5196 N NH2   . ARG D 2 199 ? 65.482  43.747 67.503  1.00 83.36  ? 199 ARG B NH2   1 
ATOM   5197 N N     . THR D 2 200 ? 69.328  48.074 72.048  1.00 56.26  ? 200 THR B N     1 
ATOM   5198 C CA    . THR D 2 200 ? 69.892  47.317 73.154  1.00 58.91  ? 200 THR B CA    1 
ATOM   5199 C C     . THR D 2 200 ? 68.863  47.257 74.264  1.00 65.15  ? 200 THR B C     1 
ATOM   5200 O O     . THR D 2 200 ? 68.127  48.217 74.470  1.00 74.22  ? 200 THR B O     1 
ATOM   5201 C CB    . THR D 2 200 ? 71.185  47.970 73.715  1.00 48.71  ? 200 THR B CB    1 
ATOM   5202 O OG1   . THR D 2 200 ? 70.952  48.418 75.055  1.00 49.13  ? 200 THR B OG1   1 
ATOM   5203 C CG2   . THR D 2 200 ? 71.613  49.159 72.872  1.00 54.28  ? 200 THR B CG2   1 
ATOM   5204 N N     . LYS D 2 201 ? 68.808  46.133 74.972  1.00 66.13  ? 201 LYS B N     1 
ATOM   5205 C CA    . LYS D 2 201 ? 67.865  45.975 76.079  1.00 66.18  ? 201 LYS B CA    1 
ATOM   5206 C C     . LYS D 2 201 ? 67.441  47.308 76.694  1.00 68.69  ? 201 LYS B C     1 
ATOM   5207 O O     . LYS D 2 201 ? 66.278  47.699 76.592  1.00 76.63  ? 201 LYS B O     1 
ATOM   5208 C CB    . LYS D 2 201 ? 68.476  45.109 77.189  1.00 59.21  ? 201 LYS B CB    1 
ATOM   5209 C CG    . LYS D 2 201 ? 67.940  45.425 78.584  1.00 40.06  ? 201 LYS B CG    1 
ATOM   5210 C CD    . LYS D 2 201 ? 67.510  44.190 79.349  1.00 28.03  ? 201 LYS B CD    1 
ATOM   5211 C CE    . LYS D 2 201 ? 67.868  44.319 80.814  1.00 32.88  ? 201 LYS B CE    1 
ATOM   5212 N NZ    . LYS D 2 201 ? 67.617  43.071 81.579  1.00 47.35  ? 201 LYS B NZ    1 
ATOM   5213 N N     . THR D 2 202 ? 68.393  48.007 77.310  1.00 67.33  ? 202 THR B N     1 
ATOM   5214 C CA    . THR D 2 202 ? 68.118  49.274 77.985  1.00 71.96  ? 202 THR B CA    1 
ATOM   5215 C C     . THR D 2 202 ? 68.031  50.533 77.119  1.00 75.28  ? 202 THR B C     1 
ATOM   5216 O O     . THR D 2 202 ? 67.494  51.554 77.565  1.00 77.54  ? 202 THR B O     1 
ATOM   5217 C CB    . THR D 2 202 ? 69.167  49.538 79.103  1.00 73.52  ? 202 THR B CB    1 
ATOM   5218 O OG1   . THR D 2 202 ? 70.360  50.079 78.525  1.00 81.51  ? 202 THR B OG1   1 
ATOM   5219 C CG2   . THR D 2 202 ? 69.509  48.253 79.834  1.00 69.73  ? 202 THR B CG2   1 
ATOM   5220 N N     . LEU D 2 203 ? 68.538  50.466 75.891  1.00 74.00  ? 203 LEU B N     1 
ATOM   5221 C CA    . LEU D 2 203 ? 68.532  51.636 75.018  1.00 75.83  ? 203 LEU B CA    1 
ATOM   5222 C C     . LEU D 2 203 ? 68.032  51.406 73.596  1.00 81.45  ? 203 LEU B C     1 
ATOM   5223 O O     . LEU D 2 203 ? 68.595  50.603 72.850  1.00 89.36  ? 203 LEU B O     1 
ATOM   5224 C CB    . LEU D 2 203 ? 69.942  52.229 74.960  1.00 68.51  ? 203 LEU B CB    1 
ATOM   5225 C CG    . LEU D 2 203 ? 70.271  53.200 73.830  1.00 62.39  ? 203 LEU B CG    1 
ATOM   5226 C CD1   . LEU D 2 203 ? 70.093  54.612 74.340  1.00 61.48  ? 203 LEU B CD1   1 
ATOM   5227 C CD2   . LEU D 2 203 ? 71.694  52.980 73.344  1.00 54.33  ? 203 LEU B CD2   1 
ATOM   5228 N N     . VAL D 2 204 ? 66.969  52.115 73.225  1.00 85.54  ? 204 VAL B N     1 
ATOM   5229 C CA    . VAL D 2 204 ? 66.422  52.025 71.870  1.00 87.93  ? 204 VAL B CA    1 
ATOM   5230 C C     . VAL D 2 204 ? 66.709  53.381 71.222  1.00 85.76  ? 204 VAL B C     1 
ATOM   5231 O O     . VAL D 2 204 ? 65.884  54.295 71.275  1.00 81.86  ? 204 VAL B O     1 
ATOM   5232 C CB    . VAL D 2 204 ? 64.885  51.765 71.861  1.00 85.57  ? 204 VAL B CB    1 
ATOM   5233 C CG1   . VAL D 2 204 ? 64.604  50.268 71.838  1.00 77.78  ? 204 VAL B CG1   1 
ATOM   5234 C CG2   . VAL D 2 204 ? 64.237  52.416 73.071  1.00 93.31  ? 204 VAL B CG2   1 
ATOM   5235 N N     . SER D 2 205 ? 67.889  53.507 70.620  1.00 85.90  ? 205 SER B N     1 
ATOM   5236 C CA    . SER D 2 205 ? 68.286  54.764 69.997  1.00 87.76  ? 205 SER B CA    1 
ATOM   5237 C C     . SER D 2 205 ? 68.802  54.682 68.559  1.00 85.14  ? 205 SER B C     1 
ATOM   5238 O O     . SER D 2 205 ? 69.390  53.678 68.136  1.00 82.31  ? 205 SER B O     1 
ATOM   5239 C CB    . SER D 2 205 ? 69.338  55.464 70.865  1.00 95.76  ? 205 SER B CB    1 
ATOM   5240 O OG    . SER D 2 205 ? 70.470  54.641 71.082  1.00 98.73  ? 205 SER B OG    1 
ATOM   5241 N N     . THR D 2 206 ? 68.574  55.776 67.830  1.00 81.90  ? 206 THR B N     1 
ATOM   5242 C CA    . THR D 2 206 ? 68.984  55.931 66.439  1.00 78.98  ? 206 THR B CA    1 
ATOM   5243 C C     . THR D 2 206 ? 70.402  56.480 66.414  1.00 74.74  ? 206 THR B C     1 
ATOM   5244 O O     . THR D 2 206 ? 71.023  56.614 65.360  1.00 77.18  ? 206 THR B O     1 
ATOM   5245 C CB    . THR D 2 206 ? 68.078  56.922 65.707  1.00 76.45  ? 206 THR B CB    1 
ATOM   5246 O OG1   . THR D 2 206 ? 68.132  58.191 66.369  1.00 71.56  ? 206 THR B OG1   1 
ATOM   5247 C CG2   . THR D 2 206 ? 66.646  56.420 65.696  1.00 75.81  ? 206 THR B CG2   1 
ATOM   5248 N N     . ALA D 2 207 ? 70.896  56.821 67.595  1.00 70.02  ? 207 ALA B N     1 
ATOM   5249 C CA    . ALA D 2 207 ? 72.245  57.322 67.740  1.00 67.38  ? 207 ALA B CA    1 
ATOM   5250 C C     . ALA D 2 207 ? 73.029  56.182 68.385  1.00 72.14  ? 207 ALA B C     1 
ATOM   5251 O O     . ALA D 2 207 ? 74.133  55.846 67.941  1.00 73.62  ? 207 ALA B O     1 
ATOM   5252 C CB    . ALA D 2 207 ? 72.251  58.534 68.629  1.00 51.70  ? 207 ALA B CB    1 
ATOM   5253 N N     . GLY D 2 208 ? 72.434  55.576 69.418  1.00 69.21  ? 208 GLY B N     1 
ATOM   5254 C CA    . GLY D 2 208 ? 73.073  54.475 70.124  1.00 65.06  ? 208 GLY B CA    1 
ATOM   5255 C C     . GLY D 2 208 ? 74.511  54.759 70.508  1.00 68.98  ? 208 GLY B C     1 
ATOM   5256 O O     . GLY D 2 208 ? 74.889  55.921 70.678  1.00 74.40  ? 208 GLY B O     1 
ATOM   5257 N N     . VAL D 2 209 ? 75.308  53.704 70.664  1.00 64.06  ? 209 VAL B N     1 
ATOM   5258 C CA    . VAL D 2 209 ? 76.723  53.854 71.009  1.00 59.50  ? 209 VAL B CA    1 
ATOM   5259 C C     . VAL D 2 209 ? 77.611  52.960 70.155  1.00 56.03  ? 209 VAL B C     1 
ATOM   5260 O O     . VAL D 2 209 ? 77.132  52.015 69.525  1.00 59.50  ? 209 VAL B O     1 
ATOM   5261 C CB    . VAL D 2 209 ? 77.001  53.488 72.470  1.00 57.91  ? 209 VAL B CB    1 
ATOM   5262 C CG1   . VAL D 2 209 ? 75.969  54.137 73.382  1.00 62.01  ? 209 VAL B CG1   1 
ATOM   5263 C CG2   . VAL D 2 209 ? 77.008  51.973 72.618  1.00 55.21  ? 209 VAL B CG2   1 
ATOM   5264 N N     . GLU D 2 210 ? 78.905  53.271 70.144  1.00 52.00  ? 210 GLU B N     1 
ATOM   5265 C CA    . GLU D 2 210 ? 79.885  52.493 69.396  1.00 51.57  ? 210 GLU B CA    1 
ATOM   5266 C C     . GLU D 2 210 ? 80.913  51.937 70.354  1.00 46.94  ? 210 GLU B C     1 
ATOM   5267 O O     . GLU D 2 210 ? 81.363  52.621 71.276  1.00 48.06  ? 210 GLU B O     1 
ATOM   5268 C CB    . GLU D 2 210 ? 80.611  53.353 68.369  1.00 57.05  ? 210 GLU B CB    1 
ATOM   5269 C CG    . GLU D 2 210 ? 79.773  54.452 67.792  1.00 68.19  ? 210 GLU B CG    1 
ATOM   5270 C CD    . GLU D 2 210 ? 80.099  54.706 66.349  1.00 66.77  ? 210 GLU B CD    1 
ATOM   5271 O OE1   . GLU D 2 210 ? 80.419  55.868 66.019  1.00 71.15  ? 210 GLU B OE1   1 
ATOM   5272 O OE2   . GLU D 2 210 ? 80.035  53.743 65.555  1.00 51.64  ? 210 GLU B OE2   1 
ATOM   5273 N N     . LYS D 2 211 ? 81.311  50.699 70.119  1.00 40.37  ? 211 LYS B N     1 
ATOM   5274 C CA    . LYS D 2 211 ? 82.283  50.086 70.987  1.00 38.47  ? 211 LYS B CA    1 
ATOM   5275 C C     . LYS D 2 211 ? 83.583  49.830 70.245  1.00 39.03  ? 211 LYS B C     1 
ATOM   5276 O O     . LYS D 2 211 ? 83.585  49.229 69.160  1.00 31.24  ? 211 LYS B O     1 
ATOM   5277 C CB    . LYS D 2 211 ? 81.706  48.785 71.547  1.00 39.68  ? 211 LYS B CB    1 
ATOM   5278 C CG    . LYS D 2 211 ? 80.218  48.887 71.838  1.00 32.92  ? 211 LYS B CG    1 
ATOM   5279 C CD    . LYS D 2 211 ? 79.892  48.631 73.298  1.00 40.16  ? 211 LYS B CD    1 
ATOM   5280 C CE    . LYS D 2 211 ? 80.510  49.679 74.203  1.00 40.31  ? 211 LYS B CE    1 
ATOM   5281 N NZ    . LYS D 2 211 ? 80.373  49.295 75.635  1.00 45.33  ? 211 LYS B NZ    1 
ATOM   5282 N N     . ALA D 2 212 ? 84.677  50.312 70.832  1.00 35.25  ? 212 ALA B N     1 
ATOM   5283 C CA    . ALA D 2 212 ? 86.000  50.122 70.263  1.00 34.35  ? 212 ALA B CA    1 
ATOM   5284 C C     . ALA D 2 212 ? 86.571  48.772 70.711  1.00 37.83  ? 212 ALA B C     1 
ATOM   5285 O O     . ALA D 2 212 ? 86.374  48.354 71.859  1.00 47.19  ? 212 ALA B O     1 
ATOM   5286 C CB    . ALA D 2 212 ? 86.908  51.245 70.716  1.00 33.81  ? 212 ALA B CB    1 
ATOM   5287 N N     . LEU D 2 213 ? 87.250  48.090 69.792  1.00 36.21  ? 213 LEU B N     1 
ATOM   5288 C CA    . LEU D 2 213 ? 87.879  46.807 70.079  1.00 32.70  ? 213 LEU B CA    1 
ATOM   5289 C C     . LEU D 2 213 ? 89.369  47.002 70.261  1.00 26.67  ? 213 LEU B C     1 
ATOM   5290 O O     . LEU D 2 213 ? 89.967  47.849 69.616  1.00 37.12  ? 213 LEU B O     1 
ATOM   5291 C CB    . LEU D 2 213 ? 87.639  45.823 68.927  1.00 22.20  ? 213 LEU B CB    1 
ATOM   5292 C CG    . LEU D 2 213 ? 86.155  45.576 68.630  1.00 27.76  ? 213 LEU B CG    1 
ATOM   5293 C CD1   . LEU D 2 213 ? 85.976  44.451 67.624  1.00 15.00  ? 213 LEU B CD1   1 
ATOM   5294 C CD2   . LEU D 2 213 ? 85.444  45.236 69.931  1.00 30.88  ? 213 LEU B CD2   1 
ATOM   5295 N N     . SER D 2 214 ? 89.970  46.222 71.147  1.00 29.41  ? 214 SER B N     1 
ATOM   5296 C CA    . SER D 2 214 ? 91.412  46.306 71.375  1.00 27.33  ? 214 SER B CA    1 
ATOM   5297 C C     . SER D 2 214 ? 92.106  45.886 70.096  1.00 34.98  ? 214 SER B C     1 
ATOM   5298 O O     . SER D 2 214 ? 91.560  45.078 69.344  1.00 38.08  ? 214 SER B O     1 
ATOM   5299 C CB    . SER D 2 214 ? 91.829  45.342 72.475  1.00 26.21  ? 214 SER B CB    1 
ATOM   5300 O OG    . SER D 2 214 ? 91.829  44.006 71.986  1.00 21.13  ? 214 SER B OG    1 
ATOM   5301 N N     . LEU D 2 215 ? 93.297  46.418 69.838  1.00 38.74  ? 215 LEU B N     1 
ATOM   5302 C CA    . LEU D 2 215 ? 94.014  46.047 68.617  1.00 35.27  ? 215 LEU B CA    1 
ATOM   5303 C C     . LEU D 2 215 ? 93.996  44.524 68.378  1.00 37.92  ? 215 LEU B C     1 
ATOM   5304 O O     . LEU D 2 215 ? 93.782  44.063 67.251  1.00 36.72  ? 215 LEU B O     1 
ATOM   5305 C CB    . LEU D 2 215 ? 95.453  46.553 68.684  1.00 26.66  ? 215 LEU B CB    1 
ATOM   5306 C CG    . LEU D 2 215 ? 95.609  47.965 68.124  1.00 35.06  ? 215 LEU B CG    1 
ATOM   5307 C CD1   . LEU D 2 215 ? 97.069  48.343 68.034  1.00 36.75  ? 215 LEU B CD1   1 
ATOM   5308 C CD2   . LEU D 2 215 ? 94.949  48.047 66.759  1.00 34.01  ? 215 LEU B CD2   1 
ATOM   5309 N N     . GLY D 2 216 ? 94.202  43.749 69.441  1.00 37.54  ? 216 GLY B N     1 
ATOM   5310 C CA    . GLY D 2 216 ? 94.195  42.300 69.320  1.00 38.22  ? 216 GLY B CA    1 
ATOM   5311 C C     . GLY D 2 216 ? 92.863  41.636 69.012  1.00 36.50  ? 216 GLY B C     1 
ATOM   5312 O O     . GLY D 2 216 ? 92.786  40.721 68.195  1.00 37.33  ? 216 GLY B O     1 
ATOM   5313 N N     . VAL D 2 217 ? 91.801  42.077 69.671  1.00 35.63  ? 217 VAL B N     1 
ATOM   5314 C CA    . VAL D 2 217 ? 90.497  41.478 69.428  1.00 34.03  ? 217 VAL B CA    1 
ATOM   5315 C C     . VAL D 2 217 ? 90.058  41.791 68.007  1.00 34.91  ? 217 VAL B C     1 
ATOM   5316 O O     . VAL D 2 217 ? 89.315  41.008 67.404  1.00 34.02  ? 217 VAL B O     1 
ATOM   5317 C CB    . VAL D 2 217 ? 89.403  42.011 70.413  1.00 29.75  ? 217 VAL B CB    1 
ATOM   5318 C CG1   . VAL D 2 217 ? 88.022  41.502 69.998  1.00 13.81  ? 217 VAL B CG1   1 
ATOM   5319 C CG2   . VAL D 2 217 ? 89.703  41.559 71.830  1.00 32.35  ? 217 VAL B CG2   1 
ATOM   5320 N N     . THR D 2 218 ? 90.511  42.925 67.469  1.00 27.54  ? 218 THR B N     1 
ATOM   5321 C CA    . THR D 2 218 ? 90.101  43.292 66.123  1.00 31.15  ? 218 THR B CA    1 
ATOM   5322 C C     . THR D 2 218 ? 90.787  42.371 65.167  1.00 32.58  ? 218 THR B C     1 
ATOM   5323 O O     . THR D 2 218 ? 90.270  42.070 64.100  1.00 33.02  ? 218 THR B O     1 
ATOM   5324 C CB    . THR D 2 218 ? 90.480  44.716 65.755  1.00 35.15  ? 218 THR B CB    1 
ATOM   5325 O OG1   . THR D 2 218 ? 91.873  44.762 65.443  1.00 52.49  ? 218 THR B OG1   1 
ATOM   5326 C CG2   . THR D 2 218 ? 90.171  45.665 66.896  1.00 38.80  ? 218 THR B CG2   1 
ATOM   5327 N N     . LYS D 2 219 ? 91.975  41.922 65.551  1.00 37.05  ? 219 LYS B N     1 
ATOM   5328 C CA    . LYS D 2 219 ? 92.715  40.988 64.707  1.00 33.40  ? 219 LYS B CA    1 
ATOM   5329 C C     . LYS D 2 219 ? 91.833  39.762 64.664  1.00 25.72  ? 219 LYS B C     1 
ATOM   5330 O O     . LYS D 2 219 ? 91.492  39.277 63.606  1.00 32.35  ? 219 LYS B O     1 
ATOM   5331 C CB    . LYS D 2 219 ? 94.058  40.618 65.336  1.00 43.99  ? 219 LYS B CB    1 
ATOM   5332 C CG    . LYS D 2 219 ? 95.249  40.814 64.418  1.00 45.32  ? 219 LYS B CG    1 
ATOM   5333 C CD    . LYS D 2 219 ? 95.810  42.223 64.530  1.00 60.15  ? 219 LYS B CD    1 
ATOM   5334 C CE    . LYS D 2 219 ? 94.990  43.220 63.723  1.00 58.30  ? 219 LYS B CE    1 
ATOM   5335 N NZ    . LYS D 2 219 ? 95.095  44.598 64.287  1.00 50.27  ? 219 LYS B NZ    1 
ATOM   5336 N N     . LEU D 2 220 ? 91.451  39.280 65.842  1.00 30.06  ? 220 LEU B N     1 
ATOM   5337 C CA    . LEU D 2 220 ? 90.574  38.114 65.967  1.00 30.67  ? 220 LEU B CA    1 
ATOM   5338 C C     . LEU D 2 220 ? 89.345  38.240 65.070  1.00 35.04  ? 220 LEU B C     1 
ATOM   5339 O O     . LEU D 2 220 ? 89.018  37.322 64.314  1.00 33.33  ? 220 LEU B O     1 
ATOM   5340 C CB    . LEU D 2 220 ? 90.106  37.972 67.415  1.00 25.78  ? 220 LEU B CB    1 
ATOM   5341 C CG    . LEU D 2 220 ? 91.158  37.583 68.447  1.00 25.63  ? 220 LEU B CG    1 
ATOM   5342 C CD1   . LEU D 2 220 ? 90.476  37.328 69.768  1.00 22.72  ? 220 LEU B CD1   1 
ATOM   5343 C CD2   . LEU D 2 220 ? 91.899  36.348 67.983  1.00 18.61  ? 220 LEU B CD2   1 
ATOM   5344 N N     . VAL D 2 221 ? 88.671  39.384 65.172  1.00 35.52  ? 221 VAL B N     1 
ATOM   5345 C CA    . VAL D 2 221 ? 87.471  39.649 64.387  1.00 36.00  ? 221 VAL B CA    1 
ATOM   5346 C C     . VAL D 2 221 ? 87.752  39.646 62.882  1.00 35.58  ? 221 VAL B C     1 
ATOM   5347 O O     . VAL D 2 221 ? 86.950  39.148 62.085  1.00 39.62  ? 221 VAL B O     1 
ATOM   5348 C CB    . VAL D 2 221 ? 86.832  41.006 64.792  1.00 33.24  ? 221 VAL B CB    1 
ATOM   5349 C CG1   . VAL D 2 221 ? 85.506  41.191 64.080  1.00 34.70  ? 221 VAL B CG1   1 
ATOM   5350 C CG2   . VAL D 2 221 ? 86.619  41.051 66.301  1.00 35.08  ? 221 VAL B CG2   1 
ATOM   5351 N N     . GLU D 2 222 ? 88.892  40.205 62.499  1.00 34.93  ? 222 GLU B N     1 
ATOM   5352 C CA    . GLU D 2 222 ? 89.260  40.252 61.095  1.00 30.09  ? 222 GLU B CA    1 
ATOM   5353 C C     . GLU D 2 222 ? 89.486  38.849 60.540  1.00 30.22  ? 222 GLU B C     1 
ATOM   5354 O O     . GLU D 2 222 ? 89.059  38.532 59.437  1.00 41.57  ? 222 GLU B O     1 
ATOM   5355 C CB    . GLU D 2 222 ? 90.521  41.072 60.917  1.00 33.35  ? 222 GLU B CB    1 
ATOM   5356 C CG    . GLU D 2 222 ? 90.251  42.534 60.607  1.00 47.30  ? 222 GLU B CG    1 
ATOM   5357 C CD    . GLU D 2 222 ? 91.349  43.451 61.112  1.00 61.38  ? 222 GLU B CD    1 
ATOM   5358 O OE1   . GLU D 2 222 ? 92.305  42.962 61.755  1.00 67.56  ? 222 GLU B OE1   1 
ATOM   5359 O OE2   . GLU D 2 222 ? 91.255  44.671 60.861  1.00 74.37  ? 222 GLU B OE2   1 
ATOM   5360 N N     . ARG D 2 223 ? 90.146  38.001 61.313  1.00 26.60  ? 223 ARG B N     1 
ATOM   5361 C CA    . ARG D 2 223 ? 90.413  36.650 60.871  1.00 22.98  ? 223 ARG B CA    1 
ATOM   5362 C C     . ARG D 2 223 ? 89.132  35.923 60.565  1.00 22.91  ? 223 ARG B C     1 
ATOM   5363 O O     . ARG D 2 223 ? 89.051  35.152 59.618  1.00 37.16  ? 223 ARG B O     1 
ATOM   5364 C CB    . ARG D 2 223 ? 91.176  35.885 61.940  1.00 21.60  ? 223 ARG B CB    1 
ATOM   5365 C CG    . ARG D 2 223 ? 91.815  34.615 61.413  1.00 38.93  ? 223 ARG B CG    1 
ATOM   5366 C CD    . ARG D 2 223 ? 92.662  33.953 62.486  1.00 61.99  ? 223 ARG B CD    1 
ATOM   5367 N NE    . ARG D 2 223 ? 93.114  32.611 62.109  1.00 74.86  ? 223 ARG B NE    1 
ATOM   5368 C CZ    . ARG D 2 223 ? 93.129  31.566 62.933  1.00 80.40  ? 223 ARG B CZ    1 
ATOM   5369 N NH1   . ARG D 2 223 ? 92.714  31.697 64.190  1.00 89.20  ? 223 ARG B NH1   1 
ATOM   5370 N NH2   . ARG D 2 223 ? 93.572  30.393 62.503  1.00 82.95  ? 223 ARG B NH2   1 
ATOM   5371 N N     . TRP D 2 224 ? 88.113  36.189 61.366  1.00 31.10  ? 224 TRP B N     1 
ATOM   5372 C CA    . TRP D 2 224 ? 86.838  35.516 61.189  1.00 34.28  ? 224 TRP B CA    1 
ATOM   5373 C C     . TRP D 2 224 ? 86.151  35.943 59.907  1.00 37.80  ? 224 TRP B C     1 
ATOM   5374 O O     . TRP D 2 224 ? 85.730  35.108 59.120  1.00 42.90  ? 224 TRP B O     1 
ATOM   5375 C CB    . TRP D 2 224 ? 85.941  35.775 62.406  1.00 36.86  ? 224 TRP B CB    1 
ATOM   5376 C CG    . TRP D 2 224 ? 84.471  35.786 62.116  1.00 36.45  ? 224 TRP B CG    1 
ATOM   5377 C CD1   . TRP D 2 224 ? 83.621  36.850 62.210  1.00 32.50  ? 224 TRP B CD1   1 
ATOM   5378 C CD2   . TRP D 2 224 ? 83.683  34.686 61.646  1.00 26.92  ? 224 TRP B CD2   1 
ATOM   5379 N NE1   . TRP D 2 224 ? 82.355  36.483 61.823  1.00 17.79  ? 224 TRP B NE1   1 
ATOM   5380 C CE2   . TRP D 2 224 ? 82.365  35.160 61.472  1.00 25.54  ? 224 TRP B CE2   1 
ATOM   5381 C CE3   . TRP D 2 224 ? 83.965  33.348 61.353  1.00 29.55  ? 224 TRP B CE3   1 
ATOM   5382 C CZ2   . TRP D 2 224 ? 81.329  34.343 61.019  1.00 25.65  ? 224 TRP B CZ2   1 
ATOM   5383 C CZ3   . TRP D 2 224 ? 82.933  32.529 60.900  1.00 32.08  ? 224 TRP B CZ3   1 
ATOM   5384 C CH2   . TRP D 2 224 ? 81.632  33.032 60.738  1.00 31.87  ? 224 TRP B CH2   1 
ATOM   5385 N N     . ILE D 2 225 ? 86.061  37.248 59.694  1.00 37.05  ? 225 ILE B N     1 
ATOM   5386 C CA    . ILE D 2 225 ? 85.412  37.788 58.503  1.00 37.01  ? 225 ILE B CA    1 
ATOM   5387 C C     . ILE D 2 225 ? 85.942  37.207 57.219  1.00 39.10  ? 225 ILE B C     1 
ATOM   5388 O O     . ILE D 2 225 ? 85.183  36.823 56.340  1.00 45.16  ? 225 ILE B O     1 
ATOM   5389 C CB    . ILE D 2 225 ? 85.609  39.287 58.398  1.00 35.98  ? 225 ILE B CB    1 
ATOM   5390 C CG1   . ILE D 2 225 ? 84.477  40.001 59.112  1.00 43.70  ? 225 ILE B CG1   1 
ATOM   5391 C CG2   . ILE D 2 225 ? 85.668  39.713 56.939  1.00 39.69  ? 225 ILE B CG2   1 
ATOM   5392 C CD1   . ILE D 2 225 ? 84.891  41.354 59.633  1.00 28.59  ? 225 ILE B CD1   1 
ATOM   5393 N N     . SER D 2 226 ? 87.259  37.179 57.104  1.00 39.89  ? 226 SER B N     1 
ATOM   5394 C CA    . SER D 2 226 ? 87.880  36.658 55.905  1.00 44.64  ? 226 SER B CA    1 
ATOM   5395 C C     . SER D 2 226 ? 87.371  35.262 55.704  1.00 38.74  ? 226 SER B C     1 
ATOM   5396 O O     . SER D 2 226 ? 86.685  34.963 54.728  1.00 48.76  ? 226 SER B O     1 
ATOM   5397 C CB    . SER D 2 226 ? 89.407  36.602 56.041  1.00 47.72  ? 226 SER B CB    1 
ATOM   5398 O OG    . SER D 2 226 ? 89.813  36.866 57.371  1.00 69.40  ? 226 SER B OG    1 
ATOM   5399 N N     . VAL D 2 227 ? 87.696  34.409 56.654  1.00 29.84  ? 227 VAL B N     1 
ATOM   5400 C CA    . VAL D 2 227 ? 87.315  33.026 56.550  1.00 29.27  ? 227 VAL B CA    1 
ATOM   5401 C C     . VAL D 2 227 ? 85.789  32.786 56.480  1.00 36.58  ? 227 VAL B C     1 
ATOM   5402 O O     . VAL D 2 227 ? 85.335  31.745 55.987  1.00 34.12  ? 227 VAL B O     1 
ATOM   5403 C CB    . VAL D 2 227 ? 88.009  32.262 57.709  1.00 20.69  ? 227 VAL B CB    1 
ATOM   5404 C CG1   . VAL D 2 227 ? 87.948  30.763 57.488  1.00 20.18  ? 227 VAL B CG1   1 
ATOM   5405 C CG2   . VAL D 2 227 ? 89.499  32.694 57.766  1.00 21.39  ? 227 VAL B CG2   1 
ATOM   5406 N N     . SER D 2 228 ? 84.991  33.751 56.933  1.00 41.52  ? 228 SER B N     1 
ATOM   5407 C CA    . SER D 2 228 ? 83.541  33.576 56.913  1.00 45.29  ? 228 SER B CA    1 
ATOM   5408 C C     . SER D 2 228 ? 82.895  34.041 55.616  1.00 52.65  ? 228 SER B C     1 
ATOM   5409 O O     . SER D 2 228 ? 81.960  33.411 55.131  1.00 60.61  ? 228 SER B O     1 
ATOM   5410 C CB    . SER D 2 228 ? 82.886  34.318 58.085  1.00 38.73  ? 228 SER B CB    1 
ATOM   5411 O OG    . SER D 2 228 ? 83.417  35.626 58.246  1.00 36.89  ? 228 SER B OG    1 
ATOM   5412 N N     . GLY D 2 229 ? 83.400  35.139 55.062  1.00 51.12  ? 229 GLY B N     1 
ATOM   5413 C CA    . GLY D 2 229 ? 82.832  35.684 53.844  1.00 51.71  ? 229 GLY B CA    1 
ATOM   5414 C C     . GLY D 2 229 ? 81.624  36.545 54.172  1.00 56.54  ? 229 GLY B C     1 
ATOM   5415 O O     . GLY D 2 229 ? 80.793  36.823 53.302  1.00 59.99  ? 229 GLY B O     1 
ATOM   5416 N N     . VAL D 2 230 ? 81.515  36.960 55.434  1.00 54.18  ? 230 VAL B N     1 
ATOM   5417 C CA    . VAL D 2 230 ? 80.398  37.794 55.880  1.00 48.65  ? 230 VAL B CA    1 
ATOM   5418 C C     . VAL D 2 230 ? 80.433  39.187 55.229  1.00 53.54  ? 230 VAL B C     1 
ATOM   5419 O O     . VAL D 2 230 ? 79.438  39.918 55.260  1.00 52.04  ? 230 VAL B O     1 
ATOM   5420 C CB    . VAL D 2 230 ? 80.396  37.954 57.443  1.00 36.94  ? 230 VAL B CB    1 
ATOM   5421 C CG1   . VAL D 2 230 ? 79.811  36.707 58.102  1.00 26.06  ? 230 VAL B CG1   1 
ATOM   5422 C CG2   . VAL D 2 230 ? 81.810  38.198 57.952  1.00 41.50  ? 230 VAL B CG2   1 
ATOM   5423 N N     . ALA D 2 231 ? 81.577  39.521 54.622  1.00 58.06  ? 231 ALA B N     1 
ATOM   5424 C CA    . ALA D 2 231 ? 81.814  40.824 53.978  1.00 52.67  ? 231 ALA B CA    1 
ATOM   5425 C C     . ALA D 2 231 ? 81.369  40.967 52.520  1.00 51.67  ? 231 ALA B C     1 
ATOM   5426 O O     . ALA D 2 231 ? 81.532  42.041 51.927  1.00 47.62  ? 231 ALA B O     1 
ATOM   5427 C CB    . ALA D 2 231 ? 83.295  41.196 54.098  1.00 48.94  ? 231 ALA B CB    1 
ATOM   5428 N N     . ASP D 2 232 ? 80.829  39.886 51.957  1.00 58.66  ? 232 ASP B N     1 
ATOM   5429 C CA    . ASP D 2 232 ? 80.315  39.859 50.585  1.00 67.51  ? 232 ASP B CA    1 
ATOM   5430 C C     . ASP D 2 232 ? 79.066  40.738 50.511  1.00 68.71  ? 232 ASP B C     1 
ATOM   5431 O O     . ASP D 2 232 ? 78.550  41.017 49.423  1.00 63.38  ? 232 ASP B O     1 
ATOM   5432 C CB    . ASP D 2 232 ? 79.922  38.434 50.187  1.00 80.05  ? 232 ASP B CB    1 
ATOM   5433 C CG    . ASP D 2 232 ? 81.086  37.474 50.228  1.00 90.69  ? 232 ASP B CG    1 
ATOM   5434 O OD1   . ASP D 2 232 ? 82.219  37.900 49.904  1.00 98.68  ? 232 ASP B OD1   1 
ATOM   5435 O OD2   . ASP D 2 232 ? 80.862  36.296 50.587  1.00 94.61  ? 232 ASP B OD2   1 
ATOM   5436 N N     . ASP D 2 233 ? 78.587  41.148 51.688  1.00 74.31  ? 233 ASP B N     1 
ATOM   5437 C CA    . ASP D 2 233 ? 77.399  41.989 51.833  1.00 68.10  ? 233 ASP B CA    1 
ATOM   5438 C C     . ASP D 2 233 ? 77.442  42.772 53.144  1.00 62.47  ? 233 ASP B C     1 
ATOM   5439 O O     . ASP D 2 233 ? 77.663  42.200 54.207  1.00 68.08  ? 233 ASP B O     1 
ATOM   5440 C CB    . ASP D 2 233 ? 76.144  41.118 51.821  1.00 69.54  ? 233 ASP B CB    1 
ATOM   5441 C CG    . ASP D 2 233 ? 74.875  41.932 51.904  1.00 71.80  ? 233 ASP B CG    1 
ATOM   5442 O OD1   . ASP D 2 233 ? 74.964  43.166 52.091  1.00 63.03  ? 233 ASP B OD1   1 
ATOM   5443 O OD2   . ASP D 2 233 ? 73.788  41.333 51.776  1.00 75.95  ? 233 ASP B OD2   1 
ATOM   5444 N N     . PRO D 2 234 ? 77.248  44.093 53.079  1.00 58.99  ? 234 PRO B N     1 
ATOM   5445 C CA    . PRO D 2 234 ? 77.256  44.971 54.253  1.00 59.18  ? 234 PRO B CA    1 
ATOM   5446 C C     . PRO D 2 234 ? 76.170  44.651 55.277  1.00 54.45  ? 234 PRO B C     1 
ATOM   5447 O O     . PRO D 2 234 ? 76.393  44.749 56.480  1.00 60.18  ? 234 PRO B O     1 
ATOM   5448 C CB    . PRO D 2 234 ? 77.074  46.364 53.664  1.00 61.61  ? 234 PRO B CB    1 
ATOM   5449 C CG    . PRO D 2 234 ? 77.485  46.224 52.246  1.00 69.52  ? 234 PRO B CG    1 
ATOM   5450 C CD    . PRO D 2 234 ? 77.060  44.857 51.843  1.00 60.29  ? 234 PRO B CD    1 
ATOM   5451 N N     . ASN D 2 235 ? 74.988  44.286 54.803  1.00 55.02  ? 235 ASN B N     1 
ATOM   5452 C CA    . ASN D 2 235 ? 73.891  43.966 55.707  1.00 52.83  ? 235 ASN B CA    1 
ATOM   5453 C C     . ASN D 2 235 ? 73.909  42.523 56.201  1.00 48.65  ? 235 ASN B C     1 
ATOM   5454 O O     . ASN D 2 235 ? 72.960  42.049 56.819  1.00 43.57  ? 235 ASN B O     1 
ATOM   5455 C CB    . ASN D 2 235 ? 72.553  44.285 55.035  1.00 62.97  ? 235 ASN B CB    1 
ATOM   5456 C CG    . ASN D 2 235 ? 72.152  45.739 55.212  1.00 67.57  ? 235 ASN B CG    1 
ATOM   5457 O OD1   . ASN D 2 235 ? 71.282  46.063 56.024  1.00 70.50  ? 235 ASN B OD1   1 
ATOM   5458 N ND2   . ASN D 2 235 ? 72.787  46.621 54.452  1.00 69.06  ? 235 ASN B ND2   1 
ATOM   5459 N N     . ASN D 2 236 ? 75.004  41.828 55.927  1.00 51.38  ? 236 ASN B N     1 
ATOM   5460 C CA    . ASN D 2 236 ? 75.171  40.444 56.371  1.00 53.61  ? 236 ASN B CA    1 
ATOM   5461 C C     . ASN D 2 236 ? 75.468  40.473 57.876  1.00 55.05  ? 236 ASN B C     1 
ATOM   5462 O O     . ASN D 2 236 ? 76.204  41.350 58.349  1.00 48.82  ? 236 ASN B O     1 
ATOM   5463 C CB    . ASN D 2 236 ? 76.354  39.788 55.638  1.00 50.90  ? 236 ASN B CB    1 
ATOM   5464 C CG    . ASN D 2 236 ? 75.932  38.653 54.735  1.00 50.45  ? 236 ASN B CG    1 
ATOM   5465 O OD1   . ASN D 2 236 ? 74.791  38.204 54.784  1.00 40.92  ? 236 ASN B OD1   1 
ATOM   5466 N ND2   . ASN D 2 236 ? 76.855  38.182 53.898  1.00 54.21  ? 236 ASN B ND2   1 
ATOM   5467 N N     . TYR D 2 237 ? 74.900  39.535 58.627  1.00 51.90  ? 237 TYR B N     1 
ATOM   5468 C CA    . TYR D 2 237 ? 75.159  39.488 60.061  1.00 46.42  ? 237 TYR B CA    1 
ATOM   5469 C C     . TYR D 2 237 ? 76.605  39.077 60.279  1.00 42.54  ? 237 TYR B C     1 
ATOM   5470 O O     . TYR D 2 237 ? 77.107  38.132 59.660  1.00 38.78  ? 237 TYR B O     1 
ATOM   5471 C CB    . TYR D 2 237 ? 74.265  38.474 60.771  1.00 47.17  ? 237 TYR B CB    1 
ATOM   5472 C CG    . TYR D 2 237 ? 72.830  38.900 60.930  1.00 47.25  ? 237 TYR B CG    1 
ATOM   5473 C CD1   . TYR D 2 237 ? 71.799  38.146 60.364  1.00 50.55  ? 237 TYR B CD1   1 
ATOM   5474 C CD2   . TYR D 2 237 ? 72.495  40.042 61.656  1.00 41.06  ? 237 TYR B CD2   1 
ATOM   5475 C CE1   . TYR D 2 237 ? 70.475  38.509 60.517  1.00 45.81  ? 237 TYR B CE1   1 
ATOM   5476 C CE2   . TYR D 2 237 ? 71.171  40.419 61.820  1.00 35.79  ? 237 TYR B CE2   1 
ATOM   5477 C CZ    . TYR D 2 237 ? 70.165  39.643 61.246  1.00 51.91  ? 237 TYR B CZ    1 
ATOM   5478 O OH    . TYR D 2 237 ? 68.837  39.960 61.416  1.00 55.51  ? 237 TYR B OH    1 
ATOM   5479 N N     . LEU D 2 238 ? 77.259  39.796 61.179  1.00 38.00  ? 238 LEU B N     1 
ATOM   5480 C CA    . LEU D 2 238 ? 78.647  39.542 61.523  1.00 34.02  ? 238 LEU B CA    1 
ATOM   5481 C C     . LEU D 2 238 ? 78.845  38.092 61.965  1.00 33.08  ? 238 LEU B C     1 
ATOM   5482 O O     . LEU D 2 238 ? 79.780  37.419 61.551  1.00 38.78  ? 238 LEU B O     1 
ATOM   5483 C CB    . LEU D 2 238 ? 79.071  40.497 62.630  1.00 31.14  ? 238 LEU B CB    1 
ATOM   5484 C CG    . LEU D 2 238 ? 80.432  40.192 63.243  1.00 39.64  ? 238 LEU B CG    1 
ATOM   5485 C CD1   . LEU D 2 238 ? 81.477  40.131 62.144  1.00 33.22  ? 238 LEU B CD1   1 
ATOM   5486 C CD2   . LEU D 2 238 ? 80.782  41.260 64.262  1.00 42.74  ? 238 LEU B CD2   1 
ATOM   5487 N N     . PHE D 2 239 ? 77.960  37.607 62.816  1.00 27.71  ? 239 PHE B N     1 
ATOM   5488 C CA    . PHE D 2 239 ? 78.080  36.238 63.249  1.00 22.07  ? 239 PHE B CA    1 
ATOM   5489 C C     . PHE D 2 239 ? 77.031  35.439 62.544  1.00 29.33  ? 239 PHE B C     1 
ATOM   5490 O O     . PHE D 2 239 ? 75.851  35.777 62.548  1.00 30.70  ? 239 PHE B O     1 
ATOM   5491 C CB    . PHE D 2 239 ? 77.920  36.125 64.764  1.00 24.83  ? 239 PHE B CB    1 
ATOM   5492 C CG    . PHE D 2 239 ? 79.115  36.596 65.502  1.00 23.57  ? 239 PHE B CG    1 
ATOM   5493 C CD1   . PHE D 2 239 ? 79.101  37.810 66.171  1.00 15.01  ? 239 PHE B CD1   1 
ATOM   5494 C CD2   . PHE D 2 239 ? 80.303  35.894 65.414  1.00 7.04   ? 239 PHE B CD2   1 
ATOM   5495 C CE1   . PHE D 2 239 ? 80.267  38.335 66.732  1.00 22.14  ? 239 PHE B CE1   1 
ATOM   5496 C CE2   . PHE D 2 239 ? 81.467  36.410 65.968  1.00 22.67  ? 239 PHE B CE2   1 
ATOM   5497 C CZ    . PHE D 2 239 ? 81.450  37.641 66.630  1.00 16.82  ? 239 PHE B CZ    1 
ATOM   5498 N N     . CYS D 2 240 ? 77.488  34.392 61.890  1.00 33.64  ? 240 CYS B N     1 
ATOM   5499 C CA    . CYS D 2 240 ? 76.598  33.499 61.188  1.00 38.04  ? 240 CYS B CA    1 
ATOM   5500 C C     . CYS D 2 240 ? 76.891  32.112 61.730  1.00 35.62  ? 240 CYS B C     1 
ATOM   5501 O O     . CYS D 2 240 ? 77.787  31.938 62.561  1.00 31.62  ? 240 CYS B O     1 
ATOM   5502 C CB    . CYS D 2 240 ? 76.876  33.547 59.696  1.00 41.60  ? 240 CYS B CB    1 
ATOM   5503 S SG    . CYS D 2 240 ? 78.370  32.686 59.284  1.00 47.52  ? 240 CYS B SG    1 
ATOM   5504 N N     . ARG D 2 241 ? 76.135  31.126 61.267  1.00 30.75  ? 241 ARG B N     1 
ATOM   5505 C CA    . ARG D 2 241 ? 76.333  29.777 61.747  1.00 34.43  ? 241 ARG B CA    1 
ATOM   5506 C C     . ARG D 2 241 ? 77.371  29.073 60.896  1.00 34.02  ? 241 ARG B C     1 
ATOM   5507 O O     . ARG D 2 241 ? 77.659  29.498 59.776  1.00 35.18  ? 241 ARG B O     1 
ATOM   5508 C CB    . ARG D 2 241 ? 75.016  29.006 61.710  1.00 40.97  ? 241 ARG B CB    1 
ATOM   5509 C CG    . ARG D 2 241 ? 74.597  28.578 60.316  1.00 43.03  ? 241 ARG B CG    1 
ATOM   5510 C CD    . ARG D 2 241 ? 73.184  28.082 60.310  1.00 31.10  ? 241 ARG B CD    1 
ATOM   5511 N NE    . ARG D 2 241 ? 73.100  26.713 60.799  1.00 35.71  ? 241 ARG B NE    1 
ATOM   5512 C CZ    . ARG D 2 241 ? 71.961  26.043 60.947  1.00 43.30  ? 241 ARG B CZ    1 
ATOM   5513 N NH1   . ARG D 2 241 ? 70.810  26.631 60.634  1.00 42.05  ? 241 ARG B NH1   1 
ATOM   5514 N NH2   . ARG D 2 241 ? 71.974  24.783 61.371  1.00 23.24  ? 241 ARG B NH2   1 
ATOM   5515 N N     . VAL D 2 242 ? 77.911  27.986 61.429  1.00 25.62  ? 242 VAL B N     1 
ATOM   5516 C CA    . VAL D 2 242 ? 78.922  27.214 60.743  1.00 22.11  ? 242 VAL B CA    1 
ATOM   5517 C C     . VAL D 2 242 ? 78.575  25.744 60.801  1.00 35.85  ? 242 VAL B C     1 
ATOM   5518 O O     . VAL D 2 242 ? 78.294  25.202 61.872  1.00 38.63  ? 242 VAL B O     1 
ATOM   5519 C CB    . VAL D 2 242 ? 80.282  27.415 61.377  1.00 25.84  ? 242 VAL B CB    1 
ATOM   5520 C CG1   . VAL D 2 242 ? 81.259  26.395 60.822  1.00 30.10  ? 242 VAL B CG1   1 
ATOM   5521 C CG2   . VAL D 2 242 ? 80.758  28.820 61.103  1.00 17.01  ? 242 VAL B CG2   1 
ATOM   5522 N N     . ARG D 2 243 ? 78.620  25.090 59.647  1.00 39.41  ? 243 ARG B N     1 
ATOM   5523 C CA    . ARG D 2 243 ? 78.251  23.691 59.592  1.00 36.30  ? 243 ARG B CA    1 
ATOM   5524 C C     . ARG D 2 243 ? 79.407  22.752 59.801  1.00 36.08  ? 243 ARG B C     1 
ATOM   5525 O O     . ARG D 2 243 ? 80.563  23.167 59.786  1.00 40.86  ? 243 ARG B O     1 
ATOM   5526 C CB    . ARG D 2 243 ? 77.527  23.417 58.275  1.00 41.28  ? 243 ARG B CB    1 
ATOM   5527 C CG    . ARG D 2 243 ? 76.344  24.367 58.095  1.00 42.54  ? 243 ARG B CG    1 
ATOM   5528 C CD    . ARG D 2 243 ? 75.452  24.006 56.926  1.00 48.08  ? 243 ARG B CD    1 
ATOM   5529 N NE    . ARG D 2 243 ? 74.055  23.773 57.303  1.00 34.52  ? 243 ARG B NE    1 
ATOM   5530 C CZ    . ARG D 2 243 ? 73.617  22.651 57.862  1.00 46.00  ? 243 ARG B CZ    1 
ATOM   5531 N NH1   . ARG D 2 243 ? 74.471  21.666 58.114  1.00 56.17  ? 243 ARG B NH1   1 
ATOM   5532 N NH2   . ARG D 2 243 ? 72.328  22.502 58.141  1.00 50.91  ? 243 ARG B NH2   1 
ATOM   5533 N N     . LYS D 2 244 ? 79.082  21.485 60.015  1.00 36.17  ? 244 LYS B N     1 
ATOM   5534 C CA    . LYS D 2 244 ? 80.085  20.470 60.265  1.00 44.97  ? 244 LYS B CA    1 
ATOM   5535 C C     . LYS D 2 244 ? 81.248  20.534 59.272  1.00 47.34  ? 244 LYS B C     1 
ATOM   5536 O O     . LYS D 2 244 ? 82.407  20.445 59.675  1.00 52.22  ? 244 LYS B O     1 
ATOM   5537 C CB    . LYS D 2 244 ? 79.431  19.088 60.250  1.00 44.06  ? 244 LYS B CB    1 
ATOM   5538 C CG    . LYS D 2 244 ? 78.458  18.887 59.099  1.00 53.29  ? 244 LYS B CG    1 
ATOM   5539 C CD    . LYS D 2 244 ? 78.396  17.431 58.676  1.00 48.51  ? 244 LYS B CD    1 
ATOM   5540 C CE    . LYS D 2 244 ? 78.159  16.512 59.860  1.00 48.29  ? 244 LYS B CE    1 
ATOM   5541 N NZ    . LYS D 2 244 ? 77.920  15.119 59.401  1.00 43.64  ? 244 LYS B NZ    1 
ATOM   5542 N N     . ASN D 2 245 ? 80.955  20.709 57.986  1.00 48.79  ? 245 ASN B N     1 
ATOM   5543 C CA    . ASN D 2 245 ? 82.031  20.777 56.994  1.00 48.77  ? 245 ASN B CA    1 
ATOM   5544 C C     . ASN D 2 245 ? 82.808  22.069 57.149  1.00 45.31  ? 245 ASN B C     1 
ATOM   5545 O O     . ASN D 2 245 ? 83.561  22.466 56.266  1.00 43.99  ? 245 ASN B O     1 
ATOM   5546 C CB    . ASN D 2 245 ? 81.479  20.711 55.572  1.00 55.75  ? 245 ASN B CB    1 
ATOM   5547 C CG    . ASN D 2 245 ? 80.124  21.352 55.448  1.00 60.61  ? 245 ASN B CG    1 
ATOM   5548 O OD1   . ASN D 2 245 ? 79.127  20.820 55.943  1.00 65.55  ? 245 ASN B OD1   1 
ATOM   5549 N ND2   . ASN D 2 245 ? 80.075  22.504 54.785  1.00 60.22  ? 245 ASN B ND2   1 
ATOM   5550 N N     . GLY D 2 246 ? 82.610  22.733 58.277  1.00 45.02  ? 246 GLY B N     1 
ATOM   5551 C CA    . GLY D 2 246 ? 83.305  23.973 58.529  1.00 42.12  ? 246 GLY B CA    1 
ATOM   5552 C C     . GLY D 2 246 ? 83.015  25.058 57.520  1.00 41.74  ? 246 GLY B C     1 
ATOM   5553 O O     . GLY D 2 246 ? 83.882  25.878 57.242  1.00 45.76  ? 246 GLY B O     1 
ATOM   5554 N N     . VAL D 2 247 ? 81.812  25.070 56.956  1.00 47.15  ? 247 VAL B N     1 
ATOM   5555 C CA    . VAL D 2 247 ? 81.460  26.110 55.990  1.00 44.49  ? 247 VAL B CA    1 
ATOM   5556 C C     . VAL D 2 247 ? 80.448  27.023 56.656  1.00 47.66  ? 247 VAL B C     1 
ATOM   5557 O O     . VAL D 2 247 ? 79.406  26.559 57.147  1.00 43.51  ? 247 VAL B O     1 
ATOM   5558 C CB    . VAL D 2 247 ? 80.830  25.556 54.673  1.00 40.43  ? 247 VAL B CB    1 
ATOM   5559 C CG1   . VAL D 2 247 ? 80.418  26.718 53.773  1.00 43.45  ? 247 VAL B CG1   1 
ATOM   5560 C CG2   . VAL D 2 247 ? 81.821  24.675 53.929  1.00 28.70  ? 247 VAL B CG2   1 
ATOM   5561 N N     . ALA D 2 248 ? 80.788  28.313 56.673  1.00 46.97  ? 248 ALA B N     1 
ATOM   5562 C CA    . ALA D 2 248 ? 79.970  29.366 57.260  1.00 49.71  ? 248 ALA B CA    1 
ATOM   5563 C C     . ALA D 2 248 ? 78.703  29.570 56.432  1.00 59.81  ? 248 ALA B C     1 
ATOM   5564 O O     . ALA D 2 248 ? 78.467  28.844 55.457  1.00 72.19  ? 248 ALA B O     1 
ATOM   5565 C CB    . ALA D 2 248 ? 80.771  30.662 57.328  1.00 21.63  ? 248 ALA B CB    1 
ATOM   5566 N N     . ALA D 2 249 ? 77.907  30.575 56.796  1.00 57.47  ? 249 ALA B N     1 
ATOM   5567 C CA    . ALA D 2 249 ? 76.655  30.827 56.091  1.00 47.72  ? 249 ALA B CA    1 
ATOM   5568 C C     . ALA D 2 249 ? 76.107  32.240 56.285  1.00 46.34  ? 249 ALA B C     1 
ATOM   5569 O O     . ALA D 2 249 ? 75.010  32.405 56.824  1.00 55.64  ? 249 ALA B O     1 
ATOM   5570 C CB    . ALA D 2 249 ? 75.611  29.810 56.550  1.00 43.56  ? 249 ALA B CB    1 
ATOM   5571 N N     . PRO D 2 250 ? 76.837  33.271 55.816  1.00 38.60  ? 250 PRO B N     1 
ATOM   5572 C CA    . PRO D 2 250 ? 76.366  34.649 55.979  1.00 40.27  ? 250 PRO B CA    1 
ATOM   5573 C C     . PRO D 2 250 ? 74.908  34.832 55.595  1.00 47.94  ? 250 PRO B C     1 
ATOM   5574 O O     . PRO D 2 250 ? 74.409  34.220 54.648  1.00 56.59  ? 250 PRO B O     1 
ATOM   5575 C CB    . PRO D 2 250 ? 77.283  35.461 55.071  1.00 27.52  ? 250 PRO B CB    1 
ATOM   5576 C CG    . PRO D 2 250 ? 78.501  34.663 54.962  1.00 23.34  ? 250 PRO B CG    1 
ATOM   5577 C CD    . PRO D 2 250 ? 78.109  33.216 55.083  1.00 30.68  ? 250 PRO B CD    1 
ATOM   5578 N N     . SER D 2 251 ? 74.215  35.671 56.346  1.00 51.40  ? 251 SER B N     1 
ATOM   5579 C CA    . SER D 2 251 ? 72.816  35.947 56.066  1.00 47.14  ? 251 SER B CA    1 
ATOM   5580 C C     . SER D 2 251 ? 72.515  37.313 56.640  1.00 44.98  ? 251 SER B C     1 
ATOM   5581 O O     . SER D 2 251 ? 73.115  37.716 57.629  1.00 48.25  ? 251 SER B O     1 
ATOM   5582 C CB    . SER D 2 251 ? 71.920  34.891 56.719  1.00 45.24  ? 251 SER B CB    1 
ATOM   5583 O OG    . SER D 2 251 ? 70.569  35.323 56.755  1.00 58.38  ? 251 SER B OG    1 
ATOM   5584 N N     . ALA D 2 252 ? 71.617  38.051 55.998  1.00 50.53  ? 252 ALA B N     1 
ATOM   5585 C CA    . ALA D 2 252 ? 71.235  39.367 56.509  1.00 51.19  ? 252 ALA B CA    1 
ATOM   5586 C C     . ALA D 2 252 ? 69.770  39.323 56.947  1.00 47.52  ? 252 ALA B C     1 
ATOM   5587 O O     . ALA D 2 252 ? 69.170  40.357 57.252  1.00 40.95  ? 252 ALA B O     1 
ATOM   5588 C CB    . ALA D 2 252 ? 71.428  40.421 55.448  1.00 51.87  ? 252 ALA B CB    1 
ATOM   5589 N N     . THR D 2 253 ? 69.215  38.114 56.986  1.00 40.84  ? 253 THR B N     1 
ATOM   5590 C CA    . THR D 2 253 ? 67.832  37.918 57.380  1.00 50.45  ? 253 THR B CA    1 
ATOM   5591 C C     . THR D 2 253 ? 67.741  37.029 58.613  1.00 47.58  ? 253 THR B C     1 
ATOM   5592 O O     . THR D 2 253 ? 66.829  37.160 59.425  1.00 50.72  ? 253 THR B O     1 
ATOM   5593 C CB    . THR D 2 253 ? 66.995  37.283 56.226  1.00 57.21  ? 253 THR B CB    1 
ATOM   5594 O OG1   . THR D 2 253 ? 67.428  35.937 55.984  1.00 63.52  ? 253 THR B OG1   1 
ATOM   5595 C CG2   . THR D 2 253 ? 67.153  38.091 54.955  1.00 58.93  ? 253 THR B CG2   1 
ATOM   5596 N N     . SER D 2 254 ? 68.689  36.120 58.758  1.00 41.24  ? 254 SER B N     1 
ATOM   5597 C CA    . SER D 2 254 ? 68.662  35.236 59.901  1.00 40.50  ? 254 SER B CA    1 
ATOM   5598 C C     . SER D 2 254 ? 69.950  35.380 60.671  1.00 39.46  ? 254 SER B C     1 
ATOM   5599 O O     . SER D 2 254 ? 71.030  35.180 60.141  1.00 50.29  ? 254 SER B O     1 
ATOM   5600 C CB    . SER D 2 254 ? 68.470  33.788 59.450  1.00 38.71  ? 254 SER B CB    1 
ATOM   5601 O OG    . SER D 2 254 ? 67.393  33.685 58.533  1.00 61.48  ? 254 SER B OG    1 
ATOM   5602 N N     . GLN D 2 255 ? 69.838  35.762 61.929  1.00 38.03  ? 255 GLN B N     1 
ATOM   5603 C CA    . GLN D 2 255 ? 71.022  35.904 62.745  1.00 34.74  ? 255 GLN B CA    1 
ATOM   5604 C C     . GLN D 2 255 ? 71.191  34.616 63.510  1.00 32.40  ? 255 GLN B C     1 
ATOM   5605 O O     . GLN D 2 255 ? 70.248  33.854 63.710  1.00 37.86  ? 255 GLN B O     1 
ATOM   5606 C CB    . GLN D 2 255 ? 70.870  37.060 63.724  1.00 41.98  ? 255 GLN B CB    1 
ATOM   5607 C CG    . GLN D 2 255 ? 69.504  37.135 64.386  1.00 43.98  ? 255 GLN B CG    1 
ATOM   5608 C CD    . GLN D 2 255 ? 69.414  38.284 65.377  1.00 51.75  ? 255 GLN B CD    1 
ATOM   5609 O OE1   . GLN D 2 255 ? 69.582  39.451 65.004  1.00 38.76  ? 255 GLN B OE1   1 
ATOM   5610 N NE2   . GLN D 2 255 ? 69.162  37.961 66.651  1.00 40.56  ? 255 GLN B NE2   1 
ATOM   5611 N N     . LEU D 2 256 ? 72.408  34.363 63.934  1.00 27.41  ? 256 LEU B N     1 
ATOM   5612 C CA    . LEU D 2 256 ? 72.674  33.162 64.682  1.00 29.56  ? 256 LEU B CA    1 
ATOM   5613 C C     . LEU D 2 256 ? 71.920  33.229 66.018  1.00 33.77  ? 256 LEU B C     1 
ATOM   5614 O O     . LEU D 2 256 ? 71.967  34.233 66.709  1.00 38.37  ? 256 LEU B O     1 
ATOM   5615 C CB    . LEU D 2 256 ? 74.179  33.065 64.874  1.00 31.33  ? 256 LEU B CB    1 
ATOM   5616 C CG    . LEU D 2 256 ? 74.819  32.013 65.766  1.00 27.86  ? 256 LEU B CG    1 
ATOM   5617 C CD1   . LEU D 2 256 ? 74.606  30.592 65.247  1.00 33.14  ? 256 LEU B CD1   1 
ATOM   5618 C CD2   . LEU D 2 256 ? 76.288  32.355 65.797  1.00 37.43  ? 256 LEU B CD2   1 
ATOM   5619 N N     . SER D 2 257 ? 71.222  32.157 66.374  1.00 37.77  ? 257 SER B N     1 
ATOM   5620 C CA    . SER D 2 257 ? 70.451  32.112 67.621  1.00 21.23  ? 257 SER B CA    1 
ATOM   5621 C C     . SER D 2 257 ? 71.273  32.403 68.874  1.00 25.10  ? 257 SER B C     1 
ATOM   5622 O O     . SER D 2 257 ? 72.404  31.937 69.002  1.00 30.26  ? 257 SER B O     1 
ATOM   5623 C CB    . SER D 2 257 ? 69.759  30.747 67.756  1.00 17.89  ? 257 SER B CB    1 
ATOM   5624 O OG    . SER D 2 257 ? 70.040  30.115 68.996  1.00 28.46  ? 257 SER B OG    1 
ATOM   5625 N N     . THR D 2 258 ? 70.691  33.181 69.792  1.00 31.45  ? 258 THR B N     1 
ATOM   5626 C CA    . THR D 2 258 ? 71.346  33.545 71.054  1.00 15.70  ? 258 THR B CA    1 
ATOM   5627 C C     . THR D 2 258 ? 71.536  32.281 71.853  1.00 13.20  ? 258 THR B C     1 
ATOM   5628 O O     . THR D 2 258 ? 72.416  32.186 72.700  1.00 23.16  ? 258 THR B O     1 
ATOM   5629 C CB    . THR D 2 258 ? 70.495  34.475 71.901  1.00 16.35  ? 258 THR B CB    1 
ATOM   5630 O OG1   . THR D 2 258 ? 69.221  33.871 72.124  1.00 34.54  ? 258 THR B OG1   1 
ATOM   5631 C CG2   . THR D 2 258 ? 70.298  35.796 71.208  1.00 11.99  ? 258 THR B CG2   1 
ATOM   5632 N N     . ARG D 2 259 ? 70.687  31.309 71.579  1.00 7.22   ? 259 ARG B N     1 
ATOM   5633 C CA    . ARG D 2 259 ? 70.774  30.030 72.241  1.00 14.42  ? 259 ARG B CA    1 
ATOM   5634 C C     . ARG D 2 259 ? 72.133  29.454 71.826  1.00 27.12  ? 259 ARG B C     1 
ATOM   5635 O O     . ARG D 2 259 ? 72.815  28.799 72.616  1.00 28.42  ? 259 ARG B O     1 
ATOM   5636 C CB    . ARG D 2 259 ? 69.670  29.123 71.728  1.00 8.39   ? 259 ARG B CB    1 
ATOM   5637 C CG    . ARG D 2 259 ? 69.714  27.759 72.331  1.00 20.21  ? 259 ARG B CG    1 
ATOM   5638 C CD    . ARG D 2 259 ? 69.317  27.822 73.776  1.00 13.85  ? 259 ARG B CD    1 
ATOM   5639 N NE    . ARG D 2 259 ? 69.499  26.539 74.438  1.00 23.90  ? 259 ARG B NE    1 
ATOM   5640 C CZ    . ARG D 2 259 ? 70.661  26.119 74.915  1.00 25.34  ? 259 ARG B CZ    1 
ATOM   5641 N NH1   . ARG D 2 259 ? 71.726  26.892 74.792  1.00 15.71  ? 259 ARG B NH1   1 
ATOM   5642 N NH2   . ARG D 2 259 ? 70.753  24.944 75.527  1.00 26.04  ? 259 ARG B NH2   1 
ATOM   5643 N N     . ALA D 2 260 ? 72.510  29.705 70.572  1.00 25.87  ? 260 ALA B N     1 
ATOM   5644 C CA    . ALA D 2 260 ? 73.769  29.210 70.030  1.00 23.48  ? 260 ALA B CA    1 
ATOM   5645 C C     . ALA D 2 260 ? 74.953  29.924 70.679  1.00 25.45  ? 260 ALA B C     1 
ATOM   5646 O O     . ALA D 2 260 ? 75.948  29.296 71.055  1.00 37.08  ? 260 ALA B O     1 
ATOM   5647 C CB    . ALA D 2 260 ? 73.795  29.406 68.513  1.00 19.88  ? 260 ALA B CB    1 
ATOM   5648 N N     . LEU D 2 261 ? 74.857  31.243 70.799  1.00 21.03  ? 261 LEU B N     1 
ATOM   5649 C CA    . LEU D 2 261 ? 75.933  32.004 71.423  1.00 20.59  ? 261 LEU B CA    1 
ATOM   5650 C C     . LEU D 2 261 ? 76.191  31.467 72.823  1.00 21.66  ? 261 LEU B C     1 
ATOM   5651 O O     . LEU D 2 261 ? 77.340  31.274 73.218  1.00 29.07  ? 261 LEU B O     1 
ATOM   5652 C CB    . LEU D 2 261 ? 75.584  33.501 71.479  1.00 16.55  ? 261 LEU B CB    1 
ATOM   5653 C CG    . LEU D 2 261 ? 75.381  34.132 70.079  1.00 21.75  ? 261 LEU B CG    1 
ATOM   5654 C CD1   . LEU D 2 261 ? 75.043  35.607 70.170  1.00 12.20  ? 261 LEU B CD1   1 
ATOM   5655 C CD2   . LEU D 2 261 ? 76.635  33.968 69.243  1.00 23.11  ? 261 LEU B CD2   1 
ATOM   5656 N N     . GLU D 2 262 ? 75.116  31.219 73.563  1.00 22.22  ? 262 GLU B N     1 
ATOM   5657 C CA    . GLU D 2 262 ? 75.226  30.688 74.915  1.00 19.97  ? 262 GLU B CA    1 
ATOM   5658 C C     . GLU D 2 262 ? 75.928  29.347 74.795  1.00 23.37  ? 262 GLU B C     1 
ATOM   5659 O O     . GLU D 2 262 ? 76.584  28.880 75.735  1.00 24.03  ? 262 GLU B O     1 
ATOM   5660 C CB    . GLU D 2 262 ? 73.832  30.490 75.514  1.00 21.73  ? 262 GLU B CB    1 
ATOM   5661 C CG    . GLU D 2 262 ? 73.129  31.765 75.962  1.00 28.75  ? 262 GLU B CG    1 
ATOM   5662 C CD    . GLU D 2 262 ? 71.732  31.497 76.495  1.00 30.91  ? 262 GLU B CD    1 
ATOM   5663 O OE1   . GLU D 2 262 ? 70.865  31.058 75.707  1.00 43.43  ? 262 GLU B OE1   1 
ATOM   5664 O OE2   . GLU D 2 262 ? 71.499  31.719 77.701  1.00 38.30  ? 262 GLU B OE2   1 
ATOM   5665 N N     . GLY D 2 263 ? 75.783  28.749 73.613  1.00 24.61  ? 263 GLY B N     1 
ATOM   5666 C CA    . GLY D 2 263 ? 76.373  27.460 73.318  1.00 16.73  ? 263 GLY B CA    1 
ATOM   5667 C C     . GLY D 2 263 ? 77.863  27.588 73.158  1.00 21.92  ? 263 GLY B C     1 
ATOM   5668 O O     . GLY D 2 263 ? 78.600  26.689 73.578  1.00 26.56  ? 263 GLY B O     1 
ATOM   5669 N N     . ILE D 2 264 ? 78.309  28.669 72.516  1.00 18.34  ? 264 ILE B N     1 
ATOM   5670 C CA    . ILE D 2 264 ? 79.744  28.893 72.367  1.00 23.79  ? 264 ILE B CA    1 
ATOM   5671 C C     . ILE D 2 264 ? 80.340  28.870 73.780  1.00 27.34  ? 264 ILE B C     1 
ATOM   5672 O O     . ILE D 2 264 ? 81.353  28.217 74.028  1.00 34.36  ? 264 ILE B O     1 
ATOM   5673 C CB    . ILE D 2 264 ? 80.067  30.271 71.753  1.00 22.75  ? 264 ILE B CB    1 
ATOM   5674 C CG1   . ILE D 2 264 ? 79.916  30.217 70.242  1.00 20.88  ? 264 ILE B CG1   1 
ATOM   5675 C CG2   . ILE D 2 264 ? 81.496  30.674 72.092  1.00 24.60  ? 264 ILE B CG2   1 
ATOM   5676 C CD1   . ILE D 2 264 ? 78.669  30.840 69.739  1.00 26.71  ? 264 ILE B CD1   1 
ATOM   5677 N N     . PHE D 2 265 ? 79.692  29.578 74.702  1.00 29.36  ? 265 PHE B N     1 
ATOM   5678 C CA    . PHE D 2 265 ? 80.147  29.672 76.090  1.00 28.54  ? 265 PHE B CA    1 
ATOM   5679 C C     . PHE D 2 265 ? 80.198  28.366 76.888  1.00 28.85  ? 265 PHE B C     1 
ATOM   5680 O O     . PHE D 2 265 ? 81.015  28.214 77.794  1.00 29.05  ? 265 PHE B O     1 
ATOM   5681 C CB    . PHE D 2 265 ? 79.279  30.672 76.837  1.00 34.21  ? 265 PHE B CB    1 
ATOM   5682 C CG    . PHE D 2 265 ? 79.815  32.069 76.811  1.00 26.59  ? 265 PHE B CG    1 
ATOM   5683 C CD1   . PHE D 2 265 ? 79.035  33.109 76.331  1.00 19.13  ? 265 PHE B CD1   1 
ATOM   5684 C CD2   . PHE D 2 265 ? 81.084  32.357 77.315  1.00 21.04  ? 265 PHE B CD2   1 
ATOM   5685 C CE1   . PHE D 2 265 ? 79.500  34.416 76.358  1.00 21.27  ? 265 PHE B CE1   1 
ATOM   5686 C CE2   . PHE D 2 265 ? 81.554  33.657 77.344  1.00 16.00  ? 265 PHE B CE2   1 
ATOM   5687 C CZ    . PHE D 2 265 ? 80.755  34.693 76.863  1.00 16.40  ? 265 PHE B CZ    1 
ATOM   5688 N N     . GLU D 2 266 ? 79.318  27.431 76.565  1.00 24.79  ? 266 GLU B N     1 
ATOM   5689 C CA    . GLU D 2 266 ? 79.297  26.157 77.270  1.00 28.02  ? 266 GLU B CA    1 
ATOM   5690 C C     . GLU D 2 266 ? 80.413  25.265 76.743  1.00 29.06  ? 266 GLU B C     1 
ATOM   5691 O O     . GLU D 2 266 ? 81.108  24.612 77.516  1.00 26.74  ? 266 GLU B O     1 
ATOM   5692 C CB    . GLU D 2 266 ? 77.946  25.476 77.063  1.00 26.38  ? 266 GLU B CB    1 
ATOM   5693 C CG    . GLU D 2 266 ? 77.471  24.665 78.234  1.00 55.53  ? 266 GLU B CG    1 
ATOM   5694 C CD    . GLU D 2 266 ? 77.431  23.190 77.909  1.00 72.25  ? 266 GLU B CD    1 
ATOM   5695 O OE1   . GLU D 2 266 ? 78.455  22.511 78.120  1.00 82.28  ? 266 GLU B OE1   1 
ATOM   5696 O OE2   . GLU D 2 266 ? 76.381  22.708 77.433  1.00 77.41  ? 266 GLU B OE2   1 
ATOM   5697 N N     . ALA D 2 267 ? 80.564  25.244 75.419  1.00 26.52  ? 267 ALA B N     1 
ATOM   5698 C CA    . ALA D 2 267 ? 81.583  24.446 74.737  1.00 21.41  ? 267 ALA B CA    1 
ATOM   5699 C C     . ALA D 2 267 ? 82.992  24.868 75.162  1.00 30.84  ? 267 ALA B C     1 
ATOM   5700 O O     . ALA D 2 267 ? 83.779  24.038 75.618  1.00 33.54  ? 267 ALA B O     1 
ATOM   5701 C CB    . ALA D 2 267 ? 81.432  24.603 73.239  1.00 6.20   ? 267 ALA B CB    1 
ATOM   5702 N N     . THR D 2 268 ? 83.304  26.154 74.983  1.00 23.85  ? 268 THR B N     1 
ATOM   5703 C CA    . THR D 2 268 ? 84.598  26.703 75.363  1.00 13.30  ? 268 THR B CA    1 
ATOM   5704 C C     . THR D 2 268 ? 84.888  26.329 76.805  1.00 21.70  ? 268 THR B C     1 
ATOM   5705 O O     . THR D 2 268 ? 86.026  26.047 77.180  1.00 26.40  ? 268 THR B O     1 
ATOM   5706 C CB    . THR D 2 268 ? 84.613  28.234 75.281  1.00 12.49  ? 268 THR B CB    1 
ATOM   5707 O OG1   . THR D 2 268 ? 84.466  28.636 73.922  1.00 18.95  ? 268 THR B OG1   1 
ATOM   5708 C CG2   . THR D 2 268 ? 85.924  28.783 75.813  1.00 28.42  ? 268 THR B CG2   1 
ATOM   5709 N N     . HIS D 2 269 ? 83.858  26.328 77.631  1.00 14.98  ? 269 HIS B N     1 
ATOM   5710 C CA    . HIS D 2 269 ? 84.085  25.987 79.010  1.00 12.85  ? 269 HIS B CA    1 
ATOM   5711 C C     . HIS D 2 269 ? 84.381  24.492 79.178  1.00 16.79  ? 269 HIS B C     1 
ATOM   5712 O O     . HIS D 2 269 ? 85.322  24.092 79.851  1.00 20.52  ? 269 HIS B O     1 
ATOM   5713 C CB    . HIS D 2 269 ? 82.868  26.359 79.825  1.00 15.49  ? 269 HIS B CB    1 
ATOM   5714 C CG    . HIS D 2 269 ? 82.950  25.886 81.232  1.00 15.54  ? 269 HIS B CG    1 
ATOM   5715 N ND1   . HIS D 2 269 ? 82.668  24.584 81.597  1.00 31.95  ? 269 HIS B ND1   1 
ATOM   5716 C CD2   . HIS D 2 269 ? 83.366  26.509 82.354  1.00 2.00   ? 269 HIS B CD2   1 
ATOM   5717 C CE1   . HIS D 2 269 ? 82.910  24.431 82.885  1.00 32.59  ? 269 HIS B CE1   1 
ATOM   5718 N NE2   . HIS D 2 269 ? 83.339  25.586 83.368  1.00 13.05  ? 269 HIS B NE2   1 
ATOM   5719 N N     . ARG D 2 270 ? 83.523  23.681 78.586  1.00 17.51  ? 270 ARG B N     1 
ATOM   5720 C CA    . ARG D 2 270 ? 83.629  22.234 78.619  1.00 25.10  ? 270 ARG B CA    1 
ATOM   5721 C C     . ARG D 2 270 ? 85.001  21.799 78.126  1.00 30.68  ? 270 ARG B C     1 
ATOM   5722 O O     . ARG D 2 270 ? 85.565  20.801 78.579  1.00 35.93  ? 270 ARG B O     1 
ATOM   5723 C CB    . ARG D 2 270 ? 82.539  21.638 77.712  1.00 19.68  ? 270 ARG B CB    1 
ATOM   5724 C CG    . ARG D 2 270 ? 82.428  20.109 77.727  1.00 25.49  ? 270 ARG B CG    1 
ATOM   5725 C CD    . ARG D 2 270 ? 81.289  19.619 76.838  1.00 34.91  ? 270 ARG B CD    1 
ATOM   5726 N NE    . ARG D 2 270 ? 81.178  20.378 75.588  1.00 51.39  ? 270 ARG B NE    1 
ATOM   5727 C CZ    . ARG D 2 270 ? 80.027  20.781 75.048  1.00 58.19  ? 270 ARG B CZ    1 
ATOM   5728 N NH1   . ARG D 2 270 ? 78.869  20.502 75.648  1.00 66.79  ? 270 ARG B NH1   1 
ATOM   5729 N NH2   . ARG D 2 270 ? 80.034  21.468 73.912  1.00 57.03  ? 270 ARG B NH2   1 
ATOM   5730 N N     . LEU D 2 271 ? 85.531  22.565 77.185  1.00 30.78  ? 271 LEU B N     1 
ATOM   5731 C CA    . LEU D 2 271 ? 86.814  22.256 76.588  1.00 23.17  ? 271 LEU B CA    1 
ATOM   5732 C C     . LEU D 2 271 ? 87.915  22.457 77.604  1.00 24.80  ? 271 LEU B C     1 
ATOM   5733 O O     . LEU D 2 271 ? 88.764  21.595 77.789  1.00 31.32  ? 271 LEU B O     1 
ATOM   5734 C CB    . LEU D 2 271 ? 87.053  23.149 75.380  1.00 14.46  ? 271 LEU B CB    1 
ATOM   5735 C CG    . LEU D 2 271 ? 88.511  23.308 74.973  1.00 27.66  ? 271 LEU B CG    1 
ATOM   5736 C CD1   . LEU D 2 271 ? 88.732  22.665 73.616  1.00 25.14  ? 271 LEU B CD1   1 
ATOM   5737 C CD2   . LEU D 2 271 ? 88.864  24.784 74.928  1.00 21.52  ? 271 LEU B CD2   1 
ATOM   5738 N N     . ILE D 2 272 ? 87.898  23.596 78.276  1.00 23.24  ? 272 ILE B N     1 
ATOM   5739 C CA    . ILE D 2 272 ? 88.916  23.856 79.275  1.00 31.98  ? 272 ILE B CA    1 
ATOM   5740 C C     . ILE D 2 272 ? 88.696  23.116 80.577  1.00 39.80  ? 272 ILE B C     1 
ATOM   5741 O O     . ILE D 2 272 ? 89.656  22.635 81.180  1.00 43.38  ? 272 ILE B O     1 
ATOM   5742 C CB    . ILE D 2 272 ? 88.976  25.313 79.680  1.00 35.26  ? 272 ILE B CB    1 
ATOM   5743 C CG1   . ILE D 2 272 ? 89.081  26.195 78.449  1.00 28.77  ? 272 ILE B CG1   1 
ATOM   5744 C CG2   . ILE D 2 272 ? 90.147  25.511 80.643  1.00 29.61  ? 272 ILE B CG2   1 
ATOM   5745 C CD1   . ILE D 2 272 ? 90.280  25.890 77.638  1.00 52.76  ? 272 ILE B CD1   1 
ATOM   5746 N N     . TYR D 2 273 ? 87.442  23.033 81.015  1.00 35.94  ? 273 TYR B N     1 
ATOM   5747 C CA    . TYR D 2 273 ? 87.143  22.406 82.293  1.00 27.60  ? 273 TYR B CA    1 
ATOM   5748 C C     . TYR D 2 273 ? 86.409  21.097 82.330  1.00 30.93  ? 273 TYR B C     1 
ATOM   5749 O O     . TYR D 2 273 ? 86.044  20.636 83.401  1.00 41.30  ? 273 TYR B O     1 
ATOM   5750 C CB    . TYR D 2 273 ? 86.397  23.386 83.160  1.00 15.17  ? 273 TYR B CB    1 
ATOM   5751 C CG    . TYR D 2 273 ? 87.210  24.593 83.380  1.00 21.72  ? 273 TYR B CG    1 
ATOM   5752 C CD1   . TYR D 2 273 ? 87.183  25.628 82.467  1.00 20.01  ? 273 TYR B CD1   1 
ATOM   5753 C CD2   . TYR D 2 273 ? 88.015  24.716 84.503  1.00 20.94  ? 273 TYR B CD2   1 
ATOM   5754 C CE1   . TYR D 2 273 ? 87.944  26.777 82.659  1.00 39.01  ? 273 TYR B CE1   1 
ATOM   5755 C CE2   . TYR D 2 273 ? 88.783  25.854 84.717  1.00 26.43  ? 273 TYR B CE2   1 
ATOM   5756 C CZ    . TYR D 2 273 ? 88.739  26.887 83.790  1.00 40.18  ? 273 TYR B CZ    1 
ATOM   5757 O OH    . TYR D 2 273 ? 89.458  28.042 83.998  1.00 53.75  ? 273 TYR B OH    1 
ATOM   5758 N N     . GLY D 2 274 ? 86.170  20.486 81.187  1.00 30.55  ? 274 GLY B N     1 
ATOM   5759 C CA    . GLY D 2 274 ? 85.486  19.211 81.221  1.00 27.88  ? 274 GLY B CA    1 
ATOM   5760 C C     . GLY D 2 274 ? 83.974  19.335 81.242  1.00 35.30  ? 274 GLY B C     1 
ATOM   5761 O O     . GLY D 2 274 ? 83.444  20.443 81.208  1.00 41.73  ? 274 GLY B O     1 
ATOM   5762 N N     . ALA D 2 275 ? 83.286  18.197 81.314  1.00 36.45  ? 275 ALA B N     1 
ATOM   5763 C CA    . ALA D 2 275 ? 81.827  18.152 81.307  1.00 37.71  ? 275 ALA B CA    1 
ATOM   5764 C C     . ALA D 2 275 ? 81.146  18.588 82.605  1.00 36.02  ? 275 ALA B C     1 
ATOM   5765 O O     . ALA D 2 275 ? 81.650  18.357 83.699  1.00 44.85  ? 275 ALA B O     1 
ATOM   5766 C CB    . ALA D 2 275 ? 81.376  16.767 80.919  1.00 43.47  ? 275 ALA B CB    1 
ATOM   5767 N N     . LYS D 2 276 ? 79.984  19.221 82.454  1.00 44.56  ? 276 LYS B N     1 
ATOM   5768 C CA    . LYS D 2 276 ? 79.184  19.740 83.566  1.00 45.97  ? 276 LYS B CA    1 
ATOM   5769 C C     . LYS D 2 276 ? 78.966  18.711 84.651  1.00 48.03  ? 276 LYS B C     1 
ATOM   5770 O O     . LYS D 2 276 ? 79.102  17.505 84.442  1.00 48.84  ? 276 LYS B O     1 
ATOM   5771 C CB    . LYS D 2 276 ? 77.796  20.172 83.071  1.00 43.88  ? 276 LYS B CB    1 
ATOM   5772 C CG    . LYS D 2 276 ? 77.519  21.664 82.954  1.00 30.08  ? 276 LYS B CG    1 
ATOM   5773 C CD    . LYS D 2 276 ? 76.431  21.857 81.880  1.00 36.42  ? 276 LYS B CD    1 
ATOM   5774 C CE    . LYS D 2 276 ? 75.481  23.023 82.146  1.00 32.08  ? 276 LYS B CE    1 
ATOM   5775 N NZ    . LYS D 2 276 ? 75.404  23.919 80.944  1.00 36.58  ? 276 LYS B NZ    1 
ATOM   5776 N N     . ASP D 2 277 ? 78.570  19.209 85.808  1.00 48.27  ? 277 ASP B N     1 
ATOM   5777 C CA    . ASP D 2 277 ? 78.298  18.340 86.913  1.00 58.02  ? 277 ASP B CA    1 
ATOM   5778 C C     . ASP D 2 277 ? 77.183  17.430 86.474  1.00 59.44  ? 277 ASP B C     1 
ATOM   5779 O O     . ASP D 2 277 ? 76.549  17.648 85.451  1.00 60.46  ? 277 ASP B O     1 
ATOM   5780 C CB    . ASP D 2 277 ? 77.841  19.132 88.121  1.00 70.48  ? 277 ASP B CB    1 
ATOM   5781 C CG    . ASP D 2 277 ? 77.819  18.297 89.360  1.00 85.73  ? 277 ASP B CG    1 
ATOM   5782 O OD1   . ASP D 2 277 ? 78.596  17.318 89.412  1.00 90.70  ? 277 ASP B OD1   1 
ATOM   5783 O OD2   . ASP D 2 277 ? 77.029  18.610 90.272  1.00 99.75  ? 277 ASP B OD2   1 
ATOM   5784 N N     . ASP D 2 278 ? 76.939  16.396 87.251  1.00 66.10  ? 278 ASP B N     1 
ATOM   5785 C CA    . ASP D 2 278 ? 75.887  15.473 86.903  1.00 73.57  ? 278 ASP B CA    1 
ATOM   5786 C C     . ASP D 2 278 ? 74.588  15.990 87.491  1.00 71.73  ? 278 ASP B C     1 
ATOM   5787 O O     . ASP D 2 278 ? 73.511  15.709 86.965  1.00 72.65  ? 278 ASP B O     1 
ATOM   5788 C CB    . ASP D 2 278 ? 76.207  14.081 87.449  1.00 83.05  ? 278 ASP B CB    1 
ATOM   5789 C CG    . ASP D 2 278 ? 76.268  14.053 88.961  1.00 92.52  ? 278 ASP B CG    1 
ATOM   5790 O OD1   . ASP D 2 278 ? 76.397  12.954 89.540  1.00 95.49  ? 278 ASP B OD1   1 
ATOM   5791 O OD2   . ASP D 2 278 ? 76.186  15.135 89.575  1.00 97.31  ? 278 ASP B OD2   1 
ATOM   5792 N N     . SER D 2 279 ? 74.701  16.774 88.563  1.00 65.89  ? 279 SER B N     1 
ATOM   5793 C CA    . SER D 2 279 ? 73.533  17.314 89.251  1.00 67.46  ? 279 SER B CA    1 
ATOM   5794 C C     . SER D 2 279 ? 72.479  17.910 88.325  1.00 70.85  ? 279 SER B C     1 
ATOM   5795 O O     . SER D 2 279 ? 71.522  17.238 87.953  1.00 68.60  ? 279 SER B O     1 
ATOM   5796 C CB    . SER D 2 279 ? 73.960  18.361 90.280  1.00 55.32  ? 279 SER B CB    1 
ATOM   5797 O OG    . SER D 2 279 ? 74.585  19.472 89.666  1.00 47.76  ? 279 SER B OG    1 
ATOM   5798 N N     . GLY D 2 280 ? 72.648  19.172 87.958  1.00 72.72  ? 280 GLY B N     1 
ATOM   5799 C CA    . GLY D 2 280 ? 71.684  19.809 87.081  1.00 72.99  ? 280 GLY B CA    1 
ATOM   5800 C C     . GLY D 2 280 ? 71.486  21.278 87.414  1.00 69.58  ? 280 GLY B C     1 
ATOM   5801 O O     . GLY D 2 280 ? 70.668  21.956 86.791  1.00 68.07  ? 280 GLY B O     1 
ATOM   5802 N N     . GLN D 2 281 ? 72.251  21.772 88.385  1.00 66.78  ? 281 GLN B N     1 
ATOM   5803 C CA    . GLN D 2 281 ? 72.154  23.165 88.822  1.00 60.09  ? 281 GLN B CA    1 
ATOM   5804 C C     . GLN D 2 281 ? 72.400  24.155 87.695  1.00 54.61  ? 281 GLN B C     1 
ATOM   5805 O O     . GLN D 2 281 ? 72.522  23.776 86.534  1.00 64.28  ? 281 GLN B O     1 
ATOM   5806 C CB    . GLN D 2 281 ? 73.123  23.430 89.978  1.00 69.73  ? 281 GLN B CB    1 
ATOM   5807 C CG    . GLN D 2 281 ? 72.585  22.966 91.338  1.00 91.43  ? 281 GLN B CG    1 
ATOM   5808 C CD    . GLN D 2 281 ? 71.424  21.965 91.230  1.00 100.00 ? 281 GLN B CD    1 
ATOM   5809 O OE1   . GLN D 2 281 ? 71.628  20.773 90.964  1.00 100.00 ? 281 GLN B OE1   1 
ATOM   5810 N NE2   . GLN D 2 281 ? 70.201  22.453 91.442  1.00 100.00 ? 281 GLN B NE2   1 
ATOM   5811 N N     . ARG D 2 282 ? 72.469  25.432 88.034  1.00 46.88  ? 282 ARG B N     1 
ATOM   5812 C CA    . ARG D 2 282 ? 72.660  26.449 87.013  1.00 40.02  ? 282 ARG B CA    1 
ATOM   5813 C C     . ARG D 2 282 ? 73.965  27.205 87.200  1.00 35.47  ? 282 ARG B C     1 
ATOM   5814 O O     . ARG D 2 282 ? 74.461  27.343 88.314  1.00 42.84  ? 282 ARG B O     1 
ATOM   5815 C CB    . ARG D 2 282 ? 71.466  27.414 87.027  1.00 38.92  ? 282 ARG B CB    1 
ATOM   5816 C CG    . ARG D 2 282 ? 71.498  28.514 85.979  1.00 48.88  ? 282 ARG B CG    1 
ATOM   5817 C CD    . ARG D 2 282 ? 70.288  29.451 86.074  1.00 46.23  ? 282 ARG B CD    1 
ATOM   5818 N NE    . ARG D 2 282 ? 69.060  28.810 85.612  1.00 50.57  ? 282 ARG B NE    1 
ATOM   5819 C CZ    . ARG D 2 282 ? 68.054  29.436 85.003  1.00 56.85  ? 282 ARG B CZ    1 
ATOM   5820 N NH1   . ARG D 2 282 ? 68.104  30.739 84.762  1.00 42.85  ? 282 ARG B NH1   1 
ATOM   5821 N NH2   . ARG D 2 282 ? 66.979  28.744 84.653  1.00 48.63  ? 282 ARG B NH2   1 
ATOM   5822 N N     . TYR D 2 283 ? 74.520  27.674 86.091  1.00 29.99  ? 283 TYR B N     1 
ATOM   5823 C CA    . TYR D 2 283 ? 75.765  28.428 86.088  1.00 28.85  ? 283 TYR B CA    1 
ATOM   5824 C C     . TYR D 2 283 ? 76.965  27.572 86.440  1.00 24.82  ? 283 TYR B C     1 
ATOM   5825 O O     . TYR D 2 283 ? 77.962  28.071 86.955  1.00 31.04  ? 283 TYR B O     1 
ATOM   5826 C CB    . TYR D 2 283 ? 75.686  29.613 87.051  1.00 26.29  ? 283 TYR B CB    1 
ATOM   5827 C CG    . TYR D 2 283 ? 74.599  30.590 86.700  1.00 33.25  ? 283 TYR B CG    1 
ATOM   5828 C CD1   . TYR D 2 283 ? 73.616  30.925 87.625  1.00 35.27  ? 283 TYR B CD1   1 
ATOM   5829 C CD2   . TYR D 2 283 ? 74.547  31.184 85.439  1.00 35.15  ? 283 TYR B CD2   1 
ATOM   5830 C CE1   . TYR D 2 283 ? 72.609  31.831 87.313  1.00 42.11  ? 283 TYR B CE1   1 
ATOM   5831 C CE2   . TYR D 2 283 ? 73.544  32.097 85.109  1.00 32.71  ? 283 TYR B CE2   1 
ATOM   5832 C CZ    . TYR D 2 283 ? 72.575  32.412 86.055  1.00 45.76  ? 283 TYR B CZ    1 
ATOM   5833 O OH    . TYR D 2 283 ? 71.568  33.300 85.751  1.00 49.98  ? 283 TYR B OH    1 
ATOM   5834 N N     . LEU D 2 284 ? 76.875  26.282 86.152  1.00 19.63  ? 284 LEU B N     1 
ATOM   5835 C CA    . LEU D 2 284 ? 77.988  25.388 86.419  1.00 30.79  ? 284 LEU B CA    1 
ATOM   5836 C C     . LEU D 2 284 ? 78.958  25.494 85.226  1.00 33.82  ? 284 LEU B C     1 
ATOM   5837 O O     . LEU D 2 284 ? 79.932  24.744 85.128  1.00 38.80  ? 284 LEU B O     1 
ATOM   5838 C CB    . LEU D 2 284 ? 77.475  23.945 86.596  1.00 23.77  ? 284 LEU B CB    1 
ATOM   5839 C CG    . LEU D 2 284 ? 76.543  23.660 87.789  1.00 27.57  ? 284 LEU B CG    1 
ATOM   5840 C CD1   . LEU D 2 284 ? 76.701  22.220 88.222  1.00 32.59  ? 284 LEU B CD1   1 
ATOM   5841 C CD2   . LEU D 2 284 ? 76.856  24.595 88.958  1.00 31.66  ? 284 LEU B CD2   1 
ATOM   5842 N N     . ALA D 2 285 ? 78.677  26.447 84.335  1.00 30.88  ? 285 ALA B N     1 
ATOM   5843 C CA    . ALA D 2 285 ? 79.483  26.689 83.142  1.00 16.92  ? 285 ALA B CA    1 
ATOM   5844 C C     . ALA D 2 285 ? 79.222  28.102 82.611  1.00 17.07  ? 285 ALA B C     1 
ATOM   5845 O O     . ALA D 2 285 ? 78.290  28.770 83.039  1.00 28.25  ? 285 ALA B O     1 
ATOM   5846 C CB    . ALA D 2 285 ? 79.143  25.661 82.075  1.00 11.77  ? 285 ALA B CB    1 
ATOM   5847 N N     . TRP D 2 286 ? 80.042  28.559 81.674  1.00 17.62  ? 286 TRP B N     1 
ATOM   5848 C CA    . TRP D 2 286 ? 79.878  29.898 81.120  1.00 24.62  ? 286 TRP B CA    1 
ATOM   5849 C C     . TRP D 2 286 ? 78.607  30.004 80.285  1.00 24.28  ? 286 TRP B C     1 
ATOM   5850 O O     . TRP D 2 286 ? 78.189  29.061 79.626  1.00 23.20  ? 286 TRP B O     1 
ATOM   5851 C CB    . TRP D 2 286 ? 81.087  30.283 80.258  1.00 27.92  ? 286 TRP B CB    1 
ATOM   5852 C CG    . TRP D 2 286 ? 82.338  30.539 81.022  1.00 21.56  ? 286 TRP B CG    1 
ATOM   5853 C CD1   . TRP D 2 286 ? 82.468  31.222 82.201  1.00 28.69  ? 286 TRP B CD1   1 
ATOM   5854 C CD2   . TRP D 2 286 ? 83.642  30.090 80.672  1.00 29.69  ? 286 TRP B CD2   1 
ATOM   5855 N NE1   . TRP D 2 286 ? 83.778  31.221 82.604  1.00 22.11  ? 286 TRP B NE1   1 
ATOM   5856 C CE2   . TRP D 2 286 ? 84.520  30.530 81.683  1.00 29.04  ? 286 TRP B CE2   1 
ATOM   5857 C CE3   . TRP D 2 286 ? 84.158  29.355 79.600  1.00 33.07  ? 286 TRP B CE3   1 
ATOM   5858 C CZ2   . TRP D 2 286 ? 85.886  30.261 81.654  1.00 26.95  ? 286 TRP B CZ2   1 
ATOM   5859 C CZ3   . TRP D 2 286 ? 85.517  29.083 79.571  1.00 32.86  ? 286 TRP B CZ3   1 
ATOM   5860 C CH2   . TRP D 2 286 ? 86.367  29.537 80.593  1.00 19.75  ? 286 TRP B CH2   1 
ATOM   5861 N N     . SER D 2 287 ? 78.037  31.196 80.288  1.00 26.88  ? 287 SER B N     1 
ATOM   5862 C CA    . SER D 2 287 ? 76.807  31.472 79.584  1.00 28.17  ? 287 SER B CA    1 
ATOM   5863 C C     . SER D 2 287 ? 76.835  32.877 78.974  1.00 26.84  ? 287 SER B C     1 
ATOM   5864 O O     . SER D 2 287 ? 77.726  33.674 79.251  1.00 29.18  ? 287 SER B O     1 
ATOM   5865 C CB    . SER D 2 287 ? 75.653  31.363 80.575  1.00 23.98  ? 287 SER B CB    1 
ATOM   5866 O OG    . SER D 2 287 ? 75.896  32.189 81.699  1.00 35.07  ? 287 SER B OG    1 
ATOM   5867 N N     . GLY D 2 288 ? 75.835  33.168 78.157  1.00 21.77  ? 288 GLY B N     1 
ATOM   5868 C CA    . GLY D 2 288 ? 75.755  34.455 77.510  1.00 5.16   ? 288 GLY B CA    1 
ATOM   5869 C C     . GLY D 2 288 ? 76.081  35.688 78.330  1.00 17.28  ? 288 GLY B C     1 
ATOM   5870 O O     . GLY D 2 288 ? 76.315  36.750 77.751  1.00 37.96  ? 288 GLY B O     1 
ATOM   5871 N N     . HIS D 2 289 ? 76.076  35.605 79.657  1.00 10.62  ? 289 HIS B N     1 
ATOM   5872 C CA    . HIS D 2 289 ? 76.391  36.813 80.438  1.00 17.30  ? 289 HIS B CA    1 
ATOM   5873 C C     . HIS D 2 289 ? 77.748  36.786 81.121  1.00 21.68  ? 289 HIS B C     1 
ATOM   5874 O O     . HIS D 2 289 ? 78.208  37.792 81.643  1.00 28.70  ? 289 HIS B O     1 
ATOM   5875 C CB    . HIS D 2 289 ? 75.310  37.081 81.494  1.00 26.14  ? 289 HIS B CB    1 
ATOM   5876 C CG    . HIS D 2 289 ? 74.624  38.407 81.331  1.00 46.28  ? 289 HIS B CG    1 
ATOM   5877 N ND1   . HIS D 2 289 ? 73.971  38.770 80.170  1.00 55.64  ? 289 HIS B ND1   1 
ATOM   5878 C CD2   . HIS D 2 289 ? 74.493  39.455 82.180  1.00 41.88  ? 289 HIS B CD2   1 
ATOM   5879 C CE1   . HIS D 2 289 ? 73.467  39.985 80.309  1.00 50.64  ? 289 HIS B CE1   1 
ATOM   5880 N NE2   . HIS D 2 289 ? 73.771  40.422 81.519  1.00 55.82  ? 289 HIS B NE2   1 
ATOM   5881 N N     . SER D 2 290 ? 78.394  35.629 81.116  1.00 26.82  ? 290 SER B N     1 
ATOM   5882 C CA    . SER D 2 290 ? 79.694  35.494 81.754  1.00 16.70  ? 290 SER B CA    1 
ATOM   5883 C C     . SER D 2 290 ? 80.677  36.604 81.430  1.00 17.42  ? 290 SER B C     1 
ATOM   5884 O O     . SER D 2 290 ? 81.290  37.147 82.336  1.00 17.36  ? 290 SER B O     1 
ATOM   5885 C CB    . SER D 2 290 ? 80.315  34.145 81.399  1.00 25.37  ? 290 SER B CB    1 
ATOM   5886 O OG    . SER D 2 290 ? 79.392  33.102 81.655  1.00 19.64  ? 290 SER B OG    1 
ATOM   5887 N N     . ALA D 2 291 ? 80.820  36.962 80.156  1.00 14.67  ? 291 ALA B N     1 
ATOM   5888 C CA    . ALA D 2 291 ? 81.790  37.995 79.779  1.00 13.54  ? 291 ALA B CA    1 
ATOM   5889 C C     . ALA D 2 291 ? 81.444  39.376 80.298  1.00 25.79  ? 291 ALA B C     1 
ATOM   5890 O O     . ALA D 2 291 ? 82.332  40.166 80.623  1.00 25.75  ? 291 ALA B O     1 
ATOM   5891 C CB    . ALA D 2 291 ? 81.974  38.033 78.288  1.00 8.91   ? 291 ALA B CB    1 
ATOM   5892 N N     . ARG D 2 292 ? 80.158  39.659 80.374  1.00 26.79  ? 292 ARG B N     1 
ATOM   5893 C CA    . ARG D 2 292 ? 79.683  40.921 80.898  1.00 24.76  ? 292 ARG B CA    1 
ATOM   5894 C C     . ARG D 2 292 ? 80.079  40.989 82.388  1.00 32.09  ? 292 ARG B C     1 
ATOM   5895 O O     . ARG D 2 292 ? 80.925  41.802 82.771  1.00 35.20  ? 292 ARG B O     1 
ATOM   5896 C CB    . ARG D 2 292 ? 78.173  40.986 80.753  1.00 34.00  ? 292 ARG B CB    1 
ATOM   5897 C CG    . ARG D 2 292 ? 77.641  42.352 80.483  1.00 39.91  ? 292 ARG B CG    1 
ATOM   5898 C CD    . ARG D 2 292 ? 76.141  42.342 80.495  1.00 27.18  ? 292 ARG B CD    1 
ATOM   5899 N NE    . ARG D 2 292 ? 75.659  43.628 80.960  1.00 36.72  ? 292 ARG B NE    1 
ATOM   5900 C CZ    . ARG D 2 292 ? 75.789  44.752 80.277  1.00 31.26  ? 292 ARG B CZ    1 
ATOM   5901 N NH1   . ARG D 2 292 ? 76.400  44.743 79.104  1.00 35.52  ? 292 ARG B NH1   1 
ATOM   5902 N NH2   . ARG D 2 292 ? 75.325  45.890 80.772  1.00 35.63  ? 292 ARG B NH2   1 
ATOM   5903 N N     . VAL D 2 293 ? 79.508  40.114 83.217  1.00 25.00  ? 293 VAL B N     1 
ATOM   5904 C CA    . VAL D 2 293 ? 79.834  40.138 84.649  1.00 23.73  ? 293 VAL B CA    1 
ATOM   5905 C C     . VAL D 2 293 ? 81.346  40.051 84.899  1.00 21.67  ? 293 VAL B C     1 
ATOM   5906 O O     . VAL D 2 293 ? 81.873  40.780 85.732  1.00 34.08  ? 293 VAL B O     1 
ATOM   5907 C CB    . VAL D 2 293 ? 79.074  39.002 85.475  1.00 22.70  ? 293 VAL B CB    1 
ATOM   5908 C CG1   . VAL D 2 293 ? 78.388  38.005 84.553  1.00 16.22  ? 293 VAL B CG1   1 
ATOM   5909 C CG2   . VAL D 2 293 ? 80.036  38.283 86.403  1.00 17.41  ? 293 VAL B CG2   1 
ATOM   5910 N N     . GLY D 2 294 ? 82.032  39.162 84.181  1.00 23.60  ? 294 GLY B N     1 
ATOM   5911 C CA    . GLY D 2 294 ? 83.475  39.011 84.310  1.00 22.44  ? 294 GLY B CA    1 
ATOM   5912 C C     . GLY D 2 294 ? 84.249  40.276 83.935  1.00 28.91  ? 294 GLY B C     1 
ATOM   5913 O O     . GLY D 2 294 ? 85.013  40.778 84.752  1.00 25.93  ? 294 GLY B O     1 
ATOM   5914 N N     . ALA D 2 295 ? 84.078  40.786 82.713  1.00 29.27  ? 295 ALA B N     1 
ATOM   5915 C CA    . ALA D 2 295 ? 84.773  42.011 82.305  1.00 22.13  ? 295 ALA B CA    1 
ATOM   5916 C C     . ALA D 2 295 ? 84.576  43.051 83.404  1.00 29.87  ? 295 ALA B C     1 
ATOM   5917 O O     . ALA D 2 295 ? 85.540  43.625 83.900  1.00 32.00  ? 295 ALA B O     1 
ATOM   5918 C CB    . ALA D 2 295 ? 84.205  42.533 80.988  1.00 26.09  ? 295 ALA B CB    1 
ATOM   5919 N N     . ALA D 2 296 ? 83.314  43.271 83.784  1.00 35.53  ? 296 ALA B N     1 
ATOM   5920 C CA    . ALA D 2 296 ? 82.912  44.229 84.827  1.00 25.38  ? 296 ALA B CA    1 
ATOM   5921 C C     . ALA D 2 296 ? 83.807  44.171 86.050  1.00 31.00  ? 296 ALA B C     1 
ATOM   5922 O O     . ALA D 2 296 ? 84.405  45.168 86.451  1.00 34.20  ? 296 ALA B O     1 
ATOM   5923 C CB    . ALA D 2 296 ? 81.490  43.952 85.247  1.00 13.80  ? 296 ALA B CB    1 
ATOM   5924 N N     . ARG D 2 297 ? 83.872  42.993 86.653  1.00 35.08  ? 297 ARG B N     1 
ATOM   5925 C CA    . ARG D 2 297 ? 84.695  42.771 87.823  1.00 27.47  ? 297 ARG B CA    1 
ATOM   5926 C C     . ARG D 2 297 ? 86.119  43.212 87.521  1.00 30.70  ? 297 ARG B C     1 
ATOM   5927 O O     . ARG D 2 297 ? 86.637  44.145 88.122  1.00 40.69  ? 297 ARG B O     1 
ATOM   5928 C CB    . ARG D 2 297 ? 84.694  41.296 88.157  1.00 28.86  ? 297 ARG B CB    1 
ATOM   5929 C CG    . ARG D 2 297 ? 83.329  40.684 88.125  1.00 22.99  ? 297 ARG B CG    1 
ATOM   5930 C CD    . ARG D 2 297 ? 83.167  39.815 89.322  1.00 33.13  ? 297 ARG B CD    1 
ATOM   5931 N NE    . ARG D 2 297 ? 81.931  39.055 89.284  1.00 48.04  ? 297 ARG B NE    1 
ATOM   5932 C CZ    . ARG D 2 297 ? 81.888  37.729 89.290  1.00 57.63  ? 297 ARG B CZ    1 
ATOM   5933 N NH1   . ARG D 2 297 ? 83.027  37.044 89.328  1.00 56.96  ? 297 ARG B NH1   1 
ATOM   5934 N NH2   . ARG D 2 297 ? 80.713  37.095 89.293  1.00 61.67  ? 297 ARG B NH2   1 
ATOM   5935 N N     . ASP D 2 298 ? 86.733  42.541 86.557  1.00 35.91  ? 298 ASP B N     1 
ATOM   5936 C CA    . ASP D 2 298 ? 88.107  42.825 86.152  1.00 47.16  ? 298 ASP B CA    1 
ATOM   5937 C C     . ASP D 2 298 ? 88.418  44.324 86.086  1.00 48.08  ? 298 ASP B C     1 
ATOM   5938 O O     . ASP D 2 298 ? 89.525  44.757 86.408  1.00 52.56  ? 298 ASP B O     1 
ATOM   5939 C CB    . ASP D 2 298 ? 88.386  42.167 84.790  1.00 52.47  ? 298 ASP B CB    1 
ATOM   5940 C CG    . ASP D 2 298 ? 88.502  40.645 84.883  1.00 69.71  ? 298 ASP B CG    1 
ATOM   5941 O OD1   . ASP D 2 298 ? 89.472  40.078 84.345  1.00 86.43  ? 298 ASP B OD1   1 
ATOM   5942 O OD2   . ASP D 2 298 ? 87.624  40.008 85.495  1.00 81.53  ? 298 ASP B OD2   1 
ATOM   5943 N N     . MET D 2 299 ? 87.414  45.096 85.683  1.00 47.05  ? 299 MET B N     1 
ATOM   5944 C CA    . MET D 2 299 ? 87.495  46.550 85.535  1.00 43.46  ? 299 MET B CA    1 
ATOM   5945 C C     . MET D 2 299 ? 87.615  47.273 86.867  1.00 46.41  ? 299 MET B C     1 
ATOM   5946 O O     . MET D 2 299 ? 88.454  48.160 87.044  1.00 47.75  ? 299 MET B O     1 
ATOM   5947 C CB    . MET D 2 299 ? 86.234  47.055 84.829  1.00 41.10  ? 299 MET B CB    1 
ATOM   5948 C CG    . MET D 2 299 ? 86.480  48.034 83.715  1.00 40.65  ? 299 MET B CG    1 
ATOM   5949 S SD    . MET D 2 299 ? 85.191  47.976 82.467  1.00 42.03  ? 299 MET B SD    1 
ATOM   5950 C CE    . MET D 2 299 ? 85.488  49.593 81.676  1.00 42.74  ? 299 MET B CE    1 
ATOM   5951 N N     . ALA D 2 300 ? 86.745  46.898 87.794  1.00 45.63  ? 300 ALA B N     1 
ATOM   5952 C CA    . ALA D 2 300 ? 86.731  47.505 89.104  1.00 46.49  ? 300 ALA B CA    1 
ATOM   5953 C C     . ALA D 2 300 ? 87.975  47.073 89.864  1.00 50.81  ? 300 ALA B C     1 
ATOM   5954 O O     . ALA D 2 300 ? 88.627  47.887 90.514  1.00 57.78  ? 300 ALA B O     1 
ATOM   5955 C CB    . ALA D 2 300 ? 85.489  47.076 89.849  1.00 45.79  ? 300 ALA B CB    1 
ATOM   5956 N N     . ARG D 2 301 ? 88.320  45.794 89.761  1.00 54.54  ? 301 ARG B N     1 
ATOM   5957 C CA    . ARG D 2 301 ? 89.482  45.275 90.467  1.00 56.85  ? 301 ARG B CA    1 
ATOM   5958 C C     . ARG D 2 301 ? 90.731  45.968 89.947  1.00 60.27  ? 301 ARG B C     1 
ATOM   5959 O O     . ARG D 2 301 ? 91.809  45.861 90.534  1.00 64.20  ? 301 ARG B O     1 
ATOM   5960 C CB    . ARG D 2 301 ? 89.599  43.765 90.262  1.00 61.09  ? 301 ARG B CB    1 
ATOM   5961 C CG    . ARG D 2 301 ? 88.608  42.931 91.077  1.00 76.68  ? 301 ARG B CG    1 
ATOM   5962 C CD    . ARG D 2 301 ? 88.807  43.090 92.584  1.00 90.83  ? 301 ARG B CD    1 
ATOM   5963 N NE    . ARG D 2 301 ? 87.684  42.548 93.356  1.00 100.00 ? 301 ARG B NE    1 
ATOM   5964 C CZ    . ARG D 2 301 ? 87.781  42.080 94.599  1.00 100.00 ? 301 ARG B CZ    1 
ATOM   5965 N NH1   . ARG D 2 301 ? 88.952  42.085 95.223  1.00 100.00 ? 301 ARG B NH1   1 
ATOM   5966 N NH2   . ARG D 2 301 ? 86.704  41.615 95.225  1.00 100.00 ? 301 ARG B NH2   1 
ATOM   5967 N N     . ALA D 2 302 ? 90.569  46.696 88.848  1.00 60.21  ? 302 ALA B N     1 
ATOM   5968 C CA    . ALA D 2 302 ? 91.674  47.416 88.227  1.00 53.21  ? 302 ALA B CA    1 
ATOM   5969 C C     . ALA D 2 302 ? 91.545  48.855 88.643  1.00 50.43  ? 302 ALA B C     1 
ATOM   5970 O O     . ALA D 2 302 ? 92.286  49.727 88.216  1.00 52.67  ? 302 ALA B O     1 
ATOM   5971 C CB    . ALA D 2 302 ? 91.594  47.303 86.717  1.00 66.82  ? 302 ALA B CB    1 
ATOM   5972 N N     . GLY D 2 303 ? 90.576  49.088 89.502  1.00 52.50  ? 303 GLY B N     1 
ATOM   5973 C CA    . GLY D 2 303 ? 90.355  50.422 89.973  1.00 54.35  ? 303 GLY B CA    1 
ATOM   5974 C C     . GLY D 2 303 ? 90.052  51.341 88.826  1.00 54.63  ? 303 GLY B C     1 
ATOM   5975 O O     . GLY D 2 303 ? 90.665  52.394 88.721  1.00 65.84  ? 303 GLY B O     1 
ATOM   5976 N N     . VAL D 2 304 ? 89.157  50.934 87.929  1.00 53.10  ? 304 VAL B N     1 
ATOM   5977 C CA    . VAL D 2 304 ? 88.763  51.835 86.839  1.00 46.57  ? 304 VAL B CA    1 
ATOM   5978 C C     . VAL D 2 304 ? 87.673  52.783 87.346  1.00 45.00  ? 304 VAL B C     1 
ATOM   5979 O O     . VAL D 2 304 ? 86.911  52.456 88.258  1.00 46.05  ? 304 VAL B O     1 
ATOM   5980 C CB    . VAL D 2 304 ? 88.206  51.090 85.616  1.00 30.45  ? 304 VAL B CB    1 
ATOM   5981 C CG1   . VAL D 2 304 ? 87.479  52.054 84.706  1.00 20.78  ? 304 VAL B CG1   1 
ATOM   5982 C CG2   . VAL D 2 304 ? 89.335  50.448 84.851  1.00 29.21  ? 304 VAL B CG2   1 
ATOM   5983 N N     . SER D 2 305 ? 87.604  53.964 86.749  1.00 48.45  ? 305 SER B N     1 
ATOM   5984 C CA    . SER D 2 305 ? 86.618  54.950 87.155  1.00 51.81  ? 305 SER B CA    1 
ATOM   5985 C C     . SER D 2 305 ? 85.208  54.424 87.010  1.00 55.15  ? 305 SER B C     1 
ATOM   5986 O O     . SER D 2 305 ? 84.868  53.755 86.036  1.00 55.40  ? 305 SER B O     1 
ATOM   5987 C CB    . SER D 2 305 ? 86.748  56.223 86.319  1.00 51.56  ? 305 SER B CB    1 
ATOM   5988 O OG    . SER D 2 305 ? 85.547  56.498 85.612  1.00 59.70  ? 305 SER B OG    1 
ATOM   5989 N N     . ILE D 2 306 ? 84.387  54.758 87.988  1.00 52.23  ? 306 ILE B N     1 
ATOM   5990 C CA    . ILE D 2 306 ? 83.005  54.353 87.989  1.00 51.58  ? 306 ILE B CA    1 
ATOM   5991 C C     . ILE D 2 306 ? 82.322  54.764 86.687  1.00 44.97  ? 306 ILE B C     1 
ATOM   5992 O O     . ILE D 2 306 ? 81.720  53.947 85.989  1.00 44.19  ? 306 ILE B O     1 
ATOM   5993 C CB    . ILE D 2 306 ? 82.279  54.989 89.191  1.00 56.80  ? 306 ILE B CB    1 
ATOM   5994 C CG1   . ILE D 2 306 ? 82.553  54.159 90.449  1.00 68.64  ? 306 ILE B CG1   1 
ATOM   5995 C CG2   . ILE D 2 306 ? 80.793  55.128 88.907  1.00 47.38  ? 306 ILE B CG2   1 
ATOM   5996 C CD1   . ILE D 2 306 ? 81.799  52.844 90.503  1.00 67.45  ? 306 ILE B CD1   1 
ATOM   5997 N N     . PRO D 2 307 ? 82.392  56.046 86.349  1.00 39.90  ? 307 PRO B N     1 
ATOM   5998 C CA    . PRO D 2 307 ? 81.741  56.451 85.108  1.00 41.05  ? 307 PRO B CA    1 
ATOM   5999 C C     . PRO D 2 307 ? 82.303  55.682 83.943  1.00 46.83  ? 307 PRO B C     1 
ATOM   6000 O O     . PRO D 2 307 ? 81.599  55.433 82.973  1.00 50.86  ? 307 PRO B O     1 
ATOM   6001 C CB    . PRO D 2 307 ? 82.030  57.939 85.018  1.00 41.59  ? 307 PRO B CB    1 
ATOM   6002 C CG    . PRO D 2 307 ? 82.344  58.336 86.439  1.00 52.71  ? 307 PRO B CG    1 
ATOM   6003 C CD    . PRO D 2 307 ? 83.018  57.172 87.053  1.00 38.15  ? 307 PRO B CD    1 
ATOM   6004 N N     . GLU D 2 308 ? 83.567  55.280 84.047  1.00 48.66  ? 308 GLU B N     1 
ATOM   6005 C CA    . GLU D 2 308 ? 84.201  54.532 82.965  1.00 53.95  ? 308 GLU B CA    1 
ATOM   6006 C C     . GLU D 2 308 ? 83.530  53.175 82.900  1.00 46.06  ? 308 GLU B C     1 
ATOM   6007 O O     . GLU D 2 308 ? 83.185  52.691 81.832  1.00 46.60  ? 308 GLU B O     1 
ATOM   6008 C CB    . GLU D 2 308 ? 85.697  54.361 83.215  1.00 58.57  ? 308 GLU B CB    1 
ATOM   6009 C CG    . GLU D 2 308 ? 86.572  55.031 82.169  1.00 61.69  ? 308 GLU B CG    1 
ATOM   6010 C CD    . GLU D 2 308 ? 88.039  55.106 82.579  1.00 74.88  ? 308 GLU B CD    1 
ATOM   6011 O OE1   . GLU D 2 308 ? 88.335  55.255 83.787  1.00 82.41  ? 308 GLU B OE1   1 
ATOM   6012 O OE2   . GLU D 2 308 ? 88.904  55.016 81.683  1.00 79.81  ? 308 GLU B OE2   1 
ATOM   6013 N N     . ILE D 2 309 ? 83.327  52.570 84.060  1.00 36.92  ? 309 ILE B N     1 
ATOM   6014 C CA    . ILE D 2 309 ? 82.661  51.287 84.130  1.00 30.05  ? 309 ILE B CA    1 
ATOM   6015 C C     . ILE D 2 309 ? 81.268  51.394 83.551  1.00 30.12  ? 309 ILE B C     1 
ATOM   6016 O O     . ILE D 2 309 ? 80.865  50.584 82.728  1.00 32.83  ? 309 ILE B O     1 
ATOM   6017 C CB    . ILE D 2 309 ? 82.498  50.842 85.554  1.00 30.71  ? 309 ILE B CB    1 
ATOM   6018 C CG1   . ILE D 2 309 ? 83.871  50.740 86.208  1.00 31.48  ? 309 ILE B CG1   1 
ATOM   6019 C CG2   . ILE D 2 309 ? 81.714  49.549 85.588  1.00 22.35  ? 309 ILE B CG2   1 
ATOM   6020 C CD1   . ILE D 2 309 ? 83.897  49.881 87.442  1.00 37.79  ? 309 ILE B CD1   1 
ATOM   6021 N N     . MET D 2 310 ? 80.516  52.381 84.010  1.00 30.56  ? 310 MET B N     1 
ATOM   6022 C CA    . MET D 2 310 ? 79.170  52.565 83.505  1.00 38.39  ? 310 MET B CA    1 
ATOM   6023 C C     . MET D 2 310 ? 79.227  52.846 82.007  1.00 40.07  ? 310 MET B C     1 
ATOM   6024 O O     . MET D 2 310 ? 78.338  52.464 81.258  1.00 38.30  ? 310 MET B O     1 
ATOM   6025 C CB    . MET D 2 310 ? 78.513  53.733 84.212  1.00 49.19  ? 310 MET B CB    1 
ATOM   6026 C CG    . MET D 2 310 ? 78.300  53.516 85.684  1.00 52.02  ? 310 MET B CG    1 
ATOM   6027 S SD    . MET D 2 310 ? 78.777  54.969 86.610  1.00 68.11  ? 310 MET B SD    1 
ATOM   6028 C CE    . MET D 2 310 ? 77.704  56.215 85.908  1.00 52.11  ? 310 MET B CE    1 
ATOM   6029 N N     . GLN D 2 311 ? 80.276  53.535 81.578  1.00 41.38  ? 311 GLN B N     1 
ATOM   6030 C CA    . GLN D 2 311 ? 80.453  53.848 80.163  1.00 52.63  ? 311 GLN B CA    1 
ATOM   6031 C C     . GLN D 2 311 ? 80.525  52.539 79.360  1.00 54.90  ? 311 GLN B C     1 
ATOM   6032 O O     . GLN D 2 311 ? 79.980  52.412 78.260  1.00 58.08  ? 311 GLN B O     1 
ATOM   6033 C CB    . GLN D 2 311 ? 81.756  54.632 79.973  1.00 63.67  ? 311 GLN B CB    1 
ATOM   6034 C CG    . GLN D 2 311 ? 82.025  55.074 78.546  1.00 74.42  ? 311 GLN B CG    1 
ATOM   6035 C CD    . GLN D 2 311 ? 80.788  55.642 77.870  1.00 89.75  ? 311 GLN B CD    1 
ATOM   6036 O OE1   . GLN D 2 311 ? 79.992  56.355 78.490  1.00 100.00 ? 311 GLN B OE1   1 
ATOM   6037 N NE2   . GLN D 2 311 ? 80.615  55.326 76.594  1.00 93.52  ? 311 GLN B NE2   1 
ATOM   6038 N N     . ALA D 2 312 ? 81.198  51.563 79.956  1.00 53.67  ? 312 ALA B N     1 
ATOM   6039 C CA    . ALA D 2 312 ? 81.427  50.244 79.378  1.00 41.52  ? 312 ALA B CA    1 
ATOM   6040 C C     . ALA D 2 312 ? 80.193  49.341 79.278  1.00 39.10  ? 312 ALA B C     1 
ATOM   6041 O O     . ALA D 2 312 ? 79.929  48.695 78.250  1.00 34.16  ? 312 ALA B O     1 
ATOM   6042 C CB    . ALA D 2 312 ? 82.517  49.541 80.201  1.00 37.98  ? 312 ALA B CB    1 
ATOM   6043 N N     . GLY D 2 313 ? 79.447  49.269 80.365  1.00 31.52  ? 313 GLY B N     1 
ATOM   6044 C CA    . GLY D 2 313 ? 78.282  48.419 80.349  1.00 34.98  ? 313 GLY B CA    1 
ATOM   6045 C C     . GLY D 2 313 ? 77.091  49.260 79.996  1.00 40.19  ? 313 GLY B C     1 
ATOM   6046 O O     . GLY D 2 313 ? 76.065  48.765 79.557  1.00 45.38  ? 313 GLY B O     1 
ATOM   6047 N N     . GLY D 2 314 ? 77.249  50.559 80.168  1.00 39.17  ? 314 GLY B N     1 
ATOM   6048 C CA    . GLY D 2 314 ? 76.160  51.453 79.885  1.00 37.46  ? 314 GLY B CA    1 
ATOM   6049 C C     . GLY D 2 314 ? 75.326  51.605 81.136  1.00 42.57  ? 314 GLY B C     1 
ATOM   6050 O O     . GLY D 2 314 ? 74.179  52.001 81.063  1.00 64.75  ? 314 GLY B O     1 
HETATM 6051 O O     . HOH E 3 .   ? 57.549  29.903 85.227  1.00 44.38  ? 36  HOH C O     1 
HETATM 6052 O O     . HOH E 3 .   ? 78.565  25.413 69.092  1.00 72.17  ? 37  HOH C O     1 
HETATM 6053 O O     . HOH E 3 .   ? 74.556  17.079 68.487  1.00 50.92  ? 38  HOH C O     1 
HETATM 6054 O O     . HOH E 3 .   ? 76.129  20.916 60.647  1.00 63.10  ? 39  HOH C O     1 
HETATM 6055 O O     . HOH E 3 .   ? 59.039  22.454 84.906  1.00 69.00  ? 40  HOH C O     1 
HETATM 6056 O O     . HOH E 3 .   ? 67.450  30.715 92.719  1.00 49.28  ? 41  HOH C O     1 
HETATM 6057 O O     . HOH E 3 .   ? 64.056  25.869 61.947  1.00 59.47  ? 42  HOH C O     1 
HETATM 6058 O O     . HOH E 3 .   ? 60.219  40.383 139.067 1.00 74.01  ? 43  HOH C O     1 
HETATM 6059 O O     . HOH E 3 .   ? 71.178  24.299 71.475  1.00 79.83  ? 44  HOH C O     1 
HETATM 6060 O O     . HOH E 3 .   ? 67.086  26.333 92.764  1.00 100.00 ? 45  HOH C O     1 
HETATM 6061 O O     . HOH E 3 .   ? 71.136  15.259 64.674  1.00 63.65  ? 46  HOH C O     1 
HETATM 6062 O O     . HOH E 3 .   ? 60.627  30.469 131.666 1.00 76.78  ? 47  HOH C O     1 
HETATM 6063 O O     . HOH E 3 .   ? 67.257  52.679 81.738  1.00 84.55  ? 48  HOH C O     1 
HETATM 6064 O O     . HOH E 3 .   ? 57.584  59.420 102.319 1.00 77.95  ? 49  HOH C O     1 
HETATM 6065 O O     . HOH E 3 .   ? 51.892  51.866 104.398 1.00 48.69  ? 50  HOH C O     1 
HETATM 6066 O O     . HOH E 3 .   ? 83.014  13.991 67.170  1.00 100.00 ? 51  HOH C O     1 
HETATM 6067 O O     . HOH E 3 .   ? 61.759  55.550 102.545 1.00 70.69  ? 52  HOH C O     1 
HETATM 6068 O O     . HOH E 3 .   ? 57.433  30.777 73.968  1.00 76.22  ? 53  HOH C O     1 
HETATM 6069 O O     . HOH E 3 .   ? 73.471  40.543 92.560  1.00 83.67  ? 54  HOH C O     1 
HETATM 6070 O O     . HOH E 3 .   ? 83.576  19.968 66.818  1.00 47.99  ? 55  HOH C O     1 
HETATM 6071 O O     . HOH E 3 .   ? 65.126  32.389 143.037 1.00 69.56  ? 56  HOH C O     1 
HETATM 6072 O O     . HOH E 3 .   ? 68.229  11.691 55.670  1.00 100.00 ? 57  HOH C O     1 
HETATM 6073 O O     . HOH E 3 .   ? 57.105  62.767 100.545 1.00 100.00 ? 58  HOH C O     1 
HETATM 6074 O O     . HOH E 3 .   ? 62.223  58.940 99.672  1.00 54.21  ? 59  HOH C O     1 
HETATM 6075 O O     . HOH E 3 .   ? 69.462  42.875 90.000  1.00 57.90  ? 60  HOH C O     1 
HETATM 6076 O O     . HOH E 3 .   ? 61.389  53.483 130.398 1.00 62.65  ? 61  HOH C O     1 
HETATM 6077 O O     . HOH E 3 .   ? 70.771  30.555 60.596  1.00 49.24  ? 62  HOH C O     1 
HETATM 6078 O O     . HOH E 3 .   ? 78.251  18.401 68.784  1.00 61.59  ? 63  HOH C O     1 
HETATM 6079 O O     . HOH E 3 .   ? 79.526  8.104  63.925  1.00 72.41  ? 64  HOH C O     1 
HETATM 6080 O O     . HOH E 3 .   ? 68.093  25.506 131.366 1.00 83.89  ? 65  HOH C O     1 
HETATM 6081 O O     . HOH E 3 .   ? 68.830  29.441 132.977 1.00 98.81  ? 66  HOH C O     1 
HETATM 6082 O O     . HOH E 3 .   ? 65.041  39.844 139.775 1.00 51.49  ? 67  HOH C O     1 
HETATM 6083 O O     . HOH E 3 .   ? 82.192  22.976 62.728  1.00 56.01  ? 68  HOH C O     1 
HETATM 6084 O O     . HOH E 3 .   ? 60.617  30.433 73.548  1.00 57.40  ? 69  HOH C O     1 
HETATM 6085 O O     . HOH F 3 .   ? 58.685  40.611 87.401  1.00 39.10  ? 36  HOH D O     1 
HETATM 6086 O O     . HOH F 3 .   ? 68.732  53.836 117.048 1.00 44.78  ? 37  HOH D O     1 
HETATM 6087 O O     . HOH F 3 .   ? 57.246  44.551 122.394 1.00 44.93  ? 38  HOH D O     1 
HETATM 6088 O O     . HOH F 3 .   ? 79.877  38.075 132.489 1.00 44.75  ? 39  HOH D O     1 
HETATM 6089 O O     . HOH F 3 .   ? 60.695  41.910 90.062  1.00 51.26  ? 40  HOH D O     1 
HETATM 6090 O O     . HOH F 3 .   ? 54.737  56.685 123.339 1.00 62.57  ? 41  HOH D O     1 
HETATM 6091 O O     . HOH F 3 .   ? 67.873  34.228 83.660  1.00 68.73  ? 42  HOH D O     1 
HETATM 6092 O O     . HOH F 3 .   ? 48.256  50.803 126.586 1.00 98.72  ? 43  HOH D O     1 
HETATM 6093 O O     . HOH F 3 .   ? 69.209  41.391 145.274 1.00 46.95  ? 44  HOH D O     1 
HETATM 6094 O O     . HOH F 3 .   ? 67.573  47.326 150.121 1.00 99.50  ? 45  HOH D O     1 
HETATM 6095 O O     . HOH F 3 .   ? 67.688  59.521 113.022 1.00 89.35  ? 46  HOH D O     1 
HETATM 6096 O O     . HOH F 3 .   ? 50.693  51.981 127.020 1.00 65.90  ? 47  HOH D O     1 
HETATM 6097 O O     . HOH F 3 .   ? 80.244  41.953 139.969 1.00 79.64  ? 48  HOH D O     1 
HETATM 6098 O O     . HOH F 3 .   ? 65.796  62.262 115.348 1.00 47.64  ? 49  HOH D O     1 
HETATM 6099 O O     . HOH F 3 .   ? 65.586  35.456 120.585 1.00 93.25  ? 50  HOH D O     1 
HETATM 6100 O O     . HOH F 3 .   ? 66.659  23.249 81.405  1.00 61.51  ? 51  HOH D O     1 
HETATM 6101 O O     . HOH F 3 .   ? 68.255  35.970 75.187  1.00 51.49  ? 52  HOH D O     1 
HETATM 6102 O O     . HOH F 3 .   ? 67.793  31.307 148.082 1.00 61.27  ? 53  HOH D O     1 
HETATM 6103 O O     . HOH F 3 .   ? 59.602  41.215 123.609 1.00 73.11  ? 54  HOH D O     1 
HETATM 6104 O O     . HOH F 3 .   ? 78.084  47.582 143.367 1.00 72.83  ? 55  HOH D O     1 
HETATM 6105 O O     . HOH F 3 .   ? 57.600  34.937 127.763 1.00 98.64  ? 56  HOH D O     1 
HETATM 6106 O O     . HOH F 3 .   ? 71.302  17.165 78.978  1.00 42.49  ? 57  HOH D O     1 
HETATM 6107 O O     . HOH F 3 .   ? 64.983  61.949 126.142 1.00 90.66  ? 58  HOH D O     1 
HETATM 6108 O O     . HOH F 3 .   ? 66.786  55.839 100.404 1.00 89.05  ? 59  HOH D O     1 
HETATM 6109 O O     . HOH F 3 .   ? 61.374  28.532 128.974 1.00 93.91  ? 60  HOH D O     1 
HETATM 6110 O O     . HOH F 3 .   ? 69.606  46.485 95.571  1.00 46.80  ? 61  HOH D O     1 
HETATM 6111 O O     . HOH F 3 .   ? 71.658  59.739 112.467 1.00 39.92  ? 62  HOH D O     1 
HETATM 6112 O O     . HOH F 3 .   ? 63.792  19.864 81.489  1.00 54.12  ? 63  HOH D O     1 
HETATM 6113 O O     . HOH F 3 .   ? 74.323  34.379 132.897 1.00 46.47  ? 64  HOH D O     1 
HETATM 6114 O O     . HOH F 3 .   ? 67.668  33.731 76.042  1.00 50.84  ? 65  HOH D O     1 
HETATM 6115 O O     . HOH F 3 .   ? 70.104  56.027 101.964 1.00 47.11  ? 66  HOH D O     1 
HETATM 6116 O O     . HOH F 3 .   ? 69.882  40.329 140.695 1.00 88.78  ? 67  HOH D O     1 
HETATM 6117 O O     . HOH F 3 .   ? 71.334  62.275 107.583 1.00 76.19  ? 68  HOH D O     1 
HETATM 6118 O O     . HOH F 3 .   ? 62.031  32.985 128.991 1.00 45.18  ? 69  HOH D O     1 
HETATM 6119 O O     . HOH F 3 .   ? 56.836  51.380 85.849  1.00 100.00 ? 70  HOH D O     1 
HETATM 6120 O O     . HOH F 3 .   ? 64.704  20.179 54.876  1.00 86.49  ? 71  HOH D O     1 
HETATM 6121 O O     . HOH F 3 .   ? 68.809  39.193 81.909  1.00 43.68  ? 72  HOH D O     1 
HETATM 6122 O O     . HOH F 3 .   ? 57.544  33.537 124.332 1.00 100.00 ? 73  HOH D O     1 
HETATM 6123 O O     . HOH F 3 .   ? 76.225  45.892 141.328 1.00 82.79  ? 74  HOH D O     1 
HETATM 6124 O O     . HOH F 3 .   ? 59.114  22.262 59.521  1.00 100.00 ? 75  HOH D O     1 
HETATM 6125 O O     . HOH F 3 .   ? 52.026  52.709 130.411 1.00 83.84  ? 76  HOH D O     1 
HETATM 6126 O O     . HOH F 3 .   ? 67.074  14.248 62.041  1.00 59.41  ? 77  HOH D O     1 
HETATM 6127 O O     . HOH F 3 .   ? 65.519  15.489 68.382  1.00 53.07  ? 78  HOH D O     1 
HETATM 6128 O O     . HOH F 3 .   ? 74.403  34.934 137.519 1.00 51.90  ? 79  HOH D O     1 
HETATM 6129 O O     . HOH F 3 .   ? 56.787  51.135 129.661 1.00 77.99  ? 80  HOH D O     1 
HETATM 6130 O O     . HOH F 3 .   ? 68.360  42.126 143.052 1.00 59.46  ? 81  HOH D O     1 
HETATM 6131 O O     . HOH F 3 .   ? 62.937  44.687 145.059 1.00 100.00 ? 82  HOH D O     1 
HETATM 6132 O O     . HOH F 3 .   ? 68.590  45.776 145.478 1.00 74.79  ? 83  HOH D O     1 
HETATM 6133 O O     . HOH F 3 .   ? 71.862  43.466 143.547 1.00 96.41  ? 84  HOH D O     1 
HETATM 6134 O O     . HOH F 3 .   ? 70.016  46.069 139.260 1.00 58.03  ? 85  HOH D O     1 
HETATM 6135 O O     . HOH F 3 .   ? 73.131  44.894 138.445 1.00 97.87  ? 86  HOH D O     1 
HETATM 6136 O O     . HOH F 3 .   ? 81.422  39.805 132.953 1.00 74.17  ? 87  HOH D O     1 
HETATM 6137 O O     . HOH F 3 .   ? 68.817  12.865 79.807  1.00 92.42  ? 88  HOH D O     1 
HETATM 6138 O O     . HOH F 3 .   ? 60.535  33.744 125.198 1.00 82.52  ? 89  HOH D O     1 
HETATM 6139 O O     . HOH F 3 .   ? 62.758  30.108 126.109 1.00 78.49  ? 90  HOH D O     1 
HETATM 6140 O O     . HOH F 3 .   ? 69.506  13.002 68.509  1.00 55.83  ? 91  HOH D O     1 
HETATM 6141 O O     . HOH G 3 .   ? 46.424  37.638 103.766 1.00 16.73  ? 346 HOH A O     1 
HETATM 6142 O O     . HOH G 3 .   ? 71.311  31.498 135.568 1.00 37.45  ? 347 HOH A O     1 
HETATM 6143 O O     . HOH G 3 .   ? 75.569  52.594 116.881 1.00 43.57  ? 348 HOH A O     1 
HETATM 6144 O O     . HOH G 3 .   ? 53.030  61.419 102.724 1.00 97.96  ? 349 HOH A O     1 
HETATM 6145 O O     . HOH G 3 .   ? 100.279 38.252 106.230 1.00 97.39  ? 350 HOH A O     1 
HETATM 6146 O O     . HOH G 3 .   ? 81.296  35.756 139.706 1.00 32.69  ? 351 HOH A O     1 
HETATM 6147 O O     . HOH G 3 .   ? 28.774  44.715 106.415 1.00 73.70  ? 352 HOH A O     1 
HETATM 6148 O O     . HOH G 3 .   ? 49.539  55.142 128.156 1.00 84.71  ? 353 HOH A O     1 
HETATM 6149 O O     . HOH G 3 .   ? 82.260  24.134 129.592 1.00 76.62  ? 354 HOH A O     1 
HETATM 6150 O O     . HOH G 3 .   ? 94.761  67.663 96.350  1.00 95.43  ? 355 HOH A O     1 
HETATM 6151 O O     . HOH G 3 .   ? 85.020  72.446 101.745 1.00 78.62  ? 356 HOH A O     1 
HETATM 6152 O O     . HOH G 3 .   ? 75.496  30.529 108.461 1.00 48.55  ? 357 HOH A O     1 
HETATM 6153 O O     . HOH G 3 .   ? 59.318  66.522 120.560 1.00 66.23  ? 358 HOH A O     1 
HETATM 6154 O O     . HOH G 3 .   ? 84.301  58.276 127.192 1.00 64.96  ? 359 HOH A O     1 
HETATM 6155 O O     . HOH G 3 .   ? 73.038  63.408 121.480 1.00 87.68  ? 360 HOH A O     1 
HETATM 6156 O O     . HOH G 3 .   ? 42.837  60.992 106.665 1.00 64.33  ? 361 HOH A O     1 
HETATM 6157 O O     . HOH G 3 .   ? 75.749  59.145 115.046 1.00 68.92  ? 362 HOH A O     1 
HETATM 6158 O O     . HOH G 3 .   ? 63.582  64.595 108.026 1.00 75.39  ? 363 HOH A O     1 
HETATM 6159 O O     . HOH G 3 .   ? 60.739  77.699 114.328 1.00 84.55  ? 364 HOH A O     1 
HETATM 6160 O O     . HOH G 3 .   ? 59.852  72.568 102.742 1.00 55.11  ? 365 HOH A O     1 
HETATM 6161 O O     . HOH G 3 .   ? 49.794  57.830 98.941  1.00 67.22  ? 366 HOH A O     1 
HETATM 6162 O O     . HOH G 3 .   ? 73.567  31.717 136.521 1.00 100.00 ? 367 HOH A O     1 
HETATM 6163 O O     . HOH G 3 .   ? 40.722  57.779 108.022 1.00 78.46  ? 368 HOH A O     1 
HETATM 6164 O O     . HOH G 3 .   ? 71.243  33.862 117.849 1.00 55.73  ? 369 HOH A O     1 
HETATM 6165 O O     . HOH G 3 .   ? 100.977 78.601 101.088 1.00 95.07  ? 370 HOH A O     1 
HETATM 6166 O O     . HOH G 3 .   ? 51.469  46.116 126.903 1.00 50.33  ? 371 HOH A O     1 
HETATM 6167 O O     . HOH G 3 .   ? 83.249  70.957 104.907 1.00 100.00 ? 372 HOH A O     1 
HETATM 6168 O O     . HOH G 3 .   ? 44.589  71.820 100.179 1.00 54.09  ? 373 HOH A O     1 
HETATM 6169 O O     . HOH G 3 .   ? 74.309  65.521 115.522 1.00 38.79  ? 374 HOH A O     1 
HETATM 6170 O O     . HOH G 3 .   ? 65.801  37.126 116.991 1.00 100.00 ? 375 HOH A O     1 
HETATM 6171 O O     . HOH G 3 .   ? 83.425  21.439 129.863 1.00 96.45  ? 376 HOH A O     1 
HETATM 6172 O O     . HOH G 3 .   ? 72.841  21.840 117.635 1.00 48.68  ? 377 HOH A O     1 
HETATM 6173 O O     . HOH G 3 .   ? 60.234  48.169 114.507 1.00 69.71  ? 378 HOH A O     1 
HETATM 6174 O O     . HOH G 3 .   ? 83.070  43.392 137.195 1.00 100.00 ? 379 HOH A O     1 
HETATM 6175 O O     . HOH G 3 .   ? 52.121  64.396 129.494 1.00 100.00 ? 380 HOH A O     1 
HETATM 6176 O O     . HOH G 3 .   ? 90.390  67.573 101.942 1.00 51.83  ? 381 HOH A O     1 
HETATM 6177 O O     . HOH G 3 .   ? 76.549  22.958 123.176 1.00 49.91  ? 382 HOH A O     1 
HETATM 6178 O O     . HOH G 3 .   ? 72.810  34.990 107.641 1.00 100.00 ? 383 HOH A O     1 
HETATM 6179 O O     . HOH G 3 .   ? 89.150  42.389 136.782 1.00 56.17  ? 384 HOH A O     1 
HETATM 6180 O O     . HOH G 3 .   ? 46.321  66.744 124.417 1.00 73.72  ? 385 HOH A O     1 
HETATM 6181 O O     . HOH G 3 .   ? 91.582  57.432 120.064 1.00 77.51  ? 386 HOH A O     1 
HETATM 6182 O O     . HOH G 3 .   ? 68.712  64.746 104.160 1.00 100.00 ? 387 HOH A O     1 
HETATM 6183 O O     . HOH G 3 .   ? 76.849  28.290 106.079 1.00 59.86  ? 388 HOH A O     1 
HETATM 6184 O O     . HOH G 3 .   ? 53.917  63.402 106.319 1.00 91.41  ? 389 HOH A O     1 
HETATM 6185 O O     . HOH G 3 .   ? 94.575  54.221 115.761 1.00 92.27  ? 390 HOH A O     1 
HETATM 6186 O O     . HOH G 3 .   ? 81.445  59.993 134.145 1.00 90.13  ? 391 HOH A O     1 
HETATM 6187 O O     . HOH G 3 .   ? 50.398  66.897 126.329 1.00 100.00 ? 392 HOH A O     1 
HETATM 6188 O O     . HOH G 3 .   ? 54.001  66.997 128.920 1.00 59.58  ? 393 HOH A O     1 
HETATM 6189 O O     . HOH G 3 .   ? 56.699  80.429 110.171 1.00 70.08  ? 394 HOH A O     1 
HETATM 6190 O O     . HOH G 3 .   ? 69.999  37.277 112.945 1.00 50.20  ? 395 HOH A O     1 
HETATM 6191 O O     . HOH G 3 .   ? 64.654  31.078 121.812 1.00 89.67  ? 396 HOH A O     1 
HETATM 6192 O O     . HOH G 3 .   ? 52.428  38.422 114.376 1.00 71.34  ? 397 HOH A O     1 
HETATM 6193 O O     . HOH G 3 .   ? 83.992  62.819 97.345  1.00 89.91  ? 398 HOH A O     1 
HETATM 6194 O O     . HOH G 3 .   ? 52.099  34.520 108.328 1.00 67.40  ? 399 HOH A O     1 
HETATM 6195 O O     . HOH G 3 .   ? 30.229  37.894 109.534 1.00 81.65  ? 400 HOH A O     1 
HETATM 6196 O O     . HOH G 3 .   ? 87.945  57.555 121.652 1.00 70.91  ? 401 HOH A O     1 
HETATM 6197 O O     . HOH G 3 .   ? 86.417  73.138 104.770 1.00 48.06  ? 402 HOH A O     1 
HETATM 6198 O O     . HOH G 3 .   ? 59.613  70.882 124.010 1.00 98.17  ? 403 HOH A O     1 
HETATM 6199 O O     . HOH G 3 .   ? 79.809  18.489 122.940 1.00 75.94  ? 404 HOH A O     1 
HETATM 6200 O O     . HOH G 3 .   ? 98.517  76.317 99.153  1.00 100.00 ? 405 HOH A O     1 
HETATM 6201 O O     . HOH G 3 .   ? 71.260  36.989 119.723 1.00 49.17  ? 406 HOH A O     1 
HETATM 6202 O O     . HOH G 3 .   ? 93.483  60.042 119.372 1.00 78.60  ? 407 HOH A O     1 
HETATM 6203 O O     . HOH G 3 .   ? 100.115 38.598 110.522 1.00 91.13  ? 408 HOH A O     1 
HETATM 6204 O O     . HOH G 3 .   ? 35.484  51.069 102.296 1.00 70.55  ? 409 HOH A O     1 
HETATM 6205 O O     . HOH G 3 .   ? 54.488  66.611 105.957 1.00 84.91  ? 410 HOH A O     1 
HETATM 6206 O O     . HOH G 3 .   ? 82.608  63.329 106.763 1.00 89.65  ? 411 HOH A O     1 
HETATM 6207 O O     . HOH G 3 .   ? 90.606  38.444 130.383 1.00 91.57  ? 412 HOH A O     1 
HETATM 6208 O O     . HOH G 3 .   ? 93.500  69.912 104.552 1.00 55.94  ? 413 HOH A O     1 
HETATM 6209 O O     . HOH G 3 .   ? 32.880  48.348 104.478 1.00 77.58  ? 414 HOH A O     1 
HETATM 6210 O O     . HOH G 3 .   ? 81.768  48.282 134.883 1.00 74.71  ? 415 HOH A O     1 
HETATM 6211 O O     . HOH G 3 .   ? 85.020  31.336 139.140 1.00 93.89  ? 416 HOH A O     1 
HETATM 6212 O O     . HOH G 3 .   ? 75.362  60.857 119.914 1.00 60.50  ? 417 HOH A O     1 
HETATM 6213 O O     . HOH G 3 .   ? 80.853  21.843 124.095 1.00 95.21  ? 418 HOH A O     1 
HETATM 6214 O O     . HOH G 3 .   ? 86.417  31.972 100.925 1.00 73.98  ? 419 HOH A O     1 
HETATM 6215 O O     . HOH G 3 .   ? 84.630  42.162 132.452 1.00 45.42  ? 420 HOH A O     1 
HETATM 6216 O O     . HOH G 3 .   ? 88.448  60.506 102.924 1.00 100.00 ? 421 HOH A O     1 
HETATM 6217 O O     . HOH G 3 .   ? 59.398  62.823 105.104 1.00 66.76  ? 422 HOH A O     1 
HETATM 6218 O O     . HOH G 3 .   ? 97.992  26.845 109.883 1.00 100.00 ? 423 HOH A O     1 
HETATM 6219 O O     . HOH G 3 .   ? 77.209  54.234 122.347 1.00 40.70  ? 424 HOH A O     1 
HETATM 6220 O O     . HOH G 3 .   ? 58.053  62.244 127.734 1.00 69.88  ? 425 HOH A O     1 
HETATM 6221 O O     . HOH G 3 .   ? 47.534  68.385 121.808 1.00 42.16  ? 426 HOH A O     1 
HETATM 6222 O O     . HOH G 3 .   ? 74.776  31.110 125.583 1.00 100.00 ? 427 HOH A O     1 
HETATM 6223 O O     . HOH G 3 .   ? 97.715  36.258 104.764 1.00 54.13  ? 428 HOH A O     1 
HETATM 6224 O O     . HOH G 3 .   ? 77.957  44.420 138.449 1.00 82.70  ? 429 HOH A O     1 
HETATM 6225 O O     . HOH G 3 .   ? 97.468  69.119 106.304 1.00 86.46  ? 430 HOH A O     1 
HETATM 6226 O O     . HOH G 3 .   ? 58.540  36.992 110.421 1.00 62.92  ? 431 HOH A O     1 
HETATM 6227 O O     . HOH G 3 .   ? 64.674  39.005 117.834 1.00 89.44  ? 432 HOH A O     1 
HETATM 6228 O O     . HOH G 3 .   ? 35.211  67.865 120.175 1.00 84.31  ? 433 HOH A O     1 
HETATM 6229 O O     . HOH G 3 .   ? 55.042  46.403 121.146 1.00 64.08  ? 434 HOH A O     1 
HETATM 6230 O O     . HOH H 3 .   ? 92.065  22.246 81.712  1.00 30.32  ? 346 HOH B O     1 
HETATM 6231 O O     . HOH H 3 .   ? 40.155  34.193 89.914  1.00 36.25  ? 347 HOH B O     1 
HETATM 6232 O O     . HOH H 3 .   ? 91.193  37.192 85.523  1.00 24.45  ? 348 HOH B O     1 
HETATM 6233 O O     . HOH H 3 .   ? 86.786  23.848 59.434  1.00 28.80  ? 349 HOH B O     1 
HETATM 6234 O O     . HOH H 3 .   ? 83.380  18.664 62.472  1.00 32.13  ? 350 HOH B O     1 
HETATM 6235 O O     . HOH H 3 .   ? 93.709  41.685 73.315  1.00 31.94  ? 351 HOH B O     1 
HETATM 6236 O O     . HOH H 3 .   ? 89.057  34.512 65.630  1.00 44.99  ? 352 HOH B O     1 
HETATM 6237 O O     . HOH H 3 .   ? 55.196  32.104 75.705  1.00 37.95  ? 353 HOH B O     1 
HETATM 6238 O O     . HOH H 3 .   ? 76.056  39.271 64.880  1.00 53.32  ? 354 HOH B O     1 
HETATM 6239 O O     . HOH H 3 .   ? 69.230  35.591 68.073  1.00 47.13  ? 355 HOH B O     1 
HETATM 6240 O O     . HOH H 3 .   ? 59.996  28.748 96.903  1.00 35.83  ? 356 HOH B O     1 
HETATM 6241 O O     . HOH H 3 .   ? 84.958  26.645 86.311  1.00 29.37  ? 357 HOH B O     1 
HETATM 6242 O O     . HOH H 3 .   ? 73.227  34.180 60.325  1.00 74.44  ? 358 HOH B O     1 
HETATM 6243 O O     . HOH H 3 .   ? 78.156  47.640 76.693  1.00 37.04  ? 359 HOH B O     1 
HETATM 6244 O O     . HOH H 3 .   ? 81.219  22.638 81.204  1.00 28.64  ? 360 HOH B O     1 
HETATM 6245 O O     . HOH H 3 .   ? 42.817  45.062 99.837  1.00 66.97  ? 361 HOH B O     1 
HETATM 6246 O O     . HOH H 3 .   ? 72.921  24.182 77.042  1.00 47.23  ? 362 HOH B O     1 
HETATM 6247 O O     . HOH H 3 .   ? 41.341  27.857 83.507  1.00 89.57  ? 363 HOH B O     1 
HETATM 6248 O O     . HOH H 3 .   ? 86.536  29.218 85.889  1.00 35.47  ? 364 HOH B O     1 
HETATM 6249 O O     . HOH H 3 .   ? 73.791  29.579 102.963 1.00 88.42  ? 365 HOH B O     1 
HETATM 6250 O O     . HOH H 3 .   ? 55.111  42.394 82.265  1.00 35.51  ? 366 HOH B O     1 
HETATM 6251 O O     . HOH H 3 .   ? 43.664  33.181 99.765  1.00 41.09  ? 367 HOH B O     1 
HETATM 6252 O O     . HOH H 3 .   ? 74.851  24.750 61.333  1.00 42.55  ? 368 HOH B O     1 
HETATM 6253 O O     . HOH H 3 .   ? 73.417  35.816 84.493  1.00 41.31  ? 369 HOH B O     1 
HETATM 6254 O O     . HOH H 3 .   ? 94.651  38.244 69.384  1.00 46.33  ? 370 HOH B O     1 
HETATM 6255 O O     . HOH H 3 .   ? 76.788  31.189 84.118  1.00 55.04  ? 371 HOH B O     1 
HETATM 6256 O O     . HOH H 3 .   ? 83.863  27.725 84.400  1.00 61.65  ? 372 HOH B O     1 
HETATM 6257 O O     . HOH H 3 .   ? 73.489  57.084 74.146  1.00 100.00 ? 373 HOH B O     1 
HETATM 6258 O O     . HOH H 3 .   ? 53.845  26.470 87.546  1.00 42.55  ? 374 HOH B O     1 
HETATM 6259 O O     . HOH H 3 .   ? 67.529  33.668 69.547  1.00 56.03  ? 375 HOH B O     1 
HETATM 6260 O O     . HOH H 3 .   ? 80.766  26.954 68.570  1.00 92.17  ? 376 HOH B O     1 
HETATM 6261 O O     . HOH H 3 .   ? 73.311  31.520 61.194  1.00 57.83  ? 377 HOH B O     1 
HETATM 6262 O O     . HOH H 3 .   ? 63.594  35.531 111.079 1.00 59.79  ? 378 HOH B O     1 
HETATM 6263 O O     . HOH H 3 .   ? 77.599  23.138 73.756  1.00 70.95  ? 379 HOH B O     1 
HETATM 6264 O O     . HOH H 3 .   ? 52.135  36.309 68.821  1.00 60.86  ? 380 HOH B O     1 
HETATM 6265 O O     . HOH H 3 .   ? 70.367  42.696 75.312  1.00 26.53  ? 381 HOH B O     1 
HETATM 6266 O O     . HOH H 3 .   ? 42.827  39.391 70.347  1.00 90.28  ? 382 HOH B O     1 
HETATM 6267 O O     . HOH H 3 .   ? 34.315  29.133 90.908  1.00 40.09  ? 383 HOH B O     1 
HETATM 6268 O O     . HOH H 3 .   ? 71.134  45.952 68.422  1.00 34.47  ? 384 HOH B O     1 
HETATM 6269 O O     . HOH H 3 .   ? 54.106  30.339 106.429 1.00 85.10  ? 385 HOH B O     1 
HETATM 6270 O O     . HOH H 3 .   ? 56.120  41.510 91.024  1.00 47.64  ? 386 HOH B O     1 
HETATM 6271 O O     . HOH H 3 .   ? 44.073  29.148 101.200 1.00 42.83  ? 387 HOH B O     1 
HETATM 6272 O O     . HOH H 3 .   ? 52.068  23.383 94.928  1.00 65.89  ? 388 HOH B O     1 
HETATM 6273 O O     . HOH H 3 .   ? 77.819  31.465 89.398  1.00 100.00 ? 389 HOH B O     1 
HETATM 6274 O O     . HOH H 3 .   ? 80.103  23.550 79.489  1.00 52.78  ? 390 HOH B O     1 
HETATM 6275 O O     . HOH H 3 .   ? 81.489  51.566 64.326  1.00 84.48  ? 391 HOH B O     1 
HETATM 6276 O O     . HOH H 3 .   ? 48.823  23.664 87.795  1.00 56.05  ? 392 HOH B O     1 
HETATM 6277 O O     . HOH H 3 .   ? 75.852  27.738 91.216  1.00 78.50  ? 393 HOH B O     1 
HETATM 6278 O O     . HOH H 3 .   ? 67.789  24.912 89.102  1.00 96.81  ? 394 HOH B O     1 
HETATM 6279 O O     . HOH H 3 .   ? 34.682  27.887 86.242  1.00 54.85  ? 395 HOH B O     1 
HETATM 6280 O O     . HOH H 3 .   ? 49.716  33.596 69.008  1.00 100.00 ? 396 HOH B O     1 
HETATM 6281 O O     . HOH H 3 .   ? 51.166  30.335 69.536  1.00 85.10  ? 397 HOH B O     1 
HETATM 6282 O O     . HOH H 3 .   ? 82.865  51.950 58.182  1.00 91.03  ? 398 HOH B O     1 
HETATM 6283 O O     . HOH H 3 .   ? 74.968  35.875 59.278  1.00 77.04  ? 399 HOH B O     1 
HETATM 6284 O O     . HOH H 3 .   ? 96.187  57.249 60.314  1.00 100.00 ? 400 HOH B O     1 
HETATM 6285 O O     . HOH H 3 .   ? 47.848  51.520 81.841  1.00 41.47  ? 401 HOH B O     1 
HETATM 6286 O O     . HOH H 3 .   ? 87.679  57.964 84.679  1.00 72.41  ? 402 HOH B O     1 
HETATM 6287 O O     . HOH H 3 .   ? 47.283  47.349 98.833  1.00 75.72  ? 403 HOH B O     1 
HETATM 6288 O O     . HOH H 3 .   ? 74.008  36.622 63.987  1.00 49.43  ? 404 HOH B O     1 
HETATM 6289 O O     . HOH H 3 .   ? 78.690  38.293 78.347  1.00 59.13  ? 405 HOH B O     1 
HETATM 6290 O O     . HOH H 3 .   ? 45.062  24.522 108.772 1.00 76.75  ? 406 HOH B O     1 
HETATM 6291 O O     . HOH H 3 .   ? 53.843  22.077 86.564  1.00 94.62  ? 407 HOH B O     1 
HETATM 6292 O O     . HOH H 3 .   ? 53.722  20.626 89.234  1.00 91.27  ? 408 HOH B O     1 
HETATM 6293 O O     . HOH H 3 .   ? 37.428  34.504 81.235  1.00 52.78  ? 409 HOH B O     1 
HETATM 6294 O O     . HOH H 3 .   ? 49.760  37.069 70.866  1.00 41.18  ? 410 HOH B O     1 
HETATM 6295 O O     . HOH H 3 .   ? 56.119  41.955 84.933  1.00 50.06  ? 411 HOH B O     1 
HETATM 6296 O O     . HOH H 3 .   ? 46.434  35.997 75.321  1.00 100.00 ? 412 HOH B O     1 
HETATM 6297 O O     . HOH H 3 .   ? 80.743  33.551 53.219  1.00 79.62  ? 413 HOH B O     1 
HETATM 6298 O O     . HOH H 3 .   ? 47.349  49.297 76.977  1.00 80.85  ? 414 HOH B O     1 
HETATM 6299 O O     . HOH H 3 .   ? 68.192  31.937 71.217  1.00 44.39  ? 415 HOH B O     1 
HETATM 6300 O O     . HOH H 3 .   ? 41.386  48.105 97.424  1.00 72.39  ? 416 HOH B O     1 
HETATM 6301 O O     . HOH H 3 .   ? 53.271  43.992 85.718  1.00 84.23  ? 417 HOH B O     1 
HETATM 6302 O O     . HOH H 3 .   ? 73.636  23.092 61.747  1.00 46.63  ? 418 HOH B O     1 
HETATM 6303 O O     . HOH H 3 .   ? 70.415  47.881 65.843  1.00 60.21  ? 419 HOH B O     1 
HETATM 6304 O O     . HOH H 3 .   ? 46.741  26.600 80.582  1.00 96.65  ? 420 HOH B O     1 
HETATM 6305 O O     . HOH H 3 .   ? 51.895  45.021 67.152  1.00 82.90  ? 421 HOH B O     1 
HETATM 6306 O O     . HOH H 3 .   ? 84.130  34.147 93.444  1.00 61.16  ? 422 HOH B O     1 
HETATM 6307 O O     . HOH H 3 .   ? 87.319  19.786 66.660  1.00 42.23  ? 423 HOH B O     1 
HETATM 6308 O O     . HOH H 3 .   ? 68.122  23.429 96.676  1.00 70.35  ? 424 HOH B O     1 
HETATM 6309 O O     . HOH H 3 .   ? 96.117  36.956 67.469  1.00 74.97  ? 425 HOH B O     1 
HETATM 6310 O O     . HOH H 3 .   ? 50.308  25.814 86.310  1.00 79.96  ? 426 HOH B O     1 
HETATM 6311 O O     . HOH H 3 .   ? 55.665  25.640 100.809 1.00 56.84  ? 427 HOH B O     1 
HETATM 6312 O O     . HOH H 3 .   ? 84.476  20.959 75.508  1.00 81.52  ? 428 HOH B O     1 
HETATM 6313 O O     . HOH H 3 .   ? 91.230  43.155 80.661  1.00 60.02  ? 429 HOH B O     1 
HETATM 6314 O O     . HOH H 3 .   ? 97.912  34.278 73.800  1.00 53.83  ? 430 HOH B O     1 
HETATM 6315 O O     . HOH H 3 .   ? 96.483  28.508 62.912  1.00 56.23  ? 431 HOH B O     1 
HETATM 6316 O O     . HOH H 3 .   ? 84.701  44.619 57.626  1.00 59.65  ? 432 HOH B O     1 
HETATM 6317 O O     . HOH H 3 .   ? 62.258  42.314 67.315  1.00 92.57  ? 433 HOH B O     1 
HETATM 6318 O O     . HOH H 3 .   ? 60.916  38.643 87.968  1.00 76.71  ? 434 HOH B O     1 
HETATM 6319 O O     . HOH H 3 .   ? 67.760  28.181 96.250  1.00 58.74  ? 435 HOH B O     1 
HETATM 6320 O O     . HOH H 3 .   ? 62.584  40.272 106.543 1.00 61.78  ? 436 HOH B O     1 
HETATM 6321 O O     . HOH H 3 .   ? 36.872  21.227 90.401  1.00 45.10  ? 437 HOH B O     1 
HETATM 6322 O O     . HOH H 3 .   ? 72.585  50.373 75.838  1.00 93.70  ? 438 HOH B O     1 
HETATM 6323 O O     . HOH H 3 .   ? 74.740  42.596 59.763  1.00 82.93  ? 439 HOH B O     1 
HETATM 6324 O O     . HOH H 3 .   ? 50.161  25.751 98.518  1.00 62.53  ? 440 HOH B O     1 
HETATM 6325 O O     . HOH H 3 .   ? 70.385  47.410 60.980  1.00 76.81  ? 441 HOH B O     1 
HETATM 6326 O O     . HOH H 3 .   ? 44.861  25.524 103.218 1.00 85.08  ? 442 HOH B O     1 
HETATM 6327 O O     . HOH H 3 .   ? 98.935  30.191 64.362  1.00 90.72  ? 443 HOH B O     1 
HETATM 6328 O O     . HOH H 3 .   ? 70.244  15.318 88.750  1.00 96.91  ? 444 HOH B O     1 
HETATM 6329 O O     . HOH H 3 .   ? 74.621  54.639 80.050  1.00 87.02  ? 445 HOH B O     1 
HETATM 6330 O O     . HOH H 3 .   ? 44.065  53.545 80.782  1.00 100.00 ? 446 HOH B O     1 
HETATM 6331 O O     . HOH H 3 .   ? 94.547  23.725 66.877  1.00 44.86  ? 447 HOH B O     1 
HETATM 6332 O O     . HOH H 3 .   ? 63.868  37.418 70.134  1.00 77.24  ? 448 HOH B O     1 
HETATM 6333 O O     . HOH H 3 .   ? 60.021  38.484 79.165  1.00 79.38  ? 449 HOH B O     1 
HETATM 6334 O O     . HOH H 3 .   ? 75.572  46.815 76.417  1.00 76.33  ? 450 HOH B O     1 
HETATM 6335 O O     . HOH H 3 .   ? 77.742  57.209 68.465  1.00 59.76  ? 451 HOH B O     1 
HETATM 6336 O O     . HOH H 3 .   ? 47.484  37.041 71.975  1.00 81.11  ? 452 HOH B O     1 
HETATM 6337 O O     . HOH H 3 .   ? 48.387  42.079 63.028  1.00 76.67  ? 453 HOH B O     1 
HETATM 6338 O O     . HOH H 3 .   ? 52.997  43.445 63.899  1.00 90.08  ? 454 HOH B O     1 
HETATM 6339 O O     . HOH H 3 .   ? 79.311  55.568 72.080  1.00 77.44  ? 455 HOH B O     1 
HETATM 6340 O O     . HOH H 3 .   ? 45.608  22.234 105.896 1.00 100.00 ? 456 HOH B O     1 
HETATM 6341 O O     . HOH H 3 .   ? 69.343  34.071 101.597 1.00 47.96  ? 457 HOH B O     1 
HETATM 6342 O O     . HOH H 3 .   ? 33.922  39.829 80.667  1.00 100.00 ? 458 HOH B O     1 
HETATM 6343 O O     . HOH H 3 .   ? 85.267  38.536 53.130  1.00 81.63  ? 459 HOH B O     1 
HETATM 6344 O O     . HOH H 3 .   ? 53.686  43.593 90.259  1.00 52.60  ? 460 HOH B O     1 
HETATM 6345 O O     . HOH H 3 .   ? 91.941  27.292 83.883  1.00 38.03  ? 461 HOH B O     1 
HETATM 6346 O O     . HOH H 3 .   ? 72.900  52.086 79.109  1.00 91.35  ? 462 HOH B O     1 
HETATM 6347 O O     . HOH H 3 .   ? 51.171  25.193 83.091  1.00 85.11  ? 463 HOH B O     1 
HETATM 6348 O O     . HOH H 3 .   ? 63.067  42.936 71.388  1.00 69.49  ? 464 HOH B O     1 
HETATM 6349 O O     . HOH H 3 .   ? 28.223  47.715 84.300  1.00 57.53  ? 465 HOH B O     1 
HETATM 6350 O O     . HOH H 3 .   ? 80.498  20.870 87.944  1.00 69.01  ? 466 HOH B O     1 
HETATM 6351 O O     . HOH H 3 .   ? 68.799  60.396 69.875  1.00 97.28  ? 467 HOH B O     1 
HETATM 6352 O O     . HOH H 3 .   ? 79.173  31.824 52.332  1.00 43.35  ? 468 HOH B O     1 
HETATM 6353 O O     . HOH H 3 .   ? 34.824  40.986 93.947  1.00 80.88  ? 469 HOH B O     1 
HETATM 6354 O O     . HOH H 3 .   ? 57.410  27.727 103.328 1.00 80.64  ? 470 HOH B O     1 
HETATM 6355 O O     . HOH H 3 .   ? 59.445  25.250 99.742  1.00 89.36  ? 471 HOH B O     1 
HETATM 6356 O O     . HOH H 3 .   ? 59.320  24.757 102.666 1.00 75.94  ? 472 HOH B O     1 
HETATM 6357 O O     . HOH H 3 .   ? 43.005  47.995 100.694 1.00 85.81  ? 473 HOH B O     1 
HETATM 6358 O O     . HOH H 3 .   ? 66.316  27.065 82.982  1.00 73.29  ? 474 HOH B O     1 
HETATM 6359 O O     . HOH H 3 .   ? 73.787  19.738 85.375  1.00 81.47  ? 475 HOH B O     1 
HETATM 6360 O O     . HOH H 3 .   ? 79.359  14.421 84.432  1.00 99.39  ? 476 HOH B O     1 
HETATM 6361 O O     . HOH H 3 .   ? 93.481  21.202 66.383  1.00 69.30  ? 477 HOH B O     1 
HETATM 6362 O O     . HOH H 3 .   ? 79.548  20.468 79.758  1.00 78.41  ? 478 HOH B O     1 
HETATM 6363 O O     . HOH H 3 .   ? 69.894  57.750 71.341  1.00 78.15  ? 479 HOH B O     1 
HETATM 6364 O O     . HOH H 3 .   ? 67.105  57.566 71.922  1.00 100.00 ? 480 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   1   ?   ?   ?   C . n 
A 1 2   DA  2   2   2   DA  A   C . n 
A 1 3   DT  3   3   3   DT  T   C . n 
A 1 4   DA  4   4   4   DA  A   C . n 
A 1 5   DA  5   5   5   DA  A   C . n 
A 1 6   DC  6   6   6   DC  C   C . n 
A 1 7   DT  7   7   7   DT  T   C . n 
A 1 8   DT  8   8   8   DT  T   C . n 
A 1 9   DC  9   9   9   DC  C   C . n 
A 1 10  DG  10  10  10  DG  G   C . n 
A 1 11  DT  11  11  11  DT  T   C . n 
A 1 12  DA  12  12  12  DA  A   C . n 
A 1 13  DT  13  13  13  DT  T   C . n 
A 1 14  DA  14  14  14  DA  A   C . n 
A 1 15  DG  15  15  15  DG  G   C . n 
A 1 16  DC  16  16  16  DC  C   C . n 
A 1 17  DA  17  17  17  DA  A   C . n 
A 1 18  DT  18  18  18  DT  T   C . n 
A 1 19  DA  19  19  19  DA  A   C . n 
A 1 20  DT  20  20  20  DT  T   C . n 
A 1 21  DG  21  21  21  DG  G   C . n 
A 1 22  DC  22  22  22  DC  C   C . n 
A 1 23  DT  23  23  23  DT  T   C . n 
A 1 24  DA  24  24  24  DA  A   C . n 
A 1 25  DT  25  25  25  DT  T   C . n 
A 1 26  DA  26  26  26  DA  A   C . n 
A 1 27  DC  27  27  27  DC  C   C . n 
A 1 28  DG  28  28  28  DG  G   C . n 
A 1 29  DA  29  29  29  DA  A   C . n 
A 1 30  DA  30  30  30  DA  A   C . n 
A 1 31  DG  31  31  31  DG  G   C . n 
A 1 32  DT  32  32  32  DT  T   C . n 
A 1 33  DT  33  33  33  DT  T   C . n 
A 1 34  DA  34  34  34  DA  A   C . n 
A 1 35  DT  35  35  ?   ?   ?   C . n 
B 1 1   DT  1   1   ?   ?   ?   D . n 
B 1 2   DA  2   2   2   DA  A   D . n 
B 1 3   DT  3   3   3   DT  T   D . n 
B 1 4   DA  4   4   4   DA  A   D . n 
B 1 5   DA  5   5   5   DA  A   D . n 
B 1 6   DC  6   6   6   DC  C   D . n 
B 1 7   DT  7   7   7   DT  T   D . n 
B 1 8   DT  8   8   8   DT  T   D . n 
B 1 9   DC  9   9   9   DC  C   D . n 
B 1 10  DG  10  10  10  DG  G   D . n 
B 1 11  DT  11  11  11  DT  T   D . n 
B 1 12  DA  12  12  12  DA  A   D . n 
B 1 13  DT  13  13  13  DT  T   D . n 
B 1 14  DA  14  14  14  DA  A   D . n 
B 1 15  DG  15  15  15  DG  G   D . n 
B 1 16  DC  16  16  16  DC  C   D . n 
B 1 17  DA  17  17  17  DA  A   D . n 
B 1 18  DT  18  18  18  DT  T   D . n 
B 1 19  DA  19  19  19  DA  A   D . n 
B 1 20  DT  20  20  20  DT  T   D . n 
B 1 21  DG  21  21  21  DG  G   D . n 
B 1 22  DC  22  22  22  DC  C   D . n 
B 1 23  DT  23  23  23  DT  T   D . n 
B 1 24  DA  24  24  24  DA  A   D . n 
B 1 25  DT  25  25  25  DT  T   D . n 
B 1 26  DA  26  26  26  DA  A   D . n 
B 1 27  DC  27  27  27  DC  C   D . n 
B 1 28  DG  28  28  28  DG  G   D . n 
B 1 29  DA  29  29  29  DA  A   D . n 
B 1 30  DA  30  30  30  DA  A   D . n 
B 1 31  DG  31  31  31  DG  G   D . n 
B 1 32  DT  32  32  32  DT  T   D . n 
B 1 33  DT  33  33  33  DT  T   D . n 
B 1 34  DA  34  34  34  DA  A   D . n 
B 1 35  DT  35  35  ?   ?   ?   D . n 
C 2 1   MET 1   1   ?   ?   ?   A . n 
C 2 2   SER 2   2   ?   ?   ?   A . n 
C 2 3   ASN 3   3   ?   ?   ?   A . n 
C 2 4   LEU 4   4   ?   ?   ?   A . n 
C 2 5   LEU 5   5   ?   ?   ?   A . n 
C 2 6   THR 6   6   ?   ?   ?   A . n 
C 2 7   VAL 7   7   ?   ?   ?   A . n 
C 2 8   HIS 8   8   ?   ?   ?   A . n 
C 2 9   GLN 9   9   ?   ?   ?   A . n 
C 2 10  ASN 10  10  ?   ?   ?   A . n 
C 2 11  LEU 11  11  ?   ?   ?   A . n 
C 2 12  PRO 12  12  ?   ?   ?   A . n 
C 2 13  ALA 13  13  ?   ?   ?   A . n 
C 2 14  LEU 14  14  ?   ?   ?   A . n 
C 2 15  PRO 15  15  ?   ?   ?   A . n 
C 2 16  VAL 16  16  ?   ?   ?   A . n 
C 2 17  ASP 17  17  ?   ?   ?   A . n 
C 2 18  ALA 18  18  ?   ?   ?   A . n 
C 2 19  THR 19  19  19  THR THR A . n 
C 2 20  SER 20  20  20  SER SER A . n 
C 2 21  ASP 21  21  21  ASP ASP A . n 
C 2 22  GLU 22  22  22  GLU GLU A . n 
C 2 23  VAL 23  23  23  VAL VAL A . n 
C 2 24  ARG 24  24  24  ARG ARG A . n 
C 2 25  LYS 25  25  25  LYS LYS A . n 
C 2 26  ASN 26  26  26  ASN ASN A . n 
C 2 27  LEU 27  27  27  LEU LEU A . n 
C 2 28  MET 28  28  28  MET MET A . n 
C 2 29  ASP 29  29  29  ASP ASP A . n 
C 2 30  MET 30  30  30  MET MET A . n 
C 2 31  PHE 31  31  31  PHE PHE A . n 
C 2 32  ARG 32  32  32  ARG ARG A . n 
C 2 33  ASP 33  33  33  ASP ASP A . n 
C 2 34  ARG 34  34  34  ARG ARG A . n 
C 2 35  GLN 35  35  35  GLN GLN A . n 
C 2 36  ALA 36  36  36  ALA ALA A . n 
C 2 37  PHE 37  37  37  PHE PHE A . n 
C 2 38  SER 38  38  38  SER SER A . n 
C 2 39  GLU 39  39  39  GLU GLU A . n 
C 2 40  HIS 40  40  40  HIS HIS A . n 
C 2 41  THR 41  41  41  THR THR A . n 
C 2 42  TRP 42  42  42  TRP TRP A . n 
C 2 43  LYS 43  43  43  LYS LYS A . n 
C 2 44  MET 44  44  44  MET MET A . n 
C 2 45  LEU 45  45  45  LEU LEU A . n 
C 2 46  LEU 46  46  46  LEU LEU A . n 
C 2 47  SER 47  47  47  SER SER A . n 
C 2 48  VAL 48  48  48  VAL VAL A . n 
C 2 49  CYS 49  49  49  CYS CYS A . n 
C 2 50  ARG 50  50  50  ARG ARG A . n 
C 2 51  SER 51  51  51  SER SER A . n 
C 2 52  TRP 52  52  52  TRP TRP A . n 
C 2 53  ALA 53  53  53  ALA ALA A . n 
C 2 54  ALA 54  54  54  ALA ALA A . n 
C 2 55  TRP 55  55  55  TRP TRP A . n 
C 2 56  CYS 56  56  56  CYS CYS A . n 
C 2 57  LYS 57  57  57  LYS LYS A . n 
C 2 58  LEU 58  58  58  LEU LEU A . n 
C 2 59  ASN 59  59  59  ASN ASN A . n 
C 2 60  ASN 60  60  60  ASN ASN A . n 
C 2 61  ARG 61  61  61  ARG ARG A . n 
C 2 62  LYS 62  62  62  LYS LYS A . n 
C 2 63  TRP 63  63  63  TRP TRP A . n 
C 2 64  PHE 64  64  64  PHE PHE A . n 
C 2 65  PRO 65  65  65  PRO PRO A . n 
C 2 66  ALA 66  66  66  ALA ALA A . n 
C 2 67  GLU 67  67  67  GLU GLU A . n 
C 2 68  PRO 68  68  68  PRO PRO A . n 
C 2 69  GLU 69  69  69  GLU GLU A . n 
C 2 70  ASP 70  70  70  ASP ASP A . n 
C 2 71  VAL 71  71  71  VAL VAL A . n 
C 2 72  ARG 72  72  72  ARG ARG A . n 
C 2 73  ASP 73  73  73  ASP ASP A . n 
C 2 74  TYR 74  74  74  TYR TYR A . n 
C 2 75  LEU 75  75  75  LEU LEU A . n 
C 2 76  LEU 76  76  76  LEU LEU A . n 
C 2 77  TYR 77  77  77  TYR TYR A . n 
C 2 78  LEU 78  78  78  LEU LEU A . n 
C 2 79  GLN 79  79  79  GLN GLN A . n 
C 2 80  ALA 80  80  80  ALA ALA A . n 
C 2 81  ARG 81  81  81  ARG ARG A . n 
C 2 82  GLY 82  82  82  GLY GLY A . n 
C 2 83  LEU 83  83  83  LEU LEU A . n 
C 2 84  ALA 84  84  84  ALA ALA A . n 
C 2 85  VAL 85  85  85  VAL VAL A . n 
C 2 86  LYS 86  86  86  LYS LYS A . n 
C 2 87  THR 87  87  87  THR THR A . n 
C 2 88  ILE 88  88  88  ILE ILE A . n 
C 2 89  GLN 89  89  89  GLN GLN A . n 
C 2 90  GLN 90  90  90  GLN GLN A . n 
C 2 91  HIS 91  91  91  HIS HIS A . n 
C 2 92  LEU 92  92  92  LEU LEU A . n 
C 2 93  GLY 93  93  93  GLY GLY A . n 
C 2 94  GLN 94  94  94  GLN GLN A . n 
C 2 95  LEU 95  95  95  LEU LEU A . n 
C 2 96  ASN 96  96  96  ASN ASN A . n 
C 2 97  MET 97  97  97  MET MET A . n 
C 2 98  LEU 98  98  98  LEU LEU A . n 
C 2 99  HIS 99  99  99  HIS HIS A . n 
C 2 100 ARG 100 100 100 ARG ARG A . n 
C 2 101 ARG 101 101 101 ARG ARG A . n 
C 2 102 SER 102 102 102 SER SER A . n 
C 2 103 GLY 103 103 103 GLY GLY A . n 
C 2 104 LEU 104 104 104 LEU LEU A . n 
C 2 105 PRO 105 105 105 PRO PRO A . n 
C 2 106 ARG 106 106 106 ARG ARG A . n 
C 2 107 PRO 107 107 107 PRO PRO A . n 
C 2 108 SER 108 108 108 SER SER A . n 
C 2 109 ASP 109 109 109 ASP ASP A . n 
C 2 110 SER 110 110 110 SER SER A . n 
C 2 111 ASN 111 111 111 ASN ASN A . n 
C 2 112 ALA 112 112 112 ALA ALA A . n 
C 2 113 VAL 113 113 113 VAL VAL A . n 
C 2 114 SER 114 114 114 SER SER A . n 
C 2 115 LEU 115 115 115 LEU LEU A . n 
C 2 116 VAL 116 116 116 VAL VAL A . n 
C 2 117 MET 117 117 117 MET MET A . n 
C 2 118 ARG 118 118 118 ARG ARG A . n 
C 2 119 ARG 119 119 119 ARG ARG A . n 
C 2 120 ILE 120 120 120 ILE ILE A . n 
C 2 121 ARG 121 121 121 ARG ARG A . n 
C 2 122 LYS 122 122 122 LYS LYS A . n 
C 2 123 GLU 123 123 123 GLU GLU A . n 
C 2 124 ASN 124 124 124 ASN ASN A . n 
C 2 125 VAL 125 125 125 VAL VAL A . n 
C 2 126 ASP 126 126 126 ASP ASP A . n 
C 2 127 ALA 127 127 127 ALA ALA A . n 
C 2 128 GLY 128 128 128 GLY GLY A . n 
C 2 129 GLU 129 129 129 GLU GLU A . n 
C 2 130 ARG 130 130 130 ARG ARG A . n 
C 2 131 ALA 131 131 131 ALA ALA A . n 
C 2 132 LYS 132 132 132 LYS LYS A . n 
C 2 133 GLN 133 133 133 GLN GLN A . n 
C 2 134 ALA 134 134 134 ALA ALA A . n 
C 2 135 LEU 135 135 135 LEU LEU A . n 
C 2 136 ALA 136 136 136 ALA ALA A . n 
C 2 137 PHE 137 137 137 PHE PHE A . n 
C 2 138 GLU 138 138 138 GLU GLU A . n 
C 2 139 ARG 139 139 139 ARG ARG A . n 
C 2 140 THR 140 140 140 THR THR A . n 
C 2 141 ASP 141 141 141 ASP ASP A . n 
C 2 142 PHE 142 142 142 PHE PHE A . n 
C 2 143 ASP 143 143 143 ASP ASP A . n 
C 2 144 GLN 144 144 144 GLN GLN A . n 
C 2 145 VAL 145 145 145 VAL VAL A . n 
C 2 146 ARG 146 146 146 ARG ARG A . n 
C 2 147 SER 147 147 147 SER SER A . n 
C 2 148 LEU 148 148 148 LEU LEU A . n 
C 2 149 MET 149 149 149 MET MET A . n 
C 2 150 GLU 150 150 150 GLU GLU A . n 
C 2 151 ASN 151 151 151 ASN ASN A . n 
C 2 152 SER 152 152 152 SER SER A . n 
C 2 153 ASP 153 153 153 ASP ASP A . n 
C 2 154 ARG 154 154 154 ARG ARG A . n 
C 2 155 CYS 155 155 155 CYS CYS A . n 
C 2 156 GLN 156 156 156 GLN GLN A . n 
C 2 157 ASP 157 157 157 ASP ASP A . n 
C 2 158 ILE 158 158 158 ILE ILE A . n 
C 2 159 ARG 159 159 159 ARG ARG A . n 
C 2 160 ASN 160 160 160 ASN ASN A . n 
C 2 161 LEU 161 161 161 LEU LEU A . n 
C 2 162 ALA 162 162 162 ALA ALA A . n 
C 2 163 PHE 163 163 163 PHE PHE A . n 
C 2 164 LEU 164 164 164 LEU LEU A . n 
C 2 165 GLY 165 165 165 GLY GLY A . n 
C 2 166 ILE 166 166 166 ILE ILE A . n 
C 2 167 ALA 167 167 167 ALA ALA A . n 
C 2 168 TYR 168 168 168 TYR TYR A . n 
C 2 169 ASN 169 169 169 ASN ASN A . n 
C 2 170 THR 170 170 170 THR THR A . n 
C 2 171 LEU 171 171 171 LEU LEU A . n 
C 2 172 LEU 172 172 172 LEU LEU A . n 
C 2 173 ARG 173 173 173 ARG ARG A . n 
C 2 174 ILE 174 174 174 ILE ILE A . n 
C 2 175 ALA 175 175 175 ALA ALA A . n 
C 2 176 GLU 176 176 176 GLU GLU A . n 
C 2 177 ILE 177 177 177 ILE ILE A . n 
C 2 178 ALA 178 178 178 ALA ALA A . n 
C 2 179 ARG 179 179 179 ARG ARG A . n 
C 2 180 ILE 180 180 180 ILE ILE A . n 
C 2 181 ARG 181 181 181 ARG ARG A . n 
C 2 182 VAL 182 182 182 VAL VAL A . n 
C 2 183 LYS 183 183 183 LYS LYS A . n 
C 2 184 ASP 184 184 184 ASP ASP A . n 
C 2 185 ILE 185 185 185 ILE ILE A . n 
C 2 186 SER 186 186 186 SER SER A . n 
C 2 187 ARG 187 187 187 ARG ARG A . n 
C 2 188 THR 188 188 188 THR THR A . n 
C 2 189 ASP 189 189 189 ASP ASP A . n 
C 2 190 GLY 190 190 190 GLY GLY A . n 
C 2 191 GLY 191 191 191 GLY GLY A . n 
C 2 192 ARG 192 192 192 ARG ARG A . n 
C 2 193 MET 193 193 193 MET MET A . n 
C 2 194 LEU 194 194 ?   ?   ?   A . n 
C 2 195 ILE 195 195 ?   ?   ?   A . n 
C 2 196 HIS 196 196 ?   ?   ?   A . n 
C 2 197 ILE 197 197 ?   ?   ?   A . n 
C 2 198 GLY 198 198 ?   ?   ?   A . n 
C 2 199 ARG 199 199 ?   ?   ?   A . n 
C 2 200 THR 200 200 ?   ?   ?   A . n 
C 2 201 LYS 201 201 ?   ?   ?   A . n 
C 2 202 THR 202 202 ?   ?   ?   A . n 
C 2 203 LEU 203 203 ?   ?   ?   A . n 
C 2 204 VAL 204 204 ?   ?   ?   A . n 
C 2 205 SER 205 205 ?   ?   ?   A . n 
C 2 206 THR 206 206 ?   ?   ?   A . n 
C 2 207 ALA 207 207 ?   ?   ?   A . n 
C 2 208 GLY 208 208 ?   ?   ?   A . n 
C 2 209 VAL 209 209 ?   ?   ?   A . n 
C 2 210 GLU 210 210 210 GLU GLU A . n 
C 2 211 LYS 211 211 211 LYS LYS A . n 
C 2 212 ALA 212 212 212 ALA ALA A . n 
C 2 213 LEU 213 213 213 LEU LEU A . n 
C 2 214 SER 214 214 214 SER SER A . n 
C 2 215 LEU 215 215 215 LEU LEU A . n 
C 2 216 GLY 216 216 216 GLY GLY A . n 
C 2 217 VAL 217 217 217 VAL VAL A . n 
C 2 218 THR 218 218 218 THR THR A . n 
C 2 219 LYS 219 219 219 LYS LYS A . n 
C 2 220 LEU 220 220 220 LEU LEU A . n 
C 2 221 VAL 221 221 221 VAL VAL A . n 
C 2 222 GLU 222 222 222 GLU GLU A . n 
C 2 223 ARG 223 223 223 ARG ARG A . n 
C 2 224 TRP 224 224 224 TRP TRP A . n 
C 2 225 ILE 225 225 225 ILE ILE A . n 
C 2 226 SER 226 226 226 SER SER A . n 
C 2 227 VAL 227 227 227 VAL VAL A . n 
C 2 228 SER 228 228 228 SER SER A . n 
C 2 229 GLY 229 229 229 GLY GLY A . n 
C 2 230 VAL 230 230 230 VAL VAL A . n 
C 2 231 ALA 231 231 231 ALA ALA A . n 
C 2 232 ASP 232 232 232 ASP ASP A . n 
C 2 233 ASP 233 233 233 ASP ASP A . n 
C 2 234 PRO 234 234 234 PRO PRO A . n 
C 2 235 ASN 235 235 235 ASN ASN A . n 
C 2 236 ASN 236 236 236 ASN ASN A . n 
C 2 237 TYR 237 237 237 TYR TYR A . n 
C 2 238 LEU 238 238 238 LEU LEU A . n 
C 2 239 PHE 239 239 239 PHE PHE A . n 
C 2 240 CYS 240 240 240 CYS CYS A . n 
C 2 241 ARG 241 241 241 ARG ARG A . n 
C 2 242 VAL 242 242 242 VAL VAL A . n 
C 2 243 ARG 243 243 243 ARG ARG A . n 
C 2 244 LYS 244 244 244 LYS LYS A . n 
C 2 245 ASN 245 245 245 ASN ASN A . n 
C 2 246 GLY 246 246 246 GLY GLY A . n 
C 2 247 VAL 247 247 247 VAL VAL A . n 
C 2 248 ALA 248 248 248 ALA ALA A . n 
C 2 249 ALA 249 249 249 ALA ALA A . n 
C 2 250 PRO 250 250 250 PRO PRO A . n 
C 2 251 SER 251 251 251 SER SER A . n 
C 2 252 ALA 252 252 252 ALA ALA A . n 
C 2 253 THR 253 253 253 THR THR A . n 
C 2 254 SER 254 254 254 SER SER A . n 
C 2 255 GLN 255 255 255 GLN GLN A . n 
C 2 256 LEU 256 256 256 LEU LEU A . n 
C 2 257 SER 257 257 257 SER SER A . n 
C 2 258 THR 258 258 258 THR THR A . n 
C 2 259 ARG 259 259 259 ARG ARG A . n 
C 2 260 ALA 260 260 260 ALA ALA A . n 
C 2 261 LEU 261 261 261 LEU LEU A . n 
C 2 262 GLU 262 262 262 GLU GLU A . n 
C 2 263 GLY 263 263 263 GLY GLY A . n 
C 2 264 ILE 264 264 264 ILE ILE A . n 
C 2 265 PHE 265 265 265 PHE PHE A . n 
C 2 266 GLU 266 266 266 GLU GLU A . n 
C 2 267 ALA 267 267 267 ALA ALA A . n 
C 2 268 THR 268 268 268 THR THR A . n 
C 2 269 HIS 269 269 269 HIS HIS A . n 
C 2 270 ARG 270 270 270 ARG ARG A . n 
C 2 271 LEU 271 271 271 LEU LEU A . n 
C 2 272 ILE 272 272 272 ILE ILE A . n 
C 2 273 TYR 273 273 273 TYR TYR A . n 
C 2 274 GLY 274 274 274 GLY GLY A . n 
C 2 275 ALA 275 275 275 ALA ALA A . n 
C 2 276 LYS 276 276 276 LYS LYS A . n 
C 2 277 ASP 277 277 277 ASP ASP A . n 
C 2 278 ASP 278 278 278 ASP ASP A . n 
C 2 279 SER 279 279 279 SER SER A . n 
C 2 280 GLY 280 280 280 GLY GLY A . n 
C 2 281 GLN 281 281 281 GLN GLN A . n 
C 2 282 ARG 282 282 282 ARG ARG A . n 
C 2 283 TYR 283 283 283 TYR TYR A . n 
C 2 284 LEU 284 284 284 LEU LEU A . n 
C 2 285 ALA 285 285 285 ALA ALA A . n 
C 2 286 TRP 286 286 286 TRP TRP A . n 
C 2 287 SER 287 287 287 SER SER A . n 
C 2 288 GLY 288 288 288 GLY GLY A . n 
C 2 289 HIS 289 289 289 HIS HIS A . n 
C 2 290 SER 290 290 290 SER SER A . n 
C 2 291 ALA 291 291 291 ALA ALA A . n 
C 2 292 ARG 292 292 292 ARG ARG A . n 
C 2 293 VAL 293 293 293 VAL VAL A . n 
C 2 294 GLY 294 294 294 GLY GLY A . n 
C 2 295 ALA 295 295 295 ALA ALA A . n 
C 2 296 ALA 296 296 296 ALA ALA A . n 
C 2 297 ARG 297 297 297 ARG ARG A . n 
C 2 298 ASP 298 298 298 ASP ASP A . n 
C 2 299 MET 299 299 299 MET MET A . n 
C 2 300 ALA 300 300 300 ALA ALA A . n 
C 2 301 ARG 301 301 301 ARG ARG A . n 
C 2 302 ALA 302 302 302 ALA ALA A . n 
C 2 303 GLY 303 303 303 GLY GLY A . n 
C 2 304 VAL 304 304 304 VAL VAL A . n 
C 2 305 SER 305 305 305 SER SER A . n 
C 2 306 ILE 306 306 306 ILE ILE A . n 
C 2 307 PRO 307 307 307 PRO PRO A . n 
C 2 308 GLU 308 308 308 GLU GLU A . n 
C 2 309 ILE 309 309 309 ILE ILE A . n 
C 2 310 MET 310 310 310 MET MET A . n 
C 2 311 GLN 311 311 311 GLN GLN A . n 
C 2 312 ALA 312 312 312 ALA ALA A . n 
C 2 313 GLY 313 313 313 GLY GLY A . n 
C 2 314 GLY 314 314 314 GLY GLY A . n 
C 2 315 TRP 315 315 315 TRP TRP A . n 
C 2 316 THR 316 316 316 THR THR A . n 
C 2 317 ASN 317 317 ?   ?   ?   A . n 
C 2 318 VAL 318 318 ?   ?   ?   A . n 
C 2 319 ASN 319 319 ?   ?   ?   A . n 
C 2 320 ILE 320 320 ?   ?   ?   A . n 
C 2 321 VAL 321 321 ?   ?   ?   A . n 
C 2 322 MET 322 322 ?   ?   ?   A . n 
C 2 323 ASN 323 323 ?   ?   ?   A . n 
C 2 324 PHE 324 324 ?   ?   ?   A . n 
C 2 325 ILE 325 325 ?   ?   ?   A . n 
C 2 326 ARG 326 326 326 ARG ARG A . n 
C 2 327 ASN 327 327 327 ASN ASN A . n 
C 2 328 LEU 328 328 328 LEU LEU A . n 
C 2 329 ASP 329 329 329 ASP ASP A . n 
C 2 330 SER 330 330 330 SER SER A . n 
C 2 331 GLU 331 331 331 GLU GLU A . n 
C 2 332 THR 332 332 332 THR THR A . n 
C 2 333 GLY 333 333 333 GLY GLY A . n 
C 2 334 ALA 334 334 334 ALA ALA A . n 
C 2 335 MET 335 335 335 MET MET A . n 
C 2 336 VAL 336 336 336 VAL VAL A . n 
C 2 337 ARG 337 337 337 ARG ARG A . n 
C 2 338 LEU 338 338 338 LEU LEU A . n 
C 2 339 LEU 339 339 339 LEU LEU A . n 
C 2 340 GLU 340 340 340 GLU GLU A . n 
C 2 341 ASP 341 341 ?   ?   ?   A . n 
C 2 342 GLY 342 342 ?   ?   ?   A . n 
C 2 343 ASP 343 343 ?   ?   ?   A . n 
D 2 1   MET 1   1   ?   ?   ?   B . n 
D 2 2   SER 2   2   ?   ?   ?   B . n 
D 2 3   ASN 3   3   ?   ?   ?   B . n 
D 2 4   LEU 4   4   ?   ?   ?   B . n 
D 2 5   LEU 5   5   ?   ?   ?   B . n 
D 2 6   THR 6   6   ?   ?   ?   B . n 
D 2 7   VAL 7   7   ?   ?   ?   B . n 
D 2 8   HIS 8   8   ?   ?   ?   B . n 
D 2 9   GLN 9   9   ?   ?   ?   B . n 
D 2 10  ASN 10  10  ?   ?   ?   B . n 
D 2 11  LEU 11  11  ?   ?   ?   B . n 
D 2 12  PRO 12  12  ?   ?   ?   B . n 
D 2 13  ALA 13  13  ?   ?   ?   B . n 
D 2 14  LEU 14  14  ?   ?   ?   B . n 
D 2 15  PRO 15  15  ?   ?   ?   B . n 
D 2 16  VAL 16  16  ?   ?   ?   B . n 
D 2 17  ASP 17  17  ?   ?   ?   B . n 
D 2 18  ALA 18  18  ?   ?   ?   B . n 
D 2 19  THR 19  19  19  THR THR B . n 
D 2 20  SER 20  20  20  SER SER B . n 
D 2 21  ASP 21  21  21  ASP ASP B . n 
D 2 22  GLU 22  22  22  GLU GLU B . n 
D 2 23  VAL 23  23  23  VAL VAL B . n 
D 2 24  ARG 24  24  24  ARG ARG B . n 
D 2 25  LYS 25  25  25  LYS LYS B . n 
D 2 26  ASN 26  26  26  ASN ASN B . n 
D 2 27  LEU 27  27  27  LEU LEU B . n 
D 2 28  MET 28  28  28  MET MET B . n 
D 2 29  ASP 29  29  29  ASP ASP B . n 
D 2 30  MET 30  30  30  MET MET B . n 
D 2 31  PHE 31  31  31  PHE PHE B . n 
D 2 32  ARG 32  32  32  ARG ARG B . n 
D 2 33  ASP 33  33  33  ASP ASP B . n 
D 2 34  ARG 34  34  34  ARG ARG B . n 
D 2 35  GLN 35  35  35  GLN GLN B . n 
D 2 36  ALA 36  36  36  ALA ALA B . n 
D 2 37  PHE 37  37  37  PHE PHE B . n 
D 2 38  SER 38  38  38  SER SER B . n 
D 2 39  GLU 39  39  39  GLU GLU B . n 
D 2 40  HIS 40  40  40  HIS HIS B . n 
D 2 41  THR 41  41  41  THR THR B . n 
D 2 42  TRP 42  42  42  TRP TRP B . n 
D 2 43  LYS 43  43  43  LYS LYS B . n 
D 2 44  MET 44  44  44  MET MET B . n 
D 2 45  LEU 45  45  45  LEU LEU B . n 
D 2 46  LEU 46  46  46  LEU LEU B . n 
D 2 47  SER 47  47  47  SER SER B . n 
D 2 48  VAL 48  48  48  VAL VAL B . n 
D 2 49  CYS 49  49  49  CYS CYS B . n 
D 2 50  ARG 50  50  50  ARG ARG B . n 
D 2 51  SER 51  51  51  SER SER B . n 
D 2 52  TRP 52  52  52  TRP TRP B . n 
D 2 53  ALA 53  53  53  ALA ALA B . n 
D 2 54  ALA 54  54  54  ALA ALA B . n 
D 2 55  TRP 55  55  55  TRP TRP B . n 
D 2 56  CYS 56  56  56  CYS CYS B . n 
D 2 57  LYS 57  57  57  LYS LYS B . n 
D 2 58  LEU 58  58  58  LEU LEU B . n 
D 2 59  ASN 59  59  59  ASN ASN B . n 
D 2 60  ASN 60  60  60  ASN ASN B . n 
D 2 61  ARG 61  61  61  ARG ARG B . n 
D 2 62  LYS 62  62  62  LYS LYS B . n 
D 2 63  TRP 63  63  63  TRP TRP B . n 
D 2 64  PHE 64  64  64  PHE PHE B . n 
D 2 65  PRO 65  65  65  PRO PRO B . n 
D 2 66  ALA 66  66  66  ALA ALA B . n 
D 2 67  GLU 67  67  67  GLU GLU B . n 
D 2 68  PRO 68  68  68  PRO PRO B . n 
D 2 69  GLU 69  69  69  GLU GLU B . n 
D 2 70  ASP 70  70  70  ASP ASP B . n 
D 2 71  VAL 71  71  71  VAL VAL B . n 
D 2 72  ARG 72  72  72  ARG ARG B . n 
D 2 73  ASP 73  73  73  ASP ASP B . n 
D 2 74  TYR 74  74  74  TYR TYR B . n 
D 2 75  LEU 75  75  75  LEU LEU B . n 
D 2 76  LEU 76  76  76  LEU LEU B . n 
D 2 77  TYR 77  77  77  TYR TYR B . n 
D 2 78  LEU 78  78  78  LEU LEU B . n 
D 2 79  GLN 79  79  79  GLN GLN B . n 
D 2 80  ALA 80  80  80  ALA ALA B . n 
D 2 81  ARG 81  81  81  ARG ARG B . n 
D 2 82  GLY 82  82  82  GLY GLY B . n 
D 2 83  LEU 83  83  83  LEU LEU B . n 
D 2 84  ALA 84  84  84  ALA ALA B . n 
D 2 85  VAL 85  85  85  VAL VAL B . n 
D 2 86  LYS 86  86  86  LYS LYS B . n 
D 2 87  THR 87  87  87  THR THR B . n 
D 2 88  ILE 88  88  88  ILE ILE B . n 
D 2 89  GLN 89  89  89  GLN GLN B . n 
D 2 90  GLN 90  90  90  GLN GLN B . n 
D 2 91  HIS 91  91  91  HIS HIS B . n 
D 2 92  LEU 92  92  92  LEU LEU B . n 
D 2 93  GLY 93  93  93  GLY GLY B . n 
D 2 94  GLN 94  94  94  GLN GLN B . n 
D 2 95  LEU 95  95  95  LEU LEU B . n 
D 2 96  ASN 96  96  96  ASN ASN B . n 
D 2 97  MET 97  97  97  MET MET B . n 
D 2 98  LEU 98  98  98  LEU LEU B . n 
D 2 99  HIS 99  99  99  HIS HIS B . n 
D 2 100 ARG 100 100 100 ARG ARG B . n 
D 2 101 ARG 101 101 101 ARG ARG B . n 
D 2 102 SER 102 102 102 SER SER B . n 
D 2 103 GLY 103 103 103 GLY GLY B . n 
D 2 104 LEU 104 104 104 LEU LEU B . n 
D 2 105 PRO 105 105 105 PRO PRO B . n 
D 2 106 ARG 106 106 106 ARG ARG B . n 
D 2 107 PRO 107 107 107 PRO PRO B . n 
D 2 108 SER 108 108 108 SER SER B . n 
D 2 109 ASP 109 109 109 ASP ASP B . n 
D 2 110 SER 110 110 110 SER SER B . n 
D 2 111 ASN 111 111 111 ASN ASN B . n 
D 2 112 ALA 112 112 112 ALA ALA B . n 
D 2 113 VAL 113 113 113 VAL VAL B . n 
D 2 114 SER 114 114 114 SER SER B . n 
D 2 115 LEU 115 115 115 LEU LEU B . n 
D 2 116 VAL 116 116 116 VAL VAL B . n 
D 2 117 MET 117 117 117 MET MET B . n 
D 2 118 ARG 118 118 118 ARG ARG B . n 
D 2 119 ARG 119 119 119 ARG ARG B . n 
D 2 120 ILE 120 120 120 ILE ILE B . n 
D 2 121 ARG 121 121 121 ARG ARG B . n 
D 2 122 LYS 122 122 122 LYS LYS B . n 
D 2 123 GLU 123 123 123 GLU GLU B . n 
D 2 124 ASN 124 124 124 ASN ASN B . n 
D 2 125 VAL 125 125 125 VAL VAL B . n 
D 2 126 ASP 126 126 126 ASP ASP B . n 
D 2 127 ALA 127 127 127 ALA ALA B . n 
D 2 128 GLY 128 128 128 GLY GLY B . n 
D 2 129 GLU 129 129 129 GLU GLU B . n 
D 2 130 ARG 130 130 130 ARG ARG B . n 
D 2 131 ALA 131 131 131 ALA ALA B . n 
D 2 132 LYS 132 132 132 LYS LYS B . n 
D 2 133 GLN 133 133 133 GLN GLN B . n 
D 2 134 ALA 134 134 134 ALA ALA B . n 
D 2 135 LEU 135 135 135 LEU LEU B . n 
D 2 136 ALA 136 136 136 ALA ALA B . n 
D 2 137 PHE 137 137 137 PHE PHE B . n 
D 2 138 GLU 138 138 138 GLU GLU B . n 
D 2 139 ARG 139 139 139 ARG ARG B . n 
D 2 140 THR 140 140 140 THR THR B . n 
D 2 141 ASP 141 141 141 ASP ASP B . n 
D 2 142 PHE 142 142 142 PHE PHE B . n 
D 2 143 ASP 143 143 143 ASP ASP B . n 
D 2 144 GLN 144 144 144 GLN GLN B . n 
D 2 145 VAL 145 145 145 VAL VAL B . n 
D 2 146 ARG 146 146 146 ARG ARG B . n 
D 2 147 SER 147 147 147 SER SER B . n 
D 2 148 LEU 148 148 148 LEU LEU B . n 
D 2 149 MET 149 149 149 MET MET B . n 
D 2 150 GLU 150 150 150 GLU GLU B . n 
D 2 151 ASN 151 151 151 ASN ASN B . n 
D 2 152 SER 152 152 152 SER SER B . n 
D 2 153 ASP 153 153 153 ASP ASP B . n 
D 2 154 ARG 154 154 154 ARG ARG B . n 
D 2 155 CYS 155 155 155 CYS CYS B . n 
D 2 156 GLN 156 156 156 GLN GLN B . n 
D 2 157 ASP 157 157 157 ASP ASP B . n 
D 2 158 ILE 158 158 158 ILE ILE B . n 
D 2 159 ARG 159 159 159 ARG ARG B . n 
D 2 160 ASN 160 160 160 ASN ASN B . n 
D 2 161 LEU 161 161 161 LEU LEU B . n 
D 2 162 ALA 162 162 162 ALA ALA B . n 
D 2 163 PHE 163 163 163 PHE PHE B . n 
D 2 164 LEU 164 164 164 LEU LEU B . n 
D 2 165 GLY 165 165 165 GLY GLY B . n 
D 2 166 ILE 166 166 166 ILE ILE B . n 
D 2 167 ALA 167 167 167 ALA ALA B . n 
D 2 168 TYR 168 168 168 TYR TYR B . n 
D 2 169 ASN 169 169 169 ASN ASN B . n 
D 2 170 THR 170 170 170 THR THR B . n 
D 2 171 LEU 171 171 171 LEU LEU B . n 
D 2 172 LEU 172 172 172 LEU LEU B . n 
D 2 173 ARG 173 173 173 ARG ARG B . n 
D 2 174 ILE 174 174 174 ILE ILE B . n 
D 2 175 ALA 175 175 175 ALA ALA B . n 
D 2 176 GLU 176 176 176 GLU GLU B . n 
D 2 177 ILE 177 177 177 ILE ILE B . n 
D 2 178 ALA 178 178 178 ALA ALA B . n 
D 2 179 ARG 179 179 179 ARG ARG B . n 
D 2 180 ILE 180 180 180 ILE ILE B . n 
D 2 181 ARG 181 181 181 ARG ARG B . n 
D 2 182 VAL 182 182 182 VAL VAL B . n 
D 2 183 LYS 183 183 183 LYS LYS B . n 
D 2 184 ASP 184 184 184 ASP ASP B . n 
D 2 185 ILE 185 185 185 ILE ILE B . n 
D 2 186 SER 186 186 186 SER SER B . n 
D 2 187 ARG 187 187 187 ARG ARG B . n 
D 2 188 THR 188 188 188 THR THR B . n 
D 2 189 ASP 189 189 189 ASP ASP B . n 
D 2 190 GLY 190 190 190 GLY GLY B . n 
D 2 191 GLY 191 191 191 GLY GLY B . n 
D 2 192 ARG 192 192 192 ARG ARG B . n 
D 2 193 MET 193 193 193 MET MET B . n 
D 2 194 LEU 194 194 194 LEU LEU B . n 
D 2 195 ILE 195 195 195 ILE ILE B . n 
D 2 196 HIS 196 196 196 HIS HIS B . n 
D 2 197 ILE 197 197 197 ILE ILE B . n 
D 2 198 GLY 198 198 198 GLY GLY B . n 
D 2 199 ARG 199 199 199 ARG ARG B . n 
D 2 200 THR 200 200 200 THR THR B . n 
D 2 201 LYS 201 201 201 LYS LYS B . n 
D 2 202 THR 202 202 202 THR THR B . n 
D 2 203 LEU 203 203 203 LEU LEU B . n 
D 2 204 VAL 204 204 204 VAL VAL B . n 
D 2 205 SER 205 205 205 SER SER B . n 
D 2 206 THR 206 206 206 THR THR B . n 
D 2 207 ALA 207 207 207 ALA ALA B . n 
D 2 208 GLY 208 208 208 GLY GLY B . n 
D 2 209 VAL 209 209 209 VAL VAL B . n 
D 2 210 GLU 210 210 210 GLU GLU B . n 
D 2 211 LYS 211 211 211 LYS LYS B . n 
D 2 212 ALA 212 212 212 ALA ALA B . n 
D 2 213 LEU 213 213 213 LEU LEU B . n 
D 2 214 SER 214 214 214 SER SER B . n 
D 2 215 LEU 215 215 215 LEU LEU B . n 
D 2 216 GLY 216 216 216 GLY GLY B . n 
D 2 217 VAL 217 217 217 VAL VAL B . n 
D 2 218 THR 218 218 218 THR THR B . n 
D 2 219 LYS 219 219 219 LYS LYS B . n 
D 2 220 LEU 220 220 220 LEU LEU B . n 
D 2 221 VAL 221 221 221 VAL VAL B . n 
D 2 222 GLU 222 222 222 GLU GLU B . n 
D 2 223 ARG 223 223 223 ARG ARG B . n 
D 2 224 TRP 224 224 224 TRP TRP B . n 
D 2 225 ILE 225 225 225 ILE ILE B . n 
D 2 226 SER 226 226 226 SER SER B . n 
D 2 227 VAL 227 227 227 VAL VAL B . n 
D 2 228 SER 228 228 228 SER SER B . n 
D 2 229 GLY 229 229 229 GLY GLY B . n 
D 2 230 VAL 230 230 230 VAL VAL B . n 
D 2 231 ALA 231 231 231 ALA ALA B . n 
D 2 232 ASP 232 232 232 ASP ASP B . n 
D 2 233 ASP 233 233 233 ASP ASP B . n 
D 2 234 PRO 234 234 234 PRO PRO B . n 
D 2 235 ASN 235 235 235 ASN ASN B . n 
D 2 236 ASN 236 236 236 ASN ASN B . n 
D 2 237 TYR 237 237 237 TYR TYR B . n 
D 2 238 LEU 238 238 238 LEU LEU B . n 
D 2 239 PHE 239 239 239 PHE PHE B . n 
D 2 240 CYS 240 240 240 CYS CYS B . n 
D 2 241 ARG 241 241 241 ARG ARG B . n 
D 2 242 VAL 242 242 242 VAL VAL B . n 
D 2 243 ARG 243 243 243 ARG ARG B . n 
D 2 244 LYS 244 244 244 LYS LYS B . n 
D 2 245 ASN 245 245 245 ASN ASN B . n 
D 2 246 GLY 246 246 246 GLY GLY B . n 
D 2 247 VAL 247 247 247 VAL VAL B . n 
D 2 248 ALA 248 248 248 ALA ALA B . n 
D 2 249 ALA 249 249 249 ALA ALA B . n 
D 2 250 PRO 250 250 250 PRO PRO B . n 
D 2 251 SER 251 251 251 SER SER B . n 
D 2 252 ALA 252 252 252 ALA ALA B . n 
D 2 253 THR 253 253 253 THR THR B . n 
D 2 254 SER 254 254 254 SER SER B . n 
D 2 255 GLN 255 255 255 GLN GLN B . n 
D 2 256 LEU 256 256 256 LEU LEU B . n 
D 2 257 SER 257 257 257 SER SER B . n 
D 2 258 THR 258 258 258 THR THR B . n 
D 2 259 ARG 259 259 259 ARG ARG B . n 
D 2 260 ALA 260 260 260 ALA ALA B . n 
D 2 261 LEU 261 261 261 LEU LEU B . n 
D 2 262 GLU 262 262 262 GLU GLU B . n 
D 2 263 GLY 263 263 263 GLY GLY B . n 
D 2 264 ILE 264 264 264 ILE ILE B . n 
D 2 265 PHE 265 265 265 PHE PHE B . n 
D 2 266 GLU 266 266 266 GLU GLU B . n 
D 2 267 ALA 267 267 267 ALA ALA B . n 
D 2 268 THR 268 268 268 THR THR B . n 
D 2 269 HIS 269 269 269 HIS HIS B . n 
D 2 270 ARG 270 270 270 ARG ARG B . n 
D 2 271 LEU 271 271 271 LEU LEU B . n 
D 2 272 ILE 272 272 272 ILE ILE B . n 
D 2 273 TYR 273 273 273 TYR TYR B . n 
D 2 274 GLY 274 274 274 GLY GLY B . n 
D 2 275 ALA 275 275 275 ALA ALA B . n 
D 2 276 LYS 276 276 276 LYS LYS B . n 
D 2 277 ASP 277 277 277 ASP ASP B . n 
D 2 278 ASP 278 278 278 ASP ASP B . n 
D 2 279 SER 279 279 279 SER SER B . n 
D 2 280 GLY 280 280 280 GLY GLY B . n 
D 2 281 GLN 281 281 281 GLN GLN B . n 
D 2 282 ARG 282 282 282 ARG ARG B . n 
D 2 283 TYR 283 283 283 TYR TYR B . n 
D 2 284 LEU 284 284 284 LEU LEU B . n 
D 2 285 ALA 285 285 285 ALA ALA B . n 
D 2 286 TRP 286 286 286 TRP TRP B . n 
D 2 287 SER 287 287 287 SER SER B . n 
D 2 288 GLY 288 288 288 GLY GLY B . n 
D 2 289 HIS 289 289 289 HIS HIS B . n 
D 2 290 SER 290 290 290 SER SER B . n 
D 2 291 ALA 291 291 291 ALA ALA B . n 
D 2 292 ARG 292 292 292 ARG ARG B . n 
D 2 293 VAL 293 293 293 VAL VAL B . n 
D 2 294 GLY 294 294 294 GLY GLY B . n 
D 2 295 ALA 295 295 295 ALA ALA B . n 
D 2 296 ALA 296 296 296 ALA ALA B . n 
D 2 297 ARG 297 297 297 ARG ARG B . n 
D 2 298 ASP 298 298 298 ASP ASP B . n 
D 2 299 MET 299 299 299 MET MET B . n 
D 2 300 ALA 300 300 300 ALA ALA B . n 
D 2 301 ARG 301 301 301 ARG ARG B . n 
D 2 302 ALA 302 302 302 ALA ALA B . n 
D 2 303 GLY 303 303 303 GLY GLY B . n 
D 2 304 VAL 304 304 304 VAL VAL B . n 
D 2 305 SER 305 305 305 SER SER B . n 
D 2 306 ILE 306 306 306 ILE ILE B . n 
D 2 307 PRO 307 307 307 PRO PRO B . n 
D 2 308 GLU 308 308 308 GLU GLU B . n 
D 2 309 ILE 309 309 309 ILE ILE B . n 
D 2 310 MET 310 310 310 MET MET B . n 
D 2 311 GLN 311 311 311 GLN GLN B . n 
D 2 312 ALA 312 312 312 ALA ALA B . n 
D 2 313 GLY 313 313 313 GLY GLY B . n 
D 2 314 GLY 314 314 314 GLY GLY B . n 
D 2 315 TRP 315 315 ?   ?   ?   B . n 
D 2 316 THR 316 316 ?   ?   ?   B . n 
D 2 317 ASN 317 317 ?   ?   ?   B . n 
D 2 318 VAL 318 318 ?   ?   ?   B . n 
D 2 319 ASN 319 319 ?   ?   ?   B . n 
D 2 320 ILE 320 320 ?   ?   ?   B . n 
D 2 321 VAL 321 321 ?   ?   ?   B . n 
D 2 322 MET 322 322 ?   ?   ?   B . n 
D 2 323 ASN 323 323 ?   ?   ?   B . n 
D 2 324 PHE 324 324 ?   ?   ?   B . n 
D 2 325 ILE 325 325 ?   ?   ?   B . n 
D 2 326 ARG 326 326 ?   ?   ?   B . n 
D 2 327 ASN 327 327 ?   ?   ?   B . n 
D 2 328 LEU 328 328 ?   ?   ?   B . n 
D 2 329 ASP 329 329 ?   ?   ?   B . n 
D 2 330 SER 330 330 ?   ?   ?   B . n 
D 2 331 GLU 331 331 ?   ?   ?   B . n 
D 2 332 THR 332 332 ?   ?   ?   B . n 
D 2 333 GLY 333 333 ?   ?   ?   B . n 
D 2 334 ALA 334 334 ?   ?   ?   B . n 
D 2 335 MET 335 335 ?   ?   ?   B . n 
D 2 336 VAL 336 336 ?   ?   ?   B . n 
D 2 337 ARG 337 337 ?   ?   ?   B . n 
D 2 338 LEU 338 338 ?   ?   ?   B . n 
D 2 339 LEU 339 339 ?   ?   ?   B . n 
D 2 340 GLU 340 340 ?   ?   ?   B . n 
D 2 341 ASP 341 341 ?   ?   ?   B . n 
D 2 342 GLY 342 342 ?   ?   ?   B . n 
D 2 343 ASP 343 343 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1   36  9   HOH HOH C . 
E 3 HOH 2   37  36  HOH HOH C . 
E 3 HOH 3   38  47  HOH HOH C . 
E 3 HOH 4   39  49  HOH HOH C . 
E 3 HOH 5   40  56  HOH HOH C . 
E 3 HOH 6   41  63  HOH HOH C . 
E 3 HOH 7   42  81  HOH HOH C . 
E 3 HOH 8   43  92  HOH HOH C . 
E 3 HOH 9   44  95  HOH HOH C . 
E 3 HOH 10  45  107 HOH HOH C . 
E 3 HOH 11  46  114 HOH HOH C . 
E 3 HOH 12  47  116 HOH HOH C . 
E 3 HOH 13  48  120 HOH HOH C . 
E 3 HOH 14  49  124 HOH HOH C . 
E 3 HOH 15  50  128 HOH HOH C . 
E 3 HOH 16  51  133 HOH HOH C . 
E 3 HOH 17  52  138 HOH HOH C . 
E 3 HOH 18  53  139 HOH HOH C . 
E 3 HOH 19  54  143 HOH HOH C . 
E 3 HOH 20  55  148 HOH HOH C . 
E 3 HOH 21  56  149 HOH HOH C . 
E 3 HOH 22  57  155 HOH HOH C . 
E 3 HOH 23  58  156 HOH HOH C . 
E 3 HOH 24  59  183 HOH HOH C . 
E 3 HOH 25  60  185 HOH HOH C . 
E 3 HOH 26  61  197 HOH HOH C . 
E 3 HOH 27  62  199 HOH HOH C . 
E 3 HOH 28  63  207 HOH HOH C . 
E 3 HOH 29  64  215 HOH HOH C . 
E 3 HOH 30  65  225 HOH HOH C . 
E 3 HOH 31  66  231 HOH HOH C . 
E 3 HOH 32  67  243 HOH HOH C . 
E 3 HOH 33  68  257 HOH HOH C . 
E 3 HOH 34  69  275 HOH HOH C . 
F 3 HOH 1   36  5   HOH HOH D . 
F 3 HOH 2   37  6   HOH HOH D . 
F 3 HOH 3   38  10  HOH HOH D . 
F 3 HOH 4   39  19  HOH HOH D . 
F 3 HOH 5   40  20  HOH HOH D . 
F 3 HOH 6   41  26  HOH HOH D . 
F 3 HOH 7   42  33  HOH HOH D . 
F 3 HOH 8   43  37  HOH HOH D . 
F 3 HOH 9   44  41  HOH HOH D . 
F 3 HOH 10  45  51  HOH HOH D . 
F 3 HOH 11  46  61  HOH HOH D . 
F 3 HOH 12  47  62  HOH HOH D . 
F 3 HOH 13  48  70  HOH HOH D . 
F 3 HOH 14  49  82  HOH HOH D . 
F 3 HOH 15  50  87  HOH HOH D . 
F 3 HOH 16  51  88  HOH HOH D . 
F 3 HOH 17  52  90  HOH HOH D . 
F 3 HOH 18  53  96  HOH HOH D . 
F 3 HOH 19  54  112 HOH HOH D . 
F 3 HOH 20  55  119 HOH HOH D . 
F 3 HOH 21  56  125 HOH HOH D . 
F 3 HOH 22  57  129 HOH HOH D . 
F 3 HOH 23  58  141 HOH HOH D . 
F 3 HOH 24  59  151 HOH HOH D . 
F 3 HOH 25  60  154 HOH HOH D . 
F 3 HOH 26  61  171 HOH HOH D . 
F 3 HOH 27  62  175 HOH HOH D . 
F 3 HOH 28  63  194 HOH HOH D . 
F 3 HOH 29  64  198 HOH HOH D . 
F 3 HOH 30  65  200 HOH HOH D . 
F 3 HOH 31  66  213 HOH HOH D . 
F 3 HOH 32  67  228 HOH HOH D . 
F 3 HOH 33  68  234 HOH HOH D . 
F 3 HOH 34  69  237 HOH HOH D . 
F 3 HOH 35  70  247 HOH HOH D . 
F 3 HOH 36  71  260 HOH HOH D . 
F 3 HOH 37  72  261 HOH HOH D . 
F 3 HOH 38  73  268 HOH HOH D . 
F 3 HOH 39  74  269 HOH HOH D . 
F 3 HOH 40  75  270 HOH HOH D . 
F 3 HOH 41  76  272 HOH HOH D . 
F 3 HOH 42  77  274 HOH HOH D . 
F 3 HOH 43  78  280 HOH HOH D . 
F 3 HOH 44  79  284 HOH HOH D . 
F 3 HOH 45  80  285 HOH HOH D . 
F 3 HOH 46  81  286 HOH HOH D . 
F 3 HOH 47  82  287 HOH HOH D . 
F 3 HOH 48  83  288 HOH HOH D . 
F 3 HOH 49  84  289 HOH HOH D . 
F 3 HOH 50  85  290 HOH HOH D . 
F 3 HOH 51  86  291 HOH HOH D . 
F 3 HOH 52  87  292 HOH HOH D . 
F 3 HOH 53  88  294 HOH HOH D . 
F 3 HOH 54  89  297 HOH HOH D . 
F 3 HOH 55  90  308 HOH HOH D . 
F 3 HOH 56  91  311 HOH HOH D . 
G 3 HOH 1   346 3   HOH HOH A . 
G 3 HOH 2   347 15  HOH HOH A . 
G 3 HOH 3   348 21  HOH HOH A . 
G 3 HOH 4   349 25  HOH HOH A . 
G 3 HOH 5   350 30  HOH HOH A . 
G 3 HOH 6   351 32  HOH HOH A . 
G 3 HOH 7   352 42  HOH HOH A . 
G 3 HOH 8   353 43  HOH HOH A . 
G 3 HOH 9   354 44  HOH HOH A . 
G 3 HOH 10  355 46  HOH HOH A . 
G 3 HOH 11  356 52  HOH HOH A . 
G 3 HOH 12  357 53  HOH HOH A . 
G 3 HOH 13  358 55  HOH HOH A . 
G 3 HOH 14  359 57  HOH HOH A . 
G 3 HOH 15  360 60  HOH HOH A . 
G 3 HOH 16  361 65  HOH HOH A . 
G 3 HOH 17  362 66  HOH HOH A . 
G 3 HOH 18  363 67  HOH HOH A . 
G 3 HOH 19  364 68  HOH HOH A . 
G 3 HOH 20  365 71  HOH HOH A . 
G 3 HOH 21  366 72  HOH HOH A . 
G 3 HOH 22  367 73  HOH HOH A . 
G 3 HOH 23  368 75  HOH HOH A . 
G 3 HOH 24  369 78  HOH HOH A . 
G 3 HOH 25  370 79  HOH HOH A . 
G 3 HOH 26  371 80  HOH HOH A . 
G 3 HOH 27  372 93  HOH HOH A . 
G 3 HOH 28  373 103 HOH HOH A . 
G 3 HOH 29  374 104 HOH HOH A . 
G 3 HOH 30  375 105 HOH HOH A . 
G 3 HOH 31  376 106 HOH HOH A . 
G 3 HOH 32  377 109 HOH HOH A . 
G 3 HOH 33  378 110 HOH HOH A . 
G 3 HOH 34  379 118 HOH HOH A . 
G 3 HOH 35  380 121 HOH HOH A . 
G 3 HOH 36  381 122 HOH HOH A . 
G 3 HOH 37  382 123 HOH HOH A . 
G 3 HOH 38  383 127 HOH HOH A . 
G 3 HOH 39  384 132 HOH HOH A . 
G 3 HOH 40  385 134 HOH HOH A . 
G 3 HOH 41  386 137 HOH HOH A . 
G 3 HOH 42  387 140 HOH HOH A . 
G 3 HOH 43  388 146 HOH HOH A . 
G 3 HOH 44  389 147 HOH HOH A . 
G 3 HOH 45  390 159 HOH HOH A . 
G 3 HOH 46  391 160 HOH HOH A . 
G 3 HOH 47  392 161 HOH HOH A . 
G 3 HOH 48  393 165 HOH HOH A . 
G 3 HOH 49  394 168 HOH HOH A . 
G 3 HOH 50  395 169 HOH HOH A . 
G 3 HOH 51  396 172 HOH HOH A . 
G 3 HOH 52  397 173 HOH HOH A . 
G 3 HOH 53  398 180 HOH HOH A . 
G 3 HOH 54  399 182 HOH HOH A . 
G 3 HOH 55  400 187 HOH HOH A . 
G 3 HOH 56  401 191 HOH HOH A . 
G 3 HOH 57  402 195 HOH HOH A . 
G 3 HOH 58  403 196 HOH HOH A . 
G 3 HOH 59  404 203 HOH HOH A . 
G 3 HOH 60  405 208 HOH HOH A . 
G 3 HOH 61  406 209 HOH HOH A . 
G 3 HOH 62  407 210 HOH HOH A . 
G 3 HOH 63  408 214 HOH HOH A . 
G 3 HOH 64  409 216 HOH HOH A . 
G 3 HOH 65  410 218 HOH HOH A . 
G 3 HOH 66  411 219 HOH HOH A . 
G 3 HOH 67  412 220 HOH HOH A . 
G 3 HOH 68  413 226 HOH HOH A . 
G 3 HOH 69  414 230 HOH HOH A . 
G 3 HOH 70  415 232 HOH HOH A . 
G 3 HOH 71  416 238 HOH HOH A . 
G 3 HOH 72  417 241 HOH HOH A . 
G 3 HOH 73  418 242 HOH HOH A . 
G 3 HOH 74  419 245 HOH HOH A . 
G 3 HOH 75  420 248 HOH HOH A . 
G 3 HOH 76  421 250 HOH HOH A . 
G 3 HOH 77  422 251 HOH HOH A . 
G 3 HOH 78  423 258 HOH HOH A . 
G 3 HOH 79  424 264 HOH HOH A . 
G 3 HOH 80  425 271 HOH HOH A . 
G 3 HOH 81  426 276 HOH HOH A . 
G 3 HOH 82  427 277 HOH HOH A . 
G 3 HOH 83  428 282 HOH HOH A . 
G 3 HOH 84  429 293 HOH HOH A . 
G 3 HOH 85  430 295 HOH HOH A . 
G 3 HOH 86  431 296 HOH HOH A . 
G 3 HOH 87  432 298 HOH HOH A . 
G 3 HOH 88  433 300 HOH HOH A . 
G 3 HOH 89  434 312 HOH HOH A . 
H 3 HOH 1   346 1   HOH HOH B . 
H 3 HOH 2   347 2   HOH HOH B . 
H 3 HOH 3   348 4   HOH HOH B . 
H 3 HOH 4   349 7   HOH HOH B . 
H 3 HOH 5   350 8   HOH HOH B . 
H 3 HOH 6   351 11  HOH HOH B . 
H 3 HOH 7   352 12  HOH HOH B . 
H 3 HOH 8   353 13  HOH HOH B . 
H 3 HOH 9   354 14  HOH HOH B . 
H 3 HOH 10  355 16  HOH HOH B . 
H 3 HOH 11  356 17  HOH HOH B . 
H 3 HOH 12  357 18  HOH HOH B . 
H 3 HOH 13  358 22  HOH HOH B . 
H 3 HOH 14  359 23  HOH HOH B . 
H 3 HOH 15  360 24  HOH HOH B . 
H 3 HOH 16  361 27  HOH HOH B . 
H 3 HOH 17  362 28  HOH HOH B . 
H 3 HOH 18  363 29  HOH HOH B . 
H 3 HOH 19  364 31  HOH HOH B . 
H 3 HOH 20  365 34  HOH HOH B . 
H 3 HOH 21  366 35  HOH HOH B . 
H 3 HOH 22  367 38  HOH HOH B . 
H 3 HOH 23  368 39  HOH HOH B . 
H 3 HOH 24  369 40  HOH HOH B . 
H 3 HOH 25  370 45  HOH HOH B . 
H 3 HOH 26  371 48  HOH HOH B . 
H 3 HOH 27  372 50  HOH HOH B . 
H 3 HOH 28  373 54  HOH HOH B . 
H 3 HOH 29  374 58  HOH HOH B . 
H 3 HOH 30  375 59  HOH HOH B . 
H 3 HOH 31  376 64  HOH HOH B . 
H 3 HOH 32  377 69  HOH HOH B . 
H 3 HOH 33  378 74  HOH HOH B . 
H 3 HOH 34  379 76  HOH HOH B . 
H 3 HOH 35  380 77  HOH HOH B . 
H 3 HOH 36  381 83  HOH HOH B . 
H 3 HOH 37  382 84  HOH HOH B . 
H 3 HOH 38  383 85  HOH HOH B . 
H 3 HOH 39  384 86  HOH HOH B . 
H 3 HOH 40  385 89  HOH HOH B . 
H 3 HOH 41  386 91  HOH HOH B . 
H 3 HOH 42  387 94  HOH HOH B . 
H 3 HOH 43  388 97  HOH HOH B . 
H 3 HOH 44  389 98  HOH HOH B . 
H 3 HOH 45  390 99  HOH HOH B . 
H 3 HOH 46  391 100 HOH HOH B . 
H 3 HOH 47  392 101 HOH HOH B . 
H 3 HOH 48  393 102 HOH HOH B . 
H 3 HOH 49  394 108 HOH HOH B . 
H 3 HOH 50  395 111 HOH HOH B . 
H 3 HOH 51  396 113 HOH HOH B . 
H 3 HOH 52  397 115 HOH HOH B . 
H 3 HOH 53  398 117 HOH HOH B . 
H 3 HOH 54  399 126 HOH HOH B . 
H 3 HOH 55  400 130 HOH HOH B . 
H 3 HOH 56  401 131 HOH HOH B . 
H 3 HOH 57  402 135 HOH HOH B . 
H 3 HOH 58  403 136 HOH HOH B . 
H 3 HOH 59  404 142 HOH HOH B . 
H 3 HOH 60  405 144 HOH HOH B . 
H 3 HOH 61  406 145 HOH HOH B . 
H 3 HOH 62  407 150 HOH HOH B . 
H 3 HOH 63  408 152 HOH HOH B . 
H 3 HOH 64  409 153 HOH HOH B . 
H 3 HOH 65  410 157 HOH HOH B . 
H 3 HOH 66  411 158 HOH HOH B . 
H 3 HOH 67  412 162 HOH HOH B . 
H 3 HOH 68  413 163 HOH HOH B . 
H 3 HOH 69  414 164 HOH HOH B . 
H 3 HOH 70  415 166 HOH HOH B . 
H 3 HOH 71  416 167 HOH HOH B . 
H 3 HOH 72  417 170 HOH HOH B . 
H 3 HOH 73  418 174 HOH HOH B . 
H 3 HOH 74  419 176 HOH HOH B . 
H 3 HOH 75  420 177 HOH HOH B . 
H 3 HOH 76  421 178 HOH HOH B . 
H 3 HOH 77  422 179 HOH HOH B . 
H 3 HOH 78  423 181 HOH HOH B . 
H 3 HOH 79  424 184 HOH HOH B . 
H 3 HOH 80  425 186 HOH HOH B . 
H 3 HOH 81  426 188 HOH HOH B . 
H 3 HOH 82  427 189 HOH HOH B . 
H 3 HOH 83  428 190 HOH HOH B . 
H 3 HOH 84  429 192 HOH HOH B . 
H 3 HOH 85  430 193 HOH HOH B . 
H 3 HOH 86  431 201 HOH HOH B . 
H 3 HOH 87  432 202 HOH HOH B . 
H 3 HOH 88  433 204 HOH HOH B . 
H 3 HOH 89  434 205 HOH HOH B . 
H 3 HOH 90  435 206 HOH HOH B . 
H 3 HOH 91  436 211 HOH HOH B . 
H 3 HOH 92  437 212 HOH HOH B . 
H 3 HOH 93  438 217 HOH HOH B . 
H 3 HOH 94  439 221 HOH HOH B . 
H 3 HOH 95  440 222 HOH HOH B . 
H 3 HOH 96  441 223 HOH HOH B . 
H 3 HOH 97  442 224 HOH HOH B . 
H 3 HOH 98  443 227 HOH HOH B . 
H 3 HOH 99  444 229 HOH HOH B . 
H 3 HOH 100 445 233 HOH HOH B . 
H 3 HOH 101 446 235 HOH HOH B . 
H 3 HOH 102 447 236 HOH HOH B . 
H 3 HOH 103 448 239 HOH HOH B . 
H 3 HOH 104 449 240 HOH HOH B . 
H 3 HOH 105 450 244 HOH HOH B . 
H 3 HOH 106 451 246 HOH HOH B . 
H 3 HOH 107 452 249 HOH HOH B . 
H 3 HOH 108 453 252 HOH HOH B . 
H 3 HOH 109 454 253 HOH HOH B . 
H 3 HOH 110 455 254 HOH HOH B . 
H 3 HOH 111 456 255 HOH HOH B . 
H 3 HOH 112 457 256 HOH HOH B . 
H 3 HOH 113 458 259 HOH HOH B . 
H 3 HOH 114 459 262 HOH HOH B . 
H 3 HOH 115 460 263 HOH HOH B . 
H 3 HOH 116 461 265 HOH HOH B . 
H 3 HOH 117 462 266 HOH HOH B . 
H 3 HOH 118 463 267 HOH HOH B . 
H 3 HOH 119 464 273 HOH HOH B . 
H 3 HOH 120 465 278 HOH HOH B . 
H 3 HOH 121 466 279 HOH HOH B . 
H 3 HOH 122 467 281 HOH HOH B . 
H 3 HOH 123 468 283 HOH HOH B . 
H 3 HOH 124 469 299 HOH HOH B . 
H 3 HOH 125 470 301 HOH HOH B . 
H 3 HOH 126 471 302 HOH HOH B . 
H 3 HOH 127 472 303 HOH HOH B . 
H 3 HOH 128 473 304 HOH HOH B . 
H 3 HOH 129 474 305 HOH HOH B . 
H 3 HOH 130 475 306 HOH HOH B . 
H 3 HOH 131 476 307 HOH HOH B . 
H 3 HOH 132 477 309 HOH HOH B . 
H 3 HOH 133 478 310 HOH HOH B . 
H 3 HOH 134 479 313 HOH HOH B . 
H 3 HOH 135 480 314 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 123.1000000000 0.0000000000 0.0000000000 -1.0000000000 180.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-07-07 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-11-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation        
2 4 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.pdbx_database_id_PubMed' 
2 4 'Structure model' '_citation.title'                   
3 4 'Structure model' '_citation_author.name'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' .         ? 1 
X-PLOR refinement       3.851     ? 2 
MOSFLM 'data reduction' .         ? 3 
CCP4   'data scaling'   '(SCALA)' ? 4 
X-PLOR phasing          .         ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG1 A THR 140 ? ? O A HOH 386 ? ? 2.09 
2 1 OP1 C DA  5   ? ? O C HOH 68  ? ? 2.09 
3 1 O   B HOH 368 ? ? O B HOH 418 ? ? 2.10 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 CG2 A THR 332 ? ? 1_555 CB  B ALA 212 ? ? 4_566 1.81 
2 1 NH1 A ARG 337 ? ? 1_555 OE2 B GLU 308 ? ? 4_566 2.04 
3 1 CD  A LYS 122 ? ? 1_555 O   B GLN 35  ? ? 4_566 2.06 
4 1 ND2 A ASN 327 ? ? 1_555 CD2 B LEU 194 ? ? 4_566 2.10 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              67 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              68 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              68 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.43 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            9.13 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 20  ? ? -173.79 -81.97  
2  1 ASP A 33  ? ? -104.97 54.42   
3  1 PRO A 68  ? ? -29.27  -66.89  
4  1 ARG A 81  ? ? -49.06  -18.95  
5  1 ARG A 101 ? ? -79.63  43.68   
6  1 SER A 102 ? ? -172.98 149.17  
7  1 PRO A 105 ? ? -67.01  -150.55 
8  1 GLN A 133 ? ? -121.33 -85.60  
9  1 ALA A 134 ? ? 133.23  100.18  
10 1 LEU A 135 ? ? -39.46  120.24  
11 1 GLU A 150 ? ? -39.30  -72.08  
12 1 VAL A 182 ? ? -64.53  -83.59  
13 1 LYS A 183 ? ? -39.95  -25.21  
14 1 ARG A 187 ? ? -59.26  78.94   
15 1 ASP A 189 ? ? 75.96   130.96  
16 1 SER A 214 ? ? -15.30  -83.87  
17 1 LEU A 215 ? ? 175.65  -50.90  
18 1 ASP A 232 ? ? -42.15  -99.11  
19 1 PRO A 234 ? ? -64.43  -167.50 
20 1 ASN A 236 ? ? -77.92  -142.52 
21 1 ARG A 243 ? ? -42.03  161.51  
22 1 ALA A 248 ? ? -62.65  -140.62 
23 1 ALA A 249 ? ? 156.26  58.34   
24 1 ALA A 252 ? ? -164.14 30.89   
25 1 THR A 253 ? ? -145.22 -28.07  
26 1 SER A 257 ? ? -37.99  132.54  
27 1 LYS A 276 ? ? -45.73  170.03  
28 1 ASP A 278 ? ? 72.95   -109.21 
29 1 SER A 279 ? ? 40.73   -144.23 
30 1 GLN A 281 ? ? -37.63  158.80  
31 1 TYR A 283 ? ? 89.70   48.83   
32 1 SER A 290 ? ? -37.22  -31.45  
33 1 ARG A 297 ? ? -52.65  -72.91  
34 1 ALA A 302 ? ? -90.96  -152.60 
35 1 ASP A 329 ? ? -75.55  -151.95 
36 1 ASP B 33  ? ? -118.36 53.29   
37 1 ASN B 60  ? ? 50.70   71.36   
38 1 ARG B 101 ? ? -78.37  20.01   
39 1 LYS B 132 ? ? -56.50  174.68  
40 1 SER B 147 ? ? -37.37  -33.63  
41 1 ALA B 167 ? ? -44.88  -76.64  
42 1 LEU B 171 ? ? 57.95   10.29   
43 1 ILE B 180 ? ? -59.20  108.96  
44 1 LYS B 201 ? ? -24.67  -65.58  
45 1 ALA B 248 ? ? -68.73  -175.07 
46 1 ALA B 249 ? ? -160.13 63.89   
47 1 LYS B 276 ? ? -49.96  162.99  
48 1 SER B 279 ? ? -46.22  -85.31  
49 1 GLN B 281 ? ? -58.03  -173.15 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DG C 15 ? ? 0.100 'SIDE CHAIN' 
2 1 DA D 17 ? ? 0.066 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 C DT  1   ? A DT  1   
2  1 Y 1 C DT  35  ? A DT  35  
3  1 Y 1 D DT  1   ? B DT  1   
4  1 Y 1 D DT  35  ? B DT  35  
5  1 Y 1 A MET 1   ? C MET 1   
6  1 Y 1 A SER 2   ? C SER 2   
7  1 Y 1 A ASN 3   ? C ASN 3   
8  1 Y 1 A LEU 4   ? C LEU 4   
9  1 Y 1 A LEU 5   ? C LEU 5   
10 1 Y 1 A THR 6   ? C THR 6   
11 1 Y 1 A VAL 7   ? C VAL 7   
12 1 Y 1 A HIS 8   ? C HIS 8   
13 1 Y 1 A GLN 9   ? C GLN 9   
14 1 Y 1 A ASN 10  ? C ASN 10  
15 1 Y 1 A LEU 11  ? C LEU 11  
16 1 Y 1 A PRO 12  ? C PRO 12  
17 1 Y 1 A ALA 13  ? C ALA 13  
18 1 Y 1 A LEU 14  ? C LEU 14  
19 1 Y 1 A PRO 15  ? C PRO 15  
20 1 Y 1 A VAL 16  ? C VAL 16  
21 1 Y 1 A ASP 17  ? C ASP 17  
22 1 Y 1 A ALA 18  ? C ALA 18  
23 1 Y 1 A LEU 194 ? C LEU 194 
24 1 Y 1 A ILE 195 ? C ILE 195 
25 1 Y 1 A HIS 196 ? C HIS 196 
26 1 Y 1 A ILE 197 ? C ILE 197 
27 1 Y 1 A GLY 198 ? C GLY 198 
28 1 Y 1 A ARG 199 ? C ARG 199 
29 1 Y 1 A THR 200 ? C THR 200 
30 1 Y 1 A LYS 201 ? C LYS 201 
31 1 Y 1 A THR 202 ? C THR 202 
32 1 Y 1 A LEU 203 ? C LEU 203 
33 1 Y 1 A VAL 204 ? C VAL 204 
34 1 Y 1 A SER 205 ? C SER 205 
35 1 Y 1 A THR 206 ? C THR 206 
36 1 Y 1 A ALA 207 ? C ALA 207 
37 1 Y 1 A GLY 208 ? C GLY 208 
38 1 Y 1 A VAL 209 ? C VAL 209 
39 1 Y 1 A ASN 317 ? C ASN 317 
40 1 Y 1 A VAL 318 ? C VAL 318 
41 1 Y 1 A ASN 319 ? C ASN 319 
42 1 Y 1 A ILE 320 ? C ILE 320 
43 1 Y 1 A VAL 321 ? C VAL 321 
44 1 Y 1 A MET 322 ? C MET 322 
45 1 Y 1 A ASN 323 ? C ASN 323 
46 1 Y 1 A PHE 324 ? C PHE 324 
47 1 Y 1 A ILE 325 ? C ILE 325 
48 1 Y 1 A ASP 341 ? C ASP 341 
49 1 Y 1 A GLY 342 ? C GLY 342 
50 1 Y 1 A ASP 343 ? C ASP 343 
51 1 Y 1 B MET 1   ? D MET 1   
52 1 Y 1 B SER 2   ? D SER 2   
53 1 Y 1 B ASN 3   ? D ASN 3   
54 1 Y 1 B LEU 4   ? D LEU 4   
55 1 Y 1 B LEU 5   ? D LEU 5   
56 1 Y 1 B THR 6   ? D THR 6   
57 1 Y 1 B VAL 7   ? D VAL 7   
58 1 Y 1 B HIS 8   ? D HIS 8   
59 1 Y 1 B GLN 9   ? D GLN 9   
60 1 Y 1 B ASN 10  ? D ASN 10  
61 1 Y 1 B LEU 11  ? D LEU 11  
62 1 Y 1 B PRO 12  ? D PRO 12  
63 1 Y 1 B ALA 13  ? D ALA 13  
64 1 Y 1 B LEU 14  ? D LEU 14  
65 1 Y 1 B PRO 15  ? D PRO 15  
66 1 Y 1 B VAL 16  ? D VAL 16  
67 1 Y 1 B ASP 17  ? D ASP 17  
68 1 Y 1 B ALA 18  ? D ALA 18  
69 1 Y 1 B TRP 315 ? D TRP 315 
70 1 Y 1 B THR 316 ? D THR 316 
71 1 Y 1 B ASN 317 ? D ASN 317 
72 1 Y 1 B VAL 318 ? D VAL 318 
73 1 Y 1 B ASN 319 ? D ASN 319 
74 1 Y 1 B ILE 320 ? D ILE 320 
75 1 Y 1 B VAL 321 ? D VAL 321 
76 1 Y 1 B MET 322 ? D MET 322 
77 1 Y 1 B ASN 323 ? D ASN 323 
78 1 Y 1 B PHE 324 ? D PHE 324 
79 1 Y 1 B ILE 325 ? D ILE 325 
80 1 Y 1 B ARG 326 ? D ARG 326 
81 1 Y 1 B ASN 327 ? D ASN 327 
82 1 Y 1 B LEU 328 ? D LEU 328 
83 1 Y 1 B ASP 329 ? D ASP 329 
84 1 Y 1 B SER 330 ? D SER 330 
85 1 Y 1 B GLU 331 ? D GLU 331 
86 1 Y 1 B THR 332 ? D THR 332 
87 1 Y 1 B GLY 333 ? D GLY 333 
88 1 Y 1 B ALA 334 ? D ALA 334 
89 1 Y 1 B MET 335 ? D MET 335 
90 1 Y 1 B VAL 336 ? D VAL 336 
91 1 Y 1 B ARG 337 ? D ARG 337 
92 1 Y 1 B LEU 338 ? D LEU 338 
93 1 Y 1 B LEU 339 ? D LEU 339 
94 1 Y 1 B GLU 340 ? D GLU 340 
95 1 Y 1 B ASP 341 ? D ASP 341 
96 1 Y 1 B GLY 342 ? D GLY 342 
97 1 Y 1 B ASP 343 ? D ASP 343 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5CRX 'double helix'        
5CRX 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 3  1_555 B DA 34 1_555 -0.411 -0.041 0.159  1.479   -3.165  -5.155 1  C_DT3:DA34_D  C 3  ? D 34 ? 20 1 
1 A DA 4  1_555 B DT 33 1_555 -0.621 -0.038 0.273  -2.843  -5.729  -0.627 2  C_DA4:DT33_D  C 4  ? D 33 ? 20 1 
1 A DA 5  1_555 B DT 32 1_555 0.372  0.253  0.609  13.114  -4.832  7.303  3  C_DA5:DT32_D  C 5  ? D 32 ? ?  ? 
1 A DC 6  1_555 B DG 31 1_555 0.286  -0.274 -0.223 10.947  -24.214 5.291  4  C_DC6:DG31_D  C 6  ? D 31 ? 19 1 
1 A DT 7  1_555 B DA 30 1_555 -0.856 -0.229 -0.057 2.500   -17.342 -0.124 5  C_DT7:DA30_D  C 7  ? D 30 ? 20 1 
1 A DT 8  1_555 B DA 29 1_555 -1.049 0.215  -0.372 -1.218  -16.842 1.043  6  C_DT8:DA29_D  C 8  ? D 29 ? 20 1 
1 A DC 9  1_555 B DG 28 1_555 -0.410 -0.071 0.076  -8.841  -4.950  -5.360 7  C_DC9:DG28_D  C 9  ? D 28 ? 19 1 
1 A DG 10 1_555 B DC 27 1_555 0.242  -0.052 0.419  8.144   10.461  -4.510 8  C_DG10:DC27_D C 10 ? D 27 ? 19 1 
1 A DT 11 1_555 B DA 26 1_555 0.171  0.165  0.116  9.476   -10.814 4.937  9  C_DT11:DA26_D C 11 ? D 26 ? 20 1 
1 A DA 12 1_555 B DT 25 1_555 0.230  -0.158 0.005  -2.606  -2.774  -0.587 10 C_DA12:DT25_D C 12 ? D 25 ? 20 1 
1 A DT 13 1_555 B DA 24 1_555 0.228  -0.373 0.228  -2.810  2.911   -3.313 11 C_DT13:DA24_D C 13 ? D 24 ? 20 1 
1 A DA 14 1_555 B DT 23 1_555 0.096  -0.318 -0.230 -13.061 -5.286  -1.486 12 C_DA14:DT23_D C 14 ? D 23 ? 20 1 
1 A DG 15 1_555 B DC 22 1_555 -0.140 -0.269 -0.324 -17.351 -7.749  1.752  13 C_DG15:DC22_D C 15 ? D 22 ? 19 1 
1 A DC 16 1_555 B DG 21 1_555 -0.498 0.292  -0.068 -1.816  -7.910  7.794  14 C_DC16:DG21_D C 16 ? D 21 ? ?  1 
1 A DA 17 1_555 B DT 20 1_555 1.863  -0.465 0.065  19.179  -24.134 15.508 15 C_DA17:DT20_D C 17 ? D 20 ? 20 1 
1 A DT 18 1_555 B DA 19 1_555 0.868  -0.311 -0.513 9.874   -0.006  -4.354 16 C_DT18:DA19_D C 18 ? D 19 ? 20 1 
1 A DA 19 1_555 B DT 18 1_555 -0.448 0.481  -0.429 -6.048  -13.087 6.197  17 C_DA19:DT18_D C 19 ? D 18 ? ?  ? 
1 A DT 20 1_555 B DA 17 1_555 -0.012 0.143  -0.068 26.898  -8.885  13.212 18 C_DT20:DA17_D C 20 ? D 17 ? ?  1 
1 A DG 21 1_555 B DC 16 1_555 0.654  0.385  0.244  -8.271  -13.664 7.496  19 C_DG21:DC16_D C 21 ? D 16 ? ?  1 
1 A DC 22 1_555 B DG 15 1_555 -1.206 0.282  0.420  -2.914  -4.430  -0.158 20 C_DC22:DG15_D C 22 ? D 15 ? 19 1 
1 A DT 23 1_555 B DA 14 1_555 -0.636 -0.021 -0.172 7.627   -2.437  -1.843 21 C_DT23:DA14_D C 23 ? D 14 ? 20 1 
1 A DA 24 1_555 B DT 13 1_555 -0.083 -0.089 0.104  0.188   -1.972  4.258  22 C_DA24:DT13_D C 24 ? D 13 ? 20 1 
1 A DT 25 1_555 B DA 12 1_555 0.184  -0.145 0.150  2.642   -8.960  -0.802 23 C_DT25:DA12_D C 25 ? D 12 ? 20 1 
1 A DA 26 1_555 B DT 11 1_555 0.875  -0.215 0.125  -14.604 -10.561 2.478  24 C_DA26:DT11_D C 26 ? D 11 ? 20 1 
1 A DC 27 1_555 B DG 10 1_555 0.376  -0.018 0.478  -2.531  -3.912  3.212  25 C_DC27:DG10_D C 27 ? D 10 ? 19 1 
1 A DG 28 1_555 B DC 9  1_555 0.007  -0.125 -0.069 3.993   -4.434  -7.121 26 C_DG28:DC9_D  C 28 ? D 9  ? 19 1 
1 A DA 29 1_555 B DT 8  1_555 1.026  -0.248 0.140  4.586   -13.566 -3.911 27 C_DA29:DT8_D  C 29 ? D 8  ? 20 1 
1 A DA 30 1_555 B DT 7  1_555 0.134  -0.271 0.251  5.199   -12.062 -4.087 28 C_DA30:DT7_D  C 30 ? D 7  ? 20 1 
1 A DG 31 1_555 B DC 6  1_555 -0.697 -0.222 -0.249 -14.507 -17.429 -0.272 29 C_DG31:DC6_D  C 31 ? D 6  ? 19 1 
1 A DT 32 1_555 B DA 5  1_555 -0.220 0.412  0.315  -10.608 -8.683  -1.328 30 C_DT32:DA5_D  C 32 ? D 5  ? 20 1 
1 A DT 33 1_555 B DA 4  1_555 -0.548 -0.046 -0.311 -1.344  -13.783 4.227  31 C_DT33:DA4_D  C 33 ? D 4  ? 20 1 
1 A DA 34 1_555 B DT 3  1_555 1.099  -0.280 -0.641 -7.255  -5.504  -8.227 32 C_DA34:DT3_D  C 34 ? D 3  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 3  1_555 B DA 34 1_555 A DA 4  1_555 B DT 33 1_555 0.353  1.495  3.489 0.305  3.091  42.560 1.718  -0.452 3.586 4.252   
-0.420  42.668 1  CC_DT3DA4:DT33DA34_DD   C 3  ? D 34 ? C 4  ? D 33 ? 
1 A DA 4  1_555 B DT 33 1_555 A DA 5  1_555 B DT 32 1_555 0.650  -0.091 2.935 -2.340 4.271  31.925 -0.837 -1.537 2.846 7.708   
4.223   32.285 2  CC_DA4DA5:DT32DT33_DD   C 4  ? D 33 ? C 5  ? D 32 ? 
1 A DA 5  1_555 B DT 32 1_555 A DC 6  1_555 B DG 31 1_555 0.600  -1.031 3.369 6.004  -3.598 31.673 -1.173 0.050  3.513 -6.494  
-10.836 32.418 3  CC_DA5DC6:DG31DT32_DD   C 5  ? D 32 ? C 6  ? D 31 ? 
1 A DC 6  1_555 B DG 31 1_555 A DT 7  1_555 B DA 30 1_555 -0.050 -0.652 3.529 -0.278 7.438  32.908 -2.404 0.039  3.308 12.925  
0.484   33.716 4  CC_DC6DT7:DA30DG31_DD   C 6  ? D 31 ? C 7  ? D 30 ? 
1 A DT 7  1_555 B DA 30 1_555 A DT 8  1_555 B DA 29 1_555 -0.006 -0.162 3.210 3.672  3.183  34.931 -0.730 0.544  3.166 5.270   
-6.080  35.257 5  CC_DT7DT8:DA29DA30_DD   C 7  ? D 30 ? C 8  ? D 29 ? 
1 A DT 8  1_555 B DA 29 1_555 A DC 9  1_555 B DG 28 1_555 0.299  -0.307 3.590 -3.012 4.942  32.834 -1.430 -1.066 3.468 8.658   
5.277   33.326 6  CC_DT8DC9:DG28DA29_DD   C 8  ? D 29 ? C 9  ? D 28 ? 
1 A DC 9  1_555 B DG 28 1_555 A DG 10 1_555 B DC 27 1_555 0.444  0.331  2.892 0.118  0.380  37.083 0.475  -0.685 2.897 0.597   
-0.186  37.085 7  CC_DC9DG10:DC27DG28_DD  C 9  ? D 28 ? C 10 ? D 27 ? 
1 A DG 10 1_555 B DC 27 1_555 A DT 11 1_555 B DA 26 1_555 0.428  0.014  3.346 6.183  7.456  28.665 -1.544 0.482  3.266 14.545  
-12.062 30.224 8  CC_DG10DT11:DA26DC27_DD C 10 ? D 27 ? C 11 ? D 26 ? 
1 A DT 11 1_555 B DA 26 1_555 A DA 12 1_555 B DT 25 1_555 0.138  -0.979 3.511 -0.592 5.484  38.298 -2.188 -0.285 3.343 8.307   
0.896   38.679 9  CC_DT11DA12:DT25DA26_DD C 11 ? D 26 ? C 12 ? D 25 ? 
1 A DA 12 1_555 B DT 25 1_555 A DT 13 1_555 B DA 24 1_555 0.496  -1.139 3.489 -0.175 -0.902 31.894 -1.896 -0.936 3.517 -1.641  
0.318   31.906 10 CC_DA12DT13:DA24DT25_DD C 12 ? D 25 ? C 13 ? D 24 ? 
1 A DT 13 1_555 B DA 24 1_555 A DA 14 1_555 B DT 23 1_555 -0.900 -0.818 3.564 1.631  -5.829 36.442 -0.423 1.663  3.605 -9.242  
-2.585  36.924 11 CC_DT13DA14:DT23DA24_DD C 13 ? D 24 ? C 14 ? D 23 ? 
1 A DA 14 1_555 B DT 23 1_555 A DG 15 1_555 B DC 22 1_555 -0.294 -0.548 3.560 0.052  1.741  36.251 -1.144 0.480  3.531 2.797   
-0.084  36.292 12 CC_DA14DG15:DC22DT23_DD C 14 ? D 23 ? C 15 ? D 22 ? 
1 A DG 15 1_555 B DC 22 1_555 A DC 16 1_555 B DG 21 1_555 -0.269 -0.558 2.994 -2.691 -1.410 24.703 -0.904 -0.123 3.032 -3.279  
6.259   24.886 13 CC_DG15DC16:DG21DC22_DD C 15 ? D 22 ? C 16 ? D 21 ? 
1 A DC 16 1_555 B DG 21 1_555 A DA 17 1_555 B DT 20 1_555 -0.161 1.092  2.904 5.749  6.018  39.858 0.965  0.812  2.981 8.713   
-8.324  40.683 14 CC_DC16DA17:DT20DG21_DD C 16 ? D 21 ? C 17 ? D 20 ? 
1 A DA 17 1_555 B DT 20 1_555 A DT 18 1_555 B DA 19 1_555 0.071  -1.971 3.721 1.803  8.884  22.637 -7.533 0.412  2.757 21.555  
-4.375  24.363 15 CC_DA17DT18:DA19DT20_DD C 17 ? D 20 ? C 18 ? D 19 ? 
1 A DT 18 1_555 B DA 19 1_555 A DA 19 1_555 B DT 18 1_555 1.069  0.128  3.788 6.659  2.062  39.330 -0.095 -0.656 3.912 3.034   
-9.800  39.919 16 CC_DT18DA19:DT18DA19_DD C 18 ? D 19 ? C 19 ? D 18 ? 
1 A DA 19 1_555 B DT 18 1_555 A DT 20 1_555 B DA 17 1_555 0.979  -0.645 2.369 -2.875 9.511  31.439 -2.247 -2.062 1.999 17.027  
5.148   32.934 17 CC_DA19DT20:DA17DT18_DD C 19 ? D 18 ? C 20 ? D 17 ? 
1 A DG 21 1_555 B DC 16 1_555 A DC 22 1_555 B DG 15 1_555 -0.212 -0.579 3.207 -1.059 0.716  27.961 -1.363 0.192  3.197 1.480   
2.190   27.990 18 CC_DG21DC22:DG15DC16_DD C 21 ? D 16 ? C 22 ? D 15 ? 
1 A DC 22 1_555 B DG 15 1_555 A DT 23 1_555 B DA 14 1_555 0.503  -0.774 3.170 4.029  -5.871 37.487 -0.446 -0.263 3.284 -9.035  
-6.201  38.133 19 CC_DC22DT23:DA14DG15_DD C 22 ? D 15 ? C 23 ? D 14 ? 
1 A DT 23 1_555 B DA 14 1_555 A DA 24 1_555 B DT 13 1_555 0.692  -0.244 3.539 -0.645 -7.721 41.989 0.509  -1.022 3.518 -10.666 
0.891   42.667 20 CC_DT23DA24:DT13DA14_DD C 23 ? D 14 ? C 24 ? D 13 ? 
1 A DA 24 1_555 B DT 13 1_555 A DT 25 1_555 B DA 12 1_555 -0.669 -0.703 3.354 -0.531 -1.576 32.472 -0.971 1.099  3.393 -2.817  
0.949   32.514 21 CC_DA24DT25:DA12DT13_DD C 24 ? D 13 ? C 25 ? D 12 ? 
1 A DT 25 1_555 B DA 12 1_555 A DA 26 1_555 B DT 11 1_555 -0.150 -0.660 3.519 2.426  6.005  43.105 -1.503 0.451  3.389 8.118   
-3.279  43.566 22 CC_DT25DA26:DT11DA12_DD C 25 ? D 12 ? C 26 ? D 11 ? 
1 A DA 26 1_555 B DT 11 1_555 A DC 27 1_555 B DG 10 1_555 0.193  -0.138 3.106 -1.935 8.037  25.342 -2.282 -0.897 2.903 17.729  
4.268   26.635 23 CC_DA26DC27:DG10DT11_DD C 26 ? D 11 ? C 27 ? D 10 ? 
1 A DC 27 1_555 B DG 10 1_555 A DG 28 1_555 B DC 9  1_555 -1.221 0.299  3.036 -1.507 0.994  32.834 0.369  1.916  3.095 1.756   
2.663   32.883 24 CC_DC27DG28:DC9DG10_DD  C 27 ? D 10 ? C 28 ? D 9  ? 
1 A DG 28 1_555 B DC 9  1_555 A DA 29 1_555 B DT 8  1_555 0.423  -1.208 3.289 -1.216 5.551  33.762 -2.906 -0.906 3.041 9.474   
2.076   34.223 25 CC_DG28DA29:DT8DC9_DD   C 28 ? D 9  ? C 29 ? D 8  ? 
1 A DA 29 1_555 B DT 8  1_555 A DA 30 1_555 B DT 7  1_555 -0.260 -0.331 3.025 -2.882 -1.703 33.485 -0.313 0.011  3.049 -2.946  
4.987   33.647 26 CC_DA29DA30:DT7DT8_DD   C 29 ? D 8  ? C 30 ? D 7  ? 
1 A DA 30 1_555 B DT 7  1_555 A DG 31 1_555 B DC 6  1_555 0.358  -0.459 3.720 2.982  3.104  37.921 -1.148 -0.119 3.689 4.758   
-4.571  38.156 27 CC_DA30DG31:DC6DT7_DD   C 30 ? D 7  ? C 31 ? D 6  ? 
1 A DG 31 1_555 B DC 6  1_555 A DT 32 1_555 B DA 5  1_555 -1.015 -1.098 3.145 -5.115 2.679  30.839 -2.521 0.941  3.164 4.983   
9.514   31.362 28 CC_DG31DT32:DA5DC6_DD   C 31 ? D 6  ? C 32 ? D 5  ? 
1 A DT 32 1_555 B DA 5  1_555 A DT 33 1_555 B DA 4  1_555 -0.160 -0.129 3.088 3.495  3.527  27.980 -1.024 1.080  3.008 7.222   
-7.157  28.409 29 CC_DT32DT33:DA4DA5_DD   C 32 ? D 5  ? C 33 ? D 4  ? 
1 A DT 33 1_555 B DA 4  1_555 A DA 34 1_555 B DT 3  1_555 0.008  1.246  3.415 3.091  2.156  51.082 1.285  0.214  3.456 2.496   
-3.579  51.212 30 CC_DT33DA34:DT3DA4_DD   C 33 ? D 4  ? C 34 ? D 3  ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#