data_5D0A
# 
_entry.id   5D0A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5D0A         
WWPDB D_1000212463 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '5D08 is the same protein, selenomethionine labeled, without RNA substrate.' 5D08 unspecified 
PDB .                                                                            5D0B unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5D0A 
_pdbx_database_status.recvd_initial_deposition_date   2015-08-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dowling, D.P.' 1 
'Miles, Z.D.'   2 
'Kohrer, C.'    3 
'Bandarian, V.' 4 
'Drennan, C.L.' 5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            44 
_citation.language                  ? 
_citation.page_first                9965 
_citation.page_last                 9976 
_citation.title                     'Molecular basis of cobalamin-dependent RNA modification.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkw806 
_citation.pdbx_database_id_PubMed   27638883 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Dowling, D.P.' 1 ? 
primary 'Miles, Z.D.'   2 ? 
primary 'Kohrer, C.'    3 ? 
primary 'Maiocco, S.J.' 4 ? 
primary 'Elliott, S.J.' 5 ? 
primary 'Bandarian, V.' 6 ? 
primary 'Drennan, C.L.' 7 ? 
# 
_cell.entry_id           5D0A 
_cell.length_a           90.587 
_cell.length_b           111.118 
_cell.length_c           96.008 
_cell.angle_alpha        90.00 
_cell.angle_beta         104.90 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5D0A 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Epoxyqueuosine reductase'                                         48736.641 4   1.17.99.6 ? ? ? 
2 polymer     syn 
;RNA (5'-R(*G*CP*AP*GP*AP*CP*UP*GP*UP*AP*AP*AP*UP*CP*UP*GP*C)-3')
;
5427.285  2   ?         ? ? ? 
3 non-polymer syn 'IRON/SULFUR CLUSTER'                                              351.640   8   ?         ? ? ? 
4 non-polymer syn COBALAMIN                                                          1330.356  4   ?         ? ? ? 
5 non-polymer syn GLYCEROL                                                           92.094    4   ?         ? ? ? 
6 non-polymer syn 'PHOSPHATE ION'                                                    94.971    4   ?         ? ? ? 
7 water       nat water                                                              18.015    794 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Queuosine biosynthesis protein QueG' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MASRGSHHHHHHGAGDRGPEFELGTRGSMNVYQLKEELIEYAKSIGVDKIGFTTADTFDSLKDRLILQESLGYLSGFEEP
DIEKRVTPKLLLPKAKSIVAIALAYPSRMKDAPRSTRTERRGIFCRASWGKDYHDVLREKLDLLEDFLKSKHEDIRTKSM
VDTGELSDRAVAERAGIGFSAKNCMITTPEYGSYVYLAEMITNIPFEPDVPIEDMCGSCTKCLDACPTGALVNPGQLNAQ
RCISFLTQTKGFLPDEFRTKIGNRLYGCDTCQTVCPLNKGKDFHLHPEMEPDPEIAKPLLKPLLAISNREFKEKFGHVSG
SWRGKKPIQRNAILALAHFKDASALPELTELMHKDPRPVIRGTAAWAIGKIGDPAYAEELEKALEKEKDEEAKLEIEKGI
ELLKASGMTKQGLSGSLEVDLQGDHGLSAWSHPQFEK
;
;MASRGSHHHHHHGAGDRGPEFELGTRGSMNVYQLKEELIEYAKSIGVDKIGFTTADTFDSLKDRLILQESLGYLSGFEEP
DIEKRVTPKLLLPKAKSIVAIALAYPSRMKDAPRSTRTERRGIFCRASWGKDYHDVLREKLDLLEDFLKSKHEDIRTKSM
VDTGELSDRAVAERAGIGFSAKNCMITTPEYGSYVYLAEMITNIPFEPDVPIEDMCGSCTKCLDACPTGALVNPGQLNAQ
RCISFLTQTKGFLPDEFRTKIGNRLYGCDTCQTVCPLNKGKDFHLHPEMEPDPEIAKPLLKPLLAISNREFKEKFGHVSG
SWRGKKPIQRNAILALAHFKDASALPELTELMHKDPRPVIRGTAAWAIGKIGDPAYAEELEKALEKEKDEEAKLEIEKGI
ELLKASGMTKQGLSGSLEVDLQGDHGLSAWSHPQFEK
;
A,B,C,D ? 
2 polyribonucleotide no no GCAGACUGUAAAUCUGC GCAGACUGUAAAUCUGC E,F     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   ARG n 
1 5   GLY n 
1 6   SER n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  HIS n 
1 12  HIS n 
1 13  GLY n 
1 14  ALA n 
1 15  GLY n 
1 16  ASP n 
1 17  ARG n 
1 18  GLY n 
1 19  PRO n 
1 20  GLU n 
1 21  PHE n 
1 22  GLU n 
1 23  LEU n 
1 24  GLY n 
1 25  THR n 
1 26  ARG n 
1 27  GLY n 
1 28  SER n 
1 29  MET n 
1 30  ASN n 
1 31  VAL n 
1 32  TYR n 
1 33  GLN n 
1 34  LEU n 
1 35  LYS n 
1 36  GLU n 
1 37  GLU n 
1 38  LEU n 
1 39  ILE n 
1 40  GLU n 
1 41  TYR n 
1 42  ALA n 
1 43  LYS n 
1 44  SER n 
1 45  ILE n 
1 46  GLY n 
1 47  VAL n 
1 48  ASP n 
1 49  LYS n 
1 50  ILE n 
1 51  GLY n 
1 52  PHE n 
1 53  THR n 
1 54  THR n 
1 55  ALA n 
1 56  ASP n 
1 57  THR n 
1 58  PHE n 
1 59  ASP n 
1 60  SER n 
1 61  LEU n 
1 62  LYS n 
1 63  ASP n 
1 64  ARG n 
1 65  LEU n 
1 66  ILE n 
1 67  LEU n 
1 68  GLN n 
1 69  GLU n 
1 70  SER n 
1 71  LEU n 
1 72  GLY n 
1 73  TYR n 
1 74  LEU n 
1 75  SER n 
1 76  GLY n 
1 77  PHE n 
1 78  GLU n 
1 79  GLU n 
1 80  PRO n 
1 81  ASP n 
1 82  ILE n 
1 83  GLU n 
1 84  LYS n 
1 85  ARG n 
1 86  VAL n 
1 87  THR n 
1 88  PRO n 
1 89  LYS n 
1 90  LEU n 
1 91  LEU n 
1 92  LEU n 
1 93  PRO n 
1 94  LYS n 
1 95  ALA n 
1 96  LYS n 
1 97  SER n 
1 98  ILE n 
1 99  VAL n 
1 100 ALA n 
1 101 ILE n 
1 102 ALA n 
1 103 LEU n 
1 104 ALA n 
1 105 TYR n 
1 106 PRO n 
1 107 SER n 
1 108 ARG n 
1 109 MET n 
1 110 LYS n 
1 111 ASP n 
1 112 ALA n 
1 113 PRO n 
1 114 ARG n 
1 115 SER n 
1 116 THR n 
1 117 ARG n 
1 118 THR n 
1 119 GLU n 
1 120 ARG n 
1 121 ARG n 
1 122 GLY n 
1 123 ILE n 
1 124 PHE n 
1 125 CYS n 
1 126 ARG n 
1 127 ALA n 
1 128 SER n 
1 129 TRP n 
1 130 GLY n 
1 131 LYS n 
1 132 ASP n 
1 133 TYR n 
1 134 HIS n 
1 135 ASP n 
1 136 VAL n 
1 137 LEU n 
1 138 ARG n 
1 139 GLU n 
1 140 LYS n 
1 141 LEU n 
1 142 ASP n 
1 143 LEU n 
1 144 LEU n 
1 145 GLU n 
1 146 ASP n 
1 147 PHE n 
1 148 LEU n 
1 149 LYS n 
1 150 SER n 
1 151 LYS n 
1 152 HIS n 
1 153 GLU n 
1 154 ASP n 
1 155 ILE n 
1 156 ARG n 
1 157 THR n 
1 158 LYS n 
1 159 SER n 
1 160 MET n 
1 161 VAL n 
1 162 ASP n 
1 163 THR n 
1 164 GLY n 
1 165 GLU n 
1 166 LEU n 
1 167 SER n 
1 168 ASP n 
1 169 ARG n 
1 170 ALA n 
1 171 VAL n 
1 172 ALA n 
1 173 GLU n 
1 174 ARG n 
1 175 ALA n 
1 176 GLY n 
1 177 ILE n 
1 178 GLY n 
1 179 PHE n 
1 180 SER n 
1 181 ALA n 
1 182 LYS n 
1 183 ASN n 
1 184 CYS n 
1 185 MET n 
1 186 ILE n 
1 187 THR n 
1 188 THR n 
1 189 PRO n 
1 190 GLU n 
1 191 TYR n 
1 192 GLY n 
1 193 SER n 
1 194 TYR n 
1 195 VAL n 
1 196 TYR n 
1 197 LEU n 
1 198 ALA n 
1 199 GLU n 
1 200 MET n 
1 201 ILE n 
1 202 THR n 
1 203 ASN n 
1 204 ILE n 
1 205 PRO n 
1 206 PHE n 
1 207 GLU n 
1 208 PRO n 
1 209 ASP n 
1 210 VAL n 
1 211 PRO n 
1 212 ILE n 
1 213 GLU n 
1 214 ASP n 
1 215 MET n 
1 216 CYS n 
1 217 GLY n 
1 218 SER n 
1 219 CYS n 
1 220 THR n 
1 221 LYS n 
1 222 CYS n 
1 223 LEU n 
1 224 ASP n 
1 225 ALA n 
1 226 CYS n 
1 227 PRO n 
1 228 THR n 
1 229 GLY n 
1 230 ALA n 
1 231 LEU n 
1 232 VAL n 
1 233 ASN n 
1 234 PRO n 
1 235 GLY n 
1 236 GLN n 
1 237 LEU n 
1 238 ASN n 
1 239 ALA n 
1 240 GLN n 
1 241 ARG n 
1 242 CYS n 
1 243 ILE n 
1 244 SER n 
1 245 PHE n 
1 246 LEU n 
1 247 THR n 
1 248 GLN n 
1 249 THR n 
1 250 LYS n 
1 251 GLY n 
1 252 PHE n 
1 253 LEU n 
1 254 PRO n 
1 255 ASP n 
1 256 GLU n 
1 257 PHE n 
1 258 ARG n 
1 259 THR n 
1 260 LYS n 
1 261 ILE n 
1 262 GLY n 
1 263 ASN n 
1 264 ARG n 
1 265 LEU n 
1 266 TYR n 
1 267 GLY n 
1 268 CYS n 
1 269 ASP n 
1 270 THR n 
1 271 CYS n 
1 272 GLN n 
1 273 THR n 
1 274 VAL n 
1 275 CYS n 
1 276 PRO n 
1 277 LEU n 
1 278 ASN n 
1 279 LYS n 
1 280 GLY n 
1 281 LYS n 
1 282 ASP n 
1 283 PHE n 
1 284 HIS n 
1 285 LEU n 
1 286 HIS n 
1 287 PRO n 
1 288 GLU n 
1 289 MET n 
1 290 GLU n 
1 291 PRO n 
1 292 ASP n 
1 293 PRO n 
1 294 GLU n 
1 295 ILE n 
1 296 ALA n 
1 297 LYS n 
1 298 PRO n 
1 299 LEU n 
1 300 LEU n 
1 301 LYS n 
1 302 PRO n 
1 303 LEU n 
1 304 LEU n 
1 305 ALA n 
1 306 ILE n 
1 307 SER n 
1 308 ASN n 
1 309 ARG n 
1 310 GLU n 
1 311 PHE n 
1 312 LYS n 
1 313 GLU n 
1 314 LYS n 
1 315 PHE n 
1 316 GLY n 
1 317 HIS n 
1 318 VAL n 
1 319 SER n 
1 320 GLY n 
1 321 SER n 
1 322 TRP n 
1 323 ARG n 
1 324 GLY n 
1 325 LYS n 
1 326 LYS n 
1 327 PRO n 
1 328 ILE n 
1 329 GLN n 
1 330 ARG n 
1 331 ASN n 
1 332 ALA n 
1 333 ILE n 
1 334 LEU n 
1 335 ALA n 
1 336 LEU n 
1 337 ALA n 
1 338 HIS n 
1 339 PHE n 
1 340 LYS n 
1 341 ASP n 
1 342 ALA n 
1 343 SER n 
1 344 ALA n 
1 345 LEU n 
1 346 PRO n 
1 347 GLU n 
1 348 LEU n 
1 349 THR n 
1 350 GLU n 
1 351 LEU n 
1 352 MET n 
1 353 HIS n 
1 354 LYS n 
1 355 ASP n 
1 356 PRO n 
1 357 ARG n 
1 358 PRO n 
1 359 VAL n 
1 360 ILE n 
1 361 ARG n 
1 362 GLY n 
1 363 THR n 
1 364 ALA n 
1 365 ALA n 
1 366 TRP n 
1 367 ALA n 
1 368 ILE n 
1 369 GLY n 
1 370 LYS n 
1 371 ILE n 
1 372 GLY n 
1 373 ASP n 
1 374 PRO n 
1 375 ALA n 
1 376 TYR n 
1 377 ALA n 
1 378 GLU n 
1 379 GLU n 
1 380 LEU n 
1 381 GLU n 
1 382 LYS n 
1 383 ALA n 
1 384 LEU n 
1 385 GLU n 
1 386 LYS n 
1 387 GLU n 
1 388 LYS n 
1 389 ASP n 
1 390 GLU n 
1 391 GLU n 
1 392 ALA n 
1 393 LYS n 
1 394 LEU n 
1 395 GLU n 
1 396 ILE n 
1 397 GLU n 
1 398 LYS n 
1 399 GLY n 
1 400 ILE n 
1 401 GLU n 
1 402 LEU n 
1 403 LEU n 
1 404 LYS n 
1 405 ALA n 
1 406 SER n 
1 407 GLY n 
1 408 MET n 
1 409 THR n 
1 410 LYS n 
1 411 GLN n 
1 412 GLY n 
1 413 LEU n 
1 414 SER n 
1 415 GLY n 
1 416 SER n 
1 417 LEU n 
1 418 GLU n 
1 419 VAL n 
1 420 ASP n 
1 421 LEU n 
1 422 GLN n 
1 423 GLY n 
1 424 ASP n 
1 425 HIS n 
1 426 GLY n 
1 427 LEU n 
1 428 SER n 
1 429 ALA n 
1 430 TRP n 
1 431 SER n 
1 432 HIS n 
1 433 PRO n 
1 434 GLN n 
1 435 PHE n 
1 436 GLU n 
1 437 LYS n 
2 1   G   n 
2 2   C   n 
2 3   A   n 
2 4   G   n 
2 5   A   n 
2 6   C   n 
2 7   U   n 
2 8   G   n 
2 9   U   n 
2 10  A   n 
2 11  A   n 
2 12  A   n 
2 13  U   n 
2 14  C   n 
2 15  U   n 
2 16  G   n 
2 17  C   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   437 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'queG, ygaP, yhbA, BSU08910' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    168 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus subtilis (strain 168)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     224308 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pASK-IBA43plus 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       17 
_pdbx_entity_src_syn.organism_scientific    'Escherichia coli' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       562 
_pdbx_entity_src_syn.details                'synthesized by IDT' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP QUEG_BACSU P97030 ? 1 
;MNVYQLKEELIEYAKSIGVDKIGFTTADTFDSLKDRLILQESLGYLSGFEEPDIEKRVTPKLLLPKAKSIVAIALAYPSR
MKDAPRSTRTERRGIFCRASWGKDYHDVLREKLDLLEDFLKSKHEDIRTKSMVDTGELSDRAVAERAGIGFSAKNCMITT
PEYGSYVYLAEMITNIPFEPDVPIEDMCGSCTKCLDACPTGALVNPGQLNAQRCISFLTQTKGFLPDEFRTKIGNRLYGC
DTCQTVCPLNKGKDFHLHPEMEPDPEIAKPLLKPLLAISNREFKEKFGHVSGSWRGKKPIQRNAILALAHFKDASALPEL
TELMHKDPRPVIRGTAAWAIGKIGDPAYAEELEKALEKEKDEEAKLEIEKGIELLKASGMTKQGLS
;
1 
2 PDB 5D0A       5D0A   ? 2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5D0A A 29 ? 414 ? P97030 1  ? 386 ? 1  386 
2 1 5D0A B 29 ? 414 ? P97030 1  ? 386 ? 1  386 
3 1 5D0A C 29 ? 414 ? P97030 1  ? 386 ? 1  386 
4 1 5D0A D 29 ? 414 ? P97030 1  ? 386 ? 1  386 
5 2 5D0A E 1  ? 17  ? 5D0A   27 ? 43  ? 27 43  
6 2 5D0A F 1  ? 17  ? 5D0A   27 ? 43  ? 27 43  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5D0A MET A 1   ? UNP P97030 ? ? 'initiating methionine' -27 1   
1 5D0A ALA A 2   ? UNP P97030 ? ? 'expression tag'        -26 2   
1 5D0A SER A 3   ? UNP P97030 ? ? 'expression tag'        -25 3   
1 5D0A ARG A 4   ? UNP P97030 ? ? 'expression tag'        -24 4   
1 5D0A GLY A 5   ? UNP P97030 ? ? 'expression tag'        -23 5   
1 5D0A SER A 6   ? UNP P97030 ? ? 'expression tag'        -22 6   
1 5D0A HIS A 7   ? UNP P97030 ? ? 'expression tag'        -21 7   
1 5D0A HIS A 8   ? UNP P97030 ? ? 'expression tag'        -20 8   
1 5D0A HIS A 9   ? UNP P97030 ? ? 'expression tag'        -19 9   
1 5D0A HIS A 10  ? UNP P97030 ? ? 'expression tag'        -18 10  
1 5D0A HIS A 11  ? UNP P97030 ? ? 'expression tag'        -17 11  
1 5D0A HIS A 12  ? UNP P97030 ? ? 'expression tag'        -16 12  
1 5D0A GLY A 13  ? UNP P97030 ? ? 'expression tag'        -15 13  
1 5D0A ALA A 14  ? UNP P97030 ? ? 'expression tag'        -14 14  
1 5D0A GLY A 15  ? UNP P97030 ? ? 'expression tag'        -13 15  
1 5D0A ASP A 16  ? UNP P97030 ? ? 'expression tag'        -12 16  
1 5D0A ARG A 17  ? UNP P97030 ? ? 'expression tag'        -11 17  
1 5D0A GLY A 18  ? UNP P97030 ? ? 'expression tag'        -10 18  
1 5D0A PRO A 19  ? UNP P97030 ? ? 'expression tag'        -9  19  
1 5D0A GLU A 20  ? UNP P97030 ? ? 'expression tag'        -8  20  
1 5D0A PHE A 21  ? UNP P97030 ? ? 'expression tag'        -7  21  
1 5D0A GLU A 22  ? UNP P97030 ? ? 'expression tag'        -6  22  
1 5D0A LEU A 23  ? UNP P97030 ? ? 'expression tag'        -5  23  
1 5D0A GLY A 24  ? UNP P97030 ? ? 'expression tag'        -4  24  
1 5D0A THR A 25  ? UNP P97030 ? ? 'expression tag'        -3  25  
1 5D0A ARG A 26  ? UNP P97030 ? ? 'expression tag'        -2  26  
1 5D0A GLY A 27  ? UNP P97030 ? ? 'expression tag'        -1  27  
1 5D0A SER A 28  ? UNP P97030 ? ? 'expression tag'        0   28  
1 5D0A GLY A 415 ? UNP P97030 ? ? 'expression tag'        387 29  
1 5D0A SER A 416 ? UNP P97030 ? ? 'expression tag'        388 30  
1 5D0A LEU A 417 ? UNP P97030 ? ? 'expression tag'        389 31  
1 5D0A GLU A 418 ? UNP P97030 ? ? 'expression tag'        390 32  
1 5D0A VAL A 419 ? UNP P97030 ? ? 'expression tag'        391 33  
1 5D0A ASP A 420 ? UNP P97030 ? ? 'expression tag'        392 34  
1 5D0A LEU A 421 ? UNP P97030 ? ? 'expression tag'        393 35  
1 5D0A GLN A 422 ? UNP P97030 ? ? 'expression tag'        394 36  
1 5D0A GLY A 423 ? UNP P97030 ? ? 'expression tag'        395 37  
1 5D0A ASP A 424 ? UNP P97030 ? ? 'expression tag'        396 38  
1 5D0A HIS A 425 ? UNP P97030 ? ? 'expression tag'        397 39  
1 5D0A GLY A 426 ? UNP P97030 ? ? 'expression tag'        398 40  
1 5D0A LEU A 427 ? UNP P97030 ? ? 'expression tag'        399 41  
1 5D0A SER A 428 ? UNP P97030 ? ? 'expression tag'        400 42  
1 5D0A ALA A 429 ? UNP P97030 ? ? 'expression tag'        401 43  
1 5D0A TRP A 430 ? UNP P97030 ? ? 'expression tag'        402 44  
1 5D0A SER A 431 ? UNP P97030 ? ? 'expression tag'        403 45  
1 5D0A HIS A 432 ? UNP P97030 ? ? 'expression tag'        404 46  
1 5D0A PRO A 433 ? UNP P97030 ? ? 'expression tag'        405 47  
1 5D0A GLN A 434 ? UNP P97030 ? ? 'expression tag'        406 48  
1 5D0A PHE A 435 ? UNP P97030 ? ? 'expression tag'        407 49  
1 5D0A GLU A 436 ? UNP P97030 ? ? 'expression tag'        408 50  
1 5D0A LYS A 437 ? UNP P97030 ? ? 'expression tag'        409 51  
2 5D0A MET B 1   ? UNP P97030 ? ? 'initiating methionine' -27 52  
2 5D0A ALA B 2   ? UNP P97030 ? ? 'expression tag'        -26 53  
2 5D0A SER B 3   ? UNP P97030 ? ? 'expression tag'        -25 54  
2 5D0A ARG B 4   ? UNP P97030 ? ? 'expression tag'        -24 55  
2 5D0A GLY B 5   ? UNP P97030 ? ? 'expression tag'        -23 56  
2 5D0A SER B 6   ? UNP P97030 ? ? 'expression tag'        -22 57  
2 5D0A HIS B 7   ? UNP P97030 ? ? 'expression tag'        -21 58  
2 5D0A HIS B 8   ? UNP P97030 ? ? 'expression tag'        -20 59  
2 5D0A HIS B 9   ? UNP P97030 ? ? 'expression tag'        -19 60  
2 5D0A HIS B 10  ? UNP P97030 ? ? 'expression tag'        -18 61  
2 5D0A HIS B 11  ? UNP P97030 ? ? 'expression tag'        -17 62  
2 5D0A HIS B 12  ? UNP P97030 ? ? 'expression tag'        -16 63  
2 5D0A GLY B 13  ? UNP P97030 ? ? 'expression tag'        -15 64  
2 5D0A ALA B 14  ? UNP P97030 ? ? 'expression tag'        -14 65  
2 5D0A GLY B 15  ? UNP P97030 ? ? 'expression tag'        -13 66  
2 5D0A ASP B 16  ? UNP P97030 ? ? 'expression tag'        -12 67  
2 5D0A ARG B 17  ? UNP P97030 ? ? 'expression tag'        -11 68  
2 5D0A GLY B 18  ? UNP P97030 ? ? 'expression tag'        -10 69  
2 5D0A PRO B 19  ? UNP P97030 ? ? 'expression tag'        -9  70  
2 5D0A GLU B 20  ? UNP P97030 ? ? 'expression tag'        -8  71  
2 5D0A PHE B 21  ? UNP P97030 ? ? 'expression tag'        -7  72  
2 5D0A GLU B 22  ? UNP P97030 ? ? 'expression tag'        -6  73  
2 5D0A LEU B 23  ? UNP P97030 ? ? 'expression tag'        -5  74  
2 5D0A GLY B 24  ? UNP P97030 ? ? 'expression tag'        -4  75  
2 5D0A THR B 25  ? UNP P97030 ? ? 'expression tag'        -3  76  
2 5D0A ARG B 26  ? UNP P97030 ? ? 'expression tag'        -2  77  
2 5D0A GLY B 27  ? UNP P97030 ? ? 'expression tag'        -1  78  
2 5D0A SER B 28  ? UNP P97030 ? ? 'expression tag'        0   79  
2 5D0A GLY B 415 ? UNP P97030 ? ? 'expression tag'        387 80  
2 5D0A SER B 416 ? UNP P97030 ? ? 'expression tag'        388 81  
2 5D0A LEU B 417 ? UNP P97030 ? ? 'expression tag'        389 82  
2 5D0A GLU B 418 ? UNP P97030 ? ? 'expression tag'        390 83  
2 5D0A VAL B 419 ? UNP P97030 ? ? 'expression tag'        391 84  
2 5D0A ASP B 420 ? UNP P97030 ? ? 'expression tag'        392 85  
2 5D0A LEU B 421 ? UNP P97030 ? ? 'expression tag'        393 86  
2 5D0A GLN B 422 ? UNP P97030 ? ? 'expression tag'        394 87  
2 5D0A GLY B 423 ? UNP P97030 ? ? 'expression tag'        395 88  
2 5D0A ASP B 424 ? UNP P97030 ? ? 'expression tag'        396 89  
2 5D0A HIS B 425 ? UNP P97030 ? ? 'expression tag'        397 90  
2 5D0A GLY B 426 ? UNP P97030 ? ? 'expression tag'        398 91  
2 5D0A LEU B 427 ? UNP P97030 ? ? 'expression tag'        399 92  
2 5D0A SER B 428 ? UNP P97030 ? ? 'expression tag'        400 93  
2 5D0A ALA B 429 ? UNP P97030 ? ? 'expression tag'        401 94  
2 5D0A TRP B 430 ? UNP P97030 ? ? 'expression tag'        402 95  
2 5D0A SER B 431 ? UNP P97030 ? ? 'expression tag'        403 96  
2 5D0A HIS B 432 ? UNP P97030 ? ? 'expression tag'        404 97  
2 5D0A PRO B 433 ? UNP P97030 ? ? 'expression tag'        405 98  
2 5D0A GLN B 434 ? UNP P97030 ? ? 'expression tag'        406 99  
2 5D0A PHE B 435 ? UNP P97030 ? ? 'expression tag'        407 100 
2 5D0A GLU B 436 ? UNP P97030 ? ? 'expression tag'        408 101 
2 5D0A LYS B 437 ? UNP P97030 ? ? 'expression tag'        409 102 
3 5D0A MET C 1   ? UNP P97030 ? ? 'initiating methionine' -27 103 
3 5D0A ALA C 2   ? UNP P97030 ? ? 'expression tag'        -26 104 
3 5D0A SER C 3   ? UNP P97030 ? ? 'expression tag'        -25 105 
3 5D0A ARG C 4   ? UNP P97030 ? ? 'expression tag'        -24 106 
3 5D0A GLY C 5   ? UNP P97030 ? ? 'expression tag'        -23 107 
3 5D0A SER C 6   ? UNP P97030 ? ? 'expression tag'        -22 108 
3 5D0A HIS C 7   ? UNP P97030 ? ? 'expression tag'        -21 109 
3 5D0A HIS C 8   ? UNP P97030 ? ? 'expression tag'        -20 110 
3 5D0A HIS C 9   ? UNP P97030 ? ? 'expression tag'        -19 111 
3 5D0A HIS C 10  ? UNP P97030 ? ? 'expression tag'        -18 112 
3 5D0A HIS C 11  ? UNP P97030 ? ? 'expression tag'        -17 113 
3 5D0A HIS C 12  ? UNP P97030 ? ? 'expression tag'        -16 114 
3 5D0A GLY C 13  ? UNP P97030 ? ? 'expression tag'        -15 115 
3 5D0A ALA C 14  ? UNP P97030 ? ? 'expression tag'        -14 116 
3 5D0A GLY C 15  ? UNP P97030 ? ? 'expression tag'        -13 117 
3 5D0A ASP C 16  ? UNP P97030 ? ? 'expression tag'        -12 118 
3 5D0A ARG C 17  ? UNP P97030 ? ? 'expression tag'        -11 119 
3 5D0A GLY C 18  ? UNP P97030 ? ? 'expression tag'        -10 120 
3 5D0A PRO C 19  ? UNP P97030 ? ? 'expression tag'        -9  121 
3 5D0A GLU C 20  ? UNP P97030 ? ? 'expression tag'        -8  122 
3 5D0A PHE C 21  ? UNP P97030 ? ? 'expression tag'        -7  123 
3 5D0A GLU C 22  ? UNP P97030 ? ? 'expression tag'        -6  124 
3 5D0A LEU C 23  ? UNP P97030 ? ? 'expression tag'        -5  125 
3 5D0A GLY C 24  ? UNP P97030 ? ? 'expression tag'        -4  126 
3 5D0A THR C 25  ? UNP P97030 ? ? 'expression tag'        -3  127 
3 5D0A ARG C 26  ? UNP P97030 ? ? 'expression tag'        -2  128 
3 5D0A GLY C 27  ? UNP P97030 ? ? 'expression tag'        -1  129 
3 5D0A SER C 28  ? UNP P97030 ? ? 'expression tag'        0   130 
3 5D0A GLY C 415 ? UNP P97030 ? ? 'expression tag'        387 131 
3 5D0A SER C 416 ? UNP P97030 ? ? 'expression tag'        388 132 
3 5D0A LEU C 417 ? UNP P97030 ? ? 'expression tag'        389 133 
3 5D0A GLU C 418 ? UNP P97030 ? ? 'expression tag'        390 134 
3 5D0A VAL C 419 ? UNP P97030 ? ? 'expression tag'        391 135 
3 5D0A ASP C 420 ? UNP P97030 ? ? 'expression tag'        392 136 
3 5D0A LEU C 421 ? UNP P97030 ? ? 'expression tag'        393 137 
3 5D0A GLN C 422 ? UNP P97030 ? ? 'expression tag'        394 138 
3 5D0A GLY C 423 ? UNP P97030 ? ? 'expression tag'        395 139 
3 5D0A ASP C 424 ? UNP P97030 ? ? 'expression tag'        396 140 
3 5D0A HIS C 425 ? UNP P97030 ? ? 'expression tag'        397 141 
3 5D0A GLY C 426 ? UNP P97030 ? ? 'expression tag'        398 142 
3 5D0A LEU C 427 ? UNP P97030 ? ? 'expression tag'        399 143 
3 5D0A SER C 428 ? UNP P97030 ? ? 'expression tag'        400 144 
3 5D0A ALA C 429 ? UNP P97030 ? ? 'expression tag'        401 145 
3 5D0A TRP C 430 ? UNP P97030 ? ? 'expression tag'        402 146 
3 5D0A SER C 431 ? UNP P97030 ? ? 'expression tag'        403 147 
3 5D0A HIS C 432 ? UNP P97030 ? ? 'expression tag'        404 148 
3 5D0A PRO C 433 ? UNP P97030 ? ? 'expression tag'        405 149 
3 5D0A GLN C 434 ? UNP P97030 ? ? 'expression tag'        406 150 
3 5D0A PHE C 435 ? UNP P97030 ? ? 'expression tag'        407 151 
3 5D0A GLU C 436 ? UNP P97030 ? ? 'expression tag'        408 152 
3 5D0A LYS C 437 ? UNP P97030 ? ? 'expression tag'        409 153 
4 5D0A MET D 1   ? UNP P97030 ? ? 'initiating methionine' -27 154 
4 5D0A ALA D 2   ? UNP P97030 ? ? 'expression tag'        -26 155 
4 5D0A SER D 3   ? UNP P97030 ? ? 'expression tag'        -25 156 
4 5D0A ARG D 4   ? UNP P97030 ? ? 'expression tag'        -24 157 
4 5D0A GLY D 5   ? UNP P97030 ? ? 'expression tag'        -23 158 
4 5D0A SER D 6   ? UNP P97030 ? ? 'expression tag'        -22 159 
4 5D0A HIS D 7   ? UNP P97030 ? ? 'expression tag'        -21 160 
4 5D0A HIS D 8   ? UNP P97030 ? ? 'expression tag'        -20 161 
4 5D0A HIS D 9   ? UNP P97030 ? ? 'expression tag'        -19 162 
4 5D0A HIS D 10  ? UNP P97030 ? ? 'expression tag'        -18 163 
4 5D0A HIS D 11  ? UNP P97030 ? ? 'expression tag'        -17 164 
4 5D0A HIS D 12  ? UNP P97030 ? ? 'expression tag'        -16 165 
4 5D0A GLY D 13  ? UNP P97030 ? ? 'expression tag'        -15 166 
4 5D0A ALA D 14  ? UNP P97030 ? ? 'expression tag'        -14 167 
4 5D0A GLY D 15  ? UNP P97030 ? ? 'expression tag'        -13 168 
4 5D0A ASP D 16  ? UNP P97030 ? ? 'expression tag'        -12 169 
4 5D0A ARG D 17  ? UNP P97030 ? ? 'expression tag'        -11 170 
4 5D0A GLY D 18  ? UNP P97030 ? ? 'expression tag'        -10 171 
4 5D0A PRO D 19  ? UNP P97030 ? ? 'expression tag'        -9  172 
4 5D0A GLU D 20  ? UNP P97030 ? ? 'expression tag'        -8  173 
4 5D0A PHE D 21  ? UNP P97030 ? ? 'expression tag'        -7  174 
4 5D0A GLU D 22  ? UNP P97030 ? ? 'expression tag'        -6  175 
4 5D0A LEU D 23  ? UNP P97030 ? ? 'expression tag'        -5  176 
4 5D0A GLY D 24  ? UNP P97030 ? ? 'expression tag'        -4  177 
4 5D0A THR D 25  ? UNP P97030 ? ? 'expression tag'        -3  178 
4 5D0A ARG D 26  ? UNP P97030 ? ? 'expression tag'        -2  179 
4 5D0A GLY D 27  ? UNP P97030 ? ? 'expression tag'        -1  180 
4 5D0A SER D 28  ? UNP P97030 ? ? 'expression tag'        0   181 
4 5D0A GLY D 415 ? UNP P97030 ? ? 'expression tag'        387 182 
4 5D0A SER D 416 ? UNP P97030 ? ? 'expression tag'        388 183 
4 5D0A LEU D 417 ? UNP P97030 ? ? 'expression tag'        389 184 
4 5D0A GLU D 418 ? UNP P97030 ? ? 'expression tag'        390 185 
4 5D0A VAL D 419 ? UNP P97030 ? ? 'expression tag'        391 186 
4 5D0A ASP D 420 ? UNP P97030 ? ? 'expression tag'        392 187 
4 5D0A LEU D 421 ? UNP P97030 ? ? 'expression tag'        393 188 
4 5D0A GLN D 422 ? UNP P97030 ? ? 'expression tag'        394 189 
4 5D0A GLY D 423 ? UNP P97030 ? ? 'expression tag'        395 190 
4 5D0A ASP D 424 ? UNP P97030 ? ? 'expression tag'        396 191 
4 5D0A HIS D 425 ? UNP P97030 ? ? 'expression tag'        397 192 
4 5D0A GLY D 426 ? UNP P97030 ? ? 'expression tag'        398 193 
4 5D0A LEU D 427 ? UNP P97030 ? ? 'expression tag'        399 194 
4 5D0A SER D 428 ? UNP P97030 ? ? 'expression tag'        400 195 
4 5D0A ALA D 429 ? UNP P97030 ? ? 'expression tag'        401 196 
4 5D0A TRP D 430 ? UNP P97030 ? ? 'expression tag'        402 197 
4 5D0A SER D 431 ? UNP P97030 ? ? 'expression tag'        403 198 
4 5D0A HIS D 432 ? UNP P97030 ? ? 'expression tag'        404 199 
4 5D0A PRO D 433 ? UNP P97030 ? ? 'expression tag'        405 200 
4 5D0A GLN D 434 ? UNP P97030 ? ? 'expression tag'        406 201 
4 5D0A PHE D 435 ? UNP P97030 ? ? 'expression tag'        407 202 
4 5D0A GLU D 436 ? UNP P97030 ? ? 'expression tag'        408 203 
4 5D0A LYS D 437 ? UNP P97030 ? ? 'expression tag'        409 204 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'        347.221  
ALA 'L-peptide linking' y ALANINE                      ?                               'C3 H7 N O2'             89.093   
ARG 'L-peptide linking' y ARGININE                     ?                               'C6 H15 N4 O2 1'         175.209  
ASN 'L-peptide linking' y ASPARAGINE                   ?                               'C4 H8 N2 O3'            132.118  
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                               'C4 H7 N O4'             133.103  
B12 non-polymer         . COBALAMIN                    ?                               'C62 H89 Co N13 O14 P 2' 1330.356 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O8 P'         323.197  
CYS 'L-peptide linking' y CYSTEINE                     ?                               'C3 H7 N O2 S'           121.158  
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O8 P'        363.221  
GLN 'L-peptide linking' y GLUTAMINE                    ?                               'C5 H10 N2 O3'           146.144  
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                               'C5 H9 N O4'             147.129  
GLY 'peptide linking'   y GLYCINE                      ?                               'C2 H5 N O2'             75.067   
GOL non-polymer         . GLYCEROL                     'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'               92.094   
HIS 'L-peptide linking' y HISTIDINE                    ?                               'C6 H10 N3 O2 1'         156.162  
HOH non-polymer         . WATER                        ?                               'H2 O'                   18.015   
ILE 'L-peptide linking' y ISOLEUCINE                   ?                               'C6 H13 N O2'            131.173  
LEU 'L-peptide linking' y LEUCINE                      ?                               'C6 H13 N O2'            131.173  
LYS 'L-peptide linking' y LYSINE                       ?                               'C6 H15 N2 O2 1'         147.195  
MET 'L-peptide linking' y METHIONINE                   ?                               'C5 H11 N O2 S'          149.211  
PHE 'L-peptide linking' y PHENYLALANINE                ?                               'C9 H11 N O2'            165.189  
PO4 non-polymer         . 'PHOSPHATE ION'              ?                               'O4 P -3'                94.971   
PRO 'L-peptide linking' y PROLINE                      ?                               'C5 H9 N O2'             115.130  
SER 'L-peptide linking' y SERINE                       ?                               'C3 H7 N O3'             105.093  
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'        ?                               'Fe4 S4'                 351.640  
THR 'L-peptide linking' y THREONINE                    ?                               'C4 H9 N O3'             119.119  
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                               'C11 H12 N2 O2'          204.225  
TYR 'L-peptide linking' y TYROSINE                     ?                               'C9 H11 N O3'            181.189  
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ?                               'C9 H13 N2 O9 P'         324.181  
VAL 'L-peptide linking' y VALINE                       ?                               'C5 H11 N O2'            117.146  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5D0A 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.27 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.79 
_exptl_crystal.description                 'square pyramidal' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    anaerobic 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;(0.1 M acetate, 0.4 M
(NH4)H2PO4, 12% (w/v) PEG 3350
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-04-17 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5D0A 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.100 
_reflns.number_obs                   104237 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.08100 
_reflns.pdbx_netI_over_sigmaI        5.8000 
_reflns.B_iso_Wilson_estimate        30.15 
_reflns.pdbx_redundancy              3.400 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   89.3 
_reflns_shell.Rmerge_I_obs           0.39400 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.90 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5D0A 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     103951 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.39 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    97.1 
_refine.ls_R_factor_obs                          0.186 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.184 
_refine.ls_R_factor_R_free                       0.225 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.910 
_refine.ls_number_reflns_R_free                  5106 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               38.00 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      5D08 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.230 
_refine.pdbx_overall_phase_error                 29.850 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11832 
_refine_hist.pdbx_number_atoms_nucleic_acid   507 
_refine_hist.pdbx_number_atoms_ligand         472 
_refine_hist.number_atoms_solvent             794 
_refine_hist.number_atoms_total               13605 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        46.39 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 13259 'X-RAY DIFFRACTION' ? 
f_angle_d          1.088  ? ? 18146 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.472 ? ? 5355  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.044  ? ? 2001  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 2300  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.1000 2.1239  2798 0.2727 84.00  0.3444 . . 137 . . . . 
'X-RAY DIFFRACTION' . 2.1239 2.1489  3099 0.2716 90.00  0.3128 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.1489 2.1751  3108 0.2564 91.00  0.3045 . . 129 . . . . 
'X-RAY DIFFRACTION' . 2.1751 2.2026  3138 0.2465 94.00  0.2896 . . 163 . . . . 
'X-RAY DIFFRACTION' . 2.2026 2.2316  3302 0.2361 97.00  0.2862 . . 152 . . . . 
'X-RAY DIFFRACTION' . 2.2316 2.2621  3348 0.2292 98.00  0.3128 . . 161 . . . . 
'X-RAY DIFFRACTION' . 2.2621 2.2945  3306 0.2218 99.00  0.2543 . . 162 . . . . 
'X-RAY DIFFRACTION' . 2.2945 2.3287  3337 0.2060 99.00  0.2474 . . 197 . . . . 
'X-RAY DIFFRACTION' . 2.3287 2.3651  3317 0.2036 99.00  0.2461 . . 171 . . . . 
'X-RAY DIFFRACTION' . 2.3651 2.4039  3324 0.2096 99.00  0.2649 . . 192 . . . . 
'X-RAY DIFFRACTION' . 2.4039 2.4453  3351 0.2014 99.00  0.2888 . . 192 . . . . 
'X-RAY DIFFRACTION' . 2.4453 2.4898  3245 0.2061 99.00  0.2702 . . 208 . . . . 
'X-RAY DIFFRACTION' . 2.4898 2.5377  3322 0.1938 98.00  0.2582 . . 180 . . . . 
'X-RAY DIFFRACTION' . 2.5377 2.5895  3338 0.1923 98.00  0.2735 . . 168 . . . . 
'X-RAY DIFFRACTION' . 2.5895 2.6458  3252 0.1865 96.00  0.2306 . . 161 . . . . 
'X-RAY DIFFRACTION' . 2.6458 2.7073  3337 0.1816 98.00  0.2334 . . 174 . . . . 
'X-RAY DIFFRACTION' . 2.7073 2.7750  3367 0.1847 99.00  0.2558 . . 165 . . . . 
'X-RAY DIFFRACTION' . 2.7750 2.8500  3351 0.1878 99.00  0.2114 . . 195 . . . . 
'X-RAY DIFFRACTION' . 2.8500 2.9339  3356 0.1973 99.00  0.2423 . . 184 . . . . 
'X-RAY DIFFRACTION' . 2.9339 3.0285  3362 0.1962 99.00  0.2560 . . 149 . . . . 
'X-RAY DIFFRACTION' . 3.0285 3.1368  3340 0.2085 99.00  0.2378 . . 196 . . . . 
'X-RAY DIFFRACTION' . 3.1368 3.2623  3357 0.2010 99.00  0.2519 . . 170 . . . . 
'X-RAY DIFFRACTION' . 3.2623 3.4108  3266 0.2015 97.00  0.2448 . . 177 . . . . 
'X-RAY DIFFRACTION' . 3.4108 3.5905  3344 0.1776 98.00  0.2427 . . 154 . . . . 
'X-RAY DIFFRACTION' . 3.5905 3.8154  3370 0.1606 100.00 0.2069 . . 183 . . . . 
'X-RAY DIFFRACTION' . 3.8154 4.1098  3394 0.1564 99.00  0.1672 . . 180 . . . . 
'X-RAY DIFFRACTION' . 4.1098 4.5231  3417 0.1406 99.00  0.1600 . . 137 . . . . 
'X-RAY DIFFRACTION' . 4.5231 5.1768  3299 0.1404 97.00  0.1906 . . 162 . . . . 
'X-RAY DIFFRACTION' . 5.1768 6.5194  3396 0.1638 99.00  0.1967 . . 194 . . . . 
'X-RAY DIFFRACTION' . 6.5194 46.4021 3304 0.1720 95.00  0.1805 . . 174 . . . . 
# 
_struct.entry_id                     5D0A 
_struct.title                        'Crystal structure of epoxyqueuosine reductase with cleaved RNA stem loop' 
_struct.pdbx_descriptor              'Epoxyqueuosine reductase/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5D0A 
_struct_keywords.text            'B12, tRNA modification, HEAT-domain, queuosine, oxidoreductase-RNA complex' 
_struct_keywords.pdbx_keywords   oxidoreductase/RNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 4 ? 
J  N N 5 ? 
K  N N 6 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 4 ? 
O  N N 5 ? 
P  N N 6 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 5 ? 
U  N N 6 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 4 ? 
Y  N N 5 ? 
Z  N N 6 ? 
AA N N 7 ? 
BA N N 7 ? 
CA N N 7 ? 
DA N N 7 ? 
EA N N 7 ? 
FA N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 ASN A 30  ? ILE A 45  ? ASN A 2   ILE A 17  1 ? 16 
HELX_P HELX_P2   AA2 PHE A 58  ? LEU A 71  ? PHE A 30  LEU A 43  1 ? 14 
HELX_P HELX_P3   AA3 ASP A 81  ? THR A 87  ? ASP A 53  THR A 59  1 ? 7  
HELX_P HELX_P4   AA4 THR A 87  ? LEU A 92  ? THR A 59  LEU A 64  1 ? 6  
HELX_P HELX_P5   AA5 ARG A 126 ? TRP A 129 ? ARG A 98  TRP A 101 5 ? 4  
HELX_P HELX_P6   AA6 ASP A 132 ? SER A 150 ? ASP A 104 SER A 122 1 ? 19 
HELX_P HELX_P7   AA7 SER A 167 ? ALA A 175 ? SER A 139 ALA A 147 1 ? 9  
HELX_P HELX_P8   AA8 THR A 220 ? CYS A 226 ? THR A 192 CYS A 198 1 ? 7  
HELX_P HELX_P9   AA9 ALA A 239 ? ARG A 241 ? ALA A 211 ARG A 213 5 ? 3  
HELX_P HELX_P10  AB1 CYS A 242 ? GLN A 248 ? CYS A 214 GLN A 220 1 ? 7  
HELX_P HELX_P11  AB2 PRO A 254 ? THR A 259 ? PRO A 226 THR A 231 1 ? 6  
HELX_P HELX_P12  AB3 ASP A 269 ? VAL A 274 ? ASP A 241 VAL A 246 1 ? 6  
HELX_P HELX_P13  AB4 CYS A 275 ? LYS A 279 ? CYS A 247 LYS A 251 5 ? 5  
HELX_P HELX_P14  AB5 HIS A 286 ? GLU A 290 ? HIS A 258 GLU A 262 5 ? 5  
HELX_P HELX_P15  AB6 ASP A 292 ? LYS A 297 ? ASP A 264 LYS A 269 1 ? 6  
HELX_P HELX_P16  AB7 LEU A 299 ? LEU A 304 ? LEU A 271 LEU A 276 1 ? 6  
HELX_P HELX_P17  AB8 SER A 307 ? GLY A 316 ? SER A 279 GLY A 288 1 ? 10 
HELX_P HELX_P18  AB9 VAL A 318 ? TRP A 322 ? VAL A 290 TRP A 294 5 ? 5  
HELX_P HELX_P19  AC1 GLY A 324 ? PHE A 339 ? GLY A 296 PHE A 311 1 ? 16 
HELX_P HELX_P20  AC2 ASP A 341 ? SER A 343 ? ASP A 313 SER A 315 5 ? 3  
HELX_P HELX_P21  AC3 ALA A 344 ? ASP A 355 ? ALA A 316 ASP A 327 1 ? 12 
HELX_P HELX_P22  AC4 ARG A 357 ? GLY A 372 ? ARG A 329 GLY A 344 1 ? 16 
HELX_P HELX_P23  AC5 ASP A 373 ? ALA A 375 ? ASP A 345 ALA A 347 5 ? 3  
HELX_P HELX_P24  AC6 TYR A 376 ? GLU A 385 ? TYR A 348 GLU A 357 1 ? 10 
HELX_P HELX_P25  AC7 ASP A 389 ? MET A 408 ? ASP A 361 MET A 380 1 ? 20 
HELX_P HELX_P26  AC8 VAL B 31  ? ILE B 45  ? VAL B 3   ILE B 17  1 ? 15 
HELX_P HELX_P27  AC9 PHE B 58  ? GLY B 72  ? PHE B 30  GLY B 44  1 ? 15 
HELX_P HELX_P28  AD1 ASP B 81  ? THR B 87  ? ASP B 53  THR B 59  1 ? 7  
HELX_P HELX_P29  AD2 THR B 87  ? LEU B 92  ? THR B 59  LEU B 64  1 ? 6  
HELX_P HELX_P30  AD3 ARG B 126 ? TRP B 129 ? ARG B 98  TRP B 101 5 ? 4  
HELX_P HELX_P31  AD4 ASP B 132 ? SER B 150 ? ASP B 104 SER B 122 1 ? 19 
HELX_P HELX_P32  AD5 SER B 167 ? ALA B 175 ? SER B 139 ALA B 147 1 ? 9  
HELX_P HELX_P33  AD6 THR B 220 ? CYS B 226 ? THR B 192 CYS B 198 1 ? 7  
HELX_P HELX_P34  AD7 ALA B 239 ? ARG B 241 ? ALA B 211 ARG B 213 5 ? 3  
HELX_P HELX_P35  AD8 CYS B 242 ? GLN B 248 ? CYS B 214 GLN B 220 1 ? 7  
HELX_P HELX_P36  AD9 PRO B 254 ? THR B 259 ? PRO B 226 THR B 231 1 ? 6  
HELX_P HELX_P37  AE1 ASP B 269 ? VAL B 274 ? ASP B 241 VAL B 246 1 ? 6  
HELX_P HELX_P38  AE2 CYS B 275 ? LYS B 279 ? CYS B 247 LYS B 251 5 ? 5  
HELX_P HELX_P39  AE3 HIS B 286 ? GLU B 290 ? HIS B 258 GLU B 262 5 ? 5  
HELX_P HELX_P40  AE4 ASP B 292 ? LYS B 297 ? ASP B 264 LYS B 269 1 ? 6  
HELX_P HELX_P41  AE5 LEU B 299 ? LEU B 304 ? LEU B 271 LEU B 276 1 ? 6  
HELX_P HELX_P42  AE6 SER B 307 ? GLY B 316 ? SER B 279 GLY B 288 1 ? 10 
HELX_P HELX_P43  AE7 VAL B 318 ? TRP B 322 ? VAL B 290 TRP B 294 5 ? 5  
HELX_P HELX_P44  AE8 LYS B 325 ? PHE B 339 ? LYS B 297 PHE B 311 1 ? 15 
HELX_P HELX_P45  AE9 ASP B 341 ? SER B 343 ? ASP B 313 SER B 315 5 ? 3  
HELX_P HELX_P46  AF1 ALA B 344 ? ASP B 355 ? ALA B 316 ASP B 327 1 ? 12 
HELX_P HELX_P47  AF2 ARG B 357 ? GLY B 372 ? ARG B 329 GLY B 344 1 ? 16 
HELX_P HELX_P48  AF3 ASP B 373 ? ALA B 375 ? ASP B 345 ALA B 347 5 ? 3  
HELX_P HELX_P49  AF4 TYR B 376 ? GLU B 385 ? TYR B 348 GLU B 357 1 ? 10 
HELX_P HELX_P50  AF5 ASP B 389 ? MET B 408 ? ASP B 361 MET B 380 1 ? 20 
HELX_P HELX_P51  AF6 VAL C 31  ? ILE C 45  ? VAL C 3   ILE C 17  1 ? 15 
HELX_P HELX_P52  AF7 PHE C 58  ? LEU C 71  ? PHE C 30  LEU C 43  1 ? 14 
HELX_P HELX_P53  AF8 ASP C 81  ? THR C 87  ? ASP C 53  THR C 59  1 ? 7  
HELX_P HELX_P54  AF9 THR C 87  ? LEU C 92  ? THR C 59  LEU C 64  1 ? 6  
HELX_P HELX_P55  AG1 ARG C 126 ? TRP C 129 ? ARG C 98  TRP C 101 5 ? 4  
HELX_P HELX_P56  AG2 ASP C 132 ? SER C 150 ? ASP C 104 SER C 122 1 ? 19 
HELX_P HELX_P57  AG3 SER C 167 ? ALA C 175 ? SER C 139 ALA C 147 1 ? 9  
HELX_P HELX_P58  AG4 THR C 220 ? CYS C 226 ? THR C 192 CYS C 198 1 ? 7  
HELX_P HELX_P59  AG5 ALA C 239 ? ARG C 241 ? ALA C 211 ARG C 213 5 ? 3  
HELX_P HELX_P60  AG6 CYS C 242 ? GLN C 248 ? CYS C 214 GLN C 220 1 ? 7  
HELX_P HELX_P61  AG7 PRO C 254 ? ARG C 258 ? PRO C 226 ARG C 230 5 ? 5  
HELX_P HELX_P62  AG8 ASP C 269 ? VAL C 274 ? ASP C 241 VAL C 246 1 ? 6  
HELX_P HELX_P63  AG9 CYS C 275 ? LYS C 279 ? CYS C 247 LYS C 251 5 ? 5  
HELX_P HELX_P64  AH1 HIS C 286 ? GLU C 290 ? HIS C 258 GLU C 262 5 ? 5  
HELX_P HELX_P65  AH2 ASP C 292 ? LYS C 297 ? ASP C 264 LYS C 269 1 ? 6  
HELX_P HELX_P66  AH3 LEU C 300 ? ALA C 305 ? LEU C 272 ALA C 277 5 ? 6  
HELX_P HELX_P67  AH4 SER C 307 ? GLY C 316 ? SER C 279 GLY C 288 1 ? 10 
HELX_P HELX_P68  AH5 VAL C 318 ? TRP C 322 ? VAL C 290 TRP C 294 5 ? 5  
HELX_P HELX_P69  AH6 LYS C 325 ? LYS C 340 ? LYS C 297 LYS C 312 1 ? 16 
HELX_P HELX_P70  AH7 ASP C 341 ? SER C 343 ? ASP C 313 SER C 315 5 ? 3  
HELX_P HELX_P71  AH8 ALA C 344 ? ASP C 355 ? ALA C 316 ASP C 327 1 ? 12 
HELX_P HELX_P72  AH9 ARG C 357 ? GLY C 372 ? ARG C 329 GLY C 344 1 ? 16 
HELX_P HELX_P73  AI1 ASP C 373 ? ALA C 375 ? ASP C 345 ALA C 347 5 ? 3  
HELX_P HELX_P74  AI2 TYR C 376 ? GLU C 385 ? TYR C 348 GLU C 357 1 ? 10 
HELX_P HELX_P75  AI3 ASP C 389 ? SER C 406 ? ASP C 361 SER C 378 1 ? 18 
HELX_P HELX_P76  AI4 VAL D 31  ? ILE D 45  ? VAL D 3   ILE D 17  1 ? 15 
HELX_P HELX_P77  AI5 PHE D 58  ? LEU D 71  ? PHE D 30  LEU D 43  1 ? 14 
HELX_P HELX_P78  AI6 ASP D 81  ? THR D 87  ? ASP D 53  THR D 59  1 ? 7  
HELX_P HELX_P79  AI7 THR D 87  ? LEU D 92  ? THR D 59  LEU D 64  1 ? 6  
HELX_P HELX_P80  AI8 ARG D 126 ? TRP D 129 ? ARG D 98  TRP D 101 5 ? 4  
HELX_P HELX_P81  AI9 ASP D 132 ? SER D 150 ? ASP D 104 SER D 122 1 ? 19 
HELX_P HELX_P82  AJ1 SER D 167 ? ALA D 175 ? SER D 139 ALA D 147 1 ? 9  
HELX_P HELX_P83  AJ2 THR D 220 ? CYS D 226 ? THR D 192 CYS D 198 1 ? 7  
HELX_P HELX_P84  AJ3 ALA D 239 ? ARG D 241 ? ALA D 211 ARG D 213 5 ? 3  
HELX_P HELX_P85  AJ4 CYS D 242 ? GLN D 248 ? CYS D 214 GLN D 220 1 ? 7  
HELX_P HELX_P86  AJ5 PRO D 254 ? ARG D 258 ? PRO D 226 ARG D 230 5 ? 5  
HELX_P HELX_P87  AJ6 ASP D 269 ? VAL D 274 ? ASP D 241 VAL D 246 1 ? 6  
HELX_P HELX_P88  AJ7 CYS D 275 ? LYS D 279 ? CYS D 247 LYS D 251 5 ? 5  
HELX_P HELX_P89  AJ8 HIS D 286 ? GLU D 290 ? HIS D 258 GLU D 262 5 ? 5  
HELX_P HELX_P90  AJ9 ASP D 292 ? LYS D 297 ? ASP D 264 LYS D 269 1 ? 6  
HELX_P HELX_P91  AK1 LEU D 299 ? ALA D 305 ? LEU D 271 ALA D 277 1 ? 7  
HELX_P HELX_P92  AK2 SER D 307 ? GLY D 316 ? SER D 279 GLY D 288 1 ? 10 
HELX_P HELX_P93  AK3 VAL D 318 ? TRP D 322 ? VAL D 290 TRP D 294 5 ? 5  
HELX_P HELX_P94  AK4 GLY D 324 ? PHE D 339 ? GLY D 296 PHE D 311 1 ? 16 
HELX_P HELX_P95  AK5 ASP D 341 ? SER D 343 ? ASP D 313 SER D 315 5 ? 3  
HELX_P HELX_P96  AK6 ALA D 344 ? ASP D 355 ? ALA D 316 ASP D 327 1 ? 12 
HELX_P HELX_P97  AK7 ARG D 357 ? GLY D 372 ? ARG D 329 GLY D 344 1 ? 16 
HELX_P HELX_P98  AK8 ASP D 373 ? ALA D 375 ? ASP D 345 ALA D 347 5 ? 3  
HELX_P HELX_P99  AK9 TYR D 376 ? GLU D 387 ? TYR D 348 GLU D 359 1 ? 12 
HELX_P HELX_P100 AL1 ASP D 389 ? ALA D 405 ? ASP D 361 ALA D 377 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 216 SG ? ? ? 1_555 G  SF4 .  FE4 ? ? A CYS 188 A SF4 501 1_555 ? ? ? ? ? ? ?             2.238 ? 
metalc2  metalc ? ? A CYS 219 SG ? ? ? 1_555 G  SF4 .  FE2 ? ? A CYS 191 A SF4 501 1_555 ? ? ? ? ? ? ?             2.291 ? 
metalc3  metalc ? ? A CYS 222 SG ? ? ? 1_555 G  SF4 .  FE1 ? ? A CYS 194 A SF4 501 1_555 ? ? ? ? ? ? ?             2.304 ? 
metalc4  metalc ? ? A CYS 226 SG ? ? ? 1_555 H  SF4 .  FE1 ? ? A CYS 198 A SF4 502 1_555 ? ? ? ? ? ? ?             2.294 ? 
metalc5  metalc ? ? A CYS 242 SG ? ? ? 1_555 H  SF4 .  FE4 ? ? A CYS 214 A SF4 502 1_555 ? ? ? ? ? ? ?             2.279 ? 
metalc6  metalc ? ? A CYS 268 SG ? ? ? 1_555 H  SF4 .  FE3 ? ? A CYS 240 A SF4 502 1_555 ? ? ? ? ? ? ?             2.289 ? 
metalc7  metalc ? ? A CYS 271 SG ? ? ? 1_555 H  SF4 .  FE2 ? ? A CYS 243 A SF4 502 1_555 ? ? ? ? ? ? ?             2.304 ? 
metalc8  metalc ? ? A CYS 275 SG ? ? ? 1_555 G  SF4 .  FE3 ? ? A CYS 247 A SF4 501 1_555 ? ? ? ? ? ? ?             2.283 ? 
metalc9  metalc ? ? B CYS 216 SG ? ? ? 1_555 L  SF4 .  FE4 ? ? B CYS 188 B SF4 501 1_555 ? ? ? ? ? ? ?             2.205 ? 
metalc10 metalc ? ? B CYS 219 SG ? ? ? 1_555 L  SF4 .  FE2 ? ? B CYS 191 B SF4 501 1_555 ? ? ? ? ? ? ?             2.313 ? 
metalc11 metalc ? ? B CYS 222 SG ? ? ? 1_555 L  SF4 .  FE1 ? ? B CYS 194 B SF4 501 1_555 ? ? ? ? ? ? ?             2.328 ? 
metalc12 metalc ? ? B CYS 226 SG ? ? ? 1_555 M  SF4 .  FE1 ? ? B CYS 198 B SF4 502 1_555 ? ? ? ? ? ? ?             2.318 ? 
metalc13 metalc ? ? B CYS 242 SG ? ? ? 1_555 M  SF4 .  FE4 ? ? B CYS 214 B SF4 502 1_555 ? ? ? ? ? ? ?             2.268 ? 
metalc14 metalc ? ? B CYS 268 SG ? ? ? 1_555 M  SF4 .  FE3 ? ? B CYS 240 B SF4 502 1_555 ? ? ? ? ? ? ?             2.307 ? 
metalc15 metalc ? ? B CYS 271 SG ? ? ? 1_555 M  SF4 .  FE2 ? ? B CYS 243 B SF4 502 1_555 ? ? ? ? ? ? ?             2.285 ? 
metalc16 metalc ? ? B CYS 275 SG ? ? ? 1_555 L  SF4 .  FE3 ? ? B CYS 247 B SF4 501 1_555 ? ? ? ? ? ? ?             2.290 ? 
metalc17 metalc ? ? C CYS 216 SG ? ? ? 1_555 Q  SF4 .  FE4 ? ? C CYS 188 C SF4 501 1_555 ? ? ? ? ? ? ?             2.285 ? 
metalc18 metalc ? ? C CYS 219 SG ? ? ? 1_555 Q  SF4 .  FE2 ? ? C CYS 191 C SF4 501 1_555 ? ? ? ? ? ? ?             2.275 ? 
metalc19 metalc ? ? C CYS 222 SG ? ? ? 1_555 Q  SF4 .  FE1 ? ? C CYS 194 C SF4 501 1_555 ? ? ? ? ? ? ?             2.303 ? 
metalc20 metalc ? ? C CYS 226 SG ? ? ? 1_555 R  SF4 .  FE1 ? ? C CYS 198 C SF4 502 1_555 ? ? ? ? ? ? ?             2.292 ? 
metalc21 metalc ? ? C CYS 242 SG ? ? ? 1_555 R  SF4 .  FE4 ? ? C CYS 214 C SF4 502 1_555 ? ? ? ? ? ? ?             2.266 ? 
metalc22 metalc ? ? C CYS 268 SG ? ? ? 1_555 R  SF4 .  FE3 ? ? C CYS 240 C SF4 502 1_555 ? ? ? ? ? ? ?             2.277 ? 
metalc23 metalc ? ? C CYS 271 SG ? ? ? 1_555 R  SF4 .  FE2 ? ? C CYS 243 C SF4 502 1_555 ? ? ? ? ? ? ?             2.296 ? 
metalc24 metalc ? ? C CYS 275 SG ? ? ? 1_555 Q  SF4 .  FE3 ? ? C CYS 247 C SF4 501 1_555 ? ? ? ? ? ? ?             2.258 ? 
metalc25 metalc ? ? D CYS 216 SG ? ? ? 1_555 V  SF4 .  FE4 ? ? D CYS 188 D SF4 501 1_555 ? ? ? ? ? ? ?             2.296 ? 
metalc26 metalc ? ? D CYS 219 SG ? ? ? 1_555 V  SF4 .  FE2 ? ? D CYS 191 D SF4 501 1_555 ? ? ? ? ? ? ?             2.262 ? 
metalc27 metalc ? ? D CYS 222 SG ? ? ? 1_555 V  SF4 .  FE1 ? ? D CYS 194 D SF4 501 1_555 ? ? ? ? ? ? ?             2.317 ? 
metalc28 metalc ? ? D CYS 226 SG ? ? ? 1_555 W  SF4 .  FE1 ? ? D CYS 198 D SF4 502 1_555 ? ? ? ? ? ? ?             2.288 ? 
metalc29 metalc ? ? D CYS 242 SG ? ? ? 1_555 W  SF4 .  FE4 ? ? D CYS 214 D SF4 502 1_555 ? ? ? ? ? ? ?             2.284 ? 
metalc30 metalc ? ? D CYS 268 SG ? ? ? 1_555 W  SF4 .  FE3 ? ? D CYS 240 D SF4 502 1_555 ? ? ? ? ? ? ?             2.277 ? 
metalc31 metalc ? ? D CYS 271 SG ? ? ? 1_555 W  SF4 .  FE2 ? ? D CYS 243 D SF4 502 1_555 ? ? ? ? ? ? ?             2.316 ? 
metalc32 metalc ? ? D CYS 275 SG ? ? ? 1_555 V  SF4 .  FE3 ? ? D CYS 247 D SF4 501 1_555 ? ? ? ? ? ? ?             2.276 ? 
metalc33 metalc ? ? I B12 .   CO ? ? ? 1_555 AA HOH .  O   ? ? A B12 503 A HOH 652 1_555 ? ? ? ? ? ? ?             2.620 ? 
metalc34 metalc ? ? N B12 .   CO ? ? ? 1_555 BA HOH .  O   ? ? B B12 503 B HOH 677 1_555 ? ? ? ? ? ? ?             2.578 ? 
metalc35 metalc ? ? S B12 .   CO ? ? ? 1_555 CA HOH .  O   ? ? C B12 503 C HOH 678 1_555 ? ? ? ? ? ? ?             2.544 ? 
metalc36 metalc ? ? X B12 .   CO ? ? ? 1_555 DA HOH .  O   ? ? D B12 503 D HOH 693 1_555 ? ? ? ? ? ? ?             2.558 ? 
hydrog1  hydrog ? ? E A   3   N1 ? ? ? 1_555 E  U   15 N3  ? ? E A   29  E U   41  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog2  hydrog ? ? E A   3   N6 ? ? ? 1_555 E  U   15 O4  ? ? E A   29  E U   41  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog3  hydrog ? ? E G   4   N1 ? ? ? 1_555 E  C   14 N3  ? ? E G   30  E C   40  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog4  hydrog ? ? E G   4   N2 ? ? ? 1_555 E  C   14 O2  ? ? E G   30  E C   40  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog5  hydrog ? ? E G   4   O6 ? ? ? 1_555 E  C   14 N4  ? ? E G   30  E C   40  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog6  hydrog ? ? E A   5   N1 ? ? ? 1_555 E  U   13 N3  ? ? E A   31  E U   39  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog7  hydrog ? ? E A   5   N6 ? ? ? 1_555 E  U   13 O4  ? ? E A   31  E U   39  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog8  hydrog ? ? E C   6   N3 ? ? ? 1_555 E  A   12 N6  ? ? E C   32  E A   38  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ?     ? 
hydrog9  hydrog ? ? E U   7   O2 ? ? ? 1_555 E  A   11 N6  ? ? E U   33  E A   37  1_555 ? ? ? ? ? ? 'U-A PAIR'    ?     ? 
hydrog10 hydrog ? ? F G   1   N1 ? ? ? 1_555 F  C   17 N3  ? ? F G   27  F C   43  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog11 hydrog ? ? F G   1   N2 ? ? ? 1_555 F  C   17 O2  ? ? F G   27  F C   43  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog12 hydrog ? ? F G   1   O6 ? ? ? 1_555 F  C   17 N4  ? ? F G   27  F C   43  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog13 hydrog ? ? F C   2   N3 ? ? ? 1_555 F  G   16 N1  ? ? F C   28  F G   42  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog14 hydrog ? ? F C   2   N4 ? ? ? 1_555 F  G   16 O6  ? ? F C   28  F G   42  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog15 hydrog ? ? F C   2   O2 ? ? ? 1_555 F  G   16 N2  ? ? F C   28  F G   42  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog16 hydrog ? ? F A   3   N1 ? ? ? 1_555 F  U   15 N3  ? ? F A   29  F U   41  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog17 hydrog ? ? F A   3   N6 ? ? ? 1_555 F  U   15 O4  ? ? F A   29  F U   41  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog18 hydrog ? ? F G   4   N1 ? ? ? 1_555 F  C   14 N3  ? ? F G   30  F C   40  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog19 hydrog ? ? F G   4   N2 ? ? ? 1_555 F  C   14 O2  ? ? F G   30  F C   40  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog20 hydrog ? ? F G   4   O6 ? ? ? 1_555 F  C   14 N4  ? ? F G   30  F C   40  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog21 hydrog ? ? F A   5   N1 ? ? ? 1_555 F  U   13 N3  ? ? F A   31  F U   39  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog22 hydrog ? ? F A   5   N6 ? ? ? 1_555 F  U   13 O4  ? ? F A   31  F U   39  1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog23 hydrog ? ? F C   6   N3 ? ? ? 1_555 F  A   12 N6  ? ? F C   32  F A   38  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 4 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
AB6 ? 2 ? 
AB7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? parallel      
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? parallel      
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 49  ? THR A 54  ? LYS A 21  THR A 26  
AA1 2 SER A 97  ? ALA A 104 ? SER A 69  ALA A 76  
AA1 3 VAL A 195 ? THR A 202 ? VAL A 167 THR A 174 
AA1 4 THR A 157 ? MET A 160 ? THR A 129 MET A 132 
AA2 1 ILE A 123 ? PHE A 124 ? ILE A 95  PHE A 96  
AA2 2 ARG A 264 ? TYR A 266 ? ARG A 236 TYR A 238 
AA3 1 PHE A 179 ? SER A 180 ? PHE A 151 SER A 152 
AA3 2 ILE A 186 ? THR A 187 ? ILE A 158 THR A 159 
AA4 1 LEU A 231 ? ASN A 233 ? LEU A 203 ASN A 205 
AA4 2 GLN A 236 ? LEU A 237 ? GLN A 208 LEU A 209 
AA5 1 LYS B 49  ? THR B 54  ? LYS B 21  THR B 26  
AA5 2 SER B 97  ? ALA B 104 ? SER B 69  ALA B 76  
AA5 3 VAL B 195 ? THR B 202 ? VAL B 167 THR B 174 
AA5 4 THR B 157 ? MET B 160 ? THR B 129 MET B 132 
AA6 1 ILE B 123 ? PHE B 124 ? ILE B 95  PHE B 96  
AA6 2 ARG B 264 ? TYR B 266 ? ARG B 236 TYR B 238 
AA7 1 PHE B 179 ? SER B 180 ? PHE B 151 SER B 152 
AA7 2 ILE B 186 ? THR B 187 ? ILE B 158 THR B 159 
AA8 1 LEU B 231 ? ASN B 233 ? LEU B 203 ASN B 205 
AA8 2 GLN B 236 ? LEU B 237 ? GLN B 208 LEU B 209 
AA9 1 LYS C 49  ? THR C 54  ? LYS C 21  THR C 26  
AA9 2 SER C 97  ? ALA C 104 ? SER C 69  ALA C 76  
AA9 3 VAL C 195 ? THR C 202 ? VAL C 167 THR C 174 
AA9 4 THR C 157 ? MET C 160 ? THR C 129 MET C 132 
AB1 1 ILE C 123 ? PHE C 124 ? ILE C 95  PHE C 96  
AB1 2 ARG C 264 ? TYR C 266 ? ARG C 236 TYR C 238 
AB2 1 PHE C 179 ? SER C 180 ? PHE C 151 SER C 152 
AB2 2 ILE C 186 ? THR C 187 ? ILE C 158 THR C 159 
AB3 1 LEU C 231 ? ASN C 233 ? LEU C 203 ASN C 205 
AB3 2 GLN C 236 ? LEU C 237 ? GLN C 208 LEU C 209 
AB4 1 LYS D 49  ? THR D 54  ? LYS D 21  THR D 26  
AB4 2 SER D 97  ? ALA D 104 ? SER D 69  ALA D 76  
AB4 3 VAL D 195 ? THR D 202 ? VAL D 167 THR D 174 
AB4 4 THR D 157 ? MET D 160 ? THR D 129 MET D 132 
AB5 1 ILE D 123 ? PHE D 124 ? ILE D 95  PHE D 96  
AB5 2 ARG D 264 ? TYR D 266 ? ARG D 236 TYR D 238 
AB6 1 PHE D 179 ? SER D 180 ? PHE D 151 SER D 152 
AB6 2 ILE D 186 ? THR D 187 ? ILE D 158 THR D 159 
AB7 1 LEU D 231 ? ASN D 233 ? LEU D 203 ASN D 205 
AB7 2 GLN D 236 ? LEU D 237 ? GLN D 208 LEU D 209 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR A 53  ? N THR A 25  O ILE A 98  ? O ILE A 70  
AA1 2 3 N VAL A 99  ? N VAL A 71  O MET A 200 ? O MET A 172 
AA1 3 4 O ILE A 201 ? O ILE A 173 N LYS A 158 ? N LYS A 130 
AA2 1 2 N ILE A 123 ? N ILE A 95  O LEU A 265 ? O LEU A 237 
AA3 1 2 N PHE A 179 ? N PHE A 151 O THR A 187 ? O THR A 159 
AA4 1 2 N ASN A 233 ? N ASN A 205 O GLN A 236 ? O GLN A 208 
AA5 1 2 N THR B 53  ? N THR B 25  O ILE B 98  ? O ILE B 70  
AA5 2 3 N LEU B 103 ? N LEU B 75  O TYR B 196 ? O TYR B 168 
AA5 3 4 O ILE B 201 ? O ILE B 173 N LYS B 158 ? N LYS B 130 
AA6 1 2 N ILE B 123 ? N ILE B 95  O LEU B 265 ? O LEU B 237 
AA7 1 2 N PHE B 179 ? N PHE B 151 O THR B 187 ? O THR B 159 
AA8 1 2 N ASN B 233 ? N ASN B 205 O GLN B 236 ? O GLN B 208 
AA9 1 2 N THR C 53  ? N THR C 25  O ILE C 98  ? O ILE C 70  
AA9 2 3 N VAL C 99  ? N VAL C 71  O MET C 200 ? O MET C 172 
AA9 3 4 O ILE C 201 ? O ILE C 173 N LYS C 158 ? N LYS C 130 
AB1 1 2 N ILE C 123 ? N ILE C 95  O LEU C 265 ? O LEU C 237 
AB2 1 2 N PHE C 179 ? N PHE C 151 O THR C 187 ? O THR C 159 
AB3 1 2 N ASN C 233 ? N ASN C 205 O GLN C 236 ? O GLN C 208 
AB4 1 2 N THR D 53  ? N THR D 25  O ILE D 98  ? O ILE D 70  
AB4 2 3 N ILE D 101 ? N ILE D 73  O ALA D 198 ? O ALA D 170 
AB4 3 4 O ILE D 201 ? O ILE D 173 N LYS D 158 ? N LYS D 130 
AB5 1 2 N ILE D 123 ? N ILE D 95  O LEU D 265 ? O LEU D 237 
AB6 1 2 N PHE D 179 ? N PHE D 151 O THR D 187 ? O THR D 159 
AB7 1 2 N ASN D 233 ? N ASN D 205 O GLN D 236 ? O GLN D 208 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SF4 501 ? 8  'binding site for residue SF4 A 501' 
AC2 Software A SF4 502 ? 8  'binding site for residue SF4 A 502' 
AC3 Software A B12 503 ? 38 'binding site for residue B12 A 503' 
AC4 Software A GOL 504 ? 7  'binding site for residue GOL A 504' 
AC5 Software A PO4 505 ? 6  'binding site for residue PO4 A 505' 
AC6 Software B SF4 501 ? 7  'binding site for residue SF4 B 501' 
AC7 Software B SF4 502 ? 8  'binding site for residue SF4 B 502' 
AC8 Software B B12 503 ? 35 'binding site for residue B12 B 503' 
AC9 Software B GOL 504 ? 6  'binding site for residue GOL B 504' 
AD1 Software B PO4 505 ? 4  'binding site for residue PO4 B 505' 
AD2 Software C SF4 501 ? 7  'binding site for residue SF4 C 501' 
AD3 Software C SF4 502 ? 7  'binding site for residue SF4 C 502' 
AD4 Software C B12 503 ? 38 'binding site for residue B12 C 503' 
AD5 Software C GOL 504 ? 7  'binding site for residue GOL C 504' 
AD6 Software C PO4 505 ? 4  'binding site for residue PO4 C 505' 
AD7 Software D SF4 501 ? 8  'binding site for residue SF4 D 501' 
AD8 Software D SF4 502 ? 6  'binding site for residue SF4 D 502' 
AD9 Software D B12 503 ? 36 'binding site for residue B12 D 503' 
AE1 Software D GOL 504 ? 7  'binding site for residue GOL D 504' 
AE2 Software D PO4 505 ? 5  'binding site for residue PO4 D 505' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 8  ALA A  181 ? ALA A 153 . ? 1_555 ? 
2   AC1 8  LYS A  182 ? LYS A 154 . ? 1_555 ? 
3   AC1 8  ASN A  183 ? ASN A 155 . ? 1_555 ? 
4   AC1 8  CYS A  216 ? CYS A 188 . ? 1_555 ? 
5   AC1 8  CYS A  219 ? CYS A 191 . ? 1_555 ? 
6   AC1 8  CYS A  222 ? CYS A 194 . ? 1_555 ? 
7   AC1 8  CYS A  275 ? CYS A 247 . ? 1_555 ? 
8   AC1 8  LEU A  277 ? LEU A 249 . ? 1_555 ? 
9   AC2 8  CYS A  226 ? CYS A 198 . ? 1_555 ? 
10  AC2 8  PRO A  227 ? PRO A 199 . ? 1_555 ? 
11  AC2 8  LEU A  237 ? LEU A 209 . ? 1_555 ? 
12  AC2 8  CYS A  242 ? CYS A 214 . ? 1_555 ? 
13  AC2 8  ILE A  243 ? ILE A 215 . ? 1_555 ? 
14  AC2 8  CYS A  268 ? CYS A 240 . ? 1_555 ? 
15  AC2 8  THR A  270 ? THR A 242 . ? 1_555 ? 
16  AC2 8  CYS A  271 ? CYS A 243 . ? 1_555 ? 
17  AC3 38 SER A  60  ? SER A 32  . ? 1_555 ? 
18  AC3 38 LEU A  61  ? LEU A 33  . ? 1_555 ? 
19  AC3 38 ARG A  64  ? ARG A 36  . ? 1_555 ? 
20  AC3 38 SER A  75  ? SER A 47  . ? 1_555 ? 
21  AC3 38 PHE A  77  ? PHE A 49  . ? 1_555 ? 
22  AC3 38 GLU A  78  ? GLU A 50  . ? 1_555 ? 
23  AC3 38 ARG A  85  ? ARG A 57  . ? 1_555 ? 
24  AC3 38 CYS A  125 ? CYS A 97  . ? 1_555 ? 
25  AC3 38 ASP A  162 ? ASP A 134 . ? 1_555 ? 
26  AC3 38 LEU A  166 ? LEU A 138 . ? 1_555 ? 
27  AC3 38 SER A  167 ? SER A 139 . ? 1_555 ? 
28  AC3 38 ASP A  168 ? ASP A 140 . ? 1_555 ? 
29  AC3 38 ARG A  169 ? ARG A 141 . ? 1_555 ? 
30  AC3 38 ALA A  170 ? ALA A 142 . ? 1_555 ? 
31  AC3 38 SER A  180 ? SER A 152 . ? 1_555 ? 
32  AC3 38 ASN A  183 ? ASN A 155 . ? 1_555 ? 
33  AC3 38 CYS A  184 ? CYS A 156 . ? 1_555 ? 
34  AC3 38 MET A  185 ? MET A 157 . ? 1_555 ? 
35  AC3 38 ILE A  186 ? ILE A 158 . ? 1_555 ? 
36  AC3 38 SER A  193 ? SER A 165 . ? 1_555 ? 
37  AC3 38 VAL A  195 ? VAL A 167 . ? 1_555 ? 
38  AC3 38 LEU A  197 ? LEU A 169 . ? 1_555 ? 
39  AC3 38 PRO A  234 ? PRO A 206 . ? 1_555 ? 
40  AC3 38 LEU A  237 ? LEU A 209 . ? 1_555 ? 
41  AC3 38 SER A  244 ? SER A 216 . ? 1_555 ? 
42  AC3 38 PHE A  245 ? PHE A 217 . ? 1_555 ? 
43  AC3 38 GLY A  267 ? GLY A 239 . ? 1_555 ? 
44  AC3 38 CYS A  268 ? CYS A 240 . ? 1_555 ? 
45  AC3 38 ASP A  269 ? ASP A 241 . ? 1_555 ? 
46  AC3 38 CYS A  271 ? CYS A 243 . ? 1_555 ? 
47  AC3 38 GLN A  272 ? GLN A 244 . ? 1_555 ? 
48  AC3 38 HOH AA .   ? HOH A 630 . ? 1_555 ? 
49  AC3 38 HOH AA .   ? HOH A 632 . ? 1_555 ? 
50  AC3 38 HOH AA .   ? HOH A 635 . ? 1_555 ? 
51  AC3 38 HOH AA .   ? HOH A 652 . ? 1_555 ? 
52  AC3 38 HOH AA .   ? HOH A 683 . ? 1_555 ? 
53  AC3 38 HOH AA .   ? HOH A 692 . ? 1_555 ? 
54  AC3 38 HOH AA .   ? HOH A 747 . ? 1_555 ? 
55  AC4 7  PHE A  77  ? PHE A 49  . ? 1_555 ? 
56  AC4 7  ASP A  162 ? ASP A 134 . ? 1_555 ? 
57  AC4 7  GLN A  248 ? GLN A 220 . ? 1_555 ? 
58  AC4 7  TYR A  266 ? TYR A 238 . ? 1_555 ? 
59  AC4 7  TRP A  322 ? TRP A 294 . ? 1_555 ? 
60  AC4 7  HOH AA .   ? HOH A 652 . ? 1_555 ? 
61  AC4 7  HOH AA .   ? HOH A 653 . ? 1_555 ? 
62  AC5 6  LYS A  140 ? LYS A 112 . ? 1_555 ? 
63  AC5 6  HIS A  286 ? HIS A 258 . ? 1_555 ? 
64  AC5 6  PRO A  287 ? PRO A 259 . ? 1_555 ? 
65  AC5 6  GLU A  288 ? GLU A 260 . ? 1_555 ? 
66  AC5 6  HOH AA .   ? HOH A 639 . ? 1_555 ? 
67  AC5 6  HOH AA .   ? HOH A 682 . ? 1_555 ? 
68  AC6 7  ALA B  181 ? ALA B 153 . ? 1_555 ? 
69  AC6 7  LYS B  182 ? LYS B 154 . ? 1_555 ? 
70  AC6 7  ASN B  183 ? ASN B 155 . ? 1_555 ? 
71  AC6 7  CYS B  216 ? CYS B 188 . ? 1_555 ? 
72  AC6 7  CYS B  219 ? CYS B 191 . ? 1_555 ? 
73  AC6 7  CYS B  222 ? CYS B 194 . ? 1_555 ? 
74  AC6 7  CYS B  275 ? CYS B 247 . ? 1_555 ? 
75  AC7 8  CYS B  226 ? CYS B 198 . ? 1_555 ? 
76  AC7 8  LEU B  231 ? LEU B 203 . ? 1_555 ? 
77  AC7 8  LEU B  237 ? LEU B 209 . ? 1_555 ? 
78  AC7 8  CYS B  242 ? CYS B 214 . ? 1_555 ? 
79  AC7 8  ILE B  243 ? ILE B 215 . ? 1_555 ? 
80  AC7 8  CYS B  268 ? CYS B 240 . ? 1_555 ? 
81  AC7 8  THR B  270 ? THR B 242 . ? 1_555 ? 
82  AC7 8  CYS B  271 ? CYS B 243 . ? 1_555 ? 
83  AC8 35 SER B  60  ? SER B 32  . ? 1_555 ? 
84  AC8 35 LEU B  61  ? LEU B 33  . ? 1_555 ? 
85  AC8 35 ARG B  64  ? ARG B 36  . ? 1_555 ? 
86  AC8 35 SER B  75  ? SER B 47  . ? 1_555 ? 
87  AC8 35 GLU B  78  ? GLU B 50  . ? 1_555 ? 
88  AC8 35 ARG B  85  ? ARG B 57  . ? 1_555 ? 
89  AC8 35 CYS B  125 ? CYS B 97  . ? 1_555 ? 
90  AC8 35 ASP B  162 ? ASP B 134 . ? 1_555 ? 
91  AC8 35 LEU B  166 ? LEU B 138 . ? 1_555 ? 
92  AC8 35 SER B  167 ? SER B 139 . ? 1_555 ? 
93  AC8 35 ASP B  168 ? ASP B 140 . ? 1_555 ? 
94  AC8 35 ARG B  169 ? ARG B 141 . ? 1_555 ? 
95  AC8 35 SER B  180 ? SER B 152 . ? 1_555 ? 
96  AC8 35 ASN B  183 ? ASN B 155 . ? 1_555 ? 
97  AC8 35 CYS B  184 ? CYS B 156 . ? 1_555 ? 
98  AC8 35 MET B  185 ? MET B 157 . ? 1_555 ? 
99  AC8 35 ILE B  186 ? ILE B 158 . ? 1_555 ? 
100 AC8 35 SER B  193 ? SER B 165 . ? 1_555 ? 
101 AC8 35 VAL B  195 ? VAL B 167 . ? 1_555 ? 
102 AC8 35 LEU B  197 ? LEU B 169 . ? 1_555 ? 
103 AC8 35 PRO B  234 ? PRO B 206 . ? 1_555 ? 
104 AC8 35 GLY B  235 ? GLY B 207 . ? 1_555 ? 
105 AC8 35 LEU B  237 ? LEU B 209 . ? 1_555 ? 
106 AC8 35 SER B  244 ? SER B 216 . ? 1_555 ? 
107 AC8 35 GLY B  267 ? GLY B 239 . ? 1_555 ? 
108 AC8 35 CYS B  268 ? CYS B 240 . ? 1_555 ? 
109 AC8 35 ASP B  269 ? ASP B 241 . ? 1_555 ? 
110 AC8 35 CYS B  271 ? CYS B 243 . ? 1_555 ? 
111 AC8 35 GLN B  272 ? GLN B 244 . ? 1_555 ? 
112 AC8 35 HOH BA .   ? HOH B 616 . ? 1_555 ? 
113 AC8 35 HOH BA .   ? HOH B 628 . ? 1_555 ? 
114 AC8 35 HOH BA .   ? HOH B 640 . ? 1_555 ? 
115 AC8 35 HOH BA .   ? HOH B 643 . ? 1_555 ? 
116 AC8 35 HOH BA .   ? HOH B 668 . ? 1_555 ? 
117 AC8 35 HOH BA .   ? HOH B 677 . ? 1_555 ? 
118 AC9 6  ASP B  162 ? ASP B 134 . ? 1_555 ? 
119 AC9 6  GLN B  248 ? GLN B 220 . ? 1_555 ? 
120 AC9 6  TYR B  266 ? TYR B 238 . ? 1_555 ? 
121 AC9 6  TRP B  322 ? TRP B 294 . ? 1_555 ? 
122 AC9 6  HOH BA .   ? HOH B 657 . ? 1_555 ? 
123 AC9 6  HOH BA .   ? HOH B 677 . ? 1_555 ? 
124 AD1 4  LYS B  140 ? LYS B 112 . ? 1_555 ? 
125 AD1 4  HIS B  286 ? HIS B 258 . ? 1_555 ? 
126 AD1 4  PRO B  287 ? PRO B 259 . ? 1_555 ? 
127 AD1 4  GLU B  288 ? GLU B 260 . ? 1_555 ? 
128 AD2 7  ALA C  181 ? ALA C 153 . ? 1_555 ? 
129 AD2 7  LYS C  182 ? LYS C 154 . ? 1_555 ? 
130 AD2 7  ASN C  183 ? ASN C 155 . ? 1_555 ? 
131 AD2 7  CYS C  216 ? CYS C 188 . ? 1_555 ? 
132 AD2 7  CYS C  219 ? CYS C 191 . ? 1_555 ? 
133 AD2 7  CYS C  222 ? CYS C 194 . ? 1_555 ? 
134 AD2 7  CYS C  275 ? CYS C 247 . ? 1_555 ? 
135 AD3 7  CYS C  226 ? CYS C 198 . ? 1_555 ? 
136 AD3 7  LEU C  237 ? LEU C 209 . ? 1_555 ? 
137 AD3 7  CYS C  242 ? CYS C 214 . ? 1_555 ? 
138 AD3 7  ILE C  243 ? ILE C 215 . ? 1_555 ? 
139 AD3 7  CYS C  268 ? CYS C 240 . ? 1_555 ? 
140 AD3 7  THR C  270 ? THR C 242 . ? 1_555 ? 
141 AD3 7  CYS C  271 ? CYS C 243 . ? 1_555 ? 
142 AD4 38 SER C  60  ? SER C 32  . ? 1_555 ? 
143 AD4 38 LEU C  61  ? LEU C 33  . ? 1_555 ? 
144 AD4 38 ARG C  64  ? ARG C 36  . ? 1_555 ? 
145 AD4 38 SER C  75  ? SER C 47  . ? 1_555 ? 
146 AD4 38 PHE C  77  ? PHE C 49  . ? 1_555 ? 
147 AD4 38 GLU C  78  ? GLU C 50  . ? 1_555 ? 
148 AD4 38 ARG C  85  ? ARG C 57  . ? 1_555 ? 
149 AD4 38 CYS C  125 ? CYS C 97  . ? 1_555 ? 
150 AD4 38 ASP C  162 ? ASP C 134 . ? 1_555 ? 
151 AD4 38 LEU C  166 ? LEU C 138 . ? 1_555 ? 
152 AD4 38 SER C  167 ? SER C 139 . ? 1_555 ? 
153 AD4 38 ASP C  168 ? ASP C 140 . ? 1_555 ? 
154 AD4 38 ARG C  169 ? ARG C 141 . ? 1_555 ? 
155 AD4 38 GLU C  173 ? GLU C 145 . ? 1_555 ? 
156 AD4 38 SER C  180 ? SER C 152 . ? 1_555 ? 
157 AD4 38 ASN C  183 ? ASN C 155 . ? 1_555 ? 
158 AD4 38 CYS C  184 ? CYS C 156 . ? 1_555 ? 
159 AD4 38 MET C  185 ? MET C 157 . ? 1_555 ? 
160 AD4 38 ILE C  186 ? ILE C 158 . ? 1_555 ? 
161 AD4 38 SER C  193 ? SER C 165 . ? 1_555 ? 
162 AD4 38 VAL C  195 ? VAL C 167 . ? 1_555 ? 
163 AD4 38 LEU C  197 ? LEU C 169 . ? 1_555 ? 
164 AD4 38 PRO C  234 ? PRO C 206 . ? 1_555 ? 
165 AD4 38 GLY C  235 ? GLY C 207 . ? 1_555 ? 
166 AD4 38 LEU C  237 ? LEU C 209 . ? 1_555 ? 
167 AD4 38 SER C  244 ? SER C 216 . ? 1_555 ? 
168 AD4 38 PHE C  245 ? PHE C 217 . ? 1_555 ? 
169 AD4 38 GLY C  267 ? GLY C 239 . ? 1_555 ? 
170 AD4 38 CYS C  268 ? CYS C 240 . ? 1_555 ? 
171 AD4 38 ASP C  269 ? ASP C 241 . ? 1_555 ? 
172 AD4 38 CYS C  271 ? CYS C 243 . ? 1_555 ? 
173 AD4 38 GLN C  272 ? GLN C 244 . ? 1_555 ? 
174 AD4 38 HOH CA .   ? HOH C 642 . ? 1_555 ? 
175 AD4 38 HOH CA .   ? HOH C 648 . ? 1_555 ? 
176 AD4 38 HOH CA .   ? HOH C 657 . ? 1_555 ? 
177 AD4 38 HOH CA .   ? HOH C 673 . ? 1_555 ? 
178 AD4 38 HOH CA .   ? HOH C 678 . ? 1_555 ? 
179 AD4 38 HOH CA .   ? HOH C 692 . ? 1_555 ? 
180 AD5 7  PHE C  77  ? PHE C 49  . ? 1_555 ? 
181 AD5 7  ASP C  162 ? ASP C 134 . ? 1_555 ? 
182 AD5 7  GLN C  248 ? GLN C 220 . ? 1_555 ? 
183 AD5 7  TYR C  266 ? TYR C 238 . ? 1_555 ? 
184 AD5 7  TRP C  322 ? TRP C 294 . ? 1_555 ? 
185 AD5 7  HOH CA .   ? HOH C 653 . ? 1_555 ? 
186 AD5 7  HOH CA .   ? HOH C 678 . ? 1_555 ? 
187 AD6 4  LYS C  140 ? LYS C 112 . ? 1_555 ? 
188 AD6 4  HIS C  286 ? HIS C 258 . ? 1_555 ? 
189 AD6 4  PRO C  287 ? PRO C 259 . ? 1_555 ? 
190 AD6 4  GLU C  288 ? GLU C 260 . ? 1_555 ? 
191 AD7 8  ALA D  181 ? ALA D 153 . ? 1_555 ? 
192 AD7 8  LYS D  182 ? LYS D 154 . ? 1_555 ? 
193 AD7 8  ASN D  183 ? ASN D 155 . ? 1_555 ? 
194 AD7 8  CYS D  216 ? CYS D 188 . ? 1_555 ? 
195 AD7 8  CYS D  219 ? CYS D 191 . ? 1_555 ? 
196 AD7 8  CYS D  222 ? CYS D 194 . ? 1_555 ? 
197 AD7 8  CYS D  275 ? CYS D 247 . ? 1_555 ? 
198 AD7 8  LEU D  277 ? LEU D 249 . ? 1_555 ? 
199 AD8 6  CYS D  226 ? CYS D 198 . ? 1_555 ? 
200 AD8 6  LEU D  237 ? LEU D 209 . ? 1_555 ? 
201 AD8 6  CYS D  242 ? CYS D 214 . ? 1_555 ? 
202 AD8 6  ILE D  243 ? ILE D 215 . ? 1_555 ? 
203 AD8 6  CYS D  268 ? CYS D 240 . ? 1_555 ? 
204 AD8 6  CYS D  271 ? CYS D 243 . ? 1_555 ? 
205 AD9 36 SER D  60  ? SER D 32  . ? 1_555 ? 
206 AD9 36 LEU D  61  ? LEU D 33  . ? 1_555 ? 
207 AD9 36 ARG D  64  ? ARG D 36  . ? 1_555 ? 
208 AD9 36 SER D  75  ? SER D 47  . ? 1_555 ? 
209 AD9 36 GLU D  78  ? GLU D 50  . ? 1_555 ? 
210 AD9 36 ARG D  85  ? ARG D 57  . ? 1_555 ? 
211 AD9 36 CYS D  125 ? CYS D 97  . ? 1_555 ? 
212 AD9 36 ASP D  162 ? ASP D 134 . ? 1_555 ? 
213 AD9 36 LEU D  166 ? LEU D 138 . ? 1_555 ? 
214 AD9 36 SER D  167 ? SER D 139 . ? 1_555 ? 
215 AD9 36 ASP D  168 ? ASP D 140 . ? 1_555 ? 
216 AD9 36 ARG D  169 ? ARG D 141 . ? 1_555 ? 
217 AD9 36 ALA D  170 ? ALA D 142 . ? 1_555 ? 
218 AD9 36 SER D  180 ? SER D 152 . ? 1_555 ? 
219 AD9 36 ASN D  183 ? ASN D 155 . ? 1_555 ? 
220 AD9 36 CYS D  184 ? CYS D 156 . ? 1_555 ? 
221 AD9 36 ILE D  186 ? ILE D 158 . ? 1_555 ? 
222 AD9 36 SER D  193 ? SER D 165 . ? 1_555 ? 
223 AD9 36 VAL D  195 ? VAL D 167 . ? 1_555 ? 
224 AD9 36 LEU D  197 ? LEU D 169 . ? 1_555 ? 
225 AD9 36 PRO D  234 ? PRO D 206 . ? 1_555 ? 
226 AD9 36 GLY D  235 ? GLY D 207 . ? 1_555 ? 
227 AD9 36 LEU D  237 ? LEU D 209 . ? 1_555 ? 
228 AD9 36 SER D  244 ? SER D 216 . ? 1_555 ? 
229 AD9 36 GLY D  267 ? GLY D 239 . ? 1_555 ? 
230 AD9 36 CYS D  268 ? CYS D 240 . ? 1_555 ? 
231 AD9 36 ASP D  269 ? ASP D 241 . ? 1_555 ? 
232 AD9 36 CYS D  271 ? CYS D 243 . ? 1_555 ? 
233 AD9 36 GLN D  272 ? GLN D 244 . ? 1_555 ? 
234 AD9 36 HOH DA .   ? HOH D 614 . ? 1_555 ? 
235 AD9 36 HOH DA .   ? HOH D 648 . ? 1_555 ? 
236 AD9 36 HOH DA .   ? HOH D 655 . ? 1_555 ? 
237 AD9 36 HOH DA .   ? HOH D 666 . ? 1_555 ? 
238 AD9 36 HOH DA .   ? HOH D 678 . ? 1_555 ? 
239 AD9 36 HOH DA .   ? HOH D 693 . ? 1_555 ? 
240 AD9 36 HOH DA .   ? HOH D 744 . ? 1_555 ? 
241 AE1 7  PHE D  77  ? PHE D 49  . ? 1_555 ? 
242 AE1 7  ASP D  162 ? ASP D 134 . ? 1_555 ? 
243 AE1 7  GLN D  248 ? GLN D 220 . ? 1_555 ? 
244 AE1 7  TYR D  266 ? TYR D 238 . ? 1_555 ? 
245 AE1 7  TRP D  322 ? TRP D 294 . ? 1_555 ? 
246 AE1 7  HOH DA .   ? HOH D 628 . ? 1_555 ? 
247 AE1 7  HOH DA .   ? HOH D 693 . ? 1_555 ? 
248 AE2 5  LYS D  140 ? LYS D 112 . ? 1_555 ? 
249 AE2 5  HIS D  286 ? HIS D 258 . ? 1_555 ? 
250 AE2 5  PRO D  287 ? PRO D 259 . ? 1_555 ? 
251 AE2 5  GLU D  288 ? GLU D 260 . ? 1_555 ? 
252 AE2 5  HOH DA .   ? HOH D 659 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5D0A 
_atom_sites.fract_transf_matrix[1][1]   0.011039 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002936 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008999 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010778 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CO 
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASN A  1 30  ? -31.493 -53.565 -24.060 1.00 42.72  ? 2   ASN A N     1 
ATOM   2     C  CA    . ASN A  1 30  ? -32.844 -53.152 -24.426 1.00 49.02  ? 2   ASN A CA    1 
ATOM   3     C  C     . ASN A  1 30  ? -32.919 -51.642 -24.624 1.00 49.15  ? 2   ASN A C     1 
ATOM   4     O  O     . ASN A  1 30  ? -33.051 -51.171 -25.747 1.00 49.24  ? 2   ASN A O     1 
ATOM   5     C  CB    . ASN A  1 30  ? -33.855 -53.577 -23.366 1.00 57.46  ? 2   ASN A CB    1 
ATOM   6     C  CG    . ASN A  1 30  ? -35.217 -52.937 -23.574 1.00 58.90  ? 2   ASN A CG    1 
ATOM   7     O  OD1   . ASN A  1 30  ? -35.794 -52.339 -22.654 1.00 62.59  ? 2   ASN A OD1   1 
ATOM   8     N  ND2   . ASN A  1 30  ? -35.732 -53.045 -24.792 1.00 50.70  ? 2   ASN A ND2   1 
ATOM   9     N  N     . VAL A  1 31  ? -32.860 -50.897 -23.523 1.00 47.04  ? 3   VAL A N     1 
ATOM   10    C  CA    . VAL A  1 31  ? -32.660 -49.460 -23.594 1.00 46.93  ? 3   VAL A CA    1 
ATOM   11    C  C     . VAL A  1 31  ? -31.277 -49.223 -24.182 1.00 47.91  ? 3   VAL A C     1 
ATOM   12    O  O     . VAL A  1 31  ? -31.090 -48.301 -24.986 1.00 43.58  ? 3   VAL A O     1 
ATOM   13    C  CB    . VAL A  1 31  ? -32.793 -48.764 -22.211 1.00 45.09  ? 3   VAL A CB    1 
ATOM   14    C  CG1   . VAL A  1 31  ? -32.163 -47.379 -22.230 1.00 43.08  ? 3   VAL A CG1   1 
ATOM   15    C  CG2   . VAL A  1 31  ? -34.255 -48.649 -21.819 1.00 45.22  ? 3   VAL A CG2   1 
ATOM   16    N  N     . TYR A  1 32  ? -30.317 -50.070 -23.807 1.00 38.48  ? 4   TYR A N     1 
ATOM   17    C  CA    . TYR A  1 32  ? -28.977 -49.973 -24.369 1.00 44.75  ? 4   TYR A CA    1 
ATOM   18    C  C     . TYR A  1 32  ? -29.038 -50.209 -25.868 1.00 48.19  ? 4   TYR A C     1 
ATOM   19    O  O     . TYR A  1 32  ? -28.306 -49.594 -26.644 1.00 44.96  ? 4   TYR A O     1 
ATOM   20    C  CB    . TYR A  1 32  ? -28.005 -50.978 -23.736 1.00 48.66  ? 4   TYR A CB    1 
ATOM   21    C  CG    . TYR A  1 32  ? -26.656 -50.970 -24.440 1.00 60.60  ? 4   TYR A CG    1 
ATOM   22    C  CD1   . TYR A  1 32  ? -25.861 -49.821 -24.447 1.00 61.77  ? 4   TYR A CD1   1 
ATOM   23    C  CD2   . TYR A  1 32  ? -26.195 -52.087 -25.134 1.00 57.18  ? 4   TYR A CD2   1 
ATOM   24    C  CE1   . TYR A  1 32  ? -24.629 -49.792 -25.103 1.00 66.12  ? 4   TYR A CE1   1 
ATOM   25    C  CE2   . TYR A  1 32  ? -24.965 -52.071 -25.793 1.00 59.32  ? 4   TYR A CE2   1 
ATOM   26    C  CZ    . TYR A  1 32  ? -24.186 -50.924 -25.773 1.00 69.13  ? 4   TYR A CZ    1 
ATOM   27    O  OH    . TYR A  1 32  ? -22.968 -50.909 -26.426 1.00 72.19  ? 4   TYR A OH    1 
ATOM   28    N  N     . GLN A  1 33  ? -29.919 -51.124 -26.258 1.00 49.21  ? 5   GLN A N     1 
ATOM   29    C  CA    . GLN A  1 33  ? -30.081 -51.506 -27.654 1.00 50.16  ? 5   GLN A CA    1 
ATOM   30    C  C     . GLN A  1 33  ? -30.737 -50.384 -28.442 1.00 39.41  ? 5   GLN A C     1 
ATOM   31    O  O     . GLN A  1 33  ? -30.354 -50.101 -29.569 1.00 37.41  ? 5   GLN A O     1 
ATOM   32    C  CB    . GLN A  1 33  ? -30.916 -52.786 -27.757 1.00 47.02  ? 5   GLN A CB    1 
ATOM   33    C  CG    . GLN A  1 33  ? -31.345 -53.171 -29.176 1.00 56.54  ? 5   GLN A CG    1 
ATOM   34    C  CD    . GLN A  1 33  ? -32.476 -54.195 -29.171 1.00 63.68  ? 5   GLN A CD    1 
ATOM   35    O  OE1   . GLN A  1 33  ? -32.608 -54.983 -28.227 1.00 67.94  ? 5   GLN A OE1   1 
ATOM   36    N  NE2   . GLN A  1 33  ? -33.310 -54.172 -30.211 1.00 61.80  ? 5   GLN A NE2   1 
ATOM   37    N  N     . LEU A  1 34  ? -31.747 -49.769 -27.844 1.00 38.56  ? 6   LEU A N     1 
ATOM   38    C  CA    . LEU A  1 34  ? -32.479 -48.707 -28.504 1.00 40.07  ? 6   LEU A CA    1 
ATOM   39    C  C     . LEU A  1 34  ? -31.549 -47.519 -28.708 1.00 38.22  ? 6   LEU A C     1 
ATOM   40    O  O     . LEU A  1 34  ? -31.608 -46.844 -29.738 1.00 38.21  ? 6   LEU A O     1 
ATOM   41    C  CB    . LEU A  1 34  ? -33.706 -48.315 -27.688 1.00 41.53  ? 6   LEU A CB    1 
ATOM   42    C  CG    . LEU A  1 34  ? -34.586 -47.184 -28.206 1.00 41.70  ? 6   LEU A CG    1 
ATOM   43    C  CD1   . LEU A  1 34  ? -35.260 -47.548 -29.521 1.00 39.05  ? 6   LEU A CD1   1 
ATOM   44    C  CD2   . LEU A  1 34  ? -35.614 -46.814 -27.156 1.00 41.47  ? 6   LEU A CD2   1 
ATOM   45    N  N     . LYS A  1 35  ? -30.665 -47.308 -27.737 1.00 38.77  ? 7   LYS A N     1 
ATOM   46    C  CA    . LYS A  1 35  ? -29.701 -46.217 -27.778 1.00 42.36  ? 7   LYS A CA    1 
ATOM   47    C  C     . LYS A  1 35  ? -28.774 -46.410 -28.952 1.00 42.88  ? 7   LYS A C     1 
ATOM   48    O  O     . LYS A  1 35  ? -28.508 -45.468 -29.713 1.00 38.05  ? 7   LYS A O     1 
ATOM   49    C  CB    . LYS A  1 35  ? -28.892 -46.141 -26.476 1.00 42.79  ? 7   LYS A CB    1 
ATOM   50    C  CG    . LYS A  1 35  ? -27.833 -45.047 -26.460 1.00 40.04  ? 7   LYS A CG    1 
ATOM   51    C  CD    . LYS A  1 35  ? -27.120 -44.958 -25.123 1.00 43.94  ? 7   LYS A CD    1 
ATOM   52    C  CE    . LYS A  1 35  ? -25.994 -43.914 -25.161 1.00 45.05  ? 7   LYS A CE    1 
ATOM   53    N  NZ    . LYS A  1 35  ? -25.304 -43.764 -23.836 1.00 41.03  ? 7   LYS A NZ    1 
ATOM   54    N  N     . GLU A  1 36  ? -28.286 -47.641 -29.088 1.00 37.45  ? 8   GLU A N     1 
ATOM   55    C  CA    . GLU A  1 36  ? -27.400 -48.010 -30.182 1.00 38.70  ? 8   GLU A CA    1 
ATOM   56    C  C     . GLU A  1 36  ? -28.038 -47.755 -31.538 1.00 31.22  ? 8   GLU A C     1 
ATOM   57    O  O     . GLU A  1 36  ? -27.390 -47.259 -32.450 1.00 30.73  ? 8   GLU A O     1 
ATOM   58    C  CB    . GLU A  1 36  ? -26.997 -49.486 -30.054 1.00 42.68  ? 8   GLU A CB    1 
ATOM   59    C  CG    . GLU A  1 36  ? -25.851 -49.697 -29.083 1.00 48.98  ? 8   GLU A CG    1 
ATOM   60    C  CD    . GLU A  1 36  ? -24.838 -48.569 -29.170 1.00 58.76  ? 8   GLU A CD    1 
ATOM   61    O  OE1   . GLU A  1 36  ? -24.119 -48.493 -30.190 1.00 61.14  ? 8   GLU A OE1   1 
ATOM   62    O  OE2   . GLU A  1 36  ? -24.782 -47.738 -28.231 1.00 58.38  ? 8   GLU A OE2   1 
ATOM   63    N  N     . GLU A  1 37  ? -29.316 -48.093 -31.656 1.00 31.82  ? 9   GLU A N     1 
ATOM   64    C  CA    . GLU A  1 37  ? -30.043 -47.926 -32.907 1.00 30.01  ? 9   GLU A CA    1 
ATOM   65    C  C     . GLU A  1 37  ? -30.291 -46.454 -33.204 1.00 33.90  ? 9   GLU A C     1 
ATOM   66    O  O     . GLU A  1 37  ? -30.135 -46.000 -34.347 1.00 33.42  ? 9   GLU A O     1 
ATOM   67    C  CB    . GLU A  1 37  ? -31.361 -48.690 -32.839 1.00 34.81  ? 9   GLU A CB    1 
ATOM   68    C  CG    . GLU A  1 37  ? -31.155 -50.217 -32.660 1.00 34.82  ? 9   GLU A CG    1 
ATOM   69    C  CD    . GLU A  1 37  ? -32.454 -50.980 -32.456 1.00 48.16  ? 9   GLU A CD    1 
ATOM   70    O  OE1   . GLU A  1 37  ? -33.533 -50.344 -32.494 1.00 48.49  ? 9   GLU A OE1   1 
ATOM   71    O  OE2   . GLU A  1 37  ? -32.391 -52.222 -32.254 1.00 54.98  ? 9   GLU A OE2   1 
ATOM   72    N  N     . LEU A  1 38  ? -30.677 -45.716 -32.167 1.00 34.85  ? 10  LEU A N     1 
ATOM   73    C  CA    . LEU A  1 38  ? -30.934 -44.287 -32.294 1.00 32.14  ? 10  LEU A CA    1 
ATOM   74    C  C     . LEU A  1 38  ? -29.692 -43.601 -32.842 1.00 29.92  ? 10  LEU A C     1 
ATOM   75    O  O     . LEU A  1 38  ? -29.760 -42.859 -33.832 1.00 35.56  ? 10  LEU A O     1 
ATOM   76    C  CB    . LEU A  1 38  ? -31.352 -43.689 -30.944 1.00 32.24  ? 10  LEU A CB    1 
ATOM   77    C  CG    . LEU A  1 38  ? -31.728 -42.197 -30.975 1.00 39.58  ? 10  LEU A CG    1 
ATOM   78    C  CD1   . LEU A  1 38  ? -32.887 -41.948 -31.948 1.00 31.87  ? 10  LEU A CD1   1 
ATOM   79    C  CD2   . LEU A  1 38  ? -32.055 -41.687 -29.569 1.00 28.45  ? 10  LEU A CD2   1 
ATOM   80    N  N     . ILE A  1 39  ? -28.552 -43.891 -32.221 1.00 27.94  ? 11  ILE A N     1 
ATOM   81    C  CA    . ILE A  1 39  ? -27.280 -43.346 -32.665 1.00 27.50  ? 11  ILE A CA    1 
ATOM   82    C  C     . ILE A  1 39  ? -27.017 -43.654 -34.132 1.00 33.77  ? 11  ILE A C     1 
ATOM   83    O  O     . ILE A  1 39  ? -26.689 -42.754 -34.921 1.00 34.07  ? 11  ILE A O     1 
ATOM   84    C  CB    . ILE A  1 39  ? -26.121 -43.874 -31.823 1.00 30.27  ? 11  ILE A CB    1 
ATOM   85    C  CG1   . ILE A  1 39  ? -26.183 -43.305 -30.393 1.00 34.92  ? 11  ILE A CG1   1 
ATOM   86    C  CG2   . ILE A  1 39  ? -24.794 -43.522 -32.470 1.00 24.73  ? 11  ILE A CG2   1 
ATOM   87    C  CD1   . ILE A  1 39  ? -25.106 -43.897 -29.458 1.00 30.11  ? 11  ILE A CD1   1 
ATOM   88    N  N     . GLU A  1 40  ? -27.162 -44.925 -34.490 1.00 32.65  ? 12  GLU A N     1 
ATOM   89    C  CA    . GLU A  1 40  ? -26.978 -45.374 -35.864 1.00 33.35  ? 12  GLU A CA    1 
ATOM   90    C  C     . GLU A  1 40  ? -27.880 -44.592 -36.829 1.00 26.74  ? 12  GLU A C     1 
ATOM   91    O  O     . GLU A  1 40  ? -27.422 -44.043 -37.829 1.00 33.59  ? 12  GLU A O     1 
ATOM   92    C  CB    . GLU A  1 40  ? -27.259 -46.889 -35.954 1.00 34.39  ? 12  GLU A CB    1 
ATOM   93    C  CG    . GLU A  1 40  ? -26.851 -47.532 -37.285 1.00 44.32  ? 12  GLU A CG    1 
ATOM   94    C  CD    . GLU A  1 40  ? -27.169 -49.033 -37.365 1.00 47.38  ? 12  GLU A CD    1 
ATOM   95    O  OE1   . GLU A  1 40  ? -27.477 -49.663 -36.320 1.00 54.39  ? 12  GLU A OE1   1 
ATOM   96    O  OE2   . GLU A  1 40  ? -27.124 -49.580 -38.484 1.00 53.10  ? 12  GLU A OE2   1 
ATOM   97    N  N     . TYR A  1 41  ? -29.164 -44.539 -36.512 1.00 26.67  ? 13  TYR A N     1 
ATOM   98    C  CA    . TYR A  1 41  ? -30.133 -43.862 -37.352 1.00 29.75  ? 13  TYR A CA    1 
ATOM   99    C  C     . TYR A  1 41  ? -29.847 -42.358 -37.456 1.00 32.78  ? 13  TYR A C     1 
ATOM   100   O  O     . TYR A  1 41  ? -29.900 -41.778 -38.551 1.00 27.16  ? 13  TYR A O     1 
ATOM   101   C  CB    . TYR A  1 41  ? -31.549 -44.107 -36.813 1.00 32.90  ? 13  TYR A CB    1 
ATOM   102   C  CG    . TYR A  1 41  ? -32.643 -43.497 -37.655 1.00 33.09  ? 13  TYR A CG    1 
ATOM   103   C  CD1   . TYR A  1 41  ? -33.585 -42.640 -37.091 1.00 31.30  ? 13  TYR A CD1   1 
ATOM   104   C  CD2   . TYR A  1 41  ? -32.726 -43.761 -39.027 1.00 32.60  ? 13  TYR A CD2   1 
ATOM   105   C  CE1   . TYR A  1 41  ? -34.592 -42.067 -37.865 1.00 30.70  ? 13  TYR A CE1   1 
ATOM   106   C  CE2   . TYR A  1 41  ? -33.723 -43.191 -39.809 1.00 29.70  ? 13  TYR A CE2   1 
ATOM   107   C  CZ    . TYR A  1 41  ? -34.654 -42.350 -39.225 1.00 34.98  ? 13  TYR A CZ    1 
ATOM   108   O  OH    . TYR A  1 41  ? -35.648 -41.790 -39.993 1.00 30.21  ? 13  TYR A OH    1 
ATOM   109   N  N     . ALA A  1 42  ? -29.544 -41.732 -36.315 1.00 31.50  ? 14  ALA A N     1 
ATOM   110   C  CA    . ALA A  1 42  ? -29.227 -40.304 -36.282 1.00 32.57  ? 14  ALA A CA    1 
ATOM   111   C  C     . ALA A  1 42  ? -28.110 -39.958 -37.272 1.00 34.95  ? 14  ALA A C     1 
ATOM   112   O  O     . ALA A  1 42  ? -28.215 -38.996 -38.052 1.00 32.51  ? 14  ALA A O     1 
ATOM   113   C  CB    . ALA A  1 42  ? -28.840 -39.874 -34.866 1.00 30.27  ? 14  ALA A CB    1 
ATOM   114   N  N     . LYS A  1 43  ? -27.049 -40.752 -37.246 1.00 32.97  ? 15  LYS A N     1 
ATOM   115   C  CA    . LYS A  1 43  ? -25.942 -40.582 -38.172 1.00 33.16  ? 15  LYS A CA    1 
ATOM   116   C  C     . LYS A  1 43  ? -26.401 -40.733 -39.621 1.00 33.98  ? 15  LYS A C     1 
ATOM   117   O  O     . LYS A  1 43  ? -25.952 -39.997 -40.500 1.00 32.00  ? 15  LYS A O     1 
ATOM   118   C  CB    . LYS A  1 43  ? -24.832 -41.596 -37.863 1.00 36.31  ? 15  LYS A CB    1 
ATOM   119   C  CG    . LYS A  1 43  ? -24.217 -41.425 -36.478 1.00 43.86  ? 15  LYS A CG    1 
ATOM   120   C  CD    . LYS A  1 43  ? -23.577 -40.034 -36.321 1.00 54.72  ? 15  LYS A CD    1 
ATOM   121   C  CE    . LYS A  1 43  ? -22.929 -39.851 -34.932 1.00 58.46  ? 15  LYS A CE    1 
ATOM   122   N  NZ    . LYS A  1 43  ? -21.841 -40.844 -34.668 1.00 56.93  ? 15  LYS A NZ    1 
ATOM   123   N  N     . SER A  1 44  ? -27.317 -41.667 -39.864 1.00 33.34  ? 16  SER A N     1 
ATOM   124   C  CA    . SER A  1 44  ? -27.706 -41.969 -41.238 1.00 33.00  ? 16  SER A CA    1 
ATOM   125   C  C     . SER A  1 44  ? -28.495 -40.813 -41.865 1.00 34.54  ? 16  SER A C     1 
ATOM   126   O  O     . SER A  1 44  ? -28.463 -40.625 -43.092 1.00 32.64  ? 16  SER A O     1 
ATOM   127   C  CB    . SER A  1 44  ? -28.511 -43.271 -41.300 1.00 30.45  ? 16  SER A CB    1 
ATOM   128   O  OG    . SER A  1 44  ? -29.883 -43.066 -41.017 1.00 30.33  ? 16  SER A OG    1 
ATOM   129   N  N     . ILE A  1 45  ? -29.185 -40.031 -41.029 1.00 28.56  ? 17  ILE A N     1 
ATOM   130   C  CA    . ILE A  1 45  ? -29.979 -38.916 -41.540 1.00 25.90  ? 17  ILE A CA    1 
ATOM   131   C  C     . ILE A  1 45  ? -29.178 -37.617 -41.466 1.00 30.64  ? 17  ILE A C     1 
ATOM   132   O  O     . ILE A  1 45  ? -29.708 -36.536 -41.707 1.00 32.64  ? 17  ILE A O     1 
ATOM   133   C  CB    . ILE A  1 45  ? -31.324 -38.779 -40.794 1.00 33.34  ? 17  ILE A CB    1 
ATOM   134   C  CG1   . ILE A  1 45  ? -31.112 -38.428 -39.306 1.00 28.14  ? 17  ILE A CG1   1 
ATOM   135   C  CG2   . ILE A  1 45  ? -32.140 -40.075 -40.948 1.00 27.80  ? 17  ILE A CG2   1 
ATOM   136   C  CD1   . ILE A  1 45  ? -32.366 -37.921 -38.594 1.00 28.09  ? 17  ILE A CD1   1 
ATOM   137   N  N     . GLY A  1 46  ? -27.893 -37.745 -41.143 1.00 31.99  ? 18  GLY A N     1 
ATOM   138   C  CA    . GLY A  1 46  ? -26.944 -36.654 -41.221 1.00 30.69  ? 18  GLY A CA    1 
ATOM   139   C  C     . GLY A  1 46  ? -26.701 -35.882 -39.929 1.00 34.37  ? 18  GLY A C     1 
ATOM   140   O  O     . GLY A  1 46  ? -26.152 -34.783 -39.959 1.00 34.79  ? 18  GLY A O     1 
ATOM   141   N  N     . VAL A  1 47  ? -27.094 -36.435 -38.792 1.00 32.27  ? 19  VAL A N     1 
ATOM   142   C  CA    . VAL A  1 47  ? -26.740 -35.792 -37.531 1.00 30.26  ? 19  VAL A CA    1 
ATOM   143   C  C     . VAL A  1 47  ? -25.251 -36.037 -37.306 1.00 34.75  ? 19  VAL A C     1 
ATOM   144   O  O     . VAL A  1 47  ? -24.761 -37.153 -37.475 1.00 31.20  ? 19  VAL A O     1 
ATOM   145   C  CB    . VAL A  1 47  ? -27.585 -36.324 -36.378 1.00 31.92  ? 19  VAL A CB    1 
ATOM   146   C  CG1   . VAL A  1 47  ? -27.063 -35.809 -35.055 1.00 31.81  ? 19  VAL A CG1   1 
ATOM   147   C  CG2   . VAL A  1 47  ? -29.049 -35.939 -36.596 1.00 26.07  ? 19  VAL A CG2   1 
ATOM   148   N  N     . ASP A  1 48  ? -24.518 -34.985 -36.962 1.00 30.22  ? 20  ASP A N     1 
ATOM   149   C  CA    . ASP A  1 48  ? -23.062 -35.054 -36.975 1.00 31.83  ? 20  ASP A CA    1 
ATOM   150   C  C     . ASP A  1 48  ? -22.510 -35.483 -35.626 1.00 34.51  ? 20  ASP A C     1 
ATOM   151   O  O     . ASP A  1 48  ? -21.426 -36.057 -35.538 1.00 34.32  ? 20  ASP A O     1 
ATOM   152   C  CB    . ASP A  1 48  ? -22.480 -33.705 -37.393 1.00 30.79  ? 20  ASP A CB    1 
ATOM   153   C  CG    . ASP A  1 48  ? -22.687 -33.429 -38.855 1.00 36.35  ? 20  ASP A CG    1 
ATOM   154   O  OD1   . ASP A  1 48  ? -22.364 -34.322 -39.676 1.00 34.51  ? 20  ASP A OD1   1 
ATOM   155   O  OD2   . ASP A  1 48  ? -23.183 -32.331 -39.198 1.00 34.84  ? 20  ASP A OD2   1 
ATOM   156   N  N     . LYS A  1 49  ? -23.263 -35.195 -34.571 1.00 31.48  ? 21  LYS A N     1 
ATOM   157   C  CA    . LYS A  1 49  ? -22.887 -35.657 -33.249 1.00 34.53  ? 21  LYS A CA    1 
ATOM   158   C  C     . LYS A  1 49  ? -24.142 -35.767 -32.393 1.00 32.54  ? 21  LYS A C     1 
ATOM   159   O  O     . LYS A  1 49  ? -25.050 -34.931 -32.476 1.00 29.10  ? 21  LYS A O     1 
ATOM   160   C  CB    . LYS A  1 49  ? -21.846 -34.732 -32.614 1.00 37.09  ? 21  LYS A CB    1 
ATOM   161   C  CG    . LYS A  1 49  ? -21.053 -35.423 -31.500 1.00 42.39  ? 21  LYS A CG    1 
ATOM   162   C  CD    . LYS A  1 49  ? -19.792 -34.674 -31.112 1.00 40.91  ? 21  LYS A CD    1 
ATOM   163   C  CE    . LYS A  1 49  ? -19.107 -35.358 -29.938 1.00 42.85  ? 21  LYS A CE    1 
ATOM   164   N  NZ    . LYS A  1 49  ? -17.853 -34.664 -29.536 1.00 46.05  ? 21  LYS A NZ    1 
ATOM   165   N  N     . ILE A  1 50  ? -24.209 -36.834 -31.612 1.00 27.01  ? 22  ILE A N     1 
ATOM   166   C  CA    . ILE A  1 50  ? -25.359 -37.080 -30.775 1.00 25.45  ? 22  ILE A CA    1 
ATOM   167   C  C     . ILE A  1 50  ? -24.885 -37.447 -29.365 1.00 31.59  ? 22  ILE A C     1 
ATOM   168   O  O     . ILE A  1 50  ? -23.859 -38.098 -29.197 1.00 30.91  ? 22  ILE A O     1 
ATOM   169   C  CB    . ILE A  1 50  ? -26.255 -38.177 -31.375 1.00 28.45  ? 22  ILE A CB    1 
ATOM   170   C  CG1   . ILE A  1 50  ? -27.496 -38.413 -30.503 1.00 30.02  ? 22  ILE A CG1   1 
ATOM   171   C  CG2   . ILE A  1 50  ? -25.447 -39.459 -31.602 1.00 28.73  ? 22  ILE A CG2   1 
ATOM   172   C  CD1   . ILE A  1 50  ? -28.643 -39.164 -31.230 1.00 26.90  ? 22  ILE A CD1   1 
ATOM   173   N  N     . GLY A  1 51  ? -25.600 -36.964 -28.355 1.00 28.30  ? 23  GLY A N     1 
ATOM   174   C  CA    . GLY A  1 51  ? -25.225 -37.214 -26.977 1.00 29.88  ? 23  GLY A CA    1 
ATOM   175   C  C     . GLY A  1 51  ? -26.435 -37.509 -26.118 1.00 32.19  ? 23  GLY A C     1 
ATOM   176   O  O     . GLY A  1 51  ? -27.586 -37.279 -26.525 1.00 34.10  ? 23  GLY A O     1 
ATOM   177   N  N     . PHE A  1 52  ? -26.181 -38.012 -24.914 1.00 34.06  ? 24  PHE A N     1 
ATOM   178   C  CA    . PHE A  1 52  ? -27.254 -38.348 -23.998 1.00 27.78  ? 24  PHE A CA    1 
ATOM   179   C  C     . PHE A  1 52  ? -26.983 -37.770 -22.623 1.00 32.50  ? 24  PHE A C     1 
ATOM   180   O  O     . PHE A  1 52  ? -25.846 -37.723 -22.150 1.00 33.01  ? 24  PHE A O     1 
ATOM   181   C  CB    . PHE A  1 52  ? -27.448 -39.884 -23.929 1.00 33.79  ? 24  PHE A CB    1 
ATOM   182   C  CG    . PHE A  1 52  ? -27.855 -40.491 -25.251 1.00 32.25  ? 24  PHE A CG    1 
ATOM   183   C  CD1   . PHE A  1 52  ? -29.180 -40.803 -25.508 1.00 32.06  ? 24  PHE A CD1   1 
ATOM   184   C  CD2   . PHE A  1 52  ? -26.917 -40.691 -26.249 1.00 30.71  ? 24  PHE A CD2   1 
ATOM   185   C  CE1   . PHE A  1 52  ? -29.560 -41.343 -26.718 1.00 37.45  ? 24  PHE A CE1   1 
ATOM   186   C  CE2   . PHE A  1 52  ? -27.285 -41.217 -27.491 1.00 34.76  ? 24  PHE A CE2   1 
ATOM   187   C  CZ    . PHE A  1 52  ? -28.611 -41.547 -27.723 1.00 36.24  ? 24  PHE A CZ    1 
ATOM   188   N  N     . THR A  1 53  ? -28.046 -37.311 -21.982 1.00 28.91  ? 25  THR A N     1 
ATOM   189   C  CA    . THR A  1 53  ? -27.943 -36.889 -20.609 1.00 30.33  ? 25  THR A CA    1 
ATOM   190   C  C     . THR A  1 53  ? -29.263 -37.225 -19.929 1.00 31.92  ? 25  THR A C     1 
ATOM   191   O  O     . THR A  1 53  ? -30.244 -37.586 -20.594 1.00 28.05  ? 25  THR A O     1 
ATOM   192   C  CB    . THR A  1 53  ? -27.611 -35.359 -20.507 1.00 34.40  ? 25  THR A CB    1 
ATOM   193   O  OG1   . THR A  1 53  ? -27.538 -34.958 -19.130 1.00 36.15  ? 25  THR A OG1   1 
ATOM   194   C  CG2   . THR A  1 53  ? -28.659 -34.530 -21.216 1.00 29.61  ? 25  THR A CG2   1 
ATOM   195   N  N     . THR A  1 54  ? -29.286 -37.095 -18.608 1.00 35.65  ? 26  THR A N     1 
ATOM   196   C  CA    . THR A  1 54  ? -30.504 -37.276 -17.825 1.00 35.22  ? 26  THR A CA    1 
ATOM   197   C  C     . THR A  1 54  ? -31.483 -36.122 -17.980 1.00 35.12  ? 26  THR A C     1 
ATOM   198   O  O     . THR A  1 54  ? -31.187 -35.113 -18.639 1.00 33.69  ? 26  THR A O     1 
ATOM   199   C  CB    . THR A  1 54  ? -30.177 -37.410 -16.322 1.00 40.40  ? 26  THR A CB    1 
ATOM   200   O  OG1   . THR A  1 54  ? -29.725 -36.132 -15.830 1.00 32.59  ? 26  THR A OG1   1 
ATOM   201   C  CG2   . THR A  1 54  ? -29.095 -38.502 -16.093 1.00 27.40  ? 26  THR A CG2   1 
ATOM   202   N  N     . ALA A  1 55  ? -32.656 -36.266 -17.367 1.00 33.41  ? 27  ALA A N     1 
ATOM   203   C  CA    . ALA A  1 55  ? -33.618 -35.167 -17.325 1.00 33.67  ? 27  ALA A CA    1 
ATOM   204   C  C     . ALA A  1 55  ? -33.560 -34.458 -15.961 1.00 35.79  ? 27  ALA A C     1 
ATOM   205   O  O     . ALA A  1 55  ? -34.542 -33.843 -15.527 1.00 29.34  ? 27  ALA A O     1 
ATOM   206   C  CB    . ALA A  1 55  ? -35.027 -35.674 -17.611 1.00 36.75  ? 27  ALA A CB    1 
ATOM   207   N  N     . ASP A  1 56  ? -32.416 -34.575 -15.287 1.00 29.29  ? 28  ASP A N     1 
ATOM   208   C  CA    . ASP A  1 56  ? -32.195 -33.917 -14.012 1.00 33.22  ? 28  ASP A CA    1 
ATOM   209   C  C     . ASP A  1 56  ? -32.061 -32.395 -14.174 1.00 40.50  ? 28  ASP A C     1 
ATOM   210   O  O     . ASP A  1 56  ? -31.549 -31.899 -15.198 1.00 34.86  ? 28  ASP A O     1 
ATOM   211   C  CB    . ASP A  1 56  ? -30.946 -34.470 -13.335 1.00 32.96  ? 28  ASP A CB    1 
ATOM   212   C  CG    . ASP A  1 56  ? -31.109 -35.929 -12.892 1.00 40.90  ? 28  ASP A CG    1 
ATOM   213   O  OD1   . ASP A  1 56  ? -32.255 -36.433 -12.802 1.00 36.16  ? 28  ASP A OD1   1 
ATOM   214   O  OD2   . ASP A  1 56  ? -30.073 -36.572 -12.642 1.00 41.74  ? 28  ASP A OD2   1 
ATOM   215   N  N     . THR A  1 57  ? -32.503 -31.666 -13.154 1.00 35.81  ? 29  THR A N     1 
ATOM   216   C  CA    . THR A  1 57  ? -32.458 -30.210 -13.175 1.00 36.49  ? 29  THR A CA    1 
ATOM   217   C  C     . THR A  1 57  ? -31.037 -29.698 -13.412 1.00 34.85  ? 29  THR A C     1 
ATOM   218   O  O     . THR A  1 57  ? -30.061 -30.328 -13.001 1.00 37.09  ? 29  THR A O     1 
ATOM   219   C  CB    . THR A  1 57  ? -32.996 -29.619 -11.870 1.00 37.22  ? 29  THR A CB    1 
ATOM   220   O  OG1   . THR A  1 57  ? -32.071 -29.905 -10.814 1.00 39.09  ? 29  THR A OG1   1 
ATOM   221   C  CG2   . THR A  1 57  ? -34.359 -30.206 -11.542 1.00 26.92  ? 29  THR A CG2   1 
ATOM   222   N  N     . PHE A  1 58  ? -30.935 -28.571 -14.110 1.00 33.26  ? 30  PHE A N     1 
ATOM   223   C  CA    . PHE A  1 58  ? -29.648 -27.923 -14.350 1.00 37.65  ? 30  PHE A CA    1 
ATOM   224   C  C     . PHE A  1 58  ? -29.367 -26.905 -13.245 1.00 37.76  ? 30  PHE A C     1 
ATOM   225   O  O     . PHE A  1 58  ? -29.628 -25.694 -13.392 1.00 35.11  ? 30  PHE A O     1 
ATOM   226   C  CB    . PHE A  1 58  ? -29.625 -27.251 -15.735 1.00 32.40  ? 30  PHE A CB    1 
ATOM   227   C  CG    . PHE A  1 58  ? -29.670 -28.231 -16.886 1.00 31.38  ? 30  PHE A CG    1 
ATOM   228   C  CD1   . PHE A  1 58  ? -28.502 -28.640 -17.512 1.00 29.79  ? 30  PHE A CD1   1 
ATOM   229   C  CD2   . PHE A  1 58  ? -30.879 -28.754 -17.324 1.00 29.90  ? 30  PHE A CD2   1 
ATOM   230   C  CE1   . PHE A  1 58  ? -28.533 -29.552 -18.563 1.00 27.95  ? 30  PHE A CE1   1 
ATOM   231   C  CE2   . PHE A  1 58  ? -30.920 -29.679 -18.375 1.00 34.37  ? 30  PHE A CE2   1 
ATOM   232   C  CZ    . PHE A  1 58  ? -29.740 -30.070 -18.993 1.00 29.53  ? 30  PHE A CZ    1 
ATOM   233   N  N     . ASP A  1 59  ? -28.852 -27.402 -12.125 1.00 42.70  ? 31  ASP A N     1 
ATOM   234   C  CA    . ASP A  1 59  ? -28.707 -26.578 -10.927 1.00 44.01  ? 31  ASP A CA    1 
ATOM   235   C  C     . ASP A  1 59  ? -27.725 -25.438 -11.166 1.00 38.05  ? 31  ASP A C     1 
ATOM   236   O  O     . ASP A  1 59  ? -28.066 -24.274 -10.966 1.00 39.50  ? 31  ASP A O     1 
ATOM   237   C  CB    . ASP A  1 59  ? -28.264 -27.431 -9.735  1.00 41.95  ? 31  ASP A CB    1 
ATOM   238   C  CG    . ASP A  1 59  ? -29.318 -28.433 -9.316  1.00 46.89  ? 31  ASP A CG    1 
ATOM   239   O  OD1   . ASP A  1 59  ? -30.519 -28.083 -9.322  1.00 49.73  ? 31  ASP A OD1   1 
ATOM   240   O  OD2   . ASP A  1 59  ? -28.945 -29.576 -8.983  1.00 56.78  ? 31  ASP A OD2   1 
ATOM   241   N  N     . SER A  1 60  ? -26.522 -25.788 -11.617 1.00 39.42  ? 32  SER A N     1 
ATOM   242   C  CA    . SER A  1 60  ? -25.503 -24.810 -11.974 1.00 39.21  ? 32  SER A CA    1 
ATOM   243   C  C     . SER A  1 60  ? -26.032 -23.709 -12.912 1.00 40.66  ? 32  SER A C     1 
ATOM   244   O  O     . SER A  1 60  ? -25.774 -22.519 -12.705 1.00 41.09  ? 32  SER A O     1 
ATOM   245   C  CB    . SER A  1 60  ? -24.311 -25.511 -12.629 1.00 43.47  ? 32  SER A CB    1 
ATOM   246   O  OG    . SER A  1 60  ? -23.468 -24.553 -13.268 1.00 57.31  ? 32  SER A OG    1 
ATOM   247   N  N     . LEU A  1 61  ? -26.775 -24.109 -13.934 1.00 37.31  ? 33  LEU A N     1 
ATOM   248   C  CA    . LEU A  1 61  ? -27.329 -23.153 -14.885 1.00 37.40  ? 33  LEU A CA    1 
ATOM   249   C  C     . LEU A  1 61  ? -28.275 -22.155 -14.214 1.00 33.67  ? 33  LEU A C     1 
ATOM   250   O  O     . LEU A  1 61  ? -28.244 -20.961 -14.519 1.00 32.60  ? 33  LEU A O     1 
ATOM   251   C  CB    . LEU A  1 61  ? -28.059 -23.883 -15.998 1.00 29.47  ? 33  LEU A CB    1 
ATOM   252   C  CG    . LEU A  1 61  ? -28.750 -23.022 -17.047 1.00 38.57  ? 33  LEU A CG    1 
ATOM   253   C  CD1   . LEU A  1 61  ? -27.730 -22.220 -17.878 1.00 33.42  ? 33  LEU A CD1   1 
ATOM   254   C  CD2   . LEU A  1 61  ? -29.600 -23.920 -17.929 1.00 33.77  ? 33  LEU A CD2   1 
ATOM   255   N  N     . LYS A  1 62  ? -29.120 -22.659 -13.321 1.00 34.13  ? 34  LYS A N     1 
ATOM   256   C  CA    . LYS A  1 62  ? -30.073 -21.836 -12.592 1.00 33.88  ? 34  LYS A CA    1 
ATOM   257   C  C     . LYS A  1 62  ? -29.354 -20.685 -11.894 1.00 36.55  ? 34  LYS A C     1 
ATOM   258   O  O     . LYS A  1 62  ? -29.728 -19.514 -12.053 1.00 32.76  ? 34  LYS A O     1 
ATOM   259   C  CB    . LYS A  1 62  ? -30.849 -22.680 -11.578 1.00 34.14  ? 34  LYS A CB    1 
ATOM   260   C  CG    . LYS A  1 62  ? -31.896 -21.900 -10.783 1.00 41.73  ? 34  LYS A CG    1 
ATOM   261   C  CD    . LYS A  1 62  ? -32.697 -22.835 -9.875  1.00 49.14  ? 34  LYS A CD    1 
ATOM   262   C  CE    . LYS A  1 62  ? -33.899 -22.134 -9.256  1.00 50.44  ? 34  LYS A CE    1 
ATOM   263   N  NZ    . LYS A  1 62  ? -34.789 -23.070 -8.496  1.00 62.57  ? 34  LYS A NZ    1 
ATOM   264   N  N     . ASP A  1 63  ? -28.298 -21.020 -11.157 1.00 36.82  ? 35  ASP A N     1 
ATOM   265   C  CA    . ASP A  1 63  ? -27.515 -20.014 -10.460 1.00 37.68  ? 35  ASP A CA    1 
ATOM   266   C  C     . ASP A  1 63  ? -26.911 -19.051 -11.474 1.00 34.01  ? 35  ASP A C     1 
ATOM   267   O  O     . ASP A  1 63  ? -26.909 -17.835 -11.264 1.00 28.52  ? 35  ASP A O     1 
ATOM   268   C  CB    . ASP A  1 63  ? -26.422 -20.660 -9.610  1.00 43.47  ? 35  ASP A CB    1 
ATOM   269   C  CG    . ASP A  1 63  ? -26.988 -21.528 -8.481  1.00 46.03  ? 35  ASP A CG    1 
ATOM   270   O  OD1   . ASP A  1 63  ? -28.099 -21.235 -7.989  1.00 49.96  ? 35  ASP A OD1   1 
ATOM   271   O  OD2   . ASP A  1 63  ? -26.317 -22.508 -8.095  1.00 48.72  ? 35  ASP A OD2   1 
ATOM   272   N  N     . ARG A  1 64  ? -26.441 -19.597 -12.589 1.00 33.86  ? 36  ARG A N     1 
ATOM   273   C  CA    . ARG A  1 64  ? -25.785 -18.776 -13.601 1.00 33.89  ? 36  ARG A CA    1 
ATOM   274   C  C     . ARG A  1 64  ? -26.767 -17.770 -14.209 1.00 28.50  ? 36  ARG A C     1 
ATOM   275   O  O     . ARG A  1 64  ? -26.468 -16.583 -14.286 1.00 29.49  ? 36  ARG A O     1 
ATOM   276   C  CB    . ARG A  1 64  ? -25.170 -19.653 -14.686 1.00 36.06  ? 36  ARG A CB    1 
ATOM   277   C  CG    . ARG A  1 64  ? -24.213 -18.903 -15.592 1.00 36.69  ? 36  ARG A CG    1 
ATOM   278   C  CD    . ARG A  1 64  ? -23.097 -18.269 -14.780 1.00 32.04  ? 36  ARG A CD    1 
ATOM   279   N  NE    . ARG A  1 64  ? -22.152 -17.558 -15.627 1.00 36.90  ? 36  ARG A NE    1 
ATOM   280   C  CZ    . ARG A  1 64  ? -21.063 -16.942 -15.186 1.00 38.00  ? 36  ARG A CZ    1 
ATOM   281   N  NH1   . ARG A  1 64  ? -20.769 -16.954 -13.893 1.00 37.91  ? 36  ARG A NH1   1 
ATOM   282   N  NH2   . ARG A  1 64  ? -20.262 -16.323 -16.041 1.00 41.39  ? 36  ARG A NH2   1 
ATOM   283   N  N     . LEU A  1 65  ? -27.950 -18.244 -14.600 1.00 28.75  ? 37  LEU A N     1 
ATOM   284   C  CA    . LEU A  1 65  ? -28.979 -17.380 -15.172 1.00 29.63  ? 37  LEU A CA    1 
ATOM   285   C  C     . LEU A  1 65  ? -29.350 -16.217 -14.238 1.00 31.79  ? 37  LEU A C     1 
ATOM   286   O  O     . LEU A  1 65  ? -29.547 -15.073 -14.688 1.00 29.59  ? 37  LEU A O     1 
ATOM   287   C  CB    . LEU A  1 65  ? -30.230 -18.192 -15.523 1.00 28.04  ? 37  LEU A CB    1 
ATOM   288   C  CG    . LEU A  1 65  ? -30.022 -19.201 -16.676 1.00 33.70  ? 37  LEU A CG    1 
ATOM   289   C  CD1   . LEU A  1 65  ? -31.225 -20.119 -16.873 1.00 30.77  ? 37  LEU A CD1   1 
ATOM   290   C  CD2   . LEU A  1 65  ? -29.666 -18.498 -17.979 1.00 31.11  ? 37  LEU A CD2   1 
ATOM   291   N  N     . ILE A  1 66  ? -29.441 -16.510 -12.942 1.00 34.28  ? 38  ILE A N     1 
ATOM   292   C  CA    . ILE A  1 66  ? -29.789 -15.497 -11.959 1.00 28.72  ? 38  ILE A CA    1 
ATOM   293   C  C     . ILE A  1 66  ? -28.661 -14.484 -11.866 1.00 30.62  ? 38  ILE A C     1 
ATOM   294   O  O     . ILE A  1 66  ? -28.903 -13.273 -11.941 1.00 34.08  ? 38  ILE A O     1 
ATOM   295   C  CB    . ILE A  1 66  ? -30.073 -16.120 -10.589 1.00 36.85  ? 38  ILE A CB    1 
ATOM   296   C  CG1   . ILE A  1 66  ? -31.345 -16.963 -10.674 1.00 37.17  ? 38  ILE A CG1   1 
ATOM   297   C  CG2   . ILE A  1 66  ? -30.178 -15.038 -9.513  1.00 37.70  ? 38  ILE A CG2   1 
ATOM   298   C  CD1   . ILE A  1 66  ? -31.632 -17.786 -9.447  1.00 33.12  ? 38  ILE A CD1   1 
ATOM   299   N  N     . LEU A  1 67  ? -27.430 -14.972 -11.761 1.00 29.86  ? 39  LEU A N     1 
ATOM   300   C  CA    . LEU A  1 67  ? -26.288 -14.074 -11.724 1.00 32.27  ? 39  LEU A CA    1 
ATOM   301   C  C     . LEU A  1 67  ? -26.257 -13.171 -12.973 1.00 30.60  ? 39  LEU A C     1 
ATOM   302   O  O     . LEU A  1 67  ? -26.206 -11.957 -12.848 1.00 31.67  ? 39  LEU A O     1 
ATOM   303   C  CB    . LEU A  1 67  ? -24.971 -14.849 -11.606 1.00 36.83  ? 39  LEU A CB    1 
ATOM   304   C  CG    . LEU A  1 67  ? -23.764 -13.907 -11.722 1.00 36.96  ? 39  LEU A CG    1 
ATOM   305   C  CD1   . LEU A  1 67  ? -23.654 -13.022 -10.469 1.00 35.22  ? 39  LEU A CD1   1 
ATOM   306   C  CD2   . LEU A  1 67  ? -22.460 -14.642 -11.992 1.00 35.67  ? 39  LEU A CD2   1 
ATOM   307   N  N     . GLN A  1 68  ? -26.328 -13.767 -14.165 1.00 32.76  ? 40  GLN A N     1 
ATOM   308   C  CA    . GLN A  1 68  ? -26.304 -13.012 -15.412 1.00 26.02  ? 40  GLN A CA    1 
ATOM   309   C  C     . GLN A  1 68  ? -27.426 -11.981 -15.441 1.00 31.85  ? 40  GLN A C     1 
ATOM   310   O  O     . GLN A  1 68  ? -27.221 -10.835 -15.820 1.00 27.07  ? 40  GLN A O     1 
ATOM   311   C  CB    . GLN A  1 68  ? -26.422 -13.939 -16.616 1.00 30.68  ? 40  GLN A CB    1 
ATOM   312   C  CG    . GLN A  1 68  ? -25.189 -14.797 -16.859 1.00 29.65  ? 40  GLN A CG    1 
ATOM   313   C  CD    . GLN A  1 68  ? -23.950 -13.952 -17.116 1.00 35.40  ? 40  GLN A CD    1 
ATOM   314   O  OE1   . GLN A  1 68  ? -23.222 -13.581 -16.183 1.00 35.82  ? 40  GLN A OE1   1 
ATOM   315   N  NE2   . GLN A  1 68  ? -23.712 -13.622 -18.386 1.00 28.23  ? 40  GLN A NE2   1 
ATOM   316   N  N     . GLU A  1 69  ? -28.614 -12.393 -15.027 1.00 30.29  ? 41  GLU A N     1 
ATOM   317   C  CA    . GLU A  1 69  ? -29.728 -11.481 -15.001 1.00 29.12  ? 41  GLU A CA    1 
ATOM   318   C  C     . GLU A  1 69  ? -29.493 -10.292 -14.035 1.00 36.05  ? 41  GLU A C     1 
ATOM   319   O  O     . GLU A  1 69  ? -29.756 -9.138  -14.391 1.00 30.40  ? 41  GLU A O     1 
ATOM   320   C  CB    . GLU A  1 69  ? -31.002 -12.220 -14.628 1.00 34.86  ? 41  GLU A CB    1 
ATOM   321   C  CG    . GLU A  1 69  ? -32.248 -11.537 -15.151 1.00 46.22  ? 41  GLU A CG    1 
ATOM   322   C  CD    . GLU A  1 69  ? -32.525 -10.210 -14.468 1.00 47.43  ? 41  GLU A CD    1 
ATOM   323   O  OE1   . GLU A  1 69  ? -32.252 -10.090 -13.249 1.00 46.87  ? 41  GLU A OE1   1 
ATOM   324   O  OE2   . GLU A  1 69  ? -33.041 -9.294  -15.144 1.00 57.67  ? 41  GLU A OE2   1 
ATOM   325   N  N     . SER A  1 70  ? -28.998 -10.560 -12.831 1.00 32.23  ? 42  SER A N     1 
ATOM   326   C  CA    . SER A  1 70  ? -28.801 -9.477  -11.877 1.00 32.23  ? 42  SER A CA    1 
ATOM   327   C  C     . SER A  1 70  ? -27.699 -8.528  -12.356 1.00 34.30  ? 42  SER A C     1 
ATOM   328   O  O     . SER A  1 70  ? -27.716 -7.338  -12.023 1.00 31.34  ? 42  SER A O     1 
ATOM   329   C  CB    . SER A  1 70  ? -28.480 -10.022 -10.482 1.00 34.70  ? 42  SER A CB    1 
ATOM   330   O  OG    . SER A  1 70  ? -27.120 -10.380 -10.384 1.00 40.94  ? 42  SER A OG    1 
ATOM   331   N  N     . LEU A  1 71  ? -26.779 -9.032  -13.179 1.00 33.19  ? 43  LEU A N     1 
ATOM   332   C  CA    . LEU A  1 71  ? -25.708 -8.197  -13.747 1.00 33.76  ? 43  LEU A CA    1 
ATOM   333   C  C     . LEU A  1 71  ? -26.142 -7.406  -14.981 1.00 32.59  ? 43  LEU A C     1 
ATOM   334   O  O     . LEU A  1 71  ? -25.375 -6.604  -15.488 1.00 29.08  ? 43  LEU A O     1 
ATOM   335   C  CB    . LEU A  1 71  ? -24.483 -9.056  -14.115 1.00 37.53  ? 43  LEU A CB    1 
ATOM   336   C  CG    . LEU A  1 71  ? -23.699 -9.678  -12.953 1.00 37.67  ? 43  LEU A CG    1 
ATOM   337   C  CD1   . LEU A  1 71  ? -22.604 -10.624 -13.437 1.00 31.05  ? 43  LEU A CD1   1 
ATOM   338   C  CD2   . LEU A  1 71  ? -23.106 -8.578  -12.060 1.00 31.28  ? 43  LEU A CD2   1 
ATOM   339   N  N     . GLY A  1 72  ? -27.360 -7.629  -15.469 1.00 36.08  ? 44  GLY A N     1 
ATOM   340   C  CA    . GLY A  1 72  ? -27.803 -6.984  -16.699 1.00 27.36  ? 44  GLY A CA    1 
ATOM   341   C  C     . GLY A  1 72  ? -27.090 -7.537  -17.938 1.00 35.30  ? 44  GLY A C     1 
ATOM   342   O  O     . GLY A  1 72  ? -26.967 -6.840  -18.943 1.00 30.64  ? 44  GLY A O     1 
ATOM   343   N  N     . TYR A  1 73  ? -26.635 -8.793  -17.881 1.00 32.40  ? 45  TYR A N     1 
ATOM   344   C  CA    . TYR A  1 73  ? -25.850 -9.375  -18.977 1.00 30.15  ? 45  TYR A CA    1 
ATOM   345   C  C     . TYR A  1 73  ? -26.656 -10.256 -19.932 1.00 31.96  ? 45  TYR A C     1 
ATOM   346   O  O     . TYR A  1 73  ? -26.119 -10.776 -20.920 1.00 29.79  ? 45  TYR A O     1 
ATOM   347   C  CB    . TYR A  1 73  ? -24.685 -10.209 -18.437 1.00 31.96  ? 45  TYR A CB    1 
ATOM   348   C  CG    . TYR A  1 73  ? -23.537 -9.420  -17.846 1.00 31.04  ? 45  TYR A CG    1 
ATOM   349   C  CD1   . TYR A  1 73  ? -23.519 -8.027  -17.875 1.00 35.98  ? 45  TYR A CD1   1 
ATOM   350   C  CD2   . TYR A  1 73  ? -22.461 -10.074 -17.273 1.00 34.69  ? 45  TYR A CD2   1 
ATOM   351   C  CE1   . TYR A  1 73  ? -22.463 -7.322  -17.332 1.00 37.10  ? 45  TYR A CE1   1 
ATOM   352   C  CE2   . TYR A  1 73  ? -21.407 -9.376  -16.723 1.00 33.53  ? 45  TYR A CE2   1 
ATOM   353   C  CZ    . TYR A  1 73  ? -21.406 -8.012  -16.756 1.00 36.62  ? 45  TYR A CZ    1 
ATOM   354   O  OH    . TYR A  1 73  ? -20.338 -7.339  -16.206 1.00 39.70  ? 45  TYR A OH    1 
ATOM   355   N  N     . LEU A  1 74  ? -27.934 -10.458 -19.648 1.00 31.11  ? 46  LEU A N     1 
ATOM   356   C  CA    . LEU A  1 74  ? -28.728 -11.270 -20.566 1.00 28.63  ? 46  LEU A CA    1 
ATOM   357   C  C     . LEU A  1 74  ? -29.131 -10.426 -21.776 1.00 34.38  ? 46  LEU A C     1 
ATOM   358   O  O     . LEU A  1 74  ? -29.011 -9.180  -21.774 1.00 26.61  ? 46  LEU A O     1 
ATOM   359   C  CB    . LEU A  1 74  ? -29.945 -11.866 -19.857 1.00 30.37  ? 46  LEU A CB    1 
ATOM   360   C  CG    . LEU A  1 74  ? -29.576 -12.971 -18.846 1.00 36.46  ? 46  LEU A CG    1 
ATOM   361   C  CD1   . LEU A  1 74  ? -30.812 -13.531 -18.139 1.00 29.51  ? 46  LEU A CD1   1 
ATOM   362   C  CD2   . LEU A  1 74  ? -28.741 -14.104 -19.515 1.00 24.78  ? 46  LEU A CD2   1 
ATOM   363   N  N     . SER A  1 75  ? -29.575 -11.115 -22.822 1.00 23.43  ? 47  SER A N     1 
ATOM   364   C  CA    . SER A  1 75  ? -29.935 -10.480 -24.080 1.00 25.51  ? 47  SER A CA    1 
ATOM   365   C  C     . SER A  1 75  ? -31.408 -10.099 -24.111 1.00 32.06  ? 47  SER A C     1 
ATOM   366   O  O     . SER A  1 75  ? -31.799 -9.111  -24.743 1.00 31.20  ? 47  SER A O     1 
ATOM   367   C  CB    . SER A  1 75  ? -29.649 -11.424 -25.247 1.00 28.15  ? 47  SER A CB    1 
ATOM   368   O  OG    . SER A  1 75  ? -30.612 -12.472 -25.251 1.00 23.84  ? 47  SER A OG    1 
ATOM   369   N  N     . GLY A  1 76  ? -32.229 -10.908 -23.454 1.00 30.76  ? 48  GLY A N     1 
ATOM   370   C  CA    . GLY A  1 76  ? -33.673 -10.805 -23.596 1.00 30.07  ? 48  GLY A CA    1 
ATOM   371   C  C     . GLY A  1 76  ? -34.260 -11.755 -24.639 1.00 32.89  ? 48  GLY A C     1 
ATOM   372   O  O     . GLY A  1 76  ? -35.478 -11.781 -24.809 1.00 35.70  ? 48  GLY A O     1 
ATOM   373   N  N     . PHE A  1 77  ? -33.418 -12.522 -25.344 1.00 27.67  ? 49  PHE A N     1 
ATOM   374   C  CA    . PHE A  1 77  ? -33.917 -13.558 -26.275 1.00 30.44  ? 49  PHE A CA    1 
ATOM   375   C  C     . PHE A  1 77  ? -34.102 -14.908 -25.562 1.00 33.72  ? 49  PHE A C     1 
ATOM   376   O  O     . PHE A  1 77  ? -34.600 -15.876 -26.146 1.00 32.65  ? 49  PHE A O     1 
ATOM   377   C  CB    . PHE A  1 77  ? -32.974 -13.754 -27.477 1.00 27.38  ? 49  PHE A CB    1 
ATOM   378   C  CG    . PHE A  1 77  ? -32.858 -12.543 -28.391 1.00 37.15  ? 49  PHE A CG    1 
ATOM   379   C  CD1   . PHE A  1 77  ? -33.947 -11.719 -28.626 1.00 34.28  ? 49  PHE A CD1   1 
ATOM   380   C  CD2   . PHE A  1 77  ? -31.648 -12.236 -29.015 1.00 33.26  ? 49  PHE A CD2   1 
ATOM   381   C  CE1   . PHE A  1 77  ? -33.837 -10.606 -29.472 1.00 40.63  ? 49  PHE A CE1   1 
ATOM   382   C  CE2   . PHE A  1 77  ? -31.535 -11.129 -29.855 1.00 26.77  ? 49  PHE A CE2   1 
ATOM   383   C  CZ    . PHE A  1 77  ? -32.633 -10.322 -30.085 1.00 30.40  ? 49  PHE A CZ    1 
ATOM   384   N  N     . GLU A  1 78  ? -33.678 -14.968 -24.304 1.00 31.11  ? 50  GLU A N     1 
ATOM   385   C  CA    . GLU A  1 78  ? -33.800 -16.189 -23.501 1.00 36.49  ? 50  GLU A CA    1 
ATOM   386   C  C     . GLU A  1 78  ? -35.258 -16.410 -23.057 1.00 33.93  ? 50  GLU A C     1 
ATOM   387   O  O     . GLU A  1 78  ? -35.983 -15.446 -22.849 1.00 35.21  ? 50  GLU A O     1 
ATOM   388   C  CB    . GLU A  1 78  ? -32.881 -16.103 -22.278 1.00 26.61  ? 50  GLU A CB    1 
ATOM   389   C  CG    . GLU A  1 78  ? -31.403 -15.815 -22.613 1.00 31.99  ? 50  GLU A CG    1 
ATOM   390   C  CD    . GLU A  1 78  ? -31.085 -14.315 -22.767 1.00 33.38  ? 50  GLU A CD    1 
ATOM   391   O  OE1   . GLU A  1 78  ? -31.992 -13.476 -22.545 1.00 31.54  ? 50  GLU A OE1   1 
ATOM   392   O  OE2   . GLU A  1 78  ? -29.923 -13.978 -23.100 1.00 29.44  ? 50  GLU A OE2   1 
ATOM   393   N  N     . GLU A  1 79  ? -35.693 -17.666 -22.936 1.00 28.73  ? 51  GLU A N     1 
ATOM   394   C  CA    . GLU A  1 79  ? -36.972 -17.949 -22.280 1.00 30.06  ? 51  GLU A CA    1 
ATOM   395   C  C     . GLU A  1 79  ? -36.967 -17.249 -20.898 1.00 29.89  ? 51  GLU A C     1 
ATOM   396   O  O     . GLU A  1 79  ? -35.979 -17.332 -20.173 1.00 33.15  ? 51  GLU A O     1 
ATOM   397   C  CB    . GLU A  1 79  ? -37.188 -19.467 -22.159 1.00 30.02  ? 51  GLU A CB    1 
ATOM   398   C  CG    . GLU A  1 79  ? -38.086 -19.901 -21.001 1.00 31.79  ? 51  GLU A CG    1 
ATOM   399   C  CD    . GLU A  1 79  ? -39.534 -19.483 -21.193 1.00 36.37  ? 51  GLU A CD    1 
ATOM   400   O  OE1   . GLU A  1 79  ? -40.046 -19.602 -22.324 1.00 39.02  ? 51  GLU A OE1   1 
ATOM   401   O  OE2   . GLU A  1 79  ? -40.167 -19.022 -20.218 1.00 37.28  ? 51  GLU A OE2   1 
ATOM   402   N  N     . PRO A  1 80  ? -38.036 -16.511 -20.552 1.00 33.03  ? 52  PRO A N     1 
ATOM   403   C  CA    . PRO A  1 80  ? -37.951 -15.744 -19.289 1.00 36.55  ? 52  PRO A CA    1 
ATOM   404   C  C     . PRO A  1 80  ? -38.176 -16.562 -18.009 1.00 39.70  ? 52  PRO A C     1 
ATOM   405   O  O     . PRO A  1 80  ? -37.733 -16.143 -16.930 1.00 38.02  ? 52  PRO A O     1 
ATOM   406   C  CB    . PRO A  1 80  ? -39.053 -14.682 -19.440 1.00 33.35  ? 52  PRO A CB    1 
ATOM   407   C  CG    . PRO A  1 80  ? -40.006 -15.238 -20.429 1.00 37.88  ? 52  PRO A CG    1 
ATOM   408   C  CD    . PRO A  1 80  ? -39.198 -16.116 -21.371 1.00 33.62  ? 52  PRO A CD    1 
ATOM   409   N  N     . ASP A  1 81  ? -38.837 -17.711 -18.119 1.00 35.00  ? 53  ASP A N     1 
ATOM   410   C  CA    . ASP A  1 81  ? -39.160 -18.513 -16.934 1.00 34.53  ? 53  ASP A CA    1 
ATOM   411   C  C     . ASP A  1 81  ? -38.005 -19.456 -16.599 1.00 33.66  ? 53  ASP A C     1 
ATOM   412   O  O     . ASP A  1 81  ? -37.823 -20.495 -17.243 1.00 30.26  ? 53  ASP A O     1 
ATOM   413   C  CB    . ASP A  1 81  ? -40.460 -19.289 -17.165 1.00 36.66  ? 53  ASP A CB    1 
ATOM   414   C  CG    . ASP A  1 81  ? -41.007 -19.921 -15.898 1.00 44.11  ? 53  ASP A CG    1 
ATOM   415   O  OD1   . ASP A  1 81  ? -40.239 -20.090 -14.936 1.00 42.96  ? 53  ASP A OD1   1 
ATOM   416   O  OD2   . ASP A  1 81  ? -42.210 -20.257 -15.872 1.00 48.00  ? 53  ASP A OD2   1 
ATOM   417   N  N     . ILE A  1 82  ? -37.224 -19.085 -15.591 1.00 29.28  ? 54  ILE A N     1 
ATOM   418   C  CA    . ILE A  1 82  ? -36.021 -19.827 -15.218 1.00 35.19  ? 54  ILE A CA    1 
ATOM   419   C  C     . ILE A  1 82  ? -36.336 -21.241 -14.725 1.00 38.17  ? 54  ILE A C     1 
ATOM   420   O  O     . ILE A  1 82  ? -35.561 -22.170 -14.957 1.00 34.91  ? 54  ILE A O     1 
ATOM   421   C  CB    . ILE A  1 82  ? -35.217 -19.081 -14.125 1.00 40.78  ? 54  ILE A CB    1 
ATOM   422   C  CG1   . ILE A  1 82  ? -34.638 -17.783 -14.680 1.00 42.43  ? 54  ILE A CG1   1 
ATOM   423   C  CG2   . ILE A  1 82  ? -34.064 -19.921 -13.622 1.00 42.96  ? 54  ILE A CG2   1 
ATOM   424   C  CD1   . ILE A  1 82  ? -33.715 -17.090 -13.693 1.00 46.11  ? 54  ILE A CD1   1 
ATOM   425   N  N     . GLU A  1 83  ? -37.476 -21.408 -14.063 1.00 37.71  ? 55  GLU A N     1 
ATOM   426   C  CA    . GLU A  1 83  ? -37.892 -22.738 -13.619 1.00 39.95  ? 55  GLU A CA    1 
ATOM   427   C  C     . GLU A  1 83  ? -37.998 -23.691 -14.812 1.00 37.63  ? 55  GLU A C     1 
ATOM   428   O  O     . GLU A  1 83  ? -37.460 -24.792 -14.770 1.00 34.42  ? 55  GLU A O     1 
ATOM   429   C  CB    . GLU A  1 83  ? -39.215 -22.674 -12.856 1.00 35.91  ? 55  GLU A CB    1 
ATOM   430   C  CG    . GLU A  1 83  ? -39.064 -22.077 -11.465 1.00 43.16  ? 55  GLU A CG    1 
ATOM   431   C  CD    . GLU A  1 83  ? -38.001 -22.794 -10.643 1.00 49.27  ? 55  GLU A CD    1 
ATOM   432   O  OE1   . GLU A  1 83  ? -38.137 -24.022 -10.425 1.00 54.70  ? 55  GLU A OE1   1 
ATOM   433   O  OE2   . GLU A  1 83  ? -37.028 -22.134 -10.217 1.00 52.49  ? 55  GLU A OE2   1 
ATOM   434   N  N     . LYS A  1 84  ? -38.644 -23.239 -15.886 1.00 33.51  ? 56  LYS A N     1 
ATOM   435   C  CA    . LYS A  1 84  ? -38.783 -24.054 -17.086 1.00 33.33  ? 56  LYS A CA    1 
ATOM   436   C  C     . LYS A  1 84  ? -37.453 -24.328 -17.801 1.00 33.42  ? 56  LYS A C     1 
ATOM   437   O  O     . LYS A  1 84  ? -37.245 -25.419 -18.328 1.00 36.49  ? 56  LYS A O     1 
ATOM   438   C  CB    . LYS A  1 84  ? -39.749 -23.402 -18.064 1.00 32.35  ? 56  LYS A CB    1 
ATOM   439   C  CG    . LYS A  1 84  ? -41.204 -23.393 -17.645 1.00 37.74  ? 56  LYS A CG    1 
ATOM   440   C  CD    . LYS A  1 84  ? -42.065 -22.877 -18.805 1.00 43.10  ? 56  LYS A CD    1 
ATOM   441   C  CE    . LYS A  1 84  ? -43.430 -22.390 -18.344 1.00 49.31  ? 56  LYS A CE    1 
ATOM   442   N  NZ    . LYS A  1 84  ? -44.230 -21.835 -19.475 1.00 57.72  ? 56  LYS A NZ    1 
ATOM   443   N  N     . ARG A  1 85  ? -36.563 -23.347 -17.821 1.00 34.26  ? 57  ARG A N     1 
ATOM   444   C  CA    . ARG A  1 85  ? -35.261 -23.469 -18.480 1.00 28.70  ? 57  ARG A CA    1 
ATOM   445   C  C     . ARG A  1 85  ? -34.362 -24.537 -17.869 1.00 31.12  ? 57  ARG A C     1 
ATOM   446   O  O     . ARG A  1 85  ? -33.498 -25.082 -18.543 1.00 35.67  ? 57  ARG A O     1 
ATOM   447   C  CB    . ARG A  1 85  ? -34.510 -22.133 -18.435 1.00 29.16  ? 57  ARG A CB    1 
ATOM   448   C  CG    . ARG A  1 85  ? -35.192 -20.966 -19.138 1.00 27.30  ? 57  ARG A CG    1 
ATOM   449   C  CD    . ARG A  1 85  ? -34.140 -20.010 -19.722 1.00 29.02  ? 57  ARG A CD    1 
ATOM   450   N  NE    . ARG A  1 85  ? -33.486 -20.580 -20.895 1.00 29.90  ? 57  ARG A NE    1 
ATOM   451   C  CZ    . ARG A  1 85  ? -32.311 -20.190 -21.391 1.00 31.61  ? 57  ARG A CZ    1 
ATOM   452   N  NH1   . ARG A  1 85  ? -31.615 -19.211 -20.825 1.00 27.67  ? 57  ARG A NH1   1 
ATOM   453   N  NH2   . ARG A  1 85  ? -31.824 -20.791 -22.470 1.00 29.67  ? 57  ARG A NH2   1 
ATOM   454   N  N     . VAL A  1 86  ? -34.553 -24.830 -16.590 1.00 34.21  ? 58  VAL A N     1 
ATOM   455   C  CA    . VAL A  1 86  ? -33.619 -25.697 -15.879 1.00 33.88  ? 58  VAL A CA    1 
ATOM   456   C  C     . VAL A  1 86  ? -34.250 -26.990 -15.407 1.00 31.16  ? 58  VAL A C     1 
ATOM   457   O  O     . VAL A  1 86  ? -33.585 -27.818 -14.785 1.00 28.81  ? 58  VAL A O     1 
ATOM   458   C  CB    . VAL A  1 86  ? -33.012 -24.978 -14.639 1.00 34.67  ? 58  VAL A CB    1 
ATOM   459   C  CG1   . VAL A  1 86  ? -32.234 -23.756 -15.074 1.00 31.73  ? 58  VAL A CG1   1 
ATOM   460   C  CG2   . VAL A  1 86  ? -34.102 -24.619 -13.642 1.00 31.12  ? 58  VAL A CG2   1 
ATOM   461   N  N     . THR A  1 87  ? -35.534 -27.161 -15.707 1.00 34.16  ? 59  THR A N     1 
ATOM   462   C  CA    . THR A  1 87  ? -36.271 -28.321 -15.227 1.00 32.31  ? 59  THR A CA    1 
ATOM   463   C  C     . THR A  1 87  ? -36.932 -29.064 -16.374 1.00 31.96  ? 59  THR A C     1 
ATOM   464   O  O     . THR A  1 87  ? -38.080 -28.793 -16.714 1.00 34.07  ? 59  THR A O     1 
ATOM   465   C  CB    . THR A  1 87  ? -37.365 -27.923 -14.193 1.00 35.29  ? 59  THR A CB    1 
ATOM   466   O  OG1   . THR A  1 87  ? -36.879 -26.867 -13.351 1.00 34.45  ? 59  THR A OG1   1 
ATOM   467   C  CG2   . THR A  1 87  ? -37.744 -29.130 -13.329 1.00 33.04  ? 59  THR A CG2   1 
ATOM   468   N  N     . PRO A  1 88  ? -36.203 -30.007 -16.980 1.00 35.84  ? 60  PRO A N     1 
ATOM   469   C  CA    . PRO A  1 88  ? -36.741 -30.846 -18.062 1.00 32.85  ? 60  PRO A CA    1 
ATOM   470   C  C     . PRO A  1 88  ? -38.072 -31.542 -17.714 1.00 38.96  ? 60  PRO A C     1 
ATOM   471   O  O     . PRO A  1 88  ? -38.949 -31.693 -18.589 1.00 34.45  ? 60  PRO A O     1 
ATOM   472   C  CB    . PRO A  1 88  ? -35.631 -31.877 -18.272 1.00 32.27  ? 60  PRO A CB    1 
ATOM   473   C  CG    . PRO A  1 88  ? -34.383 -31.159 -17.922 1.00 31.76  ? 60  PRO A CG    1 
ATOM   474   C  CD    . PRO A  1 88  ? -34.764 -30.232 -16.766 1.00 34.40  ? 60  PRO A CD    1 
ATOM   475   N  N     . LYS A  1 89  ? -38.230 -31.953 -16.454 1.00 35.04  ? 61  LYS A N     1 
ATOM   476   C  CA    . LYS A  1 89  ? -39.428 -32.694 -16.052 1.00 34.96  ? 61  LYS A CA    1 
ATOM   477   C  C     . LYS A  1 89  ? -40.683 -31.823 -15.963 1.00 40.06  ? 61  LYS A C     1 
ATOM   478   O  O     . LYS A  1 89  ? -41.799 -32.338 -15.997 1.00 38.18  ? 61  LYS A O     1 
ATOM   479   C  CB    . LYS A  1 89  ? -39.179 -33.412 -14.730 1.00 36.71  ? 61  LYS A CB    1 
ATOM   480   C  CG    . LYS A  1 89  ? -38.081 -34.457 -14.830 1.00 39.35  ? 61  LYS A CG    1 
ATOM   481   C  CD    . LYS A  1 89  ? -37.836 -35.144 -13.496 1.00 38.84  ? 61  LYS A CD    1 
ATOM   482   C  CE    . LYS A  1 89  ? -36.591 -36.019 -13.554 1.00 43.15  ? 61  LYS A CE    1 
ATOM   483   N  NZ    . LYS A  1 89  ? -36.516 -36.939 -12.392 1.00 51.21  ? 61  LYS A NZ    1 
ATOM   484   N  N     . LEU A  1 90  ? -40.498 -30.505 -15.870 1.00 36.86  ? 62  LEU A N     1 
ATOM   485   C  CA    . LEU A  1 90  ? -41.603 -29.561 -15.993 1.00 36.65  ? 62  LEU A CA    1 
ATOM   486   C  C     . LEU A  1 90  ? -42.044 -29.439 -17.446 1.00 39.37  ? 62  LEU A C     1 
ATOM   487   O  O     . LEU A  1 90  ? -43.214 -29.188 -17.734 1.00 42.11  ? 62  LEU A O     1 
ATOM   488   C  CB    . LEU A  1 90  ? -41.200 -28.170 -15.485 1.00 39.52  ? 62  LEU A CB    1 
ATOM   489   C  CG    . LEU A  1 90  ? -41.472 -27.760 -14.046 1.00 48.20  ? 62  LEU A CG    1 
ATOM   490   C  CD1   . LEU A  1 90  ? -41.116 -26.271 -13.856 1.00 38.11  ? 62  LEU A CD1   1 
ATOM   491   C  CD2   . LEU A  1 90  ? -42.932 -28.028 -13.722 1.00 49.46  ? 62  LEU A CD2   1 
ATOM   492   N  N     . LEU A  1 91  ? -41.089 -29.566 -18.360 1.00 39.12  ? 63  LEU A N     1 
ATOM   493   C  CA    . LEU A  1 91  ? -41.373 -29.423 -19.788 1.00 36.51  ? 63  LEU A CA    1 
ATOM   494   C  C     . LEU A  1 91  ? -41.984 -30.706 -20.340 1.00 36.62  ? 63  LEU A C     1 
ATOM   495   O  O     . LEU A  1 91  ? -42.899 -30.673 -21.166 1.00 40.30  ? 63  LEU A O     1 
ATOM   496   C  CB    . LEU A  1 91  ? -40.103 -29.076 -20.564 1.00 34.12  ? 63  LEU A CB    1 
ATOM   497   C  CG    . LEU A  1 91  ? -39.354 -27.813 -20.153 1.00 33.95  ? 63  LEU A CG    1 
ATOM   498   C  CD1   . LEU A  1 91  ? -38.087 -27.681 -20.966 1.00 29.30  ? 63  LEU A CD1   1 
ATOM   499   C  CD2   . LEU A  1 91  ? -40.249 -26.593 -20.334 1.00 32.04  ? 63  LEU A CD2   1 
ATOM   500   N  N     . LEU A  1 92  ? -41.468 -31.839 -19.890 1.00 34.94  ? 64  LEU A N     1 
ATOM   501   C  CA    . LEU A  1 92  ? -42.028 -33.123 -20.301 1.00 35.77  ? 64  LEU A CA    1 
ATOM   502   C  C     . LEU A  1 92  ? -42.290 -33.950 -19.054 1.00 35.26  ? 64  LEU A C     1 
ATOM   503   O  O     . LEU A  1 92  ? -41.346 -34.361 -18.383 1.00 33.99  ? 64  LEU A O     1 
ATOM   504   C  CB    . LEU A  1 92  ? -41.092 -33.868 -21.249 1.00 32.96  ? 64  LEU A CB    1 
ATOM   505   C  CG    . LEU A  1 92  ? -41.632 -35.227 -21.730 1.00 37.30  ? 64  LEU A CG    1 
ATOM   506   C  CD1   . LEU A  1 92  ? -42.805 -35.059 -22.693 1.00 32.64  ? 64  LEU A CD1   1 
ATOM   507   C  CD2   . LEU A  1 92  ? -40.542 -36.023 -22.379 1.00 34.34  ? 64  LEU A CD2   1 
ATOM   508   N  N     . PRO A  1 93  ? -43.572 -34.144 -18.717 1.00 39.20  ? 65  PRO A N     1 
ATOM   509   C  CA    . PRO A  1 93  ? -43.961 -34.955 -17.552 1.00 47.99  ? 65  PRO A CA    1 
ATOM   510   C  C     . PRO A  1 93  ? -43.279 -36.320 -17.555 1.00 40.99  ? 65  PRO A C     1 
ATOM   511   O  O     . PRO A  1 93  ? -43.311 -37.021 -18.564 1.00 41.61  ? 65  PRO A O     1 
ATOM   512   C  CB    . PRO A  1 93  ? -45.478 -35.093 -17.716 1.00 50.60  ? 65  PRO A CB    1 
ATOM   513   C  CG    . PRO A  1 93  ? -45.879 -33.823 -18.452 1.00 46.72  ? 65  PRO A CG    1 
ATOM   514   C  CD    . PRO A  1 93  ? -44.738 -33.543 -19.397 1.00 40.92  ? 65  PRO A CD    1 
ATOM   515   N  N     . LYS A  1 94  ? -42.630 -36.643 -16.443 1.00 41.94  ? 66  LYS A N     1 
ATOM   516   C  CA    . LYS A  1 94  ? -42.046 -37.960 -16.205 1.00 46.22  ? 66  LYS A CA    1 
ATOM   517   C  C     . LYS A  1 94  ? -40.884 -38.232 -17.153 1.00 43.45  ? 66  LYS A C     1 
ATOM   518   O  O     . LYS A  1 94  ? -40.561 -39.385 -17.479 1.00 41.11  ? 66  LYS A O     1 
ATOM   519   C  CB    . LYS A  1 94  ? -43.130 -39.044 -16.305 1.00 51.60  ? 66  LYS A CB    1 
ATOM   520   C  CG    . LYS A  1 94  ? -44.169 -38.931 -15.174 1.00 55.65  ? 66  LYS A CG    1 
ATOM   521   C  CD    . LYS A  1 94  ? -45.130 -40.119 -15.106 1.00 63.10  ? 66  LYS A CD    1 
ATOM   522   C  CE    . LYS A  1 94  ? -46.118 -40.125 -16.270 1.00 61.45  ? 66  LYS A CE    1 
ATOM   523   N  NZ    . LYS A  1 94  ? -47.191 -41.147 -16.082 1.00 59.90  ? 66  LYS A NZ    1 
ATOM   524   N  N     . ALA A  1 95  ? -40.252 -37.142 -17.577 1.00 39.35  ? 67  ALA A N     1 
ATOM   525   C  CA    . ALA A  1 95  ? -39.060 -37.193 -18.414 1.00 39.45  ? 67  ALA A CA    1 
ATOM   526   C  C     . ALA A  1 95  ? -37.928 -37.943 -17.733 1.00 38.71  ? 67  ALA A C     1 
ATOM   527   O  O     . ALA A  1 95  ? -37.761 -37.854 -16.518 1.00 41.77  ? 67  ALA A O     1 
ATOM   528   C  CB    . ALA A  1 95  ? -38.611 -35.772 -18.774 1.00 36.09  ? 67  ALA A CB    1 
ATOM   529   N  N     . LYS A  1 96  ? -37.139 -38.669 -18.528 1.00 36.10  ? 68  LYS A N     1 
ATOM   530   C  CA    . LYS A  1 96  ? -36.035 -39.469 -18.000 1.00 36.29  ? 68  LYS A CA    1 
ATOM   531   C  C     . LYS A  1 96  ? -34.690 -39.146 -18.645 1.00 39.75  ? 68  LYS A C     1 
ATOM   532   O  O     . LYS A  1 96  ? -33.638 -39.460 -18.071 1.00 39.74  ? 68  LYS A O     1 
ATOM   533   C  CB    . LYS A  1 96  ? -36.324 -40.963 -18.184 1.00 37.52  ? 68  LYS A CB    1 
ATOM   534   C  CG    . LYS A  1 96  ? -37.611 -41.421 -17.542 1.00 38.49  ? 68  LYS A CG    1 
ATOM   535   C  CD    . LYS A  1 96  ? -37.487 -41.371 -16.038 1.00 45.14  ? 68  LYS A CD    1 
ATOM   536   C  CE    . LYS A  1 96  ? -38.684 -42.037 -15.371 1.00 45.70  ? 68  LYS A CE    1 
ATOM   537   N  NZ    . LYS A  1 96  ? -38.675 -41.815 -13.882 1.00 62.72  ? 68  LYS A NZ    1 
ATOM   538   N  N     . SER A  1 97  ? -34.716 -38.568 -19.848 1.00 30.54  ? 69  SER A N     1 
ATOM   539   C  CA    . SER A  1 97  ? -33.482 -38.277 -20.563 1.00 28.86  ? 69  SER A CA    1 
ATOM   540   C  C     . SER A  1 97  ? -33.631 -37.150 -21.577 1.00 27.89  ? 69  SER A C     1 
ATOM   541   O  O     . SER A  1 97  ? -34.736 -36.756 -21.968 1.00 26.47  ? 69  SER A O     1 
ATOM   542   C  CB    . SER A  1 97  ? -32.967 -39.526 -21.296 1.00 30.85  ? 69  SER A CB    1 
ATOM   543   O  OG    . SER A  1 97  ? -33.803 -39.841 -22.403 1.00 27.03  ? 69  SER A OG    1 
ATOM   544   N  N     . ILE A  1 98  ? -32.494 -36.657 -22.030 1.00 25.81  ? 70  ILE A N     1 
ATOM   545   C  CA    . ILE A  1 98  ? -32.492 -35.677 -23.104 1.00 30.98  ? 70  ILE A CA    1 
ATOM   546   C  C     . ILE A  1 98  ? -31.501 -36.118 -24.161 1.00 30.64  ? 70  ILE A C     1 
ATOM   547   O  O     . ILE A  1 98  ? -30.353 -36.454 -23.843 1.00 30.86  ? 70  ILE A O     1 
ATOM   548   C  CB    . ILE A  1 98  ? -32.104 -34.265 -22.624 1.00 25.83  ? 70  ILE A CB    1 
ATOM   549   C  CG1   . ILE A  1 98  ? -32.896 -33.852 -21.386 1.00 28.33  ? 70  ILE A CG1   1 
ATOM   550   C  CG2   . ILE A  1 98  ? -32.320 -33.258 -23.747 1.00 28.42  ? 70  ILE A CG2   1 
ATOM   551   C  CD1   . ILE A  1 98  ? -32.418 -32.511 -20.798 1.00 28.49  ? 70  ILE A CD1   1 
ATOM   552   N  N     . VAL A  1 99  ? -31.933 -36.122 -25.416 1.00 24.28  ? 71  VAL A N     1 
ATOM   553   C  CA    . VAL A  1 99  ? -31.010 -36.470 -26.502 1.00 29.69  ? 71  VAL A CA    1 
ATOM   554   C  C     . VAL A  1 99  ? -30.553 -35.187 -27.190 1.00 27.05  ? 71  VAL A C     1 
ATOM   555   O  O     . VAL A  1 99  ? -31.375 -34.432 -27.683 1.00 27.37  ? 71  VAL A O     1 
ATOM   556   C  CB    . VAL A  1 99  ? -31.659 -37.426 -27.515 1.00 29.23  ? 71  VAL A CB    1 
ATOM   557   C  CG1   . VAL A  1 99  ? -30.717 -37.709 -28.689 1.00 32.21  ? 71  VAL A CG1   1 
ATOM   558   C  CG2   . VAL A  1 99  ? -32.048 -38.724 -26.825 1.00 35.39  ? 71  VAL A CG2   1 
ATOM   559   N  N     . ALA A  1 100 ? -29.245 -34.947 -27.200 1.00 30.80  ? 72  ALA A N     1 
ATOM   560   C  CA    . ALA A  1 100 ? -28.672 -33.760 -27.823 1.00 32.38  ? 72  ALA A CA    1 
ATOM   561   C  C     . ALA A  1 100 ? -28.134 -34.073 -29.212 1.00 33.10  ? 72  ALA A C     1 
ATOM   562   O  O     . ALA A  1 100 ? -27.423 -35.061 -29.390 1.00 27.80  ? 72  ALA A O     1 
ATOM   563   C  CB    . ALA A  1 100 ? -27.564 -33.198 -26.956 1.00 30.20  ? 72  ALA A CB    1 
ATOM   564   N  N     . ILE A  1 101 ? -28.433 -33.224 -30.197 1.00 27.05  ? 73  ILE A N     1 
ATOM   565   C  CA    . ILE A  1 101 ? -27.846 -33.436 -31.510 1.00 28.55  ? 73  ILE A CA    1 
ATOM   566   C  C     . ILE A  1 101 ? -27.109 -32.180 -31.961 1.00 32.15  ? 73  ILE A C     1 
ATOM   567   O  O     . ILE A  1 101 ? -27.416 -31.066 -31.523 1.00 31.00  ? 73  ILE A O     1 
ATOM   568   C  CB    . ILE A  1 101 ? -28.911 -33.852 -32.566 1.00 25.11  ? 73  ILE A CB    1 
ATOM   569   C  CG1   . ILE A  1 101 ? -29.888 -32.712 -32.855 1.00 28.60  ? 73  ILE A CG1   1 
ATOM   570   C  CG2   . ILE A  1 101 ? -29.679 -35.096 -32.105 1.00 26.41  ? 73  ILE A CG2   1 
ATOM   571   C  CD1   . ILE A  1 101 ? -30.679 -32.893 -34.142 1.00 29.78  ? 73  ILE A CD1   1 
ATOM   572   N  N     . ALA A  1 102 ? -26.126 -32.369 -32.830 1.00 27.56  ? 74  ALA A N     1 
ATOM   573   C  CA    . ALA A  1 102 ? -25.371 -31.260 -33.387 1.00 26.42  ? 74  ALA A CA    1 
ATOM   574   C  C     . ALA A  1 102 ? -25.156 -31.493 -34.865 1.00 30.63  ? 74  ALA A C     1 
ATOM   575   O  O     . ALA A  1 102 ? -24.941 -32.628 -35.290 1.00 25.98  ? 74  ALA A O     1 
ATOM   576   C  CB    . ALA A  1 102 ? -24.027 -31.099 -32.672 1.00 27.82  ? 74  ALA A CB    1 
ATOM   577   N  N     . LEU A  1 103 ? -25.223 -30.422 -35.651 1.00 33.13  ? 75  LEU A N     1 
ATOM   578   C  CA    . LEU A  1 103 ? -24.872 -30.507 -37.069 1.00 30.19  ? 75  LEU A CA    1 
ATOM   579   C  C     . LEU A  1 103 ? -23.814 -29.471 -37.373 1.00 31.80  ? 75  LEU A C     1 
ATOM   580   O  O     . LEU A  1 103 ? -23.968 -28.272 -37.032 1.00 29.08  ? 75  LEU A O     1 
ATOM   581   C  CB    . LEU A  1 103 ? -26.098 -30.302 -37.978 1.00 28.55  ? 75  LEU A CB    1 
ATOM   582   C  CG    . LEU A  1 103 ? -26.956 -31.540 -38.278 1.00 30.77  ? 75  LEU A CG    1 
ATOM   583   C  CD1   . LEU A  1 103 ? -27.776 -31.942 -37.077 1.00 28.44  ? 75  LEU A CD1   1 
ATOM   584   C  CD2   . LEU A  1 103 ? -27.854 -31.330 -39.484 1.00 26.99  ? 75  LEU A CD2   1 
ATOM   585   N  N     . ALA A  1 104 ? -22.733 -29.922 -37.997 1.00 26.60  ? 76  ALA A N     1 
ATOM   586   C  CA    . ALA A  1 104 ? -21.668 -29.017 -38.419 1.00 32.01  ? 76  ALA A CA    1 
ATOM   587   C  C     . ALA A  1 104 ? -22.099 -28.200 -39.640 1.00 30.99  ? 76  ALA A C     1 
ATOM   588   O  O     . ALA A  1 104 ? -22.645 -28.748 -40.607 1.00 31.95  ? 76  ALA A O     1 
ATOM   589   C  CB    . ALA A  1 104 ? -20.411 -29.784 -38.735 1.00 29.83  ? 76  ALA A CB    1 
ATOM   590   N  N     . TYR A  1 105 ? -21.823 -26.904 -39.609 1.00 29.40  ? 77  TYR A N     1 
ATOM   591   C  CA    . TYR A  1 105 ? -22.133 -26.050 -40.752 1.00 29.80  ? 77  TYR A CA    1 
ATOM   592   C  C     . TYR A  1 105 ? -20.890 -25.428 -41.376 1.00 28.99  ? 77  TYR A C     1 
ATOM   593   O  O     . TYR A  1 105 ? -19.870 -25.271 -40.711 1.00 30.86  ? 77  TYR A O     1 
ATOM   594   C  CB    . TYR A  1 105 ? -23.138 -24.965 -40.337 1.00 26.21  ? 77  TYR A CB    1 
ATOM   595   C  CG    . TYR A  1 105 ? -22.717 -24.033 -39.224 1.00 27.88  ? 77  TYR A CG    1 
ATOM   596   C  CD1   . TYR A  1 105 ? -21.841 -22.978 -39.469 1.00 28.10  ? 77  TYR A CD1   1 
ATOM   597   C  CD2   . TYR A  1 105 ? -23.241 -24.170 -37.936 1.00 28.79  ? 77  TYR A CD2   1 
ATOM   598   C  CE1   . TYR A  1 105 ? -21.481 -22.090 -38.450 1.00 33.89  ? 77  TYR A CE1   1 
ATOM   599   C  CE2   . TYR A  1 105 ? -22.886 -23.293 -36.920 1.00 28.06  ? 77  TYR A CE2   1 
ATOM   600   C  CZ    . TYR A  1 105 ? -22.009 -22.253 -37.182 1.00 30.68  ? 77  TYR A CZ    1 
ATOM   601   O  OH    . TYR A  1 105 ? -21.654 -21.369 -36.183 1.00 30.94  ? 77  TYR A OH    1 
ATOM   602   N  N     . PRO A  1 106 ? -20.970 -25.059 -42.664 1.00 28.17  ? 78  PRO A N     1 
ATOM   603   C  CA    . PRO A  1 106 ? -19.775 -24.523 -43.336 1.00 33.34  ? 78  PRO A CA    1 
ATOM   604   C  C     . PRO A  1 106 ? -19.261 -23.196 -42.762 1.00 32.01  ? 78  PRO A C     1 
ATOM   605   O  O     . PRO A  1 106 ? -20.028 -22.342 -42.329 1.00 32.05  ? 78  PRO A O     1 
ATOM   606   C  CB    . PRO A  1 106 ? -20.234 -24.338 -44.787 1.00 35.91  ? 78  PRO A CB    1 
ATOM   607   C  CG    . PRO A  1 106 ? -21.729 -24.354 -44.746 1.00 35.85  ? 78  PRO A CG    1 
ATOM   608   C  CD    . PRO A  1 106 ? -22.118 -25.188 -43.575 1.00 28.01  ? 78  PRO A CD    1 
ATOM   609   N  N     . SER A  1 107 ? -17.942 -23.044 -42.770 1.00 36.43  ? 79  SER A N     1 
ATOM   610   C  CA    . SER A  1 107 ? -17.291 -21.857 -42.252 1.00 33.30  ? 79  SER A CA    1 
ATOM   611   C  C     . SER A  1 107 ? -16.611 -21.044 -43.345 1.00 33.91  ? 79  SER A C     1 
ATOM   612   O  O     . SER A  1 107 ? -16.169 -19.919 -43.093 1.00 36.95  ? 79  SER A O     1 
ATOM   613   C  CB    . SER A  1 107 ? -16.261 -22.239 -41.190 1.00 38.37  ? 79  SER A CB    1 
ATOM   614   O  OG    . SER A  1 107 ? -15.173 -22.923 -41.789 1.00 38.39  ? 79  SER A OG    1 
ATOM   615   N  N     . ARG A  1 108 ? -16.522 -21.595 -44.556 1.00 37.29  ? 80  ARG A N     1 
ATOM   616   C  CA    . ARG A  1 108 ? -15.958 -20.853 -45.686 1.00 34.70  ? 80  ARG A CA    1 
ATOM   617   C  C     . ARG A  1 108 ? -16.909 -20.881 -46.861 1.00 40.68  ? 80  ARG A C     1 
ATOM   618   O  O     . ARG A  1 108 ? -17.466 -21.922 -47.210 1.00 38.82  ? 80  ARG A O     1 
ATOM   619   C  CB    . ARG A  1 108 ? -14.588 -21.404 -46.114 1.00 43.08  ? 80  ARG A CB    1 
ATOM   620   C  CG    . ARG A  1 108 ? -13.492 -21.309 -45.045 1.00 47.48  ? 80  ARG A CG    1 
ATOM   621   C  CD    . ARG A  1 108 ? -12.088 -21.560 -45.611 1.00 57.04  ? 80  ARG A CD    1 
ATOM   622   N  NE    . ARG A  1 108 ? -11.245 -22.309 -44.671 1.00 64.30  ? 80  ARG A NE    1 
ATOM   623   C  CZ    . ARG A  1 108 ? -10.959 -23.604 -44.793 1.00 60.54  ? 80  ARG A CZ    1 
ATOM   624   N  NH1   . ARG A  1 108 ? -11.444 -24.294 -45.825 1.00 62.46  ? 80  ARG A NH1   1 
ATOM   625   N  NH2   . ARG A  1 108 ? -10.186 -24.214 -43.896 1.00 53.11  ? 80  ARG A NH2   1 
ATOM   626   N  N     . MET A  1 109 ? -17.066 -19.713 -47.469 1.00 36.42  ? 81  MET A N     1 
ATOM   627   C  CA    . MET A  1 109 ? -17.966 -19.488 -48.587 1.00 42.34  ? 81  MET A CA    1 
ATOM   628   C  C     . MET A  1 109 ? -17.218 -19.685 -49.908 1.00 47.06  ? 81  MET A C     1 
ATOM   629   O  O     . MET A  1 109 ? -16.283 -18.946 -50.211 1.00 52.24  ? 81  MET A O     1 
ATOM   630   C  CB    . MET A  1 109 ? -18.542 -18.068 -48.490 1.00 41.11  ? 81  MET A CB    1 
ATOM   631   C  CG    . MET A  1 109 ? -19.732 -17.756 -49.367 1.00 41.64  ? 81  MET A CG    1 
ATOM   632   S  SD    . MET A  1 109 ? -20.133 -15.986 -49.360 1.00 43.75  ? 81  MET A SD    1 
ATOM   633   C  CE    . MET A  1 109 ? -20.686 -15.680 -47.682 1.00 37.99  ? 81  MET A CE    1 
ATOM   634   N  N     . LYS A  1 110 ? -17.622 -20.681 -50.687 1.00 48.57  ? 82  LYS A N     1 
ATOM   635   C  CA    . LYS A  1 110 ? -17.050 -20.905 -52.011 1.00 51.82  ? 82  LYS A CA    1 
ATOM   636   C  C     . LYS A  1 110 ? -17.419 -19.760 -52.953 1.00 53.64  ? 82  LYS A C     1 
ATOM   637   O  O     . LYS A  1 110 ? -18.595 -19.434 -53.108 1.00 51.44  ? 82  LYS A O     1 
ATOM   638   C  CB    . LYS A  1 110 ? -17.539 -22.235 -52.580 1.00 48.27  ? 82  LYS A CB    1 
ATOM   639   C  CG    . LYS A  1 110 ? -16.719 -22.769 -53.742 1.00 71.21  ? 82  LYS A CG    1 
ATOM   640   C  CD    . LYS A  1 110 ? -17.157 -24.189 -54.142 1.00 73.68  ? 82  LYS A CD    1 
ATOM   641   C  CE    . LYS A  1 110 ? -18.299 -24.185 -55.158 1.00 72.46  ? 82  LYS A CE    1 
ATOM   642   N  NZ    . LYS A  1 110 ? -17.862 -23.725 -56.511 1.00 75.93  ? 82  LYS A NZ    1 
ATOM   643   N  N     . ASP A  1 111 ? -16.409 -19.150 -53.567 1.00 56.46  ? 83  ASP A N     1 
ATOM   644   C  CA    . ASP A  1 111 ? -16.617 -18.071 -54.536 1.00 62.27  ? 83  ASP A CA    1 
ATOM   645   C  C     . ASP A  1 111 ? -17.344 -16.886 -53.919 1.00 59.33  ? 83  ASP A C     1 
ATOM   646   O  O     . ASP A  1 111 ? -18.337 -16.396 -54.460 1.00 57.06  ? 83  ASP A O     1 
ATOM   647   C  CB    . ASP A  1 111 ? -17.395 -18.567 -55.764 1.00 64.34  ? 83  ASP A CB    1 
ATOM   648   C  CG    . ASP A  1 111 ? -16.558 -19.452 -56.673 1.00 71.92  ? 83  ASP A CG    1 
ATOM   649   O  OD1   . ASP A  1 111 ? -15.927 -18.909 -57.606 1.00 72.17  ? 83  ASP A OD1   1 
ATOM   650   O  OD2   . ASP A  1 111 ? -16.532 -20.686 -56.457 1.00 72.78  ? 83  ASP A OD2   1 
ATOM   651   N  N     . ALA A  1 112 ? -16.855 -16.430 -52.777 1.00 56.50  ? 84  ALA A N     1 
ATOM   652   C  CA    . ALA A  1 112 ? -17.360 -15.193 -52.211 1.00 51.36  ? 84  ALA A CA    1 
ATOM   653   C  C     . ALA A  1 112 ? -17.071 -14.041 -53.177 1.00 56.18  ? 84  ALA A C     1 
ATOM   654   O  O     . ALA A  1 112 ? -15.949 -13.912 -53.666 1.00 52.59  ? 84  ALA A O     1 
ATOM   655   C  CB    . ALA A  1 112 ? -16.731 -14.939 -50.853 1.00 49.43  ? 84  ALA A CB    1 
ATOM   656   N  N     . PRO A  1 113 ? -18.092 -13.211 -53.468 1.00 57.11  ? 85  PRO A N     1 
ATOM   657   C  CA    . PRO A  1 113 ? -17.911 -12.020 -54.311 1.00 56.59  ? 85  PRO A CA    1 
ATOM   658   C  C     . PRO A  1 113 ? -17.025 -10.978 -53.628 1.00 54.50  ? 85  PRO A C     1 
ATOM   659   O  O     . PRO A  1 113 ? -16.902 -10.997 -52.404 1.00 59.53  ? 85  PRO A O     1 
ATOM   660   C  CB    . PRO A  1 113 ? -19.341 -11.495 -54.495 1.00 53.27  ? 85  PRO A CB    1 
ATOM   661   C  CG    . PRO A  1 113 ? -20.081 -11.984 -53.297 1.00 51.95  ? 85  PRO A CG    1 
ATOM   662   C  CD    . PRO A  1 113 ? -19.465 -13.311 -52.937 1.00 50.97  ? 85  PRO A CD    1 
ATOM   663   N  N     . ARG A  1 114 ? -16.412 -10.089 -54.402 1.00 58.58  ? 86  ARG A N     1 
ATOM   664   C  CA    . ARG A  1 114 ? -15.529 -9.076  -53.824 1.00 64.46  ? 86  ARG A CA    1 
ATOM   665   C  C     . ARG A  1 114 ? -16.259 -7.748  -53.595 1.00 63.03  ? 86  ARG A C     1 
ATOM   666   O  O     . ARG A  1 114 ? -16.966 -7.249  -54.477 1.00 58.90  ? 86  ARG A O     1 
ATOM   667   C  CB    . ARG A  1 114 ? -14.307 -8.855  -54.720 1.00 62.30  ? 86  ARG A CB    1 
ATOM   668   N  N     . SER A  1 115 ? -16.083 -7.194  -52.397 1.00 62.93  ? 87  SER A N     1 
ATOM   669   C  CA    . SER A  1 115 ? -16.705 -5.933  -51.995 1.00 55.03  ? 87  SER A CA    1 
ATOM   670   C  C     . SER A  1 115 ? -15.860 -4.748  -52.486 1.00 64.23  ? 87  SER A C     1 
ATOM   671   O  O     . SER A  1 115 ? -14.820 -4.441  -51.899 1.00 73.94  ? 87  SER A O     1 
ATOM   672   C  CB    . SER A  1 115 ? -16.874 -5.903  -50.461 1.00 53.86  ? 87  SER A CB    1 
ATOM   673   O  OG    . SER A  1 115 ? -17.419 -4.678  -49.981 1.00 49.04  ? 87  SER A OG    1 
ATOM   674   N  N     . THR A  1 116 ? -16.302 -4.089  -53.558 1.00 64.41  ? 88  THR A N     1 
ATOM   675   C  CA    . THR A  1 116 ? -15.508 -3.035  -54.211 1.00 61.02  ? 88  THR A CA    1 
ATOM   676   C  C     . THR A  1 116 ? -15.905 -1.614  -53.796 1.00 59.84  ? 88  THR A C     1 
ATOM   677   O  O     . THR A  1 116 ? -16.983 -1.400  -53.245 1.00 53.84  ? 88  THR A O     1 
ATOM   678   C  CB    . THR A  1 116 ? -15.617 -3.123  -55.749 1.00 57.18  ? 88  THR A CB    1 
ATOM   679   O  OG1   . THR A  1 116 ? -16.799 -2.436  -56.192 1.00 58.07  ? 88  THR A OG1   1 
ATOM   680   C  CG2   . THR A  1 116 ? -15.652 -4.589  -56.203 1.00 57.77  ? 88  THR A CG2   1 
ATOM   681   N  N     . ARG A  1 117 ? -15.031 -0.652  -54.098 1.00 57.70  ? 89  ARG A N     1 
ATOM   682   C  CA    . ARG A  1 117 ? -15.215 0.751   -53.726 1.00 58.05  ? 89  ARG A CA    1 
ATOM   683   C  C     . ARG A  1 117 ? -16.614 1.266   -54.086 1.00 55.78  ? 89  ARG A C     1 
ATOM   684   O  O     . ARG A  1 117 ? -17.256 1.971   -53.306 1.00 55.25  ? 89  ARG A O     1 
ATOM   685   C  CB    . ARG A  1 117 ? -14.132 1.609   -54.402 1.00 63.88  ? 89  ARG A CB    1 
ATOM   686   C  CG    . ARG A  1 117 ? -13.977 3.031   -53.857 1.00 67.73  ? 89  ARG A CG    1 
ATOM   687   C  CD    . ARG A  1 117 ? -13.293 3.057   -52.491 1.00 71.26  ? 89  ARG A CD    1 
ATOM   688   N  NE    . ARG A  1 117 ? -12.873 4.407   -52.106 1.00 79.29  ? 89  ARG A NE    1 
ATOM   689   C  CZ    . ARG A  1 117 ? -13.582 5.236   -51.336 1.00 81.74  ? 89  ARG A CZ    1 
ATOM   690   N  NH1   . ARG A  1 117 ? -14.764 4.864   -50.853 1.00 79.31  ? 89  ARG A NH1   1 
ATOM   691   N  NH2   . ARG A  1 117 ? -13.109 6.443   -51.045 1.00 77.03  ? 89  ARG A NH2   1 
ATOM   692   N  N     . THR A  1 118 ? -17.096 0.881   -55.260 1.00 54.45  ? 90  THR A N     1 
ATOM   693   C  CA    . THR A  1 118 ? -18.416 1.298   -55.727 1.00 60.03  ? 90  THR A CA    1 
ATOM   694   C  C     . THR A  1 118 ? -19.529 0.284   -55.382 1.00 57.41  ? 90  THR A C     1 
ATOM   695   O  O     . THR A  1 118 ? -20.697 0.654   -55.180 1.00 52.47  ? 90  THR A O     1 
ATOM   696   C  CB    . THR A  1 118 ? -18.388 1.533   -57.252 1.00 64.54  ? 90  THR A CB    1 
ATOM   697   O  OG1   . THR A  1 118 ? -19.725 1.715   -57.740 1.00 68.00  ? 90  THR A OG1   1 
ATOM   698   C  CG2   . THR A  1 118 ? -17.724 0.354   -57.959 1.00 56.52  ? 90  THR A CG2   1 
ATOM   699   N  N     . GLU A  1 119 ? -19.151 -0.989  -55.308 1.00 54.90  ? 91  GLU A N     1 
ATOM   700   C  CA    . GLU A  1 119 ? -20.089 -2.066  -55.015 1.00 56.10  ? 91  GLU A CA    1 
ATOM   701   C  C     . GLU A  1 119 ? -19.800 -2.680  -53.649 1.00 46.03  ? 91  GLU A C     1 
ATOM   702   O  O     . GLU A  1 119 ? -19.279 -3.784  -53.573 1.00 46.70  ? 91  GLU A O     1 
ATOM   703   C  CB    . GLU A  1 119 ? -20.015 -3.149  -56.097 1.00 51.26  ? 91  GLU A CB    1 
ATOM   704   C  CG    . GLU A  1 119 ? -20.267 -2.641  -57.520 1.00 62.72  ? 91  GLU A CG    1 
ATOM   705   C  CD    . GLU A  1 119 ? -21.733 -2.300  -57.787 1.00 66.53  ? 91  GLU A CD    1 
ATOM   706   O  OE1   . GLU A  1 119 ? -22.411 -3.087  -58.489 1.00 70.56  ? 91  GLU A OE1   1 
ATOM   707   O  OE2   . GLU A  1 119 ? -22.203 -1.244  -57.310 1.00 60.03  ? 91  GLU A OE2   1 
ATOM   708   N  N     . ARG A  1 120 ? -20.122 -1.959  -52.579 1.00 39.70  ? 92  ARG A N     1 
ATOM   709   C  CA    . ARG A  1 120 ? -19.827 -2.436  -51.234 1.00 44.03  ? 92  ARG A CA    1 
ATOM   710   C  C     . ARG A  1 120 ? -20.815 -3.529  -50.817 1.00 38.08  ? 92  ARG A C     1 
ATOM   711   O  O     . ARG A  1 120 ? -21.996 -3.472  -51.172 1.00 34.22  ? 92  ARG A O     1 
ATOM   712   C  CB    . ARG A  1 120 ? -19.863 -1.278  -50.230 1.00 40.48  ? 92  ARG A CB    1 
ATOM   713   C  CG    . ARG A  1 120 ? -18.866 -0.171  -50.519 1.00 45.63  ? 92  ARG A CG    1 
ATOM   714   C  CD    . ARG A  1 120 ? -17.430 -0.628  -50.282 1.00 50.27  ? 92  ARG A CD    1 
ATOM   715   N  NE    . ARG A  1 120 ? -16.535 0.522   -50.169 1.00 57.31  ? 92  ARG A NE    1 
ATOM   716   C  CZ    . ARG A  1 120 ? -15.237 0.453   -49.888 1.00 53.28  ? 92  ARG A CZ    1 
ATOM   717   N  NH1   . ARG A  1 120 ? -14.650 -0.722  -49.706 1.00 51.20  ? 92  ARG A NH1   1 
ATOM   718   N  NH2   . ARG A  1 120 ? -14.526 1.570   -49.797 1.00 58.04  ? 92  ARG A NH2   1 
ATOM   719   N  N     . ARG A  1 121 ? -20.327 -4.510  -50.060 1.00 34.19  ? 93  ARG A N     1 
ATOM   720   C  CA    . ARG A  1 121 ? -21.182 -5.581  -49.543 1.00 36.00  ? 93  ARG A CA    1 
ATOM   721   C  C     . ARG A  1 121 ? -21.240 -5.628  -48.004 1.00 32.38  ? 93  ARG A C     1 
ATOM   722   O  O     . ARG A  1 121 ? -20.312 -5.180  -47.321 1.00 29.80  ? 93  ARG A O     1 
ATOM   723   C  CB    . ARG A  1 121 ? -20.705 -6.937  -50.094 1.00 30.55  ? 93  ARG A CB    1 
ATOM   724   C  CG    . ARG A  1 121 ? -20.851 -7.031  -51.600 1.00 36.71  ? 93  ARG A CG    1 
ATOM   725   C  CD    . ARG A  1 121 ? -20.315 -8.332  -52.210 1.00 39.73  ? 93  ARG A CD    1 
ATOM   726   N  NE    . ARG A  1 121 ? -20.588 -8.351  -53.645 1.00 35.29  ? 93  ARG A NE    1 
ATOM   727   C  CZ    . ARG A  1 121 ? -21.702 -8.832  -54.194 1.00 36.22  ? 93  ARG A CZ    1 
ATOM   728   N  NH1   . ARG A  1 121 ? -22.649 -9.377  -53.435 1.00 35.10  ? 93  ARG A NH1   1 
ATOM   729   N  NH2   . ARG A  1 121 ? -21.860 -8.789  -55.509 1.00 36.04  ? 93  ARG A NH2   1 
ATOM   730   N  N     . GLY A  1 122 ? -22.329 -6.177  -47.468 1.00 30.41  ? 94  GLY A N     1 
ATOM   731   C  CA    . GLY A  1 122 ? -22.383 -6.549  -46.054 1.00 29.64  ? 94  GLY A CA    1 
ATOM   732   C  C     . GLY A  1 122 ? -22.238 -8.057  -45.869 1.00 31.54  ? 94  GLY A C     1 
ATOM   733   O  O     . GLY A  1 122 ? -22.134 -8.802  -46.833 1.00 32.72  ? 94  GLY A O     1 
ATOM   734   N  N     . ILE A  1 123 ? -22.236 -8.523  -44.628 1.00 29.23  ? 95  ILE A N     1 
ATOM   735   C  CA    . ILE A  1 123 ? -22.007 -9.937  -44.374 1.00 32.44  ? 95  ILE A CA    1 
ATOM   736   C  C     . ILE A  1 123 ? -22.932 -10.488 -43.269 1.00 33.64  ? 95  ILE A C     1 
ATOM   737   O  O     . ILE A  1 123 ? -23.112 -9.865  -42.198 1.00 29.49  ? 95  ILE A O     1 
ATOM   738   C  CB    . ILE A  1 123 ? -20.520 -10.183 -44.002 1.00 32.67  ? 95  ILE A CB    1 
ATOM   739   C  CG1   . ILE A  1 123 ? -20.265 -11.664 -43.694 1.00 34.57  ? 95  ILE A CG1   1 
ATOM   740   C  CG2   . ILE A  1 123 ? -20.068 -9.253  -42.851 1.00 28.60  ? 95  ILE A CG2   1 
ATOM   741   C  CD1   . ILE A  1 123 ? -20.248 -12.563 -44.952 1.00 36.00  ? 95  ILE A CD1   1 
ATOM   742   N  N     . PHE A  1 124 ? -23.555 -11.632 -43.557 1.00 29.33  ? 96  PHE A N     1 
ATOM   743   C  CA    . PHE A  1 124 ? -24.291 -12.395 -42.553 1.00 29.07  ? 96  PHE A CA    1 
ATOM   744   C  C     . PHE A  1 124 ? -23.351 -13.397 -41.912 1.00 29.03  ? 96  PHE A C     1 
ATOM   745   O  O     . PHE A  1 124 ? -22.516 -13.975 -42.607 1.00 29.11  ? 96  PHE A O     1 
ATOM   746   C  CB    . PHE A  1 124 ? -25.481 -13.135 -43.163 1.00 29.15  ? 96  PHE A CB    1 
ATOM   747   C  CG    . PHE A  1 124 ? -26.647 -12.256 -43.490 1.00 30.29  ? 96  PHE A CG    1 
ATOM   748   C  CD1   . PHE A  1 124 ? -27.843 -12.392 -42.797 1.00 27.30  ? 96  PHE A CD1   1 
ATOM   749   C  CD2   . PHE A  1 124 ? -26.562 -11.313 -44.506 1.00 31.65  ? 96  PHE A CD2   1 
ATOM   750   C  CE1   . PHE A  1 124 ? -28.938 -11.588 -43.089 1.00 26.05  ? 96  PHE A CE1   1 
ATOM   751   C  CE2   . PHE A  1 124 ? -27.657 -10.495 -44.812 1.00 31.25  ? 96  PHE A CE2   1 
ATOM   752   C  CZ    . PHE A  1 124 ? -28.847 -10.635 -44.108 1.00 29.52  ? 96  PHE A CZ    1 
ATOM   753   N  N     . CYS A  1 125 ? -23.496 -13.603 -40.603 1.00 30.08  ? 97  CYS A N     1 
ATOM   754   C  CA    . CYS A  1 125 ? -22.728 -14.612 -39.874 1.00 27.33  ? 97  CYS A CA    1 
ATOM   755   C  C     . CYS A  1 125 ? -22.941 -16.025 -40.436 1.00 27.28  ? 97  CYS A C     1 
ATOM   756   O  O     . CYS A  1 125 ? -23.975 -16.328 -41.047 1.00 25.17  ? 97  CYS A O     1 
ATOM   757   C  CB    . CYS A  1 125 ? -23.099 -14.605 -38.392 1.00 27.82  ? 97  CYS A CB    1 
ATOM   758   S  SG    . CYS A  1 125 ? -24.737 -15.287 -38.039 1.00 28.35  ? 97  CYS A SG    1 
ATOM   759   N  N     . ARG A  1 126 ? -21.968 -16.892 -40.191 1.00 26.17  ? 98  ARG A N     1 
ATOM   760   C  CA    . ARG A  1 126 ? -22.022 -18.272 -40.677 1.00 31.88  ? 98  ARG A CA    1 
ATOM   761   C  C     . ARG A  1 126 ? -23.295 -19.009 -40.251 1.00 30.80  ? 98  ARG A C     1 
ATOM   762   O  O     . ARG A  1 126 ? -23.786 -19.877 -40.990 1.00 24.69  ? 98  ARG A O     1 
ATOM   763   C  CB    . ARG A  1 126 ? -20.767 -19.035 -40.211 1.00 30.89  ? 98  ARG A CB    1 
ATOM   764   C  CG    . ARG A  1 126 ? -19.498 -18.564 -40.954 1.00 30.07  ? 98  ARG A CG    1 
ATOM   765   C  CD    . ARG A  1 126 ? -18.197 -18.785 -40.160 1.00 31.46  ? 98  ARG A CD    1 
ATOM   766   N  NE    . ARG A  1 126 ? -17.036 -18.351 -40.941 1.00 30.67  ? 98  ARG A NE    1 
ATOM   767   C  CZ    . ARG A  1 126 ? -16.638 -17.083 -41.062 1.00 33.05  ? 98  ARG A CZ    1 
ATOM   768   N  NH1   . ARG A  1 126 ? -17.271 -16.105 -40.420 1.00 31.68  ? 98  ARG A NH1   1 
ATOM   769   N  NH2   . ARG A  1 126 ? -15.580 -16.789 -41.804 1.00 28.89  ? 98  ARG A NH2   1 
ATOM   770   N  N     . ALA A  1 127 ? -23.852 -18.642 -39.090 1.00 30.13  ? 99  ALA A N     1 
ATOM   771   C  CA    . ALA A  1 127 ? -25.045 -19.329 -38.572 1.00 28.23  ? 99  ALA A CA    1 
ATOM   772   C  C     . ALA A  1 127 ? -26.314 -18.891 -39.314 1.00 29.80  ? 99  ALA A C     1 
ATOM   773   O  O     . ALA A  1 127 ? -27.421 -19.357 -39.001 1.00 27.39  ? 99  ALA A O     1 
ATOM   774   C  CB    . ALA A  1 127 ? -25.205 -19.095 -37.073 1.00 23.39  ? 99  ALA A CB    1 
ATOM   775   N  N     . SER A  1 128 ? -26.146 -18.002 -40.293 1.00 25.75  ? 100 SER A N     1 
ATOM   776   C  CA    . SER A  1 128 ? -27.250 -17.556 -41.134 1.00 28.33  ? 100 SER A CA    1 
ATOM   777   C  C     . SER A  1 128 ? -26.960 -17.787 -42.608 1.00 29.09  ? 100 SER A C     1 
ATOM   778   O  O     . SER A  1 128 ? -27.509 -17.087 -43.463 1.00 30.30  ? 100 SER A O     1 
ATOM   779   C  CB    . SER A  1 128 ? -27.561 -16.064 -40.896 1.00 30.24  ? 100 SER A CB    1 
ATOM   780   O  OG    . SER A  1 128 ? -28.635 -15.636 -41.724 1.00 27.09  ? 100 SER A OG    1 
ATOM   781   N  N     . TRP A  1 129 ? -26.096 -18.759 -42.904 1.00 29.56  ? 101 TRP A N     1 
ATOM   782   C  CA    . TRP A  1 129 ? -25.854 -19.200 -44.284 1.00 29.52  ? 101 TRP A CA    1 
ATOM   783   C  C     . TRP A  1 129 ? -26.770 -20.382 -44.639 1.00 31.34  ? 101 TRP A C     1 
ATOM   784   O  O     . TRP A  1 129 ? -26.893 -21.333 -43.868 1.00 27.79  ? 101 TRP A O     1 
ATOM   785   C  CB    . TRP A  1 129 ? -24.395 -19.619 -44.483 1.00 27.44  ? 101 TRP A CB    1 
ATOM   786   C  CG    . TRP A  1 129 ? -23.386 -18.532 -44.381 1.00 30.89  ? 101 TRP A CG    1 
ATOM   787   C  CD1   . TRP A  1 129 ? -23.621 -17.198 -44.168 1.00 26.73  ? 101 TRP A CD1   1 
ATOM   788   C  CD2   . TRP A  1 129 ? -21.960 -18.678 -44.490 1.00 29.60  ? 101 TRP A CD2   1 
ATOM   789   N  NE1   . TRP A  1 129 ? -22.433 -16.517 -44.121 1.00 27.89  ? 101 TRP A NE1   1 
ATOM   790   C  CE2   . TRP A  1 129 ? -21.398 -17.395 -44.324 1.00 32.92  ? 101 TRP A CE2   1 
ATOM   791   C  CE3   . TRP A  1 129 ? -21.107 -19.773 -44.698 1.00 30.21  ? 101 TRP A CE3   1 
ATOM   792   C  CZ2   . TRP A  1 129 ? -20.017 -17.170 -44.369 1.00 30.06  ? 101 TRP A CZ2   1 
ATOM   793   C  CZ3   . TRP A  1 129 ? -19.740 -19.550 -44.749 1.00 30.30  ? 101 TRP A CZ3   1 
ATOM   794   C  CH2   . TRP A  1 129 ? -19.207 -18.258 -44.591 1.00 31.38  ? 101 TRP A CH2   1 
ATOM   795   N  N     . GLY A  1 130 ? -27.412 -20.331 -45.798 1.00 31.01  ? 102 GLY A N     1 
ATOM   796   C  CA    . GLY A  1 130 ? -28.271 -21.433 -46.209 1.00 31.21  ? 102 GLY A CA    1 
ATOM   797   C  C     . GLY A  1 130 ? -29.623 -21.471 -45.511 1.00 30.91  ? 102 GLY A C     1 
ATOM   798   O  O     . GLY A  1 130 ? -30.052 -20.478 -44.920 1.00 30.70  ? 102 GLY A O     1 
ATOM   799   N  N     . LYS A  1 131 ? -30.296 -22.618 -45.591 1.00 28.56  ? 103 LYS A N     1 
ATOM   800   C  CA    . LYS A  1 131 ? -31.636 -22.806 -45.025 1.00 33.04  ? 103 LYS A CA    1 
ATOM   801   C  C     . LYS A  1 131 ? -31.581 -22.716 -43.495 1.00 31.93  ? 103 LYS A C     1 
ATOM   802   O  O     . LYS A  1 131 ? -30.805 -23.431 -42.849 1.00 29.99  ? 103 LYS A O     1 
ATOM   803   C  CB    . LYS A  1 131 ? -32.231 -24.171 -45.477 1.00 31.20  ? 103 LYS A CB    1 
ATOM   804   C  CG    . LYS A  1 131 ? -33.729 -24.458 -45.141 1.00 32.51  ? 103 LYS A CG    1 
ATOM   805   C  CD    . LYS A  1 131 ? -34.066 -26.005 -45.336 1.00 46.84  ? 103 LYS A CD    1 
ATOM   806   C  CE    . LYS A  1 131 ? -35.318 -26.540 -44.543 1.00 46.19  ? 103 LYS A CE    1 
ATOM   807   N  NZ    . LYS A  1 131 ? -35.240 -27.971 -43.899 1.00 32.51  ? 103 LYS A NZ    1 
ATOM   808   N  N     . ASP A  1 132 ? -32.390 -21.812 -42.946 1.00 28.52  ? 104 ASP A N     1 
ATOM   809   C  CA    . ASP A  1 132 ? -32.590 -21.638 -41.507 1.00 26.30  ? 104 ASP A CA    1 
ATOM   810   C  C     . ASP A  1 132 ? -32.388 -22.927 -40.694 1.00 27.70  ? 104 ASP A C     1 
ATOM   811   O  O     . ASP A  1 132 ? -33.103 -23.898 -40.887 1.00 25.28  ? 104 ASP A O     1 
ATOM   812   C  CB    . ASP A  1 132 ? -34.003 -21.096 -41.273 1.00 26.97  ? 104 ASP A CB    1 
ATOM   813   C  CG    . ASP A  1 132 ? -34.211 -20.578 -39.856 1.00 27.48  ? 104 ASP A CG    1 
ATOM   814   O  OD1   . ASP A  1 132 ? -35.276 -19.968 -39.597 1.00 30.91  ? 104 ASP A OD1   1 
ATOM   815   O  OD2   . ASP A  1 132 ? -33.305 -20.756 -39.014 1.00 25.43  ? 104 ASP A OD2   1 
ATOM   816   N  N     . TYR A  1 133 ? -31.411 -22.927 -39.792 1.00 25.94  ? 105 TYR A N     1 
ATOM   817   C  CA    . TYR A  1 133 ? -31.108 -24.115 -39.006 1.00 26.75  ? 105 TYR A CA    1 
ATOM   818   C  C     . TYR A  1 133 ? -32.290 -24.582 -38.145 1.00 28.83  ? 105 TYR A C     1 
ATOM   819   O  O     . TYR A  1 133 ? -32.387 -25.776 -37.817 1.00 25.67  ? 105 TYR A O     1 
ATOM   820   C  CB    . TYR A  1 133 ? -29.862 -23.874 -38.129 1.00 29.93  ? 105 TYR A CB    1 
ATOM   821   C  CG    . TYR A  1 133 ? -30.078 -22.967 -36.941 1.00 25.97  ? 105 TYR A CG    1 
ATOM   822   C  CD1   . TYR A  1 133 ? -30.334 -23.499 -35.679 1.00 25.37  ? 105 TYR A CD1   1 
ATOM   823   C  CD2   . TYR A  1 133 ? -30.028 -21.583 -37.078 1.00 24.95  ? 105 TYR A CD2   1 
ATOM   824   C  CE1   . TYR A  1 133 ? -30.540 -22.676 -34.580 1.00 26.69  ? 105 TYR A CE1   1 
ATOM   825   C  CE2   . TYR A  1 133 ? -30.242 -20.747 -35.988 1.00 26.37  ? 105 TYR A CE2   1 
ATOM   826   C  CZ    . TYR A  1 133 ? -30.497 -21.308 -34.739 1.00 27.92  ? 105 TYR A CZ    1 
ATOM   827   O  OH    . TYR A  1 133 ? -30.703 -20.513 -33.651 1.00 29.21  ? 105 TYR A OH    1 
ATOM   828   N  N     . HIS A  1 134 ? -33.188 -23.659 -37.780 1.00 27.53  ? 106 HIS A N     1 
ATOM   829   C  CA    . HIS A  1 134 ? -34.381 -24.048 -37.013 1.00 28.99  ? 106 HIS A CA    1 
ATOM   830   C  C     . HIS A  1 134 ? -35.156 -25.109 -37.790 1.00 28.02  ? 106 HIS A C     1 
ATOM   831   O  O     . HIS A  1 134 ? -35.590 -26.105 -37.210 1.00 28.17  ? 106 HIS A O     1 
ATOM   832   C  CB    . HIS A  1 134 ? -35.307 -22.864 -36.718 1.00 23.61  ? 106 HIS A CB    1 
ATOM   833   C  CG    . HIS A  1 134 ? -34.699 -21.811 -35.845 1.00 28.62  ? 106 HIS A CG    1 
ATOM   834   N  ND1   . HIS A  1 134 ? -33.946 -20.768 -36.350 1.00 27.45  ? 106 HIS A ND1   1 
ATOM   835   C  CD2   . HIS A  1 134 ? -34.758 -21.620 -34.506 1.00 25.15  ? 106 HIS A CD2   1 
ATOM   836   C  CE1   . HIS A  1 134 ? -33.552 -19.992 -35.353 1.00 28.48  ? 106 HIS A CE1   1 
ATOM   837   N  NE2   . HIS A  1 134 ? -34.031 -20.488 -34.223 1.00 27.87  ? 106 HIS A NE2   1 
ATOM   838   N  N     . ASP A  1 135 ? -35.328 -24.883 -39.091 1.00 26.01  ? 107 ASP A N     1 
ATOM   839   C  CA    . ASP A  1 135 ? -36.044 -25.830 -39.964 1.00 31.48  ? 107 ASP A CA    1 
ATOM   840   C  C     . ASP A  1 135 ? -35.256 -27.115 -40.174 1.00 31.14  ? 107 ASP A C     1 
ATOM   841   O  O     . ASP A  1 135 ? -35.827 -28.204 -40.152 1.00 32.32  ? 107 ASP A O     1 
ATOM   842   C  CB    . ASP A  1 135 ? -36.347 -25.214 -41.333 1.00 29.51  ? 107 ASP A CB    1 
ATOM   843   C  CG    . ASP A  1 135 ? -37.223 -23.972 -41.237 1.00 40.84  ? 107 ASP A CG    1 
ATOM   844   O  OD1   . ASP A  1 135 ? -38.153 -23.961 -40.412 1.00 47.03  ? 107 ASP A OD1   1 
ATOM   845   O  OD2   . ASP A  1 135 ? -36.981 -23.004 -41.982 1.00 42.11  ? 107 ASP A OD2   1 
ATOM   846   N  N     . VAL A  1 136 ? -33.952 -26.982 -40.423 1.00 31.02  ? 108 VAL A N     1 
ATOM   847   C  CA    . VAL A  1 136 ? -33.138 -28.147 -40.688 1.00 25.77  ? 108 VAL A CA    1 
ATOM   848   C  C     . VAL A  1 136 ? -33.119 -29.042 -39.446 1.00 33.71  ? 108 VAL A C     1 
ATOM   849   O  O     . VAL A  1 136 ? -33.413 -30.234 -39.535 1.00 28.14  ? 108 VAL A O     1 
ATOM   850   C  CB    . VAL A  1 136 ? -31.699 -27.766 -41.114 1.00 30.41  ? 108 VAL A CB    1 
ATOM   851   C  CG1   . VAL A  1 136 ? -30.850 -29.016 -41.249 1.00 26.53  ? 108 VAL A CG1   1 
ATOM   852   C  CG2   . VAL A  1 136 ? -31.695 -26.990 -42.459 1.00 24.19  ? 108 VAL A CG2   1 
ATOM   853   N  N     . LEU A  1 137 ? -32.814 -28.477 -38.273 1.00 25.34  ? 109 LEU A N     1 
ATOM   854   C  CA    . LEU A  1 137 ? -32.622 -29.342 -37.118 1.00 29.40  ? 109 LEU A CA    1 
ATOM   855   C  C     . LEU A  1 137 ? -33.971 -29.884 -36.605 1.00 30.67  ? 109 LEU A C     1 
ATOM   856   O  O     . LEU A  1 137 ? -34.034 -30.987 -36.082 1.00 27.15  ? 109 LEU A O     1 
ATOM   857   C  CB    . LEU A  1 137 ? -31.844 -28.618 -36.005 1.00 31.33  ? 109 LEU A CB    1 
ATOM   858   C  CG    . LEU A  1 137 ? -30.330 -28.828 -36.175 1.00 31.34  ? 109 LEU A CG    1 
ATOM   859   C  CD1   . LEU A  1 137 ? -29.735 -27.997 -37.369 1.00 26.94  ? 109 LEU A CD1   1 
ATOM   860   C  CD2   . LEU A  1 137 ? -29.581 -28.559 -34.881 1.00 28.59  ? 109 LEU A CD2   1 
ATOM   861   N  N     . ARG A  1 138 ? -35.055 -29.135 -36.802 1.00 32.85  ? 110 ARG A N     1 
ATOM   862   C  CA    . ARG A  1 138 ? -36.368 -29.624 -36.386 1.00 33.44  ? 110 ARG A CA    1 
ATOM   863   C  C     . ARG A  1 138 ? -36.779 -30.813 -37.238 1.00 32.06  ? 110 ARG A C     1 
ATOM   864   O  O     . ARG A  1 138 ? -37.431 -31.732 -36.754 1.00 32.46  ? 110 ARG A O     1 
ATOM   865   C  CB    . ARG A  1 138 ? -37.432 -28.524 -36.477 1.00 30.25  ? 110 ARG A CB    1 
ATOM   866   C  CG    . ARG A  1 138 ? -38.780 -28.931 -35.901 1.00 36.55  ? 110 ARG A CG    1 
ATOM   867   C  CD    . ARG A  1 138 ? -38.585 -29.828 -34.652 1.00 43.24  ? 110 ARG A CD    1 
ATOM   868   N  NE    . ARG A  1 138 ? -39.822 -30.419 -34.149 1.00 37.82  ? 110 ARG A NE    1 
ATOM   869   C  CZ    . ARG A  1 138 ? -40.497 -29.932 -33.110 1.00 50.10  ? 110 ARG A CZ    1 
ATOM   870   N  NH1   . ARG A  1 138 ? -40.040 -28.853 -32.474 1.00 40.18  ? 110 ARG A NH1   1 
ATOM   871   N  NH2   . ARG A  1 138 ? -41.619 -30.519 -32.710 1.00 47.12  ? 110 ARG A NH2   1 
ATOM   872   N  N     . GLU A  1 139 ? -36.413 -30.772 -38.513 1.00 30.20  ? 111 GLU A N     1 
ATOM   873   C  CA    . GLU A  1 139 ? -36.731 -31.850 -39.448 1.00 34.53  ? 111 GLU A CA    1 
ATOM   874   C  C     . GLU A  1 139 ? -36.093 -33.164 -38.987 1.00 29.73  ? 111 GLU A C     1 
ATOM   875   O  O     . GLU A  1 139 ? -36.717 -34.223 -39.031 1.00 29.42  ? 111 GLU A O     1 
ATOM   876   C  CB    . GLU A  1 139 ? -36.262 -31.476 -40.856 1.00 31.68  ? 111 GLU A CB    1 
ATOM   877   C  CG    . GLU A  1 139 ? -36.796 -32.361 -41.963 1.00 32.91  ? 111 GLU A CG    1 
ATOM   878   C  CD    . GLU A  1 139 ? -35.832 -33.479 -42.341 1.00 36.67  ? 111 GLU A CD    1 
ATOM   879   O  OE1   . GLU A  1 139 ? -34.658 -33.424 -41.924 1.00 31.43  ? 111 GLU A OE1   1 
ATOM   880   O  OE2   . GLU A  1 139 ? -36.244 -34.412 -43.069 1.00 39.74  ? 111 GLU A OE2   1 
ATOM   881   N  N     . LYS A  1 140 ? -34.850 -33.064 -38.527 1.00 29.79  ? 112 LYS A N     1 
ATOM   882   C  CA    . LYS A  1 140 ? -34.078 -34.195 -38.056 1.00 25.70  ? 112 LYS A CA    1 
ATOM   883   C  C     . LYS A  1 140 ? -34.642 -34.725 -36.742 1.00 36.12  ? 112 LYS A C     1 
ATOM   884   O  O     . LYS A  1 140 ? -34.729 -35.949 -36.531 1.00 30.83  ? 112 LYS A O     1 
ATOM   885   C  CB    . LYS A  1 140 ? -32.607 -33.805 -37.865 1.00 26.21  ? 112 LYS A CB    1 
ATOM   886   C  CG    . LYS A  1 140 ? -31.881 -33.375 -39.129 1.00 26.81  ? 112 LYS A CG    1 
ATOM   887   C  CD    . LYS A  1 140 ? -31.940 -34.437 -40.225 1.00 30.65  ? 112 LYS A CD    1 
ATOM   888   C  CE    . LYS A  1 140 ? -31.382 -33.877 -41.551 1.00 31.02  ? 112 LYS A CE    1 
ATOM   889   N  NZ    . LYS A  1 140 ? -31.522 -34.849 -42.678 1.00 34.38  ? 112 LYS A NZ    1 
ATOM   890   N  N     . LEU A  1 141 ? -34.997 -33.807 -35.845 1.00 24.93  ? 113 LEU A N     1 
ATOM   891   C  CA    . LEU A  1 141 ? -35.637 -34.200 -34.598 1.00 30.62  ? 113 LEU A CA    1 
ATOM   892   C  C     . LEU A  1 141 ? -36.983 -34.853 -34.875 1.00 32.38  ? 113 LEU A C     1 
ATOM   893   O  O     . LEU A  1 141 ? -37.332 -35.822 -34.219 1.00 31.15  ? 113 LEU A O     1 
ATOM   894   C  CB    . LEU A  1 141 ? -35.829 -32.997 -33.659 1.00 30.07  ? 113 LEU A CB    1 
ATOM   895   C  CG    . LEU A  1 141 ? -34.613 -32.282 -33.069 1.00 29.59  ? 113 LEU A CG    1 
ATOM   896   C  CD1   . LEU A  1 141 ? -35.073 -30.963 -32.445 1.00 32.58  ? 113 LEU A CD1   1 
ATOM   897   C  CD2   . LEU A  1 141 ? -33.900 -33.149 -32.036 1.00 32.30  ? 113 LEU A CD2   1 
ATOM   898   N  N     . ASP A  1 142 ? -37.757 -34.325 -35.825 1.00 28.31  ? 114 ASP A N     1 
ATOM   899   C  CA    . ASP A  1 142 ? -39.027 -34.978 -36.148 1.00 33.31  ? 114 ASP A CA    1 
ATOM   900   C  C     . ASP A  1 142 ? -38.822 -36.437 -36.580 1.00 37.57  ? 114 ASP A C     1 
ATOM   901   O  O     . ASP A  1 142 ? -39.651 -37.311 -36.283 1.00 29.86  ? 114 ASP A O     1 
ATOM   902   C  CB    . ASP A  1 142 ? -39.772 -34.231 -37.250 1.00 35.89  ? 114 ASP A CB    1 
ATOM   903   C  CG    . ASP A  1 142 ? -40.400 -32.938 -36.760 1.00 39.33  ? 114 ASP A CG    1 
ATOM   904   O  OD1   . ASP A  1 142 ? -40.357 -32.656 -35.541 1.00 36.62  ? 114 ASP A OD1   1 
ATOM   905   O  OD2   . ASP A  1 142 ? -40.954 -32.214 -37.608 1.00 38.98  ? 114 ASP A OD2   1 
ATOM   906   N  N     . LEU A  1 143 ? -37.717 -36.690 -37.280 1.00 32.65  ? 115 LEU A N     1 
ATOM   907   C  CA    . LEU A  1 143 ? -37.403 -38.050 -37.730 1.00 35.19  ? 115 LEU A CA    1 
ATOM   908   C  C     . LEU A  1 143 ? -36.988 -38.925 -36.555 1.00 36.42  ? 115 LEU A C     1 
ATOM   909   O  O     . LEU A  1 143 ? -37.323 -40.116 -36.510 1.00 35.10  ? 115 LEU A O     1 
ATOM   910   C  CB    . LEU A  1 143 ? -36.285 -38.045 -38.788 1.00 28.41  ? 115 LEU A CB    1 
ATOM   911   C  CG    . LEU A  1 143 ? -36.588 -37.487 -40.188 1.00 35.50  ? 115 LEU A CG    1 
ATOM   912   C  CD1   . LEU A  1 143 ? -35.299 -37.333 -41.016 1.00 30.48  ? 115 LEU A CD1   1 
ATOM   913   C  CD2   . LEU A  1 143 ? -37.590 -38.368 -40.945 1.00 31.20  ? 115 LEU A CD2   1 
ATOM   914   N  N     . LEU A  1 144 ? -36.225 -38.349 -35.628 1.00 33.51  ? 116 LEU A N     1 
ATOM   915   C  CA    . LEU A  1 144 ? -35.762 -39.103 -34.461 1.00 38.66  ? 116 LEU A CA    1 
ATOM   916   C  C     . LEU A  1 144 ? -36.948 -39.469 -33.584 1.00 36.65  ? 116 LEU A C     1 
ATOM   917   O  O     . LEU A  1 144 ? -37.040 -40.580 -33.060 1.00 34.47  ? 116 LEU A O     1 
ATOM   918   C  CB    . LEU A  1 144 ? -34.729 -38.308 -33.652 1.00 35.34  ? 116 LEU A CB    1 
ATOM   919   C  CG    . LEU A  1 144 ? -33.380 -38.128 -34.361 1.00 36.36  ? 116 LEU A CG    1 
ATOM   920   C  CD1   . LEU A  1 144 ? -32.315 -37.536 -33.437 1.00 35.14  ? 116 LEU A CD1   1 
ATOM   921   C  CD2   . LEU A  1 144 ? -32.918 -39.455 -34.938 1.00 40.00  ? 116 LEU A CD2   1 
ATOM   922   N  N     . GLU A  1 145 ? -37.865 -38.525 -33.446 1.00 35.21  ? 117 GLU A N     1 
ATOM   923   C  CA    . GLU A  1 145 ? -39.102 -38.749 -32.708 1.00 41.22  ? 117 GLU A CA    1 
ATOM   924   C  C     . GLU A  1 145 ? -39.946 -39.872 -33.331 1.00 40.90  ? 117 GLU A C     1 
ATOM   925   O  O     . GLU A  1 145 ? -40.412 -40.780 -32.624 1.00 39.19  ? 117 GLU A O     1 
ATOM   926   C  CB    . GLU A  1 145 ? -39.899 -37.445 -32.637 1.00 34.17  ? 117 GLU A CB    1 
ATOM   927   C  CG    . GLU A  1 145 ? -41.321 -37.606 -32.189 1.00 42.15  ? 117 GLU A CG    1 
ATOM   928   C  CD    . GLU A  1 145 ? -42.107 -36.334 -32.375 1.00 53.59  ? 117 GLU A CD    1 
ATOM   929   O  OE1   . GLU A  1 145 ? -41.490 -35.325 -32.803 1.00 49.67  ? 117 GLU A OE1   1 
ATOM   930   O  OE2   . GLU A  1 145 ? -43.334 -36.347 -32.103 1.00 51.76  ? 117 GLU A OE2   1 
ATOM   931   N  N     . ASP A  1 146 ? -40.129 -39.836 -34.649 1.00 37.68  ? 118 ASP A N     1 
ATOM   932   C  CA    . ASP A  1 146 ? -40.963 -40.847 -35.310 1.00 41.90  ? 118 ASP A CA    1 
ATOM   933   C  C     . ASP A  1 146 ? -40.314 -42.228 -35.254 1.00 37.88  ? 118 ASP A C     1 
ATOM   934   O  O     . ASP A  1 146 ? -41.002 -43.237 -35.171 1.00 35.55  ? 118 ASP A O     1 
ATOM   935   C  CB    . ASP A  1 146 ? -41.257 -40.462 -36.753 1.00 41.26  ? 118 ASP A CB    1 
ATOM   936   C  CG    . ASP A  1 146 ? -42.392 -41.281 -37.353 1.00 43.51  ? 118 ASP A CG    1 
ATOM   937   O  OD1   . ASP A  1 146 ? -43.549 -41.108 -36.917 1.00 45.00  ? 118 ASP A OD1   1 
ATOM   938   O  OD2   . ASP A  1 146 ? -42.138 -42.081 -38.277 1.00 43.85  ? 118 ASP A OD2   1 
ATOM   939   N  N     . PHE A  1 147 ? -38.984 -42.254 -35.289 1.00 35.17  ? 119 PHE A N     1 
ATOM   940   C  CA    . PHE A  1 147 ? -38.216 -43.460 -35.030 1.00 34.03  ? 119 PHE A CA    1 
ATOM   941   C  C     . PHE A  1 147 ? -38.587 -44.115 -33.690 1.00 41.80  ? 119 PHE A C     1 
ATOM   942   O  O     . PHE A  1 147 ? -38.823 -45.327 -33.627 1.00 44.83  ? 119 PHE A O     1 
ATOM   943   C  CB    . PHE A  1 147 ? -36.718 -43.140 -35.058 1.00 32.54  ? 119 PHE A CB    1 
ATOM   944   C  CG    . PHE A  1 147 ? -35.846 -44.276 -34.586 1.00 36.14  ? 119 PHE A CG    1 
ATOM   945   C  CD1   . PHE A  1 147 ? -35.433 -45.266 -35.470 1.00 40.06  ? 119 PHE A CD1   1 
ATOM   946   C  CD2   . PHE A  1 147 ? -35.440 -44.356 -33.260 1.00 35.38  ? 119 PHE A CD2   1 
ATOM   947   C  CE1   . PHE A  1 147 ? -34.637 -46.320 -35.037 1.00 42.27  ? 119 PHE A CE1   1 
ATOM   948   C  CE2   . PHE A  1 147 ? -34.639 -45.406 -32.821 1.00 40.22  ? 119 PHE A CE2   1 
ATOM   949   C  CZ    . PHE A  1 147 ? -34.241 -46.390 -33.706 1.00 40.00  ? 119 PHE A CZ    1 
ATOM   950   N  N     . LEU A  1 148 ? -38.612 -43.318 -32.618 1.00 35.55  ? 120 LEU A N     1 
ATOM   951   C  CA    . LEU A  1 148 ? -38.944 -43.826 -31.280 1.00 42.21  ? 120 LEU A CA    1 
ATOM   952   C  C     . LEU A  1 148 ? -40.433 -44.190 -31.141 1.00 43.33  ? 120 LEU A C     1 
ATOM   953   O  O     . LEU A  1 148 ? -40.773 -45.207 -30.541 1.00 47.94  ? 120 LEU A O     1 
ATOM   954   C  CB    . LEU A  1 148 ? -38.556 -42.799 -30.202 1.00 40.29  ? 120 LEU A CB    1 
ATOM   955   C  CG    . LEU A  1 148 ? -37.066 -42.493 -30.044 1.00 34.37  ? 120 LEU A CG    1 
ATOM   956   C  CD1   . LEU A  1 148 ? -36.847 -41.238 -29.198 1.00 28.77  ? 120 LEU A CD1   1 
ATOM   957   C  CD2   . LEU A  1 148 ? -36.333 -43.684 -29.448 1.00 33.79  ? 120 LEU A CD2   1 
ATOM   958   N  N     . LYS A  1 149 ? -41.309 -43.351 -31.692 1.00 39.77  ? 121 LYS A N     1 
ATOM   959   C  CA    . LYS A  1 149 ? -42.749 -43.568 -31.619 1.00 37.04  ? 121 LYS A CA    1 
ATOM   960   C  C     . LYS A  1 149 ? -43.108 -44.896 -32.289 1.00 51.36  ? 121 LYS A C     1 
ATOM   961   O  O     . LYS A  1 149 ? -44.008 -45.605 -31.846 1.00 53.06  ? 121 LYS A O     1 
ATOM   962   C  CB    . LYS A  1 149 ? -43.503 -42.418 -32.288 1.00 47.37  ? 121 LYS A CB    1 
ATOM   963   C  CG    . LYS A  1 149 ? -44.345 -41.535 -31.356 1.00 53.05  ? 121 LYS A CG    1 
ATOM   964   C  CD    . LYS A  1 149 ? -43.531 -40.450 -30.657 1.00 47.75  ? 121 LYS A CD    1 
ATOM   965   C  CE    . LYS A  1 149 ? -44.450 -39.445 -29.987 1.00 53.28  ? 121 LYS A CE    1 
ATOM   966   N  NZ    . LYS A  1 149 ? -43.717 -38.326 -29.324 1.00 55.76  ? 121 LYS A NZ    1 
ATOM   967   N  N     . SER A  1 150 ? -42.374 -45.223 -33.353 1.00 54.50  ? 122 SER A N     1 
ATOM   968   C  CA    . SER A  1 150 ? -42.652 -46.390 -34.182 1.00 50.30  ? 122 SER A CA    1 
ATOM   969   C  C     . SER A  1 150 ? -42.307 -47.688 -33.457 1.00 55.84  ? 122 SER A C     1 
ATOM   970   O  O     . SER A  1 150 ? -42.777 -48.753 -33.842 1.00 56.86  ? 122 SER A O     1 
ATOM   971   C  CB    . SER A  1 150 ? -41.884 -46.307 -35.499 1.00 38.38  ? 122 SER A CB    1 
ATOM   972   O  OG    . SER A  1 150 ? -40.530 -46.704 -35.328 1.00 43.46  ? 122 SER A OG    1 
ATOM   973   N  N     . LYS A  1 151 ? -41.484 -47.587 -32.413 1.00 58.03  ? 123 LYS A N     1 
ATOM   974   C  CA    . LYS A  1 151 ? -41.169 -48.728 -31.555 1.00 60.50  ? 123 LYS A CA    1 
ATOM   975   C  C     . LYS A  1 151 ? -42.308 -49.022 -30.581 1.00 60.97  ? 123 LYS A C     1 
ATOM   976   O  O     . LYS A  1 151 ? -43.185 -49.841 -30.852 1.00 62.83  ? 123 LYS A O     1 
ATOM   977   C  CB    . LYS A  1 151 ? -39.893 -48.477 -30.757 1.00 54.47  ? 123 LYS A CB    1 
ATOM   978   C  CG    . LYS A  1 151 ? -38.716 -48.035 -31.578 1.00 53.30  ? 123 LYS A CG    1 
ATOM   979   C  CD    . LYS A  1 151 ? -38.133 -49.163 -32.368 1.00 46.35  ? 123 LYS A CD    1 
ATOM   980   C  CE    . LYS A  1 151 ? -36.773 -48.763 -32.907 1.00 43.35  ? 123 LYS A CE    1 
ATOM   981   N  NZ    . LYS A  1 151 ? -36.161 -49.840 -33.741 1.00 52.20  ? 123 LYS A NZ    1 
ATOM   982   N  N     . HIS A  1 152 ? -42.279 -48.340 -29.443 1.00 65.98  ? 124 HIS A N     1 
ATOM   983   C  CA    . HIS A  1 152 ? -43.263 -48.557 -28.386 1.00 62.00  ? 124 HIS A CA    1 
ATOM   984   C  C     . HIS A  1 152 ? -44.291 -47.429 -28.361 1.00 62.18  ? 124 HIS A C     1 
ATOM   985   O  O     . HIS A  1 152 ? -45.397 -47.586 -27.834 1.00 58.83  ? 124 HIS A O     1 
ATOM   986   C  CB    . HIS A  1 152 ? -42.555 -48.687 -27.035 1.00 57.68  ? 124 HIS A CB    1 
ATOM   987   C  CG    . HIS A  1 152 ? -41.423 -49.667 -27.045 1.00 65.07  ? 124 HIS A CG    1 
ATOM   988   N  ND1   . HIS A  1 152 ? -40.139 -49.317 -27.403 1.00 68.26  ? 124 HIS A ND1   1 
ATOM   989   C  CD2   . HIS A  1 152 ? -41.388 -50.993 -26.770 1.00 70.81  ? 124 HIS A CD2   1 
ATOM   990   C  CE1   . HIS A  1 152 ? -39.358 -50.383 -27.337 1.00 66.64  ? 124 HIS A CE1   1 
ATOM   991   N  NE2   . HIS A  1 152 ? -40.092 -51.412 -26.955 1.00 74.49  ? 124 HIS A NE2   1 
ATOM   992   N  N     . ASP A  1 154 ? -44.564 -46.839 -25.536 1.00 42.57  ? 126 ASP A N     1 
ATOM   993   C  CA    . ASP A  1 154 ? -45.256 -45.715 -24.922 1.00 53.70  ? 126 ASP A CA    1 
ATOM   994   C  C     . ASP A  1 154 ? -44.308 -44.521 -24.783 1.00 51.90  ? 126 ASP A C     1 
ATOM   995   O  O     . ASP A  1 154 ? -44.383 -43.763 -23.811 1.00 42.61  ? 126 ASP A O     1 
ATOM   996   C  CB    . ASP A  1 154 ? -45.818 -46.102 -23.542 1.00 52.31  ? 126 ASP A CB    1 
ATOM   997   C  CG    . ASP A  1 154 ? -47.096 -46.940 -23.628 1.00 67.51  ? 126 ASP A CG    1 
ATOM   998   O  OD1   . ASP A  1 154 ? -47.753 -46.940 -24.693 1.00 74.94  ? 126 ASP A OD1   1 
ATOM   999   O  OD2   . ASP A  1 154 ? -47.454 -47.590 -22.621 1.00 68.98  ? 126 ASP A OD2   1 
ATOM   1000  N  N     . ILE A  1 155 ? -43.409 -44.361 -25.749 1.00 42.58  ? 127 ILE A N     1 
ATOM   1001  C  CA    . ILE A  1 155 ? -42.394 -43.322 -25.649 1.00 45.78  ? 127 ILE A CA    1 
ATOM   1002  C  C     . ILE A  1 155 ? -42.994 -41.933 -25.835 1.00 39.38  ? 127 ILE A C     1 
ATOM   1003  O  O     . ILE A  1 155 ? -43.882 -41.724 -26.654 1.00 42.41  ? 127 ILE A O     1 
ATOM   1004  C  CB    . ILE A  1 155 ? -41.271 -43.576 -26.657 1.00 42.33  ? 127 ILE A CB    1 
ATOM   1005  C  CG1   . ILE A  1 155 ? -40.471 -44.789 -26.180 1.00 39.40  ? 127 ILE A CG1   1 
ATOM   1006  C  CG2   . ILE A  1 155 ? -40.368 -42.358 -26.802 1.00 40.06  ? 127 ILE A CG2   1 
ATOM   1007  C  CD1   . ILE A  1 155 ? -39.601 -45.416 -27.217 1.00 45.71  ? 127 ILE A CD1   1 
ATOM   1008  N  N     . ARG A  1 156 ? -42.543 -40.983 -25.031 1.00 45.26  ? 128 ARG A N     1 
ATOM   1009  C  CA    . ARG A  1 156 ? -43.020 -39.618 -25.194 1.00 40.92  ? 128 ARG A CA    1 
ATOM   1010  C  C     . ARG A  1 156 ? -41.825 -38.693 -25.371 1.00 42.20  ? 128 ARG A C     1 
ATOM   1011  O  O     . ARG A  1 156 ? -40.734 -38.974 -24.866 1.00 40.86  ? 128 ARG A O     1 
ATOM   1012  C  CB    . ARG A  1 156 ? -43.908 -39.199 -24.010 1.00 42.65  ? 128 ARG A CB    1 
ATOM   1013  C  CG    . ARG A  1 156 ? -45.285 -39.919 -23.975 1.00 38.17  ? 128 ARG A CG    1 
ATOM   1014  C  CD    . ARG A  1 156 ? -46.111 -39.535 -22.744 1.00 48.74  ? 128 ARG A CD    1 
ATOM   1015  N  NE    . ARG A  1 156 ? -45.382 -39.752 -21.492 1.00 52.24  ? 128 ARG A NE    1 
ATOM   1016  C  CZ    . ARG A  1 156 ? -44.827 -38.781 -20.767 1.00 55.33  ? 128 ARG A CZ    1 
ATOM   1017  N  NH1   . ARG A  1 156 ? -44.923 -37.523 -21.167 1.00 43.67  ? 128 ARG A NH1   1 
ATOM   1018  N  NH2   . ARG A  1 156 ? -44.176 -39.065 -19.639 1.00 55.03  ? 128 ARG A NH2   1 
ATOM   1019  N  N     . THR A  1 157 ? -42.027 -37.622 -26.131 1.00 35.49  ? 129 THR A N     1 
ATOM   1020  C  CA    . THR A  1 157 ? -40.944 -36.721 -26.507 1.00 39.15  ? 129 THR A CA    1 
ATOM   1021  C  C     . THR A  1 157 ? -41.375 -35.261 -26.502 1.00 31.43  ? 129 THR A C     1 
ATOM   1022  O  O     . THR A  1 157 ? -42.548 -34.941 -26.669 1.00 32.88  ? 129 THR A O     1 
ATOM   1023  C  CB    . THR A  1 157 ? -40.401 -37.020 -27.923 1.00 38.67  ? 129 THR A CB    1 
ATOM   1024  O  OG1   . THR A  1 157 ? -41.412 -36.710 -28.888 1.00 36.59  ? 129 THR A OG1   1 
ATOM   1025  C  CG2   . THR A  1 157 ? -39.967 -38.471 -28.069 1.00 36.49  ? 129 THR A CG2   1 
ATOM   1026  N  N     . LYS A  1 158 ? -40.406 -34.378 -26.321 1.00 34.21  ? 130 LYS A N     1 
ATOM   1027  C  CA    . LYS A  1 158 ? -40.599 -32.943 -26.523 1.00 33.42  ? 130 LYS A CA    1 
ATOM   1028  C  C     . LYS A  1 158 ? -39.298 -32.382 -27.096 1.00 31.05  ? 130 LYS A C     1 
ATOM   1029  O  O     . LYS A  1 158 ? -38.232 -32.505 -26.482 1.00 31.46  ? 130 LYS A O     1 
ATOM   1030  C  CB    . LYS A  1 158 ? -40.987 -32.228 -25.213 1.00 34.48  ? 130 LYS A CB    1 
ATOM   1031  C  CG    . LYS A  1 158 ? -41.353 -30.744 -25.404 1.00 27.31  ? 130 LYS A CG    1 
ATOM   1032  C  CD    . LYS A  1 158 ? -41.716 -30.090 -24.087 1.00 39.22  ? 130 LYS A CD    1 
ATOM   1033  C  CE    . LYS A  1 158 ? -41.675 -28.561 -24.172 1.00 42.58  ? 130 LYS A CE    1 
ATOM   1034  N  NZ    . LYS A  1 158 ? -42.313 -28.021 -25.425 1.00 46.19  ? 130 LYS A NZ    1 
ATOM   1035  N  N     . SER A  1 159 ? -39.379 -31.792 -28.284 1.00 30.28  ? 131 SER A N     1 
ATOM   1036  C  CA    . SER A  1 159 ? -38.175 -31.376 -28.998 1.00 32.73  ? 131 SER A CA    1 
ATOM   1037  C  C     . SER A  1 159 ? -38.075 -29.872 -29.089 1.00 32.64  ? 131 SER A C     1 
ATOM   1038  O  O     . SER A  1 159 ? -39.092 -29.173 -29.078 1.00 30.57  ? 131 SER A O     1 
ATOM   1039  C  CB    . SER A  1 159 ? -38.152 -31.969 -30.405 1.00 34.03  ? 131 SER A CB    1 
ATOM   1040  O  OG    . SER A  1 159 ? -38.109 -33.387 -30.346 1.00 38.40  ? 131 SER A OG    1 
ATOM   1041  N  N     . MET A  1 160 ? -36.851 -29.371 -29.202 1.00 28.97  ? 132 MET A N     1 
ATOM   1042  C  CA    . MET A  1 160 ? -36.678 -27.936 -29.390 1.00 33.24  ? 132 MET A CA    1 
ATOM   1043  C  C     . MET A  1 160 ? -35.343 -27.619 -30.055 1.00 32.24  ? 132 MET A C     1 
ATOM   1044  O  O     . MET A  1 160 ? -34.390 -28.376 -29.966 1.00 27.05  ? 132 MET A O     1 
ATOM   1045  C  CB    . MET A  1 160 ? -36.822 -27.185 -28.040 1.00 26.12  ? 132 MET A CB    1 
ATOM   1046  C  CG    . MET A  1 160 ? -35.803 -27.530 -26.975 1.00 26.94  ? 132 MET A CG    1 
ATOM   1047  S  SD    . MET A  1 160 ? -36.430 -27.101 -25.319 1.00 34.00  ? 132 MET A SD    1 
ATOM   1048  C  CE    . MET A  1 160 ? -37.694 -28.366 -25.107 1.00 32.10  ? 132 MET A CE    1 
ATOM   1049  N  N     . VAL A  1 161 ? -35.304 -26.501 -30.770 1.00 30.79  ? 133 VAL A N     1 
ATOM   1050  C  CA    . VAL A  1 161 ? -34.060 -26.008 -31.323 1.00 28.03  ? 133 VAL A CA    1 
ATOM   1051  C  C     . VAL A  1 161 ? -34.070 -24.482 -31.149 1.00 28.82  ? 133 VAL A C     1 
ATOM   1052  O  O     . VAL A  1 161 ? -34.893 -23.787 -31.748 1.00 26.55  ? 133 VAL A O     1 
ATOM   1053  C  CB    . VAL A  1 161 ? -33.885 -26.428 -32.805 1.00 29.54  ? 133 VAL A CB    1 
ATOM   1054  C  CG1   . VAL A  1 161 ? -35.180 -26.240 -33.579 1.00 33.56  ? 133 VAL A CG1   1 
ATOM   1055  C  CG2   . VAL A  1 161 ? -32.728 -25.668 -33.474 1.00 29.63  ? 133 VAL A CG2   1 
ATOM   1056  N  N     . ASP A  1 162 ? -33.200 -23.979 -30.277 1.00 29.07  ? 134 ASP A N     1 
ATOM   1057  C  CA    . ASP A  1 162 ? -33.024 -22.526 -30.060 1.00 26.48  ? 134 ASP A CA    1 
ATOM   1058  C  C     . ASP A  1 162 ? -34.229 -21.782 -29.433 1.00 27.28  ? 134 ASP A C     1 
ATOM   1059  O  O     . ASP A  1 162 ? -34.039 -20.940 -28.547 1.00 28.99  ? 134 ASP A O     1 
ATOM   1060  C  CB    . ASP A  1 162 ? -32.623 -21.847 -31.385 1.00 24.24  ? 134 ASP A CB    1 
ATOM   1061  C  CG    . ASP A  1 162 ? -32.525 -20.301 -31.269 1.00 29.36  ? 134 ASP A CG    1 
ATOM   1062  O  OD1   . ASP A  1 162 ? -31.527 -19.799 -30.708 1.00 21.69  ? 134 ASP A OD1   1 
ATOM   1063  O  OD2   . ASP A  1 162 ? -33.438 -19.601 -31.761 1.00 26.39  ? 134 ASP A OD2   1 
ATOM   1064  N  N     . THR A  1 163 ? -35.452 -22.083 -29.865 1.00 26.27  ? 135 THR A N     1 
ATOM   1065  C  CA    . THR A  1 163 ? -36.624 -21.314 -29.428 1.00 28.64  ? 135 THR A CA    1 
ATOM   1066  C  C     . THR A  1 163 ? -37.403 -21.979 -28.292 1.00 35.69  ? 135 THR A C     1 
ATOM   1067  O  O     . THR A  1 163 ? -38.474 -21.501 -27.902 1.00 33.15  ? 135 THR A O     1 
ATOM   1068  C  CB    . THR A  1 163 ? -37.610 -21.068 -30.602 1.00 35.18  ? 135 THR A CB    1 
ATOM   1069  O  OG1   . THR A  1 163 ? -37.916 -22.319 -31.225 1.00 31.57  ? 135 THR A OG1   1 
ATOM   1070  C  CG2   . THR A  1 163 ? -37.027 -20.058 -31.659 1.00 27.45  ? 135 THR A CG2   1 
ATOM   1071  N  N     . GLY A  1 164 ? -36.863 -23.073 -27.762 1.00 30.93  ? 136 GLY A N     1 
ATOM   1072  C  CA    . GLY A  1 164 ? -37.464 -23.740 -26.619 1.00 32.29  ? 136 GLY A CA    1 
ATOM   1073  C  C     . GLY A  1 164 ? -36.933 -23.191 -25.296 1.00 34.75  ? 136 GLY A C     1 
ATOM   1074  O  O     . GLY A  1 164 ? -36.074 -22.307 -25.283 1.00 29.29  ? 136 GLY A O     1 
ATOM   1075  N  N     . GLU A  1 165 ? -37.417 -23.752 -24.188 1.00 36.49  ? 137 GLU A N     1 
ATOM   1076  C  CA    . GLU A  1 165 ? -37.114 -23.256 -22.835 1.00 34.03  ? 137 GLU A CA    1 
ATOM   1077  C  C     . GLU A  1 165 ? -35.705 -23.600 -22.334 1.00 33.67  ? 137 GLU A C     1 
ATOM   1078  O  O     . GLU A  1 165 ? -35.102 -22.829 -21.588 1.00 29.65  ? 137 GLU A O     1 
ATOM   1079  C  CB    . GLU A  1 165 ? -38.146 -23.802 -21.840 1.00 31.61  ? 137 GLU A CB    1 
ATOM   1080  C  CG    . GLU A  1 165 ? -39.578 -23.375 -22.133 1.00 36.59  ? 137 GLU A CG    1 
ATOM   1081  C  CD    . GLU A  1 165 ? -40.322 -24.321 -23.077 1.00 41.81  ? 137 GLU A CD    1 
ATOM   1082  O  OE1   . GLU A  1 165 ? -39.678 -25.053 -23.884 1.00 37.15  ? 137 GLU A OE1   1 
ATOM   1083  O  OE2   . GLU A  1 165 ? -41.575 -24.316 -23.013 1.00 42.13  ? 137 GLU A OE2   1 
ATOM   1084  N  N     . LEU A  1 166 ? -35.186 -24.757 -22.737 1.00 32.06  ? 138 LEU A N     1 
ATOM   1085  C  CA    . LEU A  1 166 ? -33.856 -25.201 -22.319 1.00 29.66  ? 138 LEU A CA    1 
ATOM   1086  C  C     . LEU A  1 166 ? -32.733 -24.300 -22.826 1.00 30.30  ? 138 LEU A C     1 
ATOM   1087  O  O     . LEU A  1 166 ? -32.875 -23.597 -23.834 1.00 29.18  ? 138 LEU A O     1 
ATOM   1088  C  CB    . LEU A  1 166 ? -33.595 -26.643 -22.805 1.00 28.01  ? 138 LEU A CB    1 
ATOM   1089  C  CG    . LEU A  1 166 ? -34.540 -27.726 -22.261 1.00 28.01  ? 138 LEU A CG    1 
ATOM   1090  C  CD1   . LEU A  1 166 ? -34.196 -29.102 -22.836 1.00 29.81  ? 138 LEU A CD1   1 
ATOM   1091  C  CD2   . LEU A  1 166 ? -34.463 -27.770 -20.761 1.00 31.13  ? 138 LEU A CD2   1 
ATOM   1092  N  N     . SER A  1 167 ? -31.613 -24.325 -22.119 1.00 30.62  ? 139 SER A N     1 
ATOM   1093  C  CA    . SER A  1 167 ? -30.365 -23.828 -22.673 1.00 24.74  ? 139 SER A CA    1 
ATOM   1094  C  C     . SER A  1 167 ? -29.803 -24.940 -23.533 1.00 31.22  ? 139 SER A C     1 
ATOM   1095  O  O     . SER A  1 167 ? -29.448 -26.003 -23.012 1.00 27.60  ? 139 SER A O     1 
ATOM   1096  C  CB    . SER A  1 167 ? -29.378 -23.452 -21.575 1.00 25.37  ? 139 SER A CB    1 
ATOM   1097  O  OG    . SER A  1 167 ? -28.074 -23.276 -22.090 1.00 29.35  ? 139 SER A OG    1 
ATOM   1098  N  N     . ASP A  1 168 ? -29.741 -24.713 -24.845 1.00 27.74  ? 140 ASP A N     1 
ATOM   1099  C  CA    . ASP A  1 168 ? -29.214 -25.728 -25.749 1.00 29.17  ? 140 ASP A CA    1 
ATOM   1100  C  C     . ASP A  1 168 ? -27.763 -26.067 -25.415 1.00 28.48  ? 140 ASP A C     1 
ATOM   1101  O  O     . ASP A  1 168 ? -27.357 -27.223 -25.508 1.00 27.50  ? 140 ASP A O     1 
ATOM   1102  C  CB    . ASP A  1 168 ? -29.317 -25.268 -27.199 1.00 23.69  ? 140 ASP A CB    1 
ATOM   1103  C  CG    . ASP A  1 168 ? -30.742 -24.982 -27.623 1.00 30.36  ? 140 ASP A CG    1 
ATOM   1104  O  OD1   . ASP A  1 168 ? -31.692 -25.288 -26.860 1.00 29.41  ? 140 ASP A OD1   1 
ATOM   1105  O  OD2   . ASP A  1 168 ? -30.911 -24.444 -28.737 1.00 32.00  ? 140 ASP A OD2   1 
ATOM   1106  N  N     . ARG A  1 169 ? -26.986 -25.058 -25.031 1.00 23.21  ? 141 ARG A N     1 
ATOM   1107  C  CA    . ARG A  1 169 ? -25.586 -25.275 -24.704 1.00 29.34  ? 141 ARG A CA    1 
ATOM   1108  C  C     . ARG A  1 169 ? -25.415 -26.099 -23.420 1.00 31.71  ? 141 ARG A C     1 
ATOM   1109  O  O     . ARG A  1 169 ? -24.509 -26.923 -23.340 1.00 26.05  ? 141 ARG A O     1 
ATOM   1110  C  CB    . ARG A  1 169 ? -24.847 -23.945 -24.547 1.00 32.07  ? 141 ARG A CB    1 
ATOM   1111  C  CG    . ARG A  1 169 ? -24.512 -23.182 -25.843 1.00 29.87  ? 141 ARG A CG    1 
ATOM   1112  C  CD    . ARG A  1 169 ? -23.590 -22.031 -25.479 1.00 24.43  ? 141 ARG A CD    1 
ATOM   1113  N  NE    . ARG A  1 169 ? -23.179 -21.193 -26.606 1.00 26.59  ? 141 ARG A NE    1 
ATOM   1114  C  CZ    . ARG A  1 169 ? -23.179 -19.863 -26.569 1.00 31.40  ? 141 ARG A CZ    1 
ATOM   1115  N  NH1   . ARG A  1 169 ? -23.573 -19.219 -25.461 1.00 26.57  ? 141 ARG A NH1   1 
ATOM   1116  N  NH2   . ARG A  1 169 ? -22.770 -19.176 -27.628 1.00 26.41  ? 141 ARG A NH2   1 
ATOM   1117  N  N     . ALA A  1 170 ? -26.263 -25.847 -22.415 1.00 26.67  ? 142 ALA A N     1 
ATOM   1118  C  CA    . ALA A  1 170 ? -26.183 -26.577 -21.152 1.00 33.02  ? 142 ALA A CA    1 
ATOM   1119  C  C     . ALA A  1 170 ? -26.511 -28.065 -21.393 1.00 31.42  ? 142 ALA A C     1 
ATOM   1120  O  O     . ALA A  1 170 ? -25.832 -28.943 -20.887 1.00 32.28  ? 142 ALA A O     1 
ATOM   1121  C  CB    . ALA A  1 170 ? -27.121 -25.969 -20.109 1.00 24.65  ? 142 ALA A CB    1 
ATOM   1122  N  N     . VAL A  1 171 ? -27.540 -28.327 -22.192 1.00 28.48  ? 143 VAL A N     1 
ATOM   1123  C  CA    . VAL A  1 171 ? -27.892 -29.682 -22.583 1.00 31.71  ? 143 VAL A CA    1 
ATOM   1124  C  C     . VAL A  1 171 ? -26.734 -30.372 -23.303 1.00 35.13  ? 143 VAL A C     1 
ATOM   1125  O  O     . VAL A  1 171 ? -26.349 -31.486 -22.947 1.00 33.44  ? 143 VAL A O     1 
ATOM   1126  C  CB    . VAL A  1 171 ? -29.139 -29.700 -23.487 1.00 30.76  ? 143 VAL A CB    1 
ATOM   1127  C  CG1   . VAL A  1 171 ? -29.378 -31.109 -24.030 1.00 36.47  ? 143 VAL A CG1   1 
ATOM   1128  C  CG2   . VAL A  1 171 ? -30.347 -29.224 -22.714 1.00 27.52  ? 143 VAL A CG2   1 
ATOM   1129  N  N     . ALA A  1 172 ? -26.171 -29.697 -24.300 1.00 31.65  ? 144 ALA A N     1 
ATOM   1130  C  CA    . ALA A  1 172 ? -25.067 -30.254 -25.077 1.00 33.76  ? 144 ALA A CA    1 
ATOM   1131  C  C     . ALA A  1 172 ? -23.786 -30.461 -24.257 1.00 35.31  ? 144 ALA A C     1 
ATOM   1132  O  O     . ALA A  1 172 ? -23.022 -31.389 -24.532 1.00 32.64  ? 144 ALA A O     1 
ATOM   1133  C  CB    . ALA A  1 172 ? -24.767 -29.357 -26.292 1.00 27.86  ? 144 ALA A CB    1 
ATOM   1134  N  N     . GLU A  1 173 ? -23.511 -29.584 -23.295 1.00 31.70  ? 145 GLU A N     1 
ATOM   1135  C  CA    . GLU A  1 173 ? -22.344 -29.796 -22.432 1.00 33.04  ? 145 GLU A CA    1 
ATOM   1136  C  C     . GLU A  1 173 ? -22.519 -31.064 -21.601 1.00 33.93  ? 145 GLU A C     1 
ATOM   1137  O  O     . GLU A  1 173 ? -21.616 -31.900 -21.505 1.00 30.87  ? 145 GLU A O     1 
ATOM   1138  C  CB    . GLU A  1 173 ? -22.111 -28.611 -21.490 1.00 32.05  ? 145 GLU A CB    1 
ATOM   1139  C  CG    . GLU A  1 173 ? -20.854 -28.756 -20.626 1.00 34.12  ? 145 GLU A CG    1 
ATOM   1140  C  CD    . GLU A  1 173 ? -20.759 -27.687 -19.528 1.00 47.74  ? 145 GLU A CD    1 
ATOM   1141  O  OE1   . GLU A  1 173 ? -21.796 -27.355 -18.904 1.00 45.09  ? 145 GLU A OE1   1 
ATOM   1142  O  OE2   . GLU A  1 173 ? -19.640 -27.183 -19.290 1.00 47.47  ? 145 GLU A OE2   1 
ATOM   1143  N  N     . ARG A  1 174 ? -23.694 -31.201 -21.003 1.00 31.37  ? 146 ARG A N     1 
ATOM   1144  C  CA    . ARG A  1 174 ? -23.909 -32.283 -20.066 1.00 30.94  ? 146 ARG A CA    1 
ATOM   1145  C  C     . ARG A  1 174 ? -24.077 -33.609 -20.817 1.00 33.41  ? 146 ARG A C     1 
ATOM   1146  O  O     . ARG A  1 174 ? -24.028 -34.666 -20.211 1.00 35.06  ? 146 ARG A O     1 
ATOM   1147  C  CB    . ARG A  1 174 ? -25.124 -31.989 -19.172 1.00 31.85  ? 146 ARG A CB    1 
ATOM   1148  C  CG    . ARG A  1 174 ? -25.087 -32.701 -17.821 1.00 28.87  ? 146 ARG A CG    1 
ATOM   1149  C  CD    . ARG A  1 174 ? -26.228 -32.274 -16.930 1.00 28.09  ? 146 ARG A CD    1 
ATOM   1150  N  NE    . ARG A  1 174 ? -27.536 -32.777 -17.358 1.00 25.54  ? 146 ARG A NE    1 
ATOM   1151  C  CZ    . ARG A  1 174 ? -28.675 -32.400 -16.787 1.00 31.72  ? 146 ARG A CZ    1 
ATOM   1152  N  NH1   . ARG A  1 174 ? -28.643 -31.510 -15.799 1.00 32.16  ? 146 ARG A NH1   1 
ATOM   1153  N  NH2   . ARG A  1 174 ? -29.843 -32.878 -17.194 1.00 28.62  ? 146 ARG A NH2   1 
ATOM   1154  N  N     . ALA A  1 175 ? -24.240 -33.549 -22.136 1.00 34.15  ? 147 ALA A N     1 
ATOM   1155  C  CA    . ALA A  1 175 ? -24.427 -34.757 -22.942 1.00 32.08  ? 147 ALA A CA    1 
ATOM   1156  C  C     . ALA A  1 175 ? -23.167 -35.164 -23.693 1.00 30.85  ? 147 ALA A C     1 
ATOM   1157  O  O     . ALA A  1 175 ? -23.177 -36.138 -24.447 1.00 37.11  ? 147 ALA A O     1 
ATOM   1158  C  CB    . ALA A  1 175 ? -25.573 -34.568 -23.921 1.00 34.15  ? 147 ALA A CB    1 
ATOM   1159  N  N     . GLY A  1 176 ? -22.080 -34.430 -23.486 1.00 31.89  ? 148 GLY A N     1 
ATOM   1160  C  CA    . GLY A  1 176 ? -20.801 -34.774 -24.094 1.00 31.62  ? 148 GLY A CA    1 
ATOM   1161  C  C     . GLY A  1 176 ? -20.612 -34.336 -25.543 1.00 37.36  ? 148 GLY A C     1 
ATOM   1162  O  O     . GLY A  1 176 ? -19.694 -34.810 -26.214 1.00 33.37  ? 148 GLY A O     1 
ATOM   1163  N  N     . ILE A  1 177 ? -21.458 -33.425 -26.035 1.00 31.95  ? 149 ILE A N     1 
ATOM   1164  C  CA    . ILE A  1 177 ? -21.344 -32.971 -27.423 1.00 28.13  ? 149 ILE A CA    1 
ATOM   1165  C  C     . ILE A  1 177 ? -20.050 -32.184 -27.609 1.00 30.38  ? 149 ILE A C     1 
ATOM   1166  O  O     . ILE A  1 177 ? -19.308 -32.399 -28.562 1.00 32.97  ? 149 ILE A O     1 
ATOM   1167  C  CB    . ILE A  1 177 ? -22.547 -32.086 -27.846 1.00 32.61  ? 149 ILE A CB    1 
ATOM   1168  C  CG1   . ILE A  1 177 ? -23.852 -32.882 -27.841 1.00 29.41  ? 149 ILE A CG1   1 
ATOM   1169  C  CG2   . ILE A  1 177 ? -22.306 -31.442 -29.211 1.00 33.23  ? 149 ILE A CG2   1 
ATOM   1170  C  CD1   . ILE A  1 177 ? -23.954 -33.918 -28.950 1.00 34.13  ? 149 ILE A CD1   1 
ATOM   1171  N  N     . GLY A  1 178 ? -19.799 -31.258 -26.690 1.00 33.11  ? 150 GLY A N     1 
ATOM   1172  C  CA    . GLY A  1 178 ? -18.603 -30.433 -26.708 1.00 30.83  ? 150 GLY A CA    1 
ATOM   1173  C  C     . GLY A  1 178 ? -18.422 -29.806 -25.338 1.00 32.32  ? 150 GLY A C     1 
ATOM   1174  O  O     . GLY A  1 178 ? -19.264 -29.969 -24.460 1.00 32.70  ? 150 GLY A O     1 
ATOM   1175  N  N     . PHE A  1 179 ? -17.334 -29.081 -25.130 1.00 32.52  ? 151 PHE A N     1 
ATOM   1176  C  CA    . PHE A  1 179 ? -17.195 -28.369 -23.864 1.00 35.38  ? 151 PHE A CA    1 
ATOM   1177  C  C     . PHE A  1 179 ? -17.546 -26.885 -24.026 1.00 39.28  ? 151 PHE A C     1 
ATOM   1178  O  O     . PHE A  1 179 ? -17.648 -26.379 -25.156 1.00 33.32  ? 151 PHE A O     1 
ATOM   1179  C  CB    . PHE A  1 179 ? -15.776 -28.508 -23.326 1.00 36.85  ? 151 PHE A CB    1 
ATOM   1180  C  CG    . PHE A  1 179 ? -14.757 -27.784 -24.142 1.00 40.77  ? 151 PHE A CG    1 
ATOM   1181  C  CD1   . PHE A  1 179 ? -14.345 -26.506 -23.784 1.00 36.76  ? 151 PHE A CD1   1 
ATOM   1182  C  CD2   . PHE A  1 179 ? -14.218 -28.368 -25.279 1.00 36.77  ? 151 PHE A CD2   1 
ATOM   1183  C  CE1   . PHE A  1 179 ? -13.401 -25.829 -24.535 1.00 37.55  ? 151 PHE A CE1   1 
ATOM   1184  C  CE2   . PHE A  1 179 ? -13.274 -27.686 -26.035 1.00 38.57  ? 151 PHE A CE2   1 
ATOM   1185  C  CZ    . PHE A  1 179 ? -12.870 -26.413 -25.660 1.00 37.16  ? 151 PHE A CZ    1 
ATOM   1186  N  N     . SER A  1 180 ? -17.693 -26.198 -22.891 1.00 36.74  ? 152 SER A N     1 
ATOM   1187  C  CA    . SER A  1 180 ? -17.946 -24.754 -22.865 1.00 34.16  ? 152 SER A CA    1 
ATOM   1188  C  C     . SER A  1 180 ? -16.652 -23.952 -22.900 1.00 35.47  ? 152 SER A C     1 
ATOM   1189  O  O     . SER A  1 180 ? -15.973 -23.807 -21.892 1.00 36.69  ? 152 SER A O     1 
ATOM   1190  C  CB    . SER A  1 180 ? -18.752 -24.377 -21.625 1.00 32.98  ? 152 SER A CB    1 
ATOM   1191  O  OG    . SER A  1 180 ? -20.000 -25.038 -21.630 1.00 38.25  ? 152 SER A OG    1 
ATOM   1192  N  N     . ALA A  1 181 ? -16.320 -23.428 -24.072 1.00 34.83  ? 153 ALA A N     1 
ATOM   1193  C  CA    . ALA A  1 181 ? -15.101 -22.658 -24.244 1.00 34.49  ? 153 ALA A CA    1 
ATOM   1194  C  C     . ALA A  1 181 ? -15.216 -21.251 -23.649 1.00 34.18  ? 153 ALA A C     1 
ATOM   1195  O  O     . ALA A  1 181 ? -16.292 -20.801 -23.235 1.00 31.62  ? 153 ALA A O     1 
ATOM   1196  C  CB    . ALA A  1 181 ? -14.741 -22.592 -25.712 1.00 33.37  ? 153 ALA A CB    1 
ATOM   1197  N  N     . LYS A  1 182 ? -14.088 -20.558 -23.590 1.00 36.54  ? 154 LYS A N     1 
ATOM   1198  C  CA    . LYS A  1 182 ? -14.039 -19.236 -22.989 1.00 33.57  ? 154 LYS A CA    1 
ATOM   1199  C  C     . LYS A  1 182 ? -14.833 -18.186 -23.777 1.00 38.65  ? 154 LYS A C     1 
ATOM   1200  O  O     . LYS A  1 182 ? -15.147 -17.121 -23.235 1.00 30.64  ? 154 LYS A O     1 
ATOM   1201  C  CB    . LYS A  1 182 ? -12.594 -18.767 -22.854 1.00 38.55  ? 154 LYS A CB    1 
ATOM   1202  C  CG    . LYS A  1 182 ? -11.726 -19.621 -21.957 1.00 36.28  ? 154 LYS A CG    1 
ATOM   1203  C  CD    . LYS A  1 182 ? -10.380 -18.958 -21.791 1.00 37.95  ? 154 LYS A CD    1 
ATOM   1204  C  CE    . LYS A  1 182 ? -9.423  -19.794 -20.963 1.00 40.31  ? 154 LYS A CE    1 
ATOM   1205  N  NZ    . LYS A  1 182 ? -8.056  -19.208 -21.046 1.00 43.07  ? 154 LYS A NZ    1 
ATOM   1206  N  N     . ASN A  1 183 ? -15.149 -18.479 -25.042 1.00 30.49  ? 155 ASN A N     1 
ATOM   1207  C  CA    . ASN A  1 183 ? -15.930 -17.552 -25.880 1.00 28.78  ? 155 ASN A CA    1 
ATOM   1208  C  C     . ASN A  1 183 ? -17.423 -17.837 -25.788 1.00 31.68  ? 155 ASN A C     1 
ATOM   1209  O  O     . ASN A  1 183 ? -18.217 -17.275 -26.567 1.00 28.81  ? 155 ASN A O     1 
ATOM   1210  C  CB    . ASN A  1 183 ? -15.495 -17.634 -27.348 1.00 28.61  ? 155 ASN A CB    1 
ATOM   1211  C  CG    . ASN A  1 183 ? -15.651 -19.046 -27.935 1.00 33.72  ? 155 ASN A CG    1 
ATOM   1212  O  OD1   . ASN A  1 183 ? -16.106 -19.996 -27.257 1.00 30.41  ? 155 ASN A OD1   1 
ATOM   1213  N  ND2   . ASN A  1 183 ? -15.269 -19.192 -29.201 1.00 34.86  ? 155 ASN A ND2   1 
ATOM   1214  N  N     . CYS A  1 184 ? -17.755 -18.756 -24.872 1.00 24.85  ? 156 CYS A N     1 
ATOM   1215  C  CA    . CYS A  1 184 ? -19.104 -19.223 -24.517 1.00 32.18  ? 156 CYS A CA    1 
ATOM   1216  C  C     . CYS A  1 184 ? -19.625 -20.318 -25.463 1.00 29.71  ? 156 CYS A C     1 
ATOM   1217  O  O     . CYS A  1 184 ? -20.660 -20.933 -25.195 1.00 28.18  ? 156 CYS A O     1 
ATOM   1218  C  CB    . CYS A  1 184 ? -20.120 -18.067 -24.456 1.00 33.04  ? 156 CYS A CB    1 
ATOM   1219  S  SG    . CYS A  1 184 ? -19.769 -16.785 -23.223 1.00 32.21  ? 156 CYS A SG    1 
ATOM   1220  N  N     . MET A  1 185 ? -18.896 -20.595 -26.531 1.00 26.94  ? 157 MET A N     1 
ATOM   1221  C  CA    . MET A  1 185 ? -19.349 -21.586 -27.509 1.00 28.30  ? 157 MET A CA    1 
ATOM   1222  C  C     . MET A  1 185 ? -19.179 -23.020 -26.997 1.00 32.24  ? 157 MET A C     1 
ATOM   1223  O  O     . MET A  1 185 ? -18.163 -23.333 -26.380 1.00 34.42  ? 157 MET A O     1 
ATOM   1224  C  CB    . MET A  1 185 ? -18.581 -21.434 -28.840 1.00 27.92  ? 157 MET A CB    1 
ATOM   1225  C  CG    . MET A  1 185 ? -18.699 -20.055 -29.528 1.00 28.60  ? 157 MET A CG    1 
ATOM   1226  S  SD    . MET A  1 185 ? -20.416 -19.700 -29.970 1.00 26.13  ? 157 MET A SD    1 
ATOM   1227  C  CE    . MET A  1 185 ? -20.699 -20.951 -31.219 1.00 25.94  ? 157 MET A CE    1 
ATOM   1228  N  N     . ILE A  1 186 ? -20.168 -23.882 -27.248 1.00 28.53  ? 158 ILE A N     1 
ATOM   1229  C  CA    . ILE A  1 186 ? -19.949 -25.329 -27.173 1.00 28.14  ? 158 ILE A CA    1 
ATOM   1230  C  C     . ILE A  1 186 ? -19.025 -25.707 -28.320 1.00 29.79  ? 158 ILE A C     1 
ATOM   1231  O  O     . ILE A  1 186 ? -19.334 -25.472 -29.492 1.00 29.68  ? 158 ILE A O     1 
ATOM   1232  C  CB    . ILE A  1 186 ? -21.254 -26.147 -27.255 1.00 28.37  ? 158 ILE A CB    1 
ATOM   1233  C  CG1   . ILE A  1 186 ? -22.056 -25.977 -25.978 1.00 33.41  ? 158 ILE A CG1   1 
ATOM   1234  C  CG2   . ILE A  1 186 ? -20.962 -27.650 -27.401 1.00 29.36  ? 158 ILE A CG2   1 
ATOM   1235  C  CD1   . ILE A  1 186 ? -21.324 -26.508 -24.763 1.00 33.69  ? 158 ILE A CD1   1 
ATOM   1236  N  N     . THR A  1 187 ? -17.875 -26.270 -27.976 1.00 33.01  ? 159 THR A N     1 
ATOM   1237  C  CA    . THR A  1 187 ? -16.824 -26.534 -28.949 1.00 32.35  ? 159 THR A CA    1 
ATOM   1238  C  C     . THR A  1 187 ? -16.514 -28.024 -28.980 1.00 34.75  ? 159 THR A C     1 
ATOM   1239  O  O     . THR A  1 187 ? -16.205 -28.615 -27.952 1.00 34.70  ? 159 THR A O     1 
ATOM   1240  C  CB    . THR A  1 187 ? -15.563 -25.714 -28.613 1.00 34.03  ? 159 THR A CB    1 
ATOM   1241  O  OG1   . THR A  1 187 ? -15.917 -24.333 -28.563 1.00 34.57  ? 159 THR A OG1   1 
ATOM   1242  C  CG2   . THR A  1 187 ? -14.479 -25.886 -29.648 1.00 33.53  ? 159 THR A CG2   1 
ATOM   1243  N  N     . THR A  1 188 ? -16.637 -28.619 -30.168 1.00 35.72  ? 160 THR A N     1 
ATOM   1244  C  CA    . THR A  1 188 ? -16.443 -30.047 -30.390 1.00 35.53  ? 160 THR A CA    1 
ATOM   1245  C  C     . THR A  1 188 ? -15.047 -30.347 -30.932 1.00 36.21  ? 160 THR A C     1 
ATOM   1246  O  O     . THR A  1 188 ? -14.488 -29.548 -31.661 1.00 39.43  ? 160 THR A O     1 
ATOM   1247  C  CB    . THR A  1 188 ? -17.464 -30.609 -31.396 1.00 35.45  ? 160 THR A CB    1 
ATOM   1248  O  OG1   . THR A  1 188 ? -17.142 -30.127 -32.702 1.00 33.07  ? 160 THR A OG1   1 
ATOM   1249  C  CG2   . THR A  1 188 ? -18.868 -30.179 -31.046 1.00 33.23  ? 160 THR A CG2   1 
ATOM   1250  N  N     . PRO A  1 189 ? -14.484 -31.519 -30.590 1.00 44.00  ? 161 PRO A N     1 
ATOM   1251  C  CA    . PRO A  1 189 ? -13.146 -31.818 -31.122 1.00 42.56  ? 161 PRO A CA    1 
ATOM   1252  C  C     . PRO A  1 189 ? -13.120 -31.960 -32.650 1.00 37.25  ? 161 PRO A C     1 
ATOM   1253  O  O     . PRO A  1 189 ? -12.198 -31.463 -33.296 1.00 40.67  ? 161 PRO A O     1 
ATOM   1254  C  CB    . PRO A  1 189 ? -12.773 -33.141 -30.422 1.00 41.65  ? 161 PRO A CB    1 
ATOM   1255  C  CG    . PRO A  1 189 ? -14.054 -33.703 -29.915 1.00 39.73  ? 161 PRO A CG    1 
ATOM   1256  C  CD    . PRO A  1 189 ? -14.962 -32.551 -29.649 1.00 37.81  ? 161 PRO A CD    1 
ATOM   1257  N  N     . GLU A  1 190 ? -14.133 -32.592 -33.230 1.00 36.64  ? 162 GLU A N     1 
ATOM   1258  C  CA    . GLU A  1 190 ? -14.136 -32.811 -34.679 1.00 39.29  ? 162 GLU A CA    1 
ATOM   1259  C  C     . GLU A  1 190 ? -14.501 -31.542 -35.464 1.00 38.90  ? 162 GLU A C     1 
ATOM   1260  O  O     . GLU A  1 190 ? -13.813 -31.154 -36.420 1.00 32.52  ? 162 GLU A O     1 
ATOM   1261  C  CB    . GLU A  1 190 ? -15.108 -33.941 -35.039 1.00 39.66  ? 162 GLU A CB    1 
ATOM   1262  C  CG    . GLU A  1 190 ? -15.013 -35.176 -34.130 1.00 41.83  ? 162 GLU A CG    1 
ATOM   1263  C  CD    . GLU A  1 190 ? -16.024 -35.180 -32.970 1.00 51.91  ? 162 GLU A CD    1 
ATOM   1264  O  OE1   . GLU A  1 190 ? -16.734 -36.208 -32.816 1.00 59.11  ? 162 GLU A OE1   1 
ATOM   1265  O  OE2   . GLU A  1 190 ? -16.103 -34.186 -32.201 1.00 42.80  ? 162 GLU A OE2   1 
ATOM   1266  N  N     . TYR A  1 191 ? -15.582 -30.894 -35.045 1.00 36.60  ? 163 TYR A N     1 
ATOM   1267  C  CA    . TYR A  1 191 ? -16.195 -29.848 -35.848 1.00 35.33  ? 163 TYR A CA    1 
ATOM   1268  C  C     . TYR A  1 191 ? -15.962 -28.422 -35.320 1.00 35.87  ? 163 TYR A C     1 
ATOM   1269  O  O     . TYR A  1 191 ? -16.406 -27.452 -35.939 1.00 34.90  ? 163 TYR A O     1 
ATOM   1270  C  CB    . TYR A  1 191 ? -17.692 -30.137 -35.969 1.00 35.45  ? 163 TYR A CB    1 
ATOM   1271  C  CG    . TYR A  1 191 ? -17.964 -31.566 -36.399 1.00 32.67  ? 163 TYR A CG    1 
ATOM   1272  C  CD1   . TYR A  1 191 ? -17.804 -31.958 -37.717 1.00 31.09  ? 163 TYR A CD1   1 
ATOM   1273  C  CD2   . TYR A  1 191 ? -18.363 -32.519 -35.480 1.00 34.92  ? 163 TYR A CD2   1 
ATOM   1274  C  CE1   . TYR A  1 191 ? -18.039 -33.273 -38.104 1.00 38.01  ? 163 TYR A CE1   1 
ATOM   1275  C  CE2   . TYR A  1 191 ? -18.599 -33.821 -35.851 1.00 34.40  ? 163 TYR A CE2   1 
ATOM   1276  C  CZ    . TYR A  1 191 ? -18.436 -34.196 -37.159 1.00 38.99  ? 163 TYR A CZ    1 
ATOM   1277  O  OH    . TYR A  1 191 ? -18.680 -35.496 -37.513 1.00 40.37  ? 163 TYR A OH    1 
ATOM   1278  N  N     . GLY A  1 192 ? -15.251 -28.299 -34.202 1.00 38.51  ? 164 GLY A N     1 
ATOM   1279  C  CA    . GLY A  1 192 ? -15.014 -27.003 -33.585 1.00 34.78  ? 164 GLY A CA    1 
ATOM   1280  C  C     . GLY A  1 192 ? -16.283 -26.426 -32.986 1.00 36.23  ? 164 GLY A C     1 
ATOM   1281  O  O     . GLY A  1 192 ? -17.143 -27.186 -32.535 1.00 33.84  ? 164 GLY A O     1 
ATOM   1282  N  N     . SER A  1 193 ? -16.398 -25.093 -32.980 1.00 33.33  ? 165 SER A N     1 
ATOM   1283  C  CA    . SER A  1 193 ? -17.588 -24.402 -32.460 1.00 33.19  ? 165 SER A CA    1 
ATOM   1284  C  C     . SER A  1 193 ? -18.669 -24.216 -33.533 1.00 32.81  ? 165 SER A C     1 
ATOM   1285  O  O     . SER A  1 193 ? -19.751 -23.701 -33.264 1.00 30.97  ? 165 SER A O     1 
ATOM   1286  C  CB    . SER A  1 193 ? -17.217 -23.021 -31.880 1.00 36.65  ? 165 SER A CB    1 
ATOM   1287  O  OG    . SER A  1 193 ? -16.769 -22.115 -32.889 1.00 33.92  ? 165 SER A OG    1 
ATOM   1288  N  N     . TYR A  1 194 ? -18.354 -24.615 -34.755 1.00 35.29  ? 166 TYR A N     1 
ATOM   1289  C  CA    . TYR A  1 194 ? -19.233 -24.365 -35.889 1.00 31.43  ? 166 TYR A CA    1 
ATOM   1290  C  C     . TYR A  1 194 ? -20.321 -25.437 -35.980 1.00 29.45  ? 166 TYR A C     1 
ATOM   1291  O  O     . TYR A  1 194 ? -20.407 -26.171 -36.968 1.00 30.86  ? 166 TYR A O     1 
ATOM   1292  C  CB    . TYR A  1 194 ? -18.426 -24.312 -37.189 1.00 25.96  ? 166 TYR A CB    1 
ATOM   1293  C  CG    . TYR A  1 194 ? -17.456 -23.167 -37.297 1.00 35.43  ? 166 TYR A CG    1 
ATOM   1294  C  CD1   . TYR A  1 194 ? -17.862 -21.851 -37.056 1.00 32.74  ? 166 TYR A CD1   1 
ATOM   1295  C  CD2   . TYR A  1 194 ? -16.133 -23.391 -37.660 1.00 35.25  ? 166 TYR A CD2   1 
ATOM   1296  C  CE1   . TYR A  1 194 ? -16.974 -20.796 -37.180 1.00 35.42  ? 166 TYR A CE1   1 
ATOM   1297  C  CE2   . TYR A  1 194 ? -15.234 -22.341 -37.766 1.00 35.57  ? 166 TYR A CE2   1 
ATOM   1298  C  CZ    . TYR A  1 194 ? -15.661 -21.047 -37.532 1.00 36.75  ? 166 TYR A CZ    1 
ATOM   1299  O  OH    . TYR A  1 194 ? -14.781 -20.000 -37.649 1.00 38.06  ? 166 TYR A OH    1 
ATOM   1300  N  N     . VAL A  1 195 ? -21.151 -25.529 -34.951 1.00 29.21  ? 167 VAL A N     1 
ATOM   1301  C  CA    . VAL A  1 195 ? -22.231 -26.504 -34.953 1.00 28.59  ? 167 VAL A CA    1 
ATOM   1302  C  C     . VAL A  1 195 ? -23.522 -25.844 -34.480 1.00 27.33  ? 167 VAL A C     1 
ATOM   1303  O  O     . VAL A  1 195 ? -23.500 -24.971 -33.617 1.00 26.97  ? 167 VAL A O     1 
ATOM   1304  C  CB    . VAL A  1 195 ? -21.914 -27.724 -34.050 1.00 26.94  ? 167 VAL A CB    1 
ATOM   1305  C  CG1   . VAL A  1 195 ? -20.744 -28.528 -34.618 1.00 28.57  ? 167 VAL A CG1   1 
ATOM   1306  C  CG2   . VAL A  1 195 ? -21.600 -27.260 -32.644 1.00 23.06  ? 167 VAL A CG2   1 
ATOM   1307  N  N     . TYR A  1 196 ? -24.630 -26.249 -35.094 1.00 25.90  ? 168 TYR A N     1 
ATOM   1308  C  CA    . TYR A  1 196 ? -25.981 -25.974 -34.629 1.00 24.94  ? 168 TYR A CA    1 
ATOM   1309  C  C     . TYR A  1 196 ? -26.392 -27.029 -33.576 1.00 29.67  ? 168 TYR A C     1 
ATOM   1310  O  O     . TYR A  1 196 ? -26.167 -28.215 -33.794 1.00 25.82  ? 168 TYR A O     1 
ATOM   1311  C  CB    . TYR A  1 196 ? -26.965 -26.021 -35.808 1.00 25.94  ? 168 TYR A CB    1 
ATOM   1312  C  CG    . TYR A  1 196 ? -26.752 -25.003 -36.918 1.00 30.04  ? 168 TYR A CG    1 
ATOM   1313  C  CD1   . TYR A  1 196 ? -26.642 -23.648 -36.636 1.00 27.66  ? 168 TYR A CD1   1 
ATOM   1314  C  CD2   . TYR A  1 196 ? -26.683 -25.404 -38.260 1.00 24.97  ? 168 TYR A CD2   1 
ATOM   1315  C  CE1   . TYR A  1 196 ? -26.455 -22.718 -37.647 1.00 28.08  ? 168 TYR A CE1   1 
ATOM   1316  C  CE2   . TYR A  1 196 ? -26.504 -24.488 -39.269 1.00 25.28  ? 168 TYR A CE2   1 
ATOM   1317  C  CZ    . TYR A  1 196 ? -26.393 -23.140 -38.957 1.00 28.01  ? 168 TYR A CZ    1 
ATOM   1318  O  OH    . TYR A  1 196 ? -26.214 -22.210 -39.948 1.00 25.34  ? 168 TYR A OH    1 
ATOM   1319  N  N     . LEU A  1 197 ? -27.017 -26.610 -32.473 1.00 22.25  ? 169 LEU A N     1 
ATOM   1320  C  CA    . LEU A  1 197 ? -27.461 -27.531 -31.420 1.00 26.73  ? 169 LEU A CA    1 
ATOM   1321  C  C     . LEU A  1 197 ? -28.980 -27.678 -31.391 1.00 29.22  ? 169 LEU A C     1 
ATOM   1322  O  O     . LEU A  1 197 ? -29.713 -26.735 -31.698 1.00 28.13  ? 169 LEU A O     1 
ATOM   1323  C  CB    . LEU A  1 197 ? -26.971 -27.056 -30.040 1.00 24.64  ? 169 LEU A CB    1 
ATOM   1324  C  CG    . LEU A  1 197 ? -25.459 -26.787 -29.991 1.00 26.43  ? 169 LEU A CG    1 
ATOM   1325  C  CD1   . LEU A  1 197 ? -25.070 -26.227 -28.642 1.00 26.28  ? 169 LEU A CD1   1 
ATOM   1326  C  CD2   . LEU A  1 197 ? -24.680 -28.065 -30.302 1.00 22.75  ? 169 LEU A CD2   1 
ATOM   1327  N  N     . ALA A  1 198 ? -29.450 -28.869 -31.036 1.00 23.22  ? 170 ALA A N     1 
ATOM   1328  C  CA    . ALA A  1 198 ? -30.870 -29.098 -30.780 1.00 27.08  ? 170 ALA A CA    1 
ATOM   1329  C  C     . ALA A  1 198 ? -30.987 -30.269 -29.804 1.00 26.76  ? 170 ALA A C     1 
ATOM   1330  O  O     . ALA A  1 198 ? -29.998 -30.907 -29.490 1.00 25.32  ? 170 ALA A O     1 
ATOM   1331  C  CB    . ALA A  1 198 ? -31.628 -29.368 -32.061 1.00 26.81  ? 170 ALA A CB    1 
ATOM   1332  N  N     . GLU A  1 199 ? -32.173 -30.528 -29.283 1.00 25.85  ? 171 GLU A N     1 
ATOM   1333  C  CA    . GLU A  1 199 ? -32.300 -31.625 -28.340 1.00 27.74  ? 171 GLU A CA    1 
ATOM   1334  C  C     . GLU A  1 199 ? -33.731 -32.097 -28.211 1.00 28.68  ? 171 GLU A C     1 
ATOM   1335  O  O     . GLU A  1 199 ? -34.674 -31.401 -28.609 1.00 31.46  ? 171 GLU A O     1 
ATOM   1336  C  CB    . GLU A  1 199 ? -31.754 -31.244 -26.951 1.00 25.44  ? 171 GLU A CB    1 
ATOM   1337  C  CG    . GLU A  1 199 ? -32.497 -30.093 -26.256 1.00 23.15  ? 171 GLU A CG    1 
ATOM   1338  C  CD    . GLU A  1 199 ? -31.959 -28.713 -26.617 1.00 29.31  ? 171 GLU A CD    1 
ATOM   1339  O  OE1   . GLU A  1 199 ? -30.914 -28.613 -27.308 1.00 24.30  ? 171 GLU A OE1   1 
ATOM   1340  O  OE2   . GLU A  1 199 ? -32.587 -27.709 -26.191 1.00 30.90  ? 171 GLU A OE2   1 
ATOM   1341  N  N     . MET A  1 200 ? -33.866 -33.289 -27.637 1.00 31.79  ? 172 MET A N     1 
ATOM   1342  C  CA    . MET A  1 200 ? -35.136 -33.969 -27.501 1.00 30.11  ? 172 MET A CA    1 
ATOM   1343  C  C     . MET A  1 200 ? -35.251 -34.604 -26.122 1.00 32.36  ? 172 MET A C     1 
ATOM   1344  O  O     . MET A  1 200 ? -34.516 -35.562 -25.788 1.00 28.03  ? 172 MET A O     1 
ATOM   1345  C  CB    . MET A  1 200 ? -35.288 -35.047 -28.582 1.00 32.59  ? 172 MET A CB    1 
ATOM   1346  C  CG    . MET A  1 200 ? -36.645 -35.733 -28.579 1.00 33.15  ? 172 MET A CG    1 
ATOM   1347  S  SD    . MET A  1 200 ? -36.879 -36.910 -29.945 1.00 38.73  ? 172 MET A SD    1 
ATOM   1348  C  CE    . MET A  1 200 ? -35.498 -38.005 -29.658 1.00 31.04  ? 172 MET A CE    1 
ATOM   1349  N  N     . ILE A  1 201 ? -36.178 -34.079 -25.324 1.00 28.83  ? 173 ILE A N     1 
ATOM   1350  C  CA    . ILE A  1 201 ? -36.485 -34.679 -24.033 1.00 32.78  ? 173 ILE A CA    1 
ATOM   1351  C  C     . ILE A  1 201 ? -37.348 -35.926 -24.238 1.00 31.58  ? 173 ILE A C     1 
ATOM   1352  O  O     . ILE A  1 201 ? -38.296 -35.903 -25.033 1.00 34.14  ? 173 ILE A O     1 
ATOM   1353  C  CB    . ILE A  1 201 ? -37.235 -33.716 -23.111 1.00 29.54  ? 173 ILE A CB    1 
ATOM   1354  C  CG1   . ILE A  1 201 ? -36.593 -32.321 -23.114 1.00 29.87  ? 173 ILE A CG1   1 
ATOM   1355  C  CG2   . ILE A  1 201 ? -37.287 -34.275 -21.708 1.00 30.76  ? 173 ILE A CG2   1 
ATOM   1356  C  CD1   . ILE A  1 201 ? -37.365 -31.350 -22.305 1.00 30.74  ? 173 ILE A CD1   1 
ATOM   1357  N  N     . THR A  1 202 ? -37.022 -37.008 -23.536 1.00 30.71  ? 174 THR A N     1 
ATOM   1358  C  CA    . THR A  1 202 ? -37.815 -38.243 -23.629 1.00 33.62  ? 174 THR A CA    1 
ATOM   1359  C  C     . THR A  1 202 ? -38.117 -38.827 -22.257 1.00 38.67  ? 174 THR A C     1 
ATOM   1360  O  O     . THR A  1 202 ? -37.494 -38.442 -21.260 1.00 33.02  ? 174 THR A O     1 
ATOM   1361  C  CB    . THR A  1 202 ? -37.105 -39.360 -24.436 1.00 37.89  ? 174 THR A CB    1 
ATOM   1362  O  OG1   . THR A  1 202 ? -36.097 -39.974 -23.617 1.00 32.24  ? 174 THR A OG1   1 
ATOM   1363  C  CG2   . THR A  1 202 ? -36.479 -38.826 -25.727 1.00 33.39  ? 174 THR A CG2   1 
ATOM   1364  N  N     . ASN A  1 203 ? -39.054 -39.777 -22.221 1.00 39.85  ? 175 ASN A N     1 
ATOM   1365  C  CA    . ASN A  1 203 ? -39.297 -40.575 -21.022 1.00 38.48  ? 175 ASN A CA    1 
ATOM   1366  C  C     . ASN A  1 203 ? -38.566 -41.907 -21.064 1.00 40.77  ? 175 ASN A C     1 
ATOM   1367  O  O     . ASN A  1 203 ? -39.017 -42.881 -20.471 1.00 42.33  ? 175 ASN A O     1 
ATOM   1368  C  CB    . ASN A  1 203 ? -40.795 -40.814 -20.821 1.00 41.95  ? 175 ASN A CB    1 
ATOM   1369  C  CG    . ASN A  1 203 ? -41.413 -41.642 -21.934 1.00 45.64  ? 175 ASN A CG    1 
ATOM   1370  O  OD1   . ASN A  1 203 ? -40.922 -41.655 -23.062 1.00 43.37  ? 175 ASN A OD1   1 
ATOM   1371  N  ND2   . ASN A  1 203 ? -42.504 -42.330 -21.620 1.00 40.60  ? 175 ASN A ND2   1 
ATOM   1372  N  N     . ILE A  1 204 ? -37.429 -41.941 -21.750 1.00 38.35  ? 176 ILE A N     1 
ATOM   1373  C  CA    . ILE A  1 204 ? -36.628 -43.158 -21.873 1.00 35.71  ? 176 ILE A CA    1 
ATOM   1374  C  C     . ILE A  1 204 ? -35.381 -43.078 -21.013 1.00 36.23  ? 176 ILE A C     1 
ATOM   1375  O  O     . ILE A  1 204 ? -34.593 -42.157 -21.174 1.00 37.74  ? 176 ILE A O     1 
ATOM   1376  C  CB    . ILE A  1 204 ? -36.167 -43.412 -23.326 1.00 38.91  ? 176 ILE A CB    1 
ATOM   1377  C  CG1   . ILE A  1 204 ? -37.345 -43.500 -24.290 1.00 35.05  ? 176 ILE A CG1   1 
ATOM   1378  C  CG2   . ILE A  1 204 ? -35.360 -44.686 -23.411 1.00 37.36  ? 176 ILE A CG2   1 
ATOM   1379  C  CD1   . ILE A  1 204 ? -36.904 -43.265 -25.730 1.00 39.03  ? 176 ILE A CD1   1 
ATOM   1380  N  N     . PRO A  1 205 ? -35.167 -44.060 -20.120 1.00 35.67  ? 177 PRO A N     1 
ATOM   1381  C  CA    . PRO A  1 205 ? -34.057 -43.865 -19.191 1.00 36.18  ? 177 PRO A CA    1 
ATOM   1382  C  C     . PRO A  1 205 ? -32.715 -44.202 -19.833 1.00 38.27  ? 177 PRO A C     1 
ATOM   1383  O  O     . PRO A  1 205 ? -32.005 -45.050 -19.309 1.00 39.82  ? 177 PRO A O     1 
ATOM   1384  C  CB    . PRO A  1 205 ? -34.389 -44.839 -18.059 1.00 36.80  ? 177 PRO A CB    1 
ATOM   1385  C  CG    . PRO A  1 205 ? -35.009 -46.006 -18.790 1.00 39.18  ? 177 PRO A CG    1 
ATOM   1386  C  CD    . PRO A  1 205 ? -35.742 -45.417 -20.003 1.00 40.11  ? 177 PRO A CD    1 
ATOM   1387  N  N     . PHE A  1 206 ? -32.371 -43.556 -20.945 1.00 36.71  ? 178 PHE A N     1 
ATOM   1388  C  CA    . PHE A  1 206 ? -31.057 -43.773 -21.563 1.00 40.26  ? 178 PHE A CA    1 
ATOM   1389  C  C     . PHE A  1 206 ? -29.906 -43.548 -20.590 1.00 41.54  ? 178 PHE A C     1 
ATOM   1390  O  O     . PHE A  1 206 ? -29.967 -42.660 -19.738 1.00 38.80  ? 178 PHE A O     1 
ATOM   1391  C  CB    . PHE A  1 206 ? -30.853 -42.849 -22.772 1.00 35.19  ? 178 PHE A CB    1 
ATOM   1392  C  CG    . PHE A  1 206 ? -31.686 -43.208 -23.946 1.00 37.22  ? 178 PHE A CG    1 
ATOM   1393  C  CD1   . PHE A  1 206 ? -32.593 -42.304 -24.469 1.00 36.91  ? 178 PHE A CD1   1 
ATOM   1394  C  CD2   . PHE A  1 206 ? -31.582 -44.465 -24.518 1.00 41.54  ? 178 PHE A CD2   1 
ATOM   1395  C  CE1   . PHE A  1 206 ? -33.359 -42.634 -25.557 1.00 36.91  ? 178 PHE A CE1   1 
ATOM   1396  C  CE2   . PHE A  1 206 ? -32.354 -44.800 -25.597 1.00 40.76  ? 178 PHE A CE2   1 
ATOM   1397  C  CZ    . PHE A  1 206 ? -33.243 -43.884 -26.119 1.00 40.98  ? 178 PHE A CZ    1 
ATOM   1398  N  N     . GLU A  1 207 ? -28.852 -44.342 -20.733 1.00 38.84  ? 179 GLU A N     1 
ATOM   1399  C  CA    . GLU A  1 207 ? -27.624 -44.117 -19.987 1.00 44.45  ? 179 GLU A CA    1 
ATOM   1400  C  C     . GLU A  1 207 ? -26.956 -42.824 -20.448 1.00 46.82  ? 179 GLU A C     1 
ATOM   1401  O  O     . GLU A  1 207 ? -26.706 -42.635 -21.643 1.00 42.31  ? 179 GLU A O     1 
ATOM   1402  C  CB    . GLU A  1 207 ? -26.671 -45.291 -20.159 1.00 45.77  ? 179 GLU A CB    1 
ATOM   1403  C  CG    . GLU A  1 207 ? -25.382 -45.172 -19.381 1.00 54.68  ? 179 GLU A CG    1 
ATOM   1404  C  CD    . GLU A  1 207 ? -24.676 -46.519 -19.224 1.00 73.35  ? 179 GLU A CD    1 
ATOM   1405  O  OE1   . GLU A  1 207 ? -24.453 -47.207 -20.248 1.00 69.04  ? 179 GLU A OE1   1 
ATOM   1406  O  OE2   . GLU A  1 207 ? -24.356 -46.896 -18.071 1.00 78.60  ? 179 GLU A OE2   1 
ATOM   1407  N  N     . PRO A  1 208 ? -26.664 -41.922 -19.502 1.00 42.06  ? 180 PRO A N     1 
ATOM   1408  C  CA    . PRO A  1 208 ? -26.036 -40.659 -19.914 1.00 41.36  ? 180 PRO A CA    1 
ATOM   1409  C  C     . PRO A  1 208 ? -24.592 -40.837 -20.367 1.00 42.64  ? 180 PRO A C     1 
ATOM   1410  O  O     . PRO A  1 208 ? -23.938 -41.833 -20.035 1.00 43.43  ? 180 PRO A O     1 
ATOM   1411  C  CB    . PRO A  1 208 ? -26.102 -39.799 -18.647 1.00 36.53  ? 180 PRO A CB    1 
ATOM   1412  C  CG    . PRO A  1 208 ? -26.183 -40.795 -17.504 1.00 37.79  ? 180 PRO A CG    1 
ATOM   1413  C  CD    . PRO A  1 208 ? -26.975 -41.957 -18.062 1.00 42.94  ? 180 PRO A CD    1 
ATOM   1414  N  N     . ASP A  1 209 ? -24.107 -39.860 -21.124 1.00 36.96  ? 181 ASP A N     1 
ATOM   1415  C  CA    . ASP A  1 209 ? -22.715 -39.821 -21.539 1.00 32.81  ? 181 ASP A CA    1 
ATOM   1416  C  C     . ASP A  1 209 ? -21.908 -38.985 -20.549 1.00 38.75  ? 181 ASP A C     1 
ATOM   1417  O  O     . ASP A  1 209 ? -22.473 -38.432 -19.595 1.00 36.78  ? 181 ASP A O     1 
ATOM   1418  C  CB    . ASP A  1 209 ? -22.617 -39.274 -22.964 1.00 34.96  ? 181 ASP A CB    1 
ATOM   1419  C  CG    . ASP A  1 209 ? -23.333 -40.169 -23.979 1.00 39.30  ? 181 ASP A CG    1 
ATOM   1420  O  OD1   . ASP A  1 209 ? -23.453 -41.393 -23.727 1.00 45.95  ? 181 ASP A OD1   1 
ATOM   1421  O  OD2   . ASP A  1 209 ? -23.773 -39.665 -25.028 1.00 37.76  ? 181 ASP A OD2   1 
ATOM   1422  N  N     . VAL A  1 210 ? -20.595 -38.893 -20.755 1.00 40.95  ? 182 VAL A N     1 
ATOM   1423  C  CA    . VAL A  1 210 ? -19.739 -38.119 -19.850 1.00 40.25  ? 182 VAL A CA    1 
ATOM   1424  C  C     . VAL A  1 210 ? -19.314 -36.775 -20.469 1.00 39.83  ? 182 VAL A C     1 
ATOM   1425  O  O     . VAL A  1 210 ? -18.976 -36.709 -21.650 1.00 39.77  ? 182 VAL A O     1 
ATOM   1426  C  CB    . VAL A  1 210 ? -18.476 -38.929 -19.450 1.00 45.56  ? 182 VAL A CB    1 
ATOM   1427  C  CG1   . VAL A  1 210 ? -17.603 -39.207 -20.657 1.00 38.00  ? 182 VAL A CG1   1 
ATOM   1428  C  CG2   . VAL A  1 210 ? -17.678 -38.194 -18.388 1.00 52.83  ? 182 VAL A CG2   1 
ATOM   1429  N  N     . PRO A  1 211 ? -19.365 -35.684 -19.683 1.00 44.03  ? 183 PRO A N     1 
ATOM   1430  C  CA    . PRO A  1 211 ? -18.874 -34.406 -20.235 1.00 44.82  ? 183 PRO A CA    1 
ATOM   1431  C  C     . PRO A  1 211 ? -17.425 -34.525 -20.735 1.00 48.95  ? 183 PRO A C     1 
ATOM   1432  O  O     . PRO A  1 211 ? -16.674 -35.364 -20.227 1.00 50.18  ? 183 PRO A O     1 
ATOM   1433  C  CB    . PRO A  1 211 ? -18.979 -33.442 -19.043 1.00 41.22  ? 183 PRO A CB    1 
ATOM   1434  C  CG    . PRO A  1 211 ? -20.133 -33.980 -18.232 1.00 39.10  ? 183 PRO A CG    1 
ATOM   1435  C  CD    . PRO A  1 211 ? -20.086 -35.506 -18.406 1.00 32.12  ? 183 PRO A CD    1 
ATOM   1436  N  N     . ILE A  1 212 ? -17.038 -33.727 -21.725 1.00 41.32  ? 184 ILE A N     1 
ATOM   1437  C  CA    . ILE A  1 212 ? -15.692 -33.863 -22.268 1.00 42.93  ? 184 ILE A CA    1 
ATOM   1438  C  C     . ILE A  1 212 ? -14.734 -32.773 -21.778 1.00 51.09  ? 184 ILE A C     1 
ATOM   1439  O  O     . ILE A  1 212 ? -15.152 -31.773 -21.182 1.00 45.94  ? 184 ILE A O     1 
ATOM   1440  C  CB    . ILE A  1 212 ? -15.721 -33.887 -23.801 1.00 46.30  ? 184 ILE A CB    1 
ATOM   1441  C  CG1   . ILE A  1 212 ? -16.152 -32.543 -24.379 1.00 41.60  ? 184 ILE A CG1   1 
ATOM   1442  C  CG2   . ILE A  1 212 ? -16.651 -34.997 -24.293 1.00 44.25  ? 184 ILE A CG2   1 
ATOM   1443  C  CD1   . ILE A  1 212 ? -15.941 -32.491 -25.876 1.00 40.10  ? 184 ILE A CD1   1 
ATOM   1444  N  N     . GLU A  1 213 ? -13.442 -32.991 -22.016 1.00 50.68  ? 185 GLU A N     1 
ATOM   1445  C  CA    . GLU A  1 213 ? -12.389 -32.146 -21.465 1.00 49.41  ? 185 GLU A CA    1 
ATOM   1446  C  C     . GLU A  1 213 ? -12.402 -30.726 -22.033 1.00 49.65  ? 185 GLU A C     1 
ATOM   1447  O  O     . GLU A  1 213 ? -12.716 -30.521 -23.205 1.00 47.49  ? 185 GLU A O     1 
ATOM   1448  C  CB    . GLU A  1 213 ? -11.025 -32.792 -21.720 1.00 50.52  ? 185 GLU A CB    1 
ATOM   1449  C  CG    . GLU A  1 213 ? -9.847  -32.034 -21.105 1.00 62.75  ? 185 GLU A CG    1 
ATOM   1450  C  CD    . GLU A  1 213 ? -8.489  -32.544 -21.582 1.00 71.34  ? 185 GLU A CD    1 
ATOM   1451  O  OE1   . GLU A  1 213 ? -8.412  -33.692 -22.078 1.00 68.74  ? 185 GLU A OE1   1 
ATOM   1452  O  OE2   . GLU A  1 213 ? -7.498  -31.786 -21.462 1.00 74.68  ? 185 GLU A OE2   1 
ATOM   1453  N  N     . ASP A  1 214 ? -12.057 -29.749 -21.196 1.00 49.95  ? 186 ASP A N     1 
ATOM   1454  C  CA    . ASP A  1 214 ? -11.908 -28.371 -21.649 1.00 48.91  ? 186 ASP A CA    1 
ATOM   1455  C  C     . ASP A  1 214 ? -10.555 -28.178 -22.314 1.00 50.41  ? 186 ASP A C     1 
ATOM   1456  O  O     . ASP A  1 214 ? -9.522  -28.455 -21.711 1.00 54.73  ? 186 ASP A O     1 
ATOM   1457  C  CB    . ASP A  1 214 ? -12.057 -27.392 -20.488 1.00 48.96  ? 186 ASP A CB    1 
ATOM   1458  C  CG    . ASP A  1 214 ? -12.061 -25.946 -20.950 1.00 53.12  ? 186 ASP A CG    1 
ATOM   1459  O  OD1   . ASP A  1 214 ? -13.149 -25.333 -20.969 1.00 59.84  ? 186 ASP A OD1   1 
ATOM   1460  O  OD2   . ASP A  1 214 ? -10.983 -25.425 -21.318 1.00 50.37  ? 186 ASP A OD2   1 
ATOM   1461  N  N     . MET A  1 215 ? -10.555 -27.666 -23.542 1.00 46.69  ? 187 MET A N     1 
ATOM   1462  C  CA    . MET A  1 215 ? -9.338  -27.634 -24.341 1.00 46.36  ? 187 MET A CA    1 
ATOM   1463  C  C     . MET A  1 215 ? -8.789  -26.229 -24.536 1.00 48.69  ? 187 MET A C     1 
ATOM   1464  O  O     . MET A  1 215 ? -7.892  -26.018 -25.360 1.00 50.06  ? 187 MET A O     1 
ATOM   1465  C  CB    . MET A  1 215 ? -9.592  -28.277 -25.712 1.00 43.10  ? 187 MET A CB    1 
ATOM   1466  C  CG    . MET A  1 215 ? -10.053 -29.746 -25.657 1.00 50.86  ? 187 MET A CG    1 
ATOM   1467  S  SD    . MET A  1 215 ? -9.002  -30.841 -24.653 1.00 60.09  ? 187 MET A SD    1 
ATOM   1468  C  CE    . MET A  1 215 ? -7.428  -30.696 -25.504 1.00 57.41  ? 187 MET A CE    1 
ATOM   1469  N  N     . CYS A  1 216 ? -9.323  -25.265 -23.796 1.00 46.40  ? 188 CYS A N     1 
ATOM   1470  C  CA    . CYS A  1 216 ? -8.930  -23.881 -24.030 1.00 51.34  ? 188 CYS A CA    1 
ATOM   1471  C  C     . CYS A  1 216 ? -7.562  -23.587 -23.442 1.00 52.95  ? 188 CYS A C     1 
ATOM   1472  O  O     . CYS A  1 216 ? -6.823  -22.755 -23.969 1.00 52.10  ? 188 CYS A O     1 
ATOM   1473  C  CB    . CYS A  1 216 ? -9.966  -22.915 -23.461 1.00 48.35  ? 188 CYS A CB    1 
ATOM   1474  S  SG    . CYS A  1 216 ? -11.390 -22.666 -24.534 1.00 38.94  ? 188 CYS A SG    1 
ATOM   1475  N  N     . GLY A  1 217 ? -7.221  -24.279 -22.362 1.00 54.64  ? 189 GLY A N     1 
ATOM   1476  C  CA    . GLY A  1 217 ? -5.961  -24.046 -21.685 1.00 52.05  ? 189 GLY A CA    1 
ATOM   1477  C  C     . GLY A  1 217 ? -5.804  -22.601 -21.256 1.00 49.83  ? 189 GLY A C     1 
ATOM   1478  O  O     . GLY A  1 217 ? -6.722  -22.008 -20.686 1.00 50.87  ? 189 GLY A O     1 
ATOM   1479  N  N     . SER A  1 218 ? -4.645  -22.026 -21.550 1.00 45.22  ? 190 SER A N     1 
ATOM   1480  C  CA    . SER A  1 218 ? -4.343  -20.668 -21.113 1.00 54.86  ? 190 SER A CA    1 
ATOM   1481  C  C     . SER A  1 218 ? -4.690  -19.631 -22.175 1.00 51.12  ? 190 SER A C     1 
ATOM   1482  O  O     . SER A  1 218 ? -4.383  -18.452 -22.018 1.00 50.72  ? 190 SER A O     1 
ATOM   1483  C  CB    . SER A  1 218 ? -2.865  -20.543 -20.750 1.00 57.75  ? 190 SER A CB    1 
ATOM   1484  O  OG    . SER A  1 218 ? -2.055  -20.763 -21.895 1.00 60.31  ? 190 SER A OG    1 
ATOM   1485  N  N     . CYS A  1 219 ? -5.324  -20.071 -23.255 1.00 50.77  ? 191 CYS A N     1 
ATOM   1486  C  CA    . CYS A  1 219 ? -5.621  -19.182 -24.374 1.00 50.32  ? 191 CYS A CA    1 
ATOM   1487  C  C     . CYS A  1 219 ? -6.649  -18.100 -23.976 1.00 46.67  ? 191 CYS A C     1 
ATOM   1488  O  O     . CYS A  1 219 ? -7.557  -18.359 -23.183 1.00 46.83  ? 191 CYS A O     1 
ATOM   1489  C  CB    . CYS A  1 219 ? -6.109  -20.017 -25.563 1.00 49.55  ? 191 CYS A CB    1 
ATOM   1490  S  SG    . CYS A  1 219 ? -6.565  -19.137 -27.078 1.00 50.72  ? 191 CYS A SG    1 
ATOM   1491  N  N     . THR A  1 220 ? -6.463  -16.883 -24.490 1.00 46.05  ? 192 THR A N     1 
ATOM   1492  C  CA    . THR A  1 220 ? -7.440  -15.801 -24.347 1.00 47.56  ? 192 THR A CA    1 
ATOM   1493  C  C     . THR A  1 220 ? -7.668  -15.059 -25.673 1.00 46.51  ? 192 THR A C     1 
ATOM   1494  O  O     . THR A  1 220 ? -7.984  -13.871 -25.677 1.00 44.25  ? 192 THR A O     1 
ATOM   1495  C  CB    . THR A  1 220 ? -7.007  -14.746 -23.280 1.00 50.24  ? 192 THR A CB    1 
ATOM   1496  O  OG1   . THR A  1 220 ? -5.752  -14.165 -23.654 1.00 48.21  ? 192 THR A OG1   1 
ATOM   1497  C  CG2   . THR A  1 220 ? -6.903  -15.358 -21.883 1.00 48.78  ? 192 THR A CG2   1 
ATOM   1498  N  N     . LYS A  1 221 ? -7.507  -15.751 -26.796 1.00 44.88  ? 193 LYS A N     1 
ATOM   1499  C  CA    . LYS A  1 221 ? -7.565  -15.082 -28.095 1.00 48.55  ? 193 LYS A CA    1 
ATOM   1500  C  C     . LYS A  1 221 ? -8.938  -14.466 -28.398 1.00 44.05  ? 193 LYS A C     1 
ATOM   1501  O  O     . LYS A  1 221 ? -9.017  -13.377 -28.961 1.00 40.50  ? 193 LYS A O     1 
ATOM   1502  C  CB    . LYS A  1 221 ? -7.186  -16.059 -29.213 1.00 49.50  ? 193 LYS A CB    1 
ATOM   1503  C  CG    . LYS A  1 221 ? -5.698  -16.340 -29.322 1.00 51.41  ? 193 LYS A CG    1 
ATOM   1504  C  CD    . LYS A  1 221 ? -5.401  -17.103 -30.602 1.00 53.53  ? 193 LYS A CD    1 
ATOM   1505  C  CE    . LYS A  1 221 ? -3.907  -17.222 -30.857 1.00 60.66  ? 193 LYS A CE    1 
ATOM   1506  N  NZ    . LYS A  1 221 ? -3.207  -17.904 -29.731 1.00 51.75  ? 193 LYS A NZ    1 
ATOM   1507  N  N     . CYS A  1 222 ? -10.005 -15.179 -28.050 1.00 39.88  ? 194 CYS A N     1 
ATOM   1508  C  CA    . CYS A  1 222 ? -11.362 -14.701 -28.287 1.00 34.90  ? 194 CYS A CA    1 
ATOM   1509  C  C     . CYS A  1 222 ? -11.652 -13.480 -27.419 1.00 41.35  ? 194 CYS A C     1 
ATOM   1510  O  O     . CYS A  1 222 ? -12.254 -12.512 -27.879 1.00 39.83  ? 194 CYS A O     1 
ATOM   1511  C  CB    . CYS A  1 222 ? -12.391 -15.802 -28.001 1.00 29.92  ? 194 CYS A CB    1 
ATOM   1512  S  SG    . CYS A  1 222 ? -12.258 -16.566 -26.347 1.00 38.60  ? 194 CYS A SG    1 
ATOM   1513  N  N     . LEU A  1 223 ? -11.230 -13.536 -26.157 1.00 39.80  ? 195 LEU A N     1 
ATOM   1514  C  CA    . LEU A  1 223 ? -11.500 -12.457 -25.224 1.00 41.12  ? 195 LEU A CA    1 
ATOM   1515  C  C     . LEU A  1 223 ? -10.815 -11.174 -25.679 1.00 44.95  ? 195 LEU A C     1 
ATOM   1516  O  O     . LEU A  1 223 ? -11.419 -10.104 -25.653 1.00 38.18  ? 195 LEU A O     1 
ATOM   1517  C  CB    . LEU A  1 223 ? -11.055 -12.843 -23.815 1.00 48.32  ? 195 LEU A CB    1 
ATOM   1518  C  CG    . LEU A  1 223 ? -11.849 -14.002 -23.206 1.00 44.42  ? 195 LEU A CG    1 
ATOM   1519  C  CD1   . LEU A  1 223 ? -10.977 -15.213 -23.036 1.00 46.29  ? 195 LEU A CD1   1 
ATOM   1520  C  CD2   . LEU A  1 223 ? -12.436 -13.579 -21.879 1.00 45.18  ? 195 LEU A CD2   1 
ATOM   1521  N  N     . ASP A  1 224 ? -9.573  -11.294 -26.141 1.00 42.81  ? 196 ASP A N     1 
ATOM   1522  C  CA    . ASP A  1 224 ? -8.822  -10.143 -26.631 1.00 41.04  ? 196 ASP A CA    1 
ATOM   1523  C  C     . ASP A  1 224 ? -9.315  -9.652  -28.001 1.00 43.95  ? 196 ASP A C     1 
ATOM   1524  O  O     . ASP A  1 224 ? -9.145  -8.487  -28.345 1.00 44.45  ? 196 ASP A O     1 
ATOM   1525  C  CB    . ASP A  1 224 ? -7.327  -10.479 -26.725 1.00 44.86  ? 196 ASP A CB    1 
ATOM   1526  C  CG    . ASP A  1 224 ? -6.750  -10.997 -25.415 1.00 49.10  ? 196 ASP A CG    1 
ATOM   1527  O  OD1   . ASP A  1 224 ? -7.172  -10.525 -24.336 1.00 50.08  ? 196 ASP A OD1   1 
ATOM   1528  O  OD2   . ASP A  1 224 ? -5.866  -11.880 -25.467 1.00 50.40  ? 196 ASP A OD2   1 
ATOM   1529  N  N     . ALA A  1 225 ? -9.910  -10.536 -28.794 1.00 37.13  ? 197 ALA A N     1 
ATOM   1530  C  CA    . ALA A  1 225 ? -10.289 -10.163 -30.153 1.00 40.88  ? 197 ALA A CA    1 
ATOM   1531  C  C     . ALA A  1 225 ? -11.656 -9.493  -30.217 1.00 36.67  ? 197 ALA A C     1 
ATOM   1532  O  O     . ALA A  1 225 ? -11.929 -8.746  -31.148 1.00 34.78  ? 197 ALA A O     1 
ATOM   1533  C  CB    . ALA A  1 225 ? -10.270 -11.389 -31.065 1.00 37.81  ? 197 ALA A CB    1 
ATOM   1534  N  N     . CYS A  1 226 ? -12.513 -9.780  -29.243 1.00 34.63  ? 198 CYS A N     1 
ATOM   1535  C  CA    . CYS A  1 226 ? -13.884 -9.294  -29.269 1.00 35.01  ? 198 CYS A CA    1 
ATOM   1536  C  C     . CYS A  1 226 ? -13.931 -7.781  -29.387 1.00 41.31  ? 198 CYS A C     1 
ATOM   1537  O  O     . CYS A  1 226 ? -13.403 -7.071  -28.527 1.00 42.42  ? 198 CYS A O     1 
ATOM   1538  C  CB    . CYS A  1 226 ? -14.638 -9.717  -28.025 1.00 33.46  ? 198 CYS A CB    1 
ATOM   1539  S  SG    . CYS A  1 226 ? -16.257 -8.939  -27.912 1.00 34.33  ? 198 CYS A SG    1 
ATOM   1540  N  N     . PRO A  1 227 ? -14.569 -7.283  -30.453 1.00 37.70  ? 199 PRO A N     1 
ATOM   1541  C  CA    . PRO A  1 227 ? -14.489 -5.853  -30.780 1.00 39.49  ? 199 PRO A CA    1 
ATOM   1542  C  C     . PRO A  1 227 ? -15.062 -4.933  -29.706 1.00 42.69  ? 199 PRO A C     1 
ATOM   1543  O  O     . PRO A  1 227 ? -14.733 -3.753  -29.706 1.00 40.43  ? 199 PRO A O     1 
ATOM   1544  C  CB    . PRO A  1 227 ? -15.303 -5.745  -32.077 1.00 40.25  ? 199 PRO A CB    1 
ATOM   1545  C  CG    . PRO A  1 227 ? -15.260 -7.114  -32.672 1.00 42.31  ? 199 PRO A CG    1 
ATOM   1546  C  CD    . PRO A  1 227 ? -15.278 -8.053  -31.489 1.00 33.92  ? 199 PRO A CD    1 
ATOM   1547  N  N     . THR A  1 228 ? -15.885 -5.447  -28.799 1.00 38.01  ? 200 THR A N     1 
ATOM   1548  C  CA    . THR A  1 228 ? -16.565 -4.572  -27.853 1.00 37.27  ? 200 THR A CA    1 
ATOM   1549  C  C     . THR A  1 228 ? -16.254 -4.933  -26.421 1.00 39.53  ? 200 THR A C     1 
ATOM   1550  O  O     . THR A  1 228 ? -16.767 -4.311  -25.491 1.00 35.02  ? 200 THR A O     1 
ATOM   1551  C  CB    . THR A  1 228 ? -18.089 -4.614  -28.038 1.00 37.25  ? 200 THR A CB    1 
ATOM   1552  O  OG1   . THR A  1 228 ? -18.535 -5.976  -27.942 1.00 37.38  ? 200 THR A OG1   1 
ATOM   1553  C  CG2   . THR A  1 228 ? -18.486 -4.026  -29.400 1.00 29.56  ? 200 THR A CG2   1 
ATOM   1554  N  N     . GLY A  1 229 ? -15.422 -5.957  -26.261 1.00 42.89  ? 201 GLY A N     1 
ATOM   1555  C  CA    . GLY A  1 229 ? -15.104 -6.506  -24.965 1.00 40.92  ? 201 GLY A CA    1 
ATOM   1556  C  C     . GLY A  1 229 ? -16.324 -7.116  -24.310 1.00 42.04  ? 201 GLY A C     1 
ATOM   1557  O  O     . GLY A  1 229 ? -16.417 -7.105  -23.082 1.00 44.70  ? 201 GLY A O     1 
ATOM   1558  N  N     . ALA A  1 230 ? -17.258 -7.639  -25.111 1.00 35.55  ? 202 ALA A N     1 
ATOM   1559  C  CA    . ALA A  1 230 ? -18.487 -8.232  -24.560 1.00 32.52  ? 202 ALA A CA    1 
ATOM   1560  C  C     . ALA A  1 230 ? -18.167 -9.462  -23.722 1.00 33.15  ? 202 ALA A C     1 
ATOM   1561  O  O     . ALA A  1 230 ? -18.890 -9.783  -22.777 1.00 32.50  ? 202 ALA A O     1 
ATOM   1562  C  CB    . ALA A  1 230 ? -19.457 -8.595  -25.667 1.00 30.27  ? 202 ALA A CB    1 
ATOM   1563  N  N     . LEU A  1 231 ? -17.090 -10.159 -24.074 1.00 30.06  ? 203 LEU A N     1 
ATOM   1564  C  CA    . LEU A  1 231 ? -16.648 -11.284 -23.254 1.00 33.68  ? 203 LEU A CA    1 
ATOM   1565  C  C     . LEU A  1 231 ? -15.922 -10.736 -22.021 1.00 37.86  ? 203 LEU A C     1 
ATOM   1566  O  O     . LEU A  1 231 ? -14.706 -10.542 -22.038 1.00 37.33  ? 203 LEU A O     1 
ATOM   1567  C  CB    . LEU A  1 231 ? -15.760 -12.236 -24.071 1.00 35.03  ? 203 LEU A CB    1 
ATOM   1568  C  CG    . LEU A  1 231 ? -16.515 -13.090 -25.104 1.00 34.21  ? 203 LEU A CG    1 
ATOM   1569  C  CD1   . LEU A  1 231 ? -15.591 -13.622 -26.198 1.00 32.28  ? 203 LEU A CD1   1 
ATOM   1570  C  CD2   . LEU A  1 231 ? -17.250 -14.253 -24.427 1.00 31.70  ? 203 LEU A CD2   1 
ATOM   1571  N  N     . VAL A  1 232 ? -16.688 -10.478 -20.959 1.00 39.14  ? 204 VAL A N     1 
ATOM   1572  C  CA    . VAL A  1 232 ? -16.184 -9.752  -19.788 1.00 38.59  ? 204 VAL A CA    1 
ATOM   1573  C  C     . VAL A  1 232 ? -15.300 -10.623 -18.896 1.00 41.23  ? 204 VAL A C     1 
ATOM   1574  O  O     . VAL A  1 232 ? -14.411 -10.107 -18.226 1.00 44.82  ? 204 VAL A O     1 
ATOM   1575  C  CB    . VAL A  1 232 ? -17.346 -9.156  -18.940 1.00 32.60  ? 204 VAL A CB    1 
ATOM   1576  C  CG1   . VAL A  1 232 ? -18.093 -8.089  -19.726 1.00 37.71  ? 204 VAL A CG1   1 
ATOM   1577  C  CG2   . VAL A  1 232 ? -18.307 -10.228 -18.520 1.00 36.91  ? 204 VAL A CG2   1 
ATOM   1578  N  N     . ASN A  1 233 ? -15.563 -11.930 -18.883 1.00 36.45  ? 205 ASN A N     1 
ATOM   1579  C  CA    . ASN A  1 233 ? -14.679 -12.934 -18.282 1.00 32.03  ? 205 ASN A CA    1 
ATOM   1580  C  C     . ASN A  1 233 ? -14.782 -14.184 -19.153 1.00 43.05  ? 205 ASN A C     1 
ATOM   1581  O  O     . ASN A  1 233 ? -15.672 -14.237 -20.008 1.00 42.45  ? 205 ASN A O     1 
ATOM   1582  C  CB    . ASN A  1 233 ? -15.075 -13.242 -16.830 1.00 37.35  ? 205 ASN A CB    1 
ATOM   1583  C  CG    . ASN A  1 233 ? -14.756 -12.095 -15.873 1.00 45.27  ? 205 ASN A CG    1 
ATOM   1584  O  OD1   . ASN A  1 233 ? -13.588 -11.742 -15.671 1.00 43.37  ? 205 ASN A OD1   1 
ATOM   1585  N  ND2   . ASN A  1 233 ? -15.792 -11.515 -15.276 1.00 35.07  ? 205 ASN A ND2   1 
ATOM   1586  N  N     . PRO A  1 234 ? -13.874 -15.174 -18.973 1.00 40.48  ? 206 PRO A N     1 
ATOM   1587  C  CA    . PRO A  1 234 ? -14.015 -16.444 -19.704 1.00 41.46  ? 206 PRO A CA    1 
ATOM   1588  C  C     . PRO A  1 234 ? -15.375 -17.082 -19.466 1.00 35.62  ? 206 PRO A C     1 
ATOM   1589  O  O     . PRO A  1 234 ? -15.758 -17.272 -18.321 1.00 33.80  ? 206 PRO A O     1 
ATOM   1590  C  CB    . PRO A  1 234 ? -12.902 -17.322 -19.112 1.00 35.33  ? 206 PRO A CB    1 
ATOM   1591  C  CG    . PRO A  1 234 ? -11.853 -16.355 -18.708 1.00 41.01  ? 206 PRO A CG    1 
ATOM   1592  C  CD    . PRO A  1 234 ? -12.596 -15.113 -18.236 1.00 42.57  ? 206 PRO A CD    1 
ATOM   1593  N  N     . GLY A  1 235 ? -16.092 -17.395 -20.538 1.00 34.35  ? 207 GLY A N     1 
ATOM   1594  C  CA    . GLY A  1 235 ? -17.368 -18.067 -20.414 1.00 29.72  ? 207 GLY A CA    1 
ATOM   1595  C  C     . GLY A  1 235 ? -18.446 -17.126 -19.930 1.00 30.74  ? 207 GLY A C     1 
ATOM   1596  O  O     . GLY A  1 235 ? -19.495 -17.559 -19.479 1.00 35.06  ? 207 GLY A O     1 
ATOM   1597  N  N     . GLN A  1 236 ? -18.201 -15.826 -20.040 1.00 30.55  ? 208 GLN A N     1 
ATOM   1598  C  CA    . GLN A  1 236 ? -19.174 -14.865 -19.555 1.00 34.17  ? 208 GLN A CA    1 
ATOM   1599  C  C     . GLN A  1 236 ? -19.396 -13.756 -20.576 1.00 34.47  ? 208 GLN A C     1 
ATOM   1600  O  O     . GLN A  1 236 ? -18.479 -12.994 -20.894 1.00 32.99  ? 208 GLN A O     1 
ATOM   1601  C  CB    . GLN A  1 236 ? -18.741 -14.268 -18.206 1.00 31.23  ? 208 GLN A CB    1 
ATOM   1602  C  CG    . GLN A  1 236 ? -19.824 -13.374 -17.569 1.00 37.21  ? 208 GLN A CG    1 
ATOM   1603  C  CD    . GLN A  1 236 ? -19.443 -12.834 -16.189 1.00 34.90  ? 208 GLN A CD    1 
ATOM   1604  O  OE1   . GLN A  1 236 ? -18.286 -12.524 -15.918 1.00 34.01  ? 208 GLN A OE1   1 
ATOM   1605  N  NE2   . GLN A  1 236 ? -20.426 -12.714 -15.323 1.00 28.55  ? 208 GLN A NE2   1 
ATOM   1606  N  N     . LEU A  1 237 ? -20.617 -13.683 -21.092 1.00 32.69  ? 209 LEU A N     1 
ATOM   1607  C  CA    . LEU A  1 237 ? -20.961 -12.676 -22.077 1.00 28.41  ? 209 LEU A CA    1 
ATOM   1608  C  C     . LEU A  1 237 ? -21.836 -11.620 -21.450 1.00 29.42  ? 209 LEU A C     1 
ATOM   1609  O  O     . LEU A  1 237 ? -22.810 -11.954 -20.773 1.00 27.32  ? 209 LEU A O     1 
ATOM   1610  C  CB    . LEU A  1 237 ? -21.695 -13.300 -23.266 1.00 26.44  ? 209 LEU A CB    1 
ATOM   1611  C  CG    . LEU A  1 237 ? -21.851 -12.354 -24.456 1.00 26.72  ? 209 LEU A CG    1 
ATOM   1612  C  CD1   . LEU A  1 237 ? -20.481 -12.057 -25.059 1.00 24.02  ? 209 LEU A CD1   1 
ATOM   1613  C  CD2   . LEU A  1 237 ? -22.786 -12.948 -25.505 1.00 28.97  ? 209 LEU A CD2   1 
ATOM   1614  N  N     . ASN A  1 238 ? -21.481 -10.350 -21.664 1.00 32.72  ? 210 ASN A N     1 
ATOM   1615  C  CA    . ASN A  1 238 ? -22.426 -9.258  -21.500 1.00 27.59  ? 210 ASN A CA    1 
ATOM   1616  C  C     . ASN A  1 238 ? -23.112 -9.097  -22.852 1.00 31.20  ? 210 ASN A C     1 
ATOM   1617  O  O     . ASN A  1 238 ? -22.589 -8.430  -23.759 1.00 34.62  ? 210 ASN A O     1 
ATOM   1618  C  CB    . ASN A  1 238 ? -21.735 -7.953  -21.055 1.00 31.67  ? 210 ASN A CB    1 
ATOM   1619  C  CG    . ASN A  1 238 ? -22.711 -6.775  -20.914 1.00 31.18  ? 210 ASN A CG    1 
ATOM   1620  O  OD1   . ASN A  1 238 ? -23.904 -6.889  -21.211 1.00 30.02  ? 210 ASN A OD1   1 
ATOM   1621  N  ND2   . ASN A  1 238 ? -22.201 -5.636  -20.440 1.00 33.32  ? 210 ASN A ND2   1 
ATOM   1622  N  N     . ALA A  1 239 ? -24.279 -9.720  -22.987 1.00 28.15  ? 211 ALA A N     1 
ATOM   1623  C  CA    . ALA A  1 239 ? -24.967 -9.797  -24.276 1.00 26.51  ? 211 ALA A CA    1 
ATOM   1624  C  C     . ALA A  1 239 ? -25.354 -8.416  -24.801 1.00 28.58  ? 211 ALA A C     1 
ATOM   1625  O  O     . ALA A  1 239 ? -25.465 -8.221  -26.016 1.00 29.89  ? 211 ALA A O     1 
ATOM   1626  C  CB    . ALA A  1 239 ? -26.197 -10.686 -24.158 1.00 27.62  ? 211 ALA A CB    1 
ATOM   1627  N  N     . GLN A  1 240 ? -25.523 -7.449  -23.895 1.00 29.69  ? 212 GLN A N     1 
ATOM   1628  C  CA    . GLN A  1 240 ? -25.880 -6.080  -24.284 1.00 31.45  ? 212 GLN A CA    1 
ATOM   1629  C  C     . GLN A  1 240 ? -24.775 -5.392  -25.096 1.00 28.80  ? 212 GLN A C     1 
ATOM   1630  O  O     . GLN A  1 240 ? -25.040 -4.441  -25.825 1.00 32.42  ? 212 GLN A O     1 
ATOM   1631  C  CB    . GLN A  1 240 ? -26.206 -5.224  -23.043 1.00 30.86  ? 212 GLN A CB    1 
ATOM   1632  C  CG    . GLN A  1 240 ? -27.474 -5.638  -22.316 1.00 27.90  ? 212 GLN A CG    1 
ATOM   1633  C  CD    . GLN A  1 240 ? -28.671 -5.674  -23.237 1.00 32.56  ? 212 GLN A CD    1 
ATOM   1634  O  OE1   . GLN A  1 240 ? -29.009 -4.672  -23.851 1.00 33.36  ? 212 GLN A OE1   1 
ATOM   1635  N  NE2   . GLN A  1 240 ? -29.305 -6.839  -23.361 1.00 32.35  ? 212 GLN A NE2   1 
ATOM   1636  N  N     . ARG A  1 241 ? -23.545 -5.875  -24.961 1.00 28.28  ? 213 ARG A N     1 
ATOM   1637  C  CA    . ARG A  1 241 ? -22.411 -5.283  -25.658 1.00 25.93  ? 213 ARG A CA    1 
ATOM   1638  C  C     . ARG A  1 241 ? -21.970 -6.157  -26.835 1.00 29.17  ? 213 ARG A C     1 
ATOM   1639  O  O     . ARG A  1 241 ? -21.083 -5.787  -27.600 1.00 28.87  ? 213 ARG A O     1 
ATOM   1640  C  CB    . ARG A  1 241 ? -21.249 -5.054  -24.665 1.00 31.80  ? 213 ARG A CB    1 
ATOM   1641  C  CG    . ARG A  1 241 ? -21.521 -3.914  -23.631 1.00 34.47  ? 213 ARG A CG    1 
ATOM   1642  C  CD    . ARG A  1 241 ? -20.259 -3.531  -22.850 1.00 37.01  ? 213 ARG A CD    1 
ATOM   1643  N  NE    . ARG A  1 241 ? -19.185 -3.122  -23.756 1.00 38.98  ? 213 ARG A NE    1 
ATOM   1644  C  CZ    . ARG A  1 241 ? -19.075 -1.901  -24.277 1.00 42.99  ? 213 ARG A CZ    1 
ATOM   1645  N  NH1   . ARG A  1 241 ? -19.967 -0.963  -23.961 1.00 40.99  ? 213 ARG A NH1   1 
ATOM   1646  N  NH2   . ARG A  1 241 ? -18.074 -1.617  -25.110 1.00 33.41  ? 213 ARG A NH2   1 
ATOM   1647  N  N     . CYS A  1 242 ? -22.597 -7.323  -26.980 1.00 31.38  ? 214 CYS A N     1 
ATOM   1648  C  CA    . CYS A  1 242 ? -22.242 -8.248  -28.054 1.00 27.35  ? 214 CYS A CA    1 
ATOM   1649  C  C     . CYS A  1 242 ? -22.789 -7.806  -29.431 1.00 25.77  ? 214 CYS A C     1 
ATOM   1650  O  O     . CYS A  1 242 ? -23.992 -7.581  -29.611 1.00 26.92  ? 214 CYS A O     1 
ATOM   1651  C  CB    . CYS A  1 242 ? -22.729 -9.662  -27.716 1.00 23.87  ? 214 CYS A CB    1 
ATOM   1652  S  SG    . CYS A  1 242 ? -22.380 -10.885 -29.059 1.00 26.96  ? 214 CYS A SG    1 
ATOM   1653  N  N     . ILE A  1 243 ? -21.894 -7.683  -30.407 1.00 29.89  ? 215 ILE A N     1 
ATOM   1654  C  CA    . ILE A  1 243 ? -22.274 -7.260  -31.755 1.00 32.36  ? 215 ILE A CA    1 
ATOM   1655  C  C     . ILE A  1 243 ? -23.369 -8.158  -32.352 1.00 32.04  ? 215 ILE A C     1 
ATOM   1656  O  O     . ILE A  1 243 ? -24.249 -7.683  -33.077 1.00 31.67  ? 215 ILE A O     1 
ATOM   1657  C  CB    . ILE A  1 243 ? -21.051 -7.248  -32.718 1.00 29.73  ? 215 ILE A CB    1 
ATOM   1658  C  CG1   . ILE A  1 243 ? -20.044 -6.162  -32.309 1.00 32.02  ? 215 ILE A CG1   1 
ATOM   1659  C  CG2   . ILE A  1 243 ? -21.500 -7.011  -34.153 1.00 29.38  ? 215 ILE A CG2   1 
ATOM   1660  C  CD1   . ILE A  1 243 ? -20.634 -4.753  -32.308 1.00 36.06  ? 215 ILE A CD1   1 
ATOM   1661  N  N     . SER A  1 244 ? -23.317 -9.454  -32.067 1.00 24.40  ? 216 SER A N     1 
ATOM   1662  C  CA    . SER A  1 244 ? -24.339 -10.353 -32.606 1.00 25.98  ? 216 SER A CA    1 
ATOM   1663  C  C     . SER A  1 244 ? -25.732 -9.934  -32.086 1.00 25.25  ? 216 SER A C     1 
ATOM   1664  O  O     . SER A  1 244 ? -26.661 -9.783  -32.872 1.00 28.17  ? 216 SER A O     1 
ATOM   1665  C  CB    . SER A  1 244 ? -24.033 -11.821 -32.250 1.00 24.25  ? 216 SER A CB    1 
ATOM   1666  O  OG    . SER A  1 244 ? -25.111 -12.655 -32.619 1.00 25.17  ? 216 SER A OG    1 
ATOM   1667  N  N     . PHE A  1 245 ? -25.864 -9.722  -30.778 1.00 21.03  ? 217 PHE A N     1 
ATOM   1668  C  CA    . PHE A  1 245 ? -27.101 -9.150  -30.228 1.00 26.21  ? 217 PHE A CA    1 
ATOM   1669  C  C     . PHE A  1 245 ? -27.395 -7.784  -30.850 1.00 25.39  ? 217 PHE A C     1 
ATOM   1670  O  O     . PHE A  1 245 ? -28.502 -7.540  -31.333 1.00 23.91  ? 217 PHE A O     1 
ATOM   1671  C  CB    . PHE A  1 245 ? -27.045 -9.006  -28.687 1.00 22.46  ? 217 PHE A CB    1 
ATOM   1672  C  CG    . PHE A  1 245 ? -28.191 -8.201  -28.108 1.00 26.37  ? 217 PHE A CG    1 
ATOM   1673  C  CD1   . PHE A  1 245 ? -29.472 -8.729  -28.055 1.00 22.15  ? 217 PHE A CD1   1 
ATOM   1674  C  CD2   . PHE A  1 245 ? -27.988 -6.889  -27.648 1.00 26.24  ? 217 PHE A CD2   1 
ATOM   1675  C  CE1   . PHE A  1 245 ? -30.542 -7.976  -27.536 1.00 24.99  ? 217 PHE A CE1   1 
ATOM   1676  C  CE2   . PHE A  1 245 ? -29.049 -6.128  -27.136 1.00 25.28  ? 217 PHE A CE2   1 
ATOM   1677  C  CZ    . PHE A  1 245 ? -30.329 -6.668  -27.078 1.00 23.74  ? 217 PHE A CZ    1 
ATOM   1678  N  N     . LEU A  1 246 ? -26.412 -6.890  -30.838 1.00 29.02  ? 218 LEU A N     1 
ATOM   1679  C  CA    . LEU A  1 246 ? -26.643 -5.514  -31.320 1.00 26.17  ? 218 LEU A CA    1 
ATOM   1680  C  C     . LEU A  1 246 ? -27.194 -5.482  -32.749 1.00 28.40  ? 218 LEU A C     1 
ATOM   1681  O  O     . LEU A  1 246 ? -28.103 -4.703  -33.022 1.00 30.77  ? 218 LEU A O     1 
ATOM   1682  C  CB    . LEU A  1 246 ? -25.360 -4.672  -31.203 1.00 22.73  ? 218 LEU A CB    1 
ATOM   1683  C  CG    . LEU A  1 246 ? -24.992 -4.388  -29.736 1.00 30.04  ? 218 LEU A CG    1 
ATOM   1684  C  CD1   . LEU A  1 246 ? -23.563 -3.881  -29.598 1.00 26.92  ? 218 LEU A CD1   1 
ATOM   1685  C  CD2   . LEU A  1 246 ? -25.990 -3.424  -29.067 1.00 28.71  ? 218 LEU A CD2   1 
ATOM   1686  N  N     . THR A  1 247 ? -26.706 -6.349  -33.643 1.00 28.73  ? 219 THR A N     1 
ATOM   1687  C  CA    . THR A  1 247 ? -27.240 -6.393  -35.020 1.00 23.90  ? 219 THR A CA    1 
ATOM   1688  C  C     . THR A  1 247 ? -28.730 -6.720  -35.086 1.00 25.95  ? 219 THR A C     1 
ATOM   1689  O  O     . THR A  1 247 ? -29.383 -6.417  -36.070 1.00 24.39  ? 219 THR A O     1 
ATOM   1690  C  CB    . THR A  1 247 ? -26.503 -7.436  -35.930 1.00 25.95  ? 219 THR A CB    1 
ATOM   1691  O  OG1   . THR A  1 247 ? -26.651 -8.768  -35.409 1.00 25.30  ? 219 THR A OG1   1 
ATOM   1692  C  CG2   . THR A  1 247 ? -25.020 -7.100  -36.083 1.00 25.19  ? 219 THR A CG2   1 
ATOM   1693  N  N     . GLN A  1 248 ? -29.276 -7.335  -34.042 1.00 24.12  ? 220 GLN A N     1 
ATOM   1694  C  CA    . GLN A  1 248 ? -30.654 -7.809  -34.114 1.00 26.11  ? 220 GLN A CA    1 
ATOM   1695  C  C     . GLN A  1 248 ? -31.665 -6.894  -33.426 1.00 27.40  ? 220 GLN A C     1 
ATOM   1696  O  O     . GLN A  1 248 ? -32.857 -7.185  -33.394 1.00 30.23  ? 220 GLN A O     1 
ATOM   1697  C  CB    . GLN A  1 248 ? -30.735 -9.234  -33.535 1.00 23.61  ? 220 GLN A CB    1 
ATOM   1698  C  CG    . GLN A  1 248 ? -29.894 -10.194 -34.332 1.00 28.04  ? 220 GLN A CG    1 
ATOM   1699  C  CD    . GLN A  1 248 ? -29.869 -11.587 -33.744 1.00 30.79  ? 220 GLN A CD    1 
ATOM   1700  O  OE1   . GLN A  1 248 ? -30.903 -12.248 -33.639 1.00 26.24  ? 220 GLN A OE1   1 
ATOM   1701  N  NE2   . GLN A  1 248 ? -28.681 -12.032 -33.340 1.00 24.92  ? 220 GLN A NE2   1 
ATOM   1702  N  N     . THR A  1 249 ? -31.196 -5.772  -32.896 1.00 27.05  ? 221 THR A N     1 
ATOM   1703  C  CA    . THR A  1 249 ? -32.086 -4.853  -32.210 1.00 27.86  ? 221 THR A CA    1 
ATOM   1704  C  C     . THR A  1 249 ? -32.846 -3.976  -33.226 1.00 35.07  ? 221 THR A C     1 
ATOM   1705  O  O     . THR A  1 249 ? -32.353 -3.680  -34.325 1.00 28.82  ? 221 THR A O     1 
ATOM   1706  C  CB    . THR A  1 249 ? -31.298 -3.992  -31.199 1.00 30.49  ? 221 THR A CB    1 
ATOM   1707  O  OG1   . THR A  1 249 ? -30.331 -3.185  -31.884 1.00 27.42  ? 221 THR A OG1   1 
ATOM   1708  C  CG2   . THR A  1 249 ? -30.566 -4.897  -30.227 1.00 24.19  ? 221 THR A CG2   1 
ATOM   1709  N  N     . LYS A  1 250 ? -34.065 -3.592  -32.861 1.00 31.84  ? 222 LYS A N     1 
ATOM   1710  C  CA    . LYS A  1 250 ? -34.948 -2.898  -33.778 1.00 33.86  ? 222 LYS A CA    1 
ATOM   1711  C  C     . LYS A  1 250 ? -34.894 -1.368  -33.644 1.00 37.52  ? 222 LYS A C     1 
ATOM   1712  O  O     . LYS A  1 250 ? -35.361 -0.644  -34.527 1.00 36.57  ? 222 LYS A O     1 
ATOM   1713  C  CB    . LYS A  1 250 ? -36.378 -3.392  -33.575 1.00 36.39  ? 222 LYS A CB    1 
ATOM   1714  C  CG    . LYS A  1 250 ? -36.565 -4.847  -33.977 1.00 38.50  ? 222 LYS A CG    1 
ATOM   1715  C  CD    . LYS A  1 250 ? -38.023 -5.219  -33.994 1.00 48.17  ? 222 LYS A CD    1 
ATOM   1716  C  CE    . LYS A  1 250 ? -38.266 -6.420  -34.906 1.00 50.56  ? 222 LYS A CE    1 
ATOM   1717  N  NZ    . LYS A  1 250 ? -39.688 -6.852  -34.904 1.00 54.31  ? 222 LYS A NZ    1 
ATOM   1718  N  N     . GLY A  1 251 ? -34.313 -0.885  -32.550 1.00 31.71  ? 223 GLY A N     1 
ATOM   1719  C  CA    . GLY A  1 251 ? -34.205 0.540   -32.315 1.00 34.32  ? 223 GLY A CA    1 
ATOM   1720  C  C     . GLY A  1 251 ? -32.931 1.146   -32.866 1.00 29.58  ? 223 GLY A C     1 
ATOM   1721  O  O     . GLY A  1 251 ? -32.320 0.608   -33.788 1.00 24.97  ? 223 GLY A O     1 
ATOM   1722  N  N     . PHE A  1 252 ? -32.548 2.289   -32.312 1.00 27.82  ? 224 PHE A N     1 
ATOM   1723  C  CA    . PHE A  1 252 ? -31.336 2.993   -32.717 1.00 32.06  ? 224 PHE A CA    1 
ATOM   1724  C  C     . PHE A  1 252 ? -30.128 2.288   -32.102 1.00 33.20  ? 224 PHE A C     1 
ATOM   1725  O  O     . PHE A  1 252 ? -30.141 1.959   -30.921 1.00 33.96  ? 224 PHE A O     1 
ATOM   1726  C  CB    . PHE A  1 252 ? -31.373 4.465   -32.269 1.00 27.08  ? 224 PHE A CB    1 
ATOM   1727  C  CG    . PHE A  1 252 ? -32.357 5.326   -33.036 1.00 32.80  ? 224 PHE A CG    1 
ATOM   1728  C  CD1   . PHE A  1 252 ? -33.637 5.552   -32.543 1.00 33.11  ? 224 PHE A CD1   1 
ATOM   1729  C  CD2   . PHE A  1 252 ? -31.998 5.911   -34.244 1.00 29.80  ? 224 PHE A CD2   1 
ATOM   1730  C  CE1   . PHE A  1 252 ? -34.546 6.327   -33.244 1.00 33.90  ? 224 PHE A CE1   1 
ATOM   1731  C  CE2   . PHE A  1 252 ? -32.906 6.697   -34.950 1.00 33.69  ? 224 PHE A CE2   1 
ATOM   1732  C  CZ    . PHE A  1 252 ? -34.184 6.910   -34.444 1.00 29.60  ? 224 PHE A CZ    1 
ATOM   1733  N  N     . LEU A  1 253 ? -29.082 2.064   -32.886 1.00 29.33  ? 225 LEU A N     1 
ATOM   1734  C  CA    . LEU A  1 253 ? -27.856 1.504   -32.335 1.00 28.07  ? 225 LEU A CA    1 
ATOM   1735  C  C     . LEU A  1 253 ? -27.116 2.566   -31.519 1.00 31.55  ? 225 LEU A C     1 
ATOM   1736  O  O     . LEU A  1 253 ? -26.879 3.671   -32.024 1.00 30.72  ? 225 LEU A O     1 
ATOM   1737  C  CB    . LEU A  1 253 ? -26.958 0.974   -33.453 1.00 23.89  ? 225 LEU A CB    1 
ATOM   1738  C  CG    . LEU A  1 253 ? -25.802 0.136   -32.915 1.00 31.88  ? 225 LEU A CG    1 
ATOM   1739  C  CD1   . LEU A  1 253 ? -26.350 -1.176  -32.318 1.00 30.48  ? 225 LEU A CD1   1 
ATOM   1740  C  CD2   . LEU A  1 253 ? -24.782 -0.142  -34.013 1.00 30.11  ? 225 LEU A CD2   1 
ATOM   1741  N  N     . PRO A  1 254 ? -26.755 2.249   -30.260 1.00 31.16  ? 226 PRO A N     1 
ATOM   1742  C  CA    . PRO A  1 254 ? -25.975 3.223   -29.487 1.00 26.20  ? 226 PRO A CA    1 
ATOM   1743  C  C     . PRO A  1 254 ? -24.696 3.593   -30.224 1.00 32.25  ? 226 PRO A C     1 
ATOM   1744  O  O     . PRO A  1 254 ? -24.045 2.726   -30.826 1.00 26.16  ? 226 PRO A O     1 
ATOM   1745  C  CB    . PRO A  1 254 ? -25.682 2.491   -28.166 1.00 25.98  ? 226 PRO A CB    1 
ATOM   1746  C  CG    . PRO A  1 254 ? -26.852 1.579   -28.010 1.00 27.23  ? 226 PRO A CG    1 
ATOM   1747  C  CD    . PRO A  1 254 ? -27.149 1.088   -29.438 1.00 28.48  ? 226 PRO A CD    1 
ATOM   1748  N  N     . ASP A  1 255 ? -24.390 4.888   -30.213 1.00 28.51  ? 227 ASP A N     1 
ATOM   1749  C  CA    . ASP A  1 255 ? -23.297 5.462   -30.983 1.00 28.66  ? 227 ASP A CA    1 
ATOM   1750  C  C     . ASP A  1 255 ? -21.954 4.758   -30.794 1.00 28.39  ? 227 ASP A C     1 
ATOM   1751  O  O     . ASP A  1 255 ? -21.210 4.557   -31.752 1.00 34.03  ? 227 ASP A O     1 
ATOM   1752  C  CB    . ASP A  1 255 ? -23.159 6.945   -30.626 1.00 35.04  ? 227 ASP A CB    1 
ATOM   1753  C  CG    . ASP A  1 255 ? -24.213 7.803   -31.311 1.00 40.39  ? 227 ASP A CG    1 
ATOM   1754  O  OD1   . ASP A  1 255 ? -25.291 7.264   -31.642 1.00 44.20  ? 227 ASP A OD1   1 
ATOM   1755  O  OD2   . ASP A  1 255 ? -23.969 9.007   -31.525 1.00 42.55  ? 227 ASP A OD2   1 
ATOM   1756  N  N     . GLU A  1 256 ? -21.645 4.352   -29.574 1.00 27.90  ? 228 GLU A N     1 
ATOM   1757  C  CA    . GLU A  1 256 ? -20.360 3.707   -29.348 1.00 32.29  ? 228 GLU A CA    1 
ATOM   1758  C  C     . GLU A  1 256 ? -20.214 2.391   -30.140 1.00 34.58  ? 228 GLU A C     1 
ATOM   1759  O  O     . GLU A  1 256 ? -19.096 1.911   -30.315 1.00 39.79  ? 228 GLU A O     1 
ATOM   1760  C  CB    . GLU A  1 256 ? -20.129 3.456   -27.854 1.00 32.25  ? 228 GLU A CB    1 
ATOM   1761  C  CG    . GLU A  1 256 ? -21.119 2.512   -27.202 1.00 40.24  ? 228 GLU A CG    1 
ATOM   1762  C  CD    . GLU A  1 256 ? -20.535 1.785   -25.983 1.00 41.85  ? 228 GLU A CD    1 
ATOM   1763  O  OE1   . GLU A  1 256 ? -21.271 1.638   -24.985 1.00 40.09  ? 228 GLU A OE1   1 
ATOM   1764  O  OE2   . GLU A  1 256 ? -19.358 1.351   -26.032 1.00 43.37  ? 228 GLU A OE2   1 
ATOM   1765  N  N     . PHE A  1 257 ? -21.305 1.816   -30.653 1.00 27.26  ? 229 PHE A N     1 
ATOM   1766  C  CA    . PHE A  1 257 ? -21.141 0.590   -31.462 1.00 32.07  ? 229 PHE A CA    1 
ATOM   1767  C  C     . PHE A  1 257 ? -21.233 0.839   -32.977 1.00 30.40  ? 229 PHE A C     1 
ATOM   1768  O  O     . PHE A  1 257 ? -21.002 -0.071  -33.778 1.00 30.55  ? 229 PHE A O     1 
ATOM   1769  C  CB    . PHE A  1 257 ? -22.170 -0.478  -31.062 1.00 29.72  ? 229 PHE A CB    1 
ATOM   1770  C  CG    . PHE A  1 257 ? -22.222 -0.763  -29.568 1.00 29.91  ? 229 PHE A CG    1 
ATOM   1771  C  CD1   . PHE A  1 257 ? -21.156 -1.357  -28.919 1.00 27.68  ? 229 PHE A CD1   1 
ATOM   1772  C  CD2   . PHE A  1 257 ? -23.369 -0.469  -28.831 1.00 25.28  ? 229 PHE A CD2   1 
ATOM   1773  C  CE1   . PHE A  1 257 ? -21.222 -1.624  -27.547 1.00 32.30  ? 229 PHE A CE1   1 
ATOM   1774  C  CE2   . PHE A  1 257 ? -23.447 -0.743  -27.460 1.00 26.00  ? 229 PHE A CE2   1 
ATOM   1775  C  CZ    . PHE A  1 257 ? -22.370 -1.318  -26.819 1.00 26.15  ? 229 PHE A CZ    1 
ATOM   1776  N  N     . ARG A  1 258 ? -21.550 2.073   -33.378 1.00 32.58  ? 230 ARG A N     1 
ATOM   1777  C  CA    . ARG A  1 258 ? -21.776 2.350   -34.799 1.00 31.10  ? 230 ARG A CA    1 
ATOM   1778  C  C     . ARG A  1 258 ? -20.490 2.236   -35.601 1.00 31.21  ? 230 ARG A C     1 
ATOM   1779  O  O     . ARG A  1 258 ? -20.524 1.974   -36.807 1.00 35.71  ? 230 ARG A O     1 
ATOM   1780  C  CB    . ARG A  1 258 ? -22.410 3.724   -34.991 1.00 31.62  ? 230 ARG A CB    1 
ATOM   1781  C  CG    . ARG A  1 258 ? -23.807 3.784   -34.402 1.00 29.81  ? 230 ARG A CG    1 
ATOM   1782  C  CD    . ARG A  1 258 ? -24.482 5.088   -34.690 1.00 26.98  ? 230 ARG A CD    1 
ATOM   1783  N  NE    . ARG A  1 258 ? -25.784 5.146   -34.038 1.00 32.36  ? 230 ARG A NE    1 
ATOM   1784  C  CZ    . ARG A  1 258 ? -26.667 6.121   -34.207 1.00 33.20  ? 230 ARG A CZ    1 
ATOM   1785  N  NH1   . ARG A  1 258 ? -26.389 7.139   -35.028 1.00 30.00  ? 230 ARG A NH1   1 
ATOM   1786  N  NH2   . ARG A  1 258 ? -27.829 6.081   -33.558 1.00 29.61  ? 230 ARG A NH2   1 
ATOM   1787  N  N     . THR A  1 259 ? -19.359 2.372   -34.921 1.00 29.89  ? 231 THR A N     1 
ATOM   1788  C  CA    . THR A  1 259 ? -18.057 2.193   -35.573 1.00 38.85  ? 231 THR A CA    1 
ATOM   1789  C  C     . THR A  1 259 ? -17.416 0.820   -35.331 1.00 42.54  ? 231 THR A C     1 
ATOM   1790  O  O     . THR A  1 259 ? -16.318 0.563   -35.817 1.00 49.68  ? 231 THR A O     1 
ATOM   1791  C  CB    . THR A  1 259 ? -17.064 3.252   -35.103 1.00 45.80  ? 231 THR A CB    1 
ATOM   1792  O  OG1   . THR A  1 259 ? -17.106 3.322   -33.667 1.00 55.10  ? 231 THR A OG1   1 
ATOM   1793  C  CG2   . THR A  1 259 ? -17.425 4.616   -35.689 1.00 46.52  ? 231 THR A CG2   1 
ATOM   1794  N  N     . LYS A  1 260 ? -18.076 -0.046  -34.568 1.00 34.29  ? 232 LYS A N     1 
ATOM   1795  C  CA    . LYS A  1 260 ? -17.493 -1.346  -34.233 1.00 41.10  ? 232 LYS A CA    1 
ATOM   1796  C  C     . LYS A  1 260 ? -18.170 -2.467  -35.004 1.00 34.54  ? 232 LYS A C     1 
ATOM   1797  O  O     . LYS A  1 260 ? -17.678 -3.591  -35.043 1.00 39.67  ? 232 LYS A O     1 
ATOM   1798  C  CB    . LYS A  1 260 ? -17.605 -1.623  -32.731 1.00 36.60  ? 232 LYS A CB    1 
ATOM   1799  C  CG    . LYS A  1 260 ? -17.054 -0.538  -31.837 1.00 41.15  ? 232 LYS A CG    1 
ATOM   1800  C  CD    . LYS A  1 260 ? -15.825 -1.013  -31.088 1.00 52.21  ? 232 LYS A CD    1 
ATOM   1801  C  CE    . LYS A  1 260 ? -14.645 -1.237  -32.027 1.00 55.63  ? 232 LYS A CE    1 
ATOM   1802  N  NZ    . LYS A  1 260 ? -13.520 -1.977  -31.353 1.00 61.24  ? 232 LYS A NZ    1 
ATOM   1803  N  N     . ILE A  1 261 ? -19.313 -2.151  -35.604 1.00 32.17  ? 233 ILE A N     1 
ATOM   1804  C  CA    . ILE A  1 261 ? -20.142 -3.156  -36.257 1.00 40.05  ? 233 ILE A CA    1 
ATOM   1805  C  C     . ILE A  1 261 ? -19.576 -3.484  -37.647 1.00 38.36  ? 233 ILE A C     1 
ATOM   1806  O  O     . ILE A  1 261 ? -19.847 -4.549  -38.205 1.00 36.04  ? 233 ILE A O     1 
ATOM   1807  C  CB    . ILE A  1 261 ? -21.617 -2.679  -36.336 1.00 34.47  ? 233 ILE A CB    1 
ATOM   1808  C  CG1   . ILE A  1 261 ? -22.553 -3.813  -36.762 1.00 35.72  ? 233 ILE A CG1   1 
ATOM   1809  C  CG2   . ILE A  1 261 ? -21.764 -1.488  -37.260 1.00 29.03  ? 233 ILE A CG2   1 
ATOM   1810  C  CD1   . ILE A  1 261 ? -24.001 -3.343  -36.889 1.00 34.85  ? 233 ILE A CD1   1 
ATOM   1811  N  N     . GLY A  1 262 ? -18.754 -2.582  -38.182 1.00 38.08  ? 234 GLY A N     1 
ATOM   1812  C  CA    . GLY A  1 262 ? -18.120 -2.806  -39.469 1.00 32.90  ? 234 GLY A CA    1 
ATOM   1813  C  C     . GLY A  1 262 ? -19.165 -2.994  -40.551 1.00 34.73  ? 234 GLY A C     1 
ATOM   1814  O  O     . GLY A  1 262 ? -20.117 -2.223  -40.646 1.00 39.08  ? 234 GLY A O     1 
ATOM   1815  N  N     . ASN A  1 263 ? -19.021 -4.041  -41.348 1.00 32.06  ? 235 ASN A N     1 
ATOM   1816  C  CA    . ASN A  1 263 ? -19.995 -4.298  -42.400 1.00 33.51  ? 235 ASN A CA    1 
ATOM   1817  C  C     . ASN A  1 263 ? -20.895 -5.495  -42.087 1.00 28.71  ? 235 ASN A C     1 
ATOM   1818  O  O     . ASN A  1 263 ? -21.460 -6.109  -42.992 1.00 31.90  ? 235 ASN A O     1 
ATOM   1819  C  CB    . ASN A  1 263 ? -19.279 -4.501  -43.749 1.00 28.35  ? 235 ASN A CB    1 
ATOM   1820  C  CG    . ASN A  1 263 ? -18.629 -5.868  -43.876 1.00 30.64  ? 235 ASN A CG    1 
ATOM   1821  O  OD1   . ASN A  1 263 ? -18.150 -6.443  -42.897 1.00 36.93  ? 235 ASN A OD1   1 
ATOM   1822  N  ND2   . ASN A  1 263 ? -18.625 -6.406  -45.099 1.00 31.43  ? 235 ASN A ND2   1 
ATOM   1823  N  N     . ARG A  1 264 ? -21.037 -5.817  -40.805 1.00 33.55  ? 236 ARG A N     1 
ATOM   1824  C  CA    . ARG A  1 264 ? -21.868 -6.945  -40.382 1.00 29.29  ? 236 ARG A CA    1 
ATOM   1825  C  C     . ARG A  1 264 ? -23.344 -6.575  -40.450 1.00 31.38  ? 236 ARG A C     1 
ATOM   1826  O  O     . ARG A  1 264 ? -23.768 -5.553  -39.891 1.00 29.54  ? 236 ARG A O     1 
ATOM   1827  C  CB    . ARG A  1 264 ? -21.525 -7.366  -38.956 1.00 27.83  ? 236 ARG A CB    1 
ATOM   1828  C  CG    . ARG A  1 264 ? -20.092 -7.773  -38.738 1.00 29.42  ? 236 ARG A CG    1 
ATOM   1829  C  CD    . ARG A  1 264 ? -19.955 -8.314  -37.315 1.00 26.61  ? 236 ARG A CD    1 
ATOM   1830  N  NE    . ARG A  1 264 ? -18.583 -8.609  -36.935 1.00 31.26  ? 236 ARG A NE    1 
ATOM   1831  C  CZ    . ARG A  1 264 ? -17.715 -7.696  -36.506 1.00 36.00  ? 236 ARG A CZ    1 
ATOM   1832  N  NH1   . ARG A  1 264 ? -18.072 -6.425  -36.448 1.00 36.36  ? 236 ARG A NH1   1 
ATOM   1833  N  NH2   . ARG A  1 264 ? -16.484 -8.054  -36.155 1.00 38.75  ? 236 ARG A NH2   1 
ATOM   1834  N  N     . LEU A  1 265 ? -24.125 -7.403  -41.118 1.00 24.18  ? 237 LEU A N     1 
ATOM   1835  C  CA    . LEU A  1 265 ? -25.559 -7.155  -41.284 1.00 24.36  ? 237 LEU A CA    1 
ATOM   1836  C  C     . LEU A  1 265 ? -26.368 -7.935  -40.262 1.00 26.43  ? 237 LEU A C     1 
ATOM   1837  O  O     . LEU A  1 265 ? -27.464 -7.530  -39.876 1.00 30.62  ? 237 LEU A O     1 
ATOM   1838  C  CB    . LEU A  1 265 ? -26.003 -7.541  -42.692 1.00 22.98  ? 237 LEU A CB    1 
ATOM   1839  C  CG    . LEU A  1 265 ? -25.427 -6.645  -43.799 1.00 25.24  ? 237 LEU A CG    1 
ATOM   1840  C  CD1   . LEU A  1 265 ? -25.946 -7.082  -45.142 1.00 24.73  ? 237 LEU A CD1   1 
ATOM   1841  C  CD2   . LEU A  1 265 ? -25.746 -5.150  -43.551 1.00 26.36  ? 237 LEU A CD2   1 
ATOM   1842  N  N     . TYR A  1 266 ? -25.815 -9.065  -39.840 1.00 29.19  ? 238 TYR A N     1 
ATOM   1843  C  CA    . TYR A  1 266 ? -26.495 -9.966  -38.923 1.00 26.79  ? 238 TYR A CA    1 
ATOM   1844  C  C     . TYR A  1 266 ? -25.479 -10.890 -38.288 1.00 26.58  ? 238 TYR A C     1 
ATOM   1845  O  O     . TYR A  1 266 ? -24.709 -11.557 -38.994 1.00 29.24  ? 238 TYR A O     1 
ATOM   1846  C  CB    . TYR A  1 266 ? -27.568 -10.770 -39.653 1.00 23.55  ? 238 TYR A CB    1 
ATOM   1847  C  CG    . TYR A  1 266 ? -28.319 -11.709 -38.730 1.00 30.20  ? 238 TYR A CG    1 
ATOM   1848  C  CD1   . TYR A  1 266 ? -29.462 -11.284 -38.067 1.00 25.39  ? 238 TYR A CD1   1 
ATOM   1849  C  CD2   . TYR A  1 266 ? -27.882 -13.028 -38.522 1.00 27.80  ? 238 TYR A CD2   1 
ATOM   1850  C  CE1   . TYR A  1 266 ? -30.150 -12.132 -37.209 1.00 30.23  ? 238 TYR A CE1   1 
ATOM   1851  C  CE2   . TYR A  1 266 ? -28.571 -13.888 -37.660 1.00 30.93  ? 238 TYR A CE2   1 
ATOM   1852  C  CZ    . TYR A  1 266 ? -29.706 -13.430 -37.013 1.00 29.34  ? 238 TYR A CZ    1 
ATOM   1853  O  OH    . TYR A  1 266 ? -30.414 -14.248 -36.165 1.00 32.26  ? 238 TYR A OH    1 
ATOM   1854  N  N     . GLY A  1 267 ? -25.490 -10.946 -36.958 1.00 27.92  ? 239 GLY A N     1 
ATOM   1855  C  CA    . GLY A  1 267 ? -24.569 -11.792 -36.232 1.00 22.50  ? 239 GLY A CA    1 
ATOM   1856  C  C     . GLY A  1 267 ? -23.119 -11.335 -36.265 1.00 27.39  ? 239 GLY A C     1 
ATOM   1857  O  O     . GLY A  1 267 ? -22.760 -10.367 -36.944 1.00 25.92  ? 239 GLY A O     1 
ATOM   1858  N  N     . CYS A  1 268 ? -22.276 -12.049 -35.531 1.00 25.96  ? 240 CYS A N     1 
ATOM   1859  C  CA    . CYS A  1 268 ? -20.842 -11.753 -35.460 1.00 30.89  ? 240 CYS A CA    1 
ATOM   1860  C  C     . CYS A  1 268 ? -20.073 -13.054 -35.212 1.00 30.92  ? 240 CYS A C     1 
ATOM   1861  O  O     . CYS A  1 268 ? -20.492 -13.850 -34.386 1.00 31.29  ? 240 CYS A O     1 
ATOM   1862  C  CB    . CYS A  1 268 ? -20.555 -10.725 -34.354 1.00 31.79  ? 240 CYS A CB    1 
ATOM   1863  S  SG    . CYS A  1 268 ? -18.783 -10.416 -34.008 1.00 28.12  ? 240 CYS A SG    1 
ATOM   1864  N  N     . ASP A  1 269 ? -18.971 -13.267 -35.935 1.00 30.63  ? 241 ASP A N     1 
ATOM   1865  C  CA    . ASP A  1 269 ? -18.239 -14.547 -35.909 1.00 35.08  ? 241 ASP A CA    1 
ATOM   1866  C  C     . ASP A  1 269 ? -16.826 -14.447 -35.329 1.00 35.74  ? 241 ASP A C     1 
ATOM   1867  O  O     . ASP A  1 269 ? -16.107 -15.438 -35.285 1.00 35.08  ? 241 ASP A O     1 
ATOM   1868  C  CB    . ASP A  1 269 ? -18.122 -15.132 -37.323 1.00 32.01  ? 241 ASP A CB    1 
ATOM   1869  C  CG    . ASP A  1 269 ? -19.425 -15.731 -37.831 1.00 31.44  ? 241 ASP A CG    1 
ATOM   1870  O  OD1   . ASP A  1 269 ? -20.270 -16.103 -36.995 1.00 34.18  ? 241 ASP A OD1   1 
ATOM   1871  O  OD2   . ASP A  1 269 ? -19.589 -15.854 -39.070 1.00 29.59  ? 241 ASP A OD2   1 
ATOM   1872  N  N     . THR A  1 270 ? -16.432 -13.253 -34.895 1.00 35.20  ? 242 THR A N     1 
ATOM   1873  C  CA    . THR A  1 270 ? -15.039 -12.971 -34.554 1.00 34.23  ? 242 THR A CA    1 
ATOM   1874  C  C     . THR A  1 270 ? -14.457 -13.898 -33.458 1.00 36.93  ? 242 THR A C     1 
ATOM   1875  O  O     . THR A  1 270 ? -13.343 -14.394 -33.607 1.00 34.03  ? 242 THR A O     1 
ATOM   1876  C  CB    . THR A  1 270 ? -14.899 -11.501 -34.145 1.00 39.03  ? 242 THR A CB    1 
ATOM   1877  O  OG1   . THR A  1 270 ? -15.267 -10.679 -35.258 1.00 39.30  ? 242 THR A OG1   1 
ATOM   1878  C  CG2   . THR A  1 270 ? -13.472 -11.162 -33.718 1.00 39.52  ? 242 THR A CG2   1 
ATOM   1879  N  N     . CYS A  1 271 ? -15.209 -14.162 -32.389 1.00 34.67  ? 243 CYS A N     1 
ATOM   1880  C  CA    . CYS A  1 271 ? -14.719 -15.052 -31.321 1.00 32.77  ? 243 CYS A CA    1 
ATOM   1881  C  C     . CYS A  1 271 ? -14.651 -16.522 -31.742 1.00 36.87  ? 243 CYS A C     1 
ATOM   1882  O  O     . CYS A  1 271 ? -14.139 -17.359 -31.000 1.00 35.32  ? 243 CYS A O     1 
ATOM   1883  C  CB    . CYS A  1 271 ? -15.576 -14.927 -30.051 1.00 29.71  ? 243 CYS A CB    1 
ATOM   1884  S  SG    . CYS A  1 271 ? -17.396 -15.027 -30.214 1.00 31.12  ? 243 CYS A SG    1 
ATOM   1885  N  N     . GLN A  1 272 ? -15.170 -16.847 -32.917 1.00 34.06  ? 244 GLN A N     1 
ATOM   1886  C  CA    . GLN A  1 272 ? -15.010 -18.209 -33.432 1.00 36.19  ? 244 GLN A CA    1 
ATOM   1887  C  C     . GLN A  1 272 ? -13.906 -18.286 -34.493 1.00 35.02  ? 244 GLN A C     1 
ATOM   1888  O  O     . GLN A  1 272 ? -13.087 -19.203 -34.473 1.00 35.96  ? 244 GLN A O     1 
ATOM   1889  C  CB    . GLN A  1 272 ? -16.320 -18.730 -34.019 1.00 31.74  ? 244 GLN A CB    1 
ATOM   1890  C  CG    . GLN A  1 272 ? -17.465 -18.840 -33.013 1.00 35.15  ? 244 GLN A CG    1 
ATOM   1891  C  CD    . GLN A  1 272 ? -18.721 -19.388 -33.669 1.00 35.47  ? 244 GLN A CD    1 
ATOM   1892  O  OE1   . GLN A  1 272 ? -18.876 -20.604 -33.826 1.00 32.22  ? 244 GLN A OE1   1 
ATOM   1893  N  NE2   . GLN A  1 272 ? -19.596 -18.492 -34.114 1.00 33.81  ? 244 GLN A NE2   1 
ATOM   1894  N  N     . THR A  1 273 ? -13.900 -17.336 -35.424 1.00 33.34  ? 245 THR A N     1 
ATOM   1895  C  CA    . THR A  1 273 ? -12.936 -17.332 -36.529 1.00 36.27  ? 245 THR A CA    1 
ATOM   1896  C  C     . THR A  1 273 ? -11.505 -17.149 -36.033 1.00 40.40  ? 245 THR A C     1 
ATOM   1897  O  O     . THR A  1 273 ? -10.562 -17.554 -36.710 1.00 37.87  ? 245 THR A O     1 
ATOM   1898  C  CB    . THR A  1 273 ? -13.226 -16.211 -37.551 1.00 39.95  ? 245 THR A CB    1 
ATOM   1899  O  OG1   . THR A  1 273 ? -13.263 -14.958 -36.863 1.00 42.19  ? 245 THR A OG1   1 
ATOM   1900  C  CG2   . THR A  1 273 ? -14.554 -16.424 -38.262 1.00 40.00  ? 245 THR A CG2   1 
ATOM   1901  N  N     . VAL A  1 274 ? -11.354 -16.526 -34.861 1.00 39.44  ? 246 VAL A N     1 
ATOM   1902  C  CA    . VAL A  1 274 ? -10.035 -16.251 -34.289 1.00 43.14  ? 246 VAL A CA    1 
ATOM   1903  C  C     . VAL A  1 274 ? -9.569  -17.428 -33.437 1.00 39.72  ? 246 VAL A C     1 
ATOM   1904  O  O     . VAL A  1 274 ? -8.414  -17.495 -33.009 1.00 41.45  ? 246 VAL A O     1 
ATOM   1905  C  CB    . VAL A  1 274 ? -10.031 -14.965 -33.421 1.00 46.25  ? 246 VAL A CB    1 
ATOM   1906  C  CG1   . VAL A  1 274 ? -10.656 -15.228 -32.055 1.00 40.49  ? 246 VAL A CG1   1 
ATOM   1907  C  CG2   . VAL A  1 274 ? -8.621  -14.440 -33.240 1.00 46.15  ? 246 VAL A CG2   1 
ATOM   1908  N  N     . CYS A  1 275 ? -10.478 -18.364 -33.203 1.00 37.84  ? 247 CYS A N     1 
ATOM   1909  C  CA    . CYS A  1 275 ? -10.213 -19.486 -32.310 1.00 38.99  ? 247 CYS A CA    1 
ATOM   1910  C  C     . CYS A  1 275 ? -9.379  -20.574 -32.965 1.00 39.88  ? 247 CYS A C     1 
ATOM   1911  O  O     . CYS A  1 275 ? -9.767  -21.105 -33.999 1.00 39.16  ? 247 CYS A O     1 
ATOM   1912  C  CB    . CYS A  1 275 ? -11.526 -20.097 -31.828 1.00 39.67  ? 247 CYS A CB    1 
ATOM   1913  S  SG    . CYS A  1 275 ? -11.309 -21.525 -30.746 1.00 36.38  ? 247 CYS A SG    1 
ATOM   1914  N  N     . PRO A  1 276 ? -8.242  -20.928 -32.341 1.00 45.00  ? 248 PRO A N     1 
ATOM   1915  C  CA    . PRO A  1 276 ? -7.352  -22.006 -32.811 1.00 41.41  ? 248 PRO A CA    1 
ATOM   1916  C  C     . PRO A  1 276 ? -8.059  -23.351 -32.954 1.00 37.80  ? 248 PRO A C     1 
ATOM   1917  O  O     . PRO A  1 276 ? -7.717  -24.122 -33.845 1.00 46.48  ? 248 PRO A O     1 
ATOM   1918  C  CB    . PRO A  1 276 ? -6.278  -22.078 -31.722 1.00 43.53  ? 248 PRO A CB    1 
ATOM   1919  C  CG    . PRO A  1 276 ? -6.292  -20.724 -31.077 1.00 47.64  ? 248 PRO A CG    1 
ATOM   1920  C  CD    . PRO A  1 276 ? -7.714  -20.244 -31.146 1.00 44.09  ? 248 PRO A CD    1 
ATOM   1921  N  N     . LEU A  1 277 ? -9.036  -23.629 -32.099 1.00 39.80  ? 249 LEU A N     1 
ATOM   1922  C  CA    . LEU A  1 277 ? -9.771  -24.890 -32.157 1.00 35.26  ? 249 LEU A CA    1 
ATOM   1923  C  C     . LEU A  1 277 ? -10.636 -24.993 -33.416 1.00 39.14  ? 249 LEU A C     1 
ATOM   1924  O  O     . LEU A  1 277 ? -11.146 -26.063 -33.744 1.00 36.01  ? 249 LEU A O     1 
ATOM   1925  C  CB    . LEU A  1 277 ? -10.646 -25.059 -30.911 1.00 33.30  ? 249 LEU A CB    1 
ATOM   1926  C  CG    . LEU A  1 277 ? -9.892  -25.087 -29.582 1.00 43.60  ? 249 LEU A CG    1 
ATOM   1927  C  CD1   . LEU A  1 277 ? -10.837 -25.088 -28.386 1.00 36.22  ? 249 LEU A CD1   1 
ATOM   1928  C  CD2   . LEU A  1 277 ? -8.978  -26.305 -29.541 1.00 42.56  ? 249 LEU A CD2   1 
ATOM   1929  N  N     . ASN A  1 278 ? -10.812 -23.877 -34.118 1.00 40.29  ? 250 ASN A N     1 
ATOM   1930  C  CA    . ASN A  1 278 ? -11.600 -23.875 -35.347 1.00 36.00  ? 250 ASN A CA    1 
ATOM   1931  C  C     . ASN A  1 278 ? -10.741 -23.856 -36.603 1.00 39.85  ? 250 ASN A C     1 
ATOM   1932  O  O     . ASN A  1 278 ? -11.274 -23.941 -37.712 1.00 37.19  ? 250 ASN A O     1 
ATOM   1933  C  CB    . ASN A  1 278 ? -12.559 -22.680 -35.377 1.00 38.42  ? 250 ASN A CB    1 
ATOM   1934  C  CG    . ASN A  1 278 ? -13.742 -22.858 -34.452 1.00 35.45  ? 250 ASN A CG    1 
ATOM   1935  O  OD1   . ASN A  1 278 ? -14.251 -23.966 -34.273 1.00 35.97  ? 250 ASN A OD1   1 
ATOM   1936  N  ND2   . ASN A  1 278 ? -14.190 -21.762 -33.859 1.00 32.74  ? 250 ASN A ND2   1 
ATOM   1937  N  N     . LYS A  1 279 ? -9.424  -23.729 -36.434 1.00 42.69  ? 251 LYS A N     1 
ATOM   1938  C  CA    . LYS A  1 279 ? -8.502  -23.743 -37.572 1.00 42.68  ? 251 LYS A CA    1 
ATOM   1939  C  C     . LYS A  1 279 ? -8.651  -25.027 -38.405 1.00 47.21  ? 251 LYS A C     1 
ATOM   1940  O  O     . LYS A  1 279 ? -8.598  -26.142 -37.873 1.00 50.85  ? 251 LYS A O     1 
ATOM   1941  C  CB    . LYS A  1 279 ? -7.053  -23.592 -37.102 1.00 50.08  ? 251 LYS A CB    1 
ATOM   1942  C  CG    . LYS A  1 279 ? -6.029  -23.924 -38.193 1.00 56.25  ? 251 LYS A CG    1 
ATOM   1943  C  CD    . LYS A  1 279 ? -4.592  -23.705 -37.743 1.00 60.41  ? 251 LYS A CD    1 
ATOM   1944  C  CE    . LYS A  1 279 ? -4.253  -22.220 -37.698 1.00 80.23  ? 251 LYS A CE    1 
ATOM   1945  N  NZ    . LYS A  1 279 ? -4.475  -21.537 -39.014 1.00 79.55  ? 251 LYS A NZ    1 
ATOM   1946  N  N     . GLY A  1 280 ? -8.864  -24.856 -39.705 1.00 42.49  ? 252 GLY A N     1 
ATOM   1947  C  CA    . GLY A  1 280 ? -9.078  -25.980 -40.597 1.00 43.41  ? 252 GLY A CA    1 
ATOM   1948  C  C     . GLY A  1 280 ? -10.495 -26.527 -40.634 1.00 45.42  ? 252 GLY A C     1 
ATOM   1949  O  O     . GLY A  1 280 ? -10.800 -27.395 -41.445 1.00 46.71  ? 252 GLY A O     1 
ATOM   1950  N  N     . LYS A  1 281 ? -11.372 -26.024 -39.770 1.00 40.06  ? 253 LYS A N     1 
ATOM   1951  C  CA    . LYS A  1 281 ? -12.717 -26.583 -39.675 1.00 33.79  ? 253 LYS A CA    1 
ATOM   1952  C  C     . LYS A  1 281 ? -13.680 -25.926 -40.659 1.00 37.86  ? 253 LYS A C     1 
ATOM   1953  O  O     . LYS A  1 281 ? -14.256 -24.868 -40.370 1.00 40.71  ? 253 LYS A O     1 
ATOM   1954  C  CB    . LYS A  1 281 ? -13.239 -26.454 -38.240 1.00 39.33  ? 253 LYS A CB    1 
ATOM   1955  C  CG    . LYS A  1 281 ? -12.880 -27.629 -37.313 1.00 43.79  ? 253 LYS A CG    1 
ATOM   1956  C  CD    . LYS A  1 281 ? -11.383 -27.768 -37.052 1.00 44.19  ? 253 LYS A CD    1 
ATOM   1957  C  CE    . LYS A  1 281 ? -11.110 -28.722 -35.894 1.00 36.88  ? 253 LYS A CE    1 
ATOM   1958  N  NZ    . LYS A  1 281 ? -11.756 -30.030 -36.142 1.00 48.86  ? 253 LYS A NZ    1 
ATOM   1959  N  N     . ASP A  1 282 ? -13.848 -26.552 -41.824 1.00 34.36  ? 254 ASP A N     1 
ATOM   1960  C  CA    . ASP A  1 282 ? -14.774 -26.074 -42.856 1.00 36.97  ? 254 ASP A CA    1 
ATOM   1961  C  C     . ASP A  1 282 ? -15.604 -27.209 -43.447 1.00 39.09  ? 254 ASP A C     1 
ATOM   1962  O  O     . ASP A  1 282 ? -15.344 -27.662 -44.565 1.00 35.45  ? 254 ASP A O     1 
ATOM   1963  C  CB    . ASP A  1 282 ? -14.028 -25.357 -43.986 1.00 35.29  ? 254 ASP A CB    1 
ATOM   1964  C  CG    . ASP A  1 282 ? -14.970 -24.855 -45.085 1.00 41.71  ? 254 ASP A CG    1 
ATOM   1965  O  OD1   . ASP A  1 282 ? -16.144 -24.549 -44.772 1.00 37.84  ? 254 ASP A OD1   1 
ATOM   1966  O  OD2   . ASP A  1 282 ? -14.544 -24.783 -46.261 1.00 39.51  ? 254 ASP A OD2   1 
ATOM   1967  N  N     . PHE A  1 283 ? -16.620 -27.638 -42.704 1.00 37.20  ? 255 PHE A N     1 
ATOM   1968  C  CA    . PHE A  1 283 ? -17.387 -28.825 -43.066 1.00 36.36  ? 255 PHE A CA    1 
ATOM   1969  C  C     . PHE A  1 283 ? -18.572 -28.500 -43.970 1.00 40.68  ? 255 PHE A C     1 
ATOM   1970  O  O     . PHE A  1 283 ? -19.381 -27.614 -43.661 1.00 31.81  ? 255 PHE A O     1 
ATOM   1971  C  CB    . PHE A  1 283 ? -17.867 -29.552 -41.807 1.00 34.67  ? 255 PHE A CB    1 
ATOM   1972  C  CG    . PHE A  1 283 ? -16.762 -30.238 -41.052 1.00 36.68  ? 255 PHE A CG    1 
ATOM   1973  C  CD1   . PHE A  1 283 ? -16.496 -31.592 -41.254 1.00 40.83  ? 255 PHE A CD1   1 
ATOM   1974  C  CD2   . PHE A  1 283 ? -15.965 -29.528 -40.174 1.00 34.39  ? 255 PHE A CD2   1 
ATOM   1975  C  CE1   . PHE A  1 283 ? -15.471 -32.221 -40.565 1.00 37.76  ? 255 PHE A CE1   1 
ATOM   1976  C  CE2   . PHE A  1 283 ? -14.930 -30.148 -39.488 1.00 39.97  ? 255 PHE A CE2   1 
ATOM   1977  C  CZ    . PHE A  1 283 ? -14.682 -31.493 -39.679 1.00 39.73  ? 255 PHE A CZ    1 
ATOM   1978  N  N     . HIS A  1 284 ? -18.661 -29.234 -45.082 1.00 34.21  ? 256 HIS A N     1 
ATOM   1979  C  CA    . HIS A  1 284 ? -19.743 -29.082 -46.049 1.00 35.78  ? 256 HIS A CA    1 
ATOM   1980  C  C     . HIS A  1 284 ? -20.521 -30.384 -46.175 1.00 38.55  ? 256 HIS A C     1 
ATOM   1981  O  O     . HIS A  1 284 ? -20.443 -31.072 -47.184 1.00 40.30  ? 256 HIS A O     1 
ATOM   1982  C  CB    . HIS A  1 284 ? -19.191 -28.662 -47.406 1.00 35.54  ? 256 HIS A CB    1 
ATOM   1983  C  CG    . HIS A  1 284 ? -18.477 -27.345 -47.382 1.00 35.80  ? 256 HIS A CG    1 
ATOM   1984  N  ND1   . HIS A  1 284 ? -19.042 -26.182 -47.856 1.00 36.24  ? 256 HIS A ND1   1 
ATOM   1985  C  CD2   . HIS A  1 284 ? -17.241 -27.009 -46.944 1.00 36.33  ? 256 HIS A CD2   1 
ATOM   1986  C  CE1   . HIS A  1 284 ? -18.188 -25.186 -47.711 1.00 42.15  ? 256 HIS A CE1   1 
ATOM   1987  N  NE2   . HIS A  1 284 ? -17.087 -25.661 -47.155 1.00 40.58  ? 256 HIS A NE2   1 
ATOM   1988  N  N     . LEU A  1 285 ? -21.264 -30.726 -45.138 1.00 37.77  ? 257 LEU A N     1 
ATOM   1989  C  CA    . LEU A  1 285 ? -21.912 -32.029 -45.067 1.00 35.23  ? 257 LEU A CA    1 
ATOM   1990  C  C     . LEU A  1 285 ? -23.405 -31.963 -45.345 1.00 31.34  ? 257 LEU A C     1 
ATOM   1991  O  O     . LEU A  1 285 ? -24.058 -32.996 -45.420 1.00 29.65  ? 257 LEU A O     1 
ATOM   1992  C  CB    . LEU A  1 285 ? -21.684 -32.641 -43.691 1.00 33.23  ? 257 LEU A CB    1 
ATOM   1993  C  CG    . LEU A  1 285 ? -20.227 -32.627 -43.234 1.00 37.90  ? 257 LEU A CG    1 
ATOM   1994  C  CD1   . LEU A  1 285 ? -20.105 -33.221 -41.836 1.00 36.27  ? 257 LEU A CD1   1 
ATOM   1995  C  CD2   . LEU A  1 285 ? -19.359 -33.385 -44.217 1.00 38.92  ? 257 LEU A CD2   1 
ATOM   1996  N  N     . HIS A  1 286 ? -23.934 -30.745 -45.479 1.00 29.61  ? 258 HIS A N     1 
ATOM   1997  C  CA    . HIS A  1 286 ? -25.374 -30.533 -45.632 1.00 28.17  ? 258 HIS A CA    1 
ATOM   1998  C  C     . HIS A  1 286 ? -25.639 -29.523 -46.757 1.00 32.45  ? 258 HIS A C     1 
ATOM   1999  O  O     . HIS A  1 286 ? -25.513 -28.308 -46.555 1.00 28.75  ? 258 HIS A O     1 
ATOM   2000  C  CB    . HIS A  1 286 ? -25.978 -30.065 -44.298 1.00 26.70  ? 258 HIS A CB    1 
ATOM   2001  C  CG    . HIS A  1 286 ? -25.547 -30.907 -43.135 1.00 29.28  ? 258 HIS A CG    1 
ATOM   2002  N  ND1   . HIS A  1 286 ? -26.045 -32.174 -42.913 1.00 31.34  ? 258 HIS A ND1   1 
ATOM   2003  C  CD2   . HIS A  1 286 ? -24.626 -30.691 -42.167 1.00 30.22  ? 258 HIS A CD2   1 
ATOM   2004  C  CE1   . HIS A  1 286 ? -25.457 -32.697 -41.851 1.00 30.97  ? 258 HIS A CE1   1 
ATOM   2005  N  NE2   . HIS A  1 286 ? -24.591 -31.819 -41.381 1.00 28.67  ? 258 HIS A NE2   1 
ATOM   2006  N  N     . PRO A  1 287 ? -25.992 -30.025 -47.952 1.00 33.38  ? 259 PRO A N     1 
ATOM   2007  C  CA    . PRO A  1 287 ? -26.127 -29.142 -49.125 1.00 30.84  ? 259 PRO A CA    1 
ATOM   2008  C  C     . PRO A  1 287 ? -27.015 -27.902 -48.890 1.00 32.32  ? 259 PRO A C     1 
ATOM   2009  O  O     . PRO A  1 287 ? -26.721 -26.847 -49.451 1.00 36.02  ? 259 PRO A O     1 
ATOM   2010  C  CB    . PRO A  1 287 ? -26.755 -30.064 -50.177 1.00 30.73  ? 259 PRO A CB    1 
ATOM   2011  C  CG    . PRO A  1 287 ? -26.276 -31.447 -49.786 1.00 27.41  ? 259 PRO A CG    1 
ATOM   2012  C  CD    . PRO A  1 287 ? -26.204 -31.448 -48.291 1.00 26.06  ? 259 PRO A CD    1 
ATOM   2013  N  N     . GLU A  1 288 ? -28.057 -28.014 -48.064 1.00 31.60  ? 260 GLU A N     1 
ATOM   2014  C  CA    . GLU A  1 288 ? -28.999 -26.908 -47.929 1.00 30.48  ? 260 GLU A CA    1 
ATOM   2015  C  C     . GLU A  1 288 ? -28.439 -25.804 -47.017 1.00 30.38  ? 260 GLU A C     1 
ATOM   2016  O  O     . GLU A  1 288 ? -29.034 -24.726 -46.906 1.00 32.36  ? 260 GLU A O     1 
ATOM   2017  C  CB    . GLU A  1 288 ? -30.371 -27.421 -47.432 1.00 32.16  ? 260 GLU A CB    1 
ATOM   2018  C  CG    . GLU A  1 288 ? -30.494 -27.755 -45.940 1.00 29.57  ? 260 GLU A CG    1 
ATOM   2019  C  CD    . GLU A  1 288 ? -30.017 -29.158 -45.601 1.00 31.88  ? 260 GLU A CD    1 
ATOM   2020  O  OE1   . GLU A  1 288 ? -29.025 -29.622 -46.208 1.00 33.67  ? 260 GLU A OE1   1 
ATOM   2021  O  OE2   . GLU A  1 288 ? -30.646 -29.797 -44.729 1.00 30.51  ? 260 GLU A OE2   1 
ATOM   2022  N  N     . MET A  1 289 ? -27.284 -26.064 -46.400 1.00 31.50  ? 261 MET A N     1 
ATOM   2023  C  CA    . MET A  1 289 ? -26.583 -25.076 -45.573 1.00 31.15  ? 261 MET A CA    1 
ATOM   2024  C  C     . MET A  1 289 ? -25.597 -24.233 -46.369 1.00 37.93  ? 261 MET A C     1 
ATOM   2025  O  O     . MET A  1 289 ? -25.034 -23.272 -45.830 1.00 32.69  ? 261 MET A O     1 
ATOM   2026  C  CB    . MET A  1 289 ? -25.818 -25.744 -44.437 1.00 27.16  ? 261 MET A CB    1 
ATOM   2027  C  CG    . MET A  1 289 ? -26.680 -26.373 -43.380 1.00 29.37  ? 261 MET A CG    1 
ATOM   2028  S  SD    . MET A  1 289 ? -25.643 -27.026 -42.061 1.00 29.45  ? 261 MET A SD    1 
ATOM   2029  C  CE    . MET A  1 289 ? -26.889 -27.814 -41.058 1.00 24.45  ? 261 MET A CE    1 
ATOM   2030  N  N     . GLU A  1 290 ? -25.371 -24.610 -47.628 1.00 31.08  ? 262 GLU A N     1 
ATOM   2031  C  CA    . GLU A  1 290 ? -24.454 -23.886 -48.489 1.00 31.27  ? 262 GLU A CA    1 
ATOM   2032  C  C     . GLU A  1 290 ? -24.911 -22.457 -48.712 1.00 32.48  ? 262 GLU A C     1 
ATOM   2033  O  O     . GLU A  1 290 ? -26.053 -22.210 -49.109 1.00 33.52  ? 262 GLU A O     1 
ATOM   2034  C  CB    . GLU A  1 290 ? -24.309 -24.607 -49.827 1.00 36.83  ? 262 GLU A CB    1 
ATOM   2035  C  CG    . GLU A  1 290 ? -23.447 -25.851 -49.727 1.00 36.70  ? 262 GLU A CG    1 
ATOM   2036  C  CD    . GLU A  1 290 ? -22.023 -25.500 -49.351 1.00 42.48  ? 262 GLU A CD    1 
ATOM   2037  O  OE1   . GLU A  1 290 ? -21.414 -24.676 -50.070 1.00 45.48  ? 262 GLU A OE1   1 
ATOM   2038  O  OE2   . GLU A  1 290 ? -21.520 -26.021 -48.334 1.00 37.60  ? 262 GLU A OE2   1 
ATOM   2039  N  N     . PRO A  1 291 ? -24.022 -21.496 -48.440 1.00 34.36  ? 263 PRO A N     1 
ATOM   2040  C  CA    . PRO A  1 291 ? -24.409 -20.096 -48.636 1.00 36.38  ? 263 PRO A CA    1 
ATOM   2041  C  C     . PRO A  1 291 ? -24.645 -19.738 -50.101 1.00 39.92  ? 263 PRO A C     1 
ATOM   2042  O  O     . PRO A  1 291 ? -23.931 -20.192 -50.989 1.00 39.49  ? 263 PRO A O     1 
ATOM   2043  C  CB    . PRO A  1 291 ? -23.214 -19.313 -48.078 1.00 37.45  ? 263 PRO A CB    1 
ATOM   2044  C  CG    . PRO A  1 291 ? -22.070 -20.283 -48.059 1.00 35.07  ? 263 PRO A CG    1 
ATOM   2045  C  CD    . PRO A  1 291 ? -22.698 -21.630 -47.811 1.00 33.32  ? 263 PRO A CD    1 
ATOM   2046  N  N     . ASP A  1 292 ? -25.682 -18.952 -50.334 1.00 35.92  ? 264 ASP A N     1 
ATOM   2047  C  CA    . ASP A  1 292 ? -25.838 -18.252 -51.584 1.00 37.79  ? 264 ASP A CA    1 
ATOM   2048  C  C     . ASP A  1 292 ? -25.135 -16.908 -51.401 1.00 37.53  ? 264 ASP A C     1 
ATOM   2049  O  O     . ASP A  1 292 ? -25.654 -16.021 -50.722 1.00 37.10  ? 264 ASP A O     1 
ATOM   2050  C  CB    . ASP A  1 292 ? -27.316 -18.090 -51.935 1.00 37.63  ? 264 ASP A CB    1 
ATOM   2051  C  CG    . ASP A  1 292 ? -27.534 -17.280 -53.197 1.00 42.94  ? 264 ASP A CG    1 
ATOM   2052  O  OD1   . ASP A  1 292 ? -26.573 -16.668 -53.703 1.00 41.78  ? 264 ASP A OD1   1 
ATOM   2053  O  OD2   . ASP A  1 292 ? -28.683 -17.244 -53.680 1.00 43.69  ? 264 ASP A OD2   1 
ATOM   2054  N  N     . PRO A  1 293 ? -23.951 -16.759 -52.010 1.00 36.02  ? 265 PRO A N     1 
ATOM   2055  C  CA    . PRO A  1 293 ? -23.079 -15.602 -51.799 1.00 39.61  ? 265 PRO A CA    1 
ATOM   2056  C  C     . PRO A  1 293 ? -23.771 -14.254 -52.037 1.00 39.17  ? 265 PRO A C     1 
ATOM   2057  O  O     . PRO A  1 293 ? -23.418 -13.309 -51.343 1.00 41.53  ? 265 PRO A O     1 
ATOM   2058  C  CB    . PRO A  1 293 ? -21.952 -15.821 -52.814 1.00 44.60  ? 265 PRO A CB    1 
ATOM   2059  C  CG    . PRO A  1 293 ? -21.949 -17.279 -53.075 1.00 44.78  ? 265 PRO A CG    1 
ATOM   2060  C  CD    . PRO A  1 293 ? -23.386 -17.700 -52.991 1.00 45.14  ? 265 PRO A CD    1 
ATOM   2061  N  N     . GLU A  1 294 ? -24.736 -14.169 -52.957 1.00 37.64  ? 266 GLU A N     1 
ATOM   2062  C  CA    . GLU A  1 294 ? -25.424 -12.893 -53.211 1.00 42.69  ? 266 GLU A CA    1 
ATOM   2063  C  C     . GLU A  1 294 ? -26.366 -12.478 -52.081 1.00 37.21  ? 266 GLU A C     1 
ATOM   2064  O  O     . GLU A  1 294 ? -26.777 -11.326 -52.025 1.00 33.35  ? 266 GLU A O     1 
ATOM   2065  C  CB    . GLU A  1 294 ? -26.237 -12.923 -54.516 1.00 41.97  ? 266 GLU A CB    1 
ATOM   2066  C  CG    . GLU A  1 294 ? -25.447 -13.134 -55.807 1.00 46.75  ? 266 GLU A CG    1 
ATOM   2067  C  CD    . GLU A  1 294 ? -24.260 -12.212 -55.953 1.00 53.56  ? 266 GLU A CD    1 
ATOM   2068  O  OE1   . GLU A  1 294 ? -24.431 -10.964 -55.855 1.00 54.53  ? 266 GLU A OE1   1 
ATOM   2069  O  OE2   . GLU A  1 294 ? -23.147 -12.751 -56.181 1.00 54.80  ? 266 GLU A OE2   1 
ATOM   2070  N  N     . ILE A  1 295 ? -26.740 -13.394 -51.190 1.00 38.94  ? 267 ILE A N     1 
ATOM   2071  C  CA    . ILE A  1 295 ? -27.566 -12.949 -50.062 1.00 39.29  ? 267 ILE A CA    1 
ATOM   2072  C  C     . ILE A  1 295 ? -26.845 -13.075 -48.736 1.00 33.50  ? 267 ILE A C     1 
ATOM   2073  O  O     . ILE A  1 295 ? -27.197 -12.386 -47.780 1.00 38.86  ? 267 ILE A O     1 
ATOM   2074  C  CB    . ILE A  1 295 ? -28.918 -13.702 -49.985 1.00 39.63  ? 267 ILE A CB    1 
ATOM   2075  C  CG1   . ILE A  1 295 ? -28.728 -15.141 -49.551 1.00 38.70  ? 267 ILE A CG1   1 
ATOM   2076  C  CG2   . ILE A  1 295 ? -29.660 -13.631 -51.333 1.00 44.80  ? 267 ILE A CG2   1 
ATOM   2077  C  CD1   . ILE A  1 295 ? -30.029 -15.844 -49.353 1.00 47.49  ? 267 ILE A CD1   1 
ATOM   2078  N  N     . ALA A  1 296 ? -25.829 -13.925 -48.681 1.00 32.75  ? 268 ALA A N     1 
ATOM   2079  C  CA    . ALA A  1 296 ? -25.018 -14.073 -47.484 1.00 28.08  ? 268 ALA A CA    1 
ATOM   2080  C  C     . ALA A  1 296 ? -24.031 -12.924 -47.401 1.00 35.20  ? 268 ALA A C     1 
ATOM   2081  O  O     . ALA A  1 296 ? -23.617 -12.504 -46.312 1.00 31.27  ? 268 ALA A O     1 
ATOM   2082  C  CB    . ALA A  1 296 ? -24.285 -15.403 -47.492 1.00 33.31  ? 268 ALA A CB    1 
ATOM   2083  N  N     . LYS A  1 297 ? -23.652 -12.413 -48.569 1.00 34.85  ? 269 LYS A N     1 
ATOM   2084  C  CA    . LYS A  1 297 ? -22.750 -11.277 -48.642 1.00 36.43  ? 269 LYS A CA    1 
ATOM   2085  C  C     . LYS A  1 297 ? -23.285 -10.281 -49.686 1.00 31.27  ? 269 LYS A C     1 
ATOM   2086  O  O     . LYS A  1 297 ? -22.653 -10.037 -50.701 1.00 33.40  ? 269 LYS A O     1 
ATOM   2087  C  CB    . LYS A  1 297 ? -21.324 -11.757 -48.974 1.00 37.96  ? 269 LYS A CB    1 
ATOM   2088  C  CG    . LYS A  1 297 ? -20.244 -10.682 -48.856 1.00 40.13  ? 269 LYS A CG    1 
ATOM   2089  C  CD    . LYS A  1 297 ? -18.868 -11.255 -49.196 1.00 48.36  ? 269 LYS A CD    1 
ATOM   2090  C  CE    . LYS A  1 297 ? -17.799 -10.154 -49.287 1.00 55.84  ? 269 LYS A CE    1 
ATOM   2091  N  NZ    . LYS A  1 297 ? -16.439 -10.684 -49.656 1.00 53.70  ? 269 LYS A NZ    1 
ATOM   2092  N  N     . PRO A  1 298 ? -24.464 -9.702  -49.419 1.00 34.66  ? 270 PRO A N     1 
ATOM   2093  C  CA    . PRO A  1 298 ? -25.217 -8.909  -50.392 1.00 32.33  ? 270 PRO A CA    1 
ATOM   2094  C  C     . PRO A  1 298 ? -24.688 -7.488  -50.561 1.00 33.46  ? 270 PRO A C     1 
ATOM   2095  O  O     . PRO A  1 298 ? -24.092 -6.927  -49.642 1.00 32.93  ? 270 PRO A O     1 
ATOM   2096  C  CB    . PRO A  1 298 ? -26.620 -8.885  -49.788 1.00 31.38  ? 270 PRO A CB    1 
ATOM   2097  C  CG    . PRO A  1 298 ? -26.351 -8.829  -48.306 1.00 31.42  ? 270 PRO A CG    1 
ATOM   2098  C  CD    . PRO A  1 298 ? -25.121 -9.696  -48.093 1.00 35.69  ? 270 PRO A CD    1 
ATOM   2099  N  N     . LEU A  1 299 ? -24.914 -6.917  -51.737 1.00 32.97  ? 271 LEU A N     1 
ATOM   2100  C  CA    . LEU A  1 299 ? -24.587 -5.518  -51.979 1.00 31.86  ? 271 LEU A CA    1 
ATOM   2101  C  C     . LEU A  1 299 ? -25.430 -4.647  -51.057 1.00 32.00  ? 271 LEU A C     1 
ATOM   2102  O  O     . LEU A  1 299 ? -26.625 -4.898  -50.873 1.00 29.92  ? 271 LEU A O     1 
ATOM   2103  C  CB    . LEU A  1 299 ? -24.834 -5.148  -53.441 1.00 32.56  ? 271 LEU A CB    1 
ATOM   2104  C  CG    . LEU A  1 299 ? -24.020 -5.887  -54.510 1.00 39.15  ? 271 LEU A CG    1 
ATOM   2105  C  CD1   . LEU A  1 299 ? -24.663 -5.719  -55.873 1.00 37.09  ? 271 LEU A CD1   1 
ATOM   2106  C  CD2   . LEU A  1 299 ? -22.596 -5.351  -54.526 1.00 32.74  ? 271 LEU A CD2   1 
ATOM   2107  N  N     . LEU A  1 300 ? -24.811 -3.625  -50.479 1.00 27.97  ? 272 LEU A N     1 
ATOM   2108  C  CA    . LEU A  1 300 ? -25.505 -2.785  -49.512 1.00 31.27  ? 272 LEU A CA    1 
ATOM   2109  C  C     . LEU A  1 300 ? -26.579 -1.896  -50.140 1.00 33.84  ? 272 LEU A C     1 
ATOM   2110  O  O     . LEU A  1 300 ? -27.695 -1.827  -49.626 1.00 30.60  ? 272 LEU A O     1 
ATOM   2111  C  CB    . LEU A  1 300 ? -24.501 -1.920  -48.750 1.00 31.68  ? 272 LEU A CB    1 
ATOM   2112  C  CG    . LEU A  1 300 ? -23.480 -2.724  -47.955 1.00 29.16  ? 272 LEU A CG    1 
ATOM   2113  C  CD1   . LEU A  1 300 ? -22.433 -1.778  -47.363 1.00 29.47  ? 272 LEU A CD1   1 
ATOM   2114  C  CD2   . LEU A  1 300 ? -24.177 -3.528  -46.855 1.00 25.26  ? 272 LEU A CD2   1 
ATOM   2115  N  N     . LYS A  1 301 ? -26.254 -1.216  -51.243 1.00 27.36  ? 273 LYS A N     1 
ATOM   2116  C  CA    . LYS A  1 301 ? -27.190 -0.256  -51.798 1.00 29.95  ? 273 LYS A CA    1 
ATOM   2117  C  C     . LYS A  1 301 ? -28.531 -0.843  -52.246 1.00 30.51  ? 273 LYS A C     1 
ATOM   2118  O  O     . LYS A  1 301 ? -29.560 -0.203  -52.053 1.00 31.03  ? 273 LYS A O     1 
ATOM   2119  C  CB    . LYS A  1 301 ? -26.545 0.514   -52.962 1.00 32.02  ? 273 LYS A CB    1 
ATOM   2120  C  CG    . LYS A  1 301 ? -25.665 1.647   -52.481 1.00 31.45  ? 273 LYS A CG    1 
ATOM   2121  C  CD    . LYS A  1 301 ? -25.150 2.495   -53.630 1.00 42.90  ? 273 LYS A CD    1 
ATOM   2122  C  CE    . LYS A  1 301 ? -23.932 1.883   -54.250 1.00 42.06  ? 273 LYS A CE    1 
ATOM   2123  N  NZ    . LYS A  1 301 ? -23.112 2.965   -54.854 1.00 47.68  ? 273 LYS A NZ    1 
ATOM   2124  N  N     . PRO A  1 302 ? -28.541 -2.046  -52.847 1.00 29.79  ? 274 PRO A N     1 
ATOM   2125  C  CA    . PRO A  1 302 ? -29.880 -2.525  -53.209 1.00 31.52  ? 274 PRO A CA    1 
ATOM   2126  C  C     . PRO A  1 302 ? -30.737 -2.905  -52.010 1.00 33.89  ? 274 PRO A C     1 
ATOM   2127  O  O     . PRO A  1 302 ? -31.976 -2.908  -52.114 1.00 31.61  ? 274 PRO A O     1 
ATOM   2128  C  CB    . PRO A  1 302 ? -29.586 -3.752  -54.082 1.00 30.50  ? 274 PRO A CB    1 
ATOM   2129  C  CG    . PRO A  1 302 ? -28.243 -3.470  -54.653 1.00 30.80  ? 274 PRO A CG    1 
ATOM   2130  C  CD    . PRO A  1 302 ? -27.485 -2.769  -53.576 1.00 30.99  ? 274 PRO A CD    1 
ATOM   2131  N  N     . LEU A  1 303 ? -30.093 -3.208  -50.885 1.00 34.16  ? 275 LEU A N     1 
ATOM   2132  C  CA    . LEU A  1 303 ? -30.827 -3.535  -49.667 1.00 33.04  ? 275 LEU A CA    1 
ATOM   2133  C  C     . LEU A  1 303 ? -31.618 -2.340  -49.170 1.00 36.33  ? 275 LEU A C     1 
ATOM   2134  O  O     . LEU A  1 303 ? -32.716 -2.511  -48.648 1.00 39.54  ? 275 LEU A O     1 
ATOM   2135  C  CB    . LEU A  1 303 ? -29.882 -4.018  -48.577 1.00 35.63  ? 275 LEU A CB    1 
ATOM   2136  C  CG    . LEU A  1 303 ? -29.575 -5.508  -48.587 1.00 39.34  ? 275 LEU A CG    1 
ATOM   2137  C  CD1   . LEU A  1 303 ? -28.583 -5.826  -47.479 1.00 32.43  ? 275 LEU A CD1   1 
ATOM   2138  C  CD2   . LEU A  1 303 ? -30.867 -6.327  -48.425 1.00 33.59  ? 275 LEU A CD2   1 
ATOM   2139  N  N     . LEU A  1 304 ? -31.079 -1.135  -49.355 1.00 30.37  ? 276 LEU A N     1 
ATOM   2140  C  CA    . LEU A  1 304 ? -31.751 0.067   -48.861 1.00 38.21  ? 276 LEU A CA    1 
ATOM   2141  C  C     . LEU A  1 304 ? -33.093 0.303   -49.546 1.00 32.98  ? 276 LEU A C     1 
ATOM   2142  O  O     . LEU A  1 304 ? -33.923 1.029   -49.018 1.00 30.74  ? 276 LEU A O     1 
ATOM   2143  C  CB    . LEU A  1 304 ? -30.896 1.320   -49.048 1.00 36.57  ? 276 LEU A CB    1 
ATOM   2144  C  CG    . LEU A  1 304 ? -29.451 1.442   -48.564 1.00 40.32  ? 276 LEU A CG    1 
ATOM   2145  C  CD1   . LEU A  1 304 ? -28.920 2.811   -49.000 1.00 38.23  ? 276 LEU A CD1   1 
ATOM   2146  C  CD2   . LEU A  1 304 ? -29.302 1.265   -47.069 1.00 30.55  ? 276 LEU A CD2   1 
ATOM   2147  N  N     . ALA A  1 305 ? -33.300 -0.317  -50.705 1.00 32.65  ? 277 ALA A N     1 
ATOM   2148  C  CA    . ALA A  1 305 ? -34.516 -0.093  -51.484 1.00 39.62  ? 277 ALA A CA    1 
ATOM   2149  C  C     . ALA A  1 305 ? -35.321 -1.366  -51.776 1.00 39.74  ? 277 ALA A C     1 
ATOM   2150  O  O     . ALA A  1 305 ? -36.252 -1.338  -52.582 1.00 40.19  ? 277 ALA A O     1 
ATOM   2151  C  CB    . ALA A  1 305 ? -34.165 0.615   -52.805 1.00 42.03  ? 277 ALA A CB    1 
ATOM   2152  N  N     . ILE A  1 306 ? -34.989 -2.471  -51.114 1.00 40.64  ? 278 ILE A N     1 
ATOM   2153  C  CA    . ILE A  1 306 ? -35.660 -3.738  -51.400 1.00 38.68  ? 278 ILE A CA    1 
ATOM   2154  C  C     . ILE A  1 306 ? -37.145 -3.692  -51.020 1.00 36.20  ? 278 ILE A C     1 
ATOM   2155  O  O     . ILE A  1 306 ? -37.511 -3.125  -49.994 1.00 36.57  ? 278 ILE A O     1 
ATOM   2156  C  CB    . ILE A  1 306 ? -34.963 -4.903  -50.670 1.00 37.42  ? 278 ILE A CB    1 
ATOM   2157  C  CG1   . ILE A  1 306 ? -35.454 -6.249  -51.201 1.00 38.19  ? 278 ILE A CG1   1 
ATOM   2158  C  CG2   . ILE A  1 306 ? -35.143 -4.790  -49.150 1.00 35.14  ? 278 ILE A CG2   1 
ATOM   2159  C  CD1   . ILE A  1 306 ? -34.503 -7.392  -50.929 1.00 33.98  ? 278 ILE A CD1   1 
ATOM   2160  N  N     . SER A  1 307 ? -38.004 -4.262  -51.862 1.00 39.28  ? 279 SER A N     1 
ATOM   2161  C  CA    . SER A  1 307 ? -39.422 -4.392  -51.518 1.00 39.91  ? 279 SER A CA    1 
ATOM   2162  C  C     . SER A  1 307 ? -39.599 -5.517  -50.496 1.00 40.37  ? 279 SER A C     1 
ATOM   2163  O  O     . SER A  1 307 ? -38.709 -6.349  -50.340 1.00 39.40  ? 279 SER A O     1 
ATOM   2164  C  CB    . SER A  1 307 ? -40.274 -4.672  -52.759 1.00 42.29  ? 279 SER A CB    1 
ATOM   2165  O  OG    . SER A  1 307 ? -39.972 -5.945  -53.321 1.00 38.95  ? 279 SER A OG    1 
ATOM   2166  N  N     . ASN A  1 308 ? -40.732 -5.532  -49.800 1.00 38.26  ? 280 ASN A N     1 
ATOM   2167  C  CA    . ASN A  1 308 ? -41.034 -6.609  -48.858 1.00 42.09  ? 280 ASN A CA    1 
ATOM   2168  C  C     . ASN A  1 308 ? -41.142 -7.961  -49.547 1.00 38.31  ? 280 ASN A C     1 
ATOM   2169  O  O     . ASN A  1 308 ? -40.609 -8.961  -49.061 1.00 40.79  ? 280 ASN A O     1 
ATOM   2170  C  CB    . ASN A  1 308 ? -42.322 -6.305  -48.097 1.00 39.79  ? 280 ASN A CB    1 
ATOM   2171  C  CG    . ASN A  1 308 ? -42.173 -5.109  -47.192 1.00 48.06  ? 280 ASN A CG    1 
ATOM   2172  O  OD1   . ASN A  1 308 ? -41.075 -4.838  -46.707 1.00 43.43  ? 280 ASN A OD1   1 
ATOM   2173  N  ND2   . ASN A  1 308 ? -43.262 -4.373  -46.971 1.00 44.75  ? 280 ASN A ND2   1 
ATOM   2174  N  N     . ARG A  1 309 ? -41.817 -7.985  -50.691 1.00 41.00  ? 281 ARG A N     1 
ATOM   2175  C  CA    . ARG A  1 309 ? -41.908 -9.202  -51.484 1.00 45.17  ? 281 ARG A CA    1 
ATOM   2176  C  C     . ARG A  1 309 ? -40.518 -9.696  -51.830 1.00 41.42  ? 281 ARG A C     1 
ATOM   2177  O  O     . ARG A  1 309 ? -40.234 -10.876 -51.711 1.00 40.53  ? 281 ARG A O     1 
ATOM   2178  C  CB    . ARG A  1 309 ? -42.720 -8.975  -52.764 1.00 44.08  ? 281 ARG A CB    1 
ATOM   2179  C  CG    . ARG A  1 309 ? -42.911 -10.229 -53.603 1.00 51.81  ? 281 ARG A CG    1 
ATOM   2180  C  CD    . ARG A  1 309 ? -43.502 -9.906  -54.976 1.00 63.07  ? 281 ARG A CD    1 
ATOM   2181  N  NE    . ARG A  1 309 ? -44.714 -9.098  -54.852 1.00 70.51  ? 281 ARG A NE    1 
ATOM   2182  C  CZ    . ARG A  1 309 ? -45.925 -9.600  -54.625 1.00 77.98  ? 281 ARG A CZ    1 
ATOM   2183  N  NH1   . ARG A  1 309 ? -46.096 -10.917 -54.502 1.00 63.86  ? 281 ARG A NH1   1 
ATOM   2184  N  NH2   . ARG A  1 309 ? -46.968 -8.782  -54.520 1.00 74.92  ? 281 ARG A NH2   1 
ATOM   2185  N  N     . GLU A  1 310 ? -39.641 -8.790  -52.252 1.00 43.06  ? 282 GLU A N     1 
ATOM   2186  C  CA    . GLU A  1 310 ? -38.305 -9.201  -52.677 1.00 39.46  ? 282 GLU A CA    1 
ATOM   2187  C  C     . GLU A  1 310 ? -37.474 -9.663  -51.481 1.00 40.48  ? 282 GLU A C     1 
ATOM   2188  O  O     . GLU A  1 310 ? -36.727 -10.638 -51.576 1.00 39.10  ? 282 GLU A O     1 
ATOM   2189  C  CB    . GLU A  1 310 ? -37.602 -8.067  -53.411 1.00 46.78  ? 282 GLU A CB    1 
ATOM   2190  C  CG    . GLU A  1 310 ? -36.473 -8.513  -54.325 1.00 52.87  ? 282 GLU A CG    1 
ATOM   2191  C  CD    . GLU A  1 310 ? -35.868 -7.352  -55.094 1.00 63.01  ? 282 GLU A CD    1 
ATOM   2192  O  OE1   . GLU A  1 310 ? -36.274 -6.189  -54.835 1.00 62.47  ? 282 GLU A OE1   1 
ATOM   2193  O  OE2   . GLU A  1 310 ? -34.988 -7.602  -55.954 1.00 69.60  ? 282 GLU A OE2   1 
ATOM   2194  N  N     . PHE A  1 311 ? -37.625 -8.978  -50.350 1.00 32.26  ? 283 PHE A N     1 
ATOM   2195  C  CA    . PHE A  1 311 ? -36.922 -9.374  -49.135 1.00 34.64  ? 283 PHE A CA    1 
ATOM   2196  C  C     . PHE A  1 311 ? -37.385 -10.760 -48.690 1.00 32.12  ? 283 PHE A C     1 
ATOM   2197  O  O     . PHE A  1 311 ? -36.581 -11.605 -48.293 1.00 30.62  ? 283 PHE A O     1 
ATOM   2198  C  CB    . PHE A  1 311 ? -37.135 -8.355  -47.990 1.00 31.43  ? 283 PHE A CB    1 
ATOM   2199  C  CG    . PHE A  1 311 ? -36.449 -8.753  -46.713 1.00 27.81  ? 283 PHE A CG    1 
ATOM   2200  C  CD1   . PHE A  1 311 ? -37.140 -9.430  -45.711 1.00 30.00  ? 283 PHE A CD1   1 
ATOM   2201  C  CD2   . PHE A  1 311 ? -35.094 -8.514  -46.542 1.00 23.43  ? 283 PHE A CD2   1 
ATOM   2202  C  CE1   . PHE A  1 311 ? -36.502 -9.830  -44.563 1.00 25.87  ? 283 PHE A CE1   1 
ATOM   2203  C  CE2   . PHE A  1 311 ? -34.446 -8.909  -45.398 1.00 26.13  ? 283 PHE A CE2   1 
ATOM   2204  C  CZ    . PHE A  1 311 ? -35.150 -9.570  -44.400 1.00 27.88  ? 283 PHE A CZ    1 
ATOM   2205  N  N     . LYS A  1 312 ? -38.687 -10.993 -48.764 1.00 31.85  ? 284 LYS A N     1 
ATOM   2206  C  CA    . LYS A  1 312 ? -39.217 -12.266 -48.339 1.00 36.44  ? 284 LYS A CA    1 
ATOM   2207  C  C     . LYS A  1 312 ? -38.716 -13.378 -49.271 1.00 42.37  ? 284 LYS A C     1 
ATOM   2208  O  O     . LYS A  1 312 ? -38.320 -14.446 -48.803 1.00 32.97  ? 284 LYS A O     1 
ATOM   2209  C  CB    . LYS A  1 312 ? -40.742 -12.227 -48.292 1.00 37.78  ? 284 LYS A CB    1 
ATOM   2210  C  CG    . LYS A  1 312 ? -41.354 -13.547 -47.878 1.00 50.43  ? 284 LYS A CG    1 
ATOM   2211  C  CD    . LYS A  1 312 ? -42.828 -13.414 -47.544 1.00 54.90  ? 284 LYS A CD    1 
ATOM   2212  C  CE    . LYS A  1 312 ? -43.335 -14.684 -46.864 1.00 63.19  ? 284 LYS A CE    1 
ATOM   2213  N  NZ    . LYS A  1 312 ? -44.717 -14.548 -46.319 1.00 74.94  ? 284 LYS A NZ    1 
ATOM   2214  N  N     . GLU A  1 313 ? -38.685 -13.103 -50.576 1.00 37.63  ? 285 GLU A N     1 
ATOM   2215  C  CA    . GLU A  1 313 ? -38.217 -14.088 -51.551 1.00 40.96  ? 285 GLU A CA    1 
ATOM   2216  C  C     . GLU A  1 313 ? -36.723 -14.367 -51.415 1.00 37.80  ? 285 GLU A C     1 
ATOM   2217  O  O     . GLU A  1 313 ? -36.293 -15.508 -51.496 1.00 32.80  ? 285 GLU A O     1 
ATOM   2218  C  CB    . GLU A  1 313 ? -38.531 -13.631 -52.988 1.00 44.28  ? 285 GLU A CB    1 
ATOM   2219  C  CG    . GLU A  1 313 ? -39.990 -13.849 -53.408 1.00 56.63  ? 285 GLU A CG    1 
ATOM   2220  C  CD    . GLU A  1 313 ? -40.351 -13.208 -54.754 1.00 66.27  ? 285 GLU A CD    1 
ATOM   2221  O  OE1   . GLU A  1 313 ? -39.424 -12.867 -55.528 1.00 65.75  ? 285 GLU A OE1   1 
ATOM   2222  O  OE2   . GLU A  1 313 ? -41.566 -13.039 -55.033 1.00 60.06  ? 285 GLU A OE2   1 
ATOM   2223  N  N     . LYS A  1 314 ? -35.921 -13.337 -51.206 1.00 38.44  ? 286 LYS A N     1 
ATOM   2224  C  CA    . LYS A  1 314 ? -34.478 -13.557 -51.146 1.00 37.01  ? 286 LYS A CA    1 
ATOM   2225  C  C     . LYS A  1 314 ? -33.992 -14.060 -49.784 1.00 34.15  ? 286 LYS A C     1 
ATOM   2226  O  O     . LYS A  1 314 ? -33.194 -14.989 -49.706 1.00 37.74  ? 286 LYS A O     1 
ATOM   2227  C  CB    . LYS A  1 314 ? -33.736 -12.265 -51.518 1.00 40.44  ? 286 LYS A CB    1 
ATOM   2228  C  CG    . LYS A  1 314 ? -33.936 -11.842 -52.988 1.00 44.57  ? 286 LYS A CG    1 
ATOM   2229  C  CD    . LYS A  1 314 ? -32.946 -10.762 -53.393 1.00 46.42  ? 286 LYS A CD    1 
ATOM   2230  C  CE    . LYS A  1 314 ? -33.135 -10.324 -54.848 1.00 59.42  ? 286 LYS A CE    1 
ATOM   2231  N  NZ    . LYS A  1 314 ? -32.287 -9.130  -55.162 1.00 66.54  ? 286 LYS A NZ    1 
ATOM   2232  N  N     . PHE A  1 315 ? -34.482 -13.440 -48.716 1.00 32.79  ? 287 PHE A N     1 
ATOM   2233  C  CA    . PHE A  1 315 ? -33.883 -13.588 -47.397 1.00 31.89  ? 287 PHE A CA    1 
ATOM   2234  C  C     . PHE A  1 315 ? -34.771 -14.383 -46.471 1.00 31.34  ? 287 PHE A C     1 
ATOM   2235  O  O     . PHE A  1 315 ? -34.365 -14.741 -45.369 1.00 32.77  ? 287 PHE A O     1 
ATOM   2236  C  CB    . PHE A  1 315 ? -33.594 -12.196 -46.793 1.00 26.29  ? 287 PHE A CB    1 
ATOM   2237  C  CG    . PHE A  1 315 ? -32.513 -11.443 -47.514 1.00 27.09  ? 287 PHE A CG    1 
ATOM   2238  C  CD1   . PHE A  1 315 ? -31.181 -11.623 -47.180 1.00 32.43  ? 287 PHE A CD1   1 
ATOM   2239  C  CD2   . PHE A  1 315 ? -32.822 -10.590 -48.559 1.00 31.32  ? 287 PHE A CD2   1 
ATOM   2240  C  CE1   . PHE A  1 315 ? -30.176 -10.942 -47.860 1.00 32.97  ? 287 PHE A CE1   1 
ATOM   2241  C  CE2   . PHE A  1 315 ? -31.824 -9.891  -49.241 1.00 33.61  ? 287 PHE A CE2   1 
ATOM   2242  C  CZ    . PHE A  1 315 ? -30.501 -10.073 -48.891 1.00 31.98  ? 287 PHE A CZ    1 
ATOM   2243  N  N     . GLY A  1 316 ? -35.994 -14.642 -46.922 1.00 34.63  ? 288 GLY A N     1 
ATOM   2244  C  CA    . GLY A  1 316 ? -37.001 -15.257 -46.081 1.00 33.52  ? 288 GLY A CA    1 
ATOM   2245  C  C     . GLY A  1 316 ? -36.672 -16.638 -45.535 1.00 33.33  ? 288 GLY A C     1 
ATOM   2246  O  O     . GLY A  1 316 ? -37.280 -17.046 -44.555 1.00 36.81  ? 288 GLY A O     1 
ATOM   2247  N  N     . HIS A  1 317 ? -35.733 -17.360 -46.144 1.00 30.43  ? 289 HIS A N     1 
ATOM   2248  C  CA    . HIS A  1 317 ? -35.426 -18.712 -45.659 1.00 34.39  ? 289 HIS A CA    1 
ATOM   2249  C  C     . HIS A  1 317 ? -34.101 -18.813 -44.898 1.00 32.88  ? 289 HIS A C     1 
ATOM   2250  O  O     . HIS A  1 317 ? -33.650 -19.923 -44.594 1.00 28.90  ? 289 HIS A O     1 
ATOM   2251  C  CB    . HIS A  1 317 ? -35.399 -19.719 -46.809 1.00 36.41  ? 289 HIS A CB    1 
ATOM   2252  C  CG    . HIS A  1 317 ? -36.733 -19.956 -47.447 1.00 46.07  ? 289 HIS A CG    1 
ATOM   2253  N  ND1   . HIS A  1 317 ? -37.847 -20.339 -46.730 1.00 46.45  ? 289 HIS A ND1   1 
ATOM   2254  C  CD2   . HIS A  1 317 ? -37.125 -19.883 -48.742 1.00 48.08  ? 289 HIS A CD2   1 
ATOM   2255  C  CE1   . HIS A  1 317 ? -38.869 -20.483 -47.555 1.00 49.99  ? 289 HIS A CE1   1 
ATOM   2256  N  NE2   . HIS A  1 317 ? -38.458 -20.212 -48.781 1.00 49.98  ? 289 HIS A NE2   1 
ATOM   2257  N  N     . VAL A  1 318 ? -33.468 -17.678 -44.609 1.00 30.68  ? 290 VAL A N     1 
ATOM   2258  C  CA    . VAL A  1 318 ? -32.268 -17.690 -43.779 1.00 27.31  ? 290 VAL A CA    1 
ATOM   2259  C  C     . VAL A  1 318 ? -32.649 -17.308 -42.339 1.00 26.97  ? 290 VAL A C     1 
ATOM   2260  O  O     . VAL A  1 318 ? -33.659 -16.628 -42.108 1.00 26.32  ? 290 VAL A O     1 
ATOM   2261  C  CB    . VAL A  1 318 ? -31.158 -16.745 -44.318 1.00 27.84  ? 290 VAL A CB    1 
ATOM   2262  C  CG1   . VAL A  1 318 ? -30.826 -17.088 -45.759 1.00 31.43  ? 290 VAL A CG1   1 
ATOM   2263  C  CG2   . VAL A  1 318 ? -31.568 -15.271 -44.199 1.00 29.65  ? 290 VAL A CG2   1 
ATOM   2264  N  N     . SER A  1 319 ? -31.863 -17.783 -41.376 1.00 26.13  ? 291 SER A N     1 
ATOM   2265  C  CA    . SER A  1 319 ? -32.157 -17.532 -39.970 1.00 23.06  ? 291 SER A CA    1 
ATOM   2266  C  C     . SER A  1 319 ? -32.068 -16.039 -39.657 1.00 28.02  ? 291 SER A C     1 
ATOM   2267  O  O     . SER A  1 319 ? -32.758 -15.542 -38.770 1.00 27.61  ? 291 SER A O     1 
ATOM   2268  C  CB    . SER A  1 319 ? -31.209 -18.327 -39.064 1.00 26.95  ? 291 SER A CB    1 
ATOM   2269  O  OG    . SER A  1 319 ? -29.881 -17.855 -39.158 1.00 26.81  ? 291 SER A OG    1 
ATOM   2270  N  N     . GLY A  1 320 ? -31.240 -15.325 -40.412 1.00 28.49  ? 292 GLY A N     1 
ATOM   2271  C  CA    . GLY A  1 320 ? -31.007 -13.913 -40.154 1.00 28.87  ? 292 GLY A CA    1 
ATOM   2272  C  C     . GLY A  1 320 ? -32.168 -13.011 -40.520 1.00 30.36  ? 292 GLY A C     1 
ATOM   2273  O  O     . GLY A  1 320 ? -32.098 -11.799 -40.327 1.00 33.92  ? 292 GLY A O     1 
ATOM   2274  N  N     . SER A  1 321 ? -33.245 -13.574 -41.055 1.00 29.14  ? 293 SER A N     1 
ATOM   2275  C  CA    . SER A  1 321 ? -34.373 -12.721 -41.420 1.00 32.06  ? 293 SER A CA    1 
ATOM   2276  C  C     . SER A  1 321 ? -35.492 -12.768 -40.401 1.00 31.08  ? 293 SER A C     1 
ATOM   2277  O  O     . SER A  1 321 ? -36.579 -12.245 -40.662 1.00 30.48  ? 293 SER A O     1 
ATOM   2278  C  CB    . SER A  1 321 ? -34.930 -13.112 -42.776 1.00 32.82  ? 293 SER A CB    1 
ATOM   2279  O  OG    . SER A  1 321 ? -35.467 -14.416 -42.709 1.00 35.40  ? 293 SER A OG    1 
ATOM   2280  N  N     . TRP A  1 322 ? -35.219 -13.354 -39.237 1.00 27.27  ? 294 TRP A N     1 
ATOM   2281  C  CA    . TRP A  1 322 ? -36.292 -13.675 -38.293 1.00 30.10  ? 294 TRP A CA    1 
ATOM   2282  C  C     . TRP A  1 322 ? -36.870 -12.436 -37.624 1.00 33.57  ? 294 TRP A C     1 
ATOM   2283  O  O     . TRP A  1 322 ? -37.967 -12.487 -37.092 1.00 31.36  ? 294 TRP A O     1 
ATOM   2284  C  CB    . TRP A  1 322 ? -35.813 -14.676 -37.232 1.00 26.84  ? 294 TRP A CB    1 
ATOM   2285  C  CG    . TRP A  1 322 ? -34.954 -14.096 -36.159 1.00 27.57  ? 294 TRP A CG    1 
ATOM   2286  C  CD1   . TRP A  1 322 ? -33.615 -13.852 -36.220 1.00 30.26  ? 294 TRP A CD1   1 
ATOM   2287  C  CD2   . TRP A  1 322 ? -35.367 -13.730 -34.842 1.00 29.91  ? 294 TRP A CD2   1 
ATOM   2288  N  NE1   . TRP A  1 322 ? -33.172 -13.333 -35.028 1.00 28.26  ? 294 TRP A NE1   1 
ATOM   2289  C  CE2   . TRP A  1 322 ? -34.229 -13.247 -34.166 1.00 33.37  ? 294 TRP A CE2   1 
ATOM   2290  C  CE3   . TRP A  1 322 ? -36.595 -13.753 -34.166 1.00 34.34  ? 294 TRP A CE3   1 
ATOM   2291  C  CZ2   . TRP A  1 322 ? -34.282 -12.779 -32.848 1.00 34.62  ? 294 TRP A CZ2   1 
ATOM   2292  C  CZ3   . TRP A  1 322 ? -36.641 -13.289 -32.852 1.00 33.84  ? 294 TRP A CZ3   1 
ATOM   2293  C  CH2   . TRP A  1 322 ? -35.494 -12.816 -32.213 1.00 34.08  ? 294 TRP A CH2   1 
ATOM   2294  N  N     . ARG A  1 323 ? -36.148 -11.319 -37.686 1.00 33.02  ? 295 ARG A N     1 
ATOM   2295  C  CA    . ARG A  1 323 ? -36.666 -10.037 -37.207 1.00 34.36  ? 295 ARG A CA    1 
ATOM   2296  C  C     . ARG A  1 323 ? -37.096 -9.111  -38.346 1.00 36.99  ? 295 ARG A C     1 
ATOM   2297  O  O     . ARG A  1 323 ? -37.255 -7.902  -38.134 1.00 34.78  ? 295 ARG A O     1 
ATOM   2298  C  CB    . ARG A  1 323 ? -35.613 -9.315  -36.368 1.00 33.21  ? 295 ARG A CB    1 
ATOM   2299  C  CG    . ARG A  1 323 ? -35.065 -10.147 -35.239 1.00 36.74  ? 295 ARG A CG    1 
ATOM   2300  C  CD    . ARG A  1 323 ? -35.836 -9.889  -33.978 1.00 39.90  ? 295 ARG A CD    1 
ATOM   2301  N  NE    . ARG A  1 323 ? -35.168 -8.889  -33.171 1.00 37.41  ? 295 ARG A NE    1 
ATOM   2302  C  CZ    . ARG A  1 323 ? -35.670 -8.377  -32.058 1.00 36.95  ? 295 ARG A CZ    1 
ATOM   2303  N  NH1   . ARG A  1 323 ? -36.859 -8.769  -31.634 1.00 40.98  ? 295 ARG A NH1   1 
ATOM   2304  N  NH2   . ARG A  1 323 ? -34.988 -7.458  -31.390 1.00 34.72  ? 295 ARG A NH2   1 
ATOM   2305  N  N     . GLY A  1 324 ? -37.262 -9.658  -39.547 1.00 32.96  ? 296 GLY A N     1 
ATOM   2306  C  CA    . GLY A  1 324 ? -37.618 -8.829  -40.690 1.00 30.82  ? 296 GLY A CA    1 
ATOM   2307  C  C     . GLY A  1 324 ? -36.476 -7.968  -41.218 1.00 31.98  ? 296 GLY A C     1 
ATOM   2308  O  O     . GLY A  1 324 ? -35.328 -8.102  -40.803 1.00 29.57  ? 296 GLY A O     1 
ATOM   2309  N  N     . LYS A  1 325 ? -36.792 -7.049  -42.124 1.00 27.73  ? 297 LYS A N     1 
ATOM   2310  C  CA    . LYS A  1 325 ? -35.749 -6.325  -42.820 1.00 32.51  ? 297 LYS A CA    1 
ATOM   2311  C  C     . LYS A  1 325 ? -35.232 -5.065  -42.112 1.00 28.03  ? 297 LYS A C     1 
ATOM   2312  O  O     . LYS A  1 325 ? -34.223 -4.518  -42.557 1.00 27.92  ? 297 LYS A O     1 
ATOM   2313  C  CB    . LYS A  1 325 ? -36.227 -5.939  -44.235 1.00 32.73  ? 297 LYS A CB    1 
ATOM   2314  C  CG    . LYS A  1 325 ? -37.198 -4.769  -44.279 1.00 32.42  ? 297 LYS A CG    1 
ATOM   2315  C  CD    . LYS A  1 325 ? -37.738 -4.567  -45.694 1.00 34.79  ? 297 LYS A CD    1 
ATOM   2316  C  CE    . LYS A  1 325 ? -38.470 -3.212  -45.819 1.00 37.27  ? 297 LYS A CE    1 
ATOM   2317  N  NZ    . LYS A  1 325 ? -39.480 -3.089  -44.728 1.00 47.62  ? 297 LYS A NZ    1 
ATOM   2318  N  N     . LYS A  1 326 ? -35.876 -4.599  -41.036 1.00 24.73  ? 298 LYS A N     1 
ATOM   2319  C  CA    . LYS A  1 326 ? -35.481 -3.294  -40.496 1.00 26.74  ? 298 LYS A CA    1 
ATOM   2320  C  C     . LYS A  1 326 ? -34.061 -3.298  -39.889 1.00 27.75  ? 298 LYS A C     1 
ATOM   2321  O  O     . LYS A  1 326 ? -33.269 -2.414  -40.232 1.00 27.98  ? 298 LYS A O     1 
ATOM   2322  C  CB    . LYS A  1 326 ? -36.504 -2.753  -39.476 1.00 25.65  ? 298 LYS A CB    1 
ATOM   2323  C  CG    . LYS A  1 326 ? -36.100 -1.383  -38.872 1.00 31.88  ? 298 LYS A CG    1 
ATOM   2324  C  CD    . LYS A  1 326 ? -37.205 -0.728  -38.018 1.00 28.36  ? 298 LYS A CD    1 
ATOM   2325  C  CE    . LYS A  1 326 ? -37.762 -1.667  -36.961 1.00 37.20  ? 298 LYS A CE    1 
ATOM   2326  N  NZ    . LYS A  1 326 ? -38.943 -1.077  -36.267 1.00 35.89  ? 298 LYS A NZ    1 
ATOM   2327  N  N     . PRO A  1 327 ? -33.719 -4.288  -39.021 1.00 25.40  ? 299 PRO A N     1 
ATOM   2328  C  CA    . PRO A  1 327 ? -32.357 -4.286  -38.474 1.00 23.47  ? 299 PRO A CA    1 
ATOM   2329  C  C     . PRO A  1 327 ? -31.304 -4.404  -39.547 1.00 26.73  ? 299 PRO A C     1 
ATOM   2330  O  O     . PRO A  1 327 ? -30.275 -3.752  -39.462 1.00 29.17  ? 299 PRO A O     1 
ATOM   2331  C  CB    . PRO A  1 327 ? -32.334 -5.545  -37.573 1.00 28.71  ? 299 PRO A CB    1 
ATOM   2332  C  CG    . PRO A  1 327 ? -33.754 -5.772  -37.211 1.00 27.50  ? 299 PRO A CG    1 
ATOM   2333  C  CD    . PRO A  1 327 ? -34.535 -5.374  -38.432 1.00 26.65  ? 299 PRO A CD    1 
ATOM   2334  N  N     . ILE A  1 328 ? -31.570 -5.273  -40.524 1.00 27.00  ? 300 ILE A N     1 
ATOM   2335  C  CA    A ILE A  1 328 ? -30.668 -5.476  -41.644 0.48 26.23  ? 300 ILE A CA    1 
ATOM   2336  C  CA    B ILE A  1 328 ? -30.687 -5.479  -41.665 0.52 26.24  ? 300 ILE A CA    1 
ATOM   2337  C  C     . ILE A  1 328 ? -30.472 -4.172  -42.432 1.00 27.80  ? 300 ILE A C     1 
ATOM   2338  O  O     . ILE A  1 328 ? -29.346 -3.815  -42.771 1.00 28.05  ? 300 ILE A O     1 
ATOM   2339  C  CB    A ILE A  1 328 ? -31.186 -6.604  -42.564 0.48 22.77  ? 300 ILE A CB    1 
ATOM   2340  C  CB    B ILE A  1 328 ? -31.249 -6.552  -42.628 0.52 22.75  ? 300 ILE A CB    1 
ATOM   2341  C  CG1   A ILE A  1 328 ? -31.177 -7.937  -41.802 0.48 26.56  ? 300 ILE A CG1   1 
ATOM   2342  C  CG1   B ILE A  1 328 ? -31.551 -7.850  -41.872 0.52 26.81  ? 300 ILE A CG1   1 
ATOM   2343  C  CG2   A ILE A  1 328 ? -30.347 -6.711  -43.811 0.48 26.32  ? 300 ILE A CG2   1 
ATOM   2344  C  CG2   B ILE A  1 328 ? -30.271 -6.829  -43.740 0.52 26.30  ? 300 ILE A CG2   1 
ATOM   2345  C  CD1   A ILE A  1 328 ? -31.853 -9.075  -42.534 0.48 20.64  ? 300 ILE A CD1   1 
ATOM   2346  C  CD1   B ILE A  1 328 ? -30.337 -8.502  -41.300 0.52 25.99  ? 300 ILE A CD1   1 
ATOM   2347  N  N     . GLN A  1 329 ? -31.553 -3.444  -42.697 1.00 25.40  ? 301 GLN A N     1 
ATOM   2348  C  CA    . GLN A  1 329 ? -31.419 -2.177  -43.442 1.00 26.19  ? 301 GLN A CA    1 
ATOM   2349  C  C     . GLN A  1 329 ? -30.727 -1.094  -42.619 1.00 26.27  ? 301 GLN A C     1 
ATOM   2350  O  O     . GLN A  1 329 ? -29.939 -0.313  -43.149 1.00 24.67  ? 301 GLN A O     1 
ATOM   2351  C  CB    . GLN A  1 329 ? -32.780 -1.682  -43.910 1.00 24.95  ? 301 GLN A CB    1 
ATOM   2352  C  CG    . GLN A  1 329 ? -33.427 -2.610  -44.942 1.00 30.08  ? 301 GLN A CG    1 
ATOM   2353  C  CD    . GLN A  1 329 ? -34.719 -2.042  -45.445 1.00 32.76  ? 301 GLN A CD    1 
ATOM   2354  O  OE1   . GLN A  1 329 ? -35.612 -1.721  -44.657 1.00 30.39  ? 301 GLN A OE1   1 
ATOM   2355  N  NE2   . GLN A  1 329 ? -34.817 -1.861  -46.758 1.00 32.10  ? 301 GLN A NE2   1 
ATOM   2356  N  N     . ARG A  1 330 ? -31.002 -1.066  -41.318 1.00 24.93  ? 302 ARG A N     1 
ATOM   2357  C  CA    . ARG A  1 330 ? -30.314 -0.133  -40.428 1.00 27.60  ? 302 ARG A CA    1 
ATOM   2358  C  C     . ARG A  1 330 ? -28.811 -0.429  -40.454 1.00 28.11  ? 302 ARG A C     1 
ATOM   2359  O  O     . ARG A  1 330 ? -27.987 0.477   -40.531 1.00 25.37  ? 302 ARG A O     1 
ATOM   2360  C  CB    . ARG A  1 330 ? -30.851 -0.225  -38.983 1.00 22.19  ? 302 ARG A CB    1 
ATOM   2361  C  CG    . ARG A  1 330 ? -30.075 0.652   -37.997 1.00 23.44  ? 302 ARG A CG    1 
ATOM   2362  C  CD    . ARG A  1 330 ? -30.246 0.176   -36.555 1.00 26.59  ? 302 ARG A CD    1 
ATOM   2363  N  NE    . ARG A  1 330 ? -29.463 -1.038  -36.322 1.00 30.47  ? 302 ARG A NE    1 
ATOM   2364  C  CZ    . ARG A  1 330 ? -29.459 -1.753  -35.197 1.00 33.61  ? 302 ARG A CZ    1 
ATOM   2365  N  NH1   . ARG A  1 330 ? -30.186 -1.390  -34.148 1.00 22.47  ? 302 ARG A NH1   1 
ATOM   2366  N  NH2   . ARG A  1 330 ? -28.701 -2.837  -35.123 1.00 28.69  ? 302 ARG A NH2   1 
ATOM   2367  N  N     . ASN A  1 331 ? -28.462 -1.710  -40.410 1.00 24.56  ? 303 ASN A N     1 
ATOM   2368  C  CA    . ASN A  1 331 ? -27.060 -2.104  -40.385 1.00 26.40  ? 303 ASN A CA    1 
ATOM   2369  C  C     . ASN A  1 331 ? -26.352 -1.835  -41.727 1.00 25.86  ? 303 ASN A C     1 
ATOM   2370  O  O     . ASN A  1 331 ? -25.162 -1.545  -41.765 1.00 26.35  ? 303 ASN A O     1 
ATOM   2371  C  CB    . ASN A  1 331 ? -26.952 -3.585  -39.984 1.00 24.05  ? 303 ASN A CB    1 
ATOM   2372  C  CG    . ASN A  1 331 ? -27.480 -3.842  -38.580 1.00 27.95  ? 303 ASN A CG    1 
ATOM   2373  O  OD1   . ASN A  1 331 ? -27.641 -2.904  -37.773 1.00 27.13  ? 303 ASN A OD1   1 
ATOM   2374  N  ND2   . ASN A  1 331 ? -27.737 -5.108  -38.268 1.00 24.44  ? 303 ASN A ND2   1 
ATOM   2375  N  N     . ALA A  1 332 ? -27.096 -1.902  -42.821 1.00 23.24  ? 304 ALA A N     1 
ATOM   2376  C  CA    . ALA A  1 332 ? -26.530 -1.617  -44.131 1.00 24.60  ? 304 ALA A CA    1 
ATOM   2377  C  C     . ALA A  1 332 ? -26.219 -0.119  -44.253 1.00 28.59  ? 304 ALA A C     1 
ATOM   2378  O  O     . ALA A  1 332 ? -25.216 0.268   -44.845 1.00 27.32  ? 304 ALA A O     1 
ATOM   2379  C  CB    . ALA A  1 332 ? -27.478 -2.059  -45.221 1.00 27.95  ? 304 ALA A CB    1 
ATOM   2380  N  N     . ILE A  1 333 ? -27.073 0.712   -43.663 1.00 26.21  ? 305 ILE A N     1 
ATOM   2381  C  CA    . ILE A  1 333 ? -26.823 2.148   -43.618 1.00 26.01  ? 305 ILE A CA    1 
ATOM   2382  C  C     . ILE A  1 333 ? -25.515 2.392   -42.861 1.00 28.02  ? 305 ILE A C     1 
ATOM   2383  O  O     . ILE A  1 333 ? -24.643 3.113   -43.350 1.00 29.08  ? 305 ILE A O     1 
ATOM   2384  C  CB    . ILE A  1 333 ? -28.002 2.908   -42.978 1.00 26.74  ? 305 ILE A CB    1 
ATOM   2385  C  CG1   . ILE A  1 333 ? -29.212 2.838   -43.913 1.00 23.43  ? 305 ILE A CG1   1 
ATOM   2386  C  CG2   . ILE A  1 333 ? -27.630 4.402   -42.699 1.00 24.47  ? 305 ILE A CG2   1 
ATOM   2387  C  CD1   . ILE A  1 333 ? -30.484 3.400   -43.322 1.00 28.16  ? 305 ILE A CD1   1 
ATOM   2388  N  N     . LEU A  1 334 ? -25.357 1.745   -41.705 1.00 25.50  ? 306 LEU A N     1 
ATOM   2389  C  CA    . LEU A  1 334 ? -24.138 1.877   -40.901 1.00 29.34  ? 306 LEU A CA    1 
ATOM   2390  C  C     . LEU A  1 334 ? -22.905 1.334   -41.624 1.00 30.08  ? 306 LEU A C     1 
ATOM   2391  O  O     . LEU A  1 334 ? -21.817 1.896   -41.509 1.00 31.43  ? 306 LEU A O     1 
ATOM   2392  C  CB    . LEU A  1 334 ? -24.301 1.169   -39.545 1.00 30.47  ? 306 LEU A CB    1 
ATOM   2393  C  CG    . LEU A  1 334 ? -25.354 1.795   -38.629 1.00 30.04  ? 306 LEU A CG    1 
ATOM   2394  C  CD1   . LEU A  1 334 ? -25.708 0.863   -37.458 1.00 28.06  ? 306 LEU A CD1   1 
ATOM   2395  C  CD2   . LEU A  1 334 ? -24.909 3.214   -38.143 1.00 29.13  ? 306 LEU A CD2   1 
ATOM   2396  N  N     . ALA A  1 335 ? -23.076 0.237   -42.354 1.00 28.01  ? 307 ALA A N     1 
ATOM   2397  C  CA    . ALA A  1 335 ? -21.996 -0.318  -43.162 1.00 31.71  ? 307 ALA A CA    1 
ATOM   2398  C  C     . ALA A  1 335 ? -21.535 0.690   -44.227 1.00 30.51  ? 307 ALA A C     1 
ATOM   2399  O  O     . ALA A  1 335 ? -20.345 0.883   -44.426 1.00 32.37  ? 307 ALA A O     1 
ATOM   2400  C  CB    . ALA A  1 335 ? -22.432 -1.617  -43.815 1.00 23.08  ? 307 ALA A CB    1 
ATOM   2401  N  N     . LEU A  1 336 ? -22.475 1.343   -44.895 1.00 27.06  ? 308 LEU A N     1 
ATOM   2402  C  CA    . LEU A  1 336 ? -22.111 2.345   -45.891 1.00 29.56  ? 308 LEU A CA    1 
ATOM   2403  C  C     . LEU A  1 336 ? -21.411 3.565   -45.252 1.00 35.35  ? 308 LEU A C     1 
ATOM   2404  O  O     . LEU A  1 336 ? -20.472 4.113   -45.829 1.00 32.07  ? 308 LEU A O     1 
ATOM   2405  C  CB    . LEU A  1 336 ? -23.349 2.789   -46.677 1.00 31.66  ? 308 LEU A CB    1 
ATOM   2406  C  CG    . LEU A  1 336 ? -23.940 1.752   -47.640 1.00 32.78  ? 308 LEU A CG    1 
ATOM   2407  C  CD1   . LEU A  1 336 ? -25.361 2.116   -48.050 1.00 26.98  ? 308 LEU A CD1   1 
ATOM   2408  C  CD2   . LEU A  1 336 ? -23.042 1.579   -48.856 1.00 29.47  ? 308 LEU A CD2   1 
ATOM   2409  N  N     . ALA A  1 337 ? -21.856 3.980   -44.063 1.00 28.01  ? 309 ALA A N     1 
ATOM   2410  C  CA    . ALA A  1 337 ? -21.161 5.033   -43.328 1.00 32.95  ? 309 ALA A CA    1 
ATOM   2411  C  C     . ALA A  1 337 ? -19.738 4.581   -42.993 1.00 33.78  ? 309 ALA A C     1 
ATOM   2412  O  O     . ALA A  1 337 ? -18.788 5.366   -43.036 1.00 36.09  ? 309 ALA A O     1 
ATOM   2413  C  CB    . ALA A  1 337 ? -21.926 5.402   -42.054 1.00 26.60  ? 309 ALA A CB    1 
ATOM   2414  N  N     . HIS A  1 338 ? -19.618 3.305   -42.653 1.00 33.19  ? 310 HIS A N     1 
ATOM   2415  C  CA    . HIS A  1 338 ? -18.348 2.662   -42.332 1.00 37.47  ? 310 HIS A CA    1 
ATOM   2416  C  C     . HIS A  1 338 ? -17.382 2.682   -43.517 1.00 37.10  ? 310 HIS A C     1 
ATOM   2417  O  O     . HIS A  1 338 ? -16.187 2.915   -43.352 1.00 38.17  ? 310 HIS A O     1 
ATOM   2418  C  CB    . HIS A  1 338 ? -18.614 1.222   -41.876 1.00 34.70  ? 310 HIS A CB    1 
ATOM   2419  C  CG    . HIS A  1 338 ? -17.415 0.325   -41.932 1.00 40.46  ? 310 HIS A CG    1 
ATOM   2420  N  ND1   . HIS A  1 338 ? -16.409 0.363   -40.990 1.00 39.68  ? 310 HIS A ND1   1 
ATOM   2421  C  CD2   . HIS A  1 338 ? -17.068 -0.643  -42.818 1.00 40.58  ? 310 HIS A CD2   1 
ATOM   2422  C  CE1   . HIS A  1 338 ? -15.488 -0.532  -41.300 1.00 42.00  ? 310 HIS A CE1   1 
ATOM   2423  N  NE2   . HIS A  1 338 ? -15.866 -1.161  -42.401 1.00 41.92  ? 310 HIS A NE2   1 
ATOM   2424  N  N     . PHE A  1 339 ? -17.906 2.423   -44.708 1.00 33.19  ? 311 PHE A N     1 
ATOM   2425  C  CA    . PHE A  1 339 ? -17.100 2.430   -45.925 1.00 37.34  ? 311 PHE A CA    1 
ATOM   2426  C  C     . PHE A  1 339 ? -16.969 3.843   -46.490 1.00 38.76  ? 311 PHE A C     1 
ATOM   2427  O  O     . PHE A  1 339 ? -16.325 4.038   -47.519 1.00 41.11  ? 311 PHE A O     1 
ATOM   2428  C  CB    . PHE A  1 339 ? -17.715 1.527   -46.997 1.00 39.13  ? 311 PHE A CB    1 
ATOM   2429  C  CG    . PHE A  1 339 ? -17.600 0.052   -46.717 1.00 35.77  ? 311 PHE A CG    1 
ATOM   2430  C  CD1   . PHE A  1 339 ? -16.370 -0.543  -46.536 1.00 43.15  ? 311 PHE A CD1   1 
ATOM   2431  C  CD2   . PHE A  1 339 ? -18.731 -0.749  -46.699 1.00 34.80  ? 311 PHE A CD2   1 
ATOM   2432  C  CE1   . PHE A  1 339 ? -16.266 -1.914  -46.292 1.00 36.82  ? 311 PHE A CE1   1 
ATOM   2433  C  CE2   . PHE A  1 339 ? -18.635 -2.123  -46.480 1.00 36.26  ? 311 PHE A CE2   1 
ATOM   2434  C  CZ    . PHE A  1 339 ? -17.407 -2.701  -46.274 1.00 35.20  ? 311 PHE A CZ    1 
ATOM   2435  N  N     . LYS A  1 340 ? -17.610 4.803   -45.821 1.00 31.37  ? 312 LYS A N     1 
ATOM   2436  C  CA    . LYS A  1 340 ? -17.716 6.191   -46.283 1.00 37.44  ? 312 LYS A CA    1 
ATOM   2437  C  C     . LYS A  1 340 ? -18.062 6.260   -47.768 1.00 41.15  ? 312 LYS A C     1 
ATOM   2438  O  O     . LYS A  1 340 ? -17.362 6.908   -48.546 1.00 37.08  ? 312 LYS A O     1 
ATOM   2439  C  CB    . LYS A  1 340 ? -16.419 6.956   -46.012 1.00 39.71  ? 312 LYS A CB    1 
ATOM   2440  C  CG    . LYS A  1 340 ? -16.128 7.192   -44.536 1.00 46.83  ? 312 LYS A CG    1 
ATOM   2441  C  CD    . LYS A  1 340 ? -15.054 8.267   -44.349 1.00 48.70  ? 312 LYS A CD    1 
ATOM   2442  C  CE    . LYS A  1 340 ? -14.727 8.487   -42.877 1.00 54.17  ? 312 LYS A CE    1 
ATOM   2443  N  NZ    . LYS A  1 340 ? -15.843 9.133   -42.118 1.00 56.34  ? 312 LYS A NZ    1 
ATOM   2444  N  N     . ASP A  1 341 ? -19.132 5.570   -48.153 1.00 36.94  ? 313 ASP A N     1 
ATOM   2445  C  CA    . ASP A  1 341 ? -19.519 5.455   -49.557 1.00 40.81  ? 313 ASP A CA    1 
ATOM   2446  C  C     . ASP A  1 341 ? -20.300 6.705   -50.019 1.00 37.55  ? 313 ASP A C     1 
ATOM   2447  O  O     . ASP A  1 341 ? -21.523 6.818   -49.821 1.00 32.65  ? 313 ASP A O     1 
ATOM   2448  C  CB    . ASP A  1 341 ? -20.331 4.166   -49.749 1.00 32.81  ? 313 ASP A CB    1 
ATOM   2449  C  CG    . ASP A  1 341 ? -20.662 3.880   -51.196 1.00 39.66  ? 313 ASP A CG    1 
ATOM   2450  O  OD1   . ASP A  1 341 ? -20.239 4.655   -52.077 1.00 42.23  ? 313 ASP A OD1   1 
ATOM   2451  O  OD2   . ASP A  1 341 ? -21.351 2.869   -51.454 1.00 38.71  ? 313 ASP A OD2   1 
ATOM   2452  N  N     . ALA A  1 342 ? -19.589 7.654   -50.628 1.00 36.86  ? 314 ALA A N     1 
ATOM   2453  C  CA    . ALA A  1 342 ? -20.213 8.913   -51.005 1.00 33.49  ? 314 ALA A CA    1 
ATOM   2454  C  C     . ALA A  1 342 ? -21.296 8.677   -52.059 1.00 36.21  ? 314 ALA A C     1 
ATOM   2455  O  O     . ALA A  1 342 ? -22.252 9.447   -52.151 1.00 37.05  ? 314 ALA A O     1 
ATOM   2456  C  CB    . ALA A  1 342 ? -19.167 9.913   -51.508 1.00 34.58  ? 314 ALA A CB    1 
ATOM   2457  N  N     . SER A  1 343 ? -21.159 7.592   -52.819 1.00 28.88  ? 315 SER A N     1 
ATOM   2458  C  CA    . SER A  1 343 ? -22.138 7.219   -53.836 1.00 35.41  ? 315 SER A CA    1 
ATOM   2459  C  C     . SER A  1 343 ? -23.500 6.769   -53.271 1.00 32.80  ? 315 SER A C     1 
ATOM   2460  O  O     . SER A  1 343 ? -24.490 6.693   -54.009 1.00 31.32  ? 315 SER A O     1 
ATOM   2461  C  CB    . SER A  1 343 ? -21.572 6.101   -54.720 1.00 31.92  ? 315 SER A CB    1 
ATOM   2462  O  OG    . SER A  1 343 ? -21.997 4.843   -54.239 1.00 37.14  ? 315 SER A OG    1 
ATOM   2463  N  N     . ALA A  1 344 ? -23.561 6.473   -51.979 1.00 30.94  ? 316 ALA A N     1 
ATOM   2464  C  CA    . ALA A  1 344 ? -24.842 6.152   -51.344 1.00 33.04  ? 316 ALA A CA    1 
ATOM   2465  C  C     . ALA A  1 344 ? -25.576 7.395   -50.827 1.00 29.79  ? 316 ALA A C     1 
ATOM   2466  O  O     . ALA A  1 344 ? -26.749 7.305   -50.438 1.00 29.61  ? 316 ALA A O     1 
ATOM   2467  C  CB    . ALA A  1 344 ? -24.637 5.158   -50.200 1.00 33.32  ? 316 ALA A CB    1 
ATOM   2468  N  N     . LEU A  1 345 ? -24.902 8.546   -50.841 1.00 31.35  ? 317 LEU A N     1 
ATOM   2469  C  CA    . LEU A  1 345 ? -25.456 9.766   -50.231 1.00 34.10  ? 317 LEU A CA    1 
ATOM   2470  C  C     . LEU A  1 345 ? -26.811 10.214  -50.797 1.00 26.15  ? 317 LEU A C     1 
ATOM   2471  O  O     . LEU A  1 345 ? -27.660 10.630  -50.018 1.00 31.26  ? 317 LEU A O     1 
ATOM   2472  C  CB    . LEU A  1 345 ? -24.455 10.930  -50.317 1.00 30.99  ? 317 LEU A CB    1 
ATOM   2473  C  CG    . LEU A  1 345 ? -23.234 10.814  -49.408 1.00 34.76  ? 317 LEU A CG    1 
ATOM   2474  C  CD1   . LEU A  1 345 ? -22.237 11.925  -49.733 1.00 30.50  ? 317 LEU A CD1   1 
ATOM   2475  C  CD2   . LEU A  1 345 ? -23.646 10.872  -47.931 1.00 30.30  ? 317 LEU A CD2   1 
ATOM   2476  N  N     . PRO A  1 346 ? -27.025 10.130  -52.129 1.00 30.12  ? 318 PRO A N     1 
ATOM   2477  C  CA    . PRO A  1 346 ? -28.377 10.445  -52.633 1.00 29.64  ? 318 PRO A CA    1 
ATOM   2478  C  C     . PRO A  1 346 ? -29.471 9.485   -52.118 1.00 29.50  ? 318 PRO A C     1 
ATOM   2479  O  O     . PRO A  1 346 ? -30.533 9.943   -51.681 1.00 32.41  ? 318 PRO A O     1 
ATOM   2480  C  CB    . PRO A  1 346 ? -28.226 10.321  -54.164 1.00 27.62  ? 318 PRO A CB    1 
ATOM   2481  C  CG    . PRO A  1 346 ? -26.785 10.531  -54.425 1.00 30.69  ? 318 PRO A CG    1 
ATOM   2482  C  CD    . PRO A  1 346 ? -26.054 9.971   -53.236 1.00 29.59  ? 318 PRO A CD    1 
ATOM   2483  N  N     . GLU A  1 347 ? -29.242 8.180   -52.181 1.00 29.70  ? 319 GLU A N     1 
ATOM   2484  C  CA    A GLU A  1 347 ? -30.225 7.248   -51.642 0.50 29.93  ? 319 GLU A CA    1 
ATOM   2485  C  CA    B GLU A  1 347 ? -30.182 7.202   -51.634 0.50 29.94  ? 319 GLU A CA    1 
ATOM   2486  C  C     . GLU A  1 347 ? -30.430 7.468   -50.134 1.00 29.26  ? 319 GLU A C     1 
ATOM   2487  O  O     . GLU A  1 347 ? -31.566 7.446   -49.646 1.00 27.90  ? 319 GLU A O     1 
ATOM   2488  C  CB    A GLU A  1 347 ? -29.819 5.802   -51.929 0.50 29.93  ? 319 GLU A CB    1 
ATOM   2489  C  CB    B GLU A  1 347 ? -29.649 5.777   -51.865 0.50 29.89  ? 319 GLU A CB    1 
ATOM   2490  C  CG    A GLU A  1 347 ? -30.792 4.757   -51.359 0.50 33.29  ? 319 GLU A CG    1 
ATOM   2491  C  CG    B GLU A  1 347 ? -30.679 4.652   -51.665 0.50 33.32  ? 319 GLU A CG    1 
ATOM   2492  C  CD    A GLU A  1 347 ? -32.239 4.927   -51.833 0.50 35.32  ? 319 GLU A CD    1 
ATOM   2493  C  CD    B GLU A  1 347 ? -30.193 3.285   -52.162 0.50 36.83  ? 319 GLU A CD    1 
ATOM   2494  O  OE1   A GLU A  1 347 ? -32.471 5.559   -52.890 0.50 37.74  ? 319 GLU A OE1   1 
ATOM   2495  O  OE1   B GLU A  1 347 ? -28.965 3.061   -52.209 0.50 37.06  ? 319 GLU A OE1   1 
ATOM   2496  O  OE2   A GLU A  1 347 ? -33.147 4.417   -51.145 0.50 34.35  ? 319 GLU A OE2   1 
ATOM   2497  O  OE2   B GLU A  1 347 ? -31.041 2.439   -52.520 0.50 35.85  ? 319 GLU A OE2   1 
ATOM   2498  N  N     . LEU A  1 348 ? -29.358 7.735   -49.395 1.00 28.06  ? 320 LEU A N     1 
ATOM   2499  C  CA    . LEU A  1 348 ? -29.496 7.996   -47.961 1.00 25.68  ? 320 LEU A CA    1 
ATOM   2500  C  C     . LEU A  1 348 ? -30.310 9.237   -47.700 1.00 31.97  ? 320 LEU A C     1 
ATOM   2501  O  O     . LEU A  1 348 ? -31.037 9.311   -46.707 1.00 25.99  ? 320 LEU A O     1 
ATOM   2502  C  CB    . LEU A  1 348 ? -28.136 8.142   -47.291 1.00 28.92  ? 320 LEU A CB    1 
ATOM   2503  C  CG    . LEU A  1 348 ? -27.300 6.856   -47.299 1.00 30.28  ? 320 LEU A CG    1 
ATOM   2504  C  CD1   . LEU A  1 348 ? -25.935 7.127   -46.667 1.00 32.79  ? 320 LEU A CD1   1 
ATOM   2505  C  CD2   . LEU A  1 348 ? -28.041 5.749   -46.572 1.00 31.31  ? 320 LEU A CD2   1 
ATOM   2506  N  N     . THR A  1 349 ? -30.164 10.226  -48.595 1.00 28.85  ? 321 THR A N     1 
ATOM   2507  C  CA    . THR A  1 349 ? -30.874 11.484  -48.459 1.00 25.22  ? 321 THR A CA    1 
ATOM   2508  C  C     . THR A  1 349 ? -32.362 11.265  -48.678 1.00 27.06  ? 321 THR A C     1 
ATOM   2509  O  O     . THR A  1 349 ? -33.198 11.822  -47.966 1.00 28.36  ? 321 THR A O     1 
ATOM   2510  C  CB    . THR A  1 349 ? -30.341 12.526  -49.451 1.00 29.13  ? 321 THR A CB    1 
ATOM   2511  O  OG1   . THR A  1 349 ? -28.983 12.832  -49.112 1.00 27.16  ? 321 THR A OG1   1 
ATOM   2512  C  CG2   . THR A  1 349 ? -31.175 13.773  -49.384 1.00 26.55  ? 321 THR A CG2   1 
ATOM   2513  N  N     . GLU A  1 350 ? -32.685 10.431  -49.658 1.00 27.67  ? 322 GLU A N     1 
ATOM   2514  C  CA    . GLU A  1 350 ? -34.073 10.059  -49.920 1.00 28.74  ? 322 GLU A CA    1 
ATOM   2515  C  C     . GLU A  1 350 ? -34.676 9.306   -48.720 1.00 29.08  ? 322 GLU A C     1 
ATOM   2516  O  O     . GLU A  1 350 ? -35.791 9.627   -48.266 1.00 30.49  ? 322 GLU A O     1 
ATOM   2517  C  CB    . GLU A  1 350 ? -34.153 9.215   -51.198 1.00 26.23  ? 322 GLU A CB    1 
ATOM   2518  C  CG    . GLU A  1 350 ? -35.561 8.924   -51.668 1.00 27.82  ? 322 GLU A CG    1 
ATOM   2519  C  CD    . GLU A  1 350 ? -35.593 8.231   -53.017 1.00 38.25  ? 322 GLU A CD    1 
ATOM   2520  O  OE1   . GLU A  1 350 ? -35.143 8.831   -54.021 1.00 39.13  ? 322 GLU A OE1   1 
ATOM   2521  O  OE2   . GLU A  1 350 ? -36.070 7.078   -53.085 1.00 48.07  ? 322 GLU A OE2   1 
ATOM   2522  N  N     . LEU A  1 351 ? -33.940 8.326   -48.190 1.00 26.47  ? 323 LEU A N     1 
ATOM   2523  C  CA    . LEU A  1 351 ? -34.409 7.603   -46.992 1.00 31.93  ? 323 LEU A CA    1 
ATOM   2524  C  C     . LEU A  1 351 ? -34.631 8.550   -45.809 1.00 27.31  ? 323 LEU A C     1 
ATOM   2525  O  O     . LEU A  1 351 ? -35.690 8.514   -45.186 1.00 27.06  ? 323 LEU A O     1 
ATOM   2526  C  CB    . LEU A  1 351 ? -33.428 6.496   -46.580 1.00 26.19  ? 323 LEU A CB    1 
ATOM   2527  C  CG    . LEU A  1 351 ? -33.337 5.286   -47.496 1.00 29.37  ? 323 LEU A CG    1 
ATOM   2528  C  CD1   . LEU A  1 351 ? -32.089 4.510   -47.144 1.00 34.44  ? 323 LEU A CD1   1 
ATOM   2529  C  CD2   . LEU A  1 351 ? -34.586 4.399   -47.359 1.00 29.19  ? 323 LEU A CD2   1 
ATOM   2530  N  N     . MET A  1 352 ? -33.641 9.399   -45.523 1.00 23.95  ? 324 MET A N     1 
ATOM   2531  C  CA    . MET A  1 352 ? -33.776 10.401  -44.459 1.00 31.03  ? 324 MET A CA    1 
ATOM   2532  C  C     . MET A  1 352 ? -35.085 11.177  -44.580 1.00 30.69  ? 324 MET A C     1 
ATOM   2533  O  O     . MET A  1 352 ? -35.693 11.534  -43.566 1.00 31.37  ? 324 MET A O     1 
ATOM   2534  C  CB    . MET A  1 352 ? -32.595 11.379  -44.463 1.00 27.82  ? 324 MET A CB    1 
ATOM   2535  C  CG    . MET A  1 352 ? -32.843 12.659  -43.654 1.00 30.20  ? 324 MET A CG    1 
ATOM   2536  S  SD    . MET A  1 352 ? -31.382 13.711  -43.558 1.00 30.31  ? 324 MET A SD    1 
ATOM   2537  C  CE    . MET A  1 352 ? -31.386 14.454  -45.225 1.00 25.14  ? 324 MET A CE    1 
ATOM   2538  N  N     . HIS A  1 353 ? -35.526 11.415  -45.819 1.00 30.50  ? 325 HIS A N     1 
ATOM   2539  C  CA    . HIS A  1 353 ? -36.738 12.195  -46.063 1.00 30.93  ? 325 HIS A CA    1 
ATOM   2540  C  C     . HIS A  1 353 ? -38.018 11.363  -46.137 1.00 31.59  ? 325 HIS A C     1 
ATOM   2541  O  O     . HIS A  1 353 ? -39.056 11.758  -45.614 1.00 31.35  ? 325 HIS A O     1 
ATOM   2542  C  CB    . HIS A  1 353 ? -36.588 13.001  -47.359 1.00 28.93  ? 325 HIS A CB    1 
ATOM   2543  C  CG    . HIS A  1 353 ? -35.763 14.244  -47.200 1.00 30.88  ? 325 HIS A CG    1 
ATOM   2544  N  ND1   . HIS A  1 353 ? -36.149 15.291  -46.393 1.00 35.92  ? 325 HIS A ND1   1 
ATOM   2545  C  CD2   . HIS A  1 353 ? -34.582 14.610  -47.752 1.00 32.94  ? 325 HIS A CD2   1 
ATOM   2546  C  CE1   . HIS A  1 353 ? -35.231 16.241  -46.437 1.00 33.28  ? 325 HIS A CE1   1 
ATOM   2547  N  NE2   . HIS A  1 353 ? -34.272 15.855  -47.258 1.00 34.31  ? 325 HIS A NE2   1 
ATOM   2548  N  N     . LYS A  1 354 ? -37.936 10.208  -46.788 1.00 28.75  ? 326 LYS A N     1 
ATOM   2549  C  CA    . LYS A  1 354 ? -39.122 9.499   -47.223 1.00 31.09  ? 326 LYS A CA    1 
ATOM   2550  C  C     . LYS A  1 354 ? -39.437 8.212   -46.433 1.00 36.01  ? 326 LYS A C     1 
ATOM   2551  O  O     . LYS A  1 354 ? -40.599 7.845   -46.321 1.00 34.79  ? 326 LYS A O     1 
ATOM   2552  C  CB    . LYS A  1 354 ? -38.967 9.187   -48.715 1.00 37.02  ? 326 LYS A CB    1 
ATOM   2553  C  CG    . LYS A  1 354 ? -40.141 8.515   -49.406 1.00 45.25  ? 326 LYS A CG    1 
ATOM   2554  C  CD    . LYS A  1 354 ? -39.827 8.361   -50.907 1.00 51.48  ? 326 LYS A CD    1 
ATOM   2555  C  CE    . LYS A  1 354 ? -40.711 7.324   -51.582 1.00 60.49  ? 326 LYS A CE    1 
ATOM   2556  N  NZ    . LYS A  1 354 ? -42.164 7.623   -51.406 1.00 66.05  ? 326 LYS A NZ    1 
ATOM   2557  N  N     . ASP A  1 355 ? -38.433 7.529   -45.885 1.00 30.31  ? 327 ASP A N     1 
ATOM   2558  C  CA    . ASP A  1 355 ? -38.720 6.258   -45.201 1.00 28.98  ? 327 ASP A CA    1 
ATOM   2559  C  C     . ASP A  1 355 ? -39.673 6.451   -44.006 1.00 26.34  ? 327 ASP A C     1 
ATOM   2560  O  O     . ASP A  1 355 ? -39.476 7.326   -43.180 1.00 30.73  ? 327 ASP A O     1 
ATOM   2561  C  CB    . ASP A  1 355 ? -37.440 5.566   -44.728 1.00 27.42  ? 327 ASP A CB    1 
ATOM   2562  C  CG    . ASP A  1 355 ? -37.686 4.089   -44.354 1.00 33.40  ? 327 ASP A CG    1 
ATOM   2563  O  OD1   . ASP A  1 355 ? -38.193 3.815   -43.240 1.00 29.76  ? 327 ASP A OD1   1 
ATOM   2564  O  OD2   . ASP A  1 355 ? -37.408 3.208   -45.192 1.00 26.83  ? 327 ASP A OD2   1 
ATOM   2565  N  N     . PRO A  1 356 ? -40.735 5.637   -43.925 1.00 30.48  ? 328 PRO A N     1 
ATOM   2566  C  CA    . PRO A  1 356 ? -41.708 5.851   -42.848 1.00 28.38  ? 328 PRO A CA    1 
ATOM   2567  C  C     . PRO A  1 356 ? -41.199 5.463   -41.443 1.00 31.68  ? 328 PRO A C     1 
ATOM   2568  O  O     . PRO A  1 356 ? -41.894 5.739   -40.470 1.00 32.46  ? 328 PRO A O     1 
ATOM   2569  C  CB    . PRO A  1 356 ? -42.887 4.972   -43.264 1.00 32.77  ? 328 PRO A CB    1 
ATOM   2570  C  CG    . PRO A  1 356 ? -42.301 3.943   -44.196 1.00 38.75  ? 328 PRO A CG    1 
ATOM   2571  C  CD    . PRO A  1 356 ? -41.185 4.636   -44.911 1.00 31.90  ? 328 PRO A CD    1 
ATOM   2572  N  N     . ARG A  1 357 ? -40.006 4.880   -41.332 1.00 27.77  ? 329 ARG A N     1 
ATOM   2573  C  CA    . ARG A  1 357 ? -39.500 4.432   -40.032 1.00 29.21  ? 329 ARG A CA    1 
ATOM   2574  C  C     . ARG A  1 357 ? -38.457 5.405   -39.450 1.00 32.22  ? 329 ARG A C     1 
ATOM   2575  O  O     . ARG A  1 357 ? -37.428 5.641   -40.069 1.00 25.84  ? 329 ARG A O     1 
ATOM   2576  C  CB    . ARG A  1 357 ? -38.906 3.014   -40.162 1.00 27.60  ? 329 ARG A CB    1 
ATOM   2577  C  CG    . ARG A  1 357 ? -39.904 1.977   -40.678 1.00 27.25  ? 329 ARG A CG    1 
ATOM   2578  C  CD    . ARG A  1 357 ? -39.202 0.755   -41.264 1.00 33.61  ? 329 ARG A CD    1 
ATOM   2579  N  NE    . ARG A  1 357 ? -38.497 1.100   -42.503 1.00 26.95  ? 329 ARG A NE    1 
ATOM   2580  C  CZ    . ARG A  1 357 ? -37.735 0.268   -43.208 1.00 30.58  ? 329 ARG A CZ    1 
ATOM   2581  N  NH1   . ARG A  1 357 ? -37.580 -0.993  -42.807 1.00 26.46  ? 329 ARG A NH1   1 
ATOM   2582  N  NH2   . ARG A  1 357 ? -37.129 0.702   -44.322 1.00 20.50  ? 329 ARG A NH2   1 
ATOM   2583  N  N     . PRO A  1 358 ? -38.718 5.956   -38.245 1.00 31.65  ? 330 PRO A N     1 
ATOM   2584  C  CA    . PRO A  1 358 ? -37.811 6.915   -37.595 1.00 32.54  ? 330 PRO A CA    1 
ATOM   2585  C  C     . PRO A  1 358 ? -36.373 6.410   -37.476 1.00 32.41  ? 330 PRO A C     1 
ATOM   2586  O  O     . PRO A  1 358 ? -35.439 7.189   -37.642 1.00 24.61  ? 330 PRO A O     1 
ATOM   2587  C  CB    . PRO A  1 358 ? -38.430 7.102   -36.200 1.00 28.83  ? 330 PRO A CB    1 
ATOM   2588  C  CG    . PRO A  1 358 ? -39.864 6.831   -36.400 1.00 32.47  ? 330 PRO A CG    1 
ATOM   2589  C  CD    . PRO A  1 358 ? -39.939 5.740   -37.452 1.00 33.03  ? 330 PRO A CD    1 
ATOM   2590  N  N     . VAL A  1 359 ? -36.202 5.118   -37.205 1.00 31.80  ? 331 VAL A N     1 
ATOM   2591  C  CA    . VAL A  1 359 ? -34.873 4.533   -37.075 1.00 25.59  ? 331 VAL A CA    1 
ATOM   2592  C  C     . VAL A  1 359 ? -34.090 4.587   -38.393 1.00 26.57  ? 331 VAL A C     1 
ATOM   2593  O  O     . VAL A  1 359 ? -32.876 4.787   -38.414 1.00 28.26  ? 331 VAL A O     1 
ATOM   2594  C  CB    . VAL A  1 359 ? -34.977 3.051   -36.575 1.00 28.33  ? 331 VAL A CB    1 
ATOM   2595  C  CG1   . VAL A  1 359 ? -33.691 2.329   -36.785 1.00 24.39  ? 331 VAL A CG1   1 
ATOM   2596  C  CG2   . VAL A  1 359 ? -35.326 3.033   -35.103 1.00 32.06  ? 331 VAL A CG2   1 
ATOM   2597  N  N     . ILE A  1 360 ? -34.788 4.397   -39.499 1.00 22.91  ? 332 ILE A N     1 
ATOM   2598  C  CA    . ILE A  1 360 ? -34.147 4.431   -40.805 1.00 27.09  ? 332 ILE A CA    1 
ATOM   2599  C  C     . ILE A  1 360 ? -33.824 5.896   -41.231 1.00 28.41  ? 332 ILE A C     1 
ATOM   2600  O  O     . ILE A  1 360 ? -32.682 6.197   -41.591 1.00 25.70  ? 332 ILE A O     1 
ATOM   2601  C  CB    . ILE A  1 360 ? -35.037 3.692   -41.830 1.00 27.38  ? 332 ILE A CB    1 
ATOM   2602  C  CG1   . ILE A  1 360 ? -35.211 2.256   -41.361 1.00 23.33  ? 332 ILE A CG1   1 
ATOM   2603  C  CG2   . ILE A  1 360 ? -34.410 3.666   -43.207 1.00 25.20  ? 332 ILE A CG2   1 
ATOM   2604  C  CD1   . ILE A  1 360 ? -33.897 1.468   -41.355 1.00 22.00  ? 332 ILE A CD1   1 
ATOM   2605  N  N     . ARG A  1 361 ? -34.795 6.804   -41.136 1.00 27.36  ? 333 ARG A N     1 
ATOM   2606  C  CA    . ARG A  1 361 ? -34.539 8.232   -41.419 1.00 30.90  ? 333 ARG A CA    1 
ATOM   2607  C  C     . ARG A  1 361 ? -33.382 8.770   -40.567 1.00 28.98  ? 333 ARG A C     1 
ATOM   2608  O  O     . ARG A  1 361 ? -32.459 9.412   -41.079 1.00 27.14  ? 333 ARG A O     1 
ATOM   2609  C  CB    . ARG A  1 361 ? -35.788 9.085   -41.172 1.00 27.26  ? 333 ARG A CB    1 
ATOM   2610  C  CG    . ARG A  1 361 ? -36.989 8.703   -42.005 1.00 30.44  ? 333 ARG A CG    1 
ATOM   2611  C  CD    . ARG A  1 361 ? -38.028 9.831   -42.099 1.00 27.91  ? 333 ARG A CD    1 
ATOM   2612  N  NE    . ARG A  1 361 ? -38.516 10.310  -40.810 1.00 27.13  ? 333 ARG A NE    1 
ATOM   2613  C  CZ    . ARG A  1 361 ? -39.403 9.675   -40.048 1.00 36.41  ? 333 ARG A CZ    1 
ATOM   2614  N  NH1   . ARG A  1 361 ? -39.911 8.504   -40.429 1.00 28.17  ? 333 ARG A NH1   1 
ATOM   2615  N  NH2   . ARG A  1 361 ? -39.777 10.215  -38.895 1.00 28.52  ? 333 ARG A NH2   1 
ATOM   2616  N  N     . GLY A  1 362 ? -33.426 8.478   -39.271 1.00 27.12  ? 334 GLY A N     1 
ATOM   2617  C  CA    . GLY A  1 362 ? -32.401 8.925   -38.346 1.00 26.25  ? 334 GLY A CA    1 
ATOM   2618  C  C     . GLY A  1 362 ? -31.012 8.360   -38.588 1.00 26.39  ? 334 GLY A C     1 
ATOM   2619  O  O     . GLY A  1 362 ? -30.025 9.099   -38.578 1.00 30.23  ? 334 GLY A O     1 
ATOM   2620  N  N     . THR A  1 363 ? -30.922 7.051   -38.793 1.00 22.54  ? 335 THR A N     1 
ATOM   2621  C  CA    . THR A  1 363 ? -29.628 6.408   -39.031 1.00 26.20  ? 335 THR A CA    1 
ATOM   2622  C  C     . THR A  1 363 ? -29.036 6.861   -40.385 1.00 26.75  ? 335 THR A C     1 
ATOM   2623  O  O     . THR A  1 363 ? -27.818 7.075   -40.529 1.00 23.72  ? 335 THR A O     1 
ATOM   2624  C  CB    . THR A  1 363 ? -29.787 4.868   -38.959 1.00 23.80  ? 335 THR A CB    1 
ATOM   2625  O  OG1   . THR A  1 363 ? -30.353 4.542   -37.679 1.00 27.28  ? 335 THR A OG1   1 
ATOM   2626  C  CG2   . THR A  1 363 ? -28.443 4.151   -39.109 1.00 23.01  ? 335 THR A CG2   1 
ATOM   2627  N  N     . ALA A  1 364 ? -29.912 7.061   -41.357 1.00 21.22  ? 336 ALA A N     1 
ATOM   2628  C  CA    . ALA A  1 364 ? -29.500 7.633   -42.644 1.00 27.14  ? 336 ALA A CA    1 
ATOM   2629  C  C     . ALA A  1 364 ? -28.917 9.063   -42.493 1.00 27.12  ? 336 ALA A C     1 
ATOM   2630  O  O     . ALA A  1 364 ? -27.905 9.415   -43.125 1.00 29.73  ? 336 ALA A O     1 
ATOM   2631  C  CB    . ALA A  1 364 ? -30.686 7.633   -43.618 1.00 28.91  ? 336 ALA A CB    1 
ATOM   2632  N  N     . ALA A  1 365 ? -29.536 9.882   -41.654 1.00 24.44  ? 337 ALA A N     1 
ATOM   2633  C  CA    . ALA A  1 365 ? -29.041 11.243  -41.449 1.00 26.25  ? 337 ALA A CA    1 
ATOM   2634  C  C     . ALA A  1 365 ? -27.658 11.235  -40.802 1.00 29.29  ? 337 ALA A C     1 
ATOM   2635  O  O     . ALA A  1 365 ? -26.759 11.980  -41.213 1.00 31.57  ? 337 ALA A O     1 
ATOM   2636  C  CB    . ALA A  1 365 ? -30.027 12.053  -40.604 1.00 25.24  ? 337 ALA A CB    1 
ATOM   2637  N  N     . TRP A  1 366 ? -27.504 10.400  -39.778 1.00 24.93  ? 338 TRP A N     1 
ATOM   2638  C  CA    . TRP A  1 366 ? -26.230 10.199  -39.115 1.00 26.08  ? 338 TRP A CA    1 
ATOM   2639  C  C     . TRP A  1 366 ? -25.149 9.743   -40.110 1.00 30.51  ? 338 TRP A C     1 
ATOM   2640  O  O     . TRP A  1 366 ? -24.038 10.299  -40.129 1.00 33.02  ? 338 TRP A O     1 
ATOM   2641  C  CB    . TRP A  1 366 ? -26.398 9.162   -37.970 1.00 26.68  ? 338 TRP A CB    1 
ATOM   2642  C  CG    . TRP A  1 366 ? -25.148 8.942   -37.191 1.00 25.84  ? 338 TRP A CG    1 
ATOM   2643  C  CD1   . TRP A  1 366 ? -24.725 9.661   -36.105 1.00 28.40  ? 338 TRP A CD1   1 
ATOM   2644  C  CD2   . TRP A  1 366 ? -24.131 7.958   -37.445 1.00 27.44  ? 338 TRP A CD2   1 
ATOM   2645  N  NE1   . TRP A  1 366 ? -23.519 9.174   -35.660 1.00 29.41  ? 338 TRP A NE1   1 
ATOM   2646  C  CE2   . TRP A  1 366 ? -23.133 8.126   -36.460 1.00 31.43  ? 338 TRP A CE2   1 
ATOM   2647  C  CE3   . TRP A  1 366 ? -23.985 6.928   -38.385 1.00 30.44  ? 338 TRP A CE3   1 
ATOM   2648  C  CZ2   . TRP A  1 366 ? -21.993 7.313   -36.399 1.00 26.13  ? 338 TRP A CZ2   1 
ATOM   2649  C  CZ3   . TRP A  1 366 ? -22.849 6.120   -38.322 1.00 28.91  ? 338 TRP A CZ3   1 
ATOM   2650  C  CH2   . TRP A  1 366 ? -21.866 6.324   -37.338 1.00 26.30  ? 338 TRP A CH2   1 
ATOM   2651  N  N     . ALA A  1 367 ? -25.478 8.727   -40.922 1.00 31.55  ? 339 ALA A N     1 
ATOM   2652  C  CA    . ALA A  1 367 ? -24.578 8.213   -41.970 1.00 32.25  ? 339 ALA A CA    1 
ATOM   2653  C  C     . ALA A  1 367 ? -24.122 9.300   -42.946 1.00 31.01  ? 339 ALA A C     1 
ATOM   2654  O  O     . ALA A  1 367 ? -22.944 9.381   -43.287 1.00 33.07  ? 339 ALA A O     1 
ATOM   2655  C  CB    . ALA A  1 367 ? -25.253 7.101   -42.757 1.00 23.44  ? 339 ALA A CB    1 
ATOM   2656  N  N     . ILE A  1 368 ? -25.069 10.085  -43.438 1.00 27.09  ? 340 ILE A N     1 
ATOM   2657  C  CA    . ILE A  1 368 ? -24.737 11.227  -44.319 1.00 32.06  ? 340 ILE A CA    1 
ATOM   2658  C  C     . ILE A  1 368 ? -23.669 12.142  -43.669 1.00 34.49  ? 340 ILE A C     1 
ATOM   2659  O  O     . ILE A  1 368 ? -22.677 12.504  -44.307 1.00 31.82  ? 340 ILE A O     1 
ATOM   2660  C  CB    . ILE A  1 368 ? -26.005 12.047  -44.666 1.00 30.00  ? 340 ILE A CB    1 
ATOM   2661  C  CG1   . ILE A  1 368 ? -26.910 11.227  -45.595 1.00 27.55  ? 340 ILE A CG1   1 
ATOM   2662  C  CG2   . ILE A  1 368 ? -25.644 13.416  -45.330 1.00 33.33  ? 340 ILE A CG2   1 
ATOM   2663  C  CD1   . ILE A  1 368 ? -28.320 11.776  -45.714 1.00 22.59  ? 340 ILE A CD1   1 
ATOM   2664  N  N     . GLY A  1 369 ? -23.857 12.481  -42.393 1.00 31.79  ? 341 GLY A N     1 
ATOM   2665  C  CA    . GLY A  1 369 ? -22.864 13.262  -41.670 1.00 26.56  ? 341 GLY A CA    1 
ATOM   2666  C  C     . GLY A  1 369 ? -21.550 12.520  -41.502 1.00 33.94  ? 341 GLY A C     1 
ATOM   2667  O  O     . GLY A  1 369 ? -20.481 13.107  -41.620 1.00 32.33  ? 341 GLY A O     1 
ATOM   2668  N  N     . LYS A  1 370 ? -21.639 11.217  -41.227 1.00 34.95  ? 342 LYS A N     1 
ATOM   2669  C  CA    . LYS A  1 370 ? -20.469 10.376  -40.985 1.00 33.67  ? 342 LYS A CA    1 
ATOM   2670  C  C     . LYS A  1 370 ? -19.587 10.160  -42.217 1.00 37.58  ? 342 LYS A C     1 
ATOM   2671  O  O     . LYS A  1 370 ? -18.366 10.004  -42.097 1.00 36.12  ? 342 LYS A O     1 
ATOM   2672  C  CB    . LYS A  1 370 ? -20.918 9.016   -40.450 1.00 37.12  ? 342 LYS A CB    1 
ATOM   2673  C  CG    . LYS A  1 370 ? -19.789 8.085   -40.104 1.00 37.06  ? 342 LYS A CG    1 
ATOM   2674  C  CD    . LYS A  1 370 ? -19.032 8.590   -38.904 1.00 32.91  ? 342 LYS A CD    1 
ATOM   2675  C  CE    . LYS A  1 370 ? -17.818 7.727   -38.641 1.00 37.01  ? 342 LYS A CE    1 
ATOM   2676  N  NZ    . LYS A  1 370 ? -17.211 8.105   -37.362 1.00 38.26  ? 342 LYS A NZ    1 
ATOM   2677  N  N     . ILE A  1 371 ? -20.210 10.133  -43.393 1.00 32.58  ? 343 ILE A N     1 
ATOM   2678  C  CA    . ILE A  1 371 ? -19.490 9.869   -44.633 1.00 37.94  ? 343 ILE A CA    1 
ATOM   2679  C  C     . ILE A  1 371 ? -18.626 11.091  -44.972 1.00 37.02  ? 343 ILE A C     1 
ATOM   2680  O  O     . ILE A  1 371 ? -17.567 10.969  -45.583 1.00 37.59  ? 343 ILE A O     1 
ATOM   2681  C  CB    . ILE A  1 371 ? -20.463 9.504   -45.768 1.00 33.60  ? 343 ILE A CB    1 
ATOM   2682  C  CG1   . ILE A  1 371 ? -20.940 8.052   -45.583 1.00 35.81  ? 343 ILE A CG1   1 
ATOM   2683  C  CG2   . ILE A  1 371 ? -19.793 9.628   -47.139 1.00 33.27  ? 343 ILE A CG2   1 
ATOM   2684  C  CD1   . ILE A  1 371 ? -22.354 7.782   -46.076 1.00 27.23  ? 343 ILE A CD1   1 
ATOM   2685  N  N     . GLY A  1 372 ? -19.074 12.258  -44.530 1.00 36.99  ? 344 GLY A N     1 
ATOM   2686  C  CA    . GLY A  1 372 ? -18.221 13.424  -44.470 1.00 39.49  ? 344 GLY A CA    1 
ATOM   2687  C  C     . GLY A  1 372 ? -18.107 14.210  -45.757 1.00 43.00  ? 344 GLY A C     1 
ATOM   2688  O  O     . GLY A  1 372 ? -17.045 14.747  -46.047 1.00 43.64  ? 344 GLY A O     1 
ATOM   2689  N  N     . ASP A  1 373 ? -19.187 14.266  -46.534 1.00 44.13  ? 345 ASP A N     1 
ATOM   2690  C  CA    . ASP A  1 373 ? -19.221 15.098  -47.733 1.00 41.78  ? 345 ASP A CA    1 
ATOM   2691  C  C     . ASP A  1 373 ? -19.967 16.384  -47.423 1.00 43.09  ? 345 ASP A C     1 
ATOM   2692  O  O     . ASP A  1 373 ? -21.199 16.387  -47.309 1.00 38.95  ? 345 ASP A O     1 
ATOM   2693  C  CB    . ASP A  1 373 ? -19.879 14.354  -48.893 1.00 40.41  ? 345 ASP A CB    1 
ATOM   2694  C  CG    . ASP A  1 373 ? -19.738 15.083  -50.217 1.00 43.29  ? 345 ASP A CG    1 
ATOM   2695  O  OD1   . ASP A  1 373 ? -19.698 14.404  -51.256 1.00 55.84  ? 345 ASP A OD1   1 
ATOM   2696  O  OD2   . ASP A  1 373 ? -19.667 16.323  -50.231 1.00 46.55  ? 345 ASP A OD2   1 
ATOM   2697  N  N     . PRO A  1 374 ? -19.218 17.495  -47.313 1.00 46.14  ? 346 PRO A N     1 
ATOM   2698  C  CA    . PRO A  1 374 ? -19.727 18.790  -46.840 1.00 45.12  ? 346 PRO A CA    1 
ATOM   2699  C  C     . PRO A  1 374 ? -20.881 19.307  -47.690 1.00 45.23  ? 346 PRO A C     1 
ATOM   2700  O  O     . PRO A  1 374 ? -21.647 20.159  -47.238 1.00 45.77  ? 346 PRO A O     1 
ATOM   2701  C  CB    . PRO A  1 374 ? -18.513 19.723  -46.963 1.00 47.02  ? 346 PRO A CB    1 
ATOM   2702  C  CG    . PRO A  1 374 ? -17.333 18.840  -47.118 1.00 49.96  ? 346 PRO A CG    1 
ATOM   2703  C  CD    . PRO A  1 374 ? -17.807 17.568  -47.732 1.00 43.86  ? 346 PRO A CD    1 
ATOM   2704  N  N     . ALA A  1 375 ? -20.999 18.789  -48.908 1.00 43.54  ? 347 ALA A N     1 
ATOM   2705  C  CA    . ALA A  1 375 ? -22.052 19.216  -49.828 1.00 46.03  ? 347 ALA A CA    1 
ATOM   2706  C  C     . ALA A  1 375 ? -23.450 18.868  -49.311 1.00 43.23  ? 347 ALA A C     1 
ATOM   2707  O  O     . ALA A  1 375 ? -24.439 19.445  -49.768 1.00 41.02  ? 347 ALA A O     1 
ATOM   2708  C  CB    . ALA A  1 375 ? -21.829 18.593  -51.212 1.00 42.77  ? 347 ALA A CB    1 
ATOM   2709  N  N     . TYR A  1 376 ? -23.527 17.923  -48.371 1.00 40.99  ? 348 TYR A N     1 
ATOM   2710  C  CA    . TYR A  1 376 ? -24.814 17.474  -47.838 1.00 39.55  ? 348 TYR A CA    1 
ATOM   2711  C  C     . TYR A  1 376 ? -25.191 18.173  -46.531 1.00 36.68  ? 348 TYR A C     1 
ATOM   2712  O  O     . TYR A  1 376 ? -26.310 17.999  -46.043 1.00 35.56  ? 348 TYR A O     1 
ATOM   2713  C  CB    . TYR A  1 376 ? -24.816 15.936  -47.672 1.00 35.43  ? 348 TYR A CB    1 
ATOM   2714  C  CG    . TYR A  1 376 ? -25.019 15.283  -49.023 1.00 32.77  ? 348 TYR A CG    1 
ATOM   2715  C  CD1   . TYR A  1 376 ? -26.290 14.939  -49.467 1.00 25.15  ? 348 TYR A CD1   1 
ATOM   2716  C  CD2   . TYR A  1 376 ? -23.949 15.112  -49.895 1.00 31.33  ? 348 TYR A CD2   1 
ATOM   2717  C  CE1   . TYR A  1 376 ? -26.486 14.399  -50.735 1.00 26.71  ? 348 TYR A CE1   1 
ATOM   2718  C  CE2   . TYR A  1 376 ? -24.132 14.581  -51.159 1.00 33.47  ? 348 TYR A CE2   1 
ATOM   2719  C  CZ    . TYR A  1 376 ? -25.399 14.230  -51.579 1.00 31.00  ? 348 TYR A CZ    1 
ATOM   2720  O  OH    . TYR A  1 376 ? -25.565 13.689  -52.836 1.00 33.27  ? 348 TYR A OH    1 
ATOM   2721  N  N     . ALA A  1 377 ? -24.277 18.989  -45.998 1.00 35.26  ? 349 ALA A N     1 
ATOM   2722  C  CA    . ALA A  1 377 ? -24.519 19.720  -44.747 1.00 37.19  ? 349 ALA A CA    1 
ATOM   2723  C  C     . ALA A  1 377 ? -25.803 20.534  -44.827 1.00 39.23  ? 349 ALA A C     1 
ATOM   2724  O  O     . ALA A  1 377 ? -26.626 20.498  -43.919 1.00 35.68  ? 349 ALA A O     1 
ATOM   2725  C  CB    . ALA A  1 377 ? -23.334 20.630  -44.414 1.00 38.60  ? 349 ALA A CB    1 
ATOM   2726  N  N     . GLU A  1 378 ? -25.969 21.255  -45.930 1.00 37.31  ? 350 GLU A N     1 
ATOM   2727  C  CA    . GLU A  1 378 ? -27.160 22.062  -46.142 1.00 38.64  ? 350 GLU A CA    1 
ATOM   2728  C  C     . GLU A  1 378 ? -28.444 21.241  -46.079 1.00 36.79  ? 350 GLU A C     1 
ATOM   2729  O  O     . GLU A  1 378 ? -29.397 21.645  -45.425 1.00 39.45  ? 350 GLU A O     1 
ATOM   2730  C  CB    . GLU A  1 378 ? -27.081 22.784  -47.486 1.00 39.62  ? 350 GLU A CB    1 
ATOM   2731  C  CG    . GLU A  1 378 ? -26.570 24.203  -47.417 1.00 47.68  ? 350 GLU A CG    1 
ATOM   2732  C  CD    . GLU A  1 378 ? -27.671 25.204  -47.105 1.00 62.04  ? 350 GLU A CD    1 
ATOM   2733  O  OE1   . GLU A  1 378 ? -28.128 25.888  -48.056 1.00 63.40  ? 350 GLU A OE1   1 
ATOM   2734  O  OE2   . GLU A  1 378 ? -28.073 25.309  -45.916 1.00 55.53  ? 350 GLU A OE2   1 
ATOM   2735  N  N     . GLU A  1 379 ? -28.486 20.105  -46.775 1.00 33.63  ? 351 GLU A N     1 
ATOM   2736  C  CA    . GLU A  1 379 ? -29.706 19.303  -46.798 1.00 36.34  ? 351 GLU A CA    1 
ATOM   2737  C  C     . GLU A  1 379 ? -30.035 18.676  -45.436 1.00 33.47  ? 351 GLU A C     1 
ATOM   2738  O  O     . GLU A  1 379 ? -31.210 18.427  -45.134 1.00 28.70  ? 351 GLU A O     1 
ATOM   2739  C  CB    . GLU A  1 379 ? -29.610 18.195  -47.862 1.00 35.91  ? 351 GLU A CB    1 
ATOM   2740  C  CG    . GLU A  1 379 ? -30.933 17.477  -48.129 1.00 31.86  ? 351 GLU A CG    1 
ATOM   2741  C  CD    . GLU A  1 379 ? -32.047 18.398  -48.631 1.00 35.75  ? 351 GLU A CD    1 
ATOM   2742  O  OE1   . GLU A  1 379 ? -31.781 19.578  -48.982 1.00 39.06  ? 351 GLU A OE1   1 
ATOM   2743  O  OE2   . GLU A  1 379 ? -33.206 17.930  -48.700 1.00 33.51  ? 351 GLU A OE2   1 
ATOM   2744  N  N     . LEU A  1 380 ? -29.008 18.411  -44.631 1.00 28.90  ? 352 LEU A N     1 
ATOM   2745  C  CA    . LEU A  1 380 ? -29.239 17.978  -43.248 1.00 33.39  ? 352 LEU A CA    1 
ATOM   2746  C  C     . LEU A  1 380 ? -29.922 19.114  -42.466 1.00 32.48  ? 352 LEU A C     1 
ATOM   2747  O  O     . LEU A  1 380 ? -30.887 18.883  -41.727 1.00 29.82  ? 352 LEU A O     1 
ATOM   2748  C  CB    . LEU A  1 380 ? -27.924 17.560  -42.568 1.00 33.63  ? 352 LEU A CB    1 
ATOM   2749  C  CG    . LEU A  1 380 ? -27.277 16.225  -42.986 1.00 36.29  ? 352 LEU A CG    1 
ATOM   2750  C  CD1   . LEU A  1 380 ? -25.917 16.028  -42.309 1.00 30.96  ? 352 LEU A CD1   1 
ATOM   2751  C  CD2   . LEU A  1 380 ? -28.180 15.040  -42.676 1.00 31.38  ? 352 LEU A CD2   1 
ATOM   2752  N  N     . GLU A  1 381 ? -29.438 20.344  -42.665 1.00 29.13  ? 353 GLU A N     1 
ATOM   2753  C  CA    . GLU A  1 381 ? -29.993 21.520  -41.976 1.00 34.75  ? 353 GLU A CA    1 
ATOM   2754  C  C     . GLU A  1 381 ? -31.453 21.670  -42.342 1.00 31.08  ? 353 GLU A C     1 
ATOM   2755  O  O     . GLU A  1 381 ? -32.283 21.992  -41.508 1.00 28.29  ? 353 GLU A O     1 
ATOM   2756  C  CB    . GLU A  1 381 ? -29.247 22.821  -42.334 1.00 37.77  ? 353 GLU A CB    1 
ATOM   2757  C  CG    . GLU A  1 381 ? -27.725 22.779  -42.270 1.00 44.73  ? 353 GLU A CG    1 
ATOM   2758  C  CD    . GLU A  1 381 ? -27.152 22.945  -40.872 1.00 53.95  ? 353 GLU A CD    1 
ATOM   2759  O  OE1   . GLU A  1 381 ? -27.923 22.892  -39.884 1.00 56.35  ? 353 GLU A OE1   1 
ATOM   2760  O  OE2   . GLU A  1 381 ? -25.915 23.138  -40.769 1.00 55.64  ? 353 GLU A OE2   1 
ATOM   2761  N  N     . LYS A  1 382 ? -31.756 21.411  -43.610 1.00 35.74  ? 354 LYS A N     1 
ATOM   2762  C  CA    . LYS A  1 382 ? -33.109 21.565  -44.115 1.00 32.83  ? 354 LYS A CA    1 
ATOM   2763  C  C     . LYS A  1 382 ? -34.035 20.450  -43.635 1.00 30.64  ? 354 LYS A C     1 
ATOM   2764  O  O     . LYS A  1 382 ? -35.215 20.703  -43.354 1.00 28.36  ? 354 LYS A O     1 
ATOM   2765  C  CB    . LYS A  1 382 ? -33.093 21.638  -45.646 1.00 35.01  ? 354 LYS A CB    1 
ATOM   2766  C  CG    . LYS A  1 382 ? -32.597 22.988  -46.185 1.00 30.71  ? 354 LYS A CG    1 
ATOM   2767  C  CD    . LYS A  1 382 ? -32.710 23.037  -47.685 1.00 33.55  ? 354 LYS A CD    1 
ATOM   2768  C  CE    . LYS A  1 382 ? -32.023 24.276  -48.246 1.00 36.45  ? 354 LYS A CE    1 
ATOM   2769  N  NZ    . LYS A  1 382 ? -32.654 25.522  -47.748 1.00 33.80  ? 354 LYS A NZ    1 
ATOM   2770  N  N     . ALA A  1 383 ? -33.511 19.220  -43.557 1.00 32.39  ? 355 ALA A N     1 
ATOM   2771  C  CA    . ALA A  1 383 ? -34.281 18.082  -43.047 1.00 29.52  ? 355 ALA A CA    1 
ATOM   2772  C  C     . ALA A  1 383 ? -34.596 18.248  -41.553 1.00 30.76  ? 355 ALA A C     1 
ATOM   2773  O  O     . ALA A  1 383 ? -35.689 17.908  -41.096 1.00 34.93  ? 355 ALA A O     1 
ATOM   2774  C  CB    . ALA A  1 383 ? -33.519 16.765  -43.292 1.00 31.16  ? 355 ALA A CB    1 
ATOM   2775  N  N     . LEU A  1 384 ? -33.636 18.776  -40.796 1.00 30.33  ? 356 LEU A N     1 
ATOM   2776  C  CA    . LEU A  1 384 ? -33.858 19.069  -39.377 1.00 33.11  ? 356 LEU A CA    1 
ATOM   2777  C  C     . LEU A  1 384 ? -35.099 19.920  -39.131 1.00 40.48  ? 356 LEU A C     1 
ATOM   2778  O  O     . LEU A  1 384 ? -35.807 19.716  -38.140 1.00 36.46  ? 356 LEU A O     1 
ATOM   2779  C  CB    . LEU A  1 384 ? -32.654 19.789  -38.769 1.00 35.00  ? 356 LEU A CB    1 
ATOM   2780  C  CG    . LEU A  1 384 ? -32.810 20.067  -37.270 1.00 39.80  ? 356 LEU A CG    1 
ATOM   2781  C  CD1   . LEU A  1 384 ? -32.942 18.742  -36.477 1.00 36.19  ? 356 LEU A CD1   1 
ATOM   2782  C  CD2   . LEU A  1 384 ? -31.660 20.911  -36.748 1.00 38.94  ? 356 LEU A CD2   1 
ATOM   2783  N  N     . GLU A  1 385 ? -35.364 20.884  -40.022 1.00 31.55  ? 357 GLU A N     1 
ATOM   2784  C  CA    . GLU A  1 385 ? -36.508 21.769  -39.812 1.00 35.16  ? 357 GLU A CA    1 
ATOM   2785  C  C     . GLU A  1 385 ? -37.800 21.117  -40.263 1.00 36.37  ? 357 GLU A C     1 
ATOM   2786  O  O     . GLU A  1 385 ? -38.876 21.666  -40.032 1.00 39.43  ? 357 GLU A O     1 
ATOM   2787  C  CB    . GLU A  1 385 ? -36.325 23.120  -40.541 1.00 31.51  ? 357 GLU A CB    1 
ATOM   2788  C  CG    . GLU A  1 385 ? -35.122 23.912  -40.049 1.00 37.26  ? 357 GLU A CG    1 
ATOM   2789  C  CD    . GLU A  1 385 ? -35.068 23.998  -38.518 1.00 44.12  ? 357 GLU A CD    1 
ATOM   2790  O  OE1   . GLU A  1 385 ? -36.139 24.170  -37.894 1.00 44.54  ? 357 GLU A OE1   1 
ATOM   2791  O  OE2   . GLU A  1 385 ? -33.961 23.890  -37.941 1.00 42.74  ? 357 GLU A OE2   1 
ATOM   2792  N  N     . LYS A  1 386 ? -37.705 19.952  -40.904 1.00 33.56  ? 358 LYS A N     1 
ATOM   2793  C  CA    . LYS A  1 386 ? -38.900 19.313  -41.458 1.00 37.48  ? 358 LYS A CA    1 
ATOM   2794  C  C     . LYS A  1 386 ? -39.275 18.039  -40.697 1.00 38.49  ? 358 LYS A C     1 
ATOM   2795  O  O     . LYS A  1 386 ? -40.446 17.646  -40.661 1.00 43.69  ? 358 LYS A O     1 
ATOM   2796  C  CB    . LYS A  1 386 ? -38.703 19.011  -42.953 1.00 33.72  ? 358 LYS A CB    1 
ATOM   2797  C  CG    . LYS A  1 386 ? -38.649 20.259  -43.849 1.00 36.45  ? 358 LYS A CG    1 
ATOM   2798  C  CD    . LYS A  1 386 ? -38.288 19.901  -45.299 1.00 38.11  ? 358 LYS A CD    1 
ATOM   2799  C  CE    . LYS A  1 386 ? -39.506 19.897  -46.211 1.00 34.08  ? 358 LYS A CE    1 
ATOM   2800  N  NZ    . LYS A  1 386 ? -39.133 19.573  -47.649 1.00 38.37  ? 358 LYS A NZ    1 
ATOM   2801  N  N     . GLU A  1 387 ? -38.277 17.406  -40.090 1.00 36.04  ? 359 GLU A N     1 
ATOM   2802  C  CA    . GLU A  1 387 ? -38.474 16.181  -39.307 1.00 41.19  ? 359 GLU A CA    1 
ATOM   2803  C  C     . GLU A  1 387 ? -39.297 16.405  -38.031 1.00 39.89  ? 359 GLU A C     1 
ATOM   2804  O  O     . GLU A  1 387 ? -38.972 17.274  -37.229 1.00 42.12  ? 359 GLU A O     1 
ATOM   2805  C  CB    . GLU A  1 387 ? -37.112 15.573  -38.937 1.00 36.61  ? 359 GLU A CB    1 
ATOM   2806  C  CG    . GLU A  1 387 ? -37.206 14.286  -38.110 1.00 35.57  ? 359 GLU A CG    1 
ATOM   2807  C  CD    . GLU A  1 387 ? -38.020 13.212  -38.817 1.00 37.66  ? 359 GLU A CD    1 
ATOM   2808  O  OE1   . GLU A  1 387 ? -37.659 12.866  -39.970 1.00 32.15  ? 359 GLU A OE1   1 
ATOM   2809  O  OE2   . GLU A  1 387 ? -39.025 12.731  -38.235 1.00 36.65  ? 359 GLU A OE2   1 
ATOM   2810  N  N     . LYS A  1 388 ? -40.338 15.595  -37.831 1.00 40.32  ? 360 LYS A N     1 
ATOM   2811  C  CA    . LYS A  1 388 ? -41.219 15.738  -36.664 1.00 42.23  ? 360 LYS A CA    1 
ATOM   2812  C  C     . LYS A  1 388 ? -40.846 14.795  -35.517 1.00 41.59  ? 360 LYS A C     1 
ATOM   2813  O  O     . LYS A  1 388 ? -41.080 15.105  -34.349 1.00 42.96  ? 360 LYS A O     1 
ATOM   2814  C  CB    . LYS A  1 388 ? -42.680 15.487  -37.057 1.00 45.64  ? 360 LYS A CB    1 
ATOM   2815  C  CG    . LYS A  1 388 ? -43.180 16.362  -38.209 1.00 52.80  ? 360 LYS A CG    1 
ATOM   2816  C  CD    . LYS A  1 388 ? -43.124 17.837  -37.847 1.00 48.83  ? 360 LYS A CD    1 
ATOM   2817  C  CE    . LYS A  1 388 ? -43.680 18.702  -38.979 1.00 58.33  ? 360 LYS A CE    1 
ATOM   2818  N  NZ    . LYS A  1 388 ? -43.511 20.155  -38.688 1.00 61.40  ? 360 LYS A NZ    1 
ATOM   2819  N  N     . ASP A  1 389 ? -40.289 13.636  -35.849 1.00 39.45  ? 361 ASP A N     1 
ATOM   2820  C  CA    . ASP A  1 389 ? -39.892 12.669  -34.825 1.00 36.92  ? 361 ASP A CA    1 
ATOM   2821  C  C     . ASP A  1 389 ? -38.678 13.175  -34.052 1.00 35.97  ? 361 ASP A C     1 
ATOM   2822  O  O     . ASP A  1 389 ? -37.676 13.590  -34.658 1.00 35.68  ? 361 ASP A O     1 
ATOM   2823  C  CB    . ASP A  1 389 ? -39.574 11.305  -35.444 1.00 31.90  ? 361 ASP A CB    1 
ATOM   2824  C  CG    . ASP A  1 389 ? -39.158 10.288  -34.390 1.00 32.47  ? 361 ASP A CG    1 
ATOM   2825  O  OD1   . ASP A  1 389 ? -40.044 9.635   -33.818 1.00 34.91  ? 361 ASP A OD1   1 
ATOM   2826  O  OD2   . ASP A  1 389 ? -37.954 10.172  -34.104 1.00 36.62  ? 361 ASP A OD2   1 
ATOM   2827  N  N     . GLU A  1 390 ? -38.748 13.125  -32.721 1.00 36.51  ? 362 GLU A N     1 
ATOM   2828  C  CA    . GLU A  1 390 ? -37.714 13.743  -31.899 1.00 35.89  ? 362 GLU A CA    1 
ATOM   2829  C  C     . GLU A  1 390 ? -36.418 12.933  -31.912 1.00 34.71  ? 362 GLU A C     1 
ATOM   2830  O  O     . GLU A  1 390 ? -35.331 13.500  -31.882 1.00 37.83  ? 362 GLU A O     1 
ATOM   2831  C  CB    . GLU A  1 390 ? -38.214 13.956  -30.468 1.00 40.20  ? 362 GLU A CB    1 
ATOM   2832  C  CG    . GLU A  1 390 ? -39.188 15.140  -30.328 1.00 42.46  ? 362 GLU A CG    1 
ATOM   2833  C  CD    . GLU A  1 390 ? -38.572 16.493  -30.693 1.00 49.69  ? 362 GLU A CD    1 
ATOM   2834  O  OE1   . GLU A  1 390 ? -37.328 16.629  -30.623 1.00 54.93  ? 362 GLU A OE1   1 
ATOM   2835  O  OE2   . GLU A  1 390 ? -39.326 17.427  -31.058 1.00 50.84  ? 362 GLU A OE2   1 
ATOM   2836  N  N     . GLU A  1 391 ? -36.529 11.615  -31.999 1.00 34.32  ? 363 GLU A N     1 
ATOM   2837  C  CA    . GLU A  1 391 ? -35.342 10.772  -32.038 1.00 37.02  ? 363 GLU A CA    1 
ATOM   2838  C  C     . GLU A  1 391 ? -34.610 10.936  -33.366 1.00 33.31  ? 363 GLU A C     1 
ATOM   2839  O  O     . GLU A  1 391 ? -33.382 11.048  -33.404 1.00 33.79  ? 363 GLU A O     1 
ATOM   2840  C  CB    . GLU A  1 391 ? -35.712 9.303   -31.805 1.00 34.12  ? 363 GLU A CB    1 
ATOM   2841  C  CG    . GLU A  1 391 ? -35.915 8.983   -30.328 1.00 48.99  ? 363 GLU A CG    1 
ATOM   2842  C  CD    . GLU A  1 391 ? -36.156 7.502   -30.074 1.00 50.14  ? 363 GLU A CD    1 
ATOM   2843  O  OE1   . GLU A  1 391 ? -37.168 6.975   -30.589 1.00 50.83  ? 363 GLU A OE1   1 
ATOM   2844  O  OE2   . GLU A  1 391 ? -35.330 6.869   -29.372 1.00 49.41  ? 363 GLU A OE2   1 
ATOM   2845  N  N     . ALA A  1 392 ? -35.366 10.945  -34.453 1.00 30.88  ? 364 ALA A N     1 
ATOM   2846  C  CA    . ALA A  1 392 ? -34.788 11.209  -35.763 1.00 32.50  ? 364 ALA A CA    1 
ATOM   2847  C  C     . ALA A  1 392 ? -34.190 12.614  -35.823 1.00 33.44  ? 364 ALA A C     1 
ATOM   2848  O  O     . ALA A  1 392 ? -33.084 12.784  -36.345 1.00 32.71  ? 364 ALA A O     1 
ATOM   2849  C  CB    . ALA A  1 392 ? -35.827 11.028  -36.854 1.00 35.05  ? 364 ALA A CB    1 
ATOM   2850  N  N     . LYS A  1 393 ? -34.908 13.614  -35.292 1.00 31.73  ? 365 LYS A N     1 
ATOM   2851  C  CA    . LYS A  1 393 ? -34.379 14.990  -35.231 1.00 34.01  ? 365 LYS A CA    1 
ATOM   2852  C  C     . LYS A  1 393 ? -33.001 15.000  -34.576 1.00 33.62  ? 365 LYS A C     1 
ATOM   2853  O  O     . LYS A  1 393 ? -32.087 15.689  -35.024 1.00 28.99  ? 365 LYS A O     1 
ATOM   2854  C  CB    . LYS A  1 393 ? -35.318 15.932  -34.445 1.00 36.66  ? 365 LYS A CB    1 
ATOM   2855  C  CG    . LYS A  1 393 ? -36.195 16.869  -35.273 1.00 41.54  ? 365 LYS A CG    1 
ATOM   2856  C  CD    . LYS A  1 393 ? -36.849 17.931  -34.371 1.00 41.80  ? 365 LYS A CD    1 
ATOM   2857  C  CE    . LYS A  1 393 ? -37.403 19.101  -35.175 1.00 53.25  ? 365 LYS A CE    1 
ATOM   2858  N  NZ    . LYS A  1 393 ? -37.902 20.224  -34.296 1.00 56.49  ? 365 LYS A NZ    1 
ATOM   2859  N  N     . LEU A  1 394 ? -32.868 14.215  -33.506 1.00 32.86  ? 366 LEU A N     1 
ATOM   2860  C  CA    A LEU A  1 394 ? -31.609 14.101  -32.768 0.47 33.16  ? 366 LEU A CA    1 
ATOM   2861  C  CA    B LEU A  1 394 ? -31.614 14.125  -32.783 0.53 33.15  ? 366 LEU A CA    1 
ATOM   2862  C  C     . LEU A  1 394 ? -30.505 13.531  -33.658 1.00 34.99  ? 366 LEU A C     1 
ATOM   2863  O  O     . LEU A  1 394 ? -29.356 13.987  -33.618 1.00 31.54  ? 366 LEU A O     1 
ATOM   2864  C  CB    A LEU A  1 394 ? -31.786 13.213  -31.524 0.47 35.82  ? 366 LEU A CB    1 
ATOM   2865  C  CB    B LEU A  1 394 ? -31.817 13.293  -31.523 0.53 35.83  ? 366 LEU A CB    1 
ATOM   2866  C  CG    A LEU A  1 394 ? -32.639 13.710  -30.356 0.47 35.21  ? 366 LEU A CG    1 
ATOM   2867  C  CG    B LEU A  1 394 ? -30.553 12.755  -30.879 0.53 35.51  ? 366 LEU A CG    1 
ATOM   2868  C  CD1   A LEU A  1 394 ? -32.948 12.579  -29.390 0.47 37.32  ? 366 LEU A CD1   1 
ATOM   2869  C  CD1   B LEU A  1 394 ? -29.777 13.890  -30.215 0.53 33.49  ? 366 LEU A CD1   1 
ATOM   2870  C  CD2   A LEU A  1 394 ? -31.946 14.852  -29.626 0.47 36.96  ? 366 LEU A CD2   1 
ATOM   2871  C  CD2   B LEU A  1 394 ? -30.971 11.683  -29.904 0.53 37.15  ? 366 LEU A CD2   1 
ATOM   2872  N  N     . GLU A  1 395 ? -30.855 12.521  -34.457 1.00 31.23  ? 367 GLU A N     1 
ATOM   2873  C  CA    . GLU A  1 395 ? -29.889 11.892  -35.357 1.00 33.99  ? 367 GLU A CA    1 
ATOM   2874  C  C     . GLU A  1 395 ? -29.432 12.859  -36.474 1.00 30.63  ? 367 GLU A C     1 
ATOM   2875  O  O     . GLU A  1 395 ? -28.262 12.875  -36.850 1.00 26.79  ? 367 GLU A O     1 
ATOM   2876  C  CB    . GLU A  1 395 ? -30.477 10.612  -35.958 1.00 27.57  ? 367 GLU A CB    1 
ATOM   2877  C  CG    . GLU A  1 395 ? -30.701 9.464   -34.940 1.00 27.38  ? 367 GLU A CG    1 
ATOM   2878  C  CD    . GLU A  1 395 ? -29.409 8.923   -34.367 1.00 32.14  ? 367 GLU A CD    1 
ATOM   2879  O  OE1   . GLU A  1 395 ? -28.366 9.042   -35.041 1.00 30.39  ? 367 GLU A OE1   1 
ATOM   2880  O  OE2   . GLU A  1 395 ? -29.417 8.377   -33.237 1.00 35.29  ? 367 GLU A OE2   1 
ATOM   2881  N  N     . ILE A  1 396 ? -30.353 13.665  -36.990 1.00 29.27  ? 368 ILE A N     1 
ATOM   2882  C  CA    . ILE A  1 396 ? -29.977 14.722  -37.945 1.00 31.76  ? 368 ILE A CA    1 
ATOM   2883  C  C     . ILE A  1 396 ? -29.001 15.719  -37.284 1.00 32.94  ? 368 ILE A C     1 
ATOM   2884  O  O     . ILE A  1 396 ? -28.033 16.160  -37.910 1.00 31.53  ? 368 ILE A O     1 
ATOM   2885  C  CB    . ILE A  1 396 ? -31.217 15.476  -38.494 1.00 30.08  ? 368 ILE A CB    1 
ATOM   2886  C  CG1   . ILE A  1 396 ? -32.136 14.519  -39.256 1.00 27.46  ? 368 ILE A CG1   1 
ATOM   2887  C  CG2   . ILE A  1 396 ? -30.803 16.645  -39.428 1.00 31.82  ? 368 ILE A CG2   1 
ATOM   2888  C  CD1   . ILE A  1 396 ? -33.549 14.998  -39.391 1.00 28.29  ? 368 ILE A CD1   1 
ATOM   2889  N  N     . GLU A  1 397 ? -29.238 16.037  -36.013 1.00 30.25  ? 369 GLU A N     1 
ATOM   2890  C  CA    . GLU A  1 397 ? -28.368 16.973  -35.296 1.00 34.77  ? 369 GLU A CA    1 
ATOM   2891  C  C     . GLU A  1 397 ? -26.969 16.403  -35.118 1.00 36.11  ? 369 GLU A C     1 
ATOM   2892  O  O     . GLU A  1 397 ? -25.980 17.124  -35.270 1.00 30.48  ? 369 GLU A O     1 
ATOM   2893  C  CB    . GLU A  1 397 ? -28.988 17.350  -33.950 1.00 33.80  ? 369 GLU A CB    1 
ATOM   2894  C  CG    . GLU A  1 397 ? -29.975 18.483  -34.126 1.00 42.15  ? 369 GLU A CG    1 
ATOM   2895  C  CD    . GLU A  1 397 ? -30.876 18.685  -32.941 1.00 51.92  ? 369 GLU A CD    1 
ATOM   2896  O  OE1   . GLU A  1 397 ? -31.245 17.670  -32.304 1.00 46.14  ? 369 GLU A OE1   1 
ATOM   2897  O  OE2   . GLU A  1 397 ? -31.224 19.864  -32.662 1.00 53.08  ? 369 GLU A OE2   1 
ATOM   2898  N  N     . LYS A  1 398 ? -26.897 15.103  -34.813 1.00 30.54  ? 370 LYS A N     1 
ATOM   2899  C  CA    . LYS A  1 398 ? -25.623 14.396  -34.757 1.00 31.93  ? 370 LYS A CA    1 
ATOM   2900  C  C     . LYS A  1 398 ? -24.909 14.388  -36.103 1.00 31.65  ? 370 LYS A C     1 
ATOM   2901  O  O     . LYS A  1 398 ? -23.700 14.575  -36.168 1.00 35.51  ? 370 LYS A O     1 
ATOM   2902  C  CB    . LYS A  1 398 ? -25.824 12.957  -34.302 1.00 29.97  ? 370 LYS A CB    1 
ATOM   2903  C  CG    . LYS A  1 398 ? -26.330 12.759  -32.879 1.00 32.80  ? 370 LYS A CG    1 
ATOM   2904  C  CD    . LYS A  1 398 ? -26.345 11.249  -32.590 1.00 33.24  ? 370 LYS A CD    1 
ATOM   2905  C  CE    . LYS A  1 398 ? -27.305 10.860  -31.493 1.00 44.77  ? 370 LYS A CE    1 
ATOM   2906  N  NZ    . LYS A  1 398 ? -27.339 9.362   -31.258 1.00 39.11  ? 370 LYS A NZ    1 
ATOM   2907  N  N     . GLY A  1 399 ? -25.658 14.144  -37.173 1.00 31.53  ? 371 GLY A N     1 
ATOM   2908  C  CA    . GLY A  1 399 ? -25.101 14.168  -38.519 1.00 32.88  ? 371 GLY A CA    1 
ATOM   2909  C  C     . GLY A  1 399 ? -24.494 15.532  -38.822 1.00 34.83  ? 371 GLY A C     1 
ATOM   2910  O  O     . GLY A  1 399 ? -23.343 15.620  -39.237 1.00 36.84  ? 371 GLY A O     1 
ATOM   2911  N  N     . ILE A  1 400 ? -25.269 16.587  -38.583 1.00 31.24  ? 372 ILE A N     1 
ATOM   2912  C  CA    . ILE A  1 400 ? -24.795 17.973  -38.719 1.00 38.53  ? 372 ILE A CA    1 
ATOM   2913  C  C     . ILE A  1 400 ? -23.515 18.209  -37.906 1.00 39.98  ? 372 ILE A C     1 
ATOM   2914  O  O     . ILE A  1 400 ? -22.546 18.782  -38.396 1.00 41.53  ? 372 ILE A O     1 
ATOM   2915  C  CB    . ILE A  1 400 ? -25.881 18.978  -38.272 1.00 36.75  ? 372 ILE A CB    1 
ATOM   2916  C  CG1   . ILE A  1 400 ? -27.113 18.878  -39.185 1.00 35.18  ? 372 ILE A CG1   1 
ATOM   2917  C  CG2   . ILE A  1 400 ? -25.320 20.424  -38.198 1.00 36.53  ? 372 ILE A CG2   1 
ATOM   2918  C  CD1   . ILE A  1 400 ? -28.281 19.796  -38.781 1.00 33.81  ? 372 ILE A CD1   1 
ATOM   2919  N  N     . GLU A  1 401 ? -23.516 17.736  -36.665 1.00 39.99  ? 373 GLU A N     1 
ATOM   2920  C  CA    . GLU A  1 401 ? -22.342 17.835  -35.808 1.00 44.22  ? 373 GLU A CA    1 
ATOM   2921  C  C     . GLU A  1 401 ? -21.123 17.106  -36.389 1.00 43.25  ? 373 GLU A C     1 
ATOM   2922  O  O     . GLU A  1 401 ? -20.008 17.629  -36.355 1.00 42.63  ? 373 GLU A O     1 
ATOM   2923  C  CB    . GLU A  1 401 ? -22.667 17.281  -34.421 1.00 48.05  ? 373 GLU A CB    1 
ATOM   2924  C  CG    . GLU A  1 401 ? -21.715 17.714  -33.340 1.00 50.96  ? 373 GLU A CG    1 
ATOM   2925  C  CD    . GLU A  1 401 ? -22.075 19.071  -32.757 1.00 59.98  ? 373 GLU A CD    1 
ATOM   2926  O  OE1   . GLU A  1 401 ? -22.921 19.788  -33.343 1.00 55.95  ? 373 GLU A OE1   1 
ATOM   2927  O  OE2   . GLU A  1 401 ? -21.515 19.412  -31.695 1.00 67.06  ? 373 GLU A OE2   1 
ATOM   2928  N  N     . LEU A  1 402 ? -21.334 15.898  -36.917 1.00 42.13  ? 374 LEU A N     1 
ATOM   2929  C  CA    . LEU A  1 402 ? -20.250 15.128  -37.544 1.00 45.50  ? 374 LEU A CA    1 
ATOM   2930  C  C     . LEU A  1 402 ? -19.606 15.866  -38.712 1.00 44.35  ? 374 LEU A C     1 
ATOM   2931  O  O     . LEU A  1 402 ? -18.388 15.812  -38.893 1.00 45.86  ? 374 LEU A O     1 
ATOM   2932  C  CB    . LEU A  1 402 ? -20.749 13.763  -38.035 1.00 39.05  ? 374 LEU A CB    1 
ATOM   2933  C  CG    . LEU A  1 402 ? -21.051 12.780  -36.907 1.00 38.38  ? 374 LEU A CG    1 
ATOM   2934  C  CD1   . LEU A  1 402 ? -21.346 11.367  -37.440 1.00 33.27  ? 374 LEU A CD1   1 
ATOM   2935  C  CD2   . LEU A  1 402 ? -19.889 12.781  -35.930 1.00 42.32  ? 374 LEU A CD2   1 
ATOM   2936  N  N     . LEU A  1 403 ? -20.431 16.527  -39.510 1.00 38.75  ? 375 LEU A N     1 
ATOM   2937  C  CA    . LEU A  1 403 ? -19.930 17.289  -40.640 1.00 46.78  ? 375 LEU A CA    1 
ATOM   2938  C  C     . LEU A  1 403 ? -19.180 18.535  -40.171 1.00 47.71  ? 375 LEU A C     1 
ATOM   2939  O  O     . LEU A  1 403 ? -18.108 18.845  -40.685 1.00 53.43  ? 375 LEU A O     1 
ATOM   2940  C  CB    . LEU A  1 403 ? -21.076 17.670  -41.579 1.00 41.61  ? 375 LEU A CB    1 
ATOM   2941  C  CG    . LEU A  1 403 ? -21.433 16.603  -42.615 1.00 42.95  ? 375 LEU A CG    1 
ATOM   2942  C  CD1   . LEU A  1 403 ? -22.480 17.106  -43.590 1.00 37.88  ? 375 LEU A CD1   1 
ATOM   2943  C  CD2   . LEU A  1 403 ? -20.193 16.150  -43.374 1.00 38.54  ? 375 LEU A CD2   1 
ATOM   2944  N  N     . LYS A  1 404 ? -19.734 19.233  -39.183 1.00 49.95  ? 376 LYS A N     1 
ATOM   2945  C  CA    . LYS A  1 404 ? -19.091 20.436  -38.636 1.00 54.18  ? 376 LYS A CA    1 
ATOM   2946  C  C     . LYS A  1 404 ? -17.681 20.105  -38.136 1.00 56.57  ? 376 LYS A C     1 
ATOM   2947  O  O     . LYS A  1 404 ? -16.723 20.811  -38.438 1.00 62.40  ? 376 LYS A O     1 
ATOM   2948  C  CB    . LYS A  1 404 ? -19.937 21.037  -37.504 1.00 52.61  ? 376 LYS A CB    1 
ATOM   2949  C  CG    . LYS A  1 404 ? -19.706 22.528  -37.246 1.00 65.75  ? 376 LYS A CG    1 
ATOM   2950  C  CD    . LYS A  1 404 ? -20.910 23.369  -37.678 1.00 69.01  ? 376 LYS A CD    1 
ATOM   2951  C  CE    . LYS A  1 404 ? -22.156 23.004  -36.867 1.00 65.91  ? 376 LYS A CE    1 
ATOM   2952  N  NZ    . LYS A  1 404 ? -23.413 23.623  -37.389 1.00 60.29  ? 376 LYS A NZ    1 
ATOM   2953  N  N     . ALA A  1 405 ? -17.561 19.002  -37.402 1.00 58.46  ? 377 ALA A N     1 
ATOM   2954  C  CA    . ALA A  1 405 ? -16.281 18.575  -36.845 1.00 60.29  ? 377 ALA A CA    1 
ATOM   2955  C  C     . ALA A  1 405 ? -15.287 18.107  -37.915 1.00 66.08  ? 377 ALA A C     1 
ATOM   2956  O  O     . ALA A  1 405 ? -14.093 18.390  -37.822 1.00 71.57  ? 377 ALA A O     1 
ATOM   2957  C  CB    . ALA A  1 405 ? -16.502 17.470  -35.825 1.00 58.97  ? 377 ALA A CB    1 
ATOM   2958  N  N     . SER A  1 406 ? -15.773 17.391  -38.922 1.00 60.59  ? 378 SER A N     1 
ATOM   2959  C  CA    . SER A  1 406 ? -14.892 16.798  -39.929 1.00 66.37  ? 378 SER A CA    1 
ATOM   2960  C  C     . SER A  1 406 ? -14.478 17.806  -41.005 1.00 71.32  ? 378 SER A C     1 
ATOM   2961  O  O     . SER A  1 406 ? -13.416 17.673  -41.618 1.00 71.84  ? 378 SER A O     1 
ATOM   2962  C  CB    . SER A  1 406 ? -15.568 15.595  -40.590 1.00 55.91  ? 378 SER A CB    1 
ATOM   2963  O  OG    . SER A  1 406 ? -16.602 16.024  -41.464 1.00 58.64  ? 378 SER A OG    1 
ATOM   2964  N  N     . GLY A  1 407 ? -15.330 18.799  -41.240 1.00 68.78  ? 379 GLY A N     1 
ATOM   2965  C  CA    . GLY A  1 407 ? -15.041 19.845  -42.205 1.00 71.77  ? 379 GLY A CA    1 
ATOM   2966  C  C     . GLY A  1 407 ? -14.007 20.813  -41.661 1.00 81.20  ? 379 GLY A C     1 
ATOM   2967  O  O     . GLY A  1 407 ? -13.307 21.490  -42.419 1.00 83.94  ? 379 GLY A O     1 
ATOM   2968  N  N     . MET A  1 408 ? -13.915 20.878  -40.335 1.00 82.76  ? 380 MET A N     1 
ATOM   2969  C  CA    . MET A  1 408 ? -12.913 21.704  -39.669 1.00 86.58  ? 380 MET A CA    1 
ATOM   2970  C  C     . MET A  1 408 ? -11.711 20.855  -39.245 1.00 91.16  ? 380 MET A C     1 
ATOM   2971  O  O     . MET A  1 408 ? -11.257 20.932  -38.100 1.00 90.39  ? 380 MET A O     1 
ATOM   2972  C  CB    . MET A  1 408 ? -13.523 22.421  -38.458 1.00 86.70  ? 380 MET A CB    1 
ATOM   2973  C  CG    . MET A  1 408 ? -14.604 23.443  -38.821 1.00 90.00  ? 380 MET A CG    1 
ATOM   2974  S  SD    . MET A  1 408 ? -15.209 24.399  -37.410 1.00 102.26 ? 380 MET A SD    1 
ATOM   2975  C  CE    . MET A  1 408 ? -16.439 25.438  -38.201 1.00 95.59  ? 380 MET A CE    1 
ATOM   2976  N  N     . THR A  1 409 ? -11.206 20.045  -40.178 1.00 86.35  ? 381 THR A N     1 
ATOM   2977  C  CA    . THR A  1 409 ? -10.013 19.230  -39.947 1.00 89.23  ? 381 THR A CA    1 
ATOM   2978  C  C     . THR A  1 409 ? -9.030  19.367  -41.111 1.00 90.17  ? 381 THR A C     1 
ATOM   2979  O  O     . THR A  1 409 ? -7.834  19.590  -40.909 1.00 88.59  ? 381 THR A O     1 
ATOM   2980  C  CB    . THR A  1 409 ? -10.362 17.733  -39.758 1.00 88.54  ? 381 THR A CB    1 
ATOM   2981  O  OG1   . THR A  1 409 ? -11.231 17.573  -38.630 1.00 87.48  ? 381 THR A OG1   1 
ATOM   2982  C  CG2   . THR A  1 409 ? -9.098  16.910  -39.534 1.00 86.66  ? 381 THR A CG2   1 
ATOM   2983  N  N     . ASN B  1 30  ? 13.255  -55.443 -23.916 1.00 48.95  ? 2   ASN B N     1 
ATOM   2984  C  CA    . ASN B  1 30  ? 11.923  -54.862 -24.082 1.00 55.14  ? 2   ASN B CA    1 
ATOM   2985  C  C     . ASN B  1 30  ? 11.976  -53.348 -24.282 1.00 56.87  ? 2   ASN B C     1 
ATOM   2986  O  O     . ASN B  1 30  ? 11.776  -52.861 -25.391 1.00 50.88  ? 2   ASN B O     1 
ATOM   2987  C  CB    . ASN B  1 30  ? 11.039  -55.197 -22.882 1.00 62.87  ? 2   ASN B CB    1 
ATOM   2988  C  CG    . ASN B  1 30  ? 9.712   -54.448 -22.900 1.00 67.35  ? 2   ASN B CG    1 
ATOM   2989  O  OD1   . ASN B  1 30  ? 9.356   -53.767 -21.933 1.00 72.73  ? 2   ASN B OD1   1 
ATOM   2990  N  ND2   . ASN B  1 30  ? 8.977   -54.569 -24.004 1.00 67.02  ? 2   ASN B ND2   1 
ATOM   2991  N  N     . VAL B  1 31  ? 12.229  -52.607 -23.204 1.00 56.74  ? 3   VAL B N     1 
ATOM   2992  C  CA    . VAL B  1 31  ? 12.481  -51.174 -23.309 1.00 50.09  ? 3   VAL B CA    1 
ATOM   2993  C  C     . VAL B  1 31  ? 13.853  -50.970 -23.938 1.00 51.02  ? 3   VAL B C     1 
ATOM   2994  O  O     . VAL B  1 31  ? 14.027  -50.075 -24.768 1.00 50.01  ? 3   VAL B O     1 
ATOM   2995  C  CB    . VAL B  1 31  ? 12.397  -50.454 -21.934 1.00 52.75  ? 3   VAL B CB    1 
ATOM   2996  C  CG1   . VAL B  1 31  ? 13.067  -49.084 -21.987 1.00 49.73  ? 3   VAL B CG1   1 
ATOM   2997  C  CG2   . VAL B  1 31  ? 10.946  -50.312 -21.496 1.00 48.92  ? 3   VAL B CG2   1 
ATOM   2998  N  N     . TYR B  1 32  ? 14.820  -51.809 -23.565 1.00 45.19  ? 4   TYR B N     1 
ATOM   2999  C  CA    . TYR B  1 32  ? 16.136  -51.748 -24.192 1.00 54.39  ? 4   TYR B CA    1 
ATOM   3000  C  C     . TYR B  1 32  ? 16.041  -52.119 -25.672 1.00 55.68  ? 4   TYR B C     1 
ATOM   3001  O  O     . TYR B  1 32  ? 16.777  -51.581 -26.507 1.00 53.33  ? 4   TYR B O     1 
ATOM   3002  C  CB    . TYR B  1 32  ? 17.153  -52.672 -23.505 1.00 56.47  ? 4   TYR B CB    1 
ATOM   3003  C  CG    . TYR B  1 32  ? 18.474  -52.717 -24.264 1.00 65.15  ? 4   TYR B CG    1 
ATOM   3004  C  CD1   . TYR B  1 32  ? 19.326  -51.608 -24.291 1.00 68.38  ? 4   TYR B CD1   1 
ATOM   3005  C  CD2   . TYR B  1 32  ? 18.849  -53.844 -24.990 1.00 62.96  ? 4   TYR B CD2   1 
ATOM   3006  C  CE1   . TYR B  1 32  ? 20.530  -51.634 -25.001 1.00 69.77  ? 4   TYR B CE1   1 
ATOM   3007  C  CE2   . TYR B  1 32  ? 20.049  -53.879 -25.705 1.00 66.32  ? 4   TYR B CE2   1 
ATOM   3008  C  CZ    . TYR B  1 32  ? 20.885  -52.776 -25.706 1.00 71.66  ? 4   TYR B CZ    1 
ATOM   3009  O  OH    . TYR B  1 32  ? 22.072  -52.820 -26.412 1.00 75.49  ? 4   TYR B OH    1 
ATOM   3010  N  N     . GLN B  1 33  ? 15.137  -53.038 -25.991 1.00 47.31  ? 5   GLN B N     1 
ATOM   3011  C  CA    . GLN B  1 33  ? 14.943  -53.456 -27.379 1.00 54.51  ? 5   GLN B CA    1 
ATOM   3012  C  C     . GLN B  1 33  ? 14.341  -52.312 -28.189 1.00 47.74  ? 5   GLN B C     1 
ATOM   3013  O  O     . GLN B  1 33  ? 14.763  -52.036 -29.313 1.00 42.41  ? 5   GLN B O     1 
ATOM   3014  C  CB    . GLN B  1 33  ? 14.039  -54.695 -27.457 1.00 48.81  ? 5   GLN B CB    1 
ATOM   3015  C  CG    . GLN B  1 33  ? 13.540  -55.021 -28.860 1.00 59.53  ? 5   GLN B CG    1 
ATOM   3016  C  CD    . GLN B  1 33  ? 12.474  -56.106 -28.856 1.00 68.03  ? 5   GLN B CD    1 
ATOM   3017  O  OE1   . GLN B  1 33  ? 12.282  -56.803 -27.854 1.00 69.41  ? 5   GLN B OE1   1 
ATOM   3018  N  NE2   . GLN B  1 33  ? 11.768  -56.250 -29.976 1.00 64.35  ? 5   GLN B NE2   1 
ATOM   3019  N  N     . LEU B  1 34  ? 13.342  -51.661 -27.603 1.00 45.63  ? 6   LEU B N     1 
ATOM   3020  C  CA    . LEU B  1 34  ? 12.666  -50.546 -28.240 1.00 46.14  ? 6   LEU B CA    1 
ATOM   3021  C  C     . LEU B  1 34  ? 13.636  -49.381 -28.451 1.00 43.35  ? 6   LEU B C     1 
ATOM   3022  O  O     . LEU B  1 34  ? 13.599  -48.701 -29.475 1.00 39.25  ? 6   LEU B O     1 
ATOM   3023  C  CB    . LEU B  1 34  ? 11.471  -50.113 -27.398 1.00 45.37  ? 6   LEU B CB    1 
ATOM   3024  C  CG    . LEU B  1 34  ? 10.571  -49.027 -27.979 1.00 45.43  ? 6   LEU B CG    1 
ATOM   3025  C  CD1   . LEU B  1 34  ? 9.941   -49.489 -29.291 1.00 40.29  ? 6   LEU B CD1   1 
ATOM   3026  C  CD2   . LEU B  1 34  ? 9.507   -48.631 -26.972 1.00 41.66  ? 6   LEU B CD2   1 
ATOM   3027  N  N     . LYS B  1 35  ? 14.518  -49.183 -27.483 1.00 40.98  ? 7   LYS B N     1 
ATOM   3028  C  CA    . LYS B  1 35  ? 15.488  -48.109 -27.531 1.00 43.09  ? 7   LYS B CA    1 
ATOM   3029  C  C     . LYS B  1 35  ? 16.402  -48.271 -28.725 1.00 43.62  ? 7   LYS B C     1 
ATOM   3030  O  O     . LYS B  1 35  ? 16.656  -47.314 -29.471 1.00 41.87  ? 7   LYS B O     1 
ATOM   3031  C  CB    . LYS B  1 35  ? 16.308  -48.072 -26.242 1.00 41.09  ? 7   LYS B CB    1 
ATOM   3032  C  CG    . LYS B  1 35  ? 17.480  -47.115 -26.282 1.00 45.58  ? 7   LYS B CG    1 
ATOM   3033  C  CD    . LYS B  1 35  ? 18.080  -46.965 -24.905 1.00 45.89  ? 7   LYS B CD    1 
ATOM   3034  C  CE    . LYS B  1 35  ? 19.217  -45.958 -24.878 1.00 45.99  ? 7   LYS B CE    1 
ATOM   3035  N  NZ    . LYS B  1 35  ? 19.599  -45.679 -23.458 1.00 42.34  ? 7   LYS B NZ    1 
ATOM   3036  N  N     . GLU B  1 36  ? 16.898  -49.488 -28.906 1.00 44.80  ? 8   GLU B N     1 
ATOM   3037  C  CA    . GLU B  1 36  ? 17.786  -49.790 -30.028 1.00 45.34  ? 8   GLU B CA    1 
ATOM   3038  C  C     . GLU B  1 36  ? 17.065  -49.683 -31.368 1.00 36.40  ? 8   GLU B C     1 
ATOM   3039  O  O     . GLU B  1 36  ? 17.645  -49.219 -32.358 1.00 37.84  ? 8   GLU B O     1 
ATOM   3040  C  CB    . GLU B  1 36  ? 18.412  -51.184 -29.863 1.00 47.76  ? 8   GLU B CB    1 
ATOM   3041  C  CG    . GLU B  1 36  ? 19.528  -51.227 -28.815 1.00 53.24  ? 8   GLU B CG    1 
ATOM   3042  C  CD    . GLU B  1 36  ? 20.465  -50.018 -28.887 1.00 65.61  ? 8   GLU B CD    1 
ATOM   3043  O  OE1   . GLU B  1 36  ? 21.011  -49.735 -29.982 1.00 62.03  ? 8   GLU B OE1   1 
ATOM   3044  O  OE2   . GLU B  1 36  ? 20.654  -49.344 -27.839 1.00 67.06  ? 8   GLU B OE2   1 
ATOM   3045  N  N     . GLU B  1 37  ? 15.798  -50.092 -31.405 1.00 35.23  ? 9   GLU B N     1 
ATOM   3046  C  CA    . GLU B  1 37  ? 15.011  -49.963 -32.633 1.00 38.61  ? 9   GLU B CA    1 
ATOM   3047  C  C     . GLU B  1 37  ? 14.768  -48.497 -32.980 1.00 34.83  ? 9   GLU B C     1 
ATOM   3048  O  O     . GLU B  1 37  ? 14.835  -48.114 -34.145 1.00 33.11  ? 9   GLU B O     1 
ATOM   3049  C  CB    . GLU B  1 37  ? 13.673  -50.698 -32.507 1.00 36.58  ? 9   GLU B CB    1 
ATOM   3050  C  CG    . GLU B  1 37  ? 13.825  -52.215 -32.481 1.00 44.27  ? 9   GLU B CG    1 
ATOM   3051  C  CD    . GLU B  1 37  ? 12.533  -52.930 -32.150 1.00 51.07  ? 9   GLU B CD    1 
ATOM   3052  O  OE1   . GLU B  1 37  ? 11.476  -52.261 -32.096 1.00 56.00  ? 9   GLU B OE1   1 
ATOM   3053  O  OE2   . GLU B  1 37  ? 12.574  -54.163 -31.933 1.00 62.58  ? 9   GLU B OE2   1 
ATOM   3054  N  N     . LEU B  1 38  ? 14.484  -47.691 -31.959 1.00 38.29  ? 10  LEU B N     1 
ATOM   3055  C  CA    . LEU B  1 38  ? 14.216  -46.261 -32.134 1.00 32.44  ? 10  LEU B CA    1 
ATOM   3056  C  C     . LEU B  1 38  ? 15.452  -45.567 -32.673 1.00 29.62  ? 10  LEU B C     1 
ATOM   3057  O  O     . LEU B  1 38  ? 15.378  -44.801 -33.649 1.00 35.32  ? 10  LEU B O     1 
ATOM   3058  C  CB    . LEU B  1 38  ? 13.758  -45.635 -30.804 1.00 32.88  ? 10  LEU B CB    1 
ATOM   3059  C  CG    . LEU B  1 38  ? 13.484  -44.126 -30.751 1.00 40.19  ? 10  LEU B CG    1 
ATOM   3060  C  CD1   . LEU B  1 38  ? 12.287  -43.776 -31.632 1.00 37.36  ? 10  LEU B CD1   1 
ATOM   3061  C  CD2   . LEU B  1 38  ? 13.267  -43.645 -29.301 1.00 31.60  ? 10  LEU B CD2   1 
ATOM   3062  N  N     . ILE B  1 39  ? 16.590  -45.834 -32.036 1.00 30.63  ? 11  ILE B N     1 
ATOM   3063  C  CA    . ILE B  1 39  ? 17.864  -45.278 -32.480 1.00 29.49  ? 11  ILE B CA    1 
ATOM   3064  C  C     . ILE B  1 39  ? 18.135  -45.629 -33.938 1.00 38.37  ? 11  ILE B C     1 
ATOM   3065  O  O     . ILE B  1 39  ? 18.468  -44.752 -34.750 1.00 34.79  ? 11  ILE B O     1 
ATOM   3066  C  CB    . ILE B  1 39  ? 19.036  -45.776 -31.623 1.00 34.25  ? 11  ILE B CB    1 
ATOM   3067  C  CG1   . ILE B  1 39  ? 18.917  -45.250 -30.183 1.00 38.58  ? 11  ILE B CG1   1 
ATOM   3068  C  CG2   . ILE B  1 39  ? 20.372  -45.359 -32.249 1.00 27.55  ? 11  ILE B CG2   1 
ATOM   3069  C  CD1   . ILE B  1 39  ? 19.946  -45.869 -29.202 1.00 36.26  ? 11  ILE B CD1   1 
ATOM   3070  N  N     . GLU B  1 40  ? 17.976  -46.913 -34.267 1.00 37.19  ? 12  GLU B N     1 
ATOM   3071  C  CA    . GLU B  1 40  ? 18.212  -47.374 -35.625 1.00 35.95  ? 12  GLU B CA    1 
ATOM   3072  C  C     . GLU B  1 40  ? 17.296  -46.629 -36.591 1.00 32.19  ? 12  GLU B C     1 
ATOM   3073  O  O     . GLU B  1 40  ? 17.738  -46.201 -37.651 1.00 33.29  ? 12  GLU B O     1 
ATOM   3074  C  CB    . GLU B  1 40  ? 18.004  -48.901 -35.752 1.00 33.00  ? 12  GLU B CB    1 
ATOM   3075  C  CG    . GLU B  1 40  ? 18.123  -49.409 -37.176 1.00 41.13  ? 12  GLU B CG    1 
ATOM   3076  C  CD    . GLU B  1 40  ? 18.092  -50.946 -37.296 1.00 48.46  ? 12  GLU B CD    1 
ATOM   3077  O  OE1   . GLU B  1 40  ? 17.524  -51.626 -36.412 1.00 50.03  ? 12  GLU B OE1   1 
ATOM   3078  O  OE2   . GLU B  1 40  ? 18.629  -51.463 -38.296 1.00 52.69  ? 12  GLU B OE2   1 
ATOM   3079  N  N     . TYR B  1 41  ? 16.028  -46.475 -36.218 1.00 30.39  ? 13  TYR B N     1 
ATOM   3080  C  CA    . TYR B  1 41  ? 15.056  -45.827 -37.091 1.00 32.26  ? 13  TYR B CA    1 
ATOM   3081  C  C     . TYR B  1 41  ? 15.359  -44.339 -37.245 1.00 34.32  ? 13  TYR B C     1 
ATOM   3082  O  O     . TYR B  1 41  ? 15.284  -43.788 -38.355 1.00 33.29  ? 13  TYR B O     1 
ATOM   3083  C  CB    . TYR B  1 41  ? 13.635  -46.029 -36.556 1.00 31.07  ? 13  TYR B CB    1 
ATOM   3084  C  CG    . TYR B  1 41  ? 12.559  -45.446 -37.442 1.00 30.58  ? 13  TYR B CG    1 
ATOM   3085  C  CD1   . TYR B  1 41  ? 11.596  -44.585 -36.926 1.00 34.69  ? 13  TYR B CD1   1 
ATOM   3086  C  CD2   . TYR B  1 41  ? 12.513  -45.742 -38.802 1.00 33.16  ? 13  TYR B CD2   1 
ATOM   3087  C  CE1   . TYR B  1 41  ? 10.605  -44.050 -37.734 1.00 31.19  ? 13  TYR B CE1   1 
ATOM   3088  C  CE2   . TYR B  1 41  ? 11.526  -45.202 -39.627 1.00 28.18  ? 13  TYR B CE2   1 
ATOM   3089  C  CZ    . TYR B  1 41  ? 10.574  -44.369 -39.084 1.00 32.46  ? 13  TYR B CZ    1 
ATOM   3090  O  OH    . TYR B  1 41  ? 9.595   -43.830 -39.888 1.00 31.65  ? 13  TYR B OH    1 
ATOM   3091  N  N     . ALA B  1 42  ? 15.714  -43.704 -36.128 1.00 31.74  ? 14  ALA B N     1 
ATOM   3092  C  CA    . ALA B  1 42  ? 15.995  -42.277 -36.112 1.00 35.26  ? 14  ALA B CA    1 
ATOM   3093  C  C     . ALA B  1 42  ? 17.087  -41.974 -37.106 1.00 32.41  ? 14  ALA B C     1 
ATOM   3094  O  O     . ALA B  1 42  ? 16.965  -41.065 -37.914 1.00 34.14  ? 14  ALA B O     1 
ATOM   3095  C  CB    . ALA B  1 42  ? 16.402  -41.801 -34.690 1.00 31.11  ? 14  ALA B CB    1 
ATOM   3096  N  N     . LYS B  1 43  ? 18.155  -42.752 -37.053 1.00 35.94  ? 15  LYS B N     1 
ATOM   3097  C  CA    . LYS B  1 43  ? 19.279  -42.506 -37.941 1.00 36.46  ? 15  LYS B CA    1 
ATOM   3098  C  C     . LYS B  1 43  ? 18.901  -42.771 -39.399 1.00 33.56  ? 15  LYS B C     1 
ATOM   3099  O  O     . LYS B  1 43  ? 19.402  -42.104 -40.310 1.00 33.44  ? 15  LYS B O     1 
ATOM   3100  C  CB    . LYS B  1 43  ? 20.483  -43.354 -37.513 1.00 41.16  ? 15  LYS B CB    1 
ATOM   3101  C  CG    . LYS B  1 43  ? 21.137  -42.847 -36.218 1.00 50.34  ? 15  LYS B CG    1 
ATOM   3102  C  CD    . LYS B  1 43  ? 22.299  -43.736 -35.771 1.00 58.92  ? 15  LYS B CD    1 
ATOM   3103  C  CE    . LYS B  1 43  ? 22.812  -43.357 -34.370 1.00 56.48  ? 15  LYS B CE    1 
ATOM   3104  N  NZ    . LYS B  1 43  ? 23.457  -42.006 -34.298 1.00 61.48  ? 15  LYS B NZ    1 
ATOM   3105  N  N     . SER B  1 44  ? 17.987  -43.709 -39.629 1.00 33.91  ? 16  SER B N     1 
ATOM   3106  C  CA    . SER B  1 44  ? 17.610  -44.024 -41.013 1.00 36.26  ? 16  SER B CA    1 
ATOM   3107  C  C     . SER B  1 44  ? 16.875  -42.838 -41.631 1.00 33.56  ? 16  SER B C     1 
ATOM   3108  O  O     . SER B  1 44  ? 16.975  -42.595 -42.833 1.00 32.41  ? 16  SER B O     1 
ATOM   3109  C  CB    . SER B  1 44  ? 16.748  -45.288 -41.092 1.00 32.03  ? 16  SER B CB    1 
ATOM   3110  O  OG    . SER B  1 44  ? 15.365  -45.039 -40.856 1.00 30.99  ? 16  SER B OG    1 
ATOM   3111  N  N     . ILE B  1 45  ? 16.155  -42.084 -40.802 1.00 31.40  ? 17  ILE B N     1 
ATOM   3112  C  CA    . ILE B  1 45  ? 15.369  -40.966 -41.312 1.00 31.17  ? 17  ILE B CA    1 
ATOM   3113  C  C     . ILE B  1 45  ? 16.157  -39.656 -41.232 1.00 30.22  ? 17  ILE B C     1 
ATOM   3114  O  O     . ILE B  1 45  ? 15.628  -38.587 -41.514 1.00 33.06  ? 17  ILE B O     1 
ATOM   3115  C  CB    . ILE B  1 45  ? 14.009  -40.845 -40.579 1.00 37.14  ? 17  ILE B CB    1 
ATOM   3116  C  CG1   . ILE B  1 45  ? 14.193  -40.594 -39.075 1.00 31.18  ? 17  ILE B CG1   1 
ATOM   3117  C  CG2   . ILE B  1 45  ? 13.165  -42.108 -40.816 1.00 30.30  ? 17  ILE B CG2   1 
ATOM   3118  C  CD1   . ILE B  1 45  ? 12.933  -40.094 -38.392 1.00 34.09  ? 17  ILE B CD1   1 
ATOM   3119  N  N     . GLY B  1 46  ? 17.432  -39.752 -40.865 1.00 33.07  ? 18  GLY B N     1 
ATOM   3120  C  CA    . GLY B  1 46  ? 18.337  -38.624 -40.976 1.00 31.36  ? 18  GLY B CA    1 
ATOM   3121  C  C     . GLY B  1 46  ? 18.552  -37.837 -39.694 1.00 36.77  ? 18  GLY B C     1 
ATOM   3122  O  O     . GLY B  1 46  ? 19.106  -36.737 -39.719 1.00 34.28  ? 18  GLY B O     1 
ATOM   3123  N  N     . VAL B  1 47  ? 18.094  -38.376 -38.572 1.00 32.61  ? 19  VAL B N     1 
ATOM   3124  C  CA    . VAL B  1 47  ? 18.476  -37.811 -37.289 1.00 33.73  ? 19  VAL B CA    1 
ATOM   3125  C  C     . VAL B  1 47  ? 19.984  -38.044 -37.119 1.00 34.96  ? 19  VAL B C     1 
ATOM   3126  O  O     . VAL B  1 47  ? 20.477  -39.151 -37.345 1.00 31.85  ? 19  VAL B O     1 
ATOM   3127  C  CB    . VAL B  1 47  ? 17.670  -38.430 -36.145 1.00 32.45  ? 19  VAL B CB    1 
ATOM   3128  C  CG1   . VAL B  1 47  ? 18.296  -38.098 -34.798 1.00 27.83  ? 19  VAL B CG1   1 
ATOM   3129  C  CG2   . VAL B  1 47  ? 16.219  -37.953 -36.222 1.00 31.73  ? 19  VAL B CG2   1 
ATOM   3130  N  N     . ASP B  1 48  ? 20.719  -36.990 -36.775 1.00 30.01  ? 20  ASP B N     1 
ATOM   3131  C  CA    . ASP B  1 48  ? 22.181  -37.062 -36.731 1.00 34.54  ? 20  ASP B CA    1 
ATOM   3132  C  C     . ASP B  1 48  ? 22.705  -37.509 -35.382 1.00 36.00  ? 20  ASP B C     1 
ATOM   3133  O  O     . ASP B  1 48  ? 23.760  -38.142 -35.282 1.00 35.84  ? 20  ASP B O     1 
ATOM   3134  C  CB    . ASP B  1 48  ? 22.775  -35.714 -37.104 1.00 32.10  ? 20  ASP B CB    1 
ATOM   3135  C  CG    . ASP B  1 48  ? 22.576  -35.401 -38.562 1.00 39.12  ? 20  ASP B CG    1 
ATOM   3136  O  OD1   . ASP B  1 48  ? 22.808  -36.327 -39.380 1.00 33.50  ? 20  ASP B OD1   1 
ATOM   3137  O  OD2   . ASP B  1 48  ? 22.173  -34.261 -38.887 1.00 36.58  ? 20  ASP B OD2   1 
ATOM   3138  N  N     . LYS B  1 49  ? 21.962  -37.179 -34.340 1.00 31.84  ? 21  LYS B N     1 
ATOM   3139  C  CA    . LYS B  1 49  ? 22.330  -37.615 -33.013 1.00 33.45  ? 21  LYS B CA    1 
ATOM   3140  C  C     . LYS B  1 49  ? 21.075  -37.720 -32.158 1.00 30.94  ? 21  LYS B C     1 
ATOM   3141  O  O     . LYS B  1 49  ? 20.227  -36.825 -32.167 1.00 31.58  ? 21  LYS B O     1 
ATOM   3142  C  CB    . LYS B  1 49  ? 23.361  -36.664 -32.402 1.00 36.19  ? 21  LYS B CB    1 
ATOM   3143  C  CG    . LYS B  1 49  ? 24.130  -37.312 -31.260 1.00 41.24  ? 21  LYS B CG    1 
ATOM   3144  C  CD    . LYS B  1 49  ? 25.433  -36.616 -30.948 1.00 41.05  ? 21  LYS B CD    1 
ATOM   3145  C  CE    . LYS B  1 49  ? 26.078  -37.259 -29.736 1.00 43.04  ? 21  LYS B CE    1 
ATOM   3146  N  NZ    . LYS B  1 49  ? 27.379  -36.625 -29.422 1.00 50.97  ? 21  LYS B NZ    1 
ATOM   3147  N  N     . ILE B  1 50  ? 20.946  -38.831 -31.445 1.00 25.03  ? 22  ILE B N     1 
ATOM   3148  C  CA    . ILE B  1 50  ? 19.786  -39.062 -30.608 1.00 29.37  ? 22  ILE B CA    1 
ATOM   3149  C  C     . ILE B  1 50  ? 20.243  -39.394 -29.179 1.00 38.65  ? 22  ILE B C     1 
ATOM   3150  O  O     . ILE B  1 50  ? 21.289  -40.014 -28.977 1.00 36.94  ? 22  ILE B O     1 
ATOM   3151  C  CB    . ILE B  1 50  ? 18.891  -40.185 -31.196 1.00 35.15  ? 22  ILE B CB    1 
ATOM   3152  C  CG1   . ILE B  1 50  ? 17.682  -40.449 -30.306 1.00 31.21  ? 22  ILE B CG1   1 
ATOM   3153  C  CG2   . ILE B  1 50  ? 19.681  -41.468 -31.430 1.00 32.45  ? 22  ILE B CG2   1 
ATOM   3154  C  CD1   . ILE B  1 50  ? 16.520  -41.115 -31.034 1.00 30.00  ? 22  ILE B CD1   1 
ATOM   3155  N  N     . GLY B  1 51  ? 19.478  -38.939 -28.189 1.00 35.10  ? 23  GLY B N     1 
ATOM   3156  C  CA    . GLY B  1 51  ? 19.867  -39.066 -26.800 1.00 33.62  ? 23  GLY B CA    1 
ATOM   3157  C  C     . GLY B  1 51  ? 18.684  -39.359 -25.908 1.00 34.44  ? 23  GLY B C     1 
ATOM   3158  O  O     . GLY B  1 51  ? 17.531  -39.168 -26.297 1.00 32.89  ? 23  GLY B O     1 
ATOM   3159  N  N     . PHE B  1 52  ? 18.969  -39.818 -24.696 1.00 33.13  ? 24  PHE B N     1 
ATOM   3160  C  CA    . PHE B  1 52  ? 17.915  -40.233 -23.786 1.00 35.91  ? 24  PHE B CA    1 
ATOM   3161  C  C     . PHE B  1 52  ? 18.130  -39.665 -22.392 1.00 36.99  ? 24  PHE B C     1 
ATOM   3162  O  O     . PHE B  1 52  ? 19.245  -39.644 -21.868 1.00 38.09  ? 24  PHE B O     1 
ATOM   3163  C  CB    . PHE B  1 52  ? 17.823  -41.769 -23.735 1.00 38.22  ? 24  PHE B CB    1 
ATOM   3164  C  CG    . PHE B  1 52  ? 17.441  -42.392 -25.056 1.00 37.20  ? 24  PHE B CG    1 
ATOM   3165  C  CD1   . PHE B  1 52  ? 16.124  -42.719 -25.325 1.00 32.32  ? 24  PHE B CD1   1 
ATOM   3166  C  CD2   . PHE B  1 52  ? 18.399  -42.611 -26.030 1.00 34.30  ? 24  PHE B CD2   1 
ATOM   3167  C  CE1   . PHE B  1 52  ? 15.769  -43.262 -26.534 1.00 31.73  ? 24  PHE B CE1   1 
ATOM   3168  C  CE2   . PHE B  1 52  ? 18.052  -43.146 -27.254 1.00 37.81  ? 24  PHE B CE2   1 
ATOM   3169  C  CZ    . PHE B  1 52  ? 16.735  -43.472 -27.507 1.00 35.25  ? 24  PHE B CZ    1 
ATOM   3170  N  N     . THR B  1 53  ? 17.048  -39.208 -21.789 1.00 31.82  ? 25  THR B N     1 
ATOM   3171  C  CA    . THR B  1 53  ? 17.119  -38.720 -20.437 1.00 29.43  ? 25  THR B CA    1 
ATOM   3172  C  C     . THR B  1 53  ? 15.801  -39.010 -19.761 1.00 33.40  ? 25  THR B C     1 
ATOM   3173  O  O     . THR B  1 53  ? 14.805  -39.314 -20.432 1.00 30.75  ? 25  THR B O     1 
ATOM   3174  C  CB    . THR B  1 53  ? 17.447  -37.183 -20.378 1.00 35.57  ? 25  THR B CB    1 
ATOM   3175  O  OG1   . THR B  1 53  ? 17.586  -36.771 -19.010 1.00 37.34  ? 25  THR B OG1   1 
ATOM   3176  C  CG2   . THR B  1 53  ? 16.363  -36.339 -21.060 1.00 27.31  ? 25  THR B CG2   1 
ATOM   3177  N  N     . THR B  1 54  ? 15.806  -38.904 -18.429 1.00 37.46  ? 26  THR B N     1 
ATOM   3178  C  CA    . THR B  1 54  ? 14.610  -39.072 -17.615 1.00 33.93  ? 26  THR B CA    1 
ATOM   3179  C  C     . THR B  1 54  ? 13.635  -37.919 -17.798 1.00 38.07  ? 26  THR B C     1 
ATOM   3180  O  O     . THR B  1 54  ? 13.925  -36.941 -18.501 1.00 32.58  ? 26  THR B O     1 
ATOM   3181  C  CB    . THR B  1 54  ? 14.955  -39.168 -16.122 1.00 40.73  ? 26  THR B CB    1 
ATOM   3182  O  OG1   . THR B  1 54  ? 15.274  -37.856 -15.617 1.00 35.02  ? 26  THR B OG1   1 
ATOM   3183  C  CG2   . THR B  1 54  ? 16.140  -40.141 -15.898 1.00 34.37  ? 26  THR B CG2   1 
ATOM   3184  N  N     . ALA B  1 55  ? 12.479  -38.048 -17.159 1.00 31.95  ? 27  ALA B N     1 
ATOM   3185  C  CA    . ALA B  1 55  ? 11.491  -36.980 -17.125 1.00 32.96  ? 27  ALA B CA    1 
ATOM   3186  C  C     . ALA B  1 55  ? 11.552  -36.250 -15.775 1.00 36.50  ? 27  ALA B C     1 
ATOM   3187  O  O     . ALA B  1 55  ? 10.587  -35.610 -15.352 1.00 34.69  ? 27  ALA B O     1 
ATOM   3188  C  CB    . ALA B  1 55  ? 10.094  -37.537 -17.379 1.00 34.41  ? 27  ALA B CB    1 
ATOM   3189  N  N     . ASP B  1 56  ? 12.691  -36.363 -15.096 1.00 31.86  ? 28  ASP B N     1 
ATOM   3190  C  CA    . ASP B  1 56  ? 12.903  -35.646 -13.841 1.00 36.73  ? 28  ASP B CA    1 
ATOM   3191  C  C     . ASP B  1 56  ? 12.931  -34.137 -14.062 1.00 37.64  ? 28  ASP B C     1 
ATOM   3192  O  O     . ASP B  1 56  ? 13.284  -33.662 -15.156 1.00 33.39  ? 28  ASP B O     1 
ATOM   3193  C  CB    . ASP B  1 56  ? 14.199  -36.102 -13.178 1.00 36.29  ? 28  ASP B CB    1 
ATOM   3194  C  CG    . ASP B  1 56  ? 14.120  -37.542 -12.690 1.00 39.76  ? 28  ASP B CG    1 
ATOM   3195  O  OD1   . ASP B  1 56  ? 12.989  -38.059 -12.562 1.00 37.22  ? 28  ASP B OD1   1 
ATOM   3196  O  OD2   . ASP B  1 56  ? 15.182  -38.151 -12.446 1.00 45.64  ? 28  ASP B OD2   1 
ATOM   3197  N  N     . THR B  1 57  ? 12.561  -33.389 -13.021 1.00 38.16  ? 29  THR B N     1 
ATOM   3198  C  CA    . THR B  1 57  ? 12.564  -31.924 -13.084 1.00 35.59  ? 29  THR B CA    1 
ATOM   3199  C  C     . THR B  1 57  ? 13.955  -31.388 -13.388 1.00 36.72  ? 29  THR B C     1 
ATOM   3200  O  O     . THR B  1 57  ? 14.943  -32.002 -13.003 1.00 36.46  ? 29  THR B O     1 
ATOM   3201  C  CB    . THR B  1 57  ? 12.081  -31.294 -11.767 1.00 38.42  ? 29  THR B CB    1 
ATOM   3202  O  OG1   . THR B  1 57  ? 13.054  -31.549 -10.748 1.00 41.28  ? 29  THR B OG1   1 
ATOM   3203  C  CG2   . THR B  1 57  ? 10.744  -31.873 -11.359 1.00 38.41  ? 29  THR B CG2   1 
ATOM   3204  N  N     . PHE B  1 58  ? 14.036  -30.235 -14.066 1.00 32.66  ? 30  PHE B N     1 
ATOM   3205  C  CA    . PHE B  1 58  ? 15.334  -29.596 -14.298 1.00 37.23  ? 30  PHE B CA    1 
ATOM   3206  C  C     . PHE B  1 58  ? 15.640  -28.545 -13.223 1.00 41.54  ? 30  PHE B C     1 
ATOM   3207  O  O     . PHE B  1 58  ? 15.323  -27.351 -13.379 1.00 36.50  ? 30  PHE B O     1 
ATOM   3208  C  CB    . PHE B  1 58  ? 15.384  -28.957 -15.690 1.00 38.82  ? 30  PHE B CB    1 
ATOM   3209  C  CG    . PHE B  1 58  ? 15.427  -29.958 -16.810 1.00 30.44  ? 30  PHE B CG    1 
ATOM   3210  C  CD1   . PHE B  1 58  ? 16.637  -30.338 -17.370 1.00 30.80  ? 30  PHE B CD1   1 
ATOM   3211  C  CD2   . PHE B  1 58  ? 14.254  -30.520 -17.294 1.00 31.70  ? 30  PHE B CD2   1 
ATOM   3212  C  CE1   . PHE B  1 58  ? 16.686  -31.274 -18.406 1.00 30.13  ? 30  PHE B CE1   1 
ATOM   3213  C  CE2   . PHE B  1 58  ? 14.287  -31.463 -18.331 1.00 36.30  ? 30  PHE B CE2   1 
ATOM   3214  C  CZ    . PHE B  1 58  ? 15.511  -31.834 -18.886 1.00 33.68  ? 30  PHE B CZ    1 
ATOM   3215  N  N     . ASP B  1 59  ? 16.274  -28.996 -12.143 1.00 41.76  ? 31  ASP B N     1 
ATOM   3216  C  CA    . ASP B  1 59  ? 16.479  -28.159 -10.962 1.00 46.72  ? 31  ASP B CA    1 
ATOM   3217  C  C     . ASP B  1 59  ? 17.476  -27.033 -11.192 1.00 42.59  ? 31  ASP B C     1 
ATOM   3218  O  O     . ASP B  1 59  ? 17.218  -25.891 -10.811 1.00 43.86  ? 31  ASP B O     1 
ATOM   3219  C  CB    . ASP B  1 59  ? 16.930  -29.013 -9.772  1.00 43.08  ? 31  ASP B CB    1 
ATOM   3220  C  CG    . ASP B  1 59  ? 15.875  -30.002 -9.342  1.00 51.11  ? 31  ASP B CG    1 
ATOM   3221  O  OD1   . ASP B  1 59  ? 14.675  -29.642 -9.370  1.00 52.66  ? 31  ASP B OD1   1 
ATOM   3222  O  OD2   . ASP B  1 59  ? 16.243  -31.145 -8.989  1.00 57.99  ? 31  ASP B OD2   1 
ATOM   3223  N  N     . SER B  1 60  ? 18.617  -27.355 -11.792 1.00 37.22  ? 32  SER B N     1 
ATOM   3224  C  CA    . SER B  1 60  ? 19.625  -26.351 -12.072 1.00 42.13  ? 32  SER B CA    1 
ATOM   3225  C  C     . SER B  1 60  ? 19.078  -25.273 -13.021 1.00 45.00  ? 32  SER B C     1 
ATOM   3226  O  O     . SER B  1 60  ? 19.305  -24.069 -12.817 1.00 43.75  ? 32  SER B O     1 
ATOM   3227  C  CB    . SER B  1 60  ? 20.877  -26.995 -12.667 1.00 44.56  ? 32  SER B CB    1 
ATOM   3228  O  OG    . SER B  1 60  ? 21.806  -25.997 -13.093 1.00 52.72  ? 32  SER B OG    1 
ATOM   3229  N  N     . LEU B  1 61  ? 18.365  -25.707 -14.058 1.00 38.80  ? 33  LEU B N     1 
ATOM   3230  C  CA    . LEU B  1 61  ? 17.746  -24.781 -14.996 1.00 40.31  ? 33  LEU B CA    1 
ATOM   3231  C  C     . LEU B  1 61  ? 16.776  -23.844 -14.268 1.00 38.48  ? 33  LEU B C     1 
ATOM   3232  O  O     . LEU B  1 61  ? 16.766  -22.649 -14.537 1.00 36.71  ? 33  LEU B O     1 
ATOM   3233  C  CB    . LEU B  1 61  ? 17.018  -25.535 -16.099 1.00 33.74  ? 33  LEU B CB    1 
ATOM   3234  C  CG    . LEU B  1 61  ? 16.273  -24.693 -17.133 1.00 34.55  ? 33  LEU B CG    1 
ATOM   3235  C  CD1   . LEU B  1 61  ? 17.243  -23.981 -18.090 1.00 32.15  ? 33  LEU B CD1   1 
ATOM   3236  C  CD2   . LEU B  1 61  ? 15.264  -25.541 -17.907 1.00 29.04  ? 33  LEU B CD2   1 
ATOM   3237  N  N     . LYS B  1 62  ? 15.976  -24.398 -13.352 1.00 32.18  ? 34  LYS B N     1 
ATOM   3238  C  CA    . LYS B  1 62  ? 15.033  -23.608 -12.562 1.00 41.08  ? 34  LYS B CA    1 
ATOM   3239  C  C     . LYS B  1 62  ? 15.711  -22.429 -11.869 1.00 39.04  ? 34  LYS B C     1 
ATOM   3240  O  O     . LYS B  1 62  ? 15.280  -21.283 -12.016 1.00 36.31  ? 34  LYS B O     1 
ATOM   3241  C  CB    . LYS B  1 62  ? 14.340  -24.472 -11.509 1.00 42.86  ? 34  LYS B CB    1 
ATOM   3242  C  CG    . LYS B  1 62  ? 13.239  -23.756 -10.730 1.00 40.62  ? 34  LYS B CG    1 
ATOM   3243  C  CD    . LYS B  1 62  ? 12.731  -24.665 -9.612  1.00 47.21  ? 34  LYS B CD    1 
ATOM   3244  C  CE    . LYS B  1 62  ? 11.543  -24.093 -8.866  1.00 50.36  ? 34  LYS B CE    1 
ATOM   3245  N  NZ    . LYS B  1 62  ? 11.087  -25.075 -7.829  1.00 57.14  ? 34  LYS B NZ    1 
ATOM   3246  N  N     . ASP B  1 63  ? 16.774  -22.713 -11.123 1.00 40.68  ? 35  ASP B N     1 
ATOM   3247  C  CA    . ASP B  1 63  ? 17.483  -21.658 -10.409 1.00 42.55  ? 35  ASP B CA    1 
ATOM   3248  C  C     . ASP B  1 63  ? 18.123  -20.674 -11.385 1.00 35.79  ? 35  ASP B C     1 
ATOM   3249  O  O     . ASP B  1 63  ? 18.196  -19.475 -11.113 1.00 31.69  ? 35  ASP B O     1 
ATOM   3250  C  CB    . ASP B  1 63  ? 18.543  -22.250 -9.473  1.00 45.38  ? 35  ASP B CB    1 
ATOM   3251  C  CG    . ASP B  1 63  ? 17.949  -23.220 -8.453  1.00 51.27  ? 35  ASP B CG    1 
ATOM   3252  O  OD1   . ASP B  1 63  ? 16.781  -23.019 -8.043  1.00 55.98  ? 35  ASP B OD1   1 
ATOM   3253  O  OD2   . ASP B  1 63  ? 18.647  -24.192 -8.074  1.00 55.25  ? 35  ASP B OD2   1 
ATOM   3254  N  N     . ARG B  1 64  ? 18.565  -21.183 -12.530 1.00 34.86  ? 36  ARG B N     1 
ATOM   3255  C  CA    . ARG B  1 64  ? 19.276  -20.363 -13.506 1.00 32.82  ? 36  ARG B CA    1 
ATOM   3256  C  C     . ARG B  1 64  ? 18.334  -19.365 -14.166 1.00 30.11  ? 36  ARG B C     1 
ATOM   3257  O  O     . ARG B  1 64  ? 18.655  -18.178 -14.318 1.00 31.40  ? 36  ARG B O     1 
ATOM   3258  C  CB    . ARG B  1 64  ? 19.929  -21.254 -14.562 1.00 37.71  ? 36  ARG B CB    1 
ATOM   3259  C  CG    . ARG B  1 64  ? 20.830  -20.505 -15.509 1.00 38.52  ? 36  ARG B CG    1 
ATOM   3260  C  CD    . ARG B  1 64  ? 21.945  -19.794 -14.739 1.00 35.13  ? 36  ARG B CD    1 
ATOM   3261  N  NE    . ARG B  1 64  ? 22.924  -19.226 -15.644 1.00 36.24  ? 36  ARG B NE    1 
ATOM   3262  C  CZ    . ARG B  1 64  ? 24.127  -18.800 -15.289 1.00 37.79  ? 36  ARG B CZ    1 
ATOM   3263  N  NH1   . ARG B  1 64  ? 24.522  -18.879 -14.034 1.00 34.76  ? 36  ARG B NH1   1 
ATOM   3264  N  NH2   . ARG B  1 64  ? 24.940  -18.298 -16.203 1.00 40.24  ? 36  ARG B NH2   1 
ATOM   3265  N  N     . LEU B  1 65  ? 17.160  -19.858 -14.546 1.00 30.00  ? 37  LEU B N     1 
ATOM   3266  C  CA    . LEU B  1 65  ? 16.153  -19.025 -15.166 1.00 28.59  ? 37  LEU B CA    1 
ATOM   3267  C  C     . LEU B  1 65  ? 15.781  -17.896 -14.220 1.00 33.74  ? 37  LEU B C     1 
ATOM   3268  O  O     . LEU B  1 65  ? 15.683  -16.734 -14.630 1.00 35.59  ? 37  LEU B O     1 
ATOM   3269  C  CB    . LEU B  1 65  ? 14.921  -19.847 -15.543 1.00 30.72  ? 37  LEU B CB    1 
ATOM   3270  C  CG    . LEU B  1 65  ? 15.152  -20.877 -16.665 1.00 30.99  ? 37  LEU B CG    1 
ATOM   3271  C  CD1   . LEU B  1 65  ? 13.926  -21.742 -16.855 1.00 26.84  ? 37  LEU B CD1   1 
ATOM   3272  C  CD2   . LEU B  1 65  ? 15.499  -20.145 -17.940 1.00 34.30  ? 37  LEU B CD2   1 
ATOM   3273  N  N     . ILE B  1 66  ? 15.586  -18.238 -12.949 1.00 36.47  ? 38  ILE B N     1 
ATOM   3274  C  CA    . ILE B  1 66  ? 15.248  -17.246 -11.936 1.00 34.56  ? 38  ILE B CA    1 
ATOM   3275  C  C     . ILE B  1 66  ? 16.355  -16.207 -11.825 1.00 35.05  ? 38  ILE B C     1 
ATOM   3276  O  O     . ILE B  1 66  ? 16.095  -15.000 -11.881 1.00 35.36  ? 38  ILE B O     1 
ATOM   3277  C  CB    . ILE B  1 66  ? 14.991  -17.909 -10.571 1.00 33.12  ? 38  ILE B CB    1 
ATOM   3278  C  CG1   . ILE B  1 66  ? 13.662  -18.670 -10.621 1.00 33.81  ? 38  ILE B CG1   1 
ATOM   3279  C  CG2   . ILE B  1 66  ? 14.995  -16.863 -9.455  1.00 38.21  ? 38  ILE B CG2   1 
ATOM   3280  C  CD1   . ILE B  1 66  ? 13.438  -19.590 -9.463  1.00 35.55  ? 38  ILE B CD1   1 
ATOM   3281  N  N     . LEU B  1 67  ? 17.597  -16.665 -11.710 1.00 32.44  ? 39  LEU B N     1 
ATOM   3282  C  CA    . LEU B  1 67  ? 18.700  -15.724 -11.624 1.00 28.03  ? 39  LEU B CA    1 
ATOM   3283  C  C     . LEU B  1 67  ? 18.783  -14.836 -12.867 1.00 37.42  ? 39  LEU B C     1 
ATOM   3284  O  O     . LEU B  1 67  ? 18.916  -13.617 -12.743 1.00 38.69  ? 39  LEU B O     1 
ATOM   3285  C  CB    . LEU B  1 67  ? 20.018  -16.458 -11.436 1.00 34.98  ? 39  LEU B CB    1 
ATOM   3286  C  CG    . LEU B  1 67  ? 21.236  -15.544 -11.625 1.00 35.33  ? 39  LEU B CG    1 
ATOM   3287  C  CD1   . LEU B  1 67  ? 21.327  -14.526 -10.484 1.00 30.81  ? 39  LEU B CD1   1 
ATOM   3288  C  CD2   . LEU B  1 67  ? 22.509  -16.385 -11.739 1.00 39.06  ? 39  LEU B CD2   1 
ATOM   3289  N  N     . GLN B  1 68  ? 18.704  -15.438 -14.059 1.00 32.31  ? 40  GLN B N     1 
ATOM   3290  C  CA    . GLN B  1 68  ? 18.828  -14.664 -15.297 1.00 33.26  ? 40  GLN B CA    1 
ATOM   3291  C  C     . GLN B  1 68  ? 17.733  -13.618 -15.368 1.00 32.45  ? 40  GLN B C     1 
ATOM   3292  O  O     . GLN B  1 68  ? 17.969  -12.484 -15.788 1.00 30.55  ? 40  GLN B O     1 
ATOM   3293  C  CB    . GLN B  1 68  ? 18.759  -15.550 -16.552 1.00 27.68  ? 40  GLN B CB    1 
ATOM   3294  C  CG    . GLN B  1 68  ? 19.969  -16.424 -16.801 1.00 29.27  ? 40  GLN B CG    1 
ATOM   3295  C  CD    . GLN B  1 68  ? 21.235  -15.639 -17.064 1.00 36.12  ? 40  GLN B CD    1 
ATOM   3296  O  OE1   . GLN B  1 68  ? 21.927  -15.215 -16.129 1.00 36.64  ? 40  GLN B OE1   1 
ATOM   3297  N  NE2   . GLN B  1 68  ? 21.562  -15.452 -18.346 1.00 30.50  ? 40  GLN B NE2   1 
ATOM   3298  N  N     . GLU B  1 69  ? 16.527  -13.996 -14.955 1.00 28.70  ? 41  GLU B N     1 
ATOM   3299  C  CA    . GLU B  1 69  ? 15.446  -13.052 -15.065 1.00 32.93  ? 41  GLU B CA    1 
ATOM   3300  C  C     . GLU B  1 69  ? 15.691  -11.861 -14.127 1.00 37.55  ? 41  GLU B C     1 
ATOM   3301  O  O     . GLU B  1 69  ? 15.533  -10.708 -14.536 1.00 33.50  ? 41  GLU B O     1 
ATOM   3302  C  CB    . GLU B  1 69  ? 14.098  -13.697 -14.771 1.00 35.05  ? 41  GLU B CB    1 
ATOM   3303  C  CG    . GLU B  1 69  ? 12.929  -12.803 -15.208 1.00 46.56  ? 41  GLU B CG    1 
ATOM   3304  C  CD    . GLU B  1 69  ? 12.731  -11.592 -14.287 1.00 49.74  ? 41  GLU B CD    1 
ATOM   3305  O  OE1   . GLU B  1 69  ? 12.832  -11.761 -13.050 1.00 48.10  ? 41  GLU B OE1   1 
ATOM   3306  O  OE2   . GLU B  1 69  ? 12.486  -10.471 -14.794 1.00 63.80  ? 41  GLU B OE2   1 
ATOM   3307  N  N     . SER B  1 70  ? 16.081  -12.138 -12.884 1.00 33.80  ? 42  SER B N     1 
ATOM   3308  C  CA    . SER B  1 70  ? 16.302  -11.071 -11.918 1.00 33.91  ? 42  SER B CA    1 
ATOM   3309  C  C     . SER B  1 70  ? 17.426  -10.131 -12.378 1.00 37.36  ? 42  SER B C     1 
ATOM   3310  O  O     . SER B  1 70  ? 17.409  -8.935  -12.077 1.00 32.45  ? 42  SER B O     1 
ATOM   3311  C  CB    . SER B  1 70  ? 16.627  -11.657 -10.549 1.00 35.24  ? 42  SER B CB    1 
ATOM   3312  O  OG    . SER B  1 70  ? 17.949  -12.141 -10.537 1.00 36.80  ? 42  SER B OG    1 
ATOM   3313  N  N     . LEU B  1 71  ? 18.395  -10.679 -13.114 1.00 30.59  ? 43  LEU B N     1 
ATOM   3314  C  CA    . LEU B  1 71  ? 19.468  -9.877  -13.683 1.00 35.44  ? 43  LEU B CA    1 
ATOM   3315  C  C     . LEU B  1 71  ? 19.012  -9.072  -14.923 1.00 32.94  ? 43  LEU B C     1 
ATOM   3316  O  O     . LEU B  1 71  ? 19.729  -8.209  -15.400 1.00 32.17  ? 43  LEU B O     1 
ATOM   3317  C  CB    . LEU B  1 71  ? 20.659  -10.774 -14.046 1.00 36.09  ? 43  LEU B CB    1 
ATOM   3318  C  CG    . LEU B  1 71  ? 21.410  -11.409 -12.866 1.00 38.92  ? 43  LEU B CG    1 
ATOM   3319  C  CD1   . LEU B  1 71  ? 22.406  -12.470 -13.326 1.00 38.09  ? 43  LEU B CD1   1 
ATOM   3320  C  CD2   . LEU B  1 71  ? 22.130  -10.319 -12.070 1.00 41.51  ? 43  LEU B CD2   1 
ATOM   3321  N  N     . GLY B  1 72  ? 17.815  -9.344  -15.428 1.00 30.18  ? 44  GLY B N     1 
ATOM   3322  C  CA    . GLY B  1 72  ? 17.368  -8.721  -16.660 1.00 30.32  ? 44  GLY B CA    1 
ATOM   3323  C  C     . GLY B  1 72  ? 18.052  -9.296  -17.904 1.00 36.26  ? 44  GLY B C     1 
ATOM   3324  O  O     . GLY B  1 72  ? 18.182  -8.596  -18.906 1.00 29.72  ? 44  GLY B O     1 
ATOM   3325  N  N     . TYR B  1 73  ? 18.464  -10.570 -17.865 1.00 27.69  ? 45  TYR B N     1 
ATOM   3326  C  CA    . TYR B  1 73  ? 19.276  -11.118 -18.958 1.00 27.79  ? 45  TYR B CA    1 
ATOM   3327  C  C     . TYR B  1 73  ? 18.526  -12.025 -19.930 1.00 30.81  ? 45  TYR B C     1 
ATOM   3328  O  O     . TYR B  1 73  ? 19.127  -12.533 -20.881 1.00 28.40  ? 45  TYR B O     1 
ATOM   3329  C  CB    . TYR B  1 73  ? 20.471  -11.897 -18.408 1.00 32.71  ? 45  TYR B CB    1 
ATOM   3330  C  CG    . TYR B  1 73  ? 21.596  -11.055 -17.853 1.00 31.74  ? 45  TYR B CG    1 
ATOM   3331  C  CD1   . TYR B  1 73  ? 21.596  -9.665  -17.977 1.00 31.83  ? 45  TYR B CD1   1 
ATOM   3332  C  CD2   . TYR B  1 73  ? 22.674  -11.654 -17.216 1.00 36.60  ? 45  TYR B CD2   1 
ATOM   3333  C  CE1   . TYR B  1 73  ? 22.623  -8.915  -17.475 1.00 34.72  ? 45  TYR B CE1   1 
ATOM   3334  C  CE2   . TYR B  1 73  ? 23.712  -10.899 -16.706 1.00 36.93  ? 45  TYR B CE2   1 
ATOM   3335  C  CZ    . TYR B  1 73  ? 23.679  -9.536  -16.837 1.00 35.24  ? 45  TYR B CZ    1 
ATOM   3336  O  OH    . TYR B  1 73  ? 24.717  -8.792  -16.335 1.00 41.96  ? 45  TYR B OH    1 
ATOM   3337  N  N     . LEU B  1 74  ? 17.231  -12.243 -19.710 1.00 26.48  ? 46  LEU B N     1 
ATOM   3338  C  CA    . LEU B  1 74  ? 16.480  -13.079 -20.649 1.00 29.13  ? 46  LEU B CA    1 
ATOM   3339  C  C     . LEU B  1 74  ? 16.051  -12.238 -21.858 1.00 35.46  ? 46  LEU B C     1 
ATOM   3340  O  O     . LEU B  1 74  ? 16.136  -10.983 -21.838 1.00 29.29  ? 46  LEU B O     1 
ATOM   3341  C  CB    . LEU B  1 74  ? 15.262  -13.731 -19.982 1.00 31.19  ? 46  LEU B CB    1 
ATOM   3342  C  CG    . LEU B  1 74  ? 15.494  -14.775 -18.865 1.00 37.55  ? 46  LEU B CG    1 
ATOM   3343  C  CD1   . LEU B  1 74  ? 14.171  -15.293 -18.285 1.00 33.97  ? 46  LEU B CD1   1 
ATOM   3344  C  CD2   . LEU B  1 74  ? 16.345  -15.953 -19.376 1.00 28.04  ? 46  LEU B CD2   1 
ATOM   3345  N  N     . SER B  1 75  ? 15.597  -12.929 -22.906 1.00 25.04  ? 47  SER B N     1 
ATOM   3346  C  CA    . SER B  1 75  ? 15.225  -12.257 -24.141 1.00 31.56  ? 47  SER B CA    1 
ATOM   3347  C  C     . SER B  1 75  ? 13.752  -11.865 -24.158 1.00 30.57  ? 47  SER B C     1 
ATOM   3348  O  O     . SER B  1 75  ? 13.368  -10.904 -24.822 1.00 31.85  ? 47  SER B O     1 
ATOM   3349  C  CB    . SER B  1 75  ? 15.535  -13.149 -25.350 1.00 28.23  ? 47  SER B CB    1 
ATOM   3350  O  OG    . SER B  1 75  ? 14.670  -14.277 -25.372 1.00 30.34  ? 47  SER B OG    1 
ATOM   3351  N  N     . GLY B  1 76  ? 12.919  -12.625 -23.460 1.00 30.79  ? 48  GLY B N     1 
ATOM   3352  C  CA    . GLY B  1 76  ? 11.485  -12.472 -23.630 1.00 31.14  ? 48  GLY B CA    1 
ATOM   3353  C  C     . GLY B  1 76  ? 10.913  -13.436 -24.659 1.00 31.37  ? 48  GLY B C     1 
ATOM   3354  O  O     . GLY B  1 76  ? 9.704   -13.481 -24.851 1.00 40.39  ? 48  GLY B O     1 
ATOM   3355  N  N     . PHE B  1 77  ? 11.760  -14.214 -25.322 1.00 29.69  ? 49  PHE B N     1 
ATOM   3356  C  CA    . PHE B  1 77  ? 11.263  -15.277 -26.219 1.00 33.06  ? 49  PHE B CA    1 
ATOM   3357  C  C     . PHE B  1 77  ? 11.049  -16.620 -25.494 1.00 34.64  ? 49  PHE B C     1 
ATOM   3358  O  O     . PHE B  1 77  ? 10.513  -17.576 -26.076 1.00 33.91  ? 49  PHE B O     1 
ATOM   3359  C  CB    . PHE B  1 77  ? 12.218  -15.490 -27.403 1.00 31.93  ? 49  PHE B CB    1 
ATOM   3360  C  CG    . PHE B  1 77  ? 12.322  -14.298 -28.336 1.00 33.05  ? 49  PHE B CG    1 
ATOM   3361  C  CD1   . PHE B  1 77  ? 11.207  -13.520 -28.629 1.00 37.45  ? 49  PHE B CD1   1 
ATOM   3362  C  CD2   . PHE B  1 77  ? 13.534  -13.958 -28.913 1.00 32.11  ? 49  PHE B CD2   1 
ATOM   3363  C  CE1   . PHE B  1 77  ? 11.302  -12.416 -29.489 1.00 38.40  ? 49  PHE B CE1   1 
ATOM   3364  C  CE2   . PHE B  1 77  ? 13.642  -12.859 -29.777 1.00 30.40  ? 49  PHE B CE2   1 
ATOM   3365  C  CZ    . PHE B  1 77  ? 12.521  -12.092 -30.063 1.00 35.82  ? 49  PHE B CZ    1 
ATOM   3366  N  N     . GLU B  1 78  ? 11.479  -16.710 -24.236 1.00 38.88  ? 50  GLU B N     1 
ATOM   3367  C  CA    . GLU B  1 78  ? 11.303  -17.957 -23.460 1.00 37.81  ? 50  GLU B CA    1 
ATOM   3368  C  C     . GLU B  1 78  ? 9.845   -18.133 -23.043 1.00 34.14  ? 50  GLU B C     1 
ATOM   3369  O  O     . GLU B  1 78  ? 9.125   -17.148 -22.833 1.00 31.61  ? 50  GLU B O     1 
ATOM   3370  C  CB    . GLU B  1 78  ? 12.183  -17.972 -22.197 1.00 30.95  ? 50  GLU B CB    1 
ATOM   3371  C  CG    . GLU B  1 78  ? 13.682  -17.700 -22.407 1.00 34.84  ? 50  GLU B CG    1 
ATOM   3372  C  CD    . GLU B  1 78  ? 13.979  -16.215 -22.659 1.00 30.97  ? 50  GLU B CD    1 
ATOM   3373  O  OE1   . GLU B  1 78  ? 13.046  -15.409 -22.517 1.00 33.95  ? 50  GLU B OE1   1 
ATOM   3374  O  OE2   . GLU B  1 78  ? 15.126  -15.864 -23.007 1.00 27.14  ? 50  GLU B OE2   1 
ATOM   3375  N  N     . GLU B  1 79  ? 9.416   -19.386 -22.910 1.00 33.28  ? 51  GLU B N     1 
ATOM   3376  C  CA    . GLU B  1 79  ? 8.170   -19.690 -22.205 1.00 35.15  ? 51  GLU B CA    1 
ATOM   3377  C  C     . GLU B  1 79  ? 8.233   -18.964 -20.841 1.00 29.44  ? 51  GLU B C     1 
ATOM   3378  O  O     . GLU B  1 79  ? 9.256   -19.027 -20.150 1.00 35.33  ? 51  GLU B O     1 
ATOM   3379  C  CB    . GLU B  1 79  ? 8.001   -21.214 -22.063 1.00 30.87  ? 51  GLU B CB    1 
ATOM   3380  C  CG    . GLU B  1 79  ? 7.017   -21.673 -21.004 1.00 34.93  ? 51  GLU B CG    1 
ATOM   3381  C  CD    . GLU B  1 79  ? 5.587   -21.236 -21.271 1.00 38.68  ? 51  GLU B CD    1 
ATOM   3382  O  OE1   . GLU B  1 79  ? 5.127   -21.354 -22.424 1.00 41.08  ? 51  GLU B OE1   1 
ATOM   3383  O  OE2   . GLU B  1 79  ? 4.919   -20.771 -20.319 1.00 38.51  ? 51  GLU B OE2   1 
ATOM   3384  N  N     . PRO B  1 80  ? 7.173   -18.231 -20.474 1.00 33.36  ? 52  PRO B N     1 
ATOM   3385  C  CA    . PRO B  1 80  ? 7.262   -17.445 -19.227 1.00 37.81  ? 52  PRO B CA    1 
ATOM   3386  C  C     . PRO B  1 80  ? 7.014   -18.245 -17.931 1.00 40.40  ? 52  PRO B C     1 
ATOM   3387  O  O     . PRO B  1 80  ? 7.469   -17.834 -16.850 1.00 37.78  ? 52  PRO B O     1 
ATOM   3388  C  CB    . PRO B  1 80  ? 6.184   -16.371 -19.423 1.00 40.20  ? 52  PRO B CB    1 
ATOM   3389  C  CG    . PRO B  1 80  ? 5.191   -17.008 -20.333 1.00 43.49  ? 52  PRO B CG    1 
ATOM   3390  C  CD    . PRO B  1 80  ? 5.964   -17.910 -21.252 1.00 36.91  ? 52  PRO B CD    1 
ATOM   3391  N  N     . ASP B  1 81  ? 6.318   -19.373 -18.032 1.00 39.03  ? 53  ASP B N     1 
ATOM   3392  C  CA    . ASP B  1 81  ? 5.998   -20.168 -16.848 1.00 35.00  ? 53  ASP B CA    1 
ATOM   3393  C  C     . ASP B  1 81  ? 7.150   -21.094 -16.525 1.00 34.81  ? 53  ASP B C     1 
ATOM   3394  O  O     . ASP B  1 81  ? 7.361   -22.109 -17.199 1.00 35.60  ? 53  ASP B O     1 
ATOM   3395  C  CB    . ASP B  1 81  ? 4.714   -20.962 -17.064 1.00 41.31  ? 53  ASP B CB    1 
ATOM   3396  C  CG    . ASP B  1 81  ? 4.201   -21.609 -15.784 1.00 45.61  ? 53  ASP B CG    1 
ATOM   3397  O  OD1   . ASP B  1 81  ? 5.013   -21.978 -14.908 1.00 42.15  ? 53  ASP B OD1   1 
ATOM   3398  O  OD2   . ASP B  1 81  ? 2.968   -21.750 -15.663 1.00 54.65  ? 53  ASP B OD2   1 
ATOM   3399  N  N     . ILE B  1 82  ? 7.897   -20.751 -15.487 1.00 31.73  ? 54  ILE B N     1 
ATOM   3400  C  CA    . ILE B  1 82  ? 9.112   -21.482 -15.192 1.00 34.29  ? 54  ILE B CA    1 
ATOM   3401  C  C     . ILE B  1 82  ? 8.774   -22.893 -14.718 1.00 39.60  ? 54  ILE B C     1 
ATOM   3402  O  O     . ILE B  1 82  ? 9.543   -23.837 -14.962 1.00 36.77  ? 54  ILE B O     1 
ATOM   3403  C  CB    . ILE B  1 82  ? 9.971   -20.749 -14.150 1.00 36.32  ? 54  ILE B CB    1 
ATOM   3404  C  CG1   . ILE B  1 82  ? 10.516  -19.456 -14.740 1.00 36.66  ? 54  ILE B CG1   1 
ATOM   3405  C  CG2   . ILE B  1 82  ? 11.158  -21.582 -13.736 1.00 37.30  ? 54  ILE B CG2   1 
ATOM   3406  C  CD1   . ILE B  1 82  ? 11.495  -18.745 -13.796 1.00 40.32  ? 54  ILE B CD1   1 
ATOM   3407  N  N     . GLU B  1 83  ? 7.612   -23.058 -14.092 1.00 34.74  ? 55  GLU B N     1 
ATOM   3408  C  CA    . GLU B  1 83  ? 7.226   -24.389 -13.596 1.00 43.26  ? 55  GLU B CA    1 
ATOM   3409  C  C     . GLU B  1 83  ? 7.110   -25.369 -14.770 1.00 39.10  ? 55  GLU B C     1 
ATOM   3410  O  O     . GLU B  1 83  ? 7.658   -26.472 -14.725 1.00 40.27  ? 55  GLU B O     1 
ATOM   3411  C  CB    . GLU B  1 83  ? 5.908   -24.339 -12.817 1.00 41.88  ? 55  GLU B CB    1 
ATOM   3412  C  CG    . GLU B  1 83  ? 5.987   -23.613 -11.489 1.00 46.48  ? 55  GLU B CG    1 
ATOM   3413  C  CD    . GLU B  1 83  ? 6.815   -24.365 -10.473 1.00 55.08  ? 55  GLU B CD    1 
ATOM   3414  O  OE1   . GLU B  1 83  ? 6.228   -25.155 -9.695  1.00 63.10  ? 55  GLU B OE1   1 
ATOM   3415  O  OE2   . GLU B  1 83  ? 8.051   -24.169 -10.446 1.00 54.81  ? 55  GLU B OE2   1 
ATOM   3416  N  N     . LYS B  1 84  ? 6.421   -24.939 -15.826 1.00 38.13  ? 56  LYS B N     1 
ATOM   3417  C  CA    . LYS B  1 84  ? 6.261   -25.746 -17.031 1.00 40.89  ? 56  LYS B CA    1 
ATOM   3418  C  C     . LYS B  1 84  ? 7.599   -26.014 -17.735 1.00 37.48  ? 56  LYS B C     1 
ATOM   3419  O  O     . LYS B  1 84  ? 7.815   -27.105 -18.264 1.00 43.44  ? 56  LYS B O     1 
ATOM   3420  C  CB    . LYS B  1 84  ? 5.290   -25.070 -17.997 1.00 36.15  ? 56  LYS B CB    1 
ATOM   3421  C  CG    . LYS B  1 84  ? 3.828   -25.114 -17.580 1.00 37.38  ? 56  LYS B CG    1 
ATOM   3422  C  CD    . LYS B  1 84  ? 2.979   -24.398 -18.617 1.00 43.61  ? 56  LYS B CD    1 
ATOM   3423  C  CE    . LYS B  1 84  ? 1.495   -24.641 -18.430 1.00 45.36  ? 56  LYS B CE    1 
ATOM   3424  N  NZ    . LYS B  1 84  ? 0.726   -23.685 -19.283 1.00 60.78  ? 56  LYS B NZ    1 
ATOM   3425  N  N     . ARG B  1 85  ? 8.491   -25.030 -17.721 1.00 31.72  ? 57  ARG B N     1 
ATOM   3426  C  CA    . ARG B  1 85  ? 9.810   -25.164 -18.334 1.00 34.15  ? 57  ARG B CA    1 
ATOM   3427  C  C     . ARG B  1 85  ? 10.670  -26.253 -17.717 1.00 35.99  ? 57  ARG B C     1 
ATOM   3428  O  O     . ARG B  1 85  ? 11.515  -26.829 -18.397 1.00 40.39  ? 57  ARG B O     1 
ATOM   3429  C  CB    . ARG B  1 85  ? 10.586  -23.845 -18.257 1.00 27.81  ? 57  ARG B CB    1 
ATOM   3430  C  CG    . ARG B  1 85  ? 9.919   -22.722 -18.988 1.00 30.26  ? 57  ARG B CG    1 
ATOM   3431  C  CD    . ARG B  1 85  ? 10.929  -21.797 -19.643 1.00 33.06  ? 57  ARG B CD    1 
ATOM   3432  N  NE    . ARG B  1 85  ? 11.613  -22.407 -20.782 1.00 29.50  ? 57  ARG B NE    1 
ATOM   3433  C  CZ    . ARG B  1 85  ? 12.752  -21.956 -21.303 1.00 34.90  ? 57  ARG B CZ    1 
ATOM   3434  N  NH1   . ARG B  1 85  ? 13.333  -20.867 -20.806 1.00 29.28  ? 57  ARG B NH1   1 
ATOM   3435  N  NH2   . ARG B  1 85  ? 13.312  -22.591 -22.333 1.00 32.20  ? 57  ARG B NH2   1 
ATOM   3436  N  N     . VAL B  1 86  ? 10.492  -26.529 -16.430 1.00 36.21  ? 58  VAL B N     1 
ATOM   3437  C  CA    . VAL B  1 86  ? 11.447  -27.400 -15.761 1.00 32.74  ? 58  VAL B CA    1 
ATOM   3438  C  C     . VAL B  1 86  ? 10.821  -28.708 -15.307 1.00 32.18  ? 58  VAL B C     1 
ATOM   3439  O  O     . VAL B  1 86  ? 11.474  -29.505 -14.647 1.00 30.44  ? 58  VAL B O     1 
ATOM   3440  C  CB    . VAL B  1 86  ? 12.097  -26.684 -14.547 1.00 33.23  ? 58  VAL B CB    1 
ATOM   3441  C  CG1   . VAL B  1 86  ? 12.716  -25.360 -14.994 1.00 31.81  ? 58  VAL B CG1   1 
ATOM   3442  C  CG2   . VAL B  1 86  ? 11.065  -26.444 -13.441 1.00 34.77  ? 58  VAL B CG2   1 
ATOM   3443  N  N     . THR B  1 87  ? 9.559   -28.929 -15.666 1.00 30.48  ? 59  THR B N     1 
ATOM   3444  C  CA    . THR B  1 87  ? 8.821   -30.069 -15.131 1.00 35.89  ? 59  THR B CA    1 
ATOM   3445  C  C     . THR B  1 87  ? 8.164   -30.858 -16.260 1.00 37.03  ? 59  THR B C     1 
ATOM   3446  O  O     . THR B  1 87  ? 6.994   -30.629 -16.580 1.00 37.79  ? 59  THR B O     1 
ATOM   3447  C  CB    . THR B  1 87  ? 7.747   -29.613 -14.101 1.00 39.01  ? 59  THR B CB    1 
ATOM   3448  O  OG1   . THR B  1 87  ? 8.316   -28.642 -13.212 1.00 39.02  ? 59  THR B OG1   1 
ATOM   3449  C  CG2   . THR B  1 87  ? 7.232   -30.799 -13.278 1.00 41.41  ? 59  THR B CG2   1 
ATOM   3450  N  N     . PRO B  1 88  ? 8.930   -31.771 -16.885 1.00 34.78  ? 60  PRO B N     1 
ATOM   3451  C  CA    . PRO B  1 88  ? 8.417   -32.566 -18.010 1.00 36.71  ? 60  PRO B CA    1 
ATOM   3452  C  C     . PRO B  1 88  ? 7.128   -33.306 -17.663 1.00 37.56  ? 60  PRO B C     1 
ATOM   3453  O  O     . PRO B  1 88  ? 6.294   -33.527 -18.552 1.00 37.76  ? 60  PRO B O     1 
ATOM   3454  C  CB    . PRO B  1 88  ? 9.556   -33.551 -18.298 1.00 33.88  ? 60  PRO B CB    1 
ATOM   3455  C  CG    . PRO B  1 88  ? 10.797  -32.862 -17.819 1.00 32.72  ? 60  PRO B CG    1 
ATOM   3456  C  CD    . PRO B  1 88  ? 10.348  -32.066 -16.599 1.00 33.63  ? 60  PRO B CD    1 
ATOM   3457  N  N     . LYS B  1 89  ? 6.946   -33.661 -16.391 1.00 40.02  ? 61  LYS B N     1 
ATOM   3458  C  CA    . LYS B  1 89  ? 5.752   -34.404 -15.989 1.00 39.67  ? 61  LYS B CA    1 
ATOM   3459  C  C     . LYS B  1 89  ? 4.513   -33.521 -15.920 1.00 42.90  ? 61  LYS B C     1 
ATOM   3460  O  O     . LYS B  1 89  ? 3.390   -34.029 -15.943 1.00 39.29  ? 61  LYS B O     1 
ATOM   3461  C  CB    . LYS B  1 89  ? 5.971   -35.097 -14.650 1.00 39.73  ? 61  LYS B CB    1 
ATOM   3462  C  CG    . LYS B  1 89  ? 7.012   -36.183 -14.691 1.00 39.16  ? 61  LYS B CG    1 
ATOM   3463  C  CD    . LYS B  1 89  ? 7.111   -36.902 -13.364 1.00 38.49  ? 61  LYS B CD    1 
ATOM   3464  C  CE    . LYS B  1 89  ? 8.393   -37.719 -13.274 1.00 35.51  ? 61  LYS B CE    1 
ATOM   3465  N  NZ    . LYS B  1 89  ? 8.443   -38.465 -11.970 1.00 46.06  ? 61  LYS B NZ    1 
ATOM   3466  N  N     . LEU B  1 90  ? 4.722   -32.203 -15.843 1.00 41.29  ? 62  LEU B N     1 
ATOM   3467  C  CA    . LEU B  1 90  ? 3.634   -31.240 -15.996 1.00 36.48  ? 62  LEU B CA    1 
ATOM   3468  C  C     . LEU B  1 90  ? 3.175   -31.165 -17.441 1.00 39.53  ? 62  LEU B C     1 
ATOM   3469  O  O     . LEU B  1 90  ? 1.994   -30.990 -17.718 1.00 47.80  ? 62  LEU B O     1 
ATOM   3470  C  CB    . LEU B  1 90  ? 4.068   -29.852 -15.530 1.00 42.83  ? 62  LEU B CB    1 
ATOM   3471  C  CG    . LEU B  1 90  ? 3.274   -29.255 -14.375 1.00 50.15  ? 62  LEU B CG    1 
ATOM   3472  C  CD1   . LEU B  1 90  ? 3.769   -27.828 -14.064 1.00 40.43  ? 62  LEU B CD1   1 
ATOM   3473  C  CD2   . LEU B  1 90  ? 1.777   -29.284 -14.700 1.00 48.17  ? 62  LEU B CD2   1 
ATOM   3474  N  N     . LEU B  1 91  ? 4.113   -31.296 -18.367 1.00 41.33  ? 63  LEU B N     1 
ATOM   3475  C  CA    . LEU B  1 91  ? 3.806   -31.142 -19.786 1.00 39.53  ? 63  LEU B CA    1 
ATOM   3476  C  C     . LEU B  1 91  ? 3.158   -32.409 -20.326 1.00 41.80  ? 63  LEU B C     1 
ATOM   3477  O  O     . LEU B  1 91  ? 2.265   -32.358 -21.176 1.00 43.97  ? 63  LEU B O     1 
ATOM   3478  C  CB    . LEU B  1 91  ? 5.074   -30.796 -20.564 1.00 41.47  ? 63  LEU B CB    1 
ATOM   3479  C  CG    . LEU B  1 91  ? 5.756   -29.530 -20.023 1.00 43.34  ? 63  LEU B CG    1 
ATOM   3480  C  CD1   . LEU B  1 91  ? 7.073   -29.232 -20.717 1.00 37.81  ? 63  LEU B CD1   1 
ATOM   3481  C  CD2   . LEU B  1 91  ? 4.823   -28.329 -20.123 1.00 40.67  ? 63  LEU B CD2   1 
ATOM   3482  N  N     . LEU B  1 92  ? 3.606   -33.550 -19.814 1.00 40.83  ? 64  LEU B N     1 
ATOM   3483  C  CA    . LEU B  1 92  ? 3.025   -34.834 -20.188 1.00 40.27  ? 64  LEU B CA    1 
ATOM   3484  C  C     . LEU B  1 92  ? 2.785   -35.661 -18.920 1.00 38.01  ? 64  LEU B C     1 
ATOM   3485  O  O     . LEU B  1 92  ? 3.735   -36.087 -18.253 1.00 32.28  ? 64  LEU B O     1 
ATOM   3486  C  CB    . LEU B  1 92  ? 3.928   -35.591 -21.177 1.00 35.74  ? 64  LEU B CB    1 
ATOM   3487  C  CG    . LEU B  1 92  ? 3.361   -36.925 -21.708 1.00 38.27  ? 64  LEU B CG    1 
ATOM   3488  C  CD1   . LEU B  1 92  ? 2.220   -36.692 -22.684 1.00 36.37  ? 64  LEU B CD1   1 
ATOM   3489  C  CD2   . LEU B  1 92  ? 4.432   -37.811 -22.333 1.00 34.84  ? 64  LEU B CD2   1 
ATOM   3490  N  N     . PRO B  1 93  ? 1.511   -35.858 -18.570 1.00 42.17  ? 65  PRO B N     1 
ATOM   3491  C  CA    . PRO B  1 93  ? 1.151   -36.635 -17.380 1.00 47.07  ? 65  PRO B CA    1 
ATOM   3492  C  C     . PRO B  1 93  ? 1.885   -37.967 -17.348 1.00 44.75  ? 65  PRO B C     1 
ATOM   3493  O  O     . PRO B  1 93  ? 1.905   -38.686 -18.350 1.00 43.24  ? 65  PRO B O     1 
ATOM   3494  C  CB    . PRO B  1 93  ? -0.359  -36.836 -17.534 1.00 51.10  ? 65  PRO B CB    1 
ATOM   3495  C  CG    . PRO B  1 93  ? -0.810  -35.651 -18.356 1.00 48.62  ? 65  PRO B CG    1 
ATOM   3496  C  CD    . PRO B  1 93  ? 0.326   -35.366 -19.299 1.00 43.88  ? 65  PRO B CD    1 
ATOM   3497  N  N     . LYS B  1 94  ? 2.539   -38.247 -16.228 1.00 42.90  ? 66  LYS B N     1 
ATOM   3498  C  CA    . LYS B  1 94  ? 3.154   -39.551 -15.988 1.00 50.09  ? 66  LYS B CA    1 
ATOM   3499  C  C     . LYS B  1 94  ? 4.241   -39.879 -17.018 1.00 44.70  ? 66  LYS B C     1 
ATOM   3500  O  O     . LYS B  1 94  ? 4.454   -41.044 -17.385 1.00 39.27  ? 66  LYS B O     1 
ATOM   3501  C  CB    . LYS B  1 94  ? 2.067   -40.638 -15.960 1.00 53.60  ? 66  LYS B CB    1 
ATOM   3502  C  CG    . LYS B  1 94  ? 0.993   -40.413 -14.877 1.00 52.10  ? 66  LYS B CG    1 
ATOM   3503  C  CD    . LYS B  1 94  ? -0.160  -41.421 -14.979 1.00 61.17  ? 66  LYS B CD    1 
ATOM   3504  C  CE    . LYS B  1 94  ? -0.988  -41.232 -16.254 1.00 62.55  ? 66  LYS B CE    1 
ATOM   3505  N  NZ    . LYS B  1 94  ? -2.080  -42.250 -16.406 1.00 53.02  ? 66  LYS B NZ    1 
ATOM   3506  N  N     . ALA B  1 95  ? 4.922   -38.834 -17.478 1.00 38.51  ? 67  ALA B N     1 
ATOM   3507  C  CA    . ALA B  1 95  ? 6.109   -38.973 -18.313 1.00 38.01  ? 67  ALA B CA    1 
ATOM   3508  C  C     . ALA B  1 95  ? 7.216   -39.723 -17.592 1.00 38.70  ? 67  ALA B C     1 
ATOM   3509  O  O     . ALA B  1 95  ? 7.335   -39.650 -16.372 1.00 39.44  ? 67  ALA B O     1 
ATOM   3510  C  CB    . ALA B  1 95  ? 6.615   -37.608 -18.747 1.00 33.32  ? 67  ALA B CB    1 
ATOM   3511  N  N     . LYS B  1 96  ? 8.052   -40.422 -18.352 1.00 32.17  ? 68  LYS B N     1 
ATOM   3512  C  CA    . LYS B  1 96  ? 9.123   -41.188 -17.740 1.00 37.23  ? 68  LYS B CA    1 
ATOM   3513  C  C     . LYS B  1 96  ? 10.467  -40.964 -18.394 1.00 36.15  ? 68  LYS B C     1 
ATOM   3514  O  O     . LYS B  1 96  ? 11.495  -41.306 -17.817 1.00 38.22  ? 68  LYS B O     1 
ATOM   3515  C  CB    . LYS B  1 96  ? 8.790   -42.685 -17.777 1.00 35.66  ? 68  LYS B CB    1 
ATOM   3516  C  CG    . LYS B  1 96  ? 7.532   -43.049 -17.011 1.00 36.49  ? 68  LYS B CG    1 
ATOM   3517  C  CD    . LYS B  1 96  ? 7.829   -43.301 -15.535 1.00 43.39  ? 68  LYS B CD    1 
ATOM   3518  C  CE    . LYS B  1 96  ? 6.577   -43.811 -14.805 1.00 49.69  ? 68  LYS B CE    1 
ATOM   3519  N  NZ    . LYS B  1 96  ? 6.864   -44.317 -13.418 1.00 63.01  ? 68  LYS B NZ    1 
ATOM   3520  N  N     . SER B  1 97  ? 10.466  -40.424 -19.609 1.00 36.42  ? 69  SER B N     1 
ATOM   3521  C  CA    . SER B  1 97  ? 11.715  -40.193 -20.322 1.00 32.41  ? 69  SER B CA    1 
ATOM   3522  C  C     . SER B  1 97  ? 11.575  -39.020 -21.294 1.00 30.50  ? 69  SER B C     1 
ATOM   3523  O  O     . SER B  1 97  ? 10.465  -38.613 -21.628 1.00 32.13  ? 69  SER B O     1 
ATOM   3524  C  CB    . SER B  1 97  ? 12.144  -41.452 -21.089 1.00 38.08  ? 69  SER B CB    1 
ATOM   3525  O  OG    . SER B  1 97  ? 11.268  -41.723 -22.188 1.00 31.80  ? 69  SER B OG    1 
ATOM   3526  N  N     . ILE B  1 98  ? 12.699  -38.500 -21.762 1.00 25.11  ? 70  ILE B N     1 
ATOM   3527  C  CA    . ILE B  1 98  ? 12.678  -37.546 -22.874 1.00 32.04  ? 70  ILE B CA    1 
ATOM   3528  C  C     . ILE B  1 98  ? 13.706  -37.954 -23.926 1.00 30.41  ? 70  ILE B C     1 
ATOM   3529  O  O     . ILE B  1 98  ? 14.871  -38.185 -23.606 1.00 32.76  ? 70  ILE B O     1 
ATOM   3530  C  CB    . ILE B  1 98  ? 12.992  -36.095 -22.439 1.00 28.58  ? 70  ILE B CB    1 
ATOM   3531  C  CG1   . ILE B  1 98  ? 12.065  -35.620 -21.333 1.00 30.03  ? 70  ILE B CG1   1 
ATOM   3532  C  CG2   . ILE B  1 98  ? 12.895  -35.135 -23.638 1.00 32.06  ? 70  ILE B CG2   1 
ATOM   3533  C  CD1   . ILE B  1 98  ? 12.478  -34.216 -20.821 1.00 34.31  ? 70  ILE B CD1   1 
ATOM   3534  N  N     . VAL B  1 99  ? 13.283  -38.019 -25.182 1.00 28.09  ? 71  VAL B N     1 
ATOM   3535  C  CA    . VAL B  1 99  ? 14.203  -38.369 -26.259 1.00 31.70  ? 71  VAL B CA    1 
ATOM   3536  C  C     . VAL B  1 99  ? 14.697  -37.111 -26.981 1.00 28.45  ? 71  VAL B C     1 
ATOM   3537  O  O     . VAL B  1 99  ? 13.911  -36.383 -27.565 1.00 27.02  ? 71  VAL B O     1 
ATOM   3538  C  CB    . VAL B  1 99  ? 13.527  -39.329 -27.271 1.00 37.46  ? 71  VAL B CB    1 
ATOM   3539  C  CG1   . VAL B  1 99  ? 14.467  -39.658 -28.432 1.00 35.20  ? 71  VAL B CG1   1 
ATOM   3540  C  CG2   . VAL B  1 99  ? 13.066  -40.604 -26.554 1.00 34.18  ? 71  VAL B CG2   1 
ATOM   3541  N  N     . ALA B  1 100 ? 15.998  -36.861 -26.928 1.00 29.36  ? 72  ALA B N     1 
ATOM   3542  C  CA    . ALA B  1 100 ? 16.574  -35.697 -27.574 1.00 29.52  ? 72  ALA B CA    1 
ATOM   3543  C  C     . ALA B  1 100 ? 17.120  -36.035 -28.965 1.00 32.11  ? 72  ALA B C     1 
ATOM   3544  O  O     . ALA B  1 100 ? 17.862  -37.002 -29.127 1.00 31.93  ? 72  ALA B O     1 
ATOM   3545  C  CB    . ALA B  1 100 ? 17.679  -35.117 -26.718 1.00 23.83  ? 72  ALA B CB    1 
ATOM   3546  N  N     . ILE B  1 101 ? 16.787  -35.222 -29.959 1.00 26.15  ? 73  ILE B N     1 
ATOM   3547  C  CA    . ILE B  1 101 ? 17.398  -35.378 -31.274 1.00 32.84  ? 73  ILE B CA    1 
ATOM   3548  C  C     . ILE B  1 101 ? 18.114  -34.110 -31.714 1.00 35.35  ? 73  ILE B C     1 
ATOM   3549  O  O     . ILE B  1 101 ? 17.725  -32.990 -31.355 1.00 30.87  ? 73  ILE B O     1 
ATOM   3550  C  CB    . ILE B  1 101 ? 16.362  -35.770 -32.349 1.00 30.14  ? 73  ILE B CB    1 
ATOM   3551  C  CG1   . ILE B  1 101 ? 15.370  -34.635 -32.588 1.00 30.23  ? 73  ILE B CG1   1 
ATOM   3552  C  CG2   . ILE B  1 101 ? 15.644  -37.082 -31.962 1.00 26.57  ? 73  ILE B CG2   1 
ATOM   3553  C  CD1   . ILE B  1 101 ? 14.434  -34.896 -33.734 1.00 29.45  ? 73  ILE B CD1   1 
ATOM   3554  N  N     . ALA B  1 102 ? 19.182  -34.297 -32.481 1.00 33.93  ? 74  ALA B N     1 
ATOM   3555  C  CA    . ALA B  1 102 ? 19.886  -33.186 -33.101 1.00 29.20  ? 74  ALA B CA    1 
ATOM   3556  C  C     . ALA B  1 102 ? 20.108  -33.487 -34.591 1.00 33.82  ? 74  ALA B C     1 
ATOM   3557  O  O     . ALA B  1 102 ? 20.360  -34.641 -34.965 1.00 30.17  ? 74  ALA B O     1 
ATOM   3558  C  CB    . ALA B  1 102 ? 21.209  -32.936 -32.405 1.00 25.22  ? 74  ALA B CB    1 
ATOM   3559  N  N     . LEU B  1 103 ? 19.993  -32.457 -35.424 1.00 26.88  ? 75  LEU B N     1 
ATOM   3560  C  CA    . LEU B  1 103 ? 20.364  -32.529 -36.842 1.00 32.12  ? 75  LEU B CA    1 
ATOM   3561  C  C     . LEU B  1 103 ? 21.390  -31.457 -37.141 1.00 31.66  ? 75  LEU B C     1 
ATOM   3562  O  O     . LEU B  1 103 ? 21.195  -30.273 -36.792 1.00 29.01  ? 75  LEU B O     1 
ATOM   3563  C  CB    . LEU B  1 103 ? 19.159  -32.351 -37.769 1.00 30.96  ? 75  LEU B CB    1 
ATOM   3564  C  CG    . LEU B  1 103 ? 18.365  -33.618 -38.128 1.00 29.05  ? 75  LEU B CG    1 
ATOM   3565  C  CD1   . LEU B  1 103 ? 17.502  -34.078 -36.961 1.00 28.17  ? 75  LEU B CD1   1 
ATOM   3566  C  CD2   . LEU B  1 103 ? 17.513  -33.377 -39.380 1.00 27.47  ? 75  LEU B CD2   1 
ATOM   3567  N  N     . ALA B  1 104 ? 22.483  -31.867 -37.770 1.00 25.13  ? 76  ALA B N     1 
ATOM   3568  C  CA    . ALA B  1 104 ? 23.538  -30.935 -38.146 1.00 34.74  ? 76  ALA B CA    1 
ATOM   3569  C  C     . ALA B  1 104 ? 23.140  -30.122 -39.380 1.00 31.73  ? 76  ALA B C     1 
ATOM   3570  O  O     . ALA B  1 104 ? 22.540  -30.661 -40.325 1.00 34.52  ? 76  ALA B O     1 
ATOM   3571  C  CB    . ALA B  1 104 ? 24.844  -31.684 -38.402 1.00 28.00  ? 76  ALA B CB    1 
ATOM   3572  N  N     . TYR B  1 105 ? 23.483  -28.838 -39.386 1.00 30.86  ? 77  TYR B N     1 
ATOM   3573  C  CA    . TYR B  1 105 ? 23.196  -28.010 -40.560 1.00 28.03  ? 77  TYR B CA    1 
ATOM   3574  C  C     . TYR B  1 105 ? 24.458  -27.416 -41.159 1.00 29.83  ? 77  TYR B C     1 
ATOM   3575  O  O     . TYR B  1 105 ? 25.481  -27.315 -40.487 1.00 28.96  ? 77  TYR B O     1 
ATOM   3576  C  CB    . TYR B  1 105 ? 22.205  -26.894 -40.227 1.00 29.85  ? 77  TYR B CB    1 
ATOM   3577  C  CG    . TYR B  1 105 ? 22.604  -25.957 -39.111 1.00 29.23  ? 77  TYR B CG    1 
ATOM   3578  C  CD1   . TYR B  1 105 ? 23.463  -24.877 -39.343 1.00 34.91  ? 77  TYR B CD1   1 
ATOM   3579  C  CD2   . TYR B  1 105 ? 22.088  -26.123 -37.833 1.00 27.60  ? 77  TYR B CD2   1 
ATOM   3580  C  CE1   . TYR B  1 105 ? 23.810  -24.001 -38.313 1.00 34.28  ? 77  TYR B CE1   1 
ATOM   3581  C  CE2   . TYR B  1 105 ? 22.417  -25.252 -36.810 1.00 29.19  ? 77  TYR B CE2   1 
ATOM   3582  C  CZ    . TYR B  1 105 ? 23.283  -24.200 -37.044 1.00 31.02  ? 77  TYR B CZ    1 
ATOM   3583  O  OH    . TYR B  1 105 ? 23.603  -23.349 -36.001 1.00 33.87  ? 77  TYR B OH    1 
ATOM   3584  N  N     . PRO B  1 106 ? 24.395  -27.043 -42.448 1.00 28.69  ? 78  PRO B N     1 
ATOM   3585  C  CA    . PRO B  1 106 ? 25.570  -26.505 -43.137 1.00 34.13  ? 78  PRO B CA    1 
ATOM   3586  C  C     . PRO B  1 106 ? 26.032  -25.173 -42.585 1.00 35.72  ? 78  PRO B C     1 
ATOM   3587  O  O     . PRO B  1 106 ? 25.229  -24.338 -42.166 1.00 33.92  ? 78  PRO B O     1 
ATOM   3588  C  CB    . PRO B  1 106 ? 25.100  -26.365 -44.586 1.00 35.30  ? 78  PRO B CB    1 
ATOM   3589  C  CG    . PRO B  1 106 ? 23.625  -26.453 -44.537 1.00 31.25  ? 78  PRO B CG    1 
ATOM   3590  C  CD    . PRO B  1 106 ? 23.281  -27.293 -43.373 1.00 30.52  ? 78  PRO B CD    1 
ATOM   3591  N  N     . SER B  1 107 ? 27.348  -24.995 -42.586 1.00 38.64  ? 79  SER B N     1 
ATOM   3592  C  CA    . SER B  1 107 ? 27.966  -23.817 -42.012 1.00 35.90  ? 79  SER B CA    1 
ATOM   3593  C  C     . SER B  1 107 ? 28.686  -23.005 -43.079 1.00 37.92  ? 79  SER B C     1 
ATOM   3594  O  O     . SER B  1 107 ? 29.079  -21.872 -42.818 1.00 39.31  ? 79  SER B O     1 
ATOM   3595  C  CB    . SER B  1 107 ? 28.943  -24.221 -40.907 1.00 38.72  ? 79  SER B CB    1 
ATOM   3596  O  OG    . SER B  1 107 ? 30.057  -24.922 -41.448 1.00 41.06  ? 79  SER B OG    1 
ATOM   3597  N  N     . ARG B  1 108 ? 28.861  -23.586 -44.272 1.00 33.16  ? 80  ARG B N     1 
ATOM   3598  C  CA    . ARG B  1 108 ? 29.439  -22.868 -45.408 1.00 39.53  ? 80  ARG B CA    1 
ATOM   3599  C  C     . ARG B  1 108 ? 28.527  -22.905 -46.621 1.00 41.49  ? 80  ARG B C     1 
ATOM   3600  O  O     . ARG B  1 108 ? 28.079  -23.968 -47.057 1.00 38.74  ? 80  ARG B O     1 
ATOM   3601  C  CB    . ARG B  1 108 ? 30.805  -23.424 -45.808 1.00 43.76  ? 80  ARG B CB    1 
ATOM   3602  C  CG    . ARG B  1 108 ? 31.980  -22.915 -44.986 1.00 48.36  ? 80  ARG B CG    1 
ATOM   3603  C  CD    . ARG B  1 108 ? 33.309  -23.433 -45.557 1.00 61.37  ? 80  ARG B CD    1 
ATOM   3604  N  NE    . ARG B  1 108 ? 34.447  -23.245 -44.652 1.00 66.67  ? 80  ARG B NE    1 
ATOM   3605  C  CZ    . ARG B  1 108 ? 34.922  -24.185 -43.831 1.00 75.81  ? 80  ARG B CZ    1 
ATOM   3606  N  NH1   . ARG B  1 108 ? 34.352  -25.387 -43.781 1.00 67.03  ? 80  ARG B NH1   1 
ATOM   3607  N  NH2   . ARG B  1 108 ? 35.965  -23.922 -43.049 1.00 77.11  ? 80  ARG B NH2   1 
ATOM   3608  N  N     . MET B  1 109 ? 28.285  -21.717 -47.163 1.00 36.18  ? 81  MET B N     1 
ATOM   3609  C  CA    . MET B  1 109 ? 27.435  -21.512 -48.320 1.00 44.12  ? 81  MET B CA    1 
ATOM   3610  C  C     . MET B  1 109 ? 28.233  -21.730 -49.606 1.00 49.75  ? 81  MET B C     1 
ATOM   3611  O  O     . MET B  1 109 ? 29.230  -21.046 -49.841 1.00 55.08  ? 81  MET B O     1 
ATOM   3612  C  CB    . MET B  1 109 ? 26.849  -20.091 -48.277 1.00 46.34  ? 81  MET B CB    1 
ATOM   3613  C  CG    . MET B  1 109 ? 25.809  -19.774 -49.328 1.00 41.57  ? 81  MET B CG    1 
ATOM   3614  S  SD    . MET B  1 109 ? 25.276  -18.049 -49.218 1.00 44.58  ? 81  MET B SD    1 
ATOM   3615  C  CE    . MET B  1 109 ? 24.468  -18.008 -47.627 1.00 39.71  ? 81  MET B CE    1 
ATOM   3616  N  N     . LYS B  1 110 ? 27.804  -22.682 -50.429 1.00 51.73  ? 82  LYS B N     1 
ATOM   3617  C  CA    . LYS B  1 110 ? 28.423  -22.902 -51.734 1.00 55.65  ? 82  LYS B CA    1 
ATOM   3618  C  C     . LYS B  1 110 ? 27.986  -21.817 -52.716 1.00 55.78  ? 82  LYS B C     1 
ATOM   3619  O  O     . LYS B  1 110 ? 26.794  -21.502 -52.819 1.00 57.75  ? 82  LYS B O     1 
ATOM   3620  C  CB    . LYS B  1 110 ? 28.066  -24.291 -52.281 1.00 62.34  ? 82  LYS B CB    1 
ATOM   3621  C  CG    . LYS B  1 110 ? 28.832  -24.685 -53.544 1.00 74.09  ? 82  LYS B CG    1 
ATOM   3622  C  CD    . LYS B  1 110 ? 28.535  -26.126 -53.985 1.00 75.68  ? 82  LYS B CD    1 
ATOM   3623  C  CE    . LYS B  1 110 ? 27.217  -26.250 -54.758 1.00 75.62  ? 82  LYS B CE    1 
ATOM   3624  N  NZ    . LYS B  1 110 ? 27.301  -25.757 -56.167 1.00 70.96  ? 82  LYS B NZ    1 
ATOM   3625  N  N     . ASP B  1 111 ? 28.959  -21.242 -53.418 1.00 61.43  ? 83  ASP B N     1 
ATOM   3626  C  CA    . ASP B  1 111 ? 28.711  -20.205 -54.424 1.00 64.44  ? 83  ASP B CA    1 
ATOM   3627  C  C     . ASP B  1 111 ? 27.989  -18.986 -53.854 1.00 55.74  ? 83  ASP B C     1 
ATOM   3628  O  O     . ASP B  1 111 ? 27.068  -18.454 -54.474 1.00 56.41  ? 83  ASP B O     1 
ATOM   3629  C  CB    . ASP B  1 111 ? 27.909  -20.777 -55.600 1.00 61.77  ? 83  ASP B CB    1 
ATOM   3630  C  CG    . ASP B  1 111 ? 28.750  -21.648 -56.509 1.00 69.95  ? 83  ASP B CG    1 
ATOM   3631  O  OD1   . ASP B  1 111 ? 29.324  -21.103 -57.475 1.00 80.82  ? 83  ASP B OD1   1 
ATOM   3632  O  OD2   . ASP B  1 111 ? 28.841  -22.872 -56.259 1.00 71.59  ? 83  ASP B OD2   1 
ATOM   3633  N  N     . ALA B  1 112 ? 28.411  -18.550 -52.671 1.00 52.94  ? 84  ALA B N     1 
ATOM   3634  C  CA    . ALA B  1 112 ? 27.910  -17.307 -52.097 1.00 51.40  ? 84  ALA B CA    1 
ATOM   3635  C  C     . ALA B  1 112 ? 28.253  -16.134 -53.015 1.00 46.69  ? 84  ALA B C     1 
ATOM   3636  O  O     . ALA B  1 112 ? 29.403  -15.973 -53.408 1.00 50.52  ? 84  ALA B O     1 
ATOM   3637  C  CB    . ALA B  1 112 ? 28.493  -17.088 -50.700 1.00 47.01  ? 84  ALA B CB    1 
ATOM   3638  N  N     . PRO B  1 113 ? 27.251  -15.316 -53.362 1.00 47.51  ? 85  PRO B N     1 
ATOM   3639  C  CA    . PRO B  1 113 ? 27.437  -14.171 -54.261 1.00 47.23  ? 85  PRO B CA    1 
ATOM   3640  C  C     . PRO B  1 113 ? 28.302  -13.094 -53.631 1.00 52.20  ? 85  PRO B C     1 
ATOM   3641  O  O     . PRO B  1 113 ? 28.422  -13.055 -52.405 1.00 54.15  ? 85  PRO B O     1 
ATOM   3642  C  CB    . PRO B  1 113 ? 26.015  -13.663 -54.476 1.00 42.10  ? 85  PRO B CB    1 
ATOM   3643  C  CG    . PRO B  1 113 ? 25.308  -14.034 -53.225 1.00 45.54  ? 85  PRO B CG    1 
ATOM   3644  C  CD    . PRO B  1 113 ? 25.891  -15.351 -52.800 1.00 51.21  ? 85  PRO B CD    1 
ATOM   3645  N  N     . ARG B  1 114 ? 28.889  -12.229 -54.452 1.00 51.36  ? 86  ARG B N     1 
ATOM   3646  C  CA    . ARG B  1 114 ? 29.769  -11.184 -53.945 1.00 59.45  ? 86  ARG B CA    1 
ATOM   3647  C  C     . ARG B  1 114 ? 29.001  -9.899  -53.625 1.00 60.05  ? 86  ARG B C     1 
ATOM   3648  O  O     . ARG B  1 114 ? 28.196  -9.416  -54.428 1.00 60.61  ? 86  ARG B O     1 
ATOM   3649  C  CB    . ARG B  1 114 ? 30.890  -10.885 -54.949 1.00 61.84  ? 86  ARG B CB    1 
ATOM   3650  N  N     . SER B  1 115 ? 29.254  -9.359  -52.438 1.00 58.03  ? 87  SER B N     1 
ATOM   3651  C  CA    . SER B  1 115 ? 28.734  -8.055  -52.046 1.00 54.43  ? 87  SER B CA    1 
ATOM   3652  C  C     . SER B  1 115 ? 29.661  -6.975  -52.619 1.00 56.54  ? 87  SER B C     1 
ATOM   3653  O  O     . SER B  1 115 ? 30.813  -6.874  -52.193 1.00 61.79  ? 87  SER B O     1 
ATOM   3654  C  CB    . SER B  1 115 ? 28.642  -7.973  -50.512 1.00 55.10  ? 87  SER B CB    1 
ATOM   3655  O  OG    . SER B  1 115 ? 27.897  -6.854  -50.052 1.00 47.32  ? 87  SER B OG    1 
ATOM   3656  N  N     . THR B  1 116 ? 29.183  -6.200  -53.599 1.00 58.33  ? 88  THR B N     1 
ATOM   3657  C  CA    . THR B  1 116 ? 29.995  -5.129  -54.216 1.00 60.09  ? 88  THR B CA    1 
ATOM   3658  C  C     . THR B  1 116 ? 29.555  -3.713  -53.806 1.00 55.77  ? 88  THR B C     1 
ATOM   3659  O  O     . THR B  1 116 ? 28.506  -3.540  -53.182 1.00 47.63  ? 88  THR B O     1 
ATOM   3660  C  CB    . THR B  1 116 ? 29.972  -5.194  -55.766 1.00 57.58  ? 88  THR B CB    1 
ATOM   3661  O  OG1   . THR B  1 116 ? 28.864  -4.433  -56.278 1.00 51.90  ? 88  THR B OG1   1 
ATOM   3662  C  CG2   . THR B  1 116 ? 29.908  -6.642  -56.252 1.00 56.36  ? 88  THR B CG2   1 
ATOM   3663  N  N     . ARG B  1 117 ? 30.339  -2.707  -54.199 1.00 54.91  ? 89  ARG B N     1 
ATOM   3664  C  CA    . ARG B  1 117 ? 30.153  -1.334  -53.705 1.00 52.84  ? 89  ARG B CA    1 
ATOM   3665  C  C     . ARG B  1 117 ? 28.758  -0.780  -53.951 1.00 46.84  ? 89  ARG B C     1 
ATOM   3666  O  O     . ARG B  1 117 ? 28.131  -0.243  -53.045 1.00 51.73  ? 89  ARG B O     1 
ATOM   3667  C  CB    . ARG B  1 117 ? 31.195  -0.393  -54.325 1.00 60.46  ? 89  ARG B CB    1 
ATOM   3668  C  CG    . ARG B  1 117 ? 31.071  1.063   -53.872 1.00 62.50  ? 89  ARG B CG    1 
ATOM   3669  C  CD    . ARG B  1 117 ? 32.412  1.779   -53.929 1.00 66.65  ? 89  ARG B CD    1 
ATOM   3670  N  NE    . ARG B  1 117 ? 32.280  3.231   -54.082 1.00 78.19  ? 89  ARG B NE    1 
ATOM   3671  C  CZ    . ARG B  1 117 ? 32.058  4.086   -53.082 1.00 77.26  ? 89  ARG B CZ    1 
ATOM   3672  N  NH1   . ARG B  1 117 ? 31.919  3.649   -51.834 1.00 68.76  ? 89  ARG B NH1   1 
ATOM   3673  N  NH2   . ARG B  1 117 ? 31.966  5.387   -53.332 1.00 74.82  ? 89  ARG B NH2   1 
ATOM   3674  N  N     . THR B  1 118 ? 28.261  -0.915  -55.171 1.00 49.68  ? 90  THR B N     1 
ATOM   3675  C  CA    . THR B  1 118 ? 26.932  -0.411  -55.479 1.00 52.63  ? 90  THR B CA    1 
ATOM   3676  C  C     . THR B  1 118 ? 25.837  -1.464  -55.246 1.00 54.54  ? 90  THR B C     1 
ATOM   3677  O  O     . THR B  1 118 ? 24.654  -1.125  -55.156 1.00 53.38  ? 90  THR B O     1 
ATOM   3678  C  CB    . THR B  1 118 ? 26.860  0.087   -56.932 1.00 59.78  ? 90  THR B CB    1 
ATOM   3679  O  OG1   . THR B  1 118 ? 25.591  0.712   -57.167 1.00 60.18  ? 90  THR B OG1   1 
ATOM   3680  C  CG2   . THR B  1 118 ? 27.070  -1.072  -57.903 1.00 55.25  ? 90  THR B CG2   1 
ATOM   3681  N  N     . GLU B  1 119 ? 26.242  -2.731  -55.134 1.00 51.51  ? 91  GLU B N     1 
ATOM   3682  C  CA    . GLU B  1 119 ? 25.308  -3.842  -54.947 1.00 53.09  ? 91  GLU B CA    1 
ATOM   3683  C  C     . GLU B  1 119 ? 25.554  -4.602  -53.639 1.00 42.25  ? 91  GLU B C     1 
ATOM   3684  O  O     . GLU B  1 119 ? 26.081  -5.710  -53.651 1.00 40.77  ? 91  GLU B O     1 
ATOM   3685  C  CB    . GLU B  1 119 ? 25.404  -4.805  -56.132 1.00 53.19  ? 91  GLU B CB    1 
ATOM   3686  C  CG    . GLU B  1 119 ? 25.131  -4.143  -57.475 1.00 54.44  ? 91  GLU B CG    1 
ATOM   3687  C  CD    . GLU B  1 119 ? 23.676  -3.757  -57.641 1.00 55.81  ? 91  GLU B CD    1 
ATOM   3688  O  OE1   . GLU B  1 119 ? 22.830  -4.669  -57.748 1.00 62.33  ? 91  GLU B OE1   1 
ATOM   3689  O  OE2   . GLU B  1 119 ? 23.376  -2.545  -57.663 1.00 64.48  ? 91  GLU B OE2   1 
ATOM   3690  N  N     . ARG B  1 120 ? 25.163  -4.004  -52.522 1.00 39.32  ? 92  ARG B N     1 
ATOM   3691  C  CA    . ARG B  1 120 ? 25.481  -4.532  -51.200 1.00 37.83  ? 92  ARG B CA    1 
ATOM   3692  C  C     . ARG B  1 120 ? 24.492  -5.607  -50.747 1.00 32.34  ? 92  ARG B C     1 
ATOM   3693  O  O     . ARG B  1 120 ? 23.318  -5.585  -51.125 1.00 32.61  ? 92  ARG B O     1 
ATOM   3694  C  CB    . ARG B  1 120 ? 25.511  -3.398  -50.178 1.00 35.13  ? 92  ARG B CB    1 
ATOM   3695  C  CG    . ARG B  1 120 ? 26.571  -2.356  -50.458 1.00 43.49  ? 92  ARG B CG    1 
ATOM   3696  C  CD    . ARG B  1 120 ? 27.975  -2.888  -50.173 1.00 40.10  ? 92  ARG B CD    1 
ATOM   3697  N  NE    . ARG B  1 120 ? 28.935  -1.793  -50.202 1.00 44.13  ? 92  ARG B NE    1 
ATOM   3698  C  CZ    . ARG B  1 120 ? 30.240  -1.927  -50.013 1.00 50.30  ? 92  ARG B CZ    1 
ATOM   3699  N  NH1   . ARG B  1 120 ? 30.764  -3.124  -49.790 1.00 57.28  ? 92  ARG B NH1   1 
ATOM   3700  N  NH2   . ARG B  1 120 ? 31.023  -0.855  -50.052 1.00 55.58  ? 92  ARG B NH2   1 
ATOM   3701  N  N     . ARG B  1 121 ? 24.978  -6.531  -49.928 1.00 33.56  ? 93  ARG B N     1 
ATOM   3702  C  CA    . ARG B  1 121 ? 24.163  -7.630  -49.407 1.00 37.38  ? 93  ARG B CA    1 
ATOM   3703  C  C     . ARG B  1 121 ? 24.216  -7.705  -47.882 1.00 28.74  ? 93  ARG B C     1 
ATOM   3704  O  O     . ARG B  1 121 ? 25.233  -7.372  -47.269 1.00 29.10  ? 93  ARG B O     1 
ATOM   3705  C  CB    . ARG B  1 121 ? 24.620  -8.973  -49.996 1.00 33.30  ? 93  ARG B CB    1 
ATOM   3706  C  CG    . ARG B  1 121 ? 24.434  -9.073  -51.505 1.00 37.51  ? 93  ARG B CG    1 
ATOM   3707  C  CD    . ARG B  1 121 ? 25.119  -10.301 -52.129 1.00 33.35  ? 93  ARG B CD    1 
ATOM   3708  N  NE    . ARG B  1 121 ? 24.858  -10.334 -53.570 1.00 36.87  ? 93  ARG B NE    1 
ATOM   3709  C  CZ    . ARG B  1 121 ? 23.806  -10.926 -54.134 1.00 42.96  ? 93  ARG B CZ    1 
ATOM   3710  N  NH1   . ARG B  1 121 ? 22.920  -11.572 -53.385 1.00 34.36  ? 93  ARG B NH1   1 
ATOM   3711  N  NH2   . ARG B  1 121 ? 23.634  -10.879 -55.454 1.00 41.39  ? 93  ARG B NH2   1 
ATOM   3712  N  N     . GLY B  1 122 ? 23.117  -8.155  -47.288 1.00 33.24  ? 94  GLY B N     1 
ATOM   3713  C  CA    . GLY B  1 122 ? 23.083  -8.546  -45.881 1.00 25.39  ? 94  GLY B CA    1 
ATOM   3714  C  C     . GLY B  1 122 ? 23.154  -10.063 -45.748 1.00 33.13  ? 94  GLY B C     1 
ATOM   3715  O  O     . GLY B  1 122 ? 23.223  -10.788 -46.744 1.00 30.93  ? 94  GLY B O     1 
ATOM   3716  N  N     . ILE B  1 123 ? 23.137  -10.570 -44.523 1.00 33.21  ? 95  ILE B N     1 
ATOM   3717  C  CA    . ILE B  1 123 ? 23.311  -12.008 -44.341 1.00 30.31  ? 95  ILE B CA    1 
ATOM   3718  C  C     . ILE B  1 123 ? 22.382  -12.549 -43.246 1.00 28.65  ? 95  ILE B C     1 
ATOM   3719  O  O     . ILE B  1 123 ? 22.197  -11.929 -42.194 1.00 27.71  ? 95  ILE B O     1 
ATOM   3720  C  CB    . ILE B  1 123 ? 24.799  -12.344 -44.017 1.00 32.78  ? 95  ILE B CB    1 
ATOM   3721  C  CG1   . ILE B  1 123 ? 24.989  -13.834 -43.714 1.00 37.76  ? 95  ILE B CG1   1 
ATOM   3722  C  CG2   . ILE B  1 123 ? 25.318  -11.499 -42.849 1.00 26.21  ? 95  ILE B CG2   1 
ATOM   3723  C  CD1   . ILE B  1 123 ? 25.124  -14.711 -44.952 1.00 38.25  ? 95  ILE B CD1   1 
ATOM   3724  N  N     . PHE B  1 124 ? 21.749  -13.678 -43.538 1.00 30.82  ? 96  PHE B N     1 
ATOM   3725  C  CA    . PHE B  1 124 ? 20.979  -14.420 -42.547 1.00 29.86  ? 96  PHE B CA    1 
ATOM   3726  C  C     . PHE B  1 124 ? 21.921  -15.407 -41.877 1.00 28.42  ? 96  PHE B C     1 
ATOM   3727  O  O     . PHE B  1 124 ? 22.791  -15.991 -42.534 1.00 32.54  ? 96  PHE B O     1 
ATOM   3728  C  CB    . PHE B  1 124 ? 19.777  -15.133 -43.195 1.00 29.01  ? 96  PHE B CB    1 
ATOM   3729  C  CG    . PHE B  1 124 ? 18.620  -14.209 -43.512 1.00 30.96  ? 96  PHE B CG    1 
ATOM   3730  C  CD1   . PHE B  1 124 ? 17.467  -14.224 -42.738 1.00 33.39  ? 96  PHE B CD1   1 
ATOM   3731  C  CD2   . PHE B  1 124 ? 18.696  -13.316 -44.577 1.00 31.17  ? 96  PHE B CD2   1 
ATOM   3732  C  CE1   . PHE B  1 124 ? 16.405  -13.354 -43.012 1.00 30.68  ? 96  PHE B CE1   1 
ATOM   3733  C  CE2   . PHE B  1 124 ? 17.629  -12.451 -44.862 1.00 36.90  ? 96  PHE B CE2   1 
ATOM   3734  C  CZ    . PHE B  1 124 ? 16.489  -12.470 -44.073 1.00 32.44  ? 96  PHE B CZ    1 
ATOM   3735  N  N     . CYS B  1 125 ? 21.780  -15.571 -40.572 1.00 29.16  ? 97  CYS B N     1 
ATOM   3736  C  CA    . CYS B  1 125 ? 22.571  -16.556 -39.840 1.00 25.96  ? 97  CYS B CA    1 
ATOM   3737  C  C     . CYS B  1 125 ? 22.339  -17.975 -40.362 1.00 30.64  ? 97  CYS B C     1 
ATOM   3738  O  O     . CYS B  1 125 ? 21.312  -18.267 -40.985 1.00 25.65  ? 97  CYS B O     1 
ATOM   3739  C  CB    . CYS B  1 125 ? 22.236  -16.505 -38.351 1.00 25.85  ? 97  CYS B CB    1 
ATOM   3740  S  SG    . CYS B  1 125 ? 20.604  -17.169 -37.992 1.00 29.37  ? 97  CYS B SG    1 
ATOM   3741  N  N     . ARG B  1 126 ? 23.288  -18.856 -40.079 1.00 27.93  ? 98  ARG B N     1 
ATOM   3742  C  CA    . ARG B  1 126 ? 23.253  -20.231 -40.580 1.00 33.66  ? 98  ARG B CA    1 
ATOM   3743  C  C     . ARG B  1 126 ? 22.015  -21.020 -40.145 1.00 34.59  ? 98  ARG B C     1 
ATOM   3744  O  O     . ARG B  1 126 ? 21.633  -21.976 -40.824 1.00 31.24  ? 98  ARG B O     1 
ATOM   3745  C  CB    . ARG B  1 126 ? 24.527  -20.970 -40.147 1.00 31.56  ? 98  ARG B CB    1 
ATOM   3746  C  CG    . ARG B  1 126 ? 25.777  -20.458 -40.885 1.00 36.58  ? 98  ARG B CG    1 
ATOM   3747  C  CD    . ARG B  1 126 ? 27.055  -20.661 -40.072 1.00 32.66  ? 98  ARG B CD    1 
ATOM   3748  N  NE    . ARG B  1 126 ? 28.226  -20.226 -40.831 1.00 33.38  ? 98  ARG B NE    1 
ATOM   3749  C  CZ    . ARG B  1 126 ? 28.656  -18.969 -40.925 1.00 36.79  ? 98  ARG B CZ    1 
ATOM   3750  N  NH1   . ARG B  1 126 ? 28.034  -17.974 -40.296 1.00 31.67  ? 98  ARG B NH1   1 
ATOM   3751  N  NH2   . ARG B  1 126 ? 29.734  -18.706 -41.646 1.00 42.97  ? 98  ARG B NH2   1 
ATOM   3752  N  N     . ALA B  1 127 ? 21.381  -20.615 -39.033 1.00 35.01  ? 99  ALA B N     1 
ATOM   3753  C  CA    . ALA B  1 127 ? 20.194  -21.321 -38.529 1.00 30.44  ? 99  ALA B CA    1 
ATOM   3754  C  C     . ALA B  1 127 ? 18.936  -20.879 -39.267 1.00 27.75  ? 99  ALA B C     1 
ATOM   3755  O  O     . ALA B  1 127 ? 17.840  -21.361 -38.981 1.00 27.54  ? 99  ALA B O     1 
ATOM   3756  C  CB    . ALA B  1 127 ? 20.027  -21.105 -37.012 1.00 28.22  ? 99  ALA B CB    1 
ATOM   3757  N  N     . SER B  1 128 ? 19.110  -19.949 -40.204 1.00 25.91  ? 100 SER B N     1 
ATOM   3758  C  CA    . SER B  1 128 ? 18.038  -19.508 -41.088 1.00 30.07  ? 100 SER B CA    1 
ATOM   3759  C  C     . SER B  1 128 ? 18.366  -19.776 -42.565 1.00 28.14  ? 100 SER B C     1 
ATOM   3760  O  O     . SER B  1 128 ? 17.850  -19.102 -43.455 1.00 26.69  ? 100 SER B O     1 
ATOM   3761  C  CB    . SER B  1 128 ? 17.743  -18.006 -40.883 1.00 30.77  ? 100 SER B CB    1 
ATOM   3762  O  OG    . SER B  1 128 ? 16.544  -17.638 -41.545 1.00 27.27  ? 100 SER B OG    1 
ATOM   3763  N  N     . TRP B  1 129 ? 19.212  -20.770 -42.826 1.00 32.73  ? 101 TRP B N     1 
ATOM   3764  C  CA    . TRP B  1 129 ? 19.443  -21.231 -44.199 1.00 32.64  ? 101 TRP B CA    1 
ATOM   3765  C  C     . TRP B  1 129 ? 18.541  -22.415 -44.569 1.00 29.99  ? 101 TRP B C     1 
ATOM   3766  O  O     . TRP B  1 129 ? 18.439  -23.395 -43.821 1.00 31.21  ? 101 TRP B O     1 
ATOM   3767  C  CB    . TRP B  1 129 ? 20.900  -21.639 -44.388 1.00 32.15  ? 101 TRP B CB    1 
ATOM   3768  C  CG    . TRP B  1 129 ? 21.885  -20.512 -44.306 1.00 34.70  ? 101 TRP B CG    1 
ATOM   3769  C  CD1   . TRP B  1 129 ? 21.617  -19.173 -44.109 1.00 26.96  ? 101 TRP B CD1   1 
ATOM   3770  C  CD2   . TRP B  1 129 ? 23.308  -20.626 -44.411 1.00 34.31  ? 101 TRP B CD2   1 
ATOM   3771  N  NE1   . TRP B  1 129 ? 22.790  -18.465 -44.085 1.00 28.18  ? 101 TRP B NE1   1 
ATOM   3772  C  CE2   . TRP B  1 129 ? 23.843  -19.328 -44.271 1.00 31.95  ? 101 TRP B CE2   1 
ATOM   3773  C  CE3   . TRP B  1 129 ? 24.186  -21.708 -44.600 1.00 37.59  ? 101 TRP B CE3   1 
ATOM   3774  C  CZ2   . TRP B  1 129 ? 25.214  -19.077 -44.330 1.00 34.04  ? 101 TRP B CZ2   1 
ATOM   3775  C  CZ3   . TRP B  1 129 ? 25.551  -21.455 -44.657 1.00 36.78  ? 101 TRP B CZ3   1 
ATOM   3776  C  CH2   . TRP B  1 129 ? 26.048  -20.145 -44.523 1.00 33.30  ? 101 TRP B CH2   1 
ATOM   3777  N  N     . GLY B  1 130 ? 17.906  -22.322 -45.730 1.00 30.22  ? 102 GLY B N     1 
ATOM   3778  C  CA    . GLY B  1 130 ? 17.049  -23.377 -46.247 1.00 28.75  ? 102 GLY B CA    1 
ATOM   3779  C  C     . GLY B  1 130 ? 15.721  -23.462 -45.521 1.00 32.19  ? 102 GLY B C     1 
ATOM   3780  O  O     . GLY B  1 130 ? 15.236  -22.469 -44.985 1.00 29.90  ? 102 GLY B O     1 
ATOM   3781  N  N     . LYS B  1 131 ? 15.145  -24.663 -45.478 1.00 33.33  ? 103 LYS B N     1 
ATOM   3782  C  CA    . LYS B  1 131 ? 13.818  -24.856 -44.898 1.00 36.35  ? 103 LYS B CA    1 
ATOM   3783  C  C     . LYS B  1 131 ? 13.822  -24.714 -43.372 1.00 31.60  ? 103 LYS B C     1 
ATOM   3784  O  O     . LYS B  1 131 ? 14.632  -25.339 -42.699 1.00 29.55  ? 103 LYS B O     1 
ATOM   3785  C  CB    . LYS B  1 131 ? 13.270  -26.226 -45.290 1.00 36.08  ? 103 LYS B CB    1 
ATOM   3786  C  CG    . LYS B  1 131 ? 11.915  -26.174 -45.966 1.00 43.80  ? 103 LYS B CG    1 
ATOM   3787  C  CD    . LYS B  1 131 ? 10.777  -26.152 -44.960 1.00 49.29  ? 103 LYS B CD    1 
ATOM   3788  C  CE    . LYS B  1 131 ? 9.483   -26.692 -45.588 1.00 55.11  ? 103 LYS B CE    1 
ATOM   3789  N  NZ    . LYS B  1 131 ? 8.309   -26.703 -44.656 1.00 56.36  ? 103 LYS B NZ    1 
ATOM   3790  N  N     . ASP B  1 132 ? 12.919  -23.877 -42.859 1.00 32.59  ? 104 ASP B N     1 
ATOM   3791  C  CA    . ASP B  1 132 ? 12.740  -23.632 -41.420 1.00 32.20  ? 104 ASP B CA    1 
ATOM   3792  C  C     . ASP B  1 132 ? 12.903  -24.918 -40.606 1.00 29.39  ? 104 ASP B C     1 
ATOM   3793  O  O     . ASP B  1 132 ? 12.112  -25.834 -40.745 1.00 26.00  ? 104 ASP B O     1 
ATOM   3794  C  CB    . ASP B  1 132 ? 11.358  -23.027 -41.177 1.00 28.98  ? 104 ASP B CB    1 
ATOM   3795  C  CG    . ASP B  1 132 ? 11.149  -22.549 -39.750 1.00 32.00  ? 104 ASP B CG    1 
ATOM   3796  O  OD1   . ASP B  1 132 ? 10.188  -21.774 -39.549 1.00 38.04  ? 104 ASP B OD1   1 
ATOM   3797  O  OD2   . ASP B  1 132 ? 11.919  -22.916 -38.831 1.00 31.58  ? 104 ASP B OD2   1 
ATOM   3798  N  N     . TYR B  1 133 ? 13.930  -24.966 -39.760 1.00 26.51  ? 105 TYR B N     1 
ATOM   3799  C  CA    . TYR B  1 133 ? 14.203  -26.142 -38.946 1.00 29.03  ? 105 TYR B CA    1 
ATOM   3800  C  C     . TYR B  1 133 ? 13.011  -26.561 -38.086 1.00 30.24  ? 105 TYR B C     1 
ATOM   3801  O  O     . TYR B  1 133 ? 12.913  -27.739 -37.687 1.00 24.74  ? 105 TYR B O     1 
ATOM   3802  C  CB    . TYR B  1 133 ? 15.443  -25.911 -38.069 1.00 27.30  ? 105 TYR B CB    1 
ATOM   3803  C  CG    . TYR B  1 133 ? 15.227  -24.991 -36.891 1.00 28.60  ? 105 TYR B CG    1 
ATOM   3804  C  CD1   . TYR B  1 133 ? 14.937  -25.506 -35.632 1.00 28.16  ? 105 TYR B CD1   1 
ATOM   3805  C  CD2   . TYR B  1 133 ? 15.331  -23.614 -37.034 1.00 27.35  ? 105 TYR B CD2   1 
ATOM   3806  C  CE1   . TYR B  1 133 ? 14.733  -24.667 -34.549 1.00 30.01  ? 105 TYR B CE1   1 
ATOM   3807  C  CE2   . TYR B  1 133 ? 15.120  -22.760 -35.958 1.00 27.24  ? 105 TYR B CE2   1 
ATOM   3808  C  CZ    . TYR B  1 133 ? 14.832  -23.297 -34.720 1.00 28.09  ? 105 TYR B CZ    1 
ATOM   3809  O  OH    . TYR B  1 133 ? 14.633  -22.477 -33.645 1.00 30.25  ? 105 TYR B OH    1 
ATOM   3810  N  N     . HIS B  1 134 ? 12.110  -25.613 -37.800 1.00 27.26  ? 106 HIS B N     1 
ATOM   3811  C  CA    . HIS B  1 134 ? 10.886  -25.923 -37.048 1.00 25.01  ? 106 HIS B CA    1 
ATOM   3812  C  C     . HIS B  1 134 ? 10.080  -27.004 -37.776 1.00 32.62  ? 106 HIS B C     1 
ATOM   3813  O  O     . HIS B  1 134 ? 9.611   -27.967 -37.155 1.00 31.27  ? 106 HIS B O     1 
ATOM   3814  C  CB    . HIS B  1 134 ? 10.015  -24.680 -36.840 1.00 28.03  ? 106 HIS B CB    1 
ATOM   3815  C  CG    . HIS B  1 134 ? 10.611  -23.661 -35.916 1.00 28.83  ? 106 HIS B CG    1 
ATOM   3816  N  ND1   . HIS B  1 134 ? 11.236  -22.520 -36.374 1.00 28.26  ? 106 HIS B ND1   1 
ATOM   3817  C  CD2   . HIS B  1 134 ? 10.664  -23.600 -34.561 1.00 28.39  ? 106 HIS B CD2   1 
ATOM   3818  C  CE1   . HIS B  1 134 ? 11.654  -21.801 -35.343 1.00 29.83  ? 106 HIS B CE1   1 
ATOM   3819  N  NE2   . HIS B  1 134 ? 11.314  -22.427 -34.230 1.00 25.10  ? 106 HIS B NE2   1 
ATOM   3820  N  N     . ASP B  1 135 ? 9.947   -26.855 -39.094 1.00 29.00  ? 107 ASP B N     1 
ATOM   3821  C  CA    . ASP B  1 135 ? 9.225   -27.828 -39.912 1.00 30.34  ? 107 ASP B CA    1 
ATOM   3822  C  C     . ASP B  1 135 ? 9.994   -29.147 -40.065 1.00 33.10  ? 107 ASP B C     1 
ATOM   3823  O  O     . ASP B  1 135 ? 9.414   -30.238 -39.963 1.00 31.86  ? 107 ASP B O     1 
ATOM   3824  C  CB    . ASP B  1 135 ? 8.930   -27.236 -41.284 1.00 31.95  ? 107 ASP B CB    1 
ATOM   3825  C  CG    . ASP B  1 135 ? 8.068   -25.988 -41.202 1.00 41.57  ? 107 ASP B CG    1 
ATOM   3826  O  OD1   . ASP B  1 135 ? 7.142   -25.961 -40.369 1.00 43.41  ? 107 ASP B OD1   1 
ATOM   3827  O  OD2   . ASP B  1 135 ? 8.309   -25.034 -41.966 1.00 51.27  ? 107 ASP B OD2   1 
ATOM   3828  N  N     . VAL B  1 136 ? 11.298  -29.039 -40.301 1.00 29.84  ? 108 VAL B N     1 
ATOM   3829  C  CA    . VAL B  1 136 ? 12.117  -30.211 -40.541 1.00 27.99  ? 108 VAL B CA    1 
ATOM   3830  C  C     . VAL B  1 136 ? 12.152  -31.089 -39.301 1.00 28.31  ? 108 VAL B C     1 
ATOM   3831  O  O     . VAL B  1 136 ? 11.889  -32.284 -39.389 1.00 31.31  ? 108 VAL B O     1 
ATOM   3832  C  CB    . VAL B  1 136 ? 13.560  -29.834 -40.966 1.00 29.49  ? 108 VAL B CB    1 
ATOM   3833  C  CG1   . VAL B  1 136 ? 14.446  -31.080 -41.062 1.00 29.33  ? 108 VAL B CG1   1 
ATOM   3834  C  CG2   . VAL B  1 136 ? 13.543  -29.099 -42.291 1.00 28.18  ? 108 VAL B CG2   1 
ATOM   3835  N  N     . LEU B  1 137 ? 12.442  -30.524 -38.131 1.00 31.49  ? 109 LEU B N     1 
ATOM   3836  C  CA    . LEU B  1 137 ? 12.576  -31.395 -36.950 1.00 31.50  ? 109 LEU B CA    1 
ATOM   3837  C  C     . LEU B  1 137 ? 11.222  -31.903 -36.429 1.00 30.78  ? 109 LEU B C     1 
ATOM   3838  O  O     . LEU B  1 137 ? 11.137  -33.026 -35.926 1.00 32.42  ? 109 LEU B O     1 
ATOM   3839  C  CB    . LEU B  1 137 ? 13.359  -30.697 -35.832 1.00 26.28  ? 109 LEU B CB    1 
ATOM   3840  C  CG    . LEU B  1 137 ? 14.866  -30.974 -35.951 1.00 29.44  ? 109 LEU B CG    1 
ATOM   3841  C  CD1   . LEU B  1 137 ? 15.502  -30.310 -37.203 1.00 26.95  ? 109 LEU B CD1   1 
ATOM   3842  C  CD2   . LEU B  1 137 ? 15.631  -30.600 -34.682 1.00 29.04  ? 109 LEU B CD2   1 
ATOM   3843  N  N     . ARG B  1 138 ? 10.172  -31.095 -36.559 1.00 30.79  ? 110 ARG B N     1 
ATOM   3844  C  CA    . ARG B  1 138 ? 8.815   -31.567 -36.271 1.00 29.77  ? 110 ARG B CA    1 
ATOM   3845  C  C     . ARG B  1 138 ? 8.462   -32.780 -37.137 1.00 35.26  ? 110 ARG B C     1 
ATOM   3846  O  O     . ARG B  1 138 ? 7.845   -33.734 -36.653 1.00 34.19  ? 110 ARG B O     1 
ATOM   3847  C  CB    . ARG B  1 138 ? 7.779   -30.469 -36.515 1.00 28.79  ? 110 ARG B CB    1 
ATOM   3848  C  CG    . ARG B  1 138 ? 6.396   -30.836 -36.005 1.00 37.37  ? 110 ARG B CG    1 
ATOM   3849  C  CD    . ARG B  1 138 ? 6.554   -31.555 -34.648 1.00 42.61  ? 110 ARG B CD    1 
ATOM   3850  N  NE    . ARG B  1 138 ? 5.340   -32.179 -34.128 1.00 41.30  ? 110 ARG B NE    1 
ATOM   3851  C  CZ    . ARG B  1 138 ? 4.646   -31.712 -33.088 1.00 51.57  ? 110 ARG B CZ    1 
ATOM   3852  N  NH1   . ARG B  1 138 ? 5.047   -30.606 -32.459 1.00 39.09  ? 110 ARG B NH1   1 
ATOM   3853  N  NH2   . ARG B  1 138 ? 3.552   -32.349 -32.675 1.00 46.77  ? 110 ARG B NH2   1 
ATOM   3854  N  N     . GLU B  1 139 ? 8.839   -32.712 -38.417 1.00 25.76  ? 111 GLU B N     1 
ATOM   3855  C  CA    . GLU B  1 139 ? 8.591   -33.787 -39.374 1.00 30.47  ? 111 GLU B CA    1 
ATOM   3856  C  C     . GLU B  1 139 ? 9.253   -35.074 -38.878 1.00 31.57  ? 111 GLU B C     1 
ATOM   3857  O  O     . GLU B  1 139 ? 8.648   -36.142 -38.913 1.00 30.86  ? 111 GLU B O     1 
ATOM   3858  C  CB    . GLU B  1 139 ? 9.111   -33.395 -40.769 1.00 32.25  ? 111 GLU B CB    1 
ATOM   3859  C  CG    . GLU B  1 139 ? 8.684   -34.303 -41.907 1.00 36.42  ? 111 GLU B CG    1 
ATOM   3860  C  CD    . GLU B  1 139 ? 9.650   -35.455 -42.155 1.00 37.29  ? 111 GLU B CD    1 
ATOM   3861  O  OE1   . GLU B  1 139 ? 10.762  -35.443 -41.581 1.00 34.32  ? 111 GLU B OE1   1 
ATOM   3862  O  OE2   . GLU B  1 139 ? 9.295   -36.382 -42.923 1.00 40.97  ? 111 GLU B OE2   1 
ATOM   3863  N  N     . LYS B  1 140 ? 10.494  -34.950 -38.407 1.00 27.65  ? 112 LYS B N     1 
ATOM   3864  C  CA    . LYS B  1 140 ? 11.242  -36.078 -37.891 1.00 30.71  ? 112 LYS B CA    1 
ATOM   3865  C  C     . LYS B  1 140 ? 10.602  -36.609 -36.616 1.00 34.76  ? 112 LYS B C     1 
ATOM   3866  O  O     . LYS B  1 140 ? 10.391  -37.820 -36.470 1.00 30.62  ? 112 LYS B O     1 
ATOM   3867  C  CB    . LYS B  1 140 ? 12.703  -35.687 -37.647 1.00 30.11  ? 112 LYS B CB    1 
ATOM   3868  C  CG    . LYS B  1 140 ? 13.457  -35.270 -38.915 1.00 29.28  ? 112 LYS B CG    1 
ATOM   3869  C  CD    . LYS B  1 140 ? 13.411  -36.368 -40.001 1.00 30.92  ? 112 LYS B CD    1 
ATOM   3870  C  CE    . LYS B  1 140 ? 13.916  -35.840 -41.371 1.00 29.88  ? 112 LYS B CE    1 
ATOM   3871  N  NZ    . LYS B  1 140 ? 13.989  -36.907 -42.433 1.00 29.66  ? 112 LYS B NZ    1 
ATOM   3872  N  N     . LEU B  1 141 ? 10.264  -35.701 -35.703 1.00 30.91  ? 113 LEU B N     1 
ATOM   3873  C  CA    . LEU B  1 141 ? 9.608   -36.102 -34.465 1.00 31.67  ? 113 LEU B CA    1 
ATOM   3874  C  C     . LEU B  1 141 ? 8.280   -36.827 -34.708 1.00 33.77  ? 113 LEU B C     1 
ATOM   3875  O  O     . LEU B  1 141 ? 7.969   -37.821 -34.033 1.00 29.08  ? 113 LEU B O     1 
ATOM   3876  C  CB    . LEU B  1 141 ? 9.374   -34.886 -33.575 1.00 34.73  ? 113 LEU B CB    1 
ATOM   3877  C  CG    . LEU B  1 141 ? 10.598  -34.246 -32.920 1.00 35.51  ? 113 LEU B CG    1 
ATOM   3878  C  CD1   . LEU B  1 141 ? 10.151  -33.051 -32.104 1.00 34.71  ? 113 LEU B CD1   1 
ATOM   3879  C  CD2   . LEU B  1 141 ? 11.335  -35.241 -32.041 1.00 29.07  ? 113 LEU B CD2   1 
ATOM   3880  N  N     . ASP B  1 142 ? 7.497   -36.324 -35.659 1.00 33.69  ? 114 ASP B N     1 
ATOM   3881  C  CA    . ASP B  1 142 ? 6.225   -36.956 -35.999 1.00 35.97  ? 114 ASP B CA    1 
ATOM   3882  C  C     . ASP B  1 142 ? 6.402   -38.394 -36.489 1.00 38.97  ? 114 ASP B C     1 
ATOM   3883  O  O     . ASP B  1 142 ? 5.535   -39.254 -36.242 1.00 33.68  ? 114 ASP B O     1 
ATOM   3884  C  CB    . ASP B  1 142 ? 5.485   -36.151 -37.065 1.00 30.80  ? 114 ASP B CB    1 
ATOM   3885  C  CG    . ASP B  1 142 ? 4.902   -34.863 -36.525 1.00 37.45  ? 114 ASP B CG    1 
ATOM   3886  O  OD1   . ASP B  1 142 ? 4.986   -34.627 -35.307 1.00 40.32  ? 114 ASP B OD1   1 
ATOM   3887  O  OD2   . ASP B  1 142 ? 4.346   -34.088 -37.326 1.00 41.95  ? 114 ASP B OD2   1 
ATOM   3888  N  N     . LEU B  1 143 ? 7.510   -38.655 -37.190 1.00 32.20  ? 115 LEU B N     1 
ATOM   3889  C  CA    . LEU B  1 143 ? 7.800   -40.022 -37.617 1.00 36.10  ? 115 LEU B CA    1 
ATOM   3890  C  C     . LEU B  1 143 ? 8.151   -40.903 -36.409 1.00 35.67  ? 115 LEU B C     1 
ATOM   3891  O  O     . LEU B  1 143 ? 7.687   -42.046 -36.305 1.00 33.02  ? 115 LEU B O     1 
ATOM   3892  C  CB    . LEU B  1 143 ? 8.940   -40.061 -38.637 1.00 29.11  ? 115 LEU B CB    1 
ATOM   3893  C  CG    . LEU B  1 143 ? 8.665   -39.538 -40.047 1.00 33.79  ? 115 LEU B CG    1 
ATOM   3894  C  CD1   . LEU B  1 143 ? 9.972   -39.377 -40.802 1.00 31.48  ? 115 LEU B CD1   1 
ATOM   3895  C  CD2   . LEU B  1 143 ? 7.720   -40.459 -40.815 1.00 34.77  ? 115 LEU B CD2   1 
ATOM   3896  N  N     . LEU B  1 144 ? 8.982   -40.376 -35.512 1.00 34.34  ? 116 LEU B N     1 
ATOM   3897  C  CA    . LEU B  1 144 ? 9.418   -41.139 -34.337 1.00 36.40  ? 116 LEU B CA    1 
ATOM   3898  C  C     . LEU B  1 144 ? 8.220   -41.467 -33.443 1.00 37.39  ? 116 LEU B C     1 
ATOM   3899  O  O     . LEU B  1 144 ? 8.136   -42.553 -32.869 1.00 38.41  ? 116 LEU B O     1 
ATOM   3900  C  CB    . LEU B  1 144 ? 10.483  -40.373 -33.542 1.00 31.79  ? 116 LEU B CB    1 
ATOM   3901  C  CG    . LEU B  1 144 ? 11.793  -40.097 -34.294 1.00 38.13  ? 116 LEU B CG    1 
ATOM   3902  C  CD1   . LEU B  1 144 ? 12.792  -39.324 -33.430 1.00 31.49  ? 116 LEU B CD1   1 
ATOM   3903  C  CD2   . LEU B  1 144 ? 12.415  -41.398 -34.798 1.00 36.11  ? 116 LEU B CD2   1 
ATOM   3904  N  N     . GLU B  1 145 ? 7.298   -40.518 -33.347 1.00 37.72  ? 117 GLU B N     1 
ATOM   3905  C  CA    . GLU B  1 145 ? 6.035   -40.715 -32.654 1.00 36.21  ? 117 GLU B CA    1 
ATOM   3906  C  C     . GLU B  1 145 ? 5.165   -41.814 -33.275 1.00 41.36  ? 117 GLU B C     1 
ATOM   3907  O  O     . GLU B  1 145 ? 4.575   -42.616 -32.540 1.00 40.36  ? 117 GLU B O     1 
ATOM   3908  C  CB    . GLU B  1 145 ? 5.247   -39.408 -32.611 1.00 38.22  ? 117 GLU B CB    1 
ATOM   3909  C  CG    . GLU B  1 145 ? 3.760   -39.613 -32.414 1.00 45.48  ? 117 GLU B CG    1 
ATOM   3910  C  CD    . GLU B  1 145 ? 3.027   -38.330 -32.145 1.00 54.95  ? 117 GLU B CD    1 
ATOM   3911  O  OE1   . GLU B  1 145 ? 3.639   -37.256 -32.354 1.00 56.29  ? 117 GLU B OE1   1 
ATOM   3912  O  OE2   . GLU B  1 145 ? 1.847   -38.401 -31.716 1.00 53.84  ? 117 GLU B OE2   1 
ATOM   3913  N  N     . ASP B  1 146 ? 5.058   -41.851 -34.607 1.00 37.41  ? 118 ASP B N     1 
ATOM   3914  C  CA    . ASP B  1 146 ? 4.241   -42.888 -35.246 1.00 40.14  ? 118 ASP B CA    1 
ATOM   3915  C  C     . ASP B  1 146 ? 4.909   -44.249 -35.089 1.00 39.93  ? 118 ASP B C     1 
ATOM   3916  O  O     . ASP B  1 146 ? 4.231   -45.255 -34.918 1.00 43.51  ? 118 ASP B O     1 
ATOM   3917  C  CB    . ASP B  1 146 ? 3.986   -42.592 -36.727 1.00 42.32  ? 118 ASP B CB    1 
ATOM   3918  C  CG    . ASP B  1 146 ? 2.791   -43.375 -37.279 1.00 45.20  ? 118 ASP B CG    1 
ATOM   3919  O  OD1   . ASP B  1 146 ? 1.700   -43.298 -36.670 1.00 50.17  ? 118 ASP B OD1   1 
ATOM   3920  O  OD2   . ASP B  1 146 ? 2.934   -44.084 -38.310 1.00 40.59  ? 118 ASP B OD2   1 
ATOM   3921  N  N     . PHE B  1 147 ? 6.240   -44.260 -35.139 1.00 35.64  ? 119 PHE B N     1 
ATOM   3922  C  CA    . PHE B  1 147 ? 7.034   -45.439 -34.843 1.00 34.81  ? 119 PHE B CA    1 
ATOM   3923  C  C     . PHE B  1 147 ? 6.672   -46.043 -33.476 1.00 44.31  ? 119 PHE B C     1 
ATOM   3924  O  O     . PHE B  1 147 ? 6.490   -47.254 -33.357 1.00 40.95  ? 119 PHE B O     1 
ATOM   3925  C  CB    . PHE B  1 147 ? 8.530   -45.094 -34.882 1.00 36.05  ? 119 PHE B CB    1 
ATOM   3926  C  CG    . PHE B  1 147 ? 9.417   -46.230 -34.464 1.00 36.37  ? 119 PHE B CG    1 
ATOM   3927  C  CD1   . PHE B  1 147 ? 9.919   -47.123 -35.410 1.00 41.10  ? 119 PHE B CD1   1 
ATOM   3928  C  CD2   . PHE B  1 147 ? 9.736   -46.428 -33.127 1.00 36.79  ? 119 PHE B CD2   1 
ATOM   3929  C  CE1   . PHE B  1 147 ? 10.723  -48.189 -35.020 1.00 39.88  ? 119 PHE B CE1   1 
ATOM   3930  C  CE2   . PHE B  1 147 ? 10.537  -47.496 -32.735 1.00 41.80  ? 119 PHE B CE2   1 
ATOM   3931  C  CZ    . PHE B  1 147 ? 11.030  -48.372 -33.678 1.00 36.75  ? 119 PHE B CZ    1 
ATOM   3932  N  N     . LEU B  1 148 ? 6.580   -45.192 -32.449 1.00 41.09  ? 120 LEU B N     1 
ATOM   3933  C  CA    . LEU B  1 148 ? 6.227   -45.635 -31.098 1.00 43.51  ? 120 LEU B CA    1 
ATOM   3934  C  C     . LEU B  1 148 ? 4.730   -45.957 -30.956 1.00 44.71  ? 120 LEU B C     1 
ATOM   3935  O  O     . LEU B  1 148 ? 4.367   -46.970 -30.358 1.00 49.23  ? 120 LEU B O     1 
ATOM   3936  C  CB    . LEU B  1 148 ? 6.648   -44.576 -30.069 1.00 38.60  ? 120 LEU B CB    1 
ATOM   3937  C  CG    . LEU B  1 148 ? 8.169   -44.382 -30.005 1.00 34.02  ? 120 LEU B CG    1 
ATOM   3938  C  CD1   . LEU B  1 148 ? 8.570   -43.254 -29.076 1.00 35.29  ? 120 LEU B CD1   1 
ATOM   3939  C  CD2   . LEU B  1 148 ? 8.887   -45.671 -29.618 1.00 39.64  ? 120 LEU B CD2   1 
ATOM   3940  N  N     . LYS B  1 149 ? 3.868   -45.105 -31.510 1.00 40.66  ? 121 LYS B N     1 
ATOM   3941  C  CA    . LYS B  1 149 ? 2.426   -45.341 -31.483 1.00 42.41  ? 121 LYS B CA    1 
ATOM   3942  C  C     . LYS B  1 149 ? 2.071   -46.690 -32.121 1.00 57.79  ? 121 LYS B C     1 
ATOM   3943  O  O     . LYS B  1 149 ? 1.279   -47.456 -31.568 1.00 57.64  ? 121 LYS B O     1 
ATOM   3944  C  CB    . LYS B  1 149 ? 1.675   -44.212 -32.195 1.00 47.98  ? 121 LYS B CB    1 
ATOM   3945  C  CG    . LYS B  1 149 ? 0.990   -43.192 -31.262 1.00 48.22  ? 121 LYS B CG    1 
ATOM   3946  C  CD    . LYS B  1 149 ? 1.988   -42.514 -30.325 1.00 53.48  ? 121 LYS B CD    1 
ATOM   3947  C  CE    . LYS B  1 149 ? 1.303   -41.568 -29.317 1.00 52.62  ? 121 LYS B CE    1 
ATOM   3948  N  NZ    . LYS B  1 149 ? 0.961   -40.210 -29.862 1.00 54.59  ? 121 LYS B NZ    1 
ATOM   3949  N  N     . SER B  1 150 ? 2.687   -46.984 -33.269 1.00 57.06  ? 122 SER B N     1 
ATOM   3950  C  CA    . SER B  1 150 ? 2.409   -48.208 -34.024 1.00 52.38  ? 122 SER B CA    1 
ATOM   3951  C  C     . SER B  1 150 ? 2.778   -49.475 -33.253 1.00 56.78  ? 122 SER B C     1 
ATOM   3952  O  O     . SER B  1 150 ? 2.375   -50.574 -33.640 1.00 60.61  ? 122 SER B O     1 
ATOM   3953  C  CB    . SER B  1 150 ? 3.150   -48.195 -35.366 1.00 43.75  ? 122 SER B CB    1 
ATOM   3954  O  OG    . SER B  1 150 ? 4.492   -48.646 -35.219 1.00 46.77  ? 122 SER B OG    1 
ATOM   3955  N  N     . LYS B  1 151 ? 3.545   -49.324 -32.173 1.00 59.92  ? 123 LYS B N     1 
ATOM   3956  C  CA    . LYS B  1 151 ? 3.873   -50.451 -31.306 1.00 57.40  ? 123 LYS B CA    1 
ATOM   3957  C  C     . LYS B  1 151 ? 2.752   -50.718 -30.310 1.00 63.79  ? 123 LYS B C     1 
ATOM   3958  O  O     . LYS B  1 151 ? 1.774   -51.407 -30.615 1.00 68.30  ? 123 LYS B O     1 
ATOM   3959  C  CB    . LYS B  1 151 ? 5.178   -50.205 -30.540 1.00 56.58  ? 123 LYS B CB    1 
ATOM   3960  C  CG    . LYS B  1 151 ? 6.391   -49.917 -31.408 1.00 51.29  ? 123 LYS B CG    1 
ATOM   3961  C  CD    . LYS B  1 151 ? 6.942   -51.164 -32.038 1.00 52.08  ? 123 LYS B CD    1 
ATOM   3962  C  CE    . LYS B  1 151 ? 8.275   -50.889 -32.705 1.00 53.67  ? 123 LYS B CE    1 
ATOM   3963  N  NZ    . LYS B  1 151 ? 8.681   -51.999 -33.601 1.00 58.01  ? 123 LYS B NZ    1 
ATOM   3964  N  N     . HIS B  1 152 ? 2.906   -50.162 -29.112 1.00 68.34  ? 124 HIS B N     1 
ATOM   3965  C  CA    . HIS B  1 152 ? 1.995   -50.440 -28.009 1.00 60.45  ? 124 HIS B CA    1 
ATOM   3966  C  C     . HIS B  1 152 ? 0.943   -49.352 -27.878 1.00 67.20  ? 124 HIS B C     1 
ATOM   3967  O  O     . HIS B  1 152 ? -0.200  -49.509 -28.310 1.00 70.69  ? 124 HIS B O     1 
ATOM   3968  C  CB    . HIS B  1 152 ? 2.787   -50.584 -26.712 1.00 59.33  ? 124 HIS B CB    1 
ATOM   3969  C  CG    . HIS B  1 152 ? 4.026   -51.415 -26.860 1.00 62.97  ? 124 HIS B CG    1 
ATOM   3970  N  ND1   . HIS B  1 152 ? 5.249   -50.876 -27.191 1.00 61.65  ? 124 HIS B ND1   1 
ATOM   3971  C  CD2   . HIS B  1 152 ? 4.222   -52.751 -26.746 1.00 68.07  ? 124 HIS B CD2   1 
ATOM   3972  C  CE1   . HIS B  1 152 ? 6.150   -51.841 -27.263 1.00 62.90  ? 124 HIS B CE1   1 
ATOM   3973  N  NE2   . HIS B  1 152 ? 5.552   -52.989 -26.999 1.00 69.73  ? 124 HIS B NE2   1 
ATOM   3974  N  N     . ASP B  1 154 ? 0.526   -48.670 -25.163 1.00 52.45  ? 126 ASP B N     1 
ATOM   3975  C  CA    . ASP B  1 154 ? -0.181  -47.496 -24.672 1.00 61.48  ? 126 ASP B CA    1 
ATOM   3976  C  C     . ASP B  1 154 ? 0.755   -46.296 -24.563 1.00 54.96  ? 126 ASP B C     1 
ATOM   3977  O  O     . ASP B  1 154 ? 0.716   -45.559 -23.579 1.00 49.13  ? 126 ASP B O     1 
ATOM   3978  C  CB    . ASP B  1 154 ? -0.817  -47.783 -23.309 1.00 61.40  ? 126 ASP B CB    1 
ATOM   3979  C  CG    . ASP B  1 154 ? -2.159  -48.484 -23.423 1.00 74.53  ? 126 ASP B CG    1 
ATOM   3980  O  OD1   . ASP B  1 154 ? -2.915  -48.172 -24.371 1.00 78.93  ? 126 ASP B OD1   1 
ATOM   3981  O  OD2   . ASP B  1 154 ? -2.460  -49.342 -22.561 1.00 74.96  ? 126 ASP B OD2   1 
ATOM   3982  N  N     . ILE B  1 155 ? 1.597   -46.105 -25.573 1.00 52.91  ? 127 ILE B N     1 
ATOM   3983  C  CA    . ILE B  1 155 ? 2.615   -45.061 -25.520 1.00 50.84  ? 127 ILE B CA    1 
ATOM   3984  C  C     . ILE B  1 155 ? 2.035   -43.680 -25.804 1.00 41.69  ? 127 ILE B C     1 
ATOM   3985  O  O     . ILE B  1 155 ? 1.251   -43.487 -26.726 1.00 42.66  ? 127 ILE B O     1 
ATOM   3986  C  CB    . ILE B  1 155 ? 3.763   -45.369 -26.493 1.00 49.72  ? 127 ILE B CB    1 
ATOM   3987  C  CG1   . ILE B  1 155 ? 4.524   -46.597 -25.989 1.00 44.77  ? 127 ILE B CG1   1 
ATOM   3988  C  CG2   . ILE B  1 155 ? 4.695   -44.175 -26.625 1.00 44.48  ? 127 ILE B CG2   1 
ATOM   3989  C  CD1   . ILE B  1 155 ? 5.362   -47.291 -27.039 1.00 52.68  ? 127 ILE B CD1   1 
ATOM   3990  N  N     . ARG B  1 156 ? 2.399   -42.723 -24.959 1.00 48.70  ? 128 ARG B N     1 
ATOM   3991  C  CA    . ARG B  1 156 ? 1.952   -41.353 -25.134 1.00 45.84  ? 128 ARG B CA    1 
ATOM   3992  C  C     . ARG B  1 156 ? 3.165   -40.436 -25.230 1.00 44.55  ? 128 ARG B C     1 
ATOM   3993  O  O     . ARG B  1 156 ? 4.210   -40.687 -24.611 1.00 42.23  ? 128 ARG B O     1 
ATOM   3994  C  CB    . ARG B  1 156 ? 1.023   -40.928 -23.990 1.00 46.76  ? 128 ARG B CB    1 
ATOM   3995  C  CG    . ARG B  1 156 ? -0.320  -41.677 -23.940 1.00 40.17  ? 128 ARG B CG    1 
ATOM   3996  C  CD    . ARG B  1 156 ? -1.140  -41.230 -22.721 1.00 54.93  ? 128 ARG B CD    1 
ATOM   3997  N  NE    . ARG B  1 156 ? -0.323  -41.235 -21.504 1.00 56.99  ? 128 ARG B NE    1 
ATOM   3998  C  CZ    . ARG B  1 156 ? 0.068   -40.143 -20.849 1.00 52.21  ? 128 ARG B CZ    1 
ATOM   3999  N  NH1   . ARG B  1 156 ? -0.303  -38.943 -21.270 1.00 49.18  ? 128 ARG B NH1   1 
ATOM   4000  N  NH2   . ARG B  1 156 ? 0.823   -40.254 -19.762 1.00 54.04  ? 128 ARG B NH2   1 
ATOM   4001  N  N     . THR B  1 157 ? 3.029   -39.387 -26.030 1.00 36.80  ? 129 THR B N     1 
ATOM   4002  C  CA    . THR B  1 157 ? 4.162   -38.527 -26.342 1.00 41.25  ? 129 THR B CA    1 
ATOM   4003  C  C     . THR B  1 157 ? 3.758   -37.061 -26.403 1.00 32.41  ? 129 THR B C     1 
ATOM   4004  O  O     . THR B  1 157 ? 2.603   -36.727 -26.641 1.00 35.67  ? 129 THR B O     1 
ATOM   4005  C  CB    . THR B  1 157 ? 4.819   -38.903 -27.713 1.00 39.68  ? 129 THR B CB    1 
ATOM   4006  O  OG1   . THR B  1 157 ? 3.857   -38.742 -28.762 1.00 36.80  ? 129 THR B OG1   1 
ATOM   4007  C  CG2   . THR B  1 157 ? 5.342   -40.338 -27.712 1.00 38.88  ? 129 THR B CG2   1 
ATOM   4008  N  N     . LYS B  1 158 ? 4.735   -36.193 -26.207 1.00 36.32  ? 130 LYS B N     1 
ATOM   4009  C  CA    . LYS B  1 158 ? 4.577   -34.771 -26.461 1.00 31.43  ? 130 LYS B CA    1 
ATOM   4010  C  C     . LYS B  1 158 ? 5.883   -34.226 -27.052 1.00 34.70  ? 130 LYS B C     1 
ATOM   4011  O  O     . LYS B  1 158 ? 6.959   -34.340 -26.448 1.00 33.57  ? 130 LYS B O     1 
ATOM   4012  C  CB    . LYS B  1 158 ? 4.206   -34.022 -25.184 1.00 37.58  ? 130 LYS B CB    1 
ATOM   4013  C  CG    . LYS B  1 158 ? 4.052   -32.514 -25.386 1.00 35.18  ? 130 LYS B CG    1 
ATOM   4014  C  CD    . LYS B  1 158 ? 3.559   -31.842 -24.124 1.00 42.81  ? 130 LYS B CD    1 
ATOM   4015  C  CE    . LYS B  1 158 ? 3.440   -30.324 -24.328 1.00 48.58  ? 130 LYS B CE    1 
ATOM   4016  N  NZ    . LYS B  1 158 ? 2.781   -29.976 -25.620 1.00 48.71  ? 130 LYS B NZ    1 
ATOM   4017  N  N     . SER B  1 159 ? 5.778   -33.650 -28.238 1.00 35.25  ? 131 SER B N     1 
ATOM   4018  C  CA    . SER B  1 159 ? 6.952   -33.205 -28.989 1.00 40.86  ? 131 SER B CA    1 
ATOM   4019  C  C     . SER B  1 159 ? 7.058   -31.691 -29.052 1.00 33.03  ? 131 SER B C     1 
ATOM   4020  O  O     . SER B  1 159 ? 6.047   -30.986 -29.053 1.00 34.59  ? 131 SER B O     1 
ATOM   4021  C  CB    . SER B  1 159 ? 6.920   -33.745 -30.422 1.00 36.69  ? 131 SER B CB    1 
ATOM   4022  O  OG    . SER B  1 159 ? 7.059   -35.145 -30.443 1.00 37.74  ? 131 SER B OG    1 
ATOM   4023  N  N     . MET B  1 160 ? 8.287   -31.198 -29.142 1.00 27.43  ? 132 MET B N     1 
ATOM   4024  C  CA    . MET B  1 160 ? 8.488   -29.772 -29.339 1.00 33.14  ? 132 MET B CA    1 
ATOM   4025  C  C     . MET B  1 160 ? 9.844   -29.482 -29.947 1.00 30.98  ? 132 MET B C     1 
ATOM   4026  O  O     . MET B  1 160 ? 10.814  -30.226 -29.760 1.00 30.63  ? 132 MET B O     1 
ATOM   4027  C  CB    . MET B  1 160 ? 8.344   -29.017 -28.012 1.00 30.38  ? 132 MET B CB    1 
ATOM   4028  C  CG    . MET B  1 160 ? 9.344   -29.439 -26.940 1.00 30.85  ? 132 MET B CG    1 
ATOM   4029  S  SD    . MET B  1 160 ? 8.814   -28.920 -25.278 1.00 41.46  ? 132 MET B SD    1 
ATOM   4030  C  CE    . MET B  1 160 ? 7.381   -29.967 -25.033 1.00 39.33  ? 132 MET B CE    1 
ATOM   4031  N  N     . VAL B  1 161 ? 9.902   -28.381 -30.677 1.00 32.14  ? 133 VAL B N     1 
ATOM   4032  C  CA    . VAL B  1 161 ? 11.148  -27.900 -31.220 1.00 28.83  ? 133 VAL B CA    1 
ATOM   4033  C  C     . VAL B  1 161 ? 11.101  -26.379 -31.113 1.00 26.00  ? 133 VAL B C     1 
ATOM   4034  O  O     . VAL B  1 161 ? 10.300  -25.714 -31.774 1.00 27.39  ? 133 VAL B O     1 
ATOM   4035  C  CB    . VAL B  1 161 ? 11.380  -28.418 -32.693 1.00 28.41  ? 133 VAL B CB    1 
ATOM   4036  C  CG1   . VAL B  1 161 ? 10.148  -28.233 -33.569 1.00 29.91  ? 133 VAL B CG1   1 
ATOM   4037  C  CG2   . VAL B  1 161 ? 12.611  -27.784 -33.327 1.00 28.55  ? 133 VAL B CG2   1 
ATOM   4038  N  N     . ASP B  1 162 ? 11.936  -25.855 -30.217 1.00 29.28  ? 134 ASP B N     1 
ATOM   4039  C  CA    . ASP B  1 162 ? 12.159  -24.411 -30.017 1.00 26.68  ? 134 ASP B CA    1 
ATOM   4040  C  C     . ASP B  1 162 ? 10.978  -23.638 -29.423 1.00 29.72  ? 134 ASP B C     1 
ATOM   4041  O  O     . ASP B  1 162 ? 11.167  -22.801 -28.540 1.00 28.50  ? 134 ASP B O     1 
ATOM   4042  C  CB    . ASP B  1 162 ? 12.576  -23.733 -31.321 1.00 27.23  ? 134 ASP B CB    1 
ATOM   4043  C  CG    . ASP B  1 162 ? 12.647  -22.202 -31.186 1.00 32.80  ? 134 ASP B CG    1 
ATOM   4044  O  OD1   . ASP B  1 162 ? 13.623  -21.697 -30.589 1.00 25.76  ? 134 ASP B OD1   1 
ATOM   4045  O  OD2   . ASP B  1 162 ? 11.730  -21.513 -31.694 1.00 28.50  ? 134 ASP B OD2   1 
ATOM   4046  N  N     . THR B  1 163 ? 9.768   -23.913 -29.887 1.00 30.04  ? 135 THR B N     1 
ATOM   4047  C  CA    . THR B  1 163 ? 8.608   -23.153 -29.428 1.00 32.87  ? 135 THR B CA    1 
ATOM   4048  C  C     . THR B  1 163 ? 7.847   -23.864 -28.301 1.00 36.60  ? 135 THR B C     1 
ATOM   4049  O  O     . THR B  1 163 ? 6.773   -23.421 -27.904 1.00 36.25  ? 135 THR B O     1 
ATOM   4050  C  CB    . THR B  1 163 ? 7.627   -22.879 -30.585 1.00 32.98  ? 135 THR B CB    1 
ATOM   4051  O  OG1   . THR B  1 163 ? 7.222   -24.130 -31.158 1.00 31.74  ? 135 THR B OG1   1 
ATOM   4052  C  CG2   . THR B  1 163 ? 8.277   -21.998 -31.664 1.00 28.12  ? 135 THR B CG2   1 
ATOM   4053  N  N     . GLY B  1 164 ? 8.400   -24.958 -27.786 1.00 26.45  ? 136 GLY B N     1 
ATOM   4054  C  CA    . GLY B  1 164 ? 7.791   -25.635 -26.654 1.00 31.91  ? 136 GLY B CA    1 
ATOM   4055  C  C     . GLY B  1 164 ? 8.254   -25.056 -25.328 1.00 32.80  ? 136 GLY B C     1 
ATOM   4056  O  O     . GLY B  1 164 ? 9.064   -24.133 -25.294 1.00 32.68  ? 136 GLY B O     1 
ATOM   4057  N  N     . GLU B  1 165 ? 7.758   -25.616 -24.228 1.00 35.92  ? 137 GLU B N     1 
ATOM   4058  C  CA    . GLU B  1 165 ? 8.023   -25.068 -22.894 1.00 34.88  ? 137 GLU B CA    1 
ATOM   4059  C  C     . GLU B  1 165 ? 9.439   -25.376 -22.392 1.00 34.25  ? 137 GLU B C     1 
ATOM   4060  O  O     . GLU B  1 165 ? 10.031  -24.595 -21.635 1.00 30.52  ? 137 GLU B O     1 
ATOM   4061  C  CB    . GLU B  1 165 ? 6.987   -25.603 -21.891 1.00 34.33  ? 137 GLU B CB    1 
ATOM   4062  C  CG    . GLU B  1 165 ? 5.524   -25.267 -22.216 1.00 37.25  ? 137 GLU B CG    1 
ATOM   4063  C  CD    . GLU B  1 165 ? 4.841   -26.238 -23.193 1.00 44.87  ? 137 GLU B CD    1 
ATOM   4064  O  OE1   . GLU B  1 165 ? 5.503   -27.148 -23.758 1.00 44.67  ? 137 GLU B OE1   1 
ATOM   4065  O  OE2   . GLU B  1 165 ? 3.616   -26.088 -23.401 1.00 50.13  ? 137 GLU B OE2   1 
ATOM   4066  N  N     . LEU B  1 166 ? 9.974   -26.527 -22.788 1.00 30.58  ? 138 LEU B N     1 
ATOM   4067  C  CA    . LEU B  1 166 ? 11.258  -26.980 -22.265 1.00 26.24  ? 138 LEU B CA    1 
ATOM   4068  C  C     . LEU B  1 166 ? 12.412  -26.142 -22.784 1.00 28.18  ? 138 LEU B C     1 
ATOM   4069  O  O     . LEU B  1 166 ? 12.311  -25.474 -23.814 1.00 29.73  ? 138 LEU B O     1 
ATOM   4070  C  CB    . LEU B  1 166 ? 11.511  -28.457 -22.630 1.00 28.73  ? 138 LEU B CB    1 
ATOM   4071  C  CG    . LEU B  1 166 ? 10.513  -29.504 -22.136 1.00 33.61  ? 138 LEU B CG    1 
ATOM   4072  C  CD1   . LEU B  1 166 ? 10.747  -30.880 -22.813 1.00 34.09  ? 138 LEU B CD1   1 
ATOM   4073  C  CD2   . LEU B  1 166 ? 10.605  -29.615 -20.634 1.00 29.23  ? 138 LEU B CD2   1 
ATOM   4074  N  N     . SER B  1 167 ? 13.520  -26.182 -22.059 1.00 33.32  ? 139 SER B N     1 
ATOM   4075  C  CA    . SER B  1 167 ? 14.794  -25.751 -22.620 1.00 29.90  ? 139 SER B CA    1 
ATOM   4076  C  C     . SER B  1 167 ? 15.352  -26.887 -23.480 1.00 28.98  ? 139 SER B C     1 
ATOM   4077  O  O     . SER B  1 167 ? 15.709  -27.953 -22.956 1.00 27.38  ? 139 SER B O     1 
ATOM   4078  C  CB    . SER B  1 167 ? 15.791  -25.407 -21.530 1.00 23.59  ? 139 SER B CB    1 
ATOM   4079  O  OG    . SER B  1 167 ? 17.094  -25.393 -22.070 1.00 30.02  ? 139 SER B OG    1 
ATOM   4080  N  N     . ASP B  1 168 ? 15.415  -26.656 -24.785 1.00 28.21  ? 140 ASP B N     1 
ATOM   4081  C  CA    . ASP B  1 168 ? 15.982  -27.628 -25.718 1.00 30.64  ? 140 ASP B CA    1 
ATOM   4082  C  C     . ASP B  1 168 ? 17.442  -27.929 -25.367 1.00 32.78  ? 140 ASP B C     1 
ATOM   4083  O  O     . ASP B  1 168 ? 17.884  -29.073 -25.471 1.00 31.31  ? 140 ASP B O     1 
ATOM   4084  C  CB    . ASP B  1 168 ? 15.885  -27.128 -27.164 1.00 20.19  ? 140 ASP B CB    1 
ATOM   4085  C  CG    . ASP B  1 168 ? 14.450  -26.864 -27.606 1.00 25.89  ? 140 ASP B CG    1 
ATOM   4086  O  OD1   . ASP B  1 168 ? 13.505  -27.254 -26.892 1.00 28.55  ? 140 ASP B OD1   1 
ATOM   4087  O  OD2   . ASP B  1 168 ? 14.257  -26.281 -28.691 1.00 30.87  ? 140 ASP B OD2   1 
ATOM   4088  N  N     . ARG B  1 169 ? 18.194  -26.914 -24.954 1.00 27.26  ? 141 ARG B N     1 
ATOM   4089  C  CA    . ARG B  1 169 ? 19.574  -27.157 -24.543 1.00 28.81  ? 141 ARG B CA    1 
ATOM   4090  C  C     . ARG B  1 169 ? 19.667  -27.965 -23.254 1.00 33.09  ? 141 ARG B C     1 
ATOM   4091  O  O     . ARG B  1 169 ? 20.570  -28.782 -23.113 1.00 30.01  ? 141 ARG B O     1 
ATOM   4092  C  CB    . ARG B  1 169 ? 20.325  -25.847 -24.350 1.00 29.35  ? 141 ARG B CB    1 
ATOM   4093  C  CG    . ARG B  1 169 ? 20.584  -25.068 -25.621 1.00 30.25  ? 141 ARG B CG    1 
ATOM   4094  C  CD    . ARG B  1 169 ? 21.510  -23.938 -25.272 1.00 25.47  ? 141 ARG B CD    1 
ATOM   4095  N  NE    . ARG B  1 169 ? 21.930  -23.118 -26.401 1.00 22.92  ? 141 ARG B NE    1 
ATOM   4096  C  CZ    . ARG B  1 169 ? 21.900  -21.786 -26.384 1.00 29.76  ? 141 ARG B CZ    1 
ATOM   4097  N  NH1   . ARG B  1 169 ? 21.443  -21.152 -25.305 1.00 24.29  ? 141 ARG B NH1   1 
ATOM   4098  N  NH2   . ARG B  1 169 ? 22.323  -21.090 -27.429 1.00 27.30  ? 141 ARG B NH2   1 
ATOM   4099  N  N     . ALA B  1 170 ? 18.772  -27.709 -22.297 1.00 29.24  ? 142 ALA B N     1 
ATOM   4100  C  CA    . ALA B  1 170 ? 18.844  -28.428 -21.024 1.00 37.33  ? 142 ALA B CA    1 
ATOM   4101  C  C     . ALA B  1 170 ? 18.549  -29.896 -21.278 1.00 32.93  ? 142 ALA B C     1 
ATOM   4102  O  O     . ALA B  1 170 ? 19.240  -30.772 -20.768 1.00 32.45  ? 142 ALA B O     1 
ATOM   4103  C  CB    . ALA B  1 170 ? 17.870  -27.845 -19.979 1.00 31.70  ? 142 ALA B CB    1 
ATOM   4104  N  N     . VAL B  1 171 ? 17.528  -30.149 -22.090 1.00 33.44  ? 143 VAL B N     1 
ATOM   4105  C  CA    . VAL B  1 171 ? 17.177  -31.504 -22.456 1.00 33.09  ? 143 VAL B CA    1 
ATOM   4106  C  C     . VAL B  1 171 ? 18.365  -32.173 -23.136 1.00 35.55  ? 143 VAL B C     1 
ATOM   4107  O  O     . VAL B  1 171 ? 18.781  -33.255 -22.738 1.00 33.34  ? 143 VAL B O     1 
ATOM   4108  C  CB    . VAL B  1 171 ? 15.949  -31.548 -23.371 1.00 34.71  ? 143 VAL B CB    1 
ATOM   4109  C  CG1   . VAL B  1 171 ? 15.765  -32.956 -23.934 1.00 31.05  ? 143 VAL B CG1   1 
ATOM   4110  C  CG2   . VAL B  1 171 ? 14.705  -31.116 -22.606 1.00 29.88  ? 143 VAL B CG2   1 
ATOM   4111  N  N     . ALA B  1 172 ? 18.944  -31.500 -24.119 1.00 32.05  ? 144 ALA B N     1 
ATOM   4112  C  CA    . ALA B  1 172 ? 20.043  -32.064 -24.892 1.00 33.02  ? 144 ALA B CA    1 
ATOM   4113  C  C     . ALA B  1 172 ? 21.316  -32.279 -24.073 1.00 35.74  ? 144 ALA B C     1 
ATOM   4114  O  O     . ALA B  1 172 ? 22.064  -33.233 -24.316 1.00 34.76  ? 144 ALA B O     1 
ATOM   4115  C  CB    . ALA B  1 172 ? 20.344  -31.177 -26.085 1.00 31.40  ? 144 ALA B CB    1 
ATOM   4116  N  N     . GLU B  1 173 ? 21.595  -31.387 -23.131 1.00 32.25  ? 145 GLU B N     1 
ATOM   4117  C  CA    . GLU B  1 173 ? 22.749  -31.583 -22.253 1.00 34.04  ? 145 GLU B CA    1 
ATOM   4118  C  C     . GLU B  1 173 ? 22.563  -32.832 -21.387 1.00 35.08  ? 145 GLU B C     1 
ATOM   4119  O  O     . GLU B  1 173 ? 23.473  -33.668 -21.284 1.00 31.01  ? 145 GLU B O     1 
ATOM   4120  C  CB    . GLU B  1 173 ? 22.990  -30.366 -21.355 1.00 30.75  ? 145 GLU B CB    1 
ATOM   4121  C  CG    . GLU B  1 173 ? 24.218  -30.518 -20.447 1.00 39.01  ? 145 GLU B CG    1 
ATOM   4122  C  CD    . GLU B  1 173 ? 24.348  -29.381 -19.410 1.00 49.44  ? 145 GLU B CD    1 
ATOM   4123  O  OE1   . GLU B  1 173 ? 23.325  -28.991 -18.799 1.00 46.33  ? 145 GLU B OE1   1 
ATOM   4124  O  OE2   . GLU B  1 173 ? 25.476  -28.882 -19.208 1.00 42.67  ? 145 GLU B OE2   1 
ATOM   4125  N  N     . ARG B  1 174 ? 21.388  -32.972 -20.782 1.00 31.21  ? 146 ARG B N     1 
ATOM   4126  C  CA    . ARG B  1 174 ? 21.157  -34.081 -19.848 1.00 28.74  ? 146 ARG B CA    1 
ATOM   4127  C  C     . ARG B  1 174 ? 21.038  -35.432 -20.573 1.00 37.76  ? 146 ARG B C     1 
ATOM   4128  O  O     . ARG B  1 174 ? 21.196  -36.482 -19.954 1.00 37.81  ? 146 ARG B O     1 
ATOM   4129  C  CB    . ARG B  1 174 ? 19.897  -33.838 -19.010 1.00 31.08  ? 146 ARG B CB    1 
ATOM   4130  C  CG    . ARG B  1 174 ? 19.903  -34.553 -17.656 1.00 30.12  ? 146 ARG B CG    1 
ATOM   4131  C  CD    . ARG B  1 174 ? 18.772  -34.074 -16.772 1.00 30.32  ? 146 ARG B CD    1 
ATOM   4132  N  NE    . ARG B  1 174 ? 17.465  -34.563 -17.208 1.00 30.50  ? 146 ARG B NE    1 
ATOM   4133  C  CZ    . ARG B  1 174 ? 16.315  -34.207 -16.637 1.00 31.57  ? 146 ARG B CZ    1 
ATOM   4134  N  NH1   . ARG B  1 174 ? 16.325  -33.362 -15.623 1.00 33.43  ? 146 ARG B NH1   1 
ATOM   4135  N  NH2   . ARG B  1 174 ? 15.153  -34.685 -17.073 1.00 31.15  ? 146 ARG B NH2   1 
ATOM   4136  N  N     . ALA B  1 175 ? 20.762  -35.404 -21.877 1.00 32.31  ? 147 ALA B N     1 
ATOM   4137  C  CA    . ALA B  1 175 ? 20.624  -36.634 -22.671 1.00 36.36  ? 147 ALA B CA    1 
ATOM   4138  C  C     . ALA B  1 175 ? 21.896  -36.997 -23.429 1.00 35.04  ? 147 ALA B C     1 
ATOM   4139  O  O     . ALA B  1 175 ? 21.926  -37.993 -24.167 1.00 38.78  ? 147 ALA B O     1 
ATOM   4140  C  CB    . ALA B  1 175 ? 19.456  -36.507 -23.651 1.00 35.34  ? 147 ALA B CB    1 
ATOM   4141  N  N     . GLY B  1 176 ? 22.936  -36.187 -23.265 1.00 33.12  ? 148 GLY B N     1 
ATOM   4142  C  CA    . GLY B  1 176 ? 24.250  -36.511 -23.797 1.00 34.24  ? 148 GLY B CA    1 
ATOM   4143  C  C     . GLY B  1 176 ? 24.486  -36.174 -25.260 1.00 39.72  ? 148 GLY B C     1 
ATOM   4144  O  O     . GLY B  1 176 ? 25.467  -36.633 -25.853 1.00 37.77  ? 148 GLY B O     1 
ATOM   4145  N  N     . ILE B  1 177 ? 23.590  -35.376 -25.839 1.00 35.09  ? 149 ILE B N     1 
ATOM   4146  C  CA    . ILE B  1 177 ? 23.747  -34.879 -27.203 1.00 31.83  ? 149 ILE B CA    1 
ATOM   4147  C  C     . ILE B  1 177 ? 25.047  -34.079 -27.363 1.00 35.32  ? 149 ILE B C     1 
ATOM   4148  O  O     . ILE B  1 177 ? 25.839  -34.322 -28.274 1.00 30.49  ? 149 ILE B O     1 
ATOM   4149  C  CB    . ILE B  1 177 ? 22.545  -33.995 -27.607 1.00 35.03  ? 149 ILE B CB    1 
ATOM   4150  C  CG1   . ILE B  1 177 ? 21.259  -34.826 -27.707 1.00 29.01  ? 149 ILE B CG1   1 
ATOM   4151  C  CG2   . ILE B  1 177 ? 22.837  -33.225 -28.919 1.00 30.46  ? 149 ILE B CG2   1 
ATOM   4152  C  CD1   . ILE B  1 177 ? 21.291  -35.902 -28.790 1.00 32.53  ? 149 ILE B CD1   1 
ATOM   4153  N  N     . GLY B  1 178 ? 25.261  -33.114 -26.477 1.00 35.95  ? 150 GLY B N     1 
ATOM   4154  C  CA    . GLY B  1 178 ? 26.464  -32.305 -26.522 1.00 36.04  ? 150 GLY B CA    1 
ATOM   4155  C  C     . GLY B  1 178 ? 26.663  -31.650 -25.172 1.00 37.76  ? 150 GLY B C     1 
ATOM   4156  O  O     . GLY B  1 178 ? 25.815  -31.796 -24.294 1.00 40.66  ? 150 GLY B O     1 
ATOM   4157  N  N     . PHE B  1 179 ? 27.773  -30.945 -24.976 1.00 34.36  ? 151 PHE B N     1 
ATOM   4158  C  CA    . PHE B  1 179 ? 27.952  -30.218 -23.722 1.00 36.75  ? 151 PHE B CA    1 
ATOM   4159  C  C     . PHE B  1 179 ? 27.633  -28.722 -23.872 1.00 37.26  ? 151 PHE B C     1 
ATOM   4160  O  O     . PHE B  1 179 ? 27.601  -28.184 -24.988 1.00 31.69  ? 151 PHE B O     1 
ATOM   4161  C  CB    . PHE B  1 179 ? 29.376  -30.388 -23.196 1.00 38.25  ? 151 PHE B CB    1 
ATOM   4162  C  CG    . PHE B  1 179 ? 30.387  -29.611 -23.959 1.00 43.69  ? 151 PHE B CG    1 
ATOM   4163  C  CD1   . PHE B  1 179 ? 30.804  -28.358 -23.510 1.00 39.05  ? 151 PHE B CD1   1 
ATOM   4164  C  CD2   . PHE B  1 179 ? 30.912  -30.110 -25.149 1.00 37.62  ? 151 PHE B CD2   1 
ATOM   4165  C  CE1   . PHE B  1 179 ? 31.726  -27.630 -24.219 1.00 33.91  ? 151 PHE B CE1   1 
ATOM   4166  C  CE2   . PHE B  1 179 ? 31.843  -29.378 -25.864 1.00 38.37  ? 151 PHE B CE2   1 
ATOM   4167  C  CZ    . PHE B  1 179 ? 32.247  -28.133 -25.397 1.00 41.59  ? 151 PHE B CZ    1 
ATOM   4168  N  N     . SER B  1 180 ? 27.421  -28.061 -22.733 1.00 38.67  ? 152 SER B N     1 
ATOM   4169  C  CA    . SER B  1 180 ? 27.143  -26.625 -22.681 1.00 40.01  ? 152 SER B CA    1 
ATOM   4170  C  C     . SER B  1 180 ? 28.436  -25.806 -22.695 1.00 34.26  ? 152 SER B C     1 
ATOM   4171  O  O     . SER B  1 180 ? 29.154  -25.723 -21.706 1.00 33.98  ? 152 SER B O     1 
ATOM   4172  C  CB    . SER B  1 180 ? 26.311  -26.297 -21.439 1.00 40.21  ? 152 SER B CB    1 
ATOM   4173  O  OG    . SER B  1 180 ? 25.259  -27.240 -21.301 1.00 35.23  ? 152 SER B OG    1 
ATOM   4174  N  N     . ALA B  1 181 ? 28.722  -25.200 -23.836 1.00 35.32  ? 153 ALA B N     1 
ATOM   4175  C  CA    . ALA B  1 181 ? 29.974  -24.492 -24.019 1.00 32.16  ? 153 ALA B CA    1 
ATOM   4176  C  C     . ALA B  1 181 ? 29.876  -23.063 -23.468 1.00 35.91  ? 153 ALA B C     1 
ATOM   4177  O  O     . ALA B  1 181 ? 28.817  -22.636 -22.999 1.00 27.92  ? 153 ALA B O     1 
ATOM   4178  C  CB    . ALA B  1 181 ? 30.357  -24.485 -25.473 1.00 32.90  ? 153 ALA B CB    1 
ATOM   4179  N  N     . LYS B  1 182 ? 30.992  -22.345 -23.505 1.00 35.04  ? 154 LYS B N     1 
ATOM   4180  C  CA    . LYS B  1 182 ? 31.067  -21.023 -22.893 1.00 35.92  ? 154 LYS B CA    1 
ATOM   4181  C  C     . LYS B  1 182 ? 30.308  -19.968 -23.690 1.00 33.02  ? 154 LYS B C     1 
ATOM   4182  O  O     . LYS B  1 182 ? 30.108  -18.857 -23.209 1.00 35.52  ? 154 LYS B O     1 
ATOM   4183  C  CB    . LYS B  1 182 ? 32.524  -20.589 -22.739 1.00 36.16  ? 154 LYS B CB    1 
ATOM   4184  C  CG    . LYS B  1 182 ? 33.299  -21.357 -21.695 1.00 38.38  ? 154 LYS B CG    1 
ATOM   4185  C  CD    . LYS B  1 182 ? 34.702  -20.796 -21.579 1.00 42.98  ? 154 LYS B CD    1 
ATOM   4186  C  CE    . LYS B  1 182 ? 35.487  -21.504 -20.487 1.00 47.94  ? 154 LYS B CE    1 
ATOM   4187  N  NZ    . LYS B  1 182 ? 36.836  -20.896 -20.326 1.00 48.89  ? 154 LYS B NZ    1 
ATOM   4188  N  N     . ASN B  1 183 ? 29.901  -20.315 -24.910 1.00 33.02  ? 155 ASN B N     1 
ATOM   4189  C  CA    . ASN B  1 183 ? 29.091  -19.422 -25.751 1.00 31.20  ? 155 ASN B CA    1 
ATOM   4190  C  C     . ASN B  1 183 ? 27.610  -19.774 -25.655 1.00 29.19  ? 155 ASN B C     1 
ATOM   4191  O  O     . ASN B  1 183 ? 26.815  -19.337 -26.482 1.00 32.87  ? 155 ASN B O     1 
ATOM   4192  C  CB    . ASN B  1 183 ? 29.554  -19.503 -27.223 1.00 33.70  ? 155 ASN B CB    1 
ATOM   4193  C  CG    . ASN B  1 183 ? 29.484  -20.935 -27.789 1.00 34.82  ? 155 ASN B CG    1 
ATOM   4194  O  OD1   . ASN B  1 183 ? 29.018  -21.872 -27.116 1.00 30.85  ? 155 ASN B OD1   1 
ATOM   4195  N  ND2   . ASN B  1 183 ? 29.924  -21.102 -29.047 1.00 35.41  ? 155 ASN B ND2   1 
ATOM   4196  N  N     . CYS B  1 184 ? 27.276  -20.611 -24.669 1.00 28.59  ? 156 CYS B N     1 
ATOM   4197  C  CA    . CYS B  1 184 ? 25.918  -21.116 -24.419 1.00 29.14  ? 156 CYS B CA    1 
ATOM   4198  C  C     . CYS B  1 184 ? 25.454  -22.217 -25.403 1.00 31.91  ? 156 CYS B C     1 
ATOM   4199  O  O     . CYS B  1 184 ? 24.411  -22.849 -25.180 1.00 28.08  ? 156 CYS B O     1 
ATOM   4200  C  CB    . CYS B  1 184 ? 24.902  -19.955 -24.410 1.00 25.87  ? 156 CYS B CB    1 
ATOM   4201  S  SG    . CYS B  1 184 ? 25.266  -18.673 -23.142 1.00 32.79  ? 156 CYS B SG    1 
ATOM   4202  N  N     . MET B  1 185 ? 26.220  -22.485 -26.460 1.00 27.85  ? 157 MET B N     1 
ATOM   4203  C  CA    . MET B  1 185 ? 25.791  -23.513 -27.421 1.00 23.97  ? 157 MET B CA    1 
ATOM   4204  C  C     . MET B  1 185 ? 25.935  -24.935 -26.863 1.00 33.03  ? 157 MET B C     1 
ATOM   4205  O  O     . MET B  1 185 ? 26.951  -25.270 -26.234 1.00 33.15  ? 157 MET B O     1 
ATOM   4206  C  CB    . MET B  1 185 ? 26.582  -23.407 -28.723 1.00 26.90  ? 157 MET B CB    1 
ATOM   4207  C  CG    . MET B  1 185 ? 26.467  -22.046 -29.425 1.00 31.34  ? 157 MET B CG    1 
ATOM   4208  S  SD    . MET B  1 185 ? 24.762  -21.615 -29.852 1.00 29.12  ? 157 MET B SD    1 
ATOM   4209  C  CE    . MET B  1 185 ? 24.389  -22.854 -31.111 1.00 26.20  ? 157 MET B CE    1 
ATOM   4210  N  N     . ILE B  1 186 ? 24.917  -25.769 -27.081 1.00 28.78  ? 158 ILE B N     1 
ATOM   4211  C  CA    . ILE B  1 186 ? 25.129  -27.207 -27.008 1.00 28.96  ? 158 ILE B CA    1 
ATOM   4212  C  C     . ILE B  1 186 ? 26.086  -27.564 -28.136 1.00 32.46  ? 158 ILE B C     1 
ATOM   4213  O  O     . ILE B  1 186 ? 25.786  -27.344 -29.315 1.00 30.54  ? 158 ILE B O     1 
ATOM   4214  C  CB    . ILE B  1 186 ? 23.824  -28.020 -27.121 1.00 29.73  ? 158 ILE B CB    1 
ATOM   4215  C  CG1   . ILE B  1 186 ? 22.992  -27.865 -25.849 1.00 29.38  ? 158 ILE B CG1   1 
ATOM   4216  C  CG2   . ILE B  1 186 ? 24.131  -29.536 -27.344 1.00 31.40  ? 158 ILE B CG2   1 
ATOM   4217  C  CD1   . ILE B  1 186 ? 23.659  -28.447 -24.593 1.00 34.58  ? 158 ILE B CD1   1 
ATOM   4218  N  N     . THR B  1 187 ? 27.251  -28.091 -27.764 1.00 32.19  ? 159 THR B N     1 
ATOM   4219  C  CA    . THR B  1 187 ? 28.331  -28.358 -28.715 1.00 32.42  ? 159 THR B CA    1 
ATOM   4220  C  C     . THR B  1 187 ? 28.657  -29.873 -28.784 1.00 37.42  ? 159 THR B C     1 
ATOM   4221  O  O     . THR B  1 187 ? 29.010  -30.500 -27.775 1.00 39.75  ? 159 THR B O     1 
ATOM   4222  C  CB    . THR B  1 187 ? 29.575  -27.544 -28.336 1.00 30.98  ? 159 THR B CB    1 
ATOM   4223  O  OG1   . THR B  1 187 ? 29.293  -26.145 -28.493 1.00 33.10  ? 159 THR B OG1   1 
ATOM   4224  C  CG2   . THR B  1 187 ? 30.764  -27.909 -29.200 1.00 36.09  ? 159 THR B CG2   1 
ATOM   4225  N  N     . THR B  1 188 ? 28.494  -30.463 -29.967 1.00 33.84  ? 160 THR B N     1 
ATOM   4226  C  CA    . THR B  1 188 ? 28.703  -31.900 -30.153 1.00 34.80  ? 160 THR B CA    1 
ATOM   4227  C  C     . THR B  1 188 ? 30.124  -32.196 -30.626 1.00 36.99  ? 160 THR B C     1 
ATOM   4228  O  O     . THR B  1 188 ? 30.727  -31.381 -31.310 1.00 31.85  ? 160 THR B O     1 
ATOM   4229  C  CB    . THR B  1 188 ? 27.701  -32.488 -31.170 1.00 37.72  ? 160 THR B CB    1 
ATOM   4230  O  OG1   . THR B  1 188 ? 27.997  -31.975 -32.475 1.00 35.98  ? 160 THR B OG1   1 
ATOM   4231  C  CG2   . THR B  1 188 ? 26.263  -32.122 -30.795 1.00 33.41  ? 160 THR B CG2   1 
ATOM   4232  N  N     . PRO B  1 189 ? 30.671  -33.375 -30.269 1.00 41.24  ? 161 PRO B N     1 
ATOM   4233  C  CA    . PRO B  1 189 ? 32.047  -33.616 -30.724 1.00 42.01  ? 161 PRO B CA    1 
ATOM   4234  C  C     . PRO B  1 189 ? 32.153  -33.780 -32.251 1.00 38.03  ? 161 PRO B C     1 
ATOM   4235  O  O     . PRO B  1 189 ? 33.136  -33.311 -32.831 1.00 36.97  ? 161 PRO B O     1 
ATOM   4236  C  CB    . PRO B  1 189 ? 32.458  -34.907 -29.974 1.00 40.90  ? 161 PRO B CB    1 
ATOM   4237  C  CG    . PRO B  1 189 ? 31.196  -35.504 -29.464 1.00 45.64  ? 161 PRO B CG    1 
ATOM   4238  C  CD    . PRO B  1 189 ? 30.194  -34.398 -29.322 1.00 42.47  ? 161 PRO B CD    1 
ATOM   4239  N  N     . GLU B  1 190 ? 31.146  -34.381 -32.890 1.00 39.26  ? 162 GLU B N     1 
ATOM   4240  C  CA    . GLU B  1 190 ? 31.208  -34.669 -34.332 1.00 41.44  ? 162 GLU B CA    1 
ATOM   4241  C  C     . GLU B  1 190 ? 30.760  -33.509 -35.228 1.00 39.51  ? 162 GLU B C     1 
ATOM   4242  O  O     . GLU B  1 190 ? 31.359  -33.265 -36.277 1.00 43.30  ? 162 GLU B O     1 
ATOM   4243  C  CB    . GLU B  1 190 ? 30.354  -35.904 -34.671 1.00 40.54  ? 162 GLU B CB    1 
ATOM   4244  C  CG    . GLU B  1 190 ? 30.434  -37.039 -33.648 1.00 44.50  ? 162 GLU B CG    1 
ATOM   4245  C  CD    . GLU B  1 190 ? 29.330  -36.975 -32.591 1.00 50.36  ? 162 GLU B CD    1 
ATOM   4246  O  OE1   . GLU B  1 190 ? 29.076  -35.878 -32.049 1.00 48.78  ? 162 GLU B OE1   1 
ATOM   4247  O  OE2   . GLU B  1 190 ? 28.711  -38.027 -32.303 1.00 62.38  ? 162 GLU B OE2   1 
ATOM   4248  N  N     . TYR B  1 191 ? 29.692  -32.818 -34.829 1.00 39.30  ? 163 TYR B N     1 
ATOM   4249  C  CA    . TYR B  1 191 ? 29.077  -31.780 -35.662 1.00 37.86  ? 163 TYR B CA    1 
ATOM   4250  C  C     . TYR B  1 191 ? 29.320  -30.363 -35.150 1.00 35.54  ? 163 TYR B C     1 
ATOM   4251  O  O     . TYR B  1 191 ? 28.931  -29.383 -35.803 1.00 31.04  ? 163 TYR B O     1 
ATOM   4252  C  CB    . TYR B  1 191 ? 27.571  -32.029 -35.776 1.00 32.87  ? 163 TYR B CB    1 
ATOM   4253  C  CG    . TYR B  1 191 ? 27.247  -33.457 -36.130 1.00 34.75  ? 163 TYR B CG    1 
ATOM   4254  C  CD1   . TYR B  1 191 ? 27.458  -33.932 -37.415 1.00 31.70  ? 163 TYR B CD1   1 
ATOM   4255  C  CD2   . TYR B  1 191 ? 26.748  -34.331 -35.183 1.00 35.85  ? 163 TYR B CD2   1 
ATOM   4256  C  CE1   . TYR B  1 191 ? 27.179  -35.226 -37.751 1.00 37.81  ? 163 TYR B CE1   1 
ATOM   4257  C  CE2   . TYR B  1 191 ? 26.457  -35.641 -35.512 1.00 41.36  ? 163 TYR B CE2   1 
ATOM   4258  C  CZ    . TYR B  1 191 ? 26.680  -36.077 -36.808 1.00 38.12  ? 163 TYR B CZ    1 
ATOM   4259  O  OH    . TYR B  1 191 ? 26.407  -37.373 -37.158 1.00 46.84  ? 163 TYR B OH    1 
ATOM   4260  N  N     . GLY B  1 192 ? 29.955  -30.262 -33.987 1.00 36.27  ? 164 GLY B N     1 
ATOM   4261  C  CA    . GLY B  1 192 ? 30.194  -28.977 -33.342 1.00 35.78  ? 164 GLY B CA    1 
ATOM   4262  C  C     . GLY B  1 192 ? 28.920  -28.372 -32.774 1.00 32.36  ? 164 GLY B C     1 
ATOM   4263  O  O     . GLY B  1 192 ? 28.048  -29.098 -32.325 1.00 28.98  ? 164 GLY B O     1 
ATOM   4264  N  N     . SER B  1 193 ? 28.806  -27.042 -32.810 1.00 33.54  ? 165 SER B N     1 
ATOM   4265  C  CA    . SER B  1 193 ? 27.608  -26.347 -32.315 1.00 35.65  ? 165 SER B CA    1 
ATOM   4266  C  C     . SER B  1 193 ? 26.511  -26.221 -33.389 1.00 35.27  ? 165 SER B C     1 
ATOM   4267  O  O     . SER B  1 193 ? 25.374  -25.812 -33.102 1.00 29.82  ? 165 SER B O     1 
ATOM   4268  C  CB    . SER B  1 193 ? 27.973  -24.947 -31.798 1.00 29.58  ? 165 SER B CB    1 
ATOM   4269  O  OG    . SER B  1 193 ? 28.456  -24.128 -32.858 1.00 34.34  ? 165 SER B OG    1 
ATOM   4270  N  N     . TYR B  1 194 ? 26.864  -26.569 -34.622 1.00 31.76  ? 166 TYR B N     1 
ATOM   4271  C  CA    . TYR B  1 194 ? 26.005  -26.308 -35.765 1.00 32.36  ? 166 TYR B CA    1 
ATOM   4272  C  C     . TYR B  1 194 ? 24.933  -27.373 -35.868 1.00 30.53  ? 166 TYR B C     1 
ATOM   4273  O  O     . TYR B  1 194 ? 24.866  -28.114 -36.865 1.00 31.17  ? 166 TYR B O     1 
ATOM   4274  C  CB    . TYR B  1 194 ? 26.821  -26.255 -37.062 1.00 32.02  ? 166 TYR B CB    1 
ATOM   4275  C  CG    . TYR B  1 194 ? 27.777  -25.097 -37.159 1.00 31.92  ? 166 TYR B CG    1 
ATOM   4276  C  CD1   . TYR B  1 194 ? 27.373  -23.800 -36.848 1.00 36.50  ? 166 TYR B CD1   1 
ATOM   4277  C  CD2   . TYR B  1 194 ? 29.086  -25.289 -37.560 1.00 36.21  ? 166 TYR B CD2   1 
ATOM   4278  C  CE1   . TYR B  1 194 ? 28.240  -22.740 -36.934 1.00 31.04  ? 166 TYR B CE1   1 
ATOM   4279  C  CE2   . TYR B  1 194 ? 29.968  -24.223 -37.649 1.00 37.72  ? 166 TYR B CE2   1 
ATOM   4280  C  CZ    . TYR B  1 194 ? 29.537  -22.955 -37.332 1.00 35.45  ? 166 TYR B CZ    1 
ATOM   4281  O  OH    . TYR B  1 194 ? 30.414  -21.906 -37.431 1.00 35.12  ? 166 TYR B OH    1 
ATOM   4282  N  N     . VAL B  1 195 ? 24.102  -27.458 -34.832 1.00 29.20  ? 167 VAL B N     1 
ATOM   4283  C  CA    . VAL B  1 195 ? 23.032  -28.444 -34.795 1.00 27.50  ? 167 VAL B CA    1 
ATOM   4284  C  C     . VAL B  1 195 ? 21.724  -27.798 -34.377 1.00 27.58  ? 167 VAL B C     1 
ATOM   4285  O  O     . VAL B  1 195 ? 21.716  -26.930 -33.520 1.00 27.48  ? 167 VAL B O     1 
ATOM   4286  C  CB    . VAL B  1 195 ? 23.353  -29.624 -33.820 1.00 33.37  ? 167 VAL B CB    1 
ATOM   4287  C  CG1   . VAL B  1 195 ? 24.452  -30.514 -34.389 1.00 31.15  ? 167 VAL B CG1   1 
ATOM   4288  C  CG2   . VAL B  1 195 ? 23.739  -29.103 -32.433 1.00 29.96  ? 167 VAL B CG2   1 
ATOM   4289  N  N     . TYR B  1 196 ? 20.627  -28.224 -34.992 1.00 25.01  ? 168 TYR B N     1 
ATOM   4290  C  CA    . TYR B  1 196 ? 19.288  -27.941 -34.486 1.00 25.30  ? 168 TYR B CA    1 
ATOM   4291  C  C     . TYR B  1 196 ? 18.886  -28.968 -33.433 1.00 27.94  ? 168 TYR B C     1 
ATOM   4292  O  O     . TYR B  1 196 ? 19.146  -30.155 -33.603 1.00 29.62  ? 168 TYR B O     1 
ATOM   4293  C  CB    . TYR B  1 196 ? 18.263  -27.962 -35.617 1.00 24.98  ? 168 TYR B CB    1 
ATOM   4294  C  CG    . TYR B  1 196 ? 18.507  -26.954 -36.714 1.00 30.60  ? 168 TYR B CG    1 
ATOM   4295  C  CD1   . TYR B  1 196 ? 18.515  -25.592 -36.442 1.00 24.31  ? 168 TYR B CD1   1 
ATOM   4296  C  CD2   . TYR B  1 196 ? 18.696  -27.368 -38.039 1.00 28.07  ? 168 TYR B CD2   1 
ATOM   4297  C  CE1   . TYR B  1 196 ? 18.726  -24.662 -37.452 1.00 27.50  ? 168 TYR B CE1   1 
ATOM   4298  C  CE2   . TYR B  1 196 ? 18.898  -26.456 -39.042 1.00 29.14  ? 168 TYR B CE2   1 
ATOM   4299  C  CZ    . TYR B  1 196 ? 18.906  -25.103 -38.753 1.00 29.55  ? 168 TYR B CZ    1 
ATOM   4300  O  OH    . TYR B  1 196 ? 19.112  -24.199 -39.777 1.00 30.52  ? 168 TYR B OH    1 
ATOM   4301  N  N     . LEU B  1 197 ? 18.233  -28.529 -32.361 1.00 30.29  ? 169 LEU B N     1 
ATOM   4302  C  CA    . LEU B  1 197 ? 17.768  -29.442 -31.313 1.00 26.27  ? 169 LEU B CA    1 
ATOM   4303  C  C     . LEU B  1 197 ? 16.238  -29.546 -31.257 1.00 29.76  ? 169 LEU B C     1 
ATOM   4304  O  O     . LEU B  1 197 ? 15.514  -28.600 -31.593 1.00 28.22  ? 169 LEU B O     1 
ATOM   4305  C  CB    . LEU B  1 197 ? 18.286  -28.991 -29.941 1.00 26.70  ? 169 LEU B CB    1 
ATOM   4306  C  CG    . LEU B  1 197 ? 19.775  -28.677 -29.789 1.00 26.88  ? 169 LEU B CG    1 
ATOM   4307  C  CD1   . LEU B  1 197 ? 20.054  -28.132 -28.376 1.00 29.30  ? 169 LEU B CD1   1 
ATOM   4308  C  CD2   . LEU B  1 197 ? 20.604  -29.904 -30.088 1.00 27.17  ? 169 LEU B CD2   1 
ATOM   4309  N  N     . ALA B  1 198 ? 15.751  -30.704 -30.827 1.00 27.36  ? 170 ALA B N     1 
ATOM   4310  C  CA    . ALA B  1 198 ? 14.325  -30.899 -30.557 1.00 30.14  ? 170 ALA B CA    1 
ATOM   4311  C  C     . ALA B  1 198 ? 14.193  -32.089 -29.622 1.00 26.10  ? 170 ALA B C     1 
ATOM   4312  O  O     . ALA B  1 198 ? 15.182  -32.730 -29.307 1.00 25.49  ? 170 ALA B O     1 
ATOM   4313  C  CB    . ALA B  1 198 ? 13.531  -31.123 -31.852 1.00 26.51  ? 170 ALA B CB    1 
ATOM   4314  N  N     . GLU B  1 199 ? 12.985  -32.387 -29.174 1.00 25.83  ? 171 GLU B N     1 
ATOM   4315  C  CA    . GLU B  1 199 ? 12.826  -33.475 -28.226 1.00 29.84  ? 171 GLU B CA    1 
ATOM   4316  C  C     . GLU B  1 199 ? 11.386  -33.920 -28.087 1.00 34.17  ? 171 GLU B C     1 
ATOM   4317  O  O     . GLU B  1 199 ? 10.446  -33.212 -28.470 1.00 33.17  ? 171 GLU B O     1 
ATOM   4318  C  CB    . GLU B  1 199 ? 13.366  -33.086 -26.858 1.00 28.87  ? 171 GLU B CB    1 
ATOM   4319  C  CG    . GLU B  1 199 ? 12.615  -31.917 -26.209 1.00 32.46  ? 171 GLU B CG    1 
ATOM   4320  C  CD    . GLU B  1 199 ? 13.236  -30.558 -26.510 1.00 31.79  ? 171 GLU B CD    1 
ATOM   4321  O  OE1   . GLU B  1 199 ? 14.342  -30.507 -27.095 1.00 29.54  ? 171 GLU B OE1   1 
ATOM   4322  O  OE2   . GLU B  1 199 ? 12.618  -29.537 -26.133 1.00 30.46  ? 171 GLU B OE2   1 
ATOM   4323  N  N     . MET B  1 200 ? 11.239  -35.113 -27.527 1.00 33.65  ? 172 MET B N     1 
ATOM   4324  C  CA    . MET B  1 200 ? 9.955   -35.764 -27.421 1.00 37.46  ? 172 MET B CA    1 
ATOM   4325  C  C     . MET B  1 200 ? 9.820   -36.419 -26.052 1.00 36.09  ? 172 MET B C     1 
ATOM   4326  O  O     . MET B  1 200 ? 10.487  -37.428 -25.745 1.00 32.28  ? 172 MET B O     1 
ATOM   4327  C  CB    . MET B  1 200 ? 9.786   -36.806 -28.546 1.00 37.41  ? 172 MET B CB    1 
ATOM   4328  C  CG    . MET B  1 200 ? 8.481   -37.578 -28.479 1.00 38.67  ? 172 MET B CG    1 
ATOM   4329  S  SD    . MET B  1 200 ? 8.241   -38.778 -29.821 1.00 42.44  ? 172 MET B SD    1 
ATOM   4330  C  CE    . MET B  1 200 ? 9.704   -39.787 -29.687 1.00 35.50  ? 172 MET B CE    1 
ATOM   4331  N  N     . ILE B  1 201 ? 8.958   -35.837 -25.228 1.00 37.05  ? 173 ILE B N     1 
ATOM   4332  C  CA    . ILE B  1 201 ? 8.598   -36.448 -23.964 1.00 31.52  ? 173 ILE B CA    1 
ATOM   4333  C  C     . ILE B  1 201 ? 7.832   -37.753 -24.192 1.00 33.89  ? 173 ILE B C     1 
ATOM   4334  O  O     . ILE B  1 201 ? 6.931   -37.798 -25.035 1.00 35.77  ? 173 ILE B O     1 
ATOM   4335  C  CB    . ILE B  1 201 ? 7.743   -35.511 -23.156 1.00 32.66  ? 173 ILE B CB    1 
ATOM   4336  C  CG1   . ILE B  1 201 ? 8.370   -34.119 -23.155 1.00 29.60  ? 173 ILE B CG1   1 
ATOM   4337  C  CG2   . ILE B  1 201 ? 7.584   -36.047 -21.742 1.00 31.73  ? 173 ILE B CG2   1 
ATOM   4338  C  CD1   . ILE B  1 201 ? 7.612   -33.141 -22.323 1.00 34.10  ? 173 ILE B CD1   1 
ATOM   4339  N  N     . THR B  1 202 ? 8.173   -38.813 -23.462 1.00 33.18  ? 174 THR B N     1 
ATOM   4340  C  CA    . THR B  1 202 ? 7.375   -40.055 -23.536 1.00 41.23  ? 174 THR B CA    1 
ATOM   4341  C  C     . THR B  1 202 ? 7.056   -40.630 -22.155 1.00 41.54  ? 174 THR B C     1 
ATOM   4342  O  O     . THR B  1 202 ? 7.683   -40.270 -21.153 1.00 39.60  ? 174 THR B O     1 
ATOM   4343  C  CB    . THR B  1 202 ? 8.071   -41.198 -24.353 1.00 35.85  ? 174 THR B CB    1 
ATOM   4344  O  OG1   . THR B  1 202 ? 9.091   -41.822 -23.560 1.00 36.47  ? 174 THR B OG1   1 
ATOM   4345  C  CG2   . THR B  1 202 ? 8.678   -40.683 -25.658 1.00 34.41  ? 174 THR B CG2   1 
ATOM   4346  N  N     . ASN B  1 203 ? 6.077   -41.530 -22.124 1.00 42.67  ? 175 ASN B N     1 
ATOM   4347  C  CA    . ASN B  1 203 ? 5.768   -42.298 -20.921 1.00 40.23  ? 175 ASN B CA    1 
ATOM   4348  C  C     . ASN B  1 203 ? 6.517   -43.620 -20.892 1.00 41.75  ? 175 ASN B C     1 
ATOM   4349  O  O     . ASN B  1 203 ? 6.082   -44.567 -20.259 1.00 45.73  ? 175 ASN B O     1 
ATOM   4350  C  CB    . ASN B  1 203 ? 4.255   -42.544 -20.803 1.00 42.79  ? 175 ASN B CB    1 
ATOM   4351  C  CG    . ASN B  1 203 ? 3.692   -43.406 -21.932 1.00 43.51  ? 175 ASN B CG    1 
ATOM   4352  O  OD1   . ASN B  1 203 ? 4.310   -43.571 -22.981 1.00 41.75  ? 175 ASN B OD1   1 
ATOM   4353  N  ND2   . ASN B  1 203 ? 2.497   -43.943 -21.719 1.00 42.02  ? 175 ASN B ND2   1 
ATOM   4354  N  N     . ILE B  1 204 ? 7.655   -43.672 -21.577 1.00 41.34  ? 176 ILE B N     1 
ATOM   4355  C  CA    . ILE B  1 204 ? 8.465   -44.880 -21.660 1.00 37.65  ? 176 ILE B CA    1 
ATOM   4356  C  C     . ILE B  1 204 ? 9.686   -44.787 -20.759 1.00 39.33  ? 176 ILE B C     1 
ATOM   4357  O  O     . ILE B  1 204 ? 10.491  -43.898 -20.921 1.00 39.56  ? 176 ILE B O     1 
ATOM   4358  C  CB    . ILE B  1 204 ? 8.963   -45.152 -23.105 1.00 41.89  ? 176 ILE B CB    1 
ATOM   4359  C  CG1   . ILE B  1 204 ? 7.795   -45.348 -24.078 1.00 41.25  ? 176 ILE B CG1   1 
ATOM   4360  C  CG2   . ILE B  1 204 ? 9.894   -46.352 -23.130 1.00 41.67  ? 176 ILE B CG2   1 
ATOM   4361  C  CD1   . ILE B  1 204 ? 8.189   -45.096 -25.528 1.00 41.43  ? 176 ILE B CD1   1 
ATOM   4362  N  N     . PRO B  1 205 ? 9.848   -45.732 -19.821 1.00 42.77  ? 177 PRO B N     1 
ATOM   4363  C  CA    . PRO B  1 205 ? 11.005  -45.624 -18.928 1.00 41.88  ? 177 PRO B CA    1 
ATOM   4364  C  C     . PRO B  1 205 ? 12.334  -45.976 -19.593 1.00 43.44  ? 177 PRO B C     1 
ATOM   4365  O  O     . PRO B  1 205 ? 12.966  -46.913 -19.107 1.00 41.19  ? 177 PRO B O     1 
ATOM   4366  C  CB    . PRO B  1 205 ? 10.685  -46.642 -17.825 1.00 43.92  ? 177 PRO B CB    1 
ATOM   4367  C  CG    . PRO B  1 205 ? 9.867   -47.684 -18.530 1.00 42.42  ? 177 PRO B CG    1 
ATOM   4368  C  CD    . PRO B  1 205 ? 9.019   -46.915 -19.521 1.00 41.74  ? 177 PRO B CD    1 
ATOM   4369  N  N     . PHE B  1 206 ? 12.751  -45.253 -20.639 1.00 39.82  ? 178 PHE B N     1 
ATOM   4370  C  CA    . PHE B  1 206 ? 14.029  -45.527 -21.310 1.00 40.71  ? 178 PHE B CA    1 
ATOM   4371  C  C     . PHE B  1 206 ? 15.197  -45.370 -20.356 1.00 42.48  ? 178 PHE B C     1 
ATOM   4372  O  O     . PHE B  1 206 ? 15.151  -44.548 -19.449 1.00 47.95  ? 178 PHE B O     1 
ATOM   4373  C  CB    . PHE B  1 206 ? 14.260  -44.589 -22.516 1.00 40.37  ? 178 PHE B CB    1 
ATOM   4374  C  CG    . PHE B  1 206 ? 13.464  -44.938 -23.732 1.00 38.96  ? 178 PHE B CG    1 
ATOM   4375  C  CD1   . PHE B  1 206 ? 12.591  -44.011 -24.292 1.00 37.42  ? 178 PHE B CD1   1 
ATOM   4376  C  CD2   . PHE B  1 206 ? 13.598  -46.188 -24.332 1.00 44.79  ? 178 PHE B CD2   1 
ATOM   4377  C  CE1   . PHE B  1 206 ? 11.853  -44.320 -25.418 1.00 38.35  ? 178 PHE B CE1   1 
ATOM   4378  C  CE2   . PHE B  1 206 ? 12.857  -46.518 -25.457 1.00 40.68  ? 178 PHE B CE2   1 
ATOM   4379  C  CZ    . PHE B  1 206 ? 11.980  -45.582 -26.003 1.00 41.99  ? 178 PHE B CZ    1 
ATOM   4380  N  N     . GLU B  1 207 ? 16.253  -46.141 -20.573 1.00 47.48  ? 179 GLU B N     1 
ATOM   4381  C  CA    . GLU B  1 207 ? 17.496  -45.940 -19.843 1.00 47.28  ? 179 GLU B CA    1 
ATOM   4382  C  C     . GLU B  1 207 ? 18.126  -44.630 -20.281 1.00 43.97  ? 179 GLU B C     1 
ATOM   4383  O  O     . GLU B  1 207 ? 18.436  -44.458 -21.459 1.00 44.90  ? 179 GLU B O     1 
ATOM   4384  C  CB    . GLU B  1 207 ? 18.474  -47.088 -20.089 1.00 43.37  ? 179 GLU B CB    1 
ATOM   4385  C  CG    . GLU B  1 207 ? 19.683  -47.084 -19.166 1.00 53.61  ? 179 GLU B CG    1 
ATOM   4386  C  CD    . GLU B  1 207 ? 19.361  -47.621 -17.766 1.00 68.00  ? 179 GLU B CD    1 
ATOM   4387  O  OE1   . GLU B  1 207 ? 18.941  -48.799 -17.654 1.00 71.95  ? 179 GLU B OE1   1 
ATOM   4388  O  OE2   . GLU B  1 207 ? 19.526  -46.869 -16.777 1.00 69.39  ? 179 GLU B OE2   1 
ATOM   4389  N  N     . PRO B  1 208 ? 18.338  -43.700 -19.338 1.00 45.77  ? 180 PRO B N     1 
ATOM   4390  C  CA    . PRO B  1 208 ? 18.872  -42.401 -19.753 1.00 41.93  ? 180 PRO B CA    1 
ATOM   4391  C  C     . PRO B  1 208 ? 20.345  -42.518 -20.106 1.00 43.71  ? 180 PRO B C     1 
ATOM   4392  O  O     . PRO B  1 208 ? 20.973  -43.479 -19.672 1.00 41.25  ? 180 PRO B O     1 
ATOM   4393  C  CB    . PRO B  1 208 ? 18.672  -41.532 -18.513 1.00 41.58  ? 180 PRO B CB    1 
ATOM   4394  C  CG    . PRO B  1 208 ? 18.820  -42.512 -17.368 1.00 42.97  ? 180 PRO B CG    1 
ATOM   4395  C  CD    . PRO B  1 208 ? 18.198  -43.805 -17.873 1.00 45.07  ? 180 PRO B CD    1 
ATOM   4396  N  N     . ASP B  1 209 ? 20.882  -41.561 -20.860 1.00 38.56  ? 181 ASP B N     1 
ATOM   4397  C  CA    . ASP B  1 209 ? 22.297  -41.564 -21.212 1.00 39.84  ? 181 ASP B CA    1 
ATOM   4398  C  C     . ASP B  1 209 ? 23.114  -40.724 -20.238 1.00 38.68  ? 181 ASP B C     1 
ATOM   4399  O  O     . ASP B  1 209 ? 22.579  -40.184 -19.278 1.00 43.92  ? 181 ASP B O     1 
ATOM   4400  C  CB    . ASP B  1 209 ? 22.483  -41.068 -22.648 1.00 37.27  ? 181 ASP B CB    1 
ATOM   4401  C  CG    . ASP B  1 209 ? 21.882  -42.026 -23.667 1.00 44.03  ? 181 ASP B CG    1 
ATOM   4402  O  OD1   . ASP B  1 209 ? 21.929  -43.257 -23.419 1.00 52.89  ? 181 ASP B OD1   1 
ATOM   4403  O  OD2   . ASP B  1 209 ? 21.349  -41.571 -24.702 1.00 41.55  ? 181 ASP B OD2   1 
ATOM   4404  N  N     . VAL B  1 210 ? 24.410  -40.612 -20.499 1.00 42.58  ? 182 VAL B N     1 
ATOM   4405  C  CA    . VAL B  1 210 ? 25.321  -39.865 -19.636 1.00 42.60  ? 182 VAL B CA    1 
ATOM   4406  C  C     . VAL B  1 210 ? 25.730  -38.527 -20.283 1.00 44.09  ? 182 VAL B C     1 
ATOM   4407  O  O     . VAL B  1 210 ? 26.025  -38.488 -21.468 1.00 41.02  ? 182 VAL B O     1 
ATOM   4408  C  CB    . VAL B  1 210 ? 26.575  -40.723 -19.330 1.00 44.30  ? 182 VAL B CB    1 
ATOM   4409  C  CG1   . VAL B  1 210 ? 27.668  -39.909 -18.665 1.00 50.28  ? 182 VAL B CG1   1 
ATOM   4410  C  CG2   . VAL B  1 210 ? 26.189  -41.921 -18.461 1.00 48.29  ? 182 VAL B CG2   1 
ATOM   4411  N  N     . PRO B  1 211 ? 25.721  -37.421 -19.515 1.00 45.89  ? 183 PRO B N     1 
ATOM   4412  C  CA    . PRO B  1 211 ? 26.198  -36.151 -20.094 1.00 39.69  ? 183 PRO B CA    1 
ATOM   4413  C  C     . PRO B  1 211 ? 27.651  -36.277 -20.539 1.00 47.00  ? 183 PRO B C     1 
ATOM   4414  O  O     . PRO B  1 211 ? 28.362  -37.103 -19.961 1.00 49.79  ? 183 PRO B O     1 
ATOM   4415  C  CB    . PRO B  1 211 ? 26.060  -35.156 -18.939 1.00 39.68  ? 183 PRO B CB    1 
ATOM   4416  C  CG    . PRO B  1 211 ? 24.998  -35.735 -18.064 1.00 42.67  ? 183 PRO B CG    1 
ATOM   4417  C  CD    . PRO B  1 211 ? 25.138  -37.240 -18.175 1.00 44.64  ? 183 PRO B CD    1 
ATOM   4418  N  N     . ILE B  1 212 ? 28.092  -35.507 -21.532 1.00 41.92  ? 184 ILE B N     1 
ATOM   4419  C  CA    . ILE B  1 212 ? 29.452  -35.693 -22.033 1.00 42.26  ? 184 ILE B CA    1 
ATOM   4420  C  C     . ILE B  1 212 ? 30.392  -34.587 -21.571 1.00 44.44  ? 184 ILE B C     1 
ATOM   4421  O  O     . ILE B  1 212 ? 29.960  -33.559 -21.058 1.00 46.14  ? 184 ILE B O     1 
ATOM   4422  C  CB    . ILE B  1 212 ? 29.497  -35.805 -23.585 1.00 45.72  ? 184 ILE B CB    1 
ATOM   4423  C  CG1   . ILE B  1 212 ? 28.952  -34.560 -24.271 1.00 39.91  ? 184 ILE B CG1   1 
ATOM   4424  C  CG2   . ILE B  1 212 ? 28.760  -37.063 -24.071 1.00 45.90  ? 184 ILE B CG2   1 
ATOM   4425  C  CD1   . ILE B  1 212 ? 29.053  -34.635 -25.795 1.00 38.08  ? 184 ILE B CD1   1 
ATOM   4426  N  N     . GLU B  1 213 ? 31.687  -34.825 -21.749 1.00 48.25  ? 185 GLU B N     1 
ATOM   4427  C  CA    . GLU B  1 213 ? 32.727  -33.959 -21.213 1.00 49.01  ? 185 GLU B CA    1 
ATOM   4428  C  C     . GLU B  1 213 ? 32.698  -32.568 -21.834 1.00 46.22  ? 185 GLU B C     1 
ATOM   4429  O  O     . GLU B  1 213 ? 32.391  -32.413 -23.011 1.00 46.85  ? 185 GLU B O     1 
ATOM   4430  C  CB    . GLU B  1 213 ? 34.106  -34.595 -21.425 1.00 49.58  ? 185 GLU B CB    1 
ATOM   4431  C  CG    . GLU B  1 213 ? 35.267  -33.831 -20.785 1.00 53.40  ? 185 GLU B CG    1 
ATOM   4432  C  CD    . GLU B  1 213 ? 36.629  -34.429 -21.133 1.00 64.01  ? 185 GLU B CD    1 
ATOM   4433  O  OE1   . GLU B  1 213 ? 36.670  -35.576 -21.634 1.00 59.21  ? 185 GLU B OE1   1 
ATOM   4434  O  OE2   . GLU B  1 213 ? 37.658  -33.753 -20.903 1.00 69.58  ? 185 GLU B OE2   1 
ATOM   4435  N  N     . ASP B  1 214 ? 33.014  -31.571 -21.014 1.00 43.60  ? 186 ASP B N     1 
ATOM   4436  C  CA    . ASP B  1 214 ? 33.223  -30.189 -21.451 1.00 47.42  ? 186 ASP B CA    1 
ATOM   4437  C  C     . ASP B  1 214 ? 34.589  -30.031 -22.114 1.00 47.05  ? 186 ASP B C     1 
ATOM   4438  O  O     . ASP B  1 214 ? 35.611  -30.317 -21.493 1.00 51.42  ? 186 ASP B O     1 
ATOM   4439  C  CB    . ASP B  1 214 ? 33.110  -29.252 -20.247 1.00 47.41  ? 186 ASP B CB    1 
ATOM   4440  C  CG    . ASP B  1 214 ? 33.083  -27.778 -20.640 1.00 49.12  ? 186 ASP B CG    1 
ATOM   4441  O  OD1   . ASP B  1 214 ? 32.251  -27.048 -20.066 1.00 58.04  ? 186 ASP B OD1   1 
ATOM   4442  O  OD2   . ASP B  1 214 ? 33.884  -27.346 -21.498 1.00 43.62  ? 186 ASP B OD2   1 
ATOM   4443  N  N     . MET B  1 215 ? 34.615  -29.548 -23.355 1.00 44.23  ? 187 MET B N     1 
ATOM   4444  C  CA    . MET B  1 215 ? 35.872  -29.417 -24.104 1.00 42.83  ? 187 MET B CA    1 
ATOM   4445  C  C     . MET B  1 215 ? 36.387  -27.977 -24.262 1.00 44.57  ? 187 MET B C     1 
ATOM   4446  O  O     . MET B  1 215 ? 37.334  -27.732 -25.007 1.00 43.20  ? 187 MET B O     1 
ATOM   4447  C  CB    . MET B  1 215 ? 35.721  -30.037 -25.500 1.00 42.88  ? 187 MET B CB    1 
ATOM   4448  C  CG    . MET B  1 215 ? 35.369  -31.530 -25.497 1.00 48.83  ? 187 MET B CG    1 
ATOM   4449  S  SD    . MET B  1 215 ? 36.458  -32.573 -24.481 1.00 57.53  ? 187 MET B SD    1 
ATOM   4450  C  CE    . MET B  1 215 ? 38.029  -32.398 -25.340 1.00 50.35  ? 187 MET B CE    1 
ATOM   4451  N  N     . CYS B  1 216 ? 35.789  -27.022 -23.564 1.00 42.86  ? 188 CYS B N     1 
ATOM   4452  C  CA    . CYS B  1 216 ? 36.197  -25.628 -23.756 1.00 46.27  ? 188 CYS B CA    1 
ATOM   4453  C  C     . CYS B  1 216 ? 37.567  -25.337 -23.156 1.00 49.24  ? 188 CYS B C     1 
ATOM   4454  O  O     . CYS B  1 216 ? 38.333  -24.550 -23.709 1.00 46.44  ? 188 CYS B O     1 
ATOM   4455  C  CB    . CYS B  1 216 ? 35.159  -24.672 -23.166 1.00 47.81  ? 188 CYS B CB    1 
ATOM   4456  S  SG    . CYS B  1 216 ? 33.721  -24.405 -24.226 1.00 37.57  ? 188 CYS B SG    1 
ATOM   4457  N  N     . GLY B  1 217 ? 37.878  -25.982 -22.034 1.00 51.50  ? 189 GLY B N     1 
ATOM   4458  C  CA    . GLY B  1 217 ? 39.123  -25.714 -21.337 1.00 52.27  ? 189 GLY B CA    1 
ATOM   4459  C  C     . GLY B  1 217 ? 39.231  -24.243 -20.964 1.00 51.83  ? 189 GLY B C     1 
ATOM   4460  O  O     . GLY B  1 217 ? 38.256  -23.643 -20.518 1.00 49.76  ? 189 GLY B O     1 
ATOM   4461  N  N     . SER B  1 218 ? 40.408  -23.661 -21.173 1.00 51.40  ? 190 SER B N     1 
ATOM   4462  C  CA    . SER B  1 218 ? 40.673  -22.286 -20.762 1.00 54.67  ? 190 SER B CA    1 
ATOM   4463  C  C     . SER B  1 218 ? 40.488  -21.324 -21.927 1.00 47.39  ? 190 SER B C     1 
ATOM   4464  O  O     . SER B  1 218 ? 40.892  -20.163 -21.859 1.00 42.40  ? 190 SER B O     1 
ATOM   4465  C  CB    . SER B  1 218 ? 42.092  -22.157 -20.197 1.00 56.53  ? 190 SER B CB    1 
ATOM   4466  O  OG    . SER B  1 218 ? 43.061  -22.322 -21.224 1.00 65.98  ? 190 SER B OG    1 
ATOM   4467  N  N     . CYS B  1 219 ? 39.899  -21.824 -23.007 1.00 47.38  ? 191 CYS B N     1 
ATOM   4468  C  CA    . CYS B  1 219 ? 39.611  -20.995 -24.168 1.00 50.10  ? 191 CYS B CA    1 
ATOM   4469  C  C     . CYS B  1 219 ? 38.565  -19.925 -23.800 1.00 48.14  ? 191 CYS B C     1 
ATOM   4470  O  O     . CYS B  1 219 ? 37.681  -20.162 -22.963 1.00 44.85  ? 191 CYS B O     1 
ATOM   4471  C  CB    . CYS B  1 219 ? 39.141  -21.871 -25.336 1.00 44.82  ? 191 CYS B CB    1 
ATOM   4472  S  SG    . CYS B  1 219 ? 38.655  -20.998 -26.861 1.00 48.76  ? 191 CYS B SG    1 
ATOM   4473  N  N     . THR B  1 220 ? 38.713  -18.735 -24.376 1.00 47.31  ? 192 THR B N     1 
ATOM   4474  C  CA    . THR B  1 220 ? 37.729  -17.666 -24.211 1.00 46.44  ? 192 THR B CA    1 
ATOM   4475  C  C     . THR B  1 220 ? 37.452  -16.934 -25.519 1.00 44.59  ? 192 THR B C     1 
ATOM   4476  O  O     . THR B  1 220 ? 37.039  -15.778 -25.499 1.00 47.79  ? 192 THR B O     1 
ATOM   4477  C  CB    . THR B  1 220 ? 38.176  -16.597 -23.191 1.00 49.52  ? 192 THR B CB    1 
ATOM   4478  O  OG1   . THR B  1 220 ? 39.378  -15.970 -23.658 1.00 51.00  ? 192 THR B OG1   1 
ATOM   4479  C  CG2   . THR B  1 220 ? 38.382  -17.187 -21.790 1.00 41.95  ? 192 THR B CG2   1 
ATOM   4480  N  N     . LYS B  1 221 ? 37.689  -17.592 -26.649 1.00 43.15  ? 193 LYS B N     1 
ATOM   4481  C  CA    . LYS B  1 221 ? 37.620  -16.921 -27.940 1.00 46.91  ? 193 LYS B CA    1 
ATOM   4482  C  C     . LYS B  1 221 ? 36.237  -16.325 -28.235 1.00 40.75  ? 193 LYS B C     1 
ATOM   4483  O  O     . LYS B  1 221 ? 36.132  -15.233 -28.790 1.00 39.54  ? 193 LYS B O     1 
ATOM   4484  C  CB    . LYS B  1 221 ? 38.045  -17.888 -29.047 1.00 43.65  ? 193 LYS B CB    1 
ATOM   4485  C  CG    . LYS B  1 221 ? 39.521  -18.248 -28.970 1.00 48.61  ? 193 LYS B CG    1 
ATOM   4486  C  CD    . LYS B  1 221 ? 40.001  -18.980 -30.214 1.00 53.29  ? 193 LYS B CD    1 
ATOM   4487  C  CE    . LYS B  1 221 ? 41.524  -18.949 -30.328 1.00 56.03  ? 193 LYS B CE    1 
ATOM   4488  N  NZ    . LYS B  1 221 ? 42.004  -19.771 -31.484 1.00 63.09  ? 193 LYS B NZ    1 
ATOM   4489  N  N     . CYS B  1 222 ? 35.181  -17.027 -27.848 1.00 40.63  ? 194 CYS B N     1 
ATOM   4490  C  CA    . CYS B  1 222 ? 33.835  -16.538 -28.103 1.00 38.00  ? 194 CYS B CA    1 
ATOM   4491  C  C     . CYS B  1 222 ? 33.520  -15.317 -27.245 1.00 40.60  ? 194 CYS B C     1 
ATOM   4492  O  O     . CYS B  1 222 ? 32.966  -14.334 -27.730 1.00 36.94  ? 194 CYS B O     1 
ATOM   4493  C  CB    . CYS B  1 222 ? 32.817  -17.636 -27.846 1.00 37.60  ? 194 CYS B CB    1 
ATOM   4494  S  SG    . CYS B  1 222 ? 32.996  -18.358 -26.227 1.00 39.28  ? 194 CYS B SG    1 
ATOM   4495  N  N     . LEU B  1 223 ? 33.878  -15.380 -25.971 1.00 40.11  ? 195 LEU B N     1 
ATOM   4496  C  CA    . LEU B  1 223 ? 33.652  -14.258 -25.070 1.00 44.29  ? 195 LEU B CA    1 
ATOM   4497  C  C     . LEU B  1 223 ? 34.394  -13.010 -25.566 1.00 42.10  ? 195 LEU B C     1 
ATOM   4498  O  O     . LEU B  1 223 ? 33.871  -11.904 -25.487 1.00 39.83  ? 195 LEU B O     1 
ATOM   4499  C  CB    . LEU B  1 223 ? 34.077  -14.629 -23.640 1.00 44.94  ? 195 LEU B CB    1 
ATOM   4500  C  CG    . LEU B  1 223 ? 33.592  -16.025 -23.215 1.00 44.69  ? 195 LEU B CG    1 
ATOM   4501  C  CD1   . LEU B  1 223 ? 34.214  -16.518 -21.892 1.00 43.81  ? 195 LEU B CD1   1 
ATOM   4502  C  CD2   . LEU B  1 223 ? 32.070  -16.066 -23.140 1.00 41.96  ? 195 LEU B CD2   1 
ATOM   4503  N  N     . ASP B  1 224 ? 35.590  -13.203 -26.116 1.00 38.54  ? 196 ASP B N     1 
ATOM   4504  C  CA    . ASP B  1 224 ? 36.406  -12.090 -26.591 1.00 42.80  ? 196 ASP B CA    1 
ATOM   4505  C  C     . ASP B  1 224 ? 35.946  -11.550 -27.947 1.00 43.75  ? 196 ASP B C     1 
ATOM   4506  O  O     . ASP B  1 224 ? 36.165  -10.380 -28.261 1.00 42.21  ? 196 ASP B O     1 
ATOM   4507  C  CB    . ASP B  1 224 ? 37.878  -12.514 -26.686 1.00 42.90  ? 196 ASP B CB    1 
ATOM   4508  C  CG    . ASP B  1 224 ? 38.458  -12.924 -25.344 1.00 51.24  ? 196 ASP B CG    1 
ATOM   4509  O  OD1   . ASP B  1 224 ? 38.113  -12.287 -24.324 1.00 54.95  ? 196 ASP B OD1   1 
ATOM   4510  O  OD2   . ASP B  1 224 ? 39.258  -13.887 -25.305 1.00 52.85  ? 196 ASP B OD2   1 
ATOM   4511  N  N     . ALA B  1 225 ? 35.318  -12.393 -28.758 1.00 38.63  ? 197 ALA B N     1 
ATOM   4512  C  CA    . ALA B  1 225 ? 34.958  -11.970 -30.111 1.00 42.09  ? 197 ALA B CA    1 
ATOM   4513  C  C     . ALA B  1 225 ? 33.581  -11.316 -30.180 1.00 36.74  ? 197 ALA B C     1 
ATOM   4514  O  O     . ALA B  1 225 ? 33.283  -10.597 -31.135 1.00 37.48  ? 197 ALA B O     1 
ATOM   4515  C  CB    . ALA B  1 225 ? 35.018  -13.154 -31.072 1.00 36.67  ? 197 ALA B CB    1 
ATOM   4516  N  N     . CYS B  1 226 ? 32.743  -11.572 -29.179 1.00 34.17  ? 198 CYS B N     1 
ATOM   4517  C  CA    . CYS B  1 226 ? 31.364  -11.101 -29.223 1.00 37.66  ? 198 CYS B CA    1 
ATOM   4518  C  C     . CYS B  1 226 ? 31.321  -9.584  -29.307 1.00 37.13  ? 198 CYS B C     1 
ATOM   4519  O  O     . CYS B  1 226 ? 31.805  -8.918  -28.399 1.00 38.02  ? 198 CYS B O     1 
ATOM   4520  C  CB    . CYS B  1 226 ? 30.587  -11.560 -27.999 1.00 36.72  ? 198 CYS B CB    1 
ATOM   4521  S  SG    . CYS B  1 226 ? 28.947  -10.820 -27.916 1.00 34.43  ? 198 CYS B SG    1 
ATOM   4522  N  N     . PRO B  1 227 ? 30.721  -9.044  -30.386 1.00 35.04  ? 199 PRO B N     1 
ATOM   4523  C  CA    . PRO B  1 227 ? 30.782  -7.601  -30.687 1.00 35.50  ? 199 PRO B CA    1 
ATOM   4524  C  C     . PRO B  1 227 ? 30.161  -6.702  -29.626 1.00 40.40  ? 199 PRO B C     1 
ATOM   4525  O  O     . PRO B  1 227 ? 30.450  -5.512  -29.635 1.00 42.02  ? 199 PRO B O     1 
ATOM   4526  C  CB    . PRO B  1 227 ? 29.997  -7.476  -32.001 1.00 32.96  ? 199 PRO B CB    1 
ATOM   4527  C  CG    . PRO B  1 227 ? 29.973  -8.865  -32.573 1.00 40.25  ? 199 PRO B CG    1 
ATOM   4528  C  CD    . PRO B  1 227 ? 29.939  -9.786  -31.394 1.00 29.94  ? 199 PRO B CD    1 
ATOM   4529  N  N     . THR B  1 228 ? 29.321  -7.237  -28.744 1.00 37.88  ? 200 THR B N     1 
ATOM   4530  C  CA    . THR B  1 228 ? 28.632  -6.376  -27.797 1.00 39.28  ? 200 THR B CA    1 
ATOM   4531  C  C     . THR B  1 228 ? 28.932  -6.777  -26.374 1.00 39.33  ? 200 THR B C     1 
ATOM   4532  O  O     . THR B  1 228 ? 28.450  -6.154  -25.439 1.00 36.66  ? 200 THR B O     1 
ATOM   4533  C  CB    . THR B  1 228 ? 27.100  -6.398  -27.998 1.00 40.24  ? 200 THR B CB    1 
ATOM   4534  O  OG1   . THR B  1 228 ? 26.625  -7.738  -27.828 1.00 40.24  ? 200 THR B OG1   1 
ATOM   4535  C  CG2   . THR B  1 228 ? 26.719  -5.888  -29.388 1.00 29.99  ? 200 THR B CG2   1 
ATOM   4536  N  N     . GLY B  1 229 ? 29.726  -7.831  -26.217 1.00 41.76  ? 201 GLY B N     1 
ATOM   4537  C  CA    . GLY B  1 229 ? 30.046  -8.339  -24.899 1.00 38.83  ? 201 GLY B CA    1 
ATOM   4538  C  C     . GLY B  1 229 ? 28.844  -8.972  -24.222 1.00 39.50  ? 201 GLY B C     1 
ATOM   4539  O  O     . GLY B  1 229 ? 28.795  -9.064  -22.988 1.00 39.41  ? 201 GLY B O     1 
ATOM   4540  N  N     . ALA B  1 230 ? 27.879  -9.423  -25.024 1.00 30.98  ? 202 ALA B N     1 
ATOM   4541  C  CA    . ALA B  1 230 ? 26.647  -9.988  -24.480 1.00 31.45  ? 202 ALA B CA    1 
ATOM   4542  C  C     . ALA B  1 230 ? 26.942  -11.259 -23.689 1.00 34.07  ? 202 ALA B C     1 
ATOM   4543  O  O     . ALA B  1 230 ? 26.185  -11.626 -22.796 1.00 31.30  ? 202 ALA B O     1 
ATOM   4544  C  CB    . ALA B  1 230 ? 25.652  -10.273 -25.585 1.00 26.51  ? 202 ALA B CB    1 
ATOM   4545  N  N     . LEU B  1 231 ? 28.026  -11.943 -24.054 1.00 34.48  ? 203 LEU B N     1 
ATOM   4546  C  CA    . LEU B  1 231 ? 28.523  -13.061 -23.266 1.00 36.83  ? 203 LEU B CA    1 
ATOM   4547  C  C     . LEU B  1 231 ? 29.286  -12.499 -22.042 1.00 41.97  ? 203 LEU B C     1 
ATOM   4548  O  O     . LEU B  1 231 ? 30.507  -12.299 -22.090 1.00 38.11  ? 203 LEU B O     1 
ATOM   4549  C  CB    . LEU B  1 231 ? 29.405  -13.974 -24.123 1.00 33.93  ? 203 LEU B CB    1 
ATOM   4550  C  CG    . LEU B  1 231 ? 28.733  -14.846 -25.201 1.00 35.02  ? 203 LEU B CG    1 
ATOM   4551  C  CD1   . LEU B  1 231 ? 29.768  -15.400 -26.161 1.00 31.72  ? 203 LEU B CD1   1 
ATOM   4552  C  CD2   . LEU B  1 231 ? 27.954  -15.995 -24.576 1.00 30.43  ? 203 LEU B CD2   1 
ATOM   4553  N  N     . VAL B  1 232 ? 28.560  -12.222 -20.961 1.00 34.71  ? 204 VAL B N     1 
ATOM   4554  C  CA    . VAL B  1 232 ? 29.142  -11.480 -19.835 1.00 38.16  ? 204 VAL B CA    1 
ATOM   4555  C  C     . VAL B  1 232 ? 29.956  -12.384 -18.920 1.00 41.42  ? 204 VAL B C     1 
ATOM   4556  O  O     . VAL B  1 232 ? 30.856  -11.916 -18.235 1.00 42.59  ? 204 VAL B O     1 
ATOM   4557  C  CB    . VAL B  1 232 ? 28.057  -10.737 -19.001 1.00 33.74  ? 204 VAL B CB    1 
ATOM   4558  C  CG1   . VAL B  1 232 ? 27.469  -9.597  -19.806 1.00 41.61  ? 204 VAL B CG1   1 
ATOM   4559  C  CG2   . VAL B  1 232 ? 26.962  -11.660 -18.570 1.00 31.45  ? 204 VAL B CG2   1 
ATOM   4560  N  N     . ASN B  1 233 ? 29.628  -13.676 -18.923 1.00 36.54  ? 205 ASN B N     1 
ATOM   4561  C  CA    . ASN B  1 233 ? 30.410  -14.705 -18.250 1.00 35.80  ? 205 ASN B CA    1 
ATOM   4562  C  C     . ASN B  1 233 ? 30.369  -15.976 -19.095 1.00 41.83  ? 205 ASN B C     1 
ATOM   4563  O  O     . ASN B  1 233 ? 29.498  -16.100 -19.965 1.00 37.20  ? 205 ASN B O     1 
ATOM   4564  C  CB    . ASN B  1 233 ? 29.867  -14.979 -16.843 1.00 38.62  ? 205 ASN B CB    1 
ATOM   4565  C  CG    . ASN B  1 233 ? 30.117  -13.830 -15.890 1.00 43.73  ? 205 ASN B CG    1 
ATOM   4566  O  OD1   . ASN B  1 233 ? 31.262  -13.546 -15.536 1.00 39.80  ? 205 ASN B OD1   1 
ATOM   4567  N  ND2   . ASN B  1 233 ? 29.045  -13.162 -15.467 1.00 39.56  ? 205 ASN B ND2   1 
ATOM   4568  N  N     . PRO B  1 234 ? 31.305  -16.916 -18.859 1.00 44.95  ? 206 PRO B N     1 
ATOM   4569  C  CA    . PRO B  1 234 ? 31.224  -18.199 -19.571 1.00 37.09  ? 206 PRO B CA    1 
ATOM   4570  C  C     . PRO B  1 234 ? 29.870  -18.844 -19.335 1.00 37.65  ? 206 PRO B C     1 
ATOM   4571  O  O     . PRO B  1 234 ? 29.472  -19.024 -18.177 1.00 35.71  ? 206 PRO B O     1 
ATOM   4572  C  CB    . PRO B  1 234 ? 32.347  -19.029 -18.947 1.00 42.31  ? 206 PRO B CB    1 
ATOM   4573  C  CG    . PRO B  1 234 ? 33.305  -18.053 -18.422 1.00 42.29  ? 206 PRO B CG    1 
ATOM   4574  C  CD    . PRO B  1 234 ? 32.509  -16.832 -18.015 1.00 43.93  ? 206 PRO B CD    1 
ATOM   4575  N  N     . GLY B  1 235 ? 29.157  -19.144 -20.417 1.00 35.24  ? 207 GLY B N     1 
ATOM   4576  C  CA    . GLY B  1 235 ? 27.860  -19.789 -20.331 1.00 29.43  ? 207 GLY B CA    1 
ATOM   4577  C  C     . GLY B  1 235 ? 26.760  -18.866 -19.838 1.00 33.20  ? 207 GLY B C     1 
ATOM   4578  O  O     . GLY B  1 235 ? 25.703  -19.335 -19.411 1.00 35.64  ? 207 GLY B O     1 
ATOM   4579  N  N     . GLN B  1 236 ? 26.991  -17.555 -19.898 1.00 29.81  ? 208 GLN B N     1 
ATOM   4580  C  CA    . GLN B  1 236 ? 25.977  -16.613 -19.445 1.00 33.79  ? 208 GLN B CA    1 
ATOM   4581  C  C     . GLN B  1 236 ? 25.760  -15.499 -20.459 1.00 31.12  ? 208 GLN B C     1 
ATOM   4582  O  O     . GLN B  1 236 ? 26.649  -14.691 -20.717 1.00 33.95  ? 208 GLN B O     1 
ATOM   4583  C  CB    . GLN B  1 236 ? 26.339  -16.010 -18.080 1.00 34.81  ? 208 GLN B CB    1 
ATOM   4584  C  CG    . GLN B  1 236 ? 25.204  -15.184 -17.455 1.00 36.34  ? 208 GLN B CG    1 
ATOM   4585  C  CD    . GLN B  1 236 ? 25.554  -14.614 -16.078 1.00 41.39  ? 208 GLN B CD    1 
ATOM   4586  O  OE1   . GLN B  1 236 ? 26.702  -14.248 -15.808 1.00 36.11  ? 208 GLN B OE1   1 
ATOM   4587  N  NE2   . GLN B  1 236 ? 24.562  -14.541 -15.207 1.00 30.39  ? 208 GLN B NE2   1 
ATOM   4588  N  N     . LEU B  1 237 ? 24.557  -15.461 -21.013 1.00 29.36  ? 209 LEU B N     1 
ATOM   4589  C  CA    . LEU B  1 237 ? 24.207  -14.474 -22.024 1.00 30.64  ? 209 LEU B CA    1 
ATOM   4590  C  C     . LEU B  1 237 ? 23.332  -13.380 -21.433 1.00 30.48  ? 209 LEU B C     1 
ATOM   4591  O  O     . LEU B  1 237 ? 22.340  -13.684 -20.768 1.00 28.96  ? 209 LEU B O     1 
ATOM   4592  C  CB    . LEU B  1 237 ? 23.470  -15.128 -23.205 1.00 23.97  ? 209 LEU B CB    1 
ATOM   4593  C  CG    . LEU B  1 237 ? 23.340  -14.201 -24.424 1.00 27.52  ? 209 LEU B CG    1 
ATOM   4594  C  CD1   . LEU B  1 237 ? 24.712  -14.000 -25.016 1.00 23.95  ? 209 LEU B CD1   1 
ATOM   4595  C  CD2   . LEU B  1 237 ? 22.356  -14.713 -25.483 1.00 22.32  ? 209 LEU B CD2   1 
ATOM   4596  N  N     . ASN B  1 238 ? 23.721  -12.122 -21.662 1.00 31.30  ? 210 ASN B N     1 
ATOM   4597  C  CA    . ASN B  1 238 ? 22.801  -10.994 -21.543 1.00 30.07  ? 210 ASN B CA    1 
ATOM   4598  C  C     . ASN B  1 238 ? 22.103  -10.840 -22.871 1.00 28.34  ? 210 ASN B C     1 
ATOM   4599  O  O     . ASN B  1 238 ? 22.621  -10.193 -23.787 1.00 32.33  ? 210 ASN B O     1 
ATOM   4600  C  CB    . ASN B  1 238 ? 23.506  -9.685  -21.173 1.00 28.94  ? 210 ASN B CB    1 
ATOM   4601  C  CG    . ASN B  1 238 ? 22.528  -8.526  -20.983 1.00 32.47  ? 210 ASN B CG    1 
ATOM   4602  O  OD1   . ASN B  1 238 ? 21.334  -8.643  -21.286 1.00 32.59  ? 210 ASN B OD1   1 
ATOM   4603  N  ND2   . ASN B  1 238 ? 23.029  -7.404  -20.467 1.00 29.43  ? 210 ASN B ND2   1 
ATOM   4604  N  N     . ALA B  1 239 ? 20.926  -11.433 -22.966 1.00 28.20  ? 211 ALA B N     1 
ATOM   4605  C  CA    . ALA B  1 239 ? 20.229  -11.538 -24.237 1.00 29.96  ? 211 ALA B CA    1 
ATOM   4606  C  C     . ALA B  1 239 ? 19.789  -10.170 -24.762 1.00 29.93  ? 211 ALA B C     1 
ATOM   4607  O  O     . ALA B  1 239 ? 19.693  -9.984  -25.983 1.00 31.78  ? 211 ALA B O     1 
ATOM   4608  C  CB    . ALA B  1 239 ? 19.022  -12.489 -24.112 1.00 27.99  ? 211 ALA B CB    1 
ATOM   4609  N  N     . GLN B  1 240 ? 19.565  -9.209  -23.863 1.00 28.61  ? 212 GLN B N     1 
ATOM   4610  C  CA    . GLN B  1 240 ? 19.191  -7.852  -24.291 1.00 29.06  ? 212 GLN B CA    1 
ATOM   4611  C  C     . GLN B  1 240 ? 20.306  -7.209  -25.107 1.00 27.79  ? 212 GLN B C     1 
ATOM   4612  O  O     . GLN B  1 240 ? 20.062  -6.286  -25.884 1.00 34.03  ? 212 GLN B O     1 
ATOM   4613  C  CB    . GLN B  1 240 ? 18.843  -6.958  -23.084 1.00 26.91  ? 212 GLN B CB    1 
ATOM   4614  C  CG    . GLN B  1 240 ? 17.563  -7.373  -22.348 1.00 28.53  ? 212 GLN B CG    1 
ATOM   4615  C  CD    . GLN B  1 240 ? 16.362  -7.407  -23.286 1.00 35.08  ? 212 GLN B CD    1 
ATOM   4616  O  OE1   . GLN B  1 240 ? 16.036  -6.401  -23.900 1.00 34.56  ? 212 GLN B OE1   1 
ATOM   4617  N  NE2   . GLN B  1 240 ? 15.721  -8.569  -23.422 1.00 32.61  ? 212 GLN B NE2   1 
ATOM   4618  N  N     . ARG B  1 241 ? 21.534  -7.680  -24.947 1.00 25.61  ? 213 ARG B N     1 
ATOM   4619  C  CA    . ARG B  1 241 ? 22.630  -7.099  -25.718 1.00 27.19  ? 213 ARG B CA    1 
ATOM   4620  C  C     . ARG B  1 241 ? 23.130  -8.013  -26.848 1.00 30.19  ? 213 ARG B C     1 
ATOM   4621  O  O     . ARG B  1 241 ? 24.121  -7.704  -27.506 1.00 27.76  ? 213 ARG B O     1 
ATOM   4622  C  CB    . ARG B  1 241 ? 23.780  -6.737  -24.785 1.00 30.16  ? 213 ARG B CB    1 
ATOM   4623  C  CG    . ARG B  1 241 ? 23.432  -5.619  -23.771 1.00 35.35  ? 213 ARG B CG    1 
ATOM   4624  C  CD    . ARG B  1 241 ? 24.651  -5.257  -22.922 1.00 38.21  ? 213 ARG B CD    1 
ATOM   4625  N  NE    . ARG B  1 241 ? 25.795  -4.899  -23.765 1.00 40.37  ? 213 ARG B NE    1 
ATOM   4626  C  CZ    . ARG B  1 241 ? 26.010  -3.677  -24.251 1.00 45.24  ? 213 ARG B CZ    1 
ATOM   4627  N  NH1   . ARG B  1 241 ? 25.161  -2.692  -23.972 1.00 41.94  ? 213 ARG B NH1   1 
ATOM   4628  N  NH2   . ARG B  1 241 ? 27.071  -3.441  -25.017 1.00 40.35  ? 213 ARG B NH2   1 
ATOM   4629  N  N     . CYS B  1 242 ? 22.443  -9.128  -27.077 1.00 29.78  ? 214 CYS B N     1 
ATOM   4630  C  CA    . CYS B  1 242 ? 22.860  -10.076 -28.116 1.00 27.72  ? 214 CYS B CA    1 
ATOM   4631  C  C     . CYS B  1 242 ? 22.314  -9.672  -29.483 1.00 26.06  ? 214 CYS B C     1 
ATOM   4632  O  O     . CYS B  1 242 ? 21.108  -9.513  -29.669 1.00 28.26  ? 214 CYS B O     1 
ATOM   4633  C  CB    . CYS B  1 242 ? 22.416  -11.503 -27.753 1.00 25.23  ? 214 CYS B CB    1 
ATOM   4634  S  SG    . CYS B  1 242 ? 22.792  -12.818 -29.005 1.00 24.40  ? 214 CYS B SG    1 
ATOM   4635  N  N     . ILE B  1 243 ? 23.218  -9.519  -30.442 1.00 31.68  ? 215 ILE B N     1 
ATOM   4636  C  CA    A ILE B  1 243 ? 22.856  -9.130  -31.801 0.59 28.18  ? 215 ILE B CA    1 
ATOM   4637  C  CA    B ILE B  1 243 ? 22.849  -9.121  -31.796 0.41 28.20  ? 215 ILE B CA    1 
ATOM   4638  C  C     . ILE B  1 243 ? 21.770  -10.037 -32.385 1.00 28.52  ? 215 ILE B C     1 
ATOM   4639  O  O     . ILE B  1 243 ? 20.860  -9.574  -33.072 1.00 27.01  ? 215 ILE B O     1 
ATOM   4640  C  CB    A ILE B  1 243 ? 24.099  -9.149  -32.715 0.59 31.14  ? 215 ILE B CB    1 
ATOM   4641  C  CB    B ILE B  1 243 ? 24.090  -9.109  -32.718 0.41 31.11  ? 215 ILE B CB    1 
ATOM   4642  C  CG1   A ILE B  1 243 ? 25.107  -8.090  -32.251 0.59 31.65  ? 215 ILE B CG1   1 
ATOM   4643  C  CG1   B ILE B  1 243 ? 25.136  -8.127  -32.175 0.41 31.62  ? 215 ILE B CG1   1 
ATOM   4644  C  CG2   A ILE B  1 243 ? 23.709  -8.932  -34.181 0.59 29.67  ? 215 ILE B CG2   1 
ATOM   4645  C  CG2   B ILE B  1 243 ? 23.701  -8.753  -34.153 0.41 29.70  ? 215 ILE B CG2   1 
ATOM   4646  C  CD1   A ILE B  1 243 ? 24.588  -6.672  -32.353 0.59 29.37  ? 215 ILE B CD1   1 
ATOM   4647  C  CD1   B ILE B  1 243 ? 26.408  -8.056  -32.995 0.41 29.49  ? 215 ILE B CD1   1 
ATOM   4648  N  N     . SER B  1 244 ? 21.862  -11.332 -32.097 1.00 25.35  ? 216 SER B N     1 
ATOM   4649  C  CA    . SER B  1 244 ? 20.865  -12.279 -32.585 1.00 29.38  ? 216 SER B CA    1 
ATOM   4650  C  C     . SER B  1 244 ? 19.465  -11.867 -32.115 1.00 24.81  ? 216 SER B C     1 
ATOM   4651  O  O     . SER B  1 244 ? 18.539  -11.776 -32.919 1.00 28.23  ? 216 SER B O     1 
ATOM   4652  C  CB    . SER B  1 244 ? 21.190  -13.710 -32.116 1.00 26.89  ? 216 SER B CB    1 
ATOM   4653  O  OG    . SER B  1 244 ? 20.176  -14.603 -32.516 1.00 26.65  ? 216 SER B OG    1 
ATOM   4654  N  N     . PHE B  1 245 ? 19.318  -11.626 -30.818 1.00 25.43  ? 217 PHE B N     1 
ATOM   4655  C  CA    . PHE B  1 245 ? 18.073  -11.062 -30.271 1.00 27.83  ? 217 PHE B CA    1 
ATOM   4656  C  C     . PHE B  1 245 ? 17.728  -9.700  -30.896 1.00 26.73  ? 217 PHE B C     1 
ATOM   4657  O  O     . PHE B  1 245 ? 16.618  -9.494  -31.378 1.00 25.98  ? 217 PHE B O     1 
ATOM   4658  C  CB    . PHE B  1 245 ? 18.153  -10.903 -28.745 1.00 22.59  ? 217 PHE B CB    1 
ATOM   4659  C  CG    . PHE B  1 245 ? 17.064  -10.030 -28.176 1.00 29.03  ? 217 PHE B CG    1 
ATOM   4660  C  CD1   . PHE B  1 245 ? 15.765  -10.509 -28.047 1.00 26.69  ? 217 PHE B CD1   1 
ATOM   4661  C  CD2   . PHE B  1 245 ? 17.327  -8.705  -27.808 1.00 28.42  ? 217 PHE B CD2   1 
ATOM   4662  C  CE1   . PHE B  1 245 ? 14.747  -9.694  -27.543 1.00 23.10  ? 217 PHE B CE1   1 
ATOM   4663  C  CE2   . PHE B  1 245 ? 16.321  -7.892  -27.304 1.00 27.47  ? 217 PHE B CE2   1 
ATOM   4664  C  CZ    . PHE B  1 245 ? 15.030  -8.381  -27.164 1.00 24.87  ? 217 PHE B CZ    1 
ATOM   4665  N  N     . LEU B  1 246 ? 18.673  -8.769  -30.852 1.00 27.73  ? 218 LEU B N     1 
ATOM   4666  C  CA    . LEU B  1 246 ? 18.447  -7.406  -31.363 1.00 27.04  ? 218 LEU B CA    1 
ATOM   4667  C  C     . LEU B  1 246 ? 17.963  -7.370  -32.837 1.00 28.23  ? 218 LEU B C     1 
ATOM   4668  O  O     . LEU B  1 246 ? 17.062  -6.608  -33.184 1.00 25.64  ? 218 LEU B O     1 
ATOM   4669  C  CB    . LEU B  1 246 ? 19.724  -6.599  -31.203 1.00 27.62  ? 218 LEU B CB    1 
ATOM   4670  C  CG    . LEU B  1 246 ? 20.114  -6.354  -29.754 1.00 29.77  ? 218 LEU B CG    1 
ATOM   4671  C  CD1   . LEU B  1 246 ? 21.553  -5.879  -29.685 1.00 29.10  ? 218 LEU B CD1   1 
ATOM   4672  C  CD2   . LEU B  1 246 ? 19.168  -5.323  -29.104 1.00 30.67  ? 218 LEU B CD2   1 
ATOM   4673  N  N     . THR B  1 247 ? 18.504  -8.225  -33.695 1.00 24.83  ? 219 THR B N     1 
ATOM   4674  C  CA    . THR B  1 247 ? 18.031  -8.244  -35.085 1.00 25.79  ? 219 THR B CA    1 
ATOM   4675  C  C     . THR B  1 247 ? 16.558  -8.622  -35.183 1.00 27.35  ? 219 THR B C     1 
ATOM   4676  O  O     . THR B  1 247 ? 15.913  -8.337  -36.185 1.00 26.41  ? 219 THR B O     1 
ATOM   4677  C  CB    . THR B  1 247 ? 18.816  -9.238  -35.973 1.00 26.81  ? 219 THR B CB    1 
ATOM   4678  O  OG1   . THR B  1 247 ? 18.639  -10.576 -35.471 1.00 25.44  ? 219 THR B OG1   1 
ATOM   4679  C  CG2   . THR B  1 247 ? 20.290  -8.883  -36.015 1.00 24.71  ? 219 THR B CG2   1 
ATOM   4680  N  N     . GLN B  1 248 ? 16.028  -9.284  -34.155 1.00 25.03  ? 220 GLN B N     1 
ATOM   4681  C  CA    . GLN B  1 248 ? 14.656  -9.761  -34.218 1.00 23.55  ? 220 GLN B CA    1 
ATOM   4682  C  C     . GLN B  1 248 ? 13.629  -8.822  -33.572 1.00 28.75  ? 220 GLN B C     1 
ATOM   4683  O  O     . GLN B  1 248 ? 12.438  -9.136  -33.557 1.00 31.17  ? 220 GLN B O     1 
ATOM   4684  C  CB    . GLN B  1 248 ? 14.562  -11.151 -33.573 1.00 25.27  ? 220 GLN B CB    1 
ATOM   4685  C  CG    . GLN B  1 248 ? 15.383  -12.191 -34.314 1.00 27.67  ? 220 GLN B CG    1 
ATOM   4686  C  CD    . GLN B  1 248 ? 15.383  -13.569 -33.641 1.00 35.01  ? 220 GLN B CD    1 
ATOM   4687  O  OE1   . GLN B  1 248 ? 14.340  -14.216 -33.511 1.00 28.96  ? 220 GLN B OE1   1 
ATOM   4688  N  NE2   . GLN B  1 248 ? 16.563  -14.020 -33.223 1.00 32.20  ? 220 GLN B NE2   1 
ATOM   4689  N  N     . THR B  1 249 ? 14.063  -7.682  -33.035 1.00 25.51  ? 221 THR B N     1 
ATOM   4690  C  CA    . THR B  1 249 ? 13.108  -6.787  -32.376 1.00 30.17  ? 221 THR B CA    1 
ATOM   4691  C  C     . THR B  1 249 ? 12.327  -5.968  -33.401 1.00 35.21  ? 221 THR B C     1 
ATOM   4692  O  O     . THR B  1 249 ? 12.769  -5.772  -34.552 1.00 29.15  ? 221 THR B O     1 
ATOM   4693  C  CB    . THR B  1 249 ? 13.789  -5.838  -31.376 1.00 31.67  ? 221 THR B CB    1 
ATOM   4694  O  OG1   . THR B  1 249 ? 14.800  -5.089  -32.051 1.00 32.69  ? 221 THR B OG1   1 
ATOM   4695  C  CG2   . THR B  1 249 ? 14.421  -6.627  -30.235 1.00 25.28  ? 221 THR B CG2   1 
ATOM   4696  N  N     . LYS B  1 250 ? 11.148  -5.514  -32.985 1.00 34.91  ? 222 LYS B N     1 
ATOM   4697  C  CA    . LYS B  1 250 ? 10.226  -4.836  -33.892 1.00 35.05  ? 222 LYS B CA    1 
ATOM   4698  C  C     . LYS B  1 250 ? 10.247  -3.318  -33.760 1.00 36.77  ? 222 LYS B C     1 
ATOM   4699  O  O     . LYS B  1 250 ? 9.765   -2.613  -34.643 1.00 42.02  ? 222 LYS B O     1 
ATOM   4700  C  CB    . LYS B  1 250 ? 8.804   -5.356  -33.673 1.00 38.00  ? 222 LYS B CB    1 
ATOM   4701  C  CG    . LYS B  1 250 ? 8.562   -6.708  -34.341 1.00 39.93  ? 222 LYS B CG    1 
ATOM   4702  C  CD    . LYS B  1 250 ? 7.122   -7.181  -34.199 1.00 50.15  ? 222 LYS B CD    1 
ATOM   4703  C  CE    . LYS B  1 250 ? 6.823   -8.306  -35.199 1.00 44.21  ? 222 LYS B CE    1 
ATOM   4704  N  NZ    . LYS B  1 250 ? 5.369   -8.623  -35.278 1.00 54.02  ? 222 LYS B NZ    1 
ATOM   4705  N  N     . GLY B  1 251 ? 10.818  -2.815  -32.675 1.00 32.26  ? 223 GLY B N     1 
ATOM   4706  C  CA    . GLY B  1 251 ? 10.885  -1.381  -32.465 1.00 32.97  ? 223 GLY B CA    1 
ATOM   4707  C  C     . GLY B  1 251 ? 12.152  -0.784  -33.037 1.00 31.02  ? 223 GLY B C     1 
ATOM   4708  O  O     . GLY B  1 251 ? 12.787  -1.384  -33.920 1.00 27.85  ? 223 GLY B O     1 
ATOM   4709  N  N     . PHE B  1 252 ? 12.504  0.409   -32.550 1.00 30.83  ? 224 PHE B N     1 
ATOM   4710  C  CA    . PHE B  1 252 ? 13.754  1.059   -32.925 1.00 32.98  ? 224 PHE B CA    1 
ATOM   4711  C  C     . PHE B  1 252 ? 14.925  0.317   -32.316 1.00 35.24  ? 224 PHE B C     1 
ATOM   4712  O  O     . PHE B  1 252 ? 14.849  -0.120  -31.173 1.00 32.83  ? 224 PHE B O     1 
ATOM   4713  C  CB    . PHE B  1 252 ? 13.777  2.523   -32.462 1.00 29.27  ? 224 PHE B CB    1 
ATOM   4714  C  CG    . PHE B  1 252 ? 12.795  3.379   -33.172 1.00 31.32  ? 224 PHE B CG    1 
ATOM   4715  C  CD1   . PHE B  1 252 ? 11.549  3.630   -32.618 1.00 27.97  ? 224 PHE B CD1   1 
ATOM   4716  C  CD2   . PHE B  1 252 ? 13.091  3.895   -34.431 1.00 29.85  ? 224 PHE B CD2   1 
ATOM   4717  C  CE1   . PHE B  1 252 ? 10.625  4.397   -33.295 1.00 34.42  ? 224 PHE B CE1   1 
ATOM   4718  C  CE2   . PHE B  1 252 ? 12.172  4.666   -35.110 1.00 29.45  ? 224 PHE B CE2   1 
ATOM   4719  C  CZ    . PHE B  1 252 ? 10.939  4.936   -34.538 1.00 30.30  ? 224 PHE B CZ    1 
ATOM   4720  N  N     . LEU B  1 253 ? 16.012  0.169   -33.061 1.00 32.66  ? 225 LEU B N     1 
ATOM   4721  C  CA    . LEU B  1 253 ? 17.219  -0.405  -32.464 1.00 33.07  ? 225 LEU B CA    1 
ATOM   4722  C  C     . LEU B  1 253 ? 17.952  0.667   -31.642 1.00 32.29  ? 225 LEU B C     1 
ATOM   4723  O  O     . LEU B  1 253 ? 18.146  1.788   -32.128 1.00 29.78  ? 225 LEU B O     1 
ATOM   4724  C  CB    . LEU B  1 253 ? 18.135  -0.981  -33.542 1.00 27.77  ? 225 LEU B CB    1 
ATOM   4725  C  CG    . LEU B  1 253 ? 19.313  -1.768  -32.977 1.00 30.01  ? 225 LEU B CG    1 
ATOM   4726  C  CD1   . LEU B  1 253 ? 18.820  -3.053  -32.285 1.00 31.02  ? 225 LEU B CD1   1 
ATOM   4727  C  CD2   . LEU B  1 253 ? 20.324  -2.078  -34.075 1.00 29.05  ? 225 LEU B CD2   1 
ATOM   4728  N  N     . PRO B  1 254 ? 18.327  0.352   -30.384 1.00 32.44  ? 226 PRO B N     1 
ATOM   4729  C  CA    . PRO B  1 254 ? 19.067  1.364   -29.603 1.00 28.28  ? 226 PRO B CA    1 
ATOM   4730  C  C     . PRO B  1 254 ? 20.349  1.784   -30.320 1.00 33.57  ? 226 PRO B C     1 
ATOM   4731  O  O     . PRO B  1 254 ? 20.990  0.953   -30.989 1.00 29.77  ? 226 PRO B O     1 
ATOM   4732  C  CB    . PRO B  1 254 ? 19.376  0.640   -28.283 1.00 26.86  ? 226 PRO B CB    1 
ATOM   4733  C  CG    . PRO B  1 254 ? 18.273  -0.356  -28.148 1.00 31.00  ? 226 PRO B CG    1 
ATOM   4734  C  CD    . PRO B  1 254 ? 17.974  -0.827  -29.565 1.00 30.97  ? 226 PRO B CD    1 
ATOM   4735  N  N     . ASP B  1 255 ? 20.697  3.063   -30.212 1.00 32.56  ? 227 ASP B N     1 
ATOM   4736  C  CA    . ASP B  1 255 ? 21.775  3.640   -31.005 1.00 30.17  ? 227 ASP B CA    1 
ATOM   4737  C  C     . ASP B  1 255 ? 23.120  2.900   -30.896 1.00 31.67  ? 227 ASP B C     1 
ATOM   4738  O  O     . ASP B  1 255 ? 23.814  2.697   -31.899 1.00 32.80  ? 227 ASP B O     1 
ATOM   4739  C  CB    . ASP B  1 255 ? 21.956  5.112   -30.622 1.00 35.05  ? 227 ASP B CB    1 
ATOM   4740  C  CG    . ASP B  1 255 ? 20.896  6.012   -31.261 1.00 41.55  ? 227 ASP B CG    1 
ATOM   4741  O  OD1   . ASP B  1 255 ? 19.773  5.529   -31.519 1.00 48.97  ? 227 ASP B OD1   1 
ATOM   4742  O  OD2   . ASP B  1 255 ? 21.178  7.195   -31.513 1.00 42.92  ? 227 ASP B OD2   1 
ATOM   4743  N  N     . GLU B  1 256 ? 23.488  2.488   -29.695 1.00 29.34  ? 228 GLU B N     1 
ATOM   4744  C  CA    . GLU B  1 256 ? 24.778  1.840   -29.516 1.00 33.69  ? 228 GLU B CA    1 
ATOM   4745  C  C     . GLU B  1 256 ? 24.945  0.544   -30.341 1.00 30.78  ? 228 GLU B C     1 
ATOM   4746  O  O     . GLU B  1 256 ? 26.069  0.146   -30.630 1.00 36.37  ? 228 GLU B O     1 
ATOM   4747  C  CB    . GLU B  1 256 ? 25.004  1.539   -28.036 1.00 33.97  ? 228 GLU B CB    1 
ATOM   4748  C  CG    . GLU B  1 256 ? 24.078  0.480   -27.491 1.00 38.40  ? 228 GLU B CG    1 
ATOM   4749  C  CD    . GLU B  1 256 ? 24.475  0.036   -26.103 1.00 43.99  ? 228 GLU B CD    1 
ATOM   4750  O  OE1   . GLU B  1 256 ? 23.618  0.134   -25.199 1.00 49.08  ? 228 GLU B OE1   1 
ATOM   4751  O  OE2   . GLU B  1 256 ? 25.638  -0.414  -25.929 1.00 42.25  ? 228 GLU B OE2   1 
ATOM   4752  N  N     . PHE B  1 257 ? 23.853  -0.101  -30.746 1.00 27.98  ? 229 PHE B N     1 
ATOM   4753  C  CA    . PHE B  1 257 ? 23.994  -1.359  -31.503 1.00 30.75  ? 229 PHE B CA    1 
ATOM   4754  C  C     . PHE B  1 257 ? 23.944  -1.136  -33.024 1.00 33.63  ? 229 PHE B C     1 
ATOM   4755  O  O     . PHE B  1 257 ? 24.222  -2.059  -33.804 1.00 31.77  ? 229 PHE B O     1 
ATOM   4756  C  CB    . PHE B  1 257 ? 22.921  -2.381  -31.084 1.00 30.30  ? 229 PHE B CB    1 
ATOM   4757  C  CG    . PHE B  1 257 ? 22.886  -2.659  -29.594 1.00 29.56  ? 229 PHE B CG    1 
ATOM   4758  C  CD1   . PHE B  1 257 ? 23.959  -3.271  -28.962 1.00 31.30  ? 229 PHE B CD1   1 
ATOM   4759  C  CD2   . PHE B  1 257 ? 21.776  -2.319  -28.835 1.00 25.13  ? 229 PHE B CD2   1 
ATOM   4760  C  CE1   . PHE B  1 257 ? 23.929  -3.532  -27.584 1.00 30.42  ? 229 PHE B CE1   1 
ATOM   4761  C  CE2   . PHE B  1 257 ? 21.733  -2.579  -27.468 1.00 28.73  ? 229 PHE B CE2   1 
ATOM   4762  C  CZ    . PHE B  1 257 ? 22.814  -3.179  -26.839 1.00 26.19  ? 229 PHE B CZ    1 
ATOM   4763  N  N     . ARG B  1 258 ? 23.624  0.086   -33.445 1.00 29.57  ? 230 ARG B N     1 
ATOM   4764  C  CA    . ARG B  1 258 ? 23.427  0.381   -34.861 1.00 31.77  ? 230 ARG B CA    1 
ATOM   4765  C  C     . ARG B  1 258 ? 24.720  0.260   -35.658 1.00 32.74  ? 230 ARG B C     1 
ATOM   4766  O  O     . ARG B  1 258 ? 24.706  -0.021  -36.859 1.00 33.93  ? 230 ARG B O     1 
ATOM   4767  C  CB    . ARG B  1 258 ? 22.817  1.768   -35.027 1.00 29.25  ? 230 ARG B CB    1 
ATOM   4768  C  CG    . ARG B  1 258 ? 21.377  1.811   -34.542 1.00 28.14  ? 230 ARG B CG    1 
ATOM   4769  C  CD    . ARG B  1 258 ? 20.729  3.167   -34.755 1.00 28.30  ? 230 ARG B CD    1 
ATOM   4770  N  NE    . ARG B  1 258 ? 19.441  3.203   -34.077 1.00 27.82  ? 230 ARG B NE    1 
ATOM   4771  C  CZ    . ARG B  1 258 ? 18.520  4.150   -34.216 1.00 34.24  ? 230 ARG B CZ    1 
ATOM   4772  N  NH1   . ARG B  1 258 ? 18.713  5.176   -35.052 1.00 30.80  ? 230 ARG B NH1   1 
ATOM   4773  N  NH2   . ARG B  1 258 ? 17.391  4.054   -33.525 1.00 32.58  ? 230 ARG B NH2   1 
ATOM   4774  N  N     . THR B  1 259 ? 25.834  0.420   -34.964 1.00 30.22  ? 231 THR B N     1 
ATOM   4775  C  CA    . THR B  1 259 ? 27.151  0.299   -35.568 1.00 36.50  ? 231 THR B CA    1 
ATOM   4776  C  C     . THR B  1 259 ? 27.832  -1.035  -35.231 1.00 40.40  ? 231 THR B C     1 
ATOM   4777  O  O     . THR B  1 259 ? 29.025  -1.206  -35.466 1.00 50.63  ? 231 THR B O     1 
ATOM   4778  C  CB    . THR B  1 259 ? 28.054  1.436   -35.089 1.00 39.81  ? 231 THR B CB    1 
ATOM   4779  O  OG1   . THR B  1 259 ? 28.009  1.474   -33.655 1.00 49.85  ? 231 THR B OG1   1 
ATOM   4780  C  CG2   . THR B  1 259 ? 27.563  2.777   -35.629 1.00 42.19  ? 231 THR B CG2   1 
ATOM   4781  N  N     . LYS B  1 260 ? 27.091  -1.968  -34.660 1.00 28.84  ? 232 LYS B N     1 
ATOM   4782  C  CA    . LYS B  1 260 ? 27.671  -3.256  -34.278 1.00 40.15  ? 232 LYS B CA    1 
ATOM   4783  C  C     . LYS B  1 260 ? 26.990  -4.387  -35.044 1.00 37.23  ? 232 LYS B C     1 
ATOM   4784  O  O     . LYS B  1 260 ? 27.528  -5.489  -35.157 1.00 42.43  ? 232 LYS B O     1 
ATOM   4785  C  CB    . LYS B  1 260 ? 27.550  -3.480  -32.757 1.00 34.96  ? 232 LYS B CB    1 
ATOM   4786  C  CG    . LYS B  1 260 ? 28.101  -2.313  -31.905 1.00 39.57  ? 232 LYS B CG    1 
ATOM   4787  C  CD    . LYS B  1 260 ? 29.332  -2.712  -31.101 1.00 51.08  ? 232 LYS B CD    1 
ATOM   4788  C  CE    . LYS B  1 260 ? 30.464  -3.211  -31.996 1.00 60.29  ? 232 LYS B CE    1 
ATOM   4789  N  NZ    . LYS B  1 260 ? 31.557  -3.898  -31.226 1.00 57.66  ? 232 LYS B NZ    1 
ATOM   4790  N  N     . ILE B  1 261 ? 25.812  -4.101  -35.586 1.00 34.92  ? 233 ILE B N     1 
ATOM   4791  C  CA    . ILE B  1 261 ? 25.000  -5.135  -36.220 1.00 40.79  ? 233 ILE B CA    1 
ATOM   4792  C  C     . ILE B  1 261 ? 25.609  -5.485  -37.594 1.00 37.50  ? 233 ILE B C     1 
ATOM   4793  O  O     . ILE B  1 261 ? 25.467  -6.604  -38.084 1.00 31.19  ? 233 ILE B O     1 
ATOM   4794  C  CB    . ILE B  1 261 ? 23.514  -4.676  -36.324 1.00 32.86  ? 233 ILE B CB    1 
ATOM   4795  C  CG1   . ILE B  1 261 ? 22.615  -5.778  -36.868 1.00 35.71  ? 233 ILE B CG1   1 
ATOM   4796  C  CG2   . ILE B  1 261 ? 23.378  -3.432  -37.164 1.00 30.91  ? 233 ILE B CG2   1 
ATOM   4797  C  CD1   . ILE B  1 261 ? 21.161  -5.320  -37.030 1.00 39.04  ? 233 ILE B CD1   1 
ATOM   4798  N  N     . GLY B  1 262 ? 26.330  -4.529  -38.180 1.00 32.73  ? 234 GLY B N     1 
ATOM   4799  C  CA    . GLY B  1 262 ? 27.014  -4.750  -39.445 1.00 33.71  ? 234 GLY B CA    1 
ATOM   4800  C  C     . GLY B  1 262 ? 26.045  -4.945  -40.601 1.00 35.42  ? 234 GLY B C     1 
ATOM   4801  O  O     . GLY B  1 262 ? 25.164  -4.108  -40.846 1.00 37.78  ? 234 GLY B O     1 
ATOM   4802  N  N     . ASN B  1 263 ? 26.195  -6.053  -41.314 1.00 32.99  ? 235 ASN B N     1 
ATOM   4803  C  CA    . ASN B  1 263 ? 25.298  -6.341  -42.425 1.00 33.49  ? 235 ASN B CA    1 
ATOM   4804  C  C     . ASN B  1 263 ? 24.419  -7.557  -42.128 1.00 33.25  ? 235 ASN B C     1 
ATOM   4805  O  O     . ASN B  1 263 ? 23.896  -8.204  -43.037 1.00 32.75  ? 235 ASN B O     1 
ATOM   4806  C  CB    . ASN B  1 263 ? 26.101  -6.557  -43.709 1.00 30.08  ? 235 ASN B CB    1 
ATOM   4807  C  CG    . ASN B  1 263 ? 26.740  -7.923  -43.766 1.00 37.25  ? 235 ASN B CG    1 
ATOM   4808  O  OD1   . ASN B  1 263 ? 27.192  -8.467  -42.746 1.00 33.83  ? 235 ASN B OD1   1 
ATOM   4809  N  ND2   . ASN B  1 263 ? 26.765  -8.503  -44.961 1.00 31.15  ? 235 ASN B ND2   1 
ATOM   4810  N  N     . ARG B  1 264 ? 24.263  -7.870  -40.845 1.00 34.15  ? 236 ARG B N     1 
ATOM   4811  C  CA    . ARG B  1 264 ? 23.412  -8.970  -40.420 1.00 27.38  ? 236 ARG B CA    1 
ATOM   4812  C  C     . ARG B  1 264 ? 21.950  -8.570  -40.524 1.00 31.03  ? 236 ARG B C     1 
ATOM   4813  O  O     . ARG B  1 264 ? 21.542  -7.556  -39.961 1.00 28.71  ? 236 ARG B O     1 
ATOM   4814  C  CB    . ARG B  1 264 ? 23.720  -9.367  -38.982 1.00 31.12  ? 236 ARG B CB    1 
ATOM   4815  C  CG    . ARG B  1 264 ? 25.079  -9.994  -38.752 1.00 26.49  ? 236 ARG B CG    1 
ATOM   4816  C  CD    . ARG B  1 264 ? 25.238  -10.215 -37.253 1.00 25.87  ? 236 ARG B CD    1 
ATOM   4817  N  NE    . ARG B  1 264 ? 26.600  -10.552 -36.869 1.00 31.60  ? 236 ARG B NE    1 
ATOM   4818  C  CZ    . ARG B  1 264 ? 27.568  -9.669  -36.655 1.00 28.82  ? 236 ARG B CZ    1 
ATOM   4819  N  NH1   . ARG B  1 264 ? 27.342  -8.370  -36.807 1.00 33.20  ? 236 ARG B NH1   1 
ATOM   4820  N  NH2   . ARG B  1 264 ? 28.772  -10.094 -36.290 1.00 32.00  ? 236 ARG B NH2   1 
ATOM   4821  N  N     . LEU B  1 265 ? 21.159  -9.380  -41.216 1.00 28.34  ? 237 LEU B N     1 
ATOM   4822  C  CA    . LEU B  1 265 ? 19.728  -9.118  -41.330 1.00 24.98  ? 237 LEU B CA    1 
ATOM   4823  C  C     . LEU B  1 265 ? 18.918  -9.897  -40.289 1.00 30.92  ? 237 LEU B C     1 
ATOM   4824  O  O     . LEU B  1 265 ? 17.791  -9.527  -39.952 1.00 27.97  ? 237 LEU B O     1 
ATOM   4825  C  CB    . LEU B  1 265 ? 19.257  -9.483  -42.738 1.00 28.67  ? 237 LEU B CB    1 
ATOM   4826  C  CG    . LEU B  1 265 ? 19.885  -8.611  -43.826 1.00 25.85  ? 237 LEU B CG    1 
ATOM   4827  C  CD1   . LEU B  1 265 ? 19.482  -9.124  -45.198 1.00 26.51  ? 237 LEU B CD1   1 
ATOM   4828  C  CD2   . LEU B  1 265 ? 19.441  -7.177  -43.620 1.00 25.68  ? 237 LEU B CD2   1 
ATOM   4829  N  N     . TYR B  1 266 ? 19.495  -10.990 -39.799 1.00 25.92  ? 238 TYR B N     1 
ATOM   4830  C  CA    . TYR B  1 266 ? 18.810  -11.857 -38.848 1.00 29.48  ? 238 TYR B CA    1 
ATOM   4831  C  C     . TYR B  1 266 ? 19.803  -12.817 -38.210 1.00 28.91  ? 238 TYR B C     1 
ATOM   4832  O  O     . TYR B  1 266 ? 20.543  -13.524 -38.904 1.00 27.58  ? 238 TYR B O     1 
ATOM   4833  C  CB    . TYR B  1 266 ? 17.682  -12.625 -39.539 1.00 28.98  ? 238 TYR B CB    1 
ATOM   4834  C  CG    . TYR B  1 266 ? 16.955  -13.589 -38.632 1.00 30.91  ? 238 TYR B CG    1 
ATOM   4835  C  CD1   . TYR B  1 266 ? 15.805  -13.203 -37.957 1.00 31.57  ? 238 TYR B CD1   1 
ATOM   4836  C  CD2   . TYR B  1 266 ? 17.415  -14.890 -38.456 1.00 28.35  ? 238 TYR B CD2   1 
ATOM   4837  C  CE1   . TYR B  1 266 ? 15.132  -14.087 -37.119 1.00 29.38  ? 238 TYR B CE1   1 
ATOM   4838  C  CE2   . TYR B  1 266 ? 16.755  -15.783 -37.615 1.00 31.72  ? 238 TYR B CE2   1 
ATOM   4839  C  CZ    . TYR B  1 266 ? 15.613  -15.375 -36.955 1.00 30.77  ? 238 TYR B CZ    1 
ATOM   4840  O  OH    . TYR B  1 266 ? 14.963  -16.257 -36.131 1.00 32.35  ? 238 TYR B OH    1 
ATOM   4841  N  N     . GLY B  1 267 ? 19.815  -12.839 -36.884 1.00 25.72  ? 239 GLY B N     1 
ATOM   4842  C  CA    . GLY B  1 267 ? 20.700  -13.721 -36.164 1.00 22.84  ? 239 GLY B CA    1 
ATOM   4843  C  C     . GLY B  1 267 ? 22.138  -13.266 -36.209 1.00 26.16  ? 239 GLY B C     1 
ATOM   4844  O  O     . GLY B  1 267 ? 22.493  -12.289 -36.879 1.00 25.28  ? 239 GLY B O     1 
ATOM   4845  N  N     . CYS B  1 268 ? 22.980  -13.995 -35.494 1.00 24.11  ? 240 CYS B N     1 
ATOM   4846  C  CA    . CYS B  1 268 ? 24.407  -13.685 -35.431 1.00 26.27  ? 240 CYS B CA    1 
ATOM   4847  C  C     . CYS B  1 268 ? 25.161  -14.984 -35.152 1.00 28.06  ? 240 CYS B C     1 
ATOM   4848  O  O     . CYS B  1 268 ? 24.751  -15.749 -34.285 1.00 28.26  ? 240 CYS B O     1 
ATOM   4849  C  CB    . CYS B  1 268 ? 24.685  -12.629 -34.351 1.00 25.46  ? 240 CYS B CB    1 
ATOM   4850  S  SG    . CYS B  1 268 ? 26.440  -12.379 -33.931 1.00 33.63  ? 240 CYS B SG    1 
ATOM   4851  N  N     . ASP B  1 269 ? 26.243  -15.235 -35.889 1.00 31.43  ? 241 ASP B N     1 
ATOM   4852  C  CA    . ASP B  1 269 ? 26.943  -16.526 -35.816 1.00 33.89  ? 241 ASP B CA    1 
ATOM   4853  C  C     . ASP B  1 269 ? 28.340  -16.407 -35.210 1.00 33.85  ? 241 ASP B C     1 
ATOM   4854  O  O     . ASP B  1 269 ? 29.042  -17.411 -35.055 1.00 33.39  ? 241 ASP B O     1 
ATOM   4855  C  CB    . ASP B  1 269 ? 27.063  -17.166 -37.210 1.00 27.87  ? 241 ASP B CB    1 
ATOM   4856  C  CG    . ASP B  1 269 ? 25.767  -17.781 -37.691 1.00 29.62  ? 241 ASP B CG    1 
ATOM   4857  O  OD1   . ASP B  1 269 ? 24.961  -18.216 -36.841 1.00 34.25  ? 241 ASP B OD1   1 
ATOM   4858  O  OD2   . ASP B  1 269 ? 25.561  -17.854 -38.925 1.00 33.01  ? 241 ASP B OD2   1 
ATOM   4859  N  N     . THR B  1 270 ? 28.727  -15.190 -34.849 1.00 31.56  ? 242 THR B N     1 
ATOM   4860  C  CA    . THR B  1 270 ? 30.120  -14.902 -34.522 1.00 36.21  ? 242 THR B CA    1 
ATOM   4861  C  C     . THR B  1 270 ? 30.723  -15.789 -33.425 1.00 33.46  ? 242 THR B C     1 
ATOM   4862  O  O     . THR B  1 270 ? 31.847  -16.257 -33.578 1.00 37.22  ? 242 THR B O     1 
ATOM   4863  C  CB    . THR B  1 270 ? 30.262  -13.446 -34.129 1.00 29.13  ? 242 THR B CB    1 
ATOM   4864  O  OG1   . THR B  1 270 ? 29.850  -12.645 -35.232 1.00 32.57  ? 242 THR B OG1   1 
ATOM   4865  C  CG2   . THR B  1 270 ? 31.706  -13.100 -33.752 1.00 31.01  ? 242 THR B CG2   1 
ATOM   4866  N  N     . CYS B  1 271 ? 29.989  -16.043 -32.343 1.00 28.32  ? 243 CYS B N     1 
ATOM   4867  C  CA    . CYS B  1 271 ? 30.539  -16.861 -31.258 1.00 26.40  ? 243 CYS B CA    1 
ATOM   4868  C  C     . CYS B  1 271 ? 30.583  -18.338 -31.632 1.00 33.24  ? 243 CYS B C     1 
ATOM   4869  O  O     . CYS B  1 271 ? 31.143  -19.161 -30.897 1.00 34.86  ? 243 CYS B O     1 
ATOM   4870  C  CB    . CYS B  1 271 ? 29.739  -16.683 -29.963 1.00 28.48  ? 243 CYS B CB    1 
ATOM   4871  S  SG    . CYS B  1 271 ? 27.924  -16.922 -30.117 1.00 33.33  ? 243 CYS B SG    1 
ATOM   4872  N  N     . GLN B  1 272 ? 29.962  -18.694 -32.745 1.00 32.12  ? 244 GLN B N     1 
ATOM   4873  C  CA    . GLN B  1 272 ? 30.148  -20.048 -33.264 1.00 33.01  ? 244 GLN B CA    1 
ATOM   4874  C  C     . GLN B  1 272 ? 31.270  -20.115 -34.302 1.00 33.63  ? 244 GLN B C     1 
ATOM   4875  O  O     . GLN B  1 272 ? 32.000  -21.105 -34.342 1.00 35.96  ? 244 GLN B O     1 
ATOM   4876  C  CB    . GLN B  1 272 ? 28.856  -20.585 -33.876 1.00 33.36  ? 244 GLN B CB    1 
ATOM   4877  C  CG    . GLN B  1 272 ? 27.803  -20.966 -32.867 1.00 30.77  ? 244 GLN B CG    1 
ATOM   4878  C  CD    . GLN B  1 272 ? 26.515  -21.383 -33.543 1.00 31.20  ? 244 GLN B CD    1 
ATOM   4879  O  OE1   . GLN B  1 272 ? 26.220  -22.575 -33.678 1.00 33.19  ? 244 GLN B OE1   1 
ATOM   4880  N  NE2   . GLN B  1 272 ? 25.755  -20.403 -34.001 1.00 28.29  ? 244 GLN B NE2   1 
ATOM   4881  N  N     . THR B  1 273 ? 31.417  -19.082 -35.137 1.00 27.89  ? 245 THR B N     1 
ATOM   4882  C  CA    . THR B  1 273 ? 32.357  -19.178 -36.259 1.00 34.45  ? 245 THR B CA    1 
ATOM   4883  C  C     . THR B  1 273 ? 33.805  -19.074 -35.786 1.00 39.16  ? 245 THR B C     1 
ATOM   4884  O  O     . THR B  1 273 ? 34.723  -19.548 -36.473 1.00 37.77  ? 245 THR B O     1 
ATOM   4885  C  CB    . THR B  1 273 ? 32.109  -18.095 -37.353 1.00 31.88  ? 245 THR B CB    1 
ATOM   4886  O  OG1   . THR B  1 273 ? 32.072  -16.796 -36.750 1.00 38.42  ? 245 THR B OG1   1 
ATOM   4887  C  CG2   . THR B  1 273 ? 30.787  -18.340 -38.071 1.00 34.64  ? 245 THR B CG2   1 
ATOM   4888  N  N     . VAL B  1 274 ? 34.012  -18.475 -34.613 1.00 31.77  ? 246 VAL B N     1 
ATOM   4889  C  CA    . VAL B  1 274 ? 35.367  -18.330 -34.075 1.00 35.78  ? 246 VAL B CA    1 
ATOM   4890  C  C     . VAL B  1 274 ? 35.760  -19.500 -33.194 1.00 40.27  ? 246 VAL B C     1 
ATOM   4891  O  O     . VAL B  1 274 ? 36.889  -19.574 -32.716 1.00 42.24  ? 246 VAL B O     1 
ATOM   4892  C  CB    . VAL B  1 274 ? 35.532  -17.047 -33.238 1.00 37.96  ? 246 VAL B CB    1 
ATOM   4893  C  CG1   . VAL B  1 274 ? 35.050  -15.839 -34.011 1.00 36.73  ? 246 VAL B CG1   1 
ATOM   4894  C  CG2   . VAL B  1 274 ? 34.775  -17.185 -31.934 1.00 35.58  ? 246 VAL B CG2   1 
ATOM   4895  N  N     . CYS B  1 275 ? 34.826  -20.415 -32.966 1.00 37.42  ? 247 CYS B N     1 
ATOM   4896  C  CA    . CYS B  1 275 ? 35.075  -21.499 -32.030 1.00 39.33  ? 247 CYS B CA    1 
ATOM   4897  C  C     . CYS B  1 275 ? 35.890  -22.617 -32.671 1.00 42.69  ? 247 CYS B C     1 
ATOM   4898  O  O     . CYS B  1 275 ? 35.459  -23.222 -33.662 1.00 41.87  ? 247 CYS B O     1 
ATOM   4899  C  CB    . CYS B  1 275 ? 33.754  -22.044 -31.500 1.00 33.32  ? 247 CYS B CB    1 
ATOM   4900  S  SG    . CYS B  1 275 ? 33.908  -23.495 -30.472 1.00 38.22  ? 247 CYS B SG    1 
ATOM   4901  N  N     . PRO B  1 276 ? 37.063  -22.908 -32.090 1.00 43.38  ? 248 PRO B N     1 
ATOM   4902  C  CA    . PRO B  1 276 ? 37.950  -23.985 -32.552 1.00 40.67  ? 248 PRO B CA    1 
ATOM   4903  C  C     . PRO B  1 276 ? 37.205  -25.308 -32.699 1.00 40.00  ? 248 PRO B C     1 
ATOM   4904  O  O     . PRO B  1 276 ? 37.509  -26.093 -33.594 1.00 47.61  ? 248 PRO B O     1 
ATOM   4905  C  CB    . PRO B  1 276 ? 39.009  -24.081 -31.443 1.00 41.49  ? 248 PRO B CB    1 
ATOM   4906  C  CG    . PRO B  1 276 ? 38.957  -22.771 -30.736 1.00 41.46  ? 248 PRO B CG    1 
ATOM   4907  C  CD    . PRO B  1 276 ? 37.552  -22.267 -30.855 1.00 38.04  ? 248 PRO B CD    1 
ATOM   4908  N  N     . LEU B  1 277 ? 36.221  -25.549 -31.842 1.00 41.44  ? 249 LEU B N     1 
ATOM   4909  C  CA    . LEU B  1 277 ? 35.464  -26.796 -31.922 1.00 43.34  ? 249 LEU B CA    1 
ATOM   4910  C  C     . LEU B  1 277 ? 34.563  -26.869 -33.161 1.00 38.90  ? 249 LEU B C     1 
ATOM   4911  O  O     . LEU B  1 277 ? 34.028  -27.931 -33.488 1.00 40.69  ? 249 LEU B O     1 
ATOM   4912  C  CB    . LEU B  1 277 ? 34.629  -26.993 -30.658 1.00 42.92  ? 249 LEU B CB    1 
ATOM   4913  C  CG    . LEU B  1 277 ? 35.422  -26.999 -29.358 1.00 40.38  ? 249 LEU B CG    1 
ATOM   4914  C  CD1   . LEU B  1 277 ? 34.471  -27.233 -28.214 1.00 41.91  ? 249 LEU B CD1   1 
ATOM   4915  C  CD2   . LEU B  1 277 ? 36.491  -28.093 -29.400 1.00 45.86  ? 249 LEU B CD2   1 
ATOM   4916  N  N     . ASN B  1 278 ? 34.398  -25.747 -33.854 1.00 38.68  ? 250 ASN B N     1 
ATOM   4917  C  CA    . ASN B  1 278 ? 33.603  -25.745 -35.074 1.00 40.89  ? 250 ASN B CA    1 
ATOM   4918  C  C     . ASN B  1 278 ? 34.474  -25.742 -36.327 1.00 40.75  ? 250 ASN B C     1 
ATOM   4919  O  O     . ASN B  1 278 ? 33.966  -25.867 -37.440 1.00 38.52  ? 250 ASN B O     1 
ATOM   4920  C  CB    . ASN B  1 278 ? 32.648  -24.546 -35.091 1.00 37.26  ? 250 ASN B CB    1 
ATOM   4921  C  CG    . ASN B  1 278 ? 31.424  -24.757 -34.206 1.00 36.95  ? 250 ASN B CG    1 
ATOM   4922  O  OD1   . ASN B  1 278 ? 30.909  -25.878 -34.085 1.00 36.50  ? 250 ASN B OD1   1 
ATOM   4923  N  ND2   . ASN B  1 278 ? 30.957  -23.680 -33.572 1.00 30.12  ? 250 ASN B ND2   1 
ATOM   4924  N  N     . LYS B  1 279 ? 35.783  -25.594 -36.136 1.00 41.47  ? 251 LYS B N     1 
ATOM   4925  C  CA    . LYS B  1 279 ? 36.730  -25.541 -37.253 1.00 48.91  ? 251 LYS B CA    1 
ATOM   4926  C  C     . LYS B  1 279 ? 36.643  -26.799 -38.129 1.00 46.29  ? 251 LYS B C     1 
ATOM   4927  O  O     . LYS B  1 279 ? 36.744  -27.927 -37.631 1.00 47.40  ? 251 LYS B O     1 
ATOM   4928  C  CB    . LYS B  1 279 ? 38.154  -25.362 -36.720 1.00 53.05  ? 251 LYS B CB    1 
ATOM   4929  C  CG    . LYS B  1 279 ? 39.227  -25.294 -37.796 1.00 56.36  ? 251 LYS B CG    1 
ATOM   4930  C  CD    . LYS B  1 279 ? 40.606  -25.144 -37.170 1.00 58.45  ? 251 LYS B CD    1 
ATOM   4931  C  CE    . LYS B  1 279 ? 41.591  -24.545 -38.150 1.00 57.17  ? 251 LYS B CE    1 
ATOM   4932  N  NZ    . LYS B  1 279 ? 41.694  -25.380 -39.363 1.00 70.79  ? 251 LYS B NZ    1 
ATOM   4933  N  N     . GLY B  1 280 ? 36.411  -26.600 -39.423 1.00 49.60  ? 252 GLY B N     1 
ATOM   4934  C  CA    . GLY B  1 280 ? 36.269  -27.706 -40.353 1.00 42.86  ? 252 GLY B CA    1 
ATOM   4935  C  C     . GLY B  1 280 ? 34.919  -28.395 -40.327 1.00 47.12  ? 252 GLY B C     1 
ATOM   4936  O  O     . GLY B  1 280 ? 34.696  -29.358 -41.069 1.00 48.18  ? 252 GLY B O     1 
ATOM   4937  N  N     . LYS B  1 281 ? 34.013  -27.924 -39.472 1.00 40.01  ? 253 LYS B N     1 
ATOM   4938  C  CA    . LYS B  1 281 ? 32.672  -28.505 -39.393 1.00 40.85  ? 253 LYS B CA    1 
ATOM   4939  C  C     . LYS B  1 281 ? 31.725  -27.833 -40.396 1.00 43.35  ? 253 LYS B C     1 
ATOM   4940  O  O     . LYS B  1 281 ? 31.223  -26.729 -40.150 1.00 42.40  ? 253 LYS B O     1 
ATOM   4941  C  CB    . LYS B  1 281 ? 32.103  -28.381 -37.971 1.00 41.02  ? 253 LYS B CB    1 
ATOM   4942  C  CG    . LYS B  1 281 ? 32.433  -29.513 -37.015 1.00 43.08  ? 253 LYS B CG    1 
ATOM   4943  C  CD    . LYS B  1 281 ? 33.927  -29.695 -36.802 1.00 49.09  ? 253 LYS B CD    1 
ATOM   4944  C  CE    . LYS B  1 281 ? 34.214  -30.536 -35.552 1.00 41.69  ? 253 LYS B CE    1 
ATOM   4945  N  NZ    . LYS B  1 281 ? 33.684  -31.919 -35.664 1.00 52.02  ? 253 LYS B NZ    1 
ATOM   4946  N  N     . ASP B  1 282 ? 31.491  -28.508 -41.520 1.00 40.40  ? 254 ASP B N     1 
ATOM   4947  C  CA    . ASP B  1 282 ? 30.540  -28.060 -42.535 1.00 35.66  ? 254 ASP B CA    1 
ATOM   4948  C  C     . ASP B  1 282 ? 29.757  -29.243 -43.117 1.00 40.46  ? 254 ASP B C     1 
ATOM   4949  O  O     . ASP B  1 282 ? 30.111  -29.775 -44.171 1.00 40.83  ? 254 ASP B O     1 
ATOM   4950  C  CB    . ASP B  1 282 ? 31.265  -27.317 -43.655 1.00 40.43  ? 254 ASP B CB    1 
ATOM   4951  C  CG    . ASP B  1 282 ? 30.309  -26.738 -44.683 1.00 42.55  ? 254 ASP B CG    1 
ATOM   4952  O  OD1   . ASP B  1 282 ? 29.170  -26.401 -44.302 1.00 42.63  ? 254 ASP B OD1   1 
ATOM   4953  O  OD2   . ASP B  1 282 ? 30.689  -26.619 -45.867 1.00 43.60  ? 254 ASP B OD2   1 
ATOM   4954  N  N     . PHE B  1 283 ? 28.690  -29.648 -42.440 1.00 35.63  ? 255 PHE B N     1 
ATOM   4955  C  CA    . PHE B  1 283 ? 27.942  -30.827 -42.848 1.00 38.31  ? 255 PHE B CA    1 
ATOM   4956  C  C     . PHE B  1 283 ? 26.774  -30.494 -43.778 1.00 41.14  ? 255 PHE B C     1 
ATOM   4957  O  O     . PHE B  1 283 ? 26.007  -29.562 -43.532 1.00 37.08  ? 255 PHE B O     1 
ATOM   4958  C  CB    . PHE B  1 283 ? 27.453  -31.587 -41.611 1.00 34.73  ? 255 PHE B CB    1 
ATOM   4959  C  CG    . PHE B  1 283 ? 28.560  -32.265 -40.858 1.00 39.25  ? 255 PHE B CG    1 
ATOM   4960  C  CD1   . PHE B  1 283 ? 28.799  -33.627 -41.019 1.00 37.20  ? 255 PHE B CD1   1 
ATOM   4961  C  CD2   . PHE B  1 283 ? 29.401  -31.538 -40.031 1.00 37.53  ? 255 PHE B CD2   1 
ATOM   4962  C  CE1   . PHE B  1 283 ? 29.834  -34.248 -40.336 1.00 38.81  ? 255 PHE B CE1   1 
ATOM   4963  C  CE2   . PHE B  1 283 ? 30.437  -32.164 -39.344 1.00 40.57  ? 255 PHE B CE2   1 
ATOM   4964  C  CZ    . PHE B  1 283 ? 30.650  -33.518 -39.499 1.00 36.60  ? 255 PHE B CZ    1 
ATOM   4965  N  N     . HIS B  1 284 ? 26.663  -31.261 -44.862 1.00 36.12  ? 256 HIS B N     1 
ATOM   4966  C  CA    . HIS B  1 284 ? 25.579  -31.092 -45.823 1.00 37.66  ? 256 HIS B CA    1 
ATOM   4967  C  C     . HIS B  1 284 ? 24.820  -32.406 -45.961 1.00 43.65  ? 256 HIS B C     1 
ATOM   4968  O  O     . HIS B  1 284 ? 24.879  -33.071 -47.001 1.00 38.36  ? 256 HIS B O     1 
ATOM   4969  C  CB    . HIS B  1 284 ? 26.123  -30.623 -47.175 1.00 39.56  ? 256 HIS B CB    1 
ATOM   4970  C  CG    . HIS B  1 284 ? 26.718  -29.246 -47.140 1.00 44.90  ? 256 HIS B CG    1 
ATOM   4971  N  ND1   . HIS B  1 284 ? 26.046  -28.130 -47.594 1.00 41.92  ? 256 HIS B ND1   1 
ATOM   4972  C  CD2   . HIS B  1 284 ? 27.921  -28.804 -46.700 1.00 42.59  ? 256 HIS B CD2   1 
ATOM   4973  C  CE1   . HIS B  1 284 ? 26.811  -27.063 -47.444 1.00 41.62  ? 256 HIS B CE1   1 
ATOM   4974  N  NE2   . HIS B  1 284 ? 27.952  -27.445 -46.900 1.00 41.65  ? 256 HIS B NE2   1 
ATOM   4975  N  N     . LEU B  1 285 ? 24.111  -32.777 -44.899 1.00 36.89  ? 257 LEU B N     1 
ATOM   4976  C  CA    . LEU B  1 285 ? 23.465  -34.081 -44.822 1.00 38.01  ? 257 LEU B CA    1 
ATOM   4977  C  C     . LEU B  1 285 ? 21.960  -34.052 -45.111 1.00 37.60  ? 257 LEU B C     1 
ATOM   4978  O  O     . LEU B  1 285 ? 21.328  -35.119 -45.190 1.00 32.65  ? 257 LEU B O     1 
ATOM   4979  C  CB    . LEU B  1 285 ? 23.701  -34.690 -43.438 1.00 32.97  ? 257 LEU B CB    1 
ATOM   4980  C  CG    . LEU B  1 285 ? 25.155  -34.867 -43.004 1.00 36.75  ? 257 LEU B CG    1 
ATOM   4981  C  CD1   . LEU B  1 285 ? 25.227  -35.212 -41.520 1.00 36.23  ? 257 LEU B CD1   1 
ATOM   4982  C  CD2   . LEU B  1 285 ? 25.837  -35.939 -43.830 1.00 36.42  ? 257 LEU B CD2   1 
ATOM   4983  N  N     . HIS B  1 286 ? 21.402  -32.845 -45.265 1.00 31.22  ? 258 HIS B N     1 
ATOM   4984  C  CA    . HIS B  1 286 ? 19.957  -32.642 -45.428 1.00 29.31  ? 258 HIS B CA    1 
ATOM   4985  C  C     . HIS B  1 286 ? 19.716  -31.609 -46.537 1.00 33.16  ? 258 HIS B C     1 
ATOM   4986  O  O     . HIS B  1 286 ? 19.872  -30.401 -46.308 1.00 37.82  ? 258 HIS B O     1 
ATOM   4987  C  CB    . HIS B  1 286 ? 19.316  -32.193 -44.093 1.00 31.51  ? 258 HIS B CB    1 
ATOM   4988  C  CG    . HIS B  1 286 ? 19.805  -32.970 -42.902 1.00 32.69  ? 258 HIS B CG    1 
ATOM   4989  N  ND1   . HIS B  1 286 ? 19.363  -34.244 -42.607 1.00 34.04  ? 258 HIS B ND1   1 
ATOM   4990  C  CD2   . HIS B  1 286 ? 20.743  -32.676 -41.969 1.00 31.61  ? 258 HIS B CD2   1 
ATOM   4991  C  CE1   . HIS B  1 286 ? 19.989  -34.691 -41.532 1.00 32.37  ? 258 HIS B CE1   1 
ATOM   4992  N  NE2   . HIS B  1 286 ? 20.834  -33.759 -41.125 1.00 33.82  ? 258 HIS B NE2   1 
ATOM   4993  N  N     . PRO B  1 287 ? 19.352  -32.079 -47.746 1.00 31.12  ? 259 PRO B N     1 
ATOM   4994  C  CA    . PRO B  1 287 ? 19.234  -31.224 -48.944 1.00 33.32  ? 259 PRO B CA    1 
ATOM   4995  C  C     . PRO B  1 287 ? 18.346  -29.983 -48.780 1.00 31.21  ? 259 PRO B C     1 
ATOM   4996  O  O     . PRO B  1 287 ? 18.646  -28.944 -49.360 1.00 33.09  ? 259 PRO B O     1 
ATOM   4997  C  CB    . PRO B  1 287 ? 18.623  -32.175 -49.986 1.00 27.87  ? 259 PRO B CB    1 
ATOM   4998  C  CG    . PRO B  1 287 ? 19.090  -33.537 -49.565 1.00 31.75  ? 259 PRO B CG    1 
ATOM   4999  C  CD    . PRO B  1 287 ? 19.125  -33.510 -48.061 1.00 32.47  ? 259 PRO B CD    1 
ATOM   5000  N  N     . GLU B  1 288 ? 17.261  -30.102 -48.017 1.00 32.84  ? 260 GLU B N     1 
ATOM   5001  C  CA    . GLU B  1 288 ? 16.314  -29.001 -47.827 1.00 34.45  ? 260 GLU B CA    1 
ATOM   5002  C  C     . GLU B  1 288 ? 16.906  -27.889 -46.958 1.00 29.88  ? 260 GLU B C     1 
ATOM   5003  O  O     . GLU B  1 288 ? 16.389  -26.775 -46.956 1.00 31.76  ? 260 GLU B O     1 
ATOM   5004  C  CB    . GLU B  1 288 ? 14.991  -29.511 -47.218 1.00 33.49  ? 260 GLU B CB    1 
ATOM   5005  C  CG    . GLU B  1 288 ? 15.014  -29.798 -45.714 1.00 33.16  ? 260 GLU B CG    1 
ATOM   5006  C  CD    . GLU B  1 288 ? 15.397  -31.228 -45.384 1.00 36.65  ? 260 GLU B CD    1 
ATOM   5007  O  OE1   . GLU B  1 288 ? 16.455  -31.684 -45.851 1.00 35.08  ? 260 GLU B OE1   1 
ATOM   5008  O  OE2   . GLU B  1 288 ? 14.632  -31.900 -44.659 1.00 34.17  ? 260 GLU B OE2   1 
ATOM   5009  N  N     . MET B  1 289 ? 18.001  -28.189 -46.254 1.00 31.95  ? 261 MET B N     1 
ATOM   5010  C  CA    . MET B  1 289 ? 18.710  -27.194 -45.438 1.00 33.00  ? 261 MET B CA    1 
ATOM   5011  C  C     . MET B  1 289 ? 19.693  -26.346 -46.235 1.00 33.99  ? 261 MET B C     1 
ATOM   5012  O  O     . MET B  1 289 ? 20.310  -25.428 -45.685 1.00 31.80  ? 261 MET B O     1 
ATOM   5013  C  CB    . MET B  1 289 ? 19.485  -27.862 -44.298 1.00 26.77  ? 261 MET B CB    1 
ATOM   5014  C  CG    . MET B  1 289 ? 18.627  -28.546 -43.273 1.00 30.96  ? 261 MET B CG    1 
ATOM   5015  S  SD    . MET B  1 289 ? 19.622  -29.142 -41.904 1.00 33.59  ? 261 MET B SD    1 
ATOM   5016  C  CE    . MET B  1 289 ? 18.362  -29.935 -40.906 1.00 27.70  ? 261 MET B CE    1 
ATOM   5017  N  N     . GLU B  1 290 ? 19.876  -26.661 -47.510 1.00 31.80  ? 262 GLU B N     1 
ATOM   5018  C  CA    . GLU B  1 290 ? 20.841  -25.911 -48.307 1.00 36.57  ? 262 GLU B CA    1 
ATOM   5019  C  C     . GLU B  1 290 ? 20.355  -24.480 -48.522 1.00 32.86  ? 262 GLU B C     1 
ATOM   5020  O  O     . GLU B  1 290 ? 19.214  -24.262 -48.931 1.00 32.72  ? 262 GLU B O     1 
ATOM   5021  C  CB    . GLU B  1 290 ? 21.097  -26.587 -49.660 1.00 34.55  ? 262 GLU B CB    1 
ATOM   5022  C  CG    . GLU B  1 290 ? 21.914  -27.874 -49.598 1.00 37.15  ? 262 GLU B CG    1 
ATOM   5023  C  CD    . GLU B  1 290 ? 23.330  -27.653 -49.117 1.00 38.82  ? 262 GLU B CD    1 
ATOM   5024  O  OE1   . GLU B  1 290 ? 24.009  -26.749 -49.644 1.00 53.22  ? 262 GLU B OE1   1 
ATOM   5025  O  OE2   . GLU B  1 290 ? 23.766  -28.383 -48.202 1.00 46.91  ? 262 GLU B OE2   1 
ATOM   5026  N  N     . PRO B  1 291 ? 21.224  -23.499 -48.246 1.00 31.43  ? 263 PRO B N     1 
ATOM   5027  C  CA    . PRO B  1 291 ? 20.854  -22.102 -48.473 1.00 33.72  ? 263 PRO B CA    1 
ATOM   5028  C  C     . PRO B  1 291 ? 20.643  -21.800 -49.933 1.00 39.68  ? 263 PRO B C     1 
ATOM   5029  O  O     . PRO B  1 291 ? 21.366  -22.312 -50.787 1.00 37.27  ? 263 PRO B O     1 
ATOM   5030  C  CB    . PRO B  1 291 ? 22.058  -21.310 -47.956 1.00 32.55  ? 263 PRO B CB    1 
ATOM   5031  C  CG    . PRO B  1 291 ? 23.183  -22.252 -47.979 1.00 35.46  ? 263 PRO B CG    1 
ATOM   5032  C  CD    . PRO B  1 291 ? 22.607  -23.642 -47.763 1.00 35.34  ? 263 PRO B CD    1 
ATOM   5033  N  N     . ASP B  1 292 ? 19.641  -20.984 -50.210 1.00 36.02  ? 264 ASP B N     1 
ATOM   5034  C  CA    . ASP B  1 292 ? 19.545  -20.322 -51.485 1.00 39.39  ? 264 ASP B CA    1 
ATOM   5035  C  C     . ASP B  1 292 ? 20.228  -18.958 -51.297 1.00 37.77  ? 264 ASP B C     1 
ATOM   5036  O  O     . ASP B  1 292 ? 19.672  -18.066 -50.672 1.00 37.84  ? 264 ASP B O     1 
ATOM   5037  C  CB    . ASP B  1 292 ? 18.083  -20.193 -51.920 1.00 39.53  ? 264 ASP B CB    1 
ATOM   5038  C  CG    . ASP B  1 292 ? 17.911  -19.380 -53.192 1.00 39.69  ? 264 ASP B CG    1 
ATOM   5039  O  OD1   . ASP B  1 292 ? 18.881  -18.750 -53.669 1.00 40.88  ? 264 ASP B OD1   1 
ATOM   5040  O  OD2   . ASP B  1 292 ? 16.784  -19.364 -53.713 1.00 43.86  ? 264 ASP B OD2   1 
ATOM   5041  N  N     . PRO B  1 293 ? 21.438  -18.805 -51.854 1.00 42.07  ? 265 PRO B N     1 
ATOM   5042  C  CA    . PRO B  1 293 ? 22.314  -17.638 -51.690 1.00 39.96  ? 265 PRO B CA    1 
ATOM   5043  C  C     . PRO B  1 293 ? 21.623  -16.298 -51.934 1.00 39.46  ? 265 PRO B C     1 
ATOM   5044  O  O     . PRO B  1 293 ? 22.011  -15.300 -51.330 1.00 40.96  ? 265 PRO B O     1 
ATOM   5045  C  CB    . PRO B  1 293 ? 23.408  -17.872 -52.736 1.00 43.36  ? 265 PRO B CB    1 
ATOM   5046  C  CG    . PRO B  1 293 ? 23.435  -19.343 -52.927 1.00 46.48  ? 265 PRO B CG    1 
ATOM   5047  C  CD    . PRO B  1 293 ? 22.009  -19.791 -52.794 1.00 44.38  ? 265 PRO B CD    1 
ATOM   5048  N  N     . GLU B  1 294 ? 20.613  -16.264 -52.792 1.00 37.41  ? 266 GLU B N     1 
ATOM   5049  C  CA    . GLU B  1 294 ? 19.977  -14.991 -53.124 1.00 43.78  ? 266 GLU B CA    1 
ATOM   5050  C  C     . GLU B  1 294 ? 19.023  -14.542 -52.027 1.00 40.11  ? 266 GLU B C     1 
ATOM   5051  O  O     . GLU B  1 294 ? 18.681  -13.370 -51.948 1.00 36.92  ? 266 GLU B O     1 
ATOM   5052  C  CB    . GLU B  1 294 ? 19.232  -15.077 -54.459 1.00 45.26  ? 266 GLU B CB    1 
ATOM   5053  C  CG    . GLU B  1 294 ? 20.135  -15.314 -55.679 1.00 52.75  ? 266 GLU B CG    1 
ATOM   5054  C  CD    . GLU B  1 294 ? 21.166  -14.205 -55.898 1.00 54.39  ? 266 GLU B CD    1 
ATOM   5055  O  OE1   . GLU B  1 294 ? 20.821  -13.009 -55.731 1.00 52.03  ? 266 GLU B OE1   1 
ATOM   5056  O  OE2   . GLU B  1 294 ? 22.325  -14.544 -56.230 1.00 53.02  ? 266 GLU B OE2   1 
ATOM   5057  N  N     . ILE B  1 295 ? 18.576  -15.467 -51.183 1.00 42.05  ? 267 ILE B N     1 
ATOM   5058  C  CA    . ILE B  1 295 ? 17.736  -15.039 -50.062 1.00 45.00  ? 267 ILE B CA    1 
ATOM   5059  C  C     . ILE B  1 295 ? 18.490  -15.169 -48.742 1.00 35.25  ? 267 ILE B C     1 
ATOM   5060  O  O     . ILE B  1 295 ? 18.166  -14.487 -47.775 1.00 36.14  ? 267 ILE B O     1 
ATOM   5061  C  CB    . ILE B  1 295 ? 16.394  -15.825 -49.990 1.00 40.56  ? 267 ILE B CB    1 
ATOM   5062  C  CG1   . ILE B  1 295 ? 16.582  -17.166 -49.304 1.00 37.97  ? 267 ILE B CG1   1 
ATOM   5063  C  CG2   . ILE B  1 295 ? 15.787  -15.988 -51.381 1.00 48.47  ? 267 ILE B CG2   1 
ATOM   5064  C  CD1   . ILE B  1 295 ? 15.309  -17.931 -49.169 1.00 47.24  ? 267 ILE B CD1   1 
ATOM   5065  N  N     . ALA B  1 296 ? 19.500  -16.032 -48.698 1.00 33.50  ? 268 ALA B N     1 
ATOM   5066  C  CA    . ALA B  1 296 ? 20.301  -16.170 -47.485 1.00 35.33  ? 268 ALA B CA    1 
ATOM   5067  C  C     . ALA B  1 296 ? 21.316  -15.036 -47.403 1.00 35.22  ? 268 ALA B C     1 
ATOM   5068  O  O     . ALA B  1 296 ? 21.725  -14.613 -46.318 1.00 33.09  ? 268 ALA B O     1 
ATOM   5069  C  CB    . ALA B  1 296 ? 20.998  -17.538 -47.443 1.00 31.34  ? 268 ALA B CB    1 
ATOM   5070  N  N     . LYS B  1 297 ? 21.725  -14.537 -48.565 1.00 35.59  ? 269 LYS B N     1 
ATOM   5071  C  CA    . LYS B  1 297 ? 22.619  -13.384 -48.614 1.00 33.06  ? 269 LYS B CA    1 
ATOM   5072  C  C     . LYS B  1 297 ? 22.045  -12.370 -49.619 1.00 33.72  ? 269 LYS B C     1 
ATOM   5073  O  O     . LYS B  1 297 ? 22.621  -12.116 -50.679 1.00 30.48  ? 269 LYS B O     1 
ATOM   5074  C  CB    . LYS B  1 297 ? 24.041  -13.832 -48.975 1.00 31.20  ? 269 LYS B CB    1 
ATOM   5075  C  CG    . LYS B  1 297 ? 25.100  -12.742 -48.799 1.00 35.93  ? 269 LYS B CG    1 
ATOM   5076  C  CD    . LYS B  1 297 ? 26.500  -13.256 -49.089 1.00 37.49  ? 269 LYS B CD    1 
ATOM   5077  C  CE    . LYS B  1 297 ? 27.511  -12.109 -49.170 1.00 46.02  ? 269 LYS B CE    1 
ATOM   5078  N  NZ    . LYS B  1 297 ? 28.921  -12.586 -49.369 1.00 54.69  ? 269 LYS B NZ    1 
ATOM   5079  N  N     . PRO B  1 298 ? 20.871  -11.813 -49.293 1.00 32.92  ? 270 PRO B N     1 
ATOM   5080  C  CA    . PRO B  1 298 ? 20.114  -11.039 -50.275 1.00 29.01  ? 270 PRO B CA    1 
ATOM   5081  C  C     . PRO B  1 298 ? 20.653  -9.620  -50.493 1.00 33.89  ? 270 PRO B C     1 
ATOM   5082  O  O     . PRO B  1 298 ? 21.270  -9.058  -49.585 1.00 28.60  ? 270 PRO B O     1 
ATOM   5083  C  CB    . PRO B  1 298 ? 18.709  -10.998 -49.669 1.00 30.51  ? 270 PRO B CB    1 
ATOM   5084  C  CG    . PRO B  1 298 ? 18.942  -11.054 -48.191 1.00 32.44  ? 270 PRO B CG    1 
ATOM   5085  C  CD    . PRO B  1 298 ? 20.173  -11.910 -47.993 1.00 31.74  ? 270 PRO B CD    1 
ATOM   5086  N  N     . LEU B  1 299 ? 20.427  -9.080  -51.697 1.00 29.84  ? 271 LEU B N     1 
ATOM   5087  C  CA    . LEU B  1 299 ? 20.730  -7.685  -52.022 1.00 29.73  ? 271 LEU B CA    1 
ATOM   5088  C  C     . LEU B  1 299 ? 19.915  -6.782  -51.117 1.00 29.74  ? 271 LEU B C     1 
ATOM   5089  O  O     . LEU B  1 299 ? 18.723  -7.026  -50.906 1.00 30.89  ? 271 LEU B O     1 
ATOM   5090  C  CB    . LEU B  1 299 ? 20.427  -7.387  -53.497 1.00 32.81  ? 271 LEU B CB    1 
ATOM   5091  C  CG    . LEU B  1 299 ? 21.324  -8.089  -54.525 1.00 31.49  ? 271 LEU B CG    1 
ATOM   5092  C  CD1   . LEU B  1 299 ? 20.778  -7.894  -55.929 1.00 35.88  ? 271 LEU B CD1   1 
ATOM   5093  C  CD2   . LEU B  1 299 ? 22.745  -7.542  -54.415 1.00 34.94  ? 271 LEU B CD2   1 
ATOM   5094  N  N     . LEU B  1 300 ? 20.549  -5.745  -50.581 1.00 28.67  ? 272 LEU B N     1 
ATOM   5095  C  CA    . LEU B  1 300 ? 19.893  -4.881  -49.605 1.00 29.05  ? 272 LEU B CA    1 
ATOM   5096  C  C     . LEU B  1 300 ? 18.807  -3.991  -50.212 1.00 31.06  ? 272 LEU B C     1 
ATOM   5097  O  O     . LEU B  1 300 ? 17.658  -3.997  -49.749 1.00 27.32  ? 272 LEU B O     1 
ATOM   5098  C  CB    . LEU B  1 300 ? 20.937  -4.017  -48.880 1.00 28.20  ? 272 LEU B CB    1 
ATOM   5099  C  CG    . LEU B  1 300 ? 21.866  -4.778  -47.926 1.00 28.31  ? 272 LEU B CG    1 
ATOM   5100  C  CD1   . LEU B  1 300 ? 22.985  -3.894  -47.377 1.00 28.74  ? 272 LEU B CD1   1 
ATOM   5101  C  CD2   . LEU B  1 300 ? 21.063  -5.441  -46.766 1.00 24.36  ? 272 LEU B CD2   1 
ATOM   5102  N  N     . LYS B  1 301 ? 19.159  -3.216  -51.236 1.00 31.68  ? 273 LYS B N     1 
ATOM   5103  C  CA    . LYS B  1 301 ? 18.218  -2.220  -51.779 1.00 30.54  ? 273 LYS B CA    1 
ATOM   5104  C  C     . LYS B  1 301 ? 16.860  -2.782  -52.261 1.00 32.08  ? 273 LYS B C     1 
ATOM   5105  O  O     . LYS B  1 301 ? 15.837  -2.133  -52.062 1.00 32.53  ? 273 LYS B O     1 
ATOM   5106  C  CB    . LYS B  1 301 ? 18.883  -1.424  -52.914 1.00 30.77  ? 273 LYS B CB    1 
ATOM   5107  C  CG    . LYS B  1 301 ? 20.060  -0.570  -52.434 1.00 30.65  ? 273 LYS B CG    1 
ATOM   5108  C  CD    . LYS B  1 301 ? 20.526  0.441   -53.462 1.00 42.43  ? 273 LYS B CD    1 
ATOM   5109  C  CE    . LYS B  1 301 ? 21.327  -0.198  -54.570 1.00 45.86  ? 273 LYS B CE    1 
ATOM   5110  N  NZ    . LYS B  1 301 ? 21.952  0.879   -55.402 1.00 48.72  ? 273 LYS B NZ    1 
ATOM   5111  N  N     . PRO B  1 302 ? 16.830  -3.985  -52.876 1.00 30.91  ? 274 PRO B N     1 
ATOM   5112  C  CA    . PRO B  1 302 ? 15.496  -4.466  -53.253 1.00 30.32  ? 274 PRO B CA    1 
ATOM   5113  C  C     . PRO B  1 302 ? 14.630  -4.867  -52.061 1.00 34.05  ? 274 PRO B C     1 
ATOM   5114  O  O     . PRO B  1 302 ? 13.405  -4.875  -52.191 1.00 33.66  ? 274 PRO B O     1 
ATOM   5115  C  CB    . PRO B  1 302 ? 15.799  -5.681  -54.142 1.00 34.10  ? 274 PRO B CB    1 
ATOM   5116  C  CG    . PRO B  1 302 ? 17.197  -5.444  -54.636 1.00 30.02  ? 274 PRO B CG    1 
ATOM   5117  C  CD    . PRO B  1 302 ? 17.887  -4.827  -53.461 1.00 29.98  ? 274 PRO B CD    1 
ATOM   5118  N  N     . LEU B  1 303 ? 15.252  -5.177  -50.925 1.00 31.82  ? 275 LEU B N     1 
ATOM   5119  C  CA    . LEU B  1 303 ? 14.520  -5.442  -49.686 1.00 32.33  ? 275 LEU B CA    1 
ATOM   5120  C  C     . LEU B  1 303 ? 13.800  -4.209  -49.147 1.00 37.03  ? 275 LEU B C     1 
ATOM   5121  O  O     . LEU B  1 303 ? 12.791  -4.348  -48.461 1.00 37.24  ? 275 LEU B O     1 
ATOM   5122  C  CB    . LEU B  1 303 ? 15.454  -5.961  -48.591 1.00 30.62  ? 275 LEU B CB    1 
ATOM   5123  C  CG    . LEU B  1 303 ? 16.016  -7.363  -48.662 1.00 36.37  ? 275 LEU B CG    1 
ATOM   5124  C  CD1   . LEU B  1 303 ? 16.938  -7.543  -47.470 1.00 31.45  ? 275 LEU B CD1   1 
ATOM   5125  C  CD2   . LEU B  1 303 ? 14.886  -8.398  -48.655 1.00 30.89  ? 275 LEU B CD2   1 
ATOM   5126  N  N     . LEU B  1 304 ? 14.316  -3.009  -49.427 1.00 30.09  ? 276 LEU B N     1 
ATOM   5127  C  CA    . LEU B  1 304 ? 13.640  -1.802  -48.955 1.00 33.85  ? 276 LEU B CA    1 
ATOM   5128  C  C     . LEU B  1 304 ? 12.277  -1.631  -49.615 1.00 33.80  ? 276 LEU B C     1 
ATOM   5129  O  O     . LEU B  1 304 ? 11.449  -0.888  -49.118 1.00 29.73  ? 276 LEU B O     1 
ATOM   5130  C  CB    . LEU B  1 304 ? 14.467  -0.543  -49.220 1.00 37.63  ? 276 LEU B CB    1 
ATOM   5131  C  CG    . LEU B  1 304 ? 15.911  -0.515  -48.726 1.00 41.82  ? 276 LEU B CG    1 
ATOM   5132  C  CD1   . LEU B  1 304 ? 16.565  0.817   -49.100 1.00 40.70  ? 276 LEU B CD1   1 
ATOM   5133  C  CD2   . LEU B  1 304 ? 15.957  -0.734  -47.245 1.00 32.50  ? 276 LEU B CD2   1 
ATOM   5134  N  N     . ALA B  1 305 ? 12.059  -2.311  -50.741 1.00 33.80  ? 277 ALA B N     1 
ATOM   5135  C  CA    . ALA B  1 305 ? 10.835  -2.130  -51.516 1.00 38.20  ? 277 ALA B CA    1 
ATOM   5136  C  C     . ALA B  1 305 ? 10.007  -3.417  -51.707 1.00 43.23  ? 277 ALA B C     1 
ATOM   5137  O  O     . ALA B  1 305 ? 9.058   -3.423  -52.489 1.00 43.92  ? 277 ALA B O     1 
ATOM   5138  C  CB    . ALA B  1 305 ? 11.187  -1.538  -52.884 1.00 40.21  ? 277 ALA B CB    1 
ATOM   5139  N  N     . ILE B  1 306 ? 10.353  -4.495  -51.001 1.00 35.98  ? 278 ILE B N     1 
ATOM   5140  C  CA    . ILE B  1 306 ? 9.756   -5.799  -51.293 1.00 41.92  ? 278 ILE B CA    1 
ATOM   5141  C  C     . ILE B  1 306 ? 8.290   -5.827  -50.865 1.00 43.87  ? 278 ILE B C     1 
ATOM   5142  O  O     . ILE B  1 306 ? 7.929   -5.322  -49.800 1.00 46.01  ? 278 ILE B O     1 
ATOM   5143  C  CB    . ILE B  1 306 ? 10.538  -6.957  -50.607 1.00 40.18  ? 278 ILE B CB    1 
ATOM   5144  C  CG1   . ILE B  1 306 ? 10.133  -8.316  -51.194 1.00 44.26  ? 278 ILE B CG1   1 
ATOM   5145  C  CG2   . ILE B  1 306 ? 10.348  -6.922  -49.090 1.00 36.72  ? 278 ILE B CG2   1 
ATOM   5146  C  CD1   . ILE B  1 306 ? 10.964  -9.485  -50.704 1.00 40.01  ? 278 ILE B CD1   1 
ATOM   5147  N  N     . SER B  1 307 ? 7.438   -6.397  -51.707 1.00 46.25  ? 279 SER B N     1 
ATOM   5148  C  CA    . SER B  1 307 ? 6.025   -6.490  -51.364 1.00 51.78  ? 279 SER B CA    1 
ATOM   5149  C  C     . SER B  1 307 ? 5.801   -7.583  -50.333 1.00 49.85  ? 279 SER B C     1 
ATOM   5150  O  O     . SER B  1 307 ? 6.645   -8.462  -50.144 1.00 47.88  ? 279 SER B O     1 
ATOM   5151  C  CB    . SER B  1 307 ? 5.177   -6.753  -52.607 1.00 50.05  ? 279 SER B CB    1 
ATOM   5152  O  OG    . SER B  1 307 ? 5.652   -7.878  -53.307 1.00 54.24  ? 279 SER B OG    1 
ATOM   5153  N  N     . ASN B  1 308 ? 4.667   -7.524  -49.656 1.00 46.61  ? 280 ASN B N     1 
ATOM   5154  C  CA    . ASN B  1 308 ? 4.321   -8.585  -48.725 1.00 50.45  ? 280 ASN B CA    1 
ATOM   5155  C  C     . ASN B  1 308 ? 4.184   -9.933  -49.423 1.00 51.75  ? 280 ASN B C     1 
ATOM   5156  O  O     . ASN B  1 308 ? 4.594   -10.972 -48.891 1.00 48.18  ? 280 ASN B O     1 
ATOM   5157  C  CB    . ASN B  1 308 ? 3.037   -8.230  -47.991 1.00 58.71  ? 280 ASN B CB    1 
ATOM   5158  C  CG    . ASN B  1 308 ? 3.229   -7.088  -47.029 1.00 53.64  ? 280 ASN B CG    1 
ATOM   5159  O  OD1   . ASN B  1 308 ? 3.743   -7.282  -45.931 1.00 58.17  ? 280 ASN B OD1   1 
ATOM   5160  N  ND2   . ASN B  1 308 ? 2.831   -5.889  -47.433 1.00 58.23  ? 280 ASN B ND2   1 
ATOM   5161  N  N     . ARG B  1 309 ? 3.627   -9.909  -50.629 1.00 53.79  ? 281 ARG B N     1 
ATOM   5162  C  CA    . ARG B  1 309 ? 3.480   -11.127 -51.414 1.00 53.27  ? 281 ARG B CA    1 
ATOM   5163  C  C     . ARG B  1 309 ? 4.850   -11.704 -51.752 1.00 49.01  ? 281 ARG B C     1 
ATOM   5164  O  O     . ARG B  1 309 ? 5.102   -12.893 -51.569 1.00 44.26  ? 281 ARG B O     1 
ATOM   5165  C  CB    . ARG B  1 309 ? 2.692   -10.853 -52.699 1.00 57.12  ? 281 ARG B CB    1 
ATOM   5166  C  CG    . ARG B  1 309 ? 2.390   -12.105 -53.512 1.00 60.56  ? 281 ARG B CG    1 
ATOM   5167  C  CD    . ARG B  1 309 ? 2.028   -11.771 -54.947 1.00 65.74  ? 281 ARG B CD    1 
ATOM   5168  N  NE    . ARG B  1 309 ? 3.089   -11.001 -55.591 1.00 73.41  ? 281 ARG B NE    1 
ATOM   5169  C  CZ    . ARG B  1 309 ? 4.199   -11.534 -56.096 1.00 68.90  ? 281 ARG B CZ    1 
ATOM   5170  N  NH1   . ARG B  1 309 ? 4.395   -12.845 -56.029 1.00 73.18  ? 281 ARG B NH1   1 
ATOM   5171  N  NH2   . ARG B  1 309 ? 5.115   -10.760 -56.666 1.00 72.26  ? 281 ARG B NH2   1 
ATOM   5172  N  N     . GLU B  1 310 ? 5.738   -10.848 -52.238 1.00 53.13  ? 282 GLU B N     1 
ATOM   5173  C  CA    . GLU B  1 310 ? 7.060   -11.283 -52.659 1.00 51.00  ? 282 GLU B CA    1 
ATOM   5174  C  C     . GLU B  1 310 ? 7.879   -11.758 -51.463 1.00 43.40  ? 282 GLU B C     1 
ATOM   5175  O  O     . GLU B  1 310 ? 8.616   -12.748 -51.553 1.00 40.11  ? 282 GLU B O     1 
ATOM   5176  C  CB    . GLU B  1 310 ? 7.781   -10.153 -53.386 1.00 49.32  ? 282 GLU B CB    1 
ATOM   5177  C  CG    . GLU B  1 310 ? 8.766   -10.622 -54.434 1.00 60.19  ? 282 GLU B CG    1 
ATOM   5178  C  CD    . GLU B  1 310 ? 9.289   -9.479  -55.278 1.00 72.95  ? 282 GLU B CD    1 
ATOM   5179  O  OE1   . GLU B  1 310 ? 8.814   -8.328  -55.091 1.00 72.79  ? 282 GLU B OE1   1 
ATOM   5180  O  OE2   . GLU B  1 310 ? 10.173  -9.731  -56.127 1.00 74.52  ? 282 GLU B OE2   1 
ATOM   5181  N  N     . PHE B  1 311 ? 7.730   -11.060 -50.343 1.00 39.30  ? 283 PHE B N     1 
ATOM   5182  C  CA    . PHE B  1 311 ? 8.425   -11.447 -49.131 1.00 39.85  ? 283 PHE B CA    1 
ATOM   5183  C  C     . PHE B  1 311 ? 7.987   -12.849 -48.685 1.00 37.53  ? 283 PHE B C     1 
ATOM   5184  O  O     . PHE B  1 311 ? 8.832   -13.691 -48.366 1.00 32.28  ? 283 PHE B O     1 
ATOM   5185  C  CB    . PHE B  1 311 ? 8.215   -10.431 -47.999 1.00 35.90  ? 283 PHE B CB    1 
ATOM   5186  C  CG    . PHE B  1 311 ? 8.962   -10.796 -46.743 1.00 38.37  ? 283 PHE B CG    1 
ATOM   5187  C  CD1   . PHE B  1 311 ? 8.329   -11.478 -45.715 1.00 33.99  ? 283 PHE B CD1   1 
ATOM   5188  C  CD2   . PHE B  1 311 ? 10.320  -10.528 -46.625 1.00 32.91  ? 283 PHE B CD2   1 
ATOM   5189  C  CE1   . PHE B  1 311 ? 9.022   -11.846 -44.572 1.00 35.72  ? 283 PHE B CE1   1 
ATOM   5190  C  CE2   . PHE B  1 311 ? 11.022  -10.902 -45.495 1.00 34.13  ? 283 PHE B CE2   1 
ATOM   5191  C  CZ    . PHE B  1 311 ? 10.375  -11.566 -44.465 1.00 35.08  ? 283 PHE B CZ    1 
ATOM   5192  N  N     . LYS B  1 312 ? 6.682   -13.110 -48.681 1.00 36.39  ? 284 LYS B N     1 
ATOM   5193  C  CA    . LYS B  1 312 ? 6.193   -14.424 -48.264 1.00 40.05  ? 284 LYS B CA    1 
ATOM   5194  C  C     . LYS B  1 312 ? 6.686   -15.516 -49.219 1.00 38.54  ? 284 LYS B C     1 
ATOM   5195  O  O     . LYS B  1 312 ? 7.103   -16.587 -48.792 1.00 39.28  ? 284 LYS B O     1 
ATOM   5196  C  CB    . LYS B  1 312 ? 4.668   -14.429 -48.183 1.00 48.90  ? 284 LYS B CB    1 
ATOM   5197  C  CG    . LYS B  1 312 ? 4.121   -13.596 -47.035 1.00 55.18  ? 284 LYS B CG    1 
ATOM   5198  C  CD    . LYS B  1 312 ? 2.606   -13.421 -47.123 1.00 65.21  ? 284 LYS B CD    1 
ATOM   5199  C  CE    . LYS B  1 312 ? 2.100   -12.432 -46.072 1.00 72.90  ? 284 LYS B CE    1 
ATOM   5200  N  NZ    . LYS B  1 312 ? 0.635   -12.187 -46.181 1.00 77.81  ? 284 LYS B NZ    1 
ATOM   5201  N  N     . GLU B  1 313 ? 6.688   -15.197 -50.508 1.00 39.90  ? 285 GLU B N     1 
ATOM   5202  C  CA    . GLU B  1 313 ? 7.104   -16.105 -51.573 1.00 42.66  ? 285 GLU B CA    1 
ATOM   5203  C  C     . GLU B  1 313 ? 8.575   -16.484 -51.492 1.00 39.44  ? 285 GLU B C     1 
ATOM   5204  O  O     . GLU B  1 313 ? 8.946   -17.642 -51.700 1.00 40.77  ? 285 GLU B O     1 
ATOM   5205  C  CB    . GLU B  1 313 ? 6.818   -15.455 -52.927 1.00 47.32  ? 285 GLU B CB    1 
ATOM   5206  C  CG    . GLU B  1 313 ? 6.547   -16.407 -54.060 1.00 55.44  ? 285 GLU B CG    1 
ATOM   5207  C  CD    . GLU B  1 313 ? 5.978   -15.679 -55.275 1.00 74.78  ? 285 GLU B CD    1 
ATOM   5208  O  OE1   . GLU B  1 313 ? 5.407   -16.355 -56.163 1.00 87.49  ? 285 GLU B OE1   1 
ATOM   5209  O  OE2   . GLU B  1 313 ? 6.097   -14.430 -55.339 1.00 65.11  ? 285 GLU B OE2   1 
ATOM   5210  N  N     . LYS B  1 314 ? 9.422   -15.510 -51.189 1.00 36.62  ? 286 LYS B N     1 
ATOM   5211  C  CA    . LYS B  1 314 ? 10.859  -15.758 -51.193 1.00 40.82  ? 286 LYS B CA    1 
ATOM   5212  C  C     . LYS B  1 314 ? 11.415  -16.177 -49.835 1.00 39.20  ? 286 LYS B C     1 
ATOM   5213  O  O     . LYS B  1 314 ? 12.276  -17.053 -49.763 1.00 36.50  ? 286 LYS B O     1 
ATOM   5214  C  CB    . LYS B  1 314 ? 11.601  -14.519 -51.691 1.00 46.31  ? 286 LYS B CB    1 
ATOM   5215  C  CG    . LYS B  1 314 ? 11.535  -14.369 -53.208 1.00 49.14  ? 286 LYS B CG    1 
ATOM   5216  C  CD    . LYS B  1 314 ? 12.089  -13.036 -53.669 1.00 54.20  ? 286 LYS B CD    1 
ATOM   5217  C  CE    . LYS B  1 314 ? 11.846  -12.852 -55.168 1.00 65.08  ? 286 LYS B CE    1 
ATOM   5218  N  NZ    . LYS B  1 314 ? 12.167  -11.476 -55.631 1.00 65.06  ? 286 LYS B NZ    1 
ATOM   5219  N  N     . PHE B  1 315 ? 10.914  -15.556 -48.772 1.00 34.40  ? 287 PHE B N     1 
ATOM   5220  C  CA    . PHE B  1 315 ? 11.494  -15.691 -47.437 1.00 33.69  ? 287 PHE B CA    1 
ATOM   5221  C  C     . PHE B  1 315 ? 10.627  -16.509 -46.491 1.00 30.88  ? 287 PHE B C     1 
ATOM   5222  O  O     . PHE B  1 315 ? 11.069  -16.913 -45.412 1.00 32.85  ? 287 PHE B O     1 
ATOM   5223  C  CB    . PHE B  1 315 ? 11.734  -14.287 -46.837 1.00 30.53  ? 287 PHE B CB    1 
ATOM   5224  C  CG    . PHE B  1 315 ? 12.784  -13.506 -47.561 1.00 34.91  ? 287 PHE B CG    1 
ATOM   5225  C  CD1   . PHE B  1 315 ? 14.124  -13.650 -47.232 1.00 33.74  ? 287 PHE B CD1   1 
ATOM   5226  C  CD2   . PHE B  1 315 ? 12.442  -12.665 -48.606 1.00 37.81  ? 287 PHE B CD2   1 
ATOM   5227  C  CE1   . PHE B  1 315 ? 15.103  -12.946 -47.917 1.00 39.01  ? 287 PHE B CE1   1 
ATOM   5228  C  CE2   . PHE B  1 315 ? 13.418  -11.952 -49.295 1.00 40.75  ? 287 PHE B CE2   1 
ATOM   5229  C  CZ    . PHE B  1 315 ? 14.748  -12.092 -48.949 1.00 40.32  ? 287 PHE B CZ    1 
ATOM   5230  N  N     . GLY B  1 316 ? 9.388   -16.736 -46.903 1.00 30.49  ? 288 GLY B N     1 
ATOM   5231  C  CA    . GLY B  1 316 ? 8.376   -17.308 -46.043 1.00 32.18  ? 288 GLY B CA    1 
ATOM   5232  C  C     . GLY B  1 316 ? 8.710   -18.668 -45.482 1.00 36.40  ? 288 GLY B C     1 
ATOM   5233  O  O     . GLY B  1 316 ? 8.165   -19.045 -44.448 1.00 35.91  ? 288 GLY B O     1 
ATOM   5234  N  N     . HIS B  1 317 ? 9.593   -19.411 -46.147 1.00 34.58  ? 289 HIS B N     1 
ATOM   5235  C  CA    . HIS B  1 317 ? 9.926   -20.758 -45.681 1.00 38.62  ? 289 HIS B CA    1 
ATOM   5236  C  C     . HIS B  1 317 ? 11.227  -20.846 -44.860 1.00 30.68  ? 289 HIS B C     1 
ATOM   5237  O  O     . HIS B  1 317 ? 11.650  -21.947 -44.517 1.00 34.91  ? 289 HIS B O     1 
ATOM   5238  C  CB    . HIS B  1 317 ? 10.023  -21.722 -46.872 1.00 45.46  ? 289 HIS B CB    1 
ATOM   5239  C  CG    . HIS B  1 317 ? 8.721   -21.956 -47.578 1.00 47.87  ? 289 HIS B CG    1 
ATOM   5240  N  ND1   . HIS B  1 317 ? 7.611   -22.475 -46.943 1.00 52.65  ? 289 HIS B ND1   1 
ATOM   5241  C  CD2   . HIS B  1 317 ? 8.360   -21.764 -48.868 1.00 52.02  ? 289 HIS B CD2   1 
ATOM   5242  C  CE1   . HIS B  1 317 ? 6.620   -22.583 -47.811 1.00 53.12  ? 289 HIS B CE1   1 
ATOM   5243  N  NE2   . HIS B  1 317 ? 7.048   -22.157 -48.986 1.00 54.35  ? 289 HIS B NE2   1 
ATOM   5244  N  N     . VAL B  1 318 ? 11.878  -19.715 -44.574 1.00 32.26  ? 290 VAL B N     1 
ATOM   5245  C  CA    . VAL B  1 318 ? 13.078  -19.748 -43.734 1.00 30.35  ? 290 VAL B CA    1 
ATOM   5246  C  C     . VAL B  1 318 ? 12.690  -19.371 -42.303 1.00 29.09  ? 290 VAL B C     1 
ATOM   5247  O  O     . VAL B  1 318 ? 11.704  -18.669 -42.106 1.00 28.82  ? 290 VAL B O     1 
ATOM   5248  C  CB    . VAL B  1 318 ? 14.205  -18.816 -44.251 1.00 28.24  ? 290 VAL B CB    1 
ATOM   5249  C  CG1   . VAL B  1 318 ? 14.605  -19.200 -45.655 1.00 29.97  ? 290 VAL B CG1   1 
ATOM   5250  C  CG2   . VAL B  1 318 ? 13.797  -17.340 -44.187 1.00 32.06  ? 290 VAL B CG2   1 
ATOM   5251  N  N     . SER B  1 319 ? 13.436  -19.865 -41.312 1.00 25.08  ? 291 SER B N     1 
ATOM   5252  C  CA    . SER B  1 319 ? 13.127  -19.556 -39.926 1.00 26.23  ? 291 SER B CA    1 
ATOM   5253  C  C     . SER B  1 319 ? 13.194  -18.044 -39.649 1.00 29.32  ? 291 SER B C     1 
ATOM   5254  O  O     . SER B  1 319 ? 12.447  -17.539 -38.827 1.00 31.37  ? 291 SER B O     1 
ATOM   5255  C  CB    . SER B  1 319 ? 14.053  -20.321 -38.973 1.00 29.21  ? 291 SER B CB    1 
ATOM   5256  O  OG    . SER B  1 319 ? 15.400  -19.907 -39.079 1.00 28.04  ? 291 SER B OG    1 
ATOM   5257  N  N     . GLY B  1 320 ? 14.047  -17.320 -40.367 1.00 31.03  ? 292 GLY B N     1 
ATOM   5258  C  CA    . GLY B  1 320 ? 14.230  -15.898 -40.104 1.00 28.95  ? 292 GLY B CA    1 
ATOM   5259  C  C     . GLY B  1 320 ? 13.090  -15.003 -40.544 1.00 29.80  ? 292 GLY B C     1 
ATOM   5260  O  O     . GLY B  1 320 ? 13.163  -13.779 -40.388 1.00 35.25  ? 292 GLY B O     1 
ATOM   5261  N  N     . SER B  1 321 ? 12.038  -15.589 -41.112 1.00 30.20  ? 293 SER B N     1 
ATOM   5262  C  CA    . SER B  1 321 ? 10.878  -14.790 -41.503 1.00 32.97  ? 293 SER B CA    1 
ATOM   5263  C  C     . SER B  1 321 ? 9.778   -14.766 -40.444 1.00 31.16  ? 293 SER B C     1 
ATOM   5264  O  O     . SER B  1 321 ? 8.701   -14.210 -40.675 1.00 33.02  ? 293 SER B O     1 
ATOM   5265  C  CB    . SER B  1 321 ? 10.287  -15.300 -42.811 1.00 30.29  ? 293 SER B CB    1 
ATOM   5266  O  OG    . SER B  1 321 ? 9.909   -16.659 -42.695 1.00 32.02  ? 293 SER B OG    1 
ATOM   5267  N  N     . TRP B  1 322 ? 10.056  -15.331 -39.277 1.00 31.31  ? 294 TRP B N     1 
ATOM   5268  C  CA    . TRP B  1 322 ? 8.980   -15.634 -38.341 1.00 33.66  ? 294 TRP B CA    1 
ATOM   5269  C  C     . TRP B  1 322 ? 8.403   -14.378 -37.679 1.00 34.96  ? 294 TRP B C     1 
ATOM   5270  O  O     . TRP B  1 322 ? 7.260   -14.405 -37.211 1.00 29.72  ? 294 TRP B O     1 
ATOM   5271  C  CB    . TRP B  1 322 ? 9.452   -16.648 -37.284 1.00 29.94  ? 294 TRP B CB    1 
ATOM   5272  C  CG    . TRP B  1 322 ? 10.322  -16.083 -36.207 1.00 33.94  ? 294 TRP B CG    1 
ATOM   5273  C  CD1   . TRP B  1 322 ? 11.668  -15.866 -36.267 1.00 32.30  ? 294 TRP B CD1   1 
ATOM   5274  C  CD2   . TRP B  1 322 ? 9.911   -15.696 -34.891 1.00 30.74  ? 294 TRP B CD2   1 
ATOM   5275  N  NE1   . TRP B  1 322 ? 12.117  -15.354 -35.074 1.00 29.32  ? 294 TRP B NE1   1 
ATOM   5276  C  CE2   . TRP B  1 322 ? 11.060  -15.240 -34.213 1.00 32.67  ? 294 TRP B CE2   1 
ATOM   5277  C  CE3   . TRP B  1 322 ? 8.681   -15.683 -34.224 1.00 34.22  ? 294 TRP B CE3   1 
ATOM   5278  C  CZ2   . TRP B  1 322 ? 11.016  -14.760 -32.897 1.00 36.81  ? 294 TRP B CZ2   1 
ATOM   5279  C  CZ3   . TRP B  1 322 ? 8.639   -15.216 -32.919 1.00 38.94  ? 294 TRP B CZ3   1 
ATOM   5280  C  CH2   . TRP B  1 322 ? 9.803   -14.760 -32.269 1.00 37.78  ? 294 TRP B CH2   1 
ATOM   5281  N  N     . ARG B  1 323 ? 9.172   -13.285 -37.670 1.00 33.89  ? 295 ARG B N     1 
ATOM   5282  C  CA    . ARG B  1 323 ? 8.683   -11.985 -37.179 1.00 32.59  ? 295 ARG B CA    1 
ATOM   5283  C  C     . ARG B  1 323 ? 8.251   -11.059 -38.309 1.00 36.29  ? 295 ARG B C     1 
ATOM   5284  O  O     . ARG B  1 323 ? 8.133   -9.842  -38.105 1.00 37.31  ? 295 ARG B O     1 
ATOM   5285  C  CB    . ARG B  1 323 ? 9.760   -11.270 -36.359 1.00 37.62  ? 295 ARG B CB    1 
ATOM   5286  C  CG    . ARG B  1 323 ? 10.347  -12.103 -35.239 1.00 33.33  ? 295 ARG B CG    1 
ATOM   5287  C  CD    . ARG B  1 323 ? 9.547   -11.896 -34.003 1.00 38.29  ? 295 ARG B CD    1 
ATOM   5288  N  NE    . ARG B  1 323 ? 10.020  -10.730 -33.289 1.00 36.97  ? 295 ARG B NE    1 
ATOM   5289  C  CZ    . ARG B  1 323 ? 9.417   -10.203 -32.235 1.00 37.23  ? 295 ARG B CZ    1 
ATOM   5290  N  NH1   . ARG B  1 323 ? 8.300   -10.738 -31.778 1.00 45.19  ? 295 ARG B NH1   1 
ATOM   5291  N  NH2   . ARG B  1 323 ? 9.934   -9.133  -31.648 1.00 36.40  ? 295 ARG B NH2   1 
ATOM   5292  N  N     . GLY B  1 324 ? 8.054   -11.612 -39.505 1.00 34.77  ? 296 GLY B N     1 
ATOM   5293  C  CA    . GLY B  1 324 ? 7.681   -10.803 -40.660 1.00 28.72  ? 296 GLY B CA    1 
ATOM   5294  C  C     . GLY B  1 324 ? 8.833   -9.988  -41.236 1.00 32.75  ? 296 GLY B C     1 
ATOM   5295  O  O     . GLY B  1 324 ? 9.981   -10.155 -40.839 1.00 28.90  ? 296 GLY B O     1 
ATOM   5296  N  N     . LYS B  1 325 ? 8.532   -9.087  -42.169 1.00 30.93  ? 297 LYS B N     1 
ATOM   5297  C  CA    . LYS B  1 325 ? 9.576   -8.419  -42.932 1.00 33.40  ? 297 LYS B CA    1 
ATOM   5298  C  C     . LYS B  1 325 ? 10.097  -7.114  -42.290 1.00 32.56  ? 297 LYS B C     1 
ATOM   5299  O  O     . LYS B  1 325 ? 11.108  -6.561  -42.727 1.00 31.03  ? 297 LYS B O     1 
ATOM   5300  C  CB    . LYS B  1 325 ? 9.072   -8.119  -44.351 1.00 31.81  ? 297 LYS B CB    1 
ATOM   5301  C  CG    . LYS B  1 325 ? 8.100   -6.957  -44.430 1.00 33.24  ? 297 LYS B CG    1 
ATOM   5302  C  CD    . LYS B  1 325 ? 7.691   -6.711  -45.869 1.00 37.51  ? 297 LYS B CD    1 
ATOM   5303  C  CE    . LYS B  1 325 ? 7.021   -5.347  -46.037 1.00 41.46  ? 297 LYS B CE    1 
ATOM   5304  N  NZ    . LYS B  1 325 ? 5.656   -5.309  -45.470 1.00 44.06  ? 297 LYS B NZ    1 
ATOM   5305  N  N     . LYS B  1 326 ? 9.423   -6.618  -41.266 1.00 29.78  ? 298 LYS B N     1 
ATOM   5306  C  CA    . LYS B  1 326 ? 9.811   -5.328  -40.699 1.00 28.07  ? 298 LYS B CA    1 
ATOM   5307  C  C     . LYS B  1 326 ? 11.209  -5.307  -40.031 1.00 27.68  ? 298 LYS B C     1 
ATOM   5308  O  O     . LYS B  1 326 ? 12.018  -4.443  -40.368 1.00 24.62  ? 298 LYS B O     1 
ATOM   5309  C  CB    . LYS B  1 326 ? 8.745   -4.857  -39.719 1.00 24.56  ? 298 LYS B CB    1 
ATOM   5310  C  CG    . LYS B  1 326 ? 8.959   -3.453  -39.181 1.00 33.01  ? 298 LYS B CG    1 
ATOM   5311  C  CD    . LYS B  1 326 ? 7.875   -3.199  -38.168 1.00 40.08  ? 298 LYS B CD    1 
ATOM   5312  C  CE    . LYS B  1 326 ? 8.036   -1.904  -37.427 1.00 35.85  ? 298 LYS B CE    1 
ATOM   5313  N  NZ    . LYS B  1 326 ? 7.105   -1.939  -36.248 1.00 44.30  ? 298 LYS B NZ    1 
ATOM   5314  N  N     . PRO B  1 327 ? 11.524  -6.262  -39.120 1.00 25.73  ? 299 PRO B N     1 
ATOM   5315  C  CA    . PRO B  1 327 ? 12.885  -6.229  -38.556 1.00 28.04  ? 299 PRO B CA    1 
ATOM   5316  C  C     . PRO B  1 327 ? 13.977  -6.385  -39.617 1.00 31.40  ? 299 PRO B C     1 
ATOM   5317  O  O     . PRO B  1 327 ? 15.033  -5.750  -39.539 1.00 28.44  ? 299 PRO B O     1 
ATOM   5318  C  CB    . PRO B  1 327 ? 12.912  -7.430  -37.599 1.00 27.09  ? 299 PRO B CB    1 
ATOM   5319  C  CG    . PRO B  1 327 ? 11.483  -7.744  -37.324 1.00 30.13  ? 299 PRO B CG    1 
ATOM   5320  C  CD    . PRO B  1 327 ? 10.734  -7.375  -38.565 1.00 28.01  ? 299 PRO B CD    1 
ATOM   5321  N  N     . ILE B  1 328 ? 13.708  -7.239  -40.598 1.00 27.40  ? 300 ILE B N     1 
ATOM   5322  C  CA    . ILE B  1 328 ? 14.622  -7.459  -41.705 1.00 27.92  ? 300 ILE B CA    1 
ATOM   5323  C  C     . ILE B  1 328 ? 14.814  -6.140  -42.476 1.00 29.69  ? 300 ILE B C     1 
ATOM   5324  O  O     . ILE B  1 328 ? 15.939  -5.766  -42.812 1.00 27.65  ? 300 ILE B O     1 
ATOM   5325  C  CB    . ILE B  1 328 ? 14.093  -8.587  -42.611 1.00 23.57  ? 300 ILE B CB    1 
ATOM   5326  C  CG1   . ILE B  1 328 ? 14.071  -9.893  -41.790 1.00 28.92  ? 300 ILE B CG1   1 
ATOM   5327  C  CG2   . ILE B  1 328 ? 14.925  -8.723  -43.895 1.00 22.56  ? 300 ILE B CG2   1 
ATOM   5328  C  CD1   . ILE B  1 328 ? 13.277  -10.999 -42.410 1.00 31.23  ? 300 ILE B CD1   1 
ATOM   5329  N  N     . GLN B  1 329 ? 13.732  -5.415  -42.723 1.00 27.33  ? 301 GLN B N     1 
ATOM   5330  C  CA    . GLN B  1 329 ? 13.851  -4.177  -43.482 1.00 24.96  ? 301 GLN B CA    1 
ATOM   5331  C  C     . GLN B  1 329 ? 14.551  -3.109  -42.649 1.00 26.69  ? 301 GLN B C     1 
ATOM   5332  O  O     . GLN B  1 329 ? 15.342  -2.323  -43.162 1.00 28.35  ? 301 GLN B O     1 
ATOM   5333  C  CB    . GLN B  1 329 ? 12.479  -3.698  -43.951 1.00 24.86  ? 301 GLN B CB    1 
ATOM   5334  C  CG    . GLN B  1 329 ? 11.933  -4.520  -45.091 1.00 32.22  ? 301 GLN B CG    1 
ATOM   5335  C  CD    . GLN B  1 329 ? 10.581  -4.036  -45.545 1.00 35.78  ? 301 GLN B CD    1 
ATOM   5336  O  OE1   . GLN B  1 329 ? 9.662   -3.885  -44.738 1.00 32.20  ? 301 GLN B OE1   1 
ATOM   5337  N  NE2   . GLN B  1 329 ? 10.452  -3.772  -46.850 1.00 35.63  ? 301 GLN B NE2   1 
ATOM   5338  N  N     . ARG B  1 330 ? 14.281  -3.093  -41.354 1.00 27.46  ? 302 ARG B N     1 
ATOM   5339  C  CA    . ARG B  1 330 ? 14.980  -2.173  -40.476 1.00 23.16  ? 302 ARG B CA    1 
ATOM   5340  C  C     . ARG B  1 330 ? 16.497  -2.439  -40.475 1.00 27.70  ? 302 ARG B C     1 
ATOM   5341  O  O     . ARG B  1 330 ? 17.309  -1.498  -40.536 1.00 25.43  ? 302 ARG B O     1 
ATOM   5342  C  CB    . ARG B  1 330 ? 14.429  -2.262  -39.055 1.00 22.20  ? 302 ARG B CB    1 
ATOM   5343  C  CG    . ARG B  1 330 ? 15.118  -1.281  -38.103 1.00 25.35  ? 302 ARG B CG    1 
ATOM   5344  C  CD    . ARG B  1 330 ? 15.016  -1.745  -36.667 1.00 23.26  ? 302 ARG B CD    1 
ATOM   5345  N  NE    . ARG B  1 330 ? 15.679  -3.032  -36.495 1.00 29.22  ? 302 ARG B NE    1 
ATOM   5346  C  CZ    . ARG B  1 330 ? 15.697  -3.729  -35.359 1.00 30.37  ? 302 ARG B CZ    1 
ATOM   5347  N  NH1   . ARG B  1 330 ? 15.093  -3.253  -34.267 1.00 24.28  ? 302 ARG B NH1   1 
ATOM   5348  N  NH2   . ARG B  1 330 ? 16.331  -4.894  -35.324 1.00 21.48  ? 302 ARG B NH2   1 
ATOM   5349  N  N     . ASN B  1 331 ? 16.877  -3.718  -40.417 1.00 27.19  ? 303 ASN B N     1 
ATOM   5350  C  CA    . ASN B  1 331 ? 18.285  -4.103  -40.437 1.00 27.52  ? 303 ASN B CA    1 
ATOM   5351  C  C     . ASN B  1 331 ? 18.941  -3.819  -41.787 1.00 24.79  ? 303 ASN B C     1 
ATOM   5352  O  O     . ASN B  1 331 ? 20.110  -3.445  -41.843 1.00 29.17  ? 303 ASN B O     1 
ATOM   5353  C  CB    . ASN B  1 331 ? 18.441  -5.594  -40.058 1.00 21.27  ? 303 ASN B CB    1 
ATOM   5354  C  CG    . ASN B  1 331 ? 17.854  -5.892  -38.697 1.00 27.80  ? 303 ASN B CG    1 
ATOM   5355  O  OD1   . ASN B  1 331 ? 17.620  -4.976  -37.906 1.00 28.09  ? 303 ASN B OD1   1 
ATOM   5356  N  ND2   . ASN B  1 331 ? 17.586  -7.162  -38.425 1.00 28.25  ? 303 ASN B ND2   1 
ATOM   5357  N  N     . ALA B  1 332 ? 18.189  -3.979  -42.869 1.00 24.18  ? 304 ALA B N     1 
ATOM   5358  C  CA    . ALA B  1 332 ? 18.702  -3.673  -44.208 1.00 28.88  ? 304 ALA B CA    1 
ATOM   5359  C  C     . ALA B  1 332 ? 19.056  -2.179  -44.351 1.00 28.17  ? 304 ALA B C     1 
ATOM   5360  O  O     . ALA B  1 332 ? 20.067  -1.842  -44.959 1.00 31.00  ? 304 ALA B O     1 
ATOM   5361  C  CB    . ALA B  1 332 ? 17.692  -4.080  -45.266 1.00 28.95  ? 304 ALA B CB    1 
ATOM   5362  N  N     . ILE B  1 333 ? 18.230  -1.299  -43.783 1.00 29.97  ? 305 ILE B N     1 
ATOM   5363  C  CA    . ILE B  1 333 ? 18.505  0.141   -43.766 1.00 25.41  ? 305 ILE B CA    1 
ATOM   5364  C  C     . ILE B  1 333 ? 19.787  0.407   -42.972 1.00 30.08  ? 305 ILE B C     1 
ATOM   5365  O  O     . ILE B  1 333 ? 20.685  1.127   -43.435 1.00 28.67  ? 305 ILE B O     1 
ATOM   5366  C  CB    . ILE B  1 333 ? 17.339  0.937   -43.146 1.00 28.14  ? 305 ILE B CB    1 
ATOM   5367  C  CG1   . ILE B  1 333 ? 16.072  0.819   -43.994 1.00 25.36  ? 305 ILE B CG1   1 
ATOM   5368  C  CG2   . ILE B  1 333 ? 17.689  2.410   -43.019 1.00 23.64  ? 305 ILE B CG2   1 
ATOM   5369  C  CD1   . ILE B  1 333 ? 14.851  1.372   -43.299 1.00 25.04  ? 305 ILE B CD1   1 
ATOM   5370  N  N     . LEU B  1 334 ? 19.873  -0.203  -41.788 1.00 25.13  ? 306 LEU B N     1 
ATOM   5371  C  CA    . LEU B  1 334 ? 21.048  -0.084  -40.924 1.00 24.64  ? 306 LEU B CA    1 
ATOM   5372  C  C     . LEU B  1 334 ? 22.305  -0.628  -41.603 1.00 25.83  ? 306 LEU B C     1 
ATOM   5373  O  O     . LEU B  1 334 ? 23.385  -0.067  -41.460 1.00 28.16  ? 306 LEU B O     1 
ATOM   5374  C  CB    . LEU B  1 334 ? 20.812  -0.819  -39.589 1.00 24.42  ? 306 LEU B CB    1 
ATOM   5375  C  CG    . LEU B  1 334 ? 19.767  -0.193  -38.656 1.00 28.78  ? 306 LEU B CG    1 
ATOM   5376  C  CD1   . LEU B  1 334 ? 19.501  -1.075  -37.461 1.00 26.59  ? 306 LEU B CD1   1 
ATOM   5377  C  CD2   . LEU B  1 334 ? 20.189  1.235   -38.207 1.00 20.90  ? 306 LEU B CD2   1 
ATOM   5378  N  N     . ALA B  1 335 ? 22.161  -1.743  -42.324 1.00 27.61  ? 307 ALA B N     1 
ATOM   5379  C  CA    . ALA B  1 335 ? 23.271  -2.310  -43.089 1.00 28.59  ? 307 ALA B CA    1 
ATOM   5380  C  C     . ALA B  1 335 ? 23.733  -1.365  -44.210 1.00 25.45  ? 307 ALA B C     1 
ATOM   5381  O  O     . ALA B  1 335 ? 24.934  -1.218  -44.445 1.00 28.12  ? 307 ALA B O     1 
ATOM   5382  C  CB    . ALA B  1 335 ? 22.883  -3.673  -43.678 1.00 26.94  ? 307 ALA B CB    1 
ATOM   5383  N  N     . LEU B  1 336 ? 22.793  -0.743  -44.905 1.00 26.01  ? 308 LEU B N     1 
ATOM   5384  C  CA    . LEU B  1 336 ? 23.151  0.249   -45.926 1.00 28.90  ? 308 LEU B CA    1 
ATOM   5385  C  C     . LEU B  1 336 ? 23.897  1.450   -45.304 1.00 33.13  ? 308 LEU B C     1 
ATOM   5386  O  O     . LEU B  1 336 ? 24.847  1.971   -45.890 1.00 30.72  ? 308 LEU B O     1 
ATOM   5387  C  CB    . LEU B  1 336 ? 21.903  0.721   -46.693 1.00 28.89  ? 308 LEU B CB    1 
ATOM   5388  C  CG    . LEU B  1 336 ? 21.296  -0.303  -47.670 1.00 31.97  ? 308 LEU B CG    1 
ATOM   5389  C  CD1   . LEU B  1 336 ? 19.973  0.190   -48.228 1.00 29.29  ? 308 LEU B CD1   1 
ATOM   5390  C  CD2   . LEU B  1 336 ? 22.258  -0.606  -48.802 1.00 26.51  ? 308 LEU B CD2   1 
ATOM   5391  N  N     . ALA B  1 337 ? 23.484  1.877   -44.117 1.00 28.68  ? 309 ALA B N     1 
ATOM   5392  C  CA    . ALA B  1 337 ? 24.174  2.985   -43.446 1.00 26.62  ? 309 ALA B CA    1 
ATOM   5393  C  C     . ALA B  1 337 ? 25.586  2.563   -43.034 1.00 32.41  ? 309 ALA B C     1 
ATOM   5394  O  O     . ALA B  1 337 ? 26.524  3.350   -43.117 1.00 31.52  ? 309 ALA B O     1 
ATOM   5395  C  CB    . ALA B  1 337 ? 23.381  3.453   -42.228 1.00 20.96  ? 309 ALA B CB    1 
ATOM   5396  N  N     . HIS B  1 338 ? 25.719  1.307   -42.592 1.00 31.61  ? 310 HIS B N     1 
ATOM   5397  C  CA    . HIS B  1 338 ? 27.009  0.706   -42.250 1.00 29.19  ? 310 HIS B CA    1 
ATOM   5398  C  C     . HIS B  1 338 ? 27.965  0.681   -43.453 1.00 33.91  ? 310 HIS B C     1 
ATOM   5399  O  O     . HIS B  1 338 ? 29.170  0.850   -43.289 1.00 32.77  ? 310 HIS B O     1 
ATOM   5400  C  CB    . HIS B  1 338 ? 26.799  -0.717  -41.704 1.00 36.84  ? 310 HIS B CB    1 
ATOM   5401  C  CG    . HIS B  1 338 ? 28.018  -1.589  -41.784 1.00 37.65  ? 310 HIS B CG    1 
ATOM   5402  N  ND1   . HIS B  1 338 ? 29.036  -1.534  -40.855 1.00 37.12  ? 310 HIS B ND1   1 
ATOM   5403  C  CD2   . HIS B  1 338 ? 28.387  -2.530  -42.690 1.00 39.07  ? 310 HIS B CD2   1 
ATOM   5404  C  CE1   . HIS B  1 338 ? 29.975  -2.407  -41.182 1.00 38.82  ? 310 HIS B CE1   1 
ATOM   5405  N  NE2   . HIS B  1 338 ? 29.605  -3.026  -42.289 1.00 36.14  ? 310 HIS B NE2   1 
ATOM   5406  N  N     . PHE B  1 339 ? 27.421  0.474   -44.654 1.00 30.03  ? 311 PHE B N     1 
ATOM   5407  C  CA    . PHE B  1 339 ? 28.225  0.440   -45.882 1.00 35.42  ? 311 PHE B CA    1 
ATOM   5408  C  C     . PHE B  1 339 ? 28.385  1.846   -46.481 1.00 35.76  ? 311 PHE B C     1 
ATOM   5409  O  O     . PHE B  1 339 ? 29.006  2.008   -47.535 1.00 34.50  ? 311 PHE B O     1 
ATOM   5410  C  CB    . PHE B  1 339 ? 27.597  -0.486  -46.937 1.00 32.16  ? 311 PHE B CB    1 
ATOM   5411  C  CG    . PHE B  1 339 ? 27.757  -1.951  -46.652 1.00 30.21  ? 311 PHE B CG    1 
ATOM   5412  C  CD1   . PHE B  1 339 ? 29.017  -2.510  -46.478 1.00 35.57  ? 311 PHE B CD1   1 
ATOM   5413  C  CD2   . PHE B  1 339 ? 26.642  -2.782  -46.591 1.00 32.46  ? 311 PHE B CD2   1 
ATOM   5414  C  CE1   . PHE B  1 339 ? 29.166  -3.876  -46.222 1.00 37.66  ? 311 PHE B CE1   1 
ATOM   5415  C  CE2   . PHE B  1 339 ? 26.774  -4.139  -46.345 1.00 33.63  ? 311 PHE B CE2   1 
ATOM   5416  C  CZ    . PHE B  1 339 ? 28.047  -4.690  -46.156 1.00 34.83  ? 311 PHE B CZ    1 
ATOM   5417  N  N     . LYS B  1 340 ? 27.816  2.838   -45.797 1.00 32.36  ? 312 LYS B N     1 
ATOM   5418  C  CA    . LYS B  1 340 ? 27.744  4.214   -46.275 1.00 35.70  ? 312 LYS B CA    1 
ATOM   5419  C  C     . LYS B  1 340 ? 27.368  4.293   -47.753 1.00 41.13  ? 312 LYS B C     1 
ATOM   5420  O  O     . LYS B  1 340 ? 28.029  4.982   -48.524 1.00 38.98  ? 312 LYS B O     1 
ATOM   5421  C  CB    . LYS B  1 340 ? 29.072  4.935   -46.053 1.00 38.59  ? 312 LYS B CB    1 
ATOM   5422  C  CG    . LYS B  1 340 ? 29.424  5.201   -44.596 1.00 45.32  ? 312 LYS B CG    1 
ATOM   5423  C  CD    . LYS B  1 340 ? 30.483  6.306   -44.501 1.00 50.55  ? 312 LYS B CD    1 
ATOM   5424  C  CE    . LYS B  1 340 ? 30.906  6.581   -43.074 1.00 48.73  ? 312 LYS B CE    1 
ATOM   5425  N  NZ    . LYS B  1 340 ? 29.727  6.863   -42.208 1.00 54.61  ? 312 LYS B NZ    1 
ATOM   5426  N  N     . ASP B  1 341 ? 26.305  3.595   -48.139 1.00 37.79  ? 313 ASP B N     1 
ATOM   5427  C  CA    . ASP B  1 341 ? 25.949  3.454   -49.551 1.00 37.23  ? 313 ASP B CA    1 
ATOM   5428  C  C     . ASP B  1 341 ? 25.097  4.623   -50.035 1.00 37.21  ? 313 ASP B C     1 
ATOM   5429  O  O     . ASP B  1 341 ? 23.872  4.595   -49.942 1.00 35.77  ? 313 ASP B O     1 
ATOM   5430  C  CB    . ASP B  1 341 ? 25.223  2.116   -49.781 1.00 40.13  ? 313 ASP B CB    1 
ATOM   5431  C  CG    . ASP B  1 341 ? 24.810  1.907   -51.235 1.00 39.80  ? 313 ASP B CG    1 
ATOM   5432  O  OD1   . ASP B  1 341 ? 25.282  2.664   -52.111 1.00 43.76  ? 313 ASP B OD1   1 
ATOM   5433  O  OD2   . ASP B  1 341 ? 24.019  0.977   -51.499 1.00 37.23  ? 313 ASP B OD2   1 
ATOM   5434  N  N     . ALA B  1 342 ? 25.755  5.639   -50.589 1.00 38.24  ? 314 ALA B N     1 
ATOM   5435  C  CA    . ALA B  1 342 ? 25.054  6.824   -51.044 1.00 33.82  ? 314 ALA B CA    1 
ATOM   5436  C  C     . ALA B  1 342 ? 24.113  6.543   -52.212 1.00 31.76  ? 314 ALA B C     1 
ATOM   5437  O  O     . ALA B  1 342 ? 23.230  7.348   -52.493 1.00 40.36  ? 314 ALA B O     1 
ATOM   5438  C  CB    . ALA B  1 342 ? 26.054  7.925   -51.416 1.00 37.77  ? 314 ALA B CB    1 
ATOM   5439  N  N     . SER B  1 343 ? 24.261  5.406   -52.888 1.00 33.40  ? 315 SER B N     1 
ATOM   5440  C  CA    . SER B  1 343 ? 23.317  5.081   -53.959 1.00 31.81  ? 315 SER B CA    1 
ATOM   5441  C  C     . SER B  1 343 ? 21.942  4.710   -53.393 1.00 34.15  ? 315 SER B C     1 
ATOM   5442  O  O     . SER B  1 343 ? 20.948  4.707   -54.120 1.00 31.50  ? 315 SER B O     1 
ATOM   5443  C  CB    . SER B  1 343 ? 23.848  3.947   -54.845 1.00 34.00  ? 315 SER B CB    1 
ATOM   5444  O  OG    . SER B  1 343 ? 23.549  2.672   -54.307 1.00 38.39  ? 315 SER B OG    1 
ATOM   5445  N  N     . ALA B  1 344 ? 21.887  4.412   -52.091 1.00 31.77  ? 316 ALA B N     1 
ATOM   5446  C  CA    . ALA B  1 344 ? 20.616  4.116   -51.422 1.00 35.79  ? 316 ALA B CA    1 
ATOM   5447  C  C     . ALA B  1 344 ? 19.887  5.375   -50.902 1.00 30.49  ? 316 ALA B C     1 
ATOM   5448  O  O     . ALA B  1 344 ? 18.740  5.286   -50.435 1.00 29.82  ? 316 ALA B O     1 
ATOM   5449  C  CB    . ALA B  1 344 ? 20.852  3.121   -50.246 1.00 33.32  ? 316 ALA B CB    1 
ATOM   5450  N  N     . LEU B  1 345 ? 20.534  6.536   -50.985 1.00 32.01  ? 317 LEU B N     1 
ATOM   5451  C  CA    . LEU B  1 345 ? 19.960  7.760   -50.405 1.00 30.13  ? 317 LEU B CA    1 
ATOM   5452  C  C     . LEU B  1 345 ? 18.595  8.140   -50.999 1.00 28.30  ? 317 LEU B C     1 
ATOM   5453  O  O     . LEU B  1 345 ? 17.691  8.465   -50.249 1.00 29.28  ? 317 LEU B O     1 
ATOM   5454  C  CB    . LEU B  1 345 ? 20.946  8.927   -50.519 1.00 30.66  ? 317 LEU B CB    1 
ATOM   5455  C  CG    . LEU B  1 345 ? 22.147  8.728   -49.581 1.00 35.05  ? 317 LEU B CG    1 
ATOM   5456  C  CD1   . LEU B  1 345 ? 23.228  9.762   -49.843 1.00 31.79  ? 317 LEU B CD1   1 
ATOM   5457  C  CD2   . LEU B  1 345 ? 21.712  8.766   -48.097 1.00 32.66  ? 317 LEU B CD2   1 
ATOM   5458  N  N     . PRO B  1 346 ? 18.414  8.060   -52.333 1.00 34.41  ? 318 PRO B N     1 
ATOM   5459  C  CA    . PRO B  1 346 ? 17.057  8.365   -52.825 1.00 26.06  ? 318 PRO B CA    1 
ATOM   5460  C  C     . PRO B  1 346 ? 15.954  7.428   -52.300 1.00 28.96  ? 318 PRO B C     1 
ATOM   5461  O  O     . PRO B  1 346 ? 14.896  7.911   -51.908 1.00 30.42  ? 318 PRO B O     1 
ATOM   5462  C  CB    . PRO B  1 346 ? 17.198  8.217   -54.350 1.00 29.12  ? 318 PRO B CB    1 
ATOM   5463  C  CG    . PRO B  1 346 ? 18.634  8.501   -54.618 1.00 32.40  ? 318 PRO B CG    1 
ATOM   5464  C  CD    . PRO B  1 346 ? 19.379  7.912   -53.444 1.00 31.94  ? 318 PRO B CD    1 
ATOM   5465  N  N     . GLU B  1 347 ? 16.186  6.114   -52.299 1.00 29.19  ? 319 GLU B N     1 
ATOM   5466  C  CA    . GLU B  1 347 ? 15.186  5.182   -51.774 1.00 28.17  ? 319 GLU B CA    1 
ATOM   5467  C  C     . GLU B  1 347 ? 14.945  5.384   -50.280 1.00 29.61  ? 319 GLU B C     1 
ATOM   5468  O  O     . GLU B  1 347 ? 13.802  5.334   -49.825 1.00 30.13  ? 319 GLU B O     1 
ATOM   5469  C  CB    . GLU B  1 347 ? 15.590  3.726   -52.053 1.00 32.10  ? 319 GLU B CB    1 
ATOM   5470  C  CG    . GLU B  1 347 ? 14.648  2.659   -51.468 1.00 34.40  ? 319 GLU B CG    1 
ATOM   5471  C  CD    . GLU B  1 347 ? 13.152  2.837   -51.838 1.00 48.84  ? 319 GLU B CD    1 
ATOM   5472  O  OE1   . GLU B  1 347 ? 12.835  3.557   -52.828 1.00 48.46  ? 319 GLU B OE1   1 
ATOM   5473  O  OE2   . GLU B  1 347 ? 12.286  2.250   -51.126 1.00 46.33  ? 319 GLU B OE2   1 
ATOM   5474  N  N     . LEU B  1 348 ? 16.005  5.631   -49.515 1.00 26.54  ? 320 LEU B N     1 
ATOM   5475  C  CA    . LEU B  1 348 ? 15.841  5.918   -48.084 1.00 26.92  ? 320 LEU B CA    1 
ATOM   5476  C  C     . LEU B  1 348 ? 15.035  7.189   -47.818 1.00 27.77  ? 320 LEU B C     1 
ATOM   5477  O  O     . LEU B  1 348 ? 14.228  7.237   -46.881 1.00 27.29  ? 320 LEU B O     1 
ATOM   5478  C  CB    . LEU B  1 348 ? 17.206  6.021   -47.393 1.00 28.65  ? 320 LEU B CB    1 
ATOM   5479  C  CG    . LEU B  1 348 ? 17.971  4.692   -47.313 1.00 28.48  ? 320 LEU B CG    1 
ATOM   5480  C  CD1   . LEU B  1 348 ? 19.370  4.909   -46.766 1.00 32.93  ? 320 LEU B CD1   1 
ATOM   5481  C  CD2   . LEU B  1 348 ? 17.220  3.658   -46.465 1.00 29.39  ? 320 LEU B CD2   1 
ATOM   5482  N  N     . THR B  1 349 ? 15.259  8.222   -48.639 1.00 29.06  ? 321 THR B N     1 
ATOM   5483  C  CA    . THR B  1 349 ? 14.478  9.449   -48.553 1.00 26.22  ? 321 THR B CA    1 
ATOM   5484  C  C     . THR B  1 349 ? 13.000  9.187   -48.868 1.00 28.47  ? 321 THR B C     1 
ATOM   5485  O  O     . THR B  1 349 ? 12.119  9.735   -48.213 1.00 28.57  ? 321 THR B O     1 
ATOM   5486  C  CB    . THR B  1 349 ? 15.012  10.525  -49.514 1.00 29.82  ? 321 THR B CB    1 
ATOM   5487  O  OG1   . THR B  1 349 ? 16.359  10.864  -49.155 1.00 25.66  ? 321 THR B OG1   1 
ATOM   5488  C  CG2   . THR B  1 349 ? 14.149  11.758  -49.437 1.00 26.45  ? 321 THR B CG2   1 
ATOM   5489  N  N     . GLU B  1 350 ? 12.720  8.354   -49.871 1.00 27.68  ? 322 GLU B N     1 
ATOM   5490  C  CA    . GLU B  1 350 ? 11.325  8.017   -50.172 1.00 28.34  ? 322 GLU B CA    1 
ATOM   5491  C  C     . GLU B  1 350 ? 10.675  7.289   -48.975 1.00 34.04  ? 322 GLU B C     1 
ATOM   5492  O  O     . GLU B  1 350 ? 9.539   7.597   -48.580 1.00 32.14  ? 322 GLU B O     1 
ATOM   5493  C  CB    . GLU B  1 350 ? 11.239  7.159   -51.437 1.00 31.33  ? 322 GLU B CB    1 
ATOM   5494  C  CG    . GLU B  1 350 ? 9.821   6.836   -51.871 1.00 32.32  ? 322 GLU B CG    1 
ATOM   5495  C  CD    . GLU B  1 350 ? 9.752   6.180   -53.261 1.00 41.60  ? 322 GLU B CD    1 
ATOM   5496  O  OE1   . GLU B  1 350 ? 10.176  6.798   -54.263 1.00 41.78  ? 322 GLU B OE1   1 
ATOM   5497  O  OE2   . GLU B  1 350 ? 9.263   5.037   -53.355 1.00 51.12  ? 322 GLU B OE2   1 
ATOM   5498  N  N     . LEU B  1 351 ? 11.411  6.340   -48.389 1.00 29.07  ? 323 LEU B N     1 
ATOM   5499  C  CA    . LEU B  1 351 ? 10.904  5.575   -47.255 1.00 27.55  ? 323 LEU B CA    1 
ATOM   5500  C  C     . LEU B  1 351 ? 10.629  6.497   -46.102 1.00 26.16  ? 323 LEU B C     1 
ATOM   5501  O  O     . LEU B  1 351 ? 9.560   6.415   -45.488 1.00 31.02  ? 323 LEU B O     1 
ATOM   5502  C  CB    . LEU B  1 351 ? 11.895  4.490   -46.816 1.00 27.05  ? 323 LEU B CB    1 
ATOM   5503  C  CG    . LEU B  1 351 ? 11.993  3.272   -47.704 1.00 29.93  ? 323 LEU B CG    1 
ATOM   5504  C  CD1   . LEU B  1 351 ? 13.126  2.378   -47.216 1.00 38.65  ? 323 LEU B CD1   1 
ATOM   5505  C  CD2   . LEU B  1 351 ? 10.655  2.532   -47.676 1.00 31.44  ? 323 LEU B CD2   1 
ATOM   5506  N  N     . MET B  1 352 ? 11.587  7.385   -45.819 1.00 27.60  ? 324 MET B N     1 
ATOM   5507  C  CA    . MET B  1 352 ? 11.432  8.377   -44.745 1.00 31.33  ? 324 MET B CA    1 
ATOM   5508  C  C     . MET B  1 352 ? 10.110  9.134   -44.810 1.00 33.01  ? 324 MET B C     1 
ATOM   5509  O  O     . MET B  1 352 ? 9.504   9.424   -43.784 1.00 36.35  ? 324 MET B O     1 
ATOM   5510  C  CB    . MET B  1 352 ? 12.578  9.386   -44.767 1.00 31.77  ? 324 MET B CB    1 
ATOM   5511  C  CG    . MET B  1 352 ? 12.389  10.568  -43.802 1.00 33.68  ? 324 MET B CG    1 
ATOM   5512  S  SD    . MET B  1 352 ? 13.821  11.668  -43.705 1.00 32.69  ? 324 MET B SD    1 
ATOM   5513  C  CE    . MET B  1 352 ? 13.755  12.407  -45.348 1.00 34.12  ? 324 MET B CE    1 
ATOM   5514  N  N     . HIS B  1 353 ? 9.663   9.439   -46.016 1.00 29.35  ? 325 HIS B N     1 
ATOM   5515  C  CA    . HIS B  1 353 ? 8.424   10.186  -46.208 1.00 34.71  ? 325 HIS B CA    1 
ATOM   5516  C  C     . HIS B  1 353 ? 7.192   9.289   -46.323 1.00 28.04  ? 325 HIS B C     1 
ATOM   5517  O  O     . HIS B  1 353 ? 6.143   9.599   -45.780 1.00 30.50  ? 325 HIS B O     1 
ATOM   5518  C  CB    . HIS B  1 353 ? 8.525   11.059  -47.479 1.00 30.10  ? 325 HIS B CB    1 
ATOM   5519  C  CG    . HIS B  1 353 ? 9.448   12.231  -47.344 1.00 34.84  ? 325 HIS B CG    1 
ATOM   5520  N  ND1   . HIS B  1 353 ? 9.172   13.304  -46.525 1.00 37.32  ? 325 HIS B ND1   1 
ATOM   5521  C  CD2   . HIS B  1 353 ? 10.628  12.515  -47.951 1.00 35.61  ? 325 HIS B CD2   1 
ATOM   5522  C  CE1   . HIS B  1 353 ? 10.153  14.186  -46.613 1.00 34.16  ? 325 HIS B CE1   1 
ATOM   5523  N  NE2   . HIS B  1 353 ? 11.049  13.731  -47.471 1.00 32.30  ? 325 HIS B NE2   1 
ATOM   5524  N  N     . LYS B  1 354 ? 7.316   8.203   -47.077 1.00 26.89  ? 326 LYS B N     1 
ATOM   5525  C  CA    . LYS B  1 354 ? 6.154   7.411   -47.470 1.00 35.26  ? 326 LYS B CA    1 
ATOM   5526  C  C     . LYS B  1 354 ? 5.836   6.181   -46.607 1.00 36.75  ? 326 LYS B C     1 
ATOM   5527  O  O     . LYS B  1 354 ? 4.678   5.787   -46.516 1.00 38.12  ? 326 LYS B O     1 
ATOM   5528  C  CB    . LYS B  1 354 ? 6.323   6.933   -48.908 1.00 36.20  ? 326 LYS B CB    1 
ATOM   5529  C  CG    . LYS B  1 354 ? 5.642   7.799   -49.937 1.00 50.53  ? 326 LYS B CG    1 
ATOM   5530  C  CD    . LYS B  1 354 ? 4.549   7.011   -50.679 1.00 54.18  ? 326 LYS B CD    1 
ATOM   5531  C  CE    . LYS B  1 354 ? 5.097   6.163   -51.836 1.00 48.97  ? 326 LYS B CE    1 
ATOM   5532  N  NZ    . LYS B  1 354 ? 5.865   4.953   -51.413 1.00 58.22  ? 326 LYS B NZ    1 
ATOM   5533  N  N     . ASP B  1 355 ? 6.836   5.539   -46.021 1.00 36.29  ? 327 ASP B N     1 
ATOM   5534  C  CA    . ASP B  1 355 ? 6.561   4.260   -45.351 1.00 30.46  ? 327 ASP B CA    1 
ATOM   5535  C  C     . ASP B  1 355 ? 5.571   4.473   -44.190 1.00 29.22  ? 327 ASP B C     1 
ATOM   5536  O  O     . ASP B  1 355 ? 5.764   5.364   -43.379 1.00 30.40  ? 327 ASP B O     1 
ATOM   5537  C  CB    . ASP B  1 355 ? 7.844   3.604   -44.844 1.00 24.19  ? 327 ASP B CB    1 
ATOM   5538  C  CG    . ASP B  1 355 ? 7.617   2.131   -44.422 1.00 33.38  ? 327 ASP B CG    1 
ATOM   5539  O  OD1   . ASP B  1 355 ? 7.097   1.875   -43.303 1.00 28.71  ? 327 ASP B OD1   1 
ATOM   5540  O  OD2   . ASP B  1 355 ? 7.942   1.236   -45.224 1.00 27.09  ? 327 ASP B OD2   1 
ATOM   5541  N  N     . PRO B  1 356 ? 4.487   3.676   -44.138 1.00 30.12  ? 328 PRO B N     1 
ATOM   5542  C  CA    . PRO B  1 356 ? 3.489   3.771   -43.056 1.00 32.71  ? 328 PRO B CA    1 
ATOM   5543  C  C     . PRO B  1 356 ? 4.040   3.493   -41.643 1.00 37.83  ? 328 PRO B C     1 
ATOM   5544  O  O     . PRO B  1 356 ? 3.407   3.882   -40.661 1.00 31.71  ? 328 PRO B O     1 
ATOM   5545  C  CB    . PRO B  1 356 ? 2.450   2.702   -43.439 1.00 33.03  ? 328 PRO B CB    1 
ATOM   5546  C  CG    . PRO B  1 356 ? 3.166   1.765   -44.358 1.00 35.46  ? 328 PRO B CG    1 
ATOM   5547  C  CD    . PRO B  1 356 ? 4.159   2.610   -45.106 1.00 37.16  ? 328 PRO B CD    1 
ATOM   5548  N  N     . ARG B  1 357 ? 5.196   2.837   -41.533 1.00 33.44  ? 329 ARG B N     1 
ATOM   5549  C  CA    . ARG B  1 357 ? 5.722   2.447   -40.219 1.00 30.96  ? 329 ARG B CA    1 
ATOM   5550  C  C     . ARG B  1 357 ? 6.764   3.432   -39.675 1.00 28.66  ? 329 ARG B C     1 
ATOM   5551  O  O     . ARG B  1 357 ? 7.799   3.613   -40.296 1.00 27.77  ? 329 ARG B O     1 
ATOM   5552  C  CB    . ARG B  1 357 ? 6.329   1.032   -40.306 1.00 27.70  ? 329 ARG B CB    1 
ATOM   5553  C  CG    . ARG B  1 357 ? 5.362   -0.031  -40.821 1.00 29.56  ? 329 ARG B CG    1 
ATOM   5554  C  CD    . ARG B  1 357 ? 6.080   -1.233  -41.419 1.00 35.02  ? 329 ARG B CD    1 
ATOM   5555  N  NE    . ARG B  1 357 ? 6.854   -0.873  -42.606 1.00 30.61  ? 329 ARG B NE    1 
ATOM   5556  C  CZ    . ARG B  1 357 ? 7.615   -1.719  -43.297 1.00 31.95  ? 329 ARG B CZ    1 
ATOM   5557  N  NH1   . ARG B  1 357 ? 7.710   -2.997  -42.930 1.00 30.53  ? 329 ARG B NH1   1 
ATOM   5558  N  NH2   . ARG B  1 357 ? 8.284   -1.289  -44.357 1.00 26.53  ? 329 ARG B NH2   1 
ATOM   5559  N  N     . PRO B  1 358 ? 6.506   4.045   -38.496 1.00 32.39  ? 330 PRO B N     1 
ATOM   5560  C  CA    . PRO B  1 358 ? 7.447   5.001   -37.883 1.00 29.81  ? 330 PRO B CA    1 
ATOM   5561  C  C     . PRO B  1 358 ? 8.875   4.462   -37.661 1.00 33.59  ? 330 PRO B C     1 
ATOM   5562  O  O     . PRO B  1 358 ? 9.832   5.240   -37.763 1.00 27.86  ? 330 PRO B O     1 
ATOM   5563  C  CB    . PRO B  1 358 ? 6.781   5.324   -36.529 1.00 29.62  ? 330 PRO B CB    1 
ATOM   5564  C  CG    . PRO B  1 358 ? 5.334   5.122   -36.789 1.00 32.18  ? 330 PRO B CG    1 
ATOM   5565  C  CD    . PRO B  1 358 ? 5.272   3.915   -37.693 1.00 27.77  ? 330 PRO B CD    1 
ATOM   5566  N  N     . VAL B  1 359 ? 9.023   3.170   -37.353 1.00 31.22  ? 331 VAL B N     1 
ATOM   5567  C  CA    . VAL B  1 359 ? 10.353  2.568   -37.196 1.00 27.46  ? 331 VAL B CA    1 
ATOM   5568  C  C     . VAL B  1 359 ? 11.117  2.577   -38.524 1.00 27.60  ? 331 VAL B C     1 
ATOM   5569  O  O     . VAL B  1 359 ? 12.332  2.758   -38.549 1.00 27.40  ? 331 VAL B O     1 
ATOM   5570  C  CB    . VAL B  1 359 ? 10.276  1.103   -36.667 1.00 33.14  ? 331 VAL B CB    1 
ATOM   5571  C  CG1   . VAL B  1 359 ? 11.639  0.426   -36.709 1.00 25.96  ? 331 VAL B CG1   1 
ATOM   5572  C  CG2   . VAL B  1 359 ? 9.739   1.088   -35.259 1.00 32.92  ? 331 VAL B CG2   1 
ATOM   5573  N  N     . ILE B  1 360 ? 10.410  2.383   -39.626 1.00 25.86  ? 332 ILE B N     1 
ATOM   5574  C  CA    . ILE B  1 360 ? 11.069  2.393   -40.932 1.00 27.98  ? 332 ILE B CA    1 
ATOM   5575  C  C     . ILE B  1 360 ? 11.394  3.843   -41.378 1.00 29.92  ? 332 ILE B C     1 
ATOM   5576  O  O     . ILE B  1 360 ? 12.521  4.120   -41.798 1.00 29.24  ? 332 ILE B O     1 
ATOM   5577  C  CB    . ILE B  1 360 ? 10.218  1.679   -41.992 1.00 25.74  ? 332 ILE B CB    1 
ATOM   5578  C  CG1   . ILE B  1 360 ? 10.031  0.207   -41.604 1.00 28.87  ? 332 ILE B CG1   1 
ATOM   5579  C  CG2   . ILE B  1 360 ? 10.865  1.793   -43.373 1.00 22.40  ? 332 ILE B CG2   1 
ATOM   5580  C  CD1   . ILE B  1 360 ? 11.324  -0.484  -41.238 1.00 28.20  ? 332 ILE B CD1   1 
ATOM   5581  N  N     . ARG B  1 361 ? 10.426  4.749   -41.260 1.00 25.52  ? 333 ARG B N     1 
ATOM   5582  C  CA    . ARG B  1 361 ? 10.636  6.187   -41.567 1.00 29.95  ? 333 ARG B CA    1 
ATOM   5583  C  C     . ARG B  1 361 ? 11.772  6.775   -40.758 1.00 29.20  ? 333 ARG B C     1 
ATOM   5584  O  O     . ARG B  1 361 ? 12.658  7.439   -41.303 1.00 26.45  ? 333 ARG B O     1 
ATOM   5585  C  CB    . ARG B  1 361 ? 9.375   7.011   -41.302 1.00 28.53  ? 333 ARG B CB    1 
ATOM   5586  C  CG    . ARG B  1 361 ? 8.207   6.709   -42.238 1.00 27.74  ? 333 ARG B CG    1 
ATOM   5587  C  CD    . ARG B  1 361 ? 7.197   7.875   -42.302 1.00 29.17  ? 333 ARG B CD    1 
ATOM   5588  N  NE    . ARG B  1 361 ? 6.689   8.290   -40.992 1.00 28.77  ? 333 ARG B NE    1 
ATOM   5589  C  CZ    . ARG B  1 361 ? 5.720   7.657   -40.326 1.00 34.03  ? 333 ARG B CZ    1 
ATOM   5590  N  NH1   . ARG B  1 361 ? 5.155   6.560   -40.827 1.00 28.19  ? 333 ARG B NH1   1 
ATOM   5591  N  NH2   . ARG B  1 361 ? 5.326   8.112   -39.148 1.00 33.04  ? 333 ARG B NH2   1 
ATOM   5592  N  N     . GLY B  1 362 ? 11.733  6.531   -39.446 1.00 28.50  ? 334 GLY B N     1 
ATOM   5593  C  CA    . GLY B  1 362 ? 12.778  6.971   -38.542 1.00 25.14  ? 334 GLY B CA    1 
ATOM   5594  C  C     . GLY B  1 362 ? 14.157  6.370   -38.766 1.00 26.80  ? 334 GLY B C     1 
ATOM   5595  O  O     . GLY B  1 362 ? 15.148  7.089   -38.796 1.00 28.97  ? 334 GLY B O     1 
ATOM   5596  N  N     . THR B  1 363 ? 14.246  5.047   -38.888 1.00 28.12  ? 335 THR B N     1 
ATOM   5597  C  CA    . THR B  1 363 ? 15.538  4.417   -39.168 1.00 26.13  ? 335 THR B CA    1 
ATOM   5598  C  C     . THR B  1 363 ? 16.113  4.856   -40.530 1.00 27.21  ? 335 THR B C     1 
ATOM   5599  O  O     . THR B  1 363 ? 17.325  5.065   -40.654 1.00 25.47  ? 335 THR B O     1 
ATOM   5600  C  CB    . THR B  1 363 ? 15.442  2.873   -39.117 1.00 27.53  ? 335 THR B CB    1 
ATOM   5601  O  OG1   . THR B  1 363 ? 14.870  2.469   -37.861 1.00 27.21  ? 335 THR B OG1   1 
ATOM   5602  C  CG2   . THR B  1 363 ? 16.825  2.241   -39.271 1.00 24.42  ? 335 THR B CG2   1 
ATOM   5603  N  N     . ALA B  1 364 ? 15.255  5.009   -41.539 1.00 24.81  ? 336 ALA B N     1 
ATOM   5604  C  CA    . ALA B  1 364 ? 15.688  5.592   -42.824 1.00 29.08  ? 336 ALA B CA    1 
ATOM   5605  C  C     . ALA B  1 364 ? 16.304  6.989   -42.631 1.00 27.01  ? 336 ALA B C     1 
ATOM   5606  O  O     . ALA B  1 364 ? 17.370  7.283   -43.174 1.00 28.46  ? 336 ALA B O     1 
ATOM   5607  C  CB    . ALA B  1 364 ? 14.516  5.662   -43.825 1.00 22.90  ? 336 ALA B CB    1 
ATOM   5608  N  N     . ALA B  1 365 ? 15.646  7.838   -41.848 1.00 29.04  ? 337 ALA B N     1 
ATOM   5609  C  CA    . ALA B  1 365 ? 16.131  9.200   -41.653 1.00 28.69  ? 337 ALA B CA    1 
ATOM   5610  C  C     . ALA B  1 365 ? 17.495  9.193   -40.967 1.00 28.80  ? 337 ALA B C     1 
ATOM   5611  O  O     . ALA B  1 365 ? 18.407  9.904   -41.364 1.00 30.87  ? 337 ALA B O     1 
ATOM   5612  C  CB    . ALA B  1 365 ? 15.135  10.002  -40.854 1.00 27.43  ? 337 ALA B CB    1 
ATOM   5613  N  N     . TRP B  1 366 ? 17.636  8.363   -39.950 1.00 29.13  ? 338 TRP B N     1 
ATOM   5614  C  CA    . TRP B  1 366 ? 18.909  8.233   -39.256 1.00 32.19  ? 338 TRP B CA    1 
ATOM   5615  C  C     . TRP B  1 366 ? 19.995  7.746   -40.227 1.00 29.45  ? 338 TRP B C     1 
ATOM   5616  O  O     . TRP B  1 366 ? 21.120  8.258   -40.221 1.00 27.02  ? 338 TRP B O     1 
ATOM   5617  C  CB    . TRP B  1 366 ? 18.764  7.263   -38.067 1.00 26.37  ? 338 TRP B CB    1 
ATOM   5618  C  CG    . TRP B  1 366 ? 20.023  7.040   -37.303 1.00 24.85  ? 338 TRP B CG    1 
ATOM   5619  C  CD1   . TRP B  1 366 ? 20.439  7.727   -36.191 1.00 28.45  ? 338 TRP B CD1   1 
ATOM   5620  C  CD2   . TRP B  1 366 ? 21.040  6.060   -37.576 1.00 23.60  ? 338 TRP B CD2   1 
ATOM   5621  N  NE1   . TRP B  1 366 ? 21.642  7.222   -35.751 1.00 30.51  ? 338 TRP B NE1   1 
ATOM   5622  C  CE2   . TRP B  1 366 ? 22.035  6.204   -36.584 1.00 32.46  ? 338 TRP B CE2   1 
ATOM   5623  C  CE3   . TRP B  1 366 ? 21.191  5.057   -38.546 1.00 27.43  ? 338 TRP B CE3   1 
ATOM   5624  C  CZ2   . TRP B  1 366 ? 23.177  5.390   -36.541 1.00 32.94  ? 338 TRP B CZ2   1 
ATOM   5625  C  CZ3   . TRP B  1 366 ? 22.331  4.248   -38.505 1.00 29.60  ? 338 TRP B CZ3   1 
ATOM   5626  C  CH2   . TRP B  1 366 ? 23.310  4.426   -37.509 1.00 29.37  ? 338 TRP B CH2   1 
ATOM   5627  N  N     . ALA B  1 367 ? 19.644  6.757   -41.059 1.00 27.19  ? 339 ALA B N     1 
ATOM   5628  C  CA    . ALA B  1 367 ? 20.588  6.168   -42.020 1.00 28.37  ? 339 ALA B CA    1 
ATOM   5629  C  C     . ALA B  1 367 ? 21.067  7.201   -43.042 1.00 29.68  ? 339 ALA B C     1 
ATOM   5630  O  O     . ALA B  1 367 ? 22.230  7.190   -43.434 1.00 30.73  ? 339 ALA B O     1 
ATOM   5631  C  CB    . ALA B  1 367 ? 19.964  4.979   -42.746 1.00 23.85  ? 339 ALA B CB    1 
ATOM   5632  N  N     . ILE B  1 368 ? 20.165  8.075   -43.469 1.00 29.50  ? 340 ILE B N     1 
ATOM   5633  C  CA    . ILE B  1 368 ? 20.517  9.191   -44.362 1.00 27.73  ? 340 ILE B CA    1 
ATOM   5634  C  C     . ILE B  1 368 ? 21.582  10.079  -43.727 1.00 33.21  ? 340 ILE B C     1 
ATOM   5635  O  O     . ILE B  1 368 ? 22.520  10.507  -44.401 1.00 34.31  ? 340 ILE B O     1 
ATOM   5636  C  CB    . ILE B  1 368 ? 19.272  10.018  -44.710 1.00 28.22  ? 340 ILE B CB    1 
ATOM   5637  C  CG1   . ILE B  1 368 ? 18.410  9.237   -45.715 1.00 25.49  ? 340 ILE B CG1   1 
ATOM   5638  C  CG2   . ILE B  1 368 ? 19.642  11.431  -45.218 1.00 28.89  ? 340 ILE B CG2   1 
ATOM   5639  C  CD1   . ILE B  1 368 ? 17.042  9.865   -45.963 1.00 26.44  ? 340 ILE B CD1   1 
ATOM   5640  N  N     . GLY B  1 369 ? 21.456  10.339  -42.428 1.00 28.90  ? 341 GLY B N     1 
ATOM   5641  C  CA    . GLY B  1 369 ? 22.436  11.160  -41.732 1.00 28.34  ? 341 GLY B CA    1 
ATOM   5642  C  C     . GLY B  1 369 ? 23.752  10.421  -41.529 1.00 36.14  ? 341 GLY B C     1 
ATOM   5643  O  O     . GLY B  1 369 ? 24.834  10.985  -41.729 1.00 33.75  ? 341 GLY B O     1 
ATOM   5644  N  N     . LYS B  1 370 ? 23.659  9.149   -41.134 1.00 35.02  ? 342 LYS B N     1 
ATOM   5645  C  CA    . LYS B  1 370 ? 24.838  8.322   -40.903 1.00 30.99  ? 342 LYS B CA    1 
ATOM   5646  C  C     . LYS B  1 370 ? 25.692  8.130   -42.165 1.00 33.48  ? 342 LYS B C     1 
ATOM   5647  O  O     . LYS B  1 370 ? 26.921  8.043   -42.083 1.00 31.86  ? 342 LYS B O     1 
ATOM   5648  C  CB    . LYS B  1 370 ? 24.424  6.955   -40.352 1.00 36.20  ? 342 LYS B CB    1 
ATOM   5649  C  CG    . LYS B  1 370 ? 25.593  6.071   -39.968 1.00 32.91  ? 342 LYS B CG    1 
ATOM   5650  C  CD    . LYS B  1 370 ? 26.266  6.588   -38.716 1.00 32.62  ? 342 LYS B CD    1 
ATOM   5651  C  CE    . LYS B  1 370 ? 27.632  5.973   -38.552 1.00 41.51  ? 342 LYS B CE    1 
ATOM   5652  N  NZ    . LYS B  1 370 ? 28.180  6.364   -37.238 1.00 52.62  ? 342 LYS B NZ    1 
ATOM   5653  N  N     . ILE B  1 371 ? 25.040  8.080   -43.324 1.00 32.06  ? 343 ILE B N     1 
ATOM   5654  C  CA    . ILE B  1 371 ? 25.730  7.812   -44.588 1.00 36.79  ? 343 ILE B CA    1 
ATOM   5655  C  C     . ILE B  1 371 ? 26.621  9.007   -44.946 1.00 36.53  ? 343 ILE B C     1 
ATOM   5656  O  O     . ILE B  1 371 ? 27.700  8.835   -45.515 1.00 37.06  ? 343 ILE B O     1 
ATOM   5657  C  CB    . ILE B  1 371 ? 24.723  7.473   -45.721 1.00 31.42  ? 343 ILE B CB    1 
ATOM   5658  C  CG1   . ILE B  1 371 ? 24.185  6.043   -45.521 1.00 28.78  ? 343 ILE B CG1   1 
ATOM   5659  C  CG2   . ILE B  1 371 ? 25.370  7.610   -47.105 1.00 33.94  ? 343 ILE B CG2   1 
ATOM   5660  C  CD1   . ILE B  1 371 ? 22.920  5.702   -46.337 1.00 28.03  ? 343 ILE B CD1   1 
ATOM   5661  N  N     . GLY B  1 372 ? 26.181  10.206  -44.576 1.00 37.78  ? 344 GLY B N     1 
ATOM   5662  C  CA    . GLY B  1 372 ? 27.076  11.343  -44.481 1.00 35.12  ? 344 GLY B CA    1 
ATOM   5663  C  C     . GLY B  1 372 ? 27.174  12.257  -45.677 1.00 38.06  ? 344 GLY B C     1 
ATOM   5664  O  O     . GLY B  1 372 ? 28.158  12.962  -45.824 1.00 43.60  ? 344 GLY B O     1 
ATOM   5665  N  N     . ASP B  1 373 ? 26.163  12.256  -46.534 1.00 44.52  ? 345 ASP B N     1 
ATOM   5666  C  CA    . ASP B  1 373 ? 26.157  13.148  -47.693 1.00 40.95  ? 345 ASP B CA    1 
ATOM   5667  C  C     . ASP B  1 373 ? 25.409  14.444  -47.360 1.00 41.87  ? 345 ASP B C     1 
ATOM   5668  O  O     . ASP B  1 373 ? 24.200  14.410  -47.125 1.00 41.11  ? 345 ASP B O     1 
ATOM   5669  C  CB    . ASP B  1 373 ? 25.527  12.431  -48.894 1.00 41.70  ? 345 ASP B CB    1 
ATOM   5670  C  CG    . ASP B  1 373 ? 25.510  13.277  -50.158 1.00 46.95  ? 345 ASP B CG    1 
ATOM   5671  O  OD1   . ASP B  1 373 ? 24.978  12.782  -51.175 1.00 51.65  ? 345 ASP B OD1   1 
ATOM   5672  O  OD2   . ASP B  1 373 ? 26.019  14.422  -50.148 1.00 47.94  ? 345 ASP B OD2   1 
ATOM   5673  N  N     . PRO B  1 374 ? 26.125  15.595  -47.348 1.00 44.53  ? 346 PRO B N     1 
ATOM   5674  C  CA    . PRO B  1 374 ? 25.528  16.862  -46.893 1.00 42.60  ? 346 PRO B CA    1 
ATOM   5675  C  C     . PRO B  1 374 ? 24.378  17.302  -47.772 1.00 40.12  ? 346 PRO B C     1 
ATOM   5676  O  O     . PRO B  1 374 ? 23.559  18.103  -47.342 1.00 43.30  ? 346 PRO B O     1 
ATOM   5677  C  CB    . PRO B  1 374 ? 26.683  17.875  -46.995 1.00 42.37  ? 346 PRO B CB    1 
ATOM   5678  C  CG    . PRO B  1 374 ? 27.910  17.067  -47.155 1.00 51.43  ? 346 PRO B CG    1 
ATOM   5679  C  CD    . PRO B  1 374 ? 27.504  15.790  -47.824 1.00 43.21  ? 346 PRO B CD    1 
ATOM   5680  N  N     . ALA B  1 375 ? 24.323  16.782  -48.994 1.00 37.95  ? 347 ALA B N     1 
ATOM   5681  C  CA    . ALA B  1 375 ? 23.272  17.165  -49.930 1.00 42.73  ? 347 ALA B CA    1 
ATOM   5682  C  C     . ALA B  1 375 ? 21.868  16.777  -49.446 1.00 41.20  ? 347 ALA B C     1 
ATOM   5683  O  O     . ALA B  1 375 ? 20.878  17.304  -49.949 1.00 43.68  ? 347 ALA B O     1 
ATOM   5684  C  CB    . ALA B  1 375 ? 23.543  16.552  -51.309 1.00 43.55  ? 347 ALA B CB    1 
ATOM   5685  N  N     . TYR B  1 376 ? 21.775  15.869  -48.473 1.00 38.49  ? 348 TYR B N     1 
ATOM   5686  C  CA    . TYR B  1 376 ? 20.465  15.477  -47.956 1.00 32.69  ? 348 TYR B CA    1 
ATOM   5687  C  C     . TYR B  1 376 ? 20.095  16.169  -46.644 1.00 35.78  ? 348 TYR B C     1 
ATOM   5688  O  O     . TYR B  1 376 ? 19.015  15.919  -46.117 1.00 32.58  ? 348 TYR B O     1 
ATOM   5689  C  CB    . TYR B  1 376 ? 20.385  13.943  -47.792 1.00 32.86  ? 348 TYR B CB    1 
ATOM   5690  C  CG    . TYR B  1 376 ? 20.207  13.266  -49.131 1.00 30.77  ? 348 TYR B CG    1 
ATOM   5691  C  CD1   . TYR B  1 376 ? 18.943  12.911  -49.591 1.00 28.32  ? 348 TYR B CD1   1 
ATOM   5692  C  CD2   . TYR B  1 376 ? 21.294  13.067  -49.973 1.00 28.05  ? 348 TYR B CD2   1 
ATOM   5693  C  CE1   . TYR B  1 376 ? 18.770  12.316  -50.840 1.00 27.46  ? 348 TYR B CE1   1 
ATOM   5694  C  CE2   . TYR B  1 376 ? 21.134  12.491  -51.229 1.00 36.88  ? 348 TYR B CE2   1 
ATOM   5695  C  CZ    . TYR B  1 376 ? 19.869  12.113  -51.657 1.00 35.82  ? 348 TYR B CZ    1 
ATOM   5696  O  OH    . TYR B  1 376 ? 19.711  11.531  -52.903 1.00 34.96  ? 348 TYR B OH    1 
ATOM   5697  N  N     . ALA B  1 377 ? 20.966  17.044  -46.132 1.00 33.32  ? 349 ALA B N     1 
ATOM   5698  C  CA    . ALA B  1 377 ? 20.708  17.711  -44.855 1.00 36.06  ? 349 ALA B CA    1 
ATOM   5699  C  C     . ALA B  1 377 ? 19.426  18.540  -44.923 1.00 38.91  ? 349 ALA B C     1 
ATOM   5700  O  O     . ALA B  1 377 ? 18.580  18.455  -44.036 1.00 37.29  ? 349 ALA B O     1 
ATOM   5701  C  CB    . ALA B  1 377 ? 21.900  18.593  -44.444 1.00 35.55  ? 349 ALA B CB    1 
ATOM   5702  N  N     . GLU B  1 378 ? 19.276  19.325  -45.983 1.00 35.75  ? 350 GLU B N     1 
ATOM   5703  C  CA    . GLU B  1 378 ? 18.057  20.102  -46.181 1.00 37.23  ? 350 GLU B CA    1 
ATOM   5704  C  C     . GLU B  1 378 ? 16.776  19.258  -46.168 1.00 32.45  ? 350 GLU B C     1 
ATOM   5705  O  O     . GLU B  1 378 ? 15.824  19.589  -45.461 1.00 34.91  ? 350 GLU B O     1 
ATOM   5706  C  CB    . GLU B  1 378 ? 18.134  20.892  -47.494 1.00 39.13  ? 350 GLU B CB    1 
ATOM   5707  C  CG    . GLU B  1 378 ? 18.623  22.314  -47.331 1.00 51.34  ? 350 GLU B CG    1 
ATOM   5708  C  CD    . GLU B  1 378 ? 17.539  23.250  -46.818 1.00 58.23  ? 350 GLU B CD    1 
ATOM   5709  O  OE1   . GLU B  1 378 ? 17.379  24.341  -47.408 1.00 63.51  ? 350 GLU B OE1   1 
ATOM   5710  O  OE2   . GLU B  1 378 ? 16.844  22.901  -45.832 1.00 55.02  ? 350 GLU B OE2   1 
ATOM   5711  N  N     . GLU B  1 379 ? 16.739  18.182  -46.950 1.00 31.87  ? 351 GLU B N     1 
ATOM   5712  C  CA    . GLU B  1 379 ? 15.550  17.322  -46.966 1.00 38.81  ? 351 GLU B CA    1 
ATOM   5713  C  C     . GLU B  1 379 ? 15.276  16.692  -45.580 1.00 31.77  ? 351 GLU B C     1 
ATOM   5714  O  O     . GLU B  1 379 ? 14.114  16.477  -45.226 1.00 27.88  ? 351 GLU B O     1 
ATOM   5715  C  CB    . GLU B  1 379 ? 15.668  16.235  -48.045 1.00 31.84  ? 351 GLU B CB    1 
ATOM   5716  C  CG    . GLU B  1 379 ? 14.358  15.513  -48.387 1.00 36.30  ? 351 GLU B CG    1 
ATOM   5717  C  CD    . GLU B  1 379 ? 13.152  16.429  -48.669 1.00 36.36  ? 351 GLU B CD    1 
ATOM   5718  O  OE1   . GLU B  1 379 ? 13.314  17.639  -48.983 1.00 35.46  ? 351 GLU B OE1   1 
ATOM   5719  O  OE2   . GLU B  1 379 ? 12.007  15.908  -48.596 1.00 34.41  ? 351 GLU B OE2   1 
ATOM   5720  N  N     . LEU B  1 380 ? 16.322  16.426  -44.796 1.00 27.59  ? 352 LEU B N     1 
ATOM   5721  C  CA    . LEU B  1 380 ? 16.113  16.029  -43.400 1.00 31.08  ? 352 LEU B CA    1 
ATOM   5722  C  C     . LEU B  1 380 ? 15.393  17.166  -42.630 1.00 35.74  ? 352 LEU B C     1 
ATOM   5723  O  O     . LEU B  1 380 ? 14.446  16.911  -41.873 1.00 29.64  ? 352 LEU B O     1 
ATOM   5724  C  CB    . LEU B  1 380 ? 17.433  15.683  -42.704 1.00 28.52  ? 352 LEU B CB    1 
ATOM   5725  C  CG    . LEU B  1 380 ? 18.183  14.408  -43.105 1.00 36.39  ? 352 LEU B CG    1 
ATOM   5726  C  CD1   . LEU B  1 380 ? 19.358  14.146  -42.159 1.00 29.28  ? 352 LEU B CD1   1 
ATOM   5727  C  CD2   . LEU B  1 380 ? 17.225  13.211  -43.166 1.00 25.57  ? 352 LEU B CD2   1 
ATOM   5728  N  N     . GLU B  1 381 ? 15.823  18.413  -42.839 1.00 31.37  ? 353 GLU B N     1 
ATOM   5729  C  CA    . GLU B  1 381 ? 15.235  19.542  -42.107 1.00 32.37  ? 353 GLU B CA    1 
ATOM   5730  C  C     . GLU B  1 381 ? 13.771  19.704  -42.463 1.00 31.53  ? 353 GLU B C     1 
ATOM   5731  O  O     . GLU B  1 381 ? 12.956  20.082  -41.633 1.00 31.72  ? 353 GLU B O     1 
ATOM   5732  C  CB    . GLU B  1 381 ? 15.978  20.837  -42.403 1.00 35.96  ? 353 GLU B CB    1 
ATOM   5733  C  CG    . GLU B  1 381 ? 17.470  20.753  -42.200 1.00 41.23  ? 353 GLU B CG    1 
ATOM   5734  C  CD    . GLU B  1 381 ? 17.882  21.101  -40.785 1.00 58.53  ? 353 GLU B CD    1 
ATOM   5735  O  OE1   . GLU B  1 381 ? 16.994  21.154  -39.896 1.00 56.39  ? 353 GLU B OE1   1 
ATOM   5736  O  OE2   . GLU B  1 381 ? 19.097  21.336  -40.565 1.00 62.69  ? 353 GLU B OE2   1 
ATOM   5737  N  N     . LYS B  1 382 ? 13.448  19.416  -43.719 1.00 33.89  ? 354 LYS B N     1 
ATOM   5738  C  CA    . LYS B  1 382 ? 12.093  19.587  -44.212 1.00 31.47  ? 354 LYS B CA    1 
ATOM   5739  C  C     . LYS B  1 382 ? 11.174  18.469  -43.736 1.00 34.02  ? 354 LYS B C     1 
ATOM   5740  O  O     . LYS B  1 382 ? 10.002  18.697  -43.428 1.00 32.07  ? 354 LYS B O     1 
ATOM   5741  C  CB    . LYS B  1 382 ? 12.105  19.672  -45.748 1.00 33.14  ? 354 LYS B CB    1 
ATOM   5742  C  CG    . LYS B  1 382 ? 12.662  21.019  -46.302 1.00 30.90  ? 354 LYS B CG    1 
ATOM   5743  C  CD    . LYS B  1 382 ? 12.730  21.010  -47.830 1.00 33.21  ? 354 LYS B CD    1 
ATOM   5744  C  CE    . LYS B  1 382 ? 13.331  22.301  -48.355 1.00 39.94  ? 354 LYS B CE    1 
ATOM   5745  N  NZ    . LYS B  1 382 ? 12.615  23.502  -47.836 1.00 29.73  ? 354 LYS B NZ    1 
ATOM   5746  N  N     . ALA B  1 383 ? 11.717  17.255  -43.682 1.00 30.50  ? 355 ALA B N     1 
ATOM   5747  C  CA    . ALA B  1 383 ? 10.961  16.079  -43.277 1.00 37.17  ? 355 ALA B CA    1 
ATOM   5748  C  C     . ALA B  1 383 ? 10.540  16.214  -41.827 1.00 34.30  ? 355 ALA B C     1 
ATOM   5749  O  O     . ALA B  1 383 ? 9.434   15.826  -41.448 1.00 34.28  ? 355 ALA B O     1 
ATOM   5750  C  CB    . ALA B  1 383 ? 11.801  14.789  -43.482 1.00 31.98  ? 355 ALA B CB    1 
ATOM   5751  N  N     . LEU B  1 384 ? 11.444  16.765  -41.026 1.00 34.09  ? 356 LEU B N     1 
ATOM   5752  C  CA    . LEU B  1 384 ? 11.195  17.000  -39.608 1.00 36.94  ? 356 LEU B CA    1 
ATOM   5753  C  C     . LEU B  1 384 ? 9.937   17.845  -39.374 1.00 43.42  ? 356 LEU B C     1 
ATOM   5754  O  O     . LEU B  1 384 ? 9.139   17.536  -38.471 1.00 38.38  ? 356 LEU B O     1 
ATOM   5755  C  CB    . LEU B  1 384 ? 12.404  17.681  -38.963 1.00 35.47  ? 356 LEU B CB    1 
ATOM   5756  C  CG    . LEU B  1 384 ? 12.273  18.022  -37.473 1.00 40.45  ? 356 LEU B CG    1 
ATOM   5757  C  CD1   . LEU B  1 384 ? 12.074  16.756  -36.611 1.00 36.42  ? 356 LEU B CD1   1 
ATOM   5758  C  CD2   . LEU B  1 384 ? 13.481  18.796  -37.019 1.00 39.45  ? 356 LEU B CD2   1 
ATOM   5759  N  N     . GLU B  1 385 ? 9.739   18.898  -40.180 1.00 34.07  ? 357 GLU B N     1 
ATOM   5760  C  CA    . GLU B  1 385 ? 8.554   19.736  -39.983 1.00 34.36  ? 357 GLU B CA    1 
ATOM   5761  C  C     . GLU B  1 385 ? 7.274   19.052  -40.461 1.00 32.43  ? 357 GLU B C     1 
ATOM   5762  O  O     . GLU B  1 385 ? 6.184   19.555  -40.233 1.00 35.52  ? 357 GLU B O     1 
ATOM   5763  C  CB    . GLU B  1 385 ? 8.710   21.092  -40.688 1.00 31.09  ? 357 GLU B CB    1 
ATOM   5764  C  CG    . GLU B  1 385 ? 9.901   21.897  -40.200 1.00 36.32  ? 357 GLU B CG    1 
ATOM   5765  C  CD    . GLU B  1 385 ? 9.971   21.993  -38.676 1.00 43.91  ? 357 GLU B CD    1 
ATOM   5766  O  OE1   . GLU B  1 385 ? 8.943   22.301  -38.035 1.00 41.10  ? 357 GLU B OE1   1 
ATOM   5767  O  OE2   . GLU B  1 385 ? 11.059  21.755  -38.116 1.00 43.25  ? 357 GLU B OE2   1 
ATOM   5768  N  N     . LYS B  1 386 ? 7.396   17.908  -41.127 1.00 35.25  ? 358 LYS B N     1 
ATOM   5769  C  CA    . LYS B  1 386 ? 6.215   17.246  -41.687 1.00 35.17  ? 358 LYS B CA    1 
ATOM   5770  C  C     . LYS B  1 386 ? 5.854   15.946  -40.949 1.00 39.49  ? 358 LYS B C     1 
ATOM   5771  O  O     . LYS B  1 386 ? 4.697   15.531  -40.942 1.00 40.92  ? 358 LYS B O     1 
ATOM   5772  C  CB    . LYS B  1 386 ? 6.431   16.982  -43.186 1.00 30.89  ? 358 LYS B CB    1 
ATOM   5773  C  CG    . LYS B  1 386 ? 6.604   18.282  -43.994 1.00 35.90  ? 358 LYS B CG    1 
ATOM   5774  C  CD    . LYS B  1 386 ? 7.016   18.046  -45.448 1.00 36.58  ? 358 LYS B CD    1 
ATOM   5775  C  CE    . LYS B  1 386 ? 5.829   17.821  -46.355 1.00 39.30  ? 358 LYS B CE    1 
ATOM   5776  N  NZ    . LYS B  1 386 ? 6.261   17.484  -47.767 1.00 37.02  ? 358 LYS B NZ    1 
ATOM   5777  N  N     . GLU B  1 387 ? 6.856   15.319  -40.333 1.00 36.12  ? 359 GLU B N     1 
ATOM   5778  C  CA    . GLU B  1 387 ? 6.680   14.098  -39.555 1.00 36.42  ? 359 GLU B CA    1 
ATOM   5779  C  C     . GLU B  1 387 ? 5.876   14.333  -38.276 1.00 36.10  ? 359 GLU B C     1 
ATOM   5780  O  O     . GLU B  1 387 ? 6.239   15.177  -37.475 1.00 35.54  ? 359 GLU B O     1 
ATOM   5781  C  CB    . GLU B  1 387 ? 8.048   13.507  -39.199 1.00 37.53  ? 359 GLU B CB    1 
ATOM   5782  C  CG    . GLU B  1 387 ? 7.959   12.232  -38.365 1.00 32.94  ? 359 GLU B CG    1 
ATOM   5783  C  CD    . GLU B  1 387 ? 7.217   11.138  -39.103 1.00 38.39  ? 359 GLU B CD    1 
ATOM   5784  O  OE1   . GLU B  1 387 ? 7.664   10.798  -40.217 1.00 38.82  ? 359 GLU B OE1   1 
ATOM   5785  O  OE2   . GLU B  1 387 ? 6.183   10.636  -38.594 1.00 37.69  ? 359 GLU B OE2   1 
ATOM   5786  N  N     . LYS B  1 388 ? 4.793   13.582  -38.079 1.00 36.56  ? 360 LYS B N     1 
ATOM   5787  C  CA    . LYS B  1 388 ? 3.954   13.769  -36.888 1.00 39.61  ? 360 LYS B CA    1 
ATOM   5788  C  C     . LYS B  1 388 ? 4.338   12.808  -35.750 1.00 39.96  ? 360 LYS B C     1 
ATOM   5789  O  O     . LYS B  1 388 ? 4.096   13.096  -34.575 1.00 39.90  ? 360 LYS B O     1 
ATOM   5790  C  CB    . LYS B  1 388 ? 2.469   13.585  -37.235 1.00 37.48  ? 360 LYS B CB    1 
ATOM   5791  C  CG    . LYS B  1 388 ? 1.930   14.575  -38.257 1.00 49.92  ? 360 LYS B CG    1 
ATOM   5792  C  CD    . LYS B  1 388 ? 2.085   16.020  -37.775 1.00 51.08  ? 360 LYS B CD    1 
ATOM   5793  C  CE    . LYS B  1 388 ? 1.781   16.997  -38.915 1.00 57.16  ? 360 LYS B CE    1 
ATOM   5794  N  NZ    . LYS B  1 388 ? 2.229   18.388  -38.610 1.00 60.94  ? 360 LYS B NZ    1 
ATOM   5795  N  N     . ASP B  1 389 ? 4.926   11.666  -36.090 1.00 33.34  ? 361 ASP B N     1 
ATOM   5796  C  CA    . ASP B  1 389 ? 5.315   10.706  -35.058 1.00 37.26  ? 361 ASP B CA    1 
ATOM   5797  C  C     . ASP B  1 389 ? 6.528   11.204  -34.288 1.00 36.16  ? 361 ASP B C     1 
ATOM   5798  O  O     . ASP B  1 389 ? 7.560   11.504  -34.882 1.00 35.29  ? 361 ASP B O     1 
ATOM   5799  C  CB    . ASP B  1 389 ? 5.609   9.335   -35.668 1.00 35.29  ? 361 ASP B CB    1 
ATOM   5800  C  CG    . ASP B  1 389 ? 5.865   8.282   -34.603 1.00 38.66  ? 361 ASP B CG    1 
ATOM   5801  O  OD1   . ASP B  1 389 ? 4.886   7.726   -34.076 1.00 40.50  ? 361 ASP B OD1   1 
ATOM   5802  O  OD2   . ASP B  1 389 ? 7.042   8.029   -34.279 1.00 38.88  ? 361 ASP B OD2   1 
ATOM   5803  N  N     . GLU B  1 390 ? 6.408   11.286  -32.964 1.00 37.35  ? 362 GLU B N     1 
ATOM   5804  C  CA    . GLU B  1 390 ? 7.452   11.896  -32.141 1.00 37.45  ? 362 GLU B CA    1 
ATOM   5805  C  C     . GLU B  1 390 ? 8.771   11.125  -32.170 1.00 35.00  ? 362 GLU B C     1 
ATOM   5806  O  O     . GLU B  1 390 ? 9.851   11.722  -32.190 1.00 33.82  ? 362 GLU B O     1 
ATOM   5807  C  CB    . GLU B  1 390 ? 6.970   12.044  -30.691 1.00 41.12  ? 362 GLU B CB    1 
ATOM   5808  C  CG    . GLU B  1 390 ? 5.952   13.176  -30.480 1.00 48.08  ? 362 GLU B CG    1 
ATOM   5809  C  CD    . GLU B  1 390 ? 6.497   14.565  -30.831 1.00 51.55  ? 362 GLU B CD    1 
ATOM   5810  O  OE1   . GLU B  1 390 ? 7.733   14.751  -30.813 1.00 54.38  ? 362 GLU B OE1   1 
ATOM   5811  O  OE2   . GLU B  1 390 ? 5.692   15.477  -31.137 1.00 57.84  ? 362 GLU B OE2   1 
ATOM   5812  N  N     . GLU B  1 391 ? 8.682   9.800   -32.166 1.00 34.91  ? 363 GLU B N     1 
ATOM   5813  C  CA    . GLU B  1 391 ? 9.875   8.964   -32.182 1.00 35.09  ? 363 GLU B CA    1 
ATOM   5814  C  C     . GLU B  1 391 ? 10.573  9.030   -33.536 1.00 31.88  ? 363 GLU B C     1 
ATOM   5815  O  O     . GLU B  1 391 ? 11.793  9.094   -33.605 1.00 33.31  ? 363 GLU B O     1 
ATOM   5816  C  CB    . GLU B  1 391 ? 9.525   7.521   -31.837 1.00 40.13  ? 363 GLU B CB    1 
ATOM   5817  C  CG    . GLU B  1 391 ? 9.159   7.297   -30.366 1.00 37.69  ? 363 GLU B CG    1 
ATOM   5818  C  CD    . GLU B  1 391 ? 8.957   5.822   -30.068 1.00 51.18  ? 363 GLU B CD    1 
ATOM   5819  O  OE1   . GLU B  1 391 ? 7.889   5.281   -30.440 1.00 51.57  ? 363 GLU B OE1   1 
ATOM   5820  O  OE2   . GLU B  1 391 ? 9.878   5.196   -29.491 1.00 49.03  ? 363 GLU B OE2   1 
ATOM   5821  N  N     . ALA B  1 392 ? 9.798   9.037   -34.608 1.00 27.60  ? 364 ALA B N     1 
ATOM   5822  C  CA    . ALA B  1 392 ? 10.363  9.281   -35.940 1.00 34.36  ? 364 ALA B CA    1 
ATOM   5823  C  C     . ALA B  1 392 ? 10.969  10.688  -36.062 1.00 32.45  ? 364 ALA B C     1 
ATOM   5824  O  O     . ALA B  1 392 ? 12.038  10.841  -36.656 1.00 33.59  ? 364 ALA B O     1 
ATOM   5825  C  CB    . ALA B  1 392 ? 9.304   9.062   -37.024 1.00 30.80  ? 364 ALA B CB    1 
ATOM   5826  N  N     . LYS B  1 393 ? 10.292  11.706  -35.518 1.00 32.55  ? 365 LYS B N     1 
ATOM   5827  C  CA    . LYS B  1 393 ? 10.839  13.068  -35.486 1.00 31.96  ? 365 LYS B CA    1 
ATOM   5828  C  C     . LYS B  1 393 ? 12.209  13.030  -34.858 1.00 35.54  ? 365 LYS B C     1 
ATOM   5829  O  O     . LYS B  1 393 ? 13.172  13.625  -35.343 1.00 34.52  ? 365 LYS B O     1 
ATOM   5830  C  CB    . LYS B  1 393 ? 9.970   14.022  -34.664 1.00 35.13  ? 365 LYS B CB    1 
ATOM   5831  C  CG    . LYS B  1 393 ? 8.936   14.821  -35.404 1.00 41.01  ? 365 LYS B CG    1 
ATOM   5832  C  CD    . LYS B  1 393 ? 8.629   16.085  -34.598 1.00 43.14  ? 365 LYS B CD    1 
ATOM   5833  C  CE    . LYS B  1 393 ? 7.312   16.745  -35.001 1.00 47.88  ? 365 LYS B CE    1 
ATOM   5834  N  NZ    . LYS B  1 393 ? 6.108   16.061  -34.428 1.00 52.97  ? 365 LYS B NZ    1 
ATOM   5835  N  N     . LEU B  1 394 ? 12.270  12.324  -33.739 1.00 31.38  ? 366 LEU B N     1 
ATOM   5836  C  CA    . LEU B  1 394 ? 13.493  12.214  -32.986 1.00 32.66  ? 366 LEU B CA    1 
ATOM   5837  C  C     . LEU B  1 394 ? 14.632  11.580  -33.808 1.00 32.20  ? 366 LEU B C     1 
ATOM   5838  O  O     . LEU B  1 394 ? 15.785  12.029  -33.733 1.00 29.88  ? 366 LEU B O     1 
ATOM   5839  C  CB    . LEU B  1 394 ? 13.220  11.414  -31.728 1.00 32.24  ? 366 LEU B CB    1 
ATOM   5840  C  CG    . LEU B  1 394 ? 14.497  10.923  -31.093 1.00 40.51  ? 366 LEU B CG    1 
ATOM   5841  C  CD1   . LEU B  1 394 ? 15.137  12.083  -30.313 1.00 43.05  ? 366 LEU B CD1   1 
ATOM   5842  C  CD2   . LEU B  1 394 ? 14.136  9.717   -30.247 1.00 45.44  ? 366 LEU B CD2   1 
ATOM   5843  N  N     . GLU B  1 395 ? 14.312  10.551  -34.603 1.00 25.90  ? 367 GLU B N     1 
ATOM   5844  C  CA    . GLU B  1 395 ? 15.327  9.924   -35.434 1.00 25.79  ? 367 GLU B CA    1 
ATOM   5845  C  C     . GLU B  1 395 ? 15.824  10.907  -36.531 1.00 32.47  ? 367 GLU B C     1 
ATOM   5846  O  O     . GLU B  1 395 ? 17.014  10.942  -36.850 1.00 29.42  ? 367 GLU B O     1 
ATOM   5847  C  CB    . GLU B  1 395 ? 14.789  8.634   -36.056 1.00 27.63  ? 367 GLU B CB    1 
ATOM   5848  C  CG    . GLU B  1 395 ? 14.493  7.490   -35.060 1.00 28.78  ? 367 GLU B CG    1 
ATOM   5849  C  CD    . GLU B  1 395 ? 15.753  6.925   -34.422 1.00 36.76  ? 367 GLU B CD    1 
ATOM   5850  O  OE1   . GLU B  1 395 ? 16.848  7.153   -34.970 1.00 35.06  ? 367 GLU B OE1   1 
ATOM   5851  O  OE2   . GLU B  1 395 ? 15.658  6.253   -33.367 1.00 36.46  ? 367 GLU B OE2   1 
ATOM   5852  N  N     . ILE B  1 396 ? 14.918  11.696  -37.101 1.00 27.73  ? 368 ILE B N     1 
ATOM   5853  C  CA    . ILE B  1 396 ? 15.307  12.724  -38.074 1.00 33.63  ? 368 ILE B CA    1 
ATOM   5854  C  C     . ILE B  1 396 ? 16.269  13.733  -37.421 1.00 35.63  ? 368 ILE B C     1 
ATOM   5855  O  O     . ILE B  1 396 ? 17.282  14.126  -38.013 1.00 32.67  ? 368 ILE B O     1 
ATOM   5856  C  CB    . ILE B  1 396 ? 14.068  13.465  -38.642 1.00 31.86  ? 368 ILE B CB    1 
ATOM   5857  C  CG1   . ILE B  1 396 ? 13.122  12.475  -39.328 1.00 34.90  ? 368 ILE B CG1   1 
ATOM   5858  C  CG2   . ILE B  1 396 ? 14.490  14.530  -39.636 1.00 33.23  ? 368 ILE B CG2   1 
ATOM   5859  C  CD1   . ILE B  1 396 ? 11.744  13.026  -39.618 1.00 30.78  ? 368 ILE B CD1   1 
ATOM   5860  N  N     . GLU B  1 397 ? 15.962  14.121  -36.185 1.00 33.00  ? 369 GLU B N     1 
ATOM   5861  C  CA    . GLU B  1 397 ? 16.824  15.022  -35.430 1.00 33.74  ? 369 GLU B CA    1 
ATOM   5862  C  C     . GLU B  1 397 ? 18.201  14.418  -35.152 1.00 37.77  ? 369 GLU B C     1 
ATOM   5863  O  O     . GLU B  1 397 ? 19.203  15.136  -35.134 1.00 33.95  ? 369 GLU B O     1 
ATOM   5864  C  CB    . GLU B  1 397 ? 16.140  15.413  -34.123 1.00 33.14  ? 369 GLU B CB    1 
ATOM   5865  C  CG    . GLU B  1 397 ? 15.068  16.461  -34.365 1.00 41.42  ? 369 GLU B CG    1 
ATOM   5866  C  CD    . GLU B  1 397 ? 14.275  16.781  -33.136 1.00 45.92  ? 369 GLU B CD    1 
ATOM   5867  O  OE1   . GLU B  1 397 ? 13.901  15.822  -32.417 1.00 48.94  ? 369 GLU B OE1   1 
ATOM   5868  O  OE2   . GLU B  1 397 ? 14.021  17.989  -32.897 1.00 53.40  ? 369 GLU B OE2   1 
ATOM   5869  N  N     . LYS B  1 398 ? 18.245  13.096  -34.944 1.00 32.11  ? 370 LYS B N     1 
ATOM   5870  C  CA    . LYS B  1 398 ? 19.518  12.399  -34.816 1.00 33.94  ? 370 LYS B CA    1 
ATOM   5871  C  C     . LYS B  1 398 ? 20.250  12.367  -36.162 1.00 33.66  ? 370 LYS B C     1 
ATOM   5872  O  O     . LYS B  1 398 ? 21.458  12.568  -36.220 1.00 33.77  ? 370 LYS B O     1 
ATOM   5873  C  CB    . LYS B  1 398 ? 19.310  10.982  -34.290 1.00 38.74  ? 370 LYS B CB    1 
ATOM   5874  C  CG    . LYS B  1 398 ? 18.853  10.925  -32.842 1.00 35.03  ? 370 LYS B CG    1 
ATOM   5875  C  CD    . LYS B  1 398 ? 18.916  9.492   -32.305 1.00 38.85  ? 370 LYS B CD    1 
ATOM   5876  C  CE    . LYS B  1 398 ? 17.542  8.846   -32.262 1.00 43.31  ? 370 LYS B CE    1 
ATOM   5877  N  NZ    . LYS B  1 398 ? 17.572  7.484   -31.603 1.00 41.33  ? 370 LYS B NZ    1 
ATOM   5878  N  N     . GLY B  1 399 ? 19.505  12.132  -37.238 1.00 30.56  ? 371 GLY B N     1 
ATOM   5879  C  CA    . GLY B  1 399 ? 20.052  12.199  -38.585 1.00 33.85  ? 371 GLY B CA    1 
ATOM   5880  C  C     . GLY B  1 399 ? 20.691  13.547  -38.906 1.00 34.31  ? 371 GLY B C     1 
ATOM   5881  O  O     . GLY B  1 399 ? 21.821  13.594  -39.386 1.00 30.86  ? 371 GLY B O     1 
ATOM   5882  N  N     . ILE B  1 400 ? 19.969  14.630  -38.620 1.00 34.80  ? 372 ILE B N     1 
ATOM   5883  C  CA    . ILE B  1 400 ? 20.472  16.005  -38.818 1.00 35.36  ? 372 ILE B CA    1 
ATOM   5884  C  C     . ILE B  1 400 ? 21.757  16.214  -38.032 1.00 38.60  ? 372 ILE B C     1 
ATOM   5885  O  O     . ILE B  1 400 ? 22.747  16.698  -38.568 1.00 36.84  ? 372 ILE B O     1 
ATOM   5886  C  CB    . ILE B  1 400 ? 19.419  17.047  -38.403 1.00 35.50  ? 372 ILE B CB    1 
ATOM   5887  C  CG1   . ILE B  1 400 ? 18.215  16.986  -39.361 1.00 30.88  ? 372 ILE B CG1   1 
ATOM   5888  C  CG2   . ILE B  1 400 ? 20.025  18.469  -38.322 1.00 33.71  ? 372 ILE B CG2   1 
ATOM   5889  C  CD1   . ILE B  1 400 ? 17.001  17.788  -38.893 1.00 35.05  ? 372 ILE B CD1   1 
ATOM   5890  N  N     . GLU B  1 401 ? 21.748  15.801  -36.768 1.00 38.31  ? 373 GLU B N     1 
ATOM   5891  C  CA    . GLU B  1 401 ? 22.924  15.939  -35.921 1.00 37.69  ? 373 GLU B CA    1 
ATOM   5892  C  C     . GLU B  1 401 ? 24.137  15.170  -36.462 1.00 42.43  ? 373 GLU B C     1 
ATOM   5893  O  O     . GLU B  1 401 ? 25.268  15.658  -36.386 1.00 38.02  ? 373 GLU B O     1 
ATOM   5894  C  CB    . GLU B  1 401 ? 22.597  15.468  -34.508 1.00 44.93  ? 373 GLU B CB    1 
ATOM   5895  C  CG    . GLU B  1 401 ? 23.559  15.968  -33.459 1.00 48.46  ? 373 GLU B CG    1 
ATOM   5896  C  CD    . GLU B  1 401 ? 23.361  17.448  -33.145 1.00 53.98  ? 373 GLU B CD    1 
ATOM   5897  O  OE1   . GLU B  1 401 ? 22.215  17.944  -33.258 1.00 52.50  ? 373 GLU B OE1   1 
ATOM   5898  O  OE2   . GLU B  1 401 ? 24.356  18.113  -32.778 1.00 58.70  ? 373 GLU B OE2   1 
ATOM   5899  N  N     . LEU B  1 402 ? 23.908  13.971  -37.008 1.00 37.49  ? 374 LEU B N     1 
ATOM   5900  C  CA    . LEU B  1 402 ? 24.997  13.176  -37.577 1.00 37.09  ? 374 LEU B CA    1 
ATOM   5901  C  C     . LEU B  1 402 ? 25.647  13.864  -38.772 1.00 40.51  ? 374 LEU B C     1 
ATOM   5902  O  O     . LEU B  1 402 ? 26.867  13.837  -38.927 1.00 42.38  ? 374 LEU B O     1 
ATOM   5903  C  CB    . LEU B  1 402 ? 24.501  11.798  -38.010 1.00 33.35  ? 374 LEU B CB    1 
ATOM   5904  C  CG    . LEU B  1 402 ? 24.202  10.812  -36.890 1.00 39.69  ? 374 LEU B CG    1 
ATOM   5905  C  CD1   . LEU B  1 402 ? 23.721  9.515   -37.493 1.00 34.96  ? 374 LEU B CD1   1 
ATOM   5906  C  CD2   . LEU B  1 402 ? 25.437  10.599  -36.033 1.00 37.78  ? 374 LEU B CD2   1 
ATOM   5907  N  N     . LEU B  1 403 ? 24.813  14.447  -39.624 1.00 33.45  ? 375 LEU B N     1 
ATOM   5908  C  CA    . LEU B  1 403 ? 25.269  15.173  -40.799 1.00 41.71  ? 375 LEU B CA    1 
ATOM   5909  C  C     . LEU B  1 403 ? 25.972  16.474  -40.420 1.00 47.42  ? 375 LEU B C     1 
ATOM   5910  O  O     . LEU B  1 403 ? 26.955  16.862  -41.042 1.00 55.69  ? 375 LEU B O     1 
ATOM   5911  C  CB    . LEU B  1 403 ? 24.093  15.468  -41.724 1.00 36.27  ? 375 LEU B CB    1 
ATOM   5912  C  CG    . LEU B  1 403 ? 23.807  14.397  -42.775 1.00 43.96  ? 375 LEU B CG    1 
ATOM   5913  C  CD1   . LEU B  1 403 ? 22.696  14.862  -43.715 1.00 39.34  ? 375 LEU B CD1   1 
ATOM   5914  C  CD2   . LEU B  1 403 ? 25.073  14.086  -43.565 1.00 41.51  ? 375 LEU B CD2   1 
ATOM   5915  N  N     . LYS B  1 404 ? 25.463  17.147  -39.397 1.00 49.12  ? 376 LYS B N     1 
ATOM   5916  C  CA    A LYS B  1 404 ? 26.083  18.384  -38.940 0.49 49.12  ? 376 LYS B CA    1 
ATOM   5917  C  CA    B LYS B  1 404 ? 26.066  18.375  -38.888 0.51 49.12  ? 376 LYS B CA    1 
ATOM   5918  C  C     . LYS B  1 404 ? 27.470  18.103  -38.354 1.00 52.91  ? 376 LYS B C     1 
ATOM   5919  O  O     . LYS B  1 404 ? 28.395  18.883  -38.550 1.00 60.90  ? 376 LYS B O     1 
ATOM   5920  C  CB    A LYS B  1 404 ? 25.188  19.091  -37.918 0.49 47.57  ? 376 LYS B CB    1 
ATOM   5921  C  CB    B LYS B  1 404 ? 25.181  18.979  -37.792 0.51 47.52  ? 376 LYS B CB    1 
ATOM   5922  C  CG    A LYS B  1 404 ? 25.193  20.613  -38.047 0.49 51.30  ? 376 LYS B CG    1 
ATOM   5923  C  CG    B LYS B  1 404 ? 25.839  20.066  -36.958 0.51 50.37  ? 376 LYS B CG    1 
ATOM   5924  C  CD    A LYS B  1 404 ? 23.777  21.184  -38.162 0.49 48.05  ? 376 LYS B CD    1 
ATOM   5925  C  CD    B LYS B  1 404 ? 24.901  20.566  -35.865 0.51 45.83  ? 376 LYS B CD    1 
ATOM   5926  C  CE    A LYS B  1 404 ? 22.985  20.993  -36.876 0.49 47.04  ? 376 LYS B CE    1 
ATOM   5927  C  CE    B LYS B  1 404 ? 25.617  21.506  -34.907 0.51 51.28  ? 376 LYS B CE    1 
ATOM   5928  N  NZ    A LYS B  1 404 ? 21.607  21.560  -36.982 0.49 43.61  ? 376 LYS B NZ    1 
ATOM   5929  N  NZ    B LYS B  1 404 ? 24.776  21.861  -33.725 0.51 49.38  ? 376 LYS B NZ    1 
ATOM   5930  N  N     . ALA B  1 405 ? 27.624  16.975  -37.668 1.00 54.09  ? 377 ALA B N     1 
ATOM   5931  C  CA    . ALA B  1 405 ? 28.906  16.625  -37.068 1.00 56.76  ? 377 ALA B CA    1 
ATOM   5932  C  C     . ALA B  1 405 ? 29.957  16.269  -38.122 1.00 64.50  ? 377 ALA B C     1 
ATOM   5933  O  O     . ALA B  1 405 ? 31.079  16.770  -38.071 1.00 74.12  ? 377 ALA B O     1 
ATOM   5934  C  CB    . ALA B  1 405 ? 28.736  15.478  -36.087 1.00 49.62  ? 377 ALA B CB    1 
ATOM   5935  N  N     . SER B  1 406 ? 29.592  15.406  -39.069 1.00 58.32  ? 378 SER B N     1 
ATOM   5936  C  CA    . SER B  1 406 ? 30.501  14.989  -40.144 1.00 59.33  ? 378 SER B CA    1 
ATOM   5937  C  C     . SER B  1 406 ? 30.772  16.106  -41.163 1.00 65.07  ? 378 SER B C     1 
ATOM   5938  O  O     . SER B  1 406 ? 31.830  16.136  -41.790 1.00 65.93  ? 378 SER B O     1 
ATOM   5939  C  CB    . SER B  1 406 ? 29.947  13.749  -40.863 1.00 56.71  ? 378 SER B CB    1 
ATOM   5940  O  OG    . SER B  1 406 ? 28.635  13.967  -41.365 1.00 53.53  ? 378 SER B OG    1 
ATOM   5941  N  N     . GLY B  1 407 ? 29.815  17.015  -41.328 1.00 62.69  ? 379 GLY B N     1 
ATOM   5942  C  CA    . GLY B  1 407 ? 30.024  18.199  -42.148 1.00 67.36  ? 379 GLY B CA    1 
ATOM   5943  C  C     . GLY B  1 407 ? 31.084  19.113  -41.546 1.00 71.07  ? 379 GLY B C     1 
ATOM   5944  O  O     . GLY B  1 407 ? 31.777  19.838  -42.266 1.00 68.80  ? 379 GLY B O     1 
ATOM   5945  N  N     . MET B  1 408 ? 31.204  19.070  -40.219 1.00 74.19  ? 380 MET B N     1 
ATOM   5946  C  CA    . MET B  1 408 ? 32.262  19.780  -39.500 1.00 80.24  ? 380 MET B CA    1 
ATOM   5947  C  C     . MET B  1 408 ? 33.558  18.961  -39.507 1.00 82.55  ? 380 MET B C     1 
ATOM   5948  O  O     . MET B  1 408 ? 34.314  18.974  -38.532 1.00 85.76  ? 380 MET B O     1 
ATOM   5949  C  CB    . MET B  1 408 ? 31.838  20.083  -38.052 1.00 79.91  ? 380 MET B CB    1 
ATOM   5950  C  CG    . MET B  1 408 ? 30.639  21.031  -37.895 1.00 81.59  ? 380 MET B CG    1 
ATOM   5951  S  SD    . MET B  1 408 ? 30.975  22.781  -38.234 1.00 101.23 ? 380 MET B SD    1 
ATOM   5952  C  CE    . MET B  1 408 ? 29.348  23.500  -37.982 1.00 85.75  ? 380 MET B CE    1 
ATOM   5953  N  N     . THR B  1 409 ? 33.794  18.237  -40.600 1.00 79.59  ? 381 THR B N     1 
ATOM   5954  C  CA    . THR B  1 409 ? 35.055  17.524  -40.826 1.00 82.97  ? 381 THR B CA    1 
ATOM   5955  C  C     . THR B  1 409 ? 35.233  17.195  -42.310 1.00 80.80  ? 381 THR B C     1 
ATOM   5956  O  O     . THR B  1 409 ? 35.229  18.087  -43.163 1.00 80.32  ? 381 THR B O     1 
ATOM   5957  C  CB    . THR B  1 409 ? 35.145  16.213  -40.008 1.00 81.81  ? 381 THR B CB    1 
ATOM   5958  O  OG1   . THR B  1 409 ? 34.978  16.495  -38.613 1.00 82.86  ? 381 THR B OG1   1 
ATOM   5959  C  CG2   . THR B  1 409 ? 36.499  15.540  -40.225 1.00 75.28  ? 381 THR B CG2   1 
ATOM   5960  N  N     . ASN C  1 30  ? -33.643 54.303  -18.850 1.00 39.50  ? 2   ASN C N     1 
ATOM   5961  C  CA    . ASN C  1 30  ? -34.990 53.815  -19.146 1.00 52.54  ? 2   ASN C CA    1 
ATOM   5962  C  C     . ASN C  1 30  ? -35.086 52.283  -19.047 1.00 53.17  ? 2   ASN C C     1 
ATOM   5963  O  O     . ASN C  1 30  ? -35.745 51.761  -18.146 1.00 55.76  ? 2   ASN C O     1 
ATOM   5964  C  CB    . ASN C  1 30  ? -35.434 54.283  -20.525 1.00 53.71  ? 2   ASN C CB    1 
ATOM   5965  C  CG    . ASN C  1 30  ? -36.681 53.569  -21.006 1.00 63.72  ? 2   ASN C CG    1 
ATOM   5966  O  OD1   . ASN C  1 30  ? -36.662 52.896  -22.044 1.00 65.83  ? 2   ASN C OD1   1 
ATOM   5967  N  ND2   . ASN C  1 30  ? -37.772 53.706  -20.252 1.00 58.19  ? 2   ASN C ND2   1 
ATOM   5968  N  N     . VAL C  1 31  ? -34.435 51.567  -19.962 1.00 47.25  ? 3   VAL C N     1 
ATOM   5969  C  CA    . VAL C  1 31  ? -34.245 50.131  -19.780 1.00 48.05  ? 3   VAL C CA    1 
ATOM   5970  C  C     . VAL C  1 31  ? -33.259 49.908  -18.628 1.00 49.50  ? 3   VAL C C     1 
ATOM   5971  O  O     . VAL C  1 31  ? -33.369 48.923  -17.879 1.00 48.81  ? 3   VAL C O     1 
ATOM   5972  C  CB    . VAL C  1 31  ? -33.750 49.440  -21.072 1.00 45.45  ? 3   VAL C CB    1 
ATOM   5973  C  CG1   . VAL C  1 31  ? -33.162 48.078  -20.779 1.00 42.26  ? 3   VAL C CG1   1 
ATOM   5974  C  CG2   . VAL C  1 31  ? -34.891 49.309  -22.061 1.00 51.41  ? 3   VAL C CG2   1 
ATOM   5975  N  N     . TYR C  1 32  ? -32.310 50.828  -18.455 1.00 41.79  ? 4   TYR C N     1 
ATOM   5976  C  CA    . TYR C  1 32  ? -31.431 50.732  -17.296 1.00 49.70  ? 4   TYR C CA    1 
ATOM   5977  C  C     . TYR C  1 32  ? -32.237 51.014  -16.032 1.00 48.88  ? 4   TYR C C     1 
ATOM   5978  O  O     . TYR C  1 32  ? -31.970 50.445  -14.971 1.00 49.30  ? 4   TYR C O     1 
ATOM   5979  C  CB    . TYR C  1 32  ? -30.243 51.689  -17.385 1.00 49.37  ? 4   TYR C CB    1 
ATOM   5980  C  CG    . TYR C  1 32  ? -29.477 51.759  -16.078 1.00 55.59  ? 4   TYR C CG    1 
ATOM   5981  C  CD1   . TYR C  1 32  ? -28.905 50.611  -15.522 1.00 59.31  ? 4   TYR C CD1   1 
ATOM   5982  C  CD2   . TYR C  1 32  ? -29.347 52.959  -15.382 1.00 51.72  ? 4   TYR C CD2   1 
ATOM   5983  C  CE1   . TYR C  1 32  ? -28.209 50.663  -14.318 1.00 60.90  ? 4   TYR C CE1   1 
ATOM   5984  C  CE2   . TYR C  1 32  ? -28.653 53.021  -14.178 1.00 53.19  ? 4   TYR C CE2   1 
ATOM   5985  C  CZ    . TYR C  1 32  ? -28.089 51.874  -13.652 1.00 59.32  ? 4   TYR C CZ    1 
ATOM   5986  O  OH    . TYR C  1 32  ? -27.403 51.931  -12.458 1.00 65.95  ? 4   TYR C OH    1 
ATOM   5987  N  N     . GLN C  1 33  ? -33.236 51.879  -16.157 1.00 47.85  ? 5   GLN C N     1 
ATOM   5988  C  CA    . GLN C  1 33  ? -34.096 52.207  -15.025 1.00 48.76  ? 5   GLN C CA    1 
ATOM   5989  C  C     . GLN C  1 33  ? -34.995 51.033  -14.695 1.00 43.69  ? 5   GLN C C     1 
ATOM   5990  O  O     . GLN C  1 33  ? -35.171 50.687  -13.524 1.00 41.80  ? 5   GLN C O     1 
ATOM   5991  C  CB    . GLN C  1 33  ? -34.947 53.444  -15.313 1.00 52.19  ? 5   GLN C CB    1 
ATOM   5992  C  CG    . GLN C  1 33  ? -35.908 53.805  -14.183 1.00 58.05  ? 5   GLN C CG    1 
ATOM   5993  C  CD    . GLN C  1 33  ? -36.842 54.945  -14.556 1.00 65.90  ? 5   GLN C CD    1 
ATOM   5994  O  OE1   . GLN C  1 33  ? -36.720 55.538  -15.631 1.00 63.71  ? 5   GLN C OE1   1 
ATOM   5995  N  NE2   . GLN C  1 33  ? -37.785 55.251  -13.672 1.00 69.03  ? 5   GLN C NE2   1 
ATOM   5996  N  N     . LEU C  1 34  ? -35.571 50.431  -15.732 1.00 44.80  ? 6   LEU C N     1 
ATOM   5997  C  CA    . LEU C  1 34  ? -36.442 49.282  -15.547 1.00 43.34  ? 6   LEU C CA    1 
ATOM   5998  C  C     . LEU C  1 34  ? -35.669 48.147  -14.868 1.00 42.75  ? 6   LEU C C     1 
ATOM   5999  O  O     . LEU C  1 34  ? -36.169 47.506  -13.943 1.00 36.97  ? 6   LEU C O     1 
ATOM   6000  C  CB    . LEU C  1 34  ? -37.019 48.826  -16.878 1.00 41.27  ? 6   LEU C CB    1 
ATOM   6001  C  CG    . LEU C  1 34  ? -38.071 47.715  -16.806 1.00 38.98  ? 6   LEU C CG    1 
ATOM   6002  C  CD1   . LEU C  1 34  ? -39.281 48.180  -16.019 1.00 40.79  ? 6   LEU C CD1   1 
ATOM   6003  C  CD2   . LEU C  1 34  ? -38.488 47.288  -18.195 1.00 41.13  ? 6   LEU C CD2   1 
ATOM   6004  N  N     . LYS C  1 35  ? -34.433 47.943  -15.311 1.00 38.81  ? 7   LYS C N     1 
ATOM   6005  C  CA    . LYS C  1 35  ? -33.589 46.891  -14.772 1.00 39.93  ? 7   LYS C CA    1 
ATOM   6006  C  C     . LYS C  1 35  ? -33.324 47.075  -13.279 1.00 46.36  ? 7   LYS C C     1 
ATOM   6007  O  O     . LYS C  1 35  ? -33.397 46.109  -12.499 1.00 36.64  ? 7   LYS C O     1 
ATOM   6008  C  CB    . LYS C  1 35  ? -32.266 46.829  -15.539 1.00 40.76  ? 7   LYS C CB    1 
ATOM   6009  C  CG    . LYS C  1 35  ? -31.294 45.791  -14.994 1.00 42.37  ? 7   LYS C CG    1 
ATOM   6010  C  CD    . LYS C  1 35  ? -30.111 45.602  -15.916 1.00 44.10  ? 7   LYS C CD    1 
ATOM   6011  C  CE    . LYS C  1 35  ? -29.087 44.665  -15.304 1.00 42.12  ? 7   LYS C CE    1 
ATOM   6012  N  NZ    . LYS C  1 35  ? -28.012 44.339  -16.277 1.00 41.35  ? 7   LYS C NZ    1 
ATOM   6013  N  N     . GLU C  1 36  ? -33.013 48.311  -12.883 1.00 42.19  ? 8   GLU C N     1 
ATOM   6014  C  CA    . GLU C  1 36  ? -32.776 48.615  -11.472 1.00 38.30  ? 8   GLU C CA    1 
ATOM   6015  C  C     . GLU C  1 36  ? -34.047 48.456  -10.633 1.00 31.32  ? 8   GLU C C     1 
ATOM   6016  O  O     . GLU C  1 36  ? -33.989 47.947  -9.517  1.00 32.88  ? 8   GLU C O     1 
ATOM   6017  C  CB    . GLU C  1 36  ? -32.195 50.034  -11.313 1.00 40.89  ? 8   GLU C CB    1 
ATOM   6018  C  CG    . GLU C  1 36  ? -30.700 50.114  -11.631 1.00 41.26  ? 8   GLU C CG    1 
ATOM   6019  C  CD    . GLU C  1 36  ? -29.944 48.840  -11.240 1.00 60.75  ? 8   GLU C CD    1 
ATOM   6020  O  OE1   . GLU C  1 36  ? -29.824 48.564  -10.024 1.00 63.71  ? 8   GLU C OE1   1 
ATOM   6021  O  OE2   . GLU C  1 36  ? -29.475 48.103  -12.147 1.00 56.38  ? 8   GLU C OE2   1 
ATOM   6022  N  N     . GLU C  1 37  ? -35.193 48.885  -11.162 1.00 31.30  ? 9   GLU C N     1 
ATOM   6023  C  CA    . GLU C  1 37  ? -36.483 48.661  -10.485 1.00 35.91  ? 9   GLU C CA    1 
ATOM   6024  C  C     . GLU C  1 37  ? -36.833 47.172  -10.330 1.00 34.10  ? 9   GLU C C     1 
ATOM   6025  O  O     . GLU C  1 37  ? -37.306 46.749  -9.274  1.00 35.90  ? 9   GLU C O     1 
ATOM   6026  C  CB    . GLU C  1 37  ? -37.617 49.357  -11.239 1.00 37.57  ? 9   GLU C CB    1 
ATOM   6027  C  CG    . GLU C  1 37  ? -37.517 50.883  -11.241 1.00 49.18  ? 9   GLU C CG    1 
ATOM   6028  C  CD    . GLU C  1 37  ? -38.630 51.541  -12.034 1.00 58.33  ? 9   GLU C CD    1 
ATOM   6029  O  OE1   . GLU C  1 37  ? -39.588 50.836  -12.430 1.00 49.76  ? 9   GLU C OE1   1 
ATOM   6030  O  OE2   . GLU C  1 37  ? -38.542 52.771  -12.258 1.00 70.81  ? 9   GLU C OE2   1 
ATOM   6031  N  N     . LEU C  1 38  ? -36.616 46.399  -11.393 1.00 30.04  ? 10  LEU C N     1 
ATOM   6032  C  CA    . LEU C  1 38  ? -36.906 44.971  -11.389 1.00 32.61  ? 10  LEU C CA    1 
ATOM   6033  C  C     . LEU C  1 38  ? -36.094 44.288  -10.306 1.00 32.73  ? 10  LEU C C     1 
ATOM   6034  O  O     . LEU C  1 38  ? -36.628 43.509  -9.519  1.00 32.84  ? 10  LEU C O     1 
ATOM   6035  C  CB    . LEU C  1 38  ? -36.600 44.348  -12.749 1.00 32.79  ? 10  LEU C CB    1 
ATOM   6036  C  CG    . LEU C  1 38  ? -36.877 42.853  -12.962 1.00 32.61  ? 10  LEU C CG    1 
ATOM   6037  C  CD1   . LEU C  1 38  ? -38.363 42.516  -12.805 1.00 26.72  ? 10  LEU C CD1   1 
ATOM   6038  C  CD2   . LEU C  1 38  ? -36.400 42.475  -14.361 1.00 35.23  ? 10  LEU C CD2   1 
ATOM   6039  N  N     . ILE C  1 39  ? -34.800 44.599  -10.272 1.00 28.67  ? 11  ILE C N     1 
ATOM   6040  C  CA    . ILE C  1 39  ? -33.910 44.019  -9.291  1.00 30.53  ? 11  ILE C CA    1 
ATOM   6041  C  C     . ILE C  1 39  ? -34.404 44.316  -7.872  1.00 36.54  ? 11  ILE C C     1 
ATOM   6042  O  O     . ILE C  1 39  ? -34.548 43.409  -7.044  1.00 32.69  ? 11  ILE C O     1 
ATOM   6043  C  CB    . ILE C  1 39  ? -32.477 44.540  -9.464  1.00 28.00  ? 11  ILE C CB    1 
ATOM   6044  C  CG1   . ILE C  1 39  ? -31.855 43.971  -10.746 1.00 33.36  ? 11  ILE C CG1   1 
ATOM   6045  C  CG2   . ILE C  1 39  ? -31.626 44.161  -8.261  1.00 29.48  ? 11  ILE C CG2   1 
ATOM   6046  C  CD1   . ILE C  1 39  ? -30.471 44.535  -11.085 1.00 32.90  ? 11  ILE C CD1   1 
ATOM   6047  N  N     . GLU C  1 40  ? -34.684 45.587  -7.602  1.00 31.06  ? 12  GLU C N     1 
ATOM   6048  C  CA    . GLU C  1 40  ? -35.122 46.011  -6.270  1.00 30.76  ? 12  GLU C CA    1 
ATOM   6049  C  C     . GLU C  1 40  ? -36.427 45.329  -5.893  1.00 30.17  ? 12  GLU C C     1 
ATOM   6050  O  O     . GLU C  1 40  ? -36.581 44.845  -4.769  1.00 29.66  ? 12  GLU C O     1 
ATOM   6051  C  CB    . GLU C  1 40  ? -35.286 47.543  -6.211  1.00 34.57  ? 12  GLU C CB    1 
ATOM   6052  C  CG    . GLU C  1 40  ? -35.941 48.055  -4.938  1.00 40.85  ? 12  GLU C CG    1 
ATOM   6053  C  CD    . GLU C  1 40  ? -35.991 49.585  -4.869  1.00 46.17  ? 12  GLU C CD    1 
ATOM   6054  O  OE1   . GLU C  1 40  ? -36.600 50.218  -5.763  1.00 46.69  ? 12  GLU C OE1   1 
ATOM   6055  O  OE2   . GLU C  1 40  ? -35.407 50.151  -3.921  1.00 56.14  ? 12  GLU C OE2   1 
ATOM   6056  N  N     . TYR C  1 41  ? -37.365 45.286  -6.834  1.00 27.72  ? 13  TYR C N     1 
ATOM   6057  C  CA    . TYR C  1 41  ? -38.630 44.598  -6.600  1.00 28.97  ? 13  TYR C CA    1 
ATOM   6058  C  C     . TYR C  1 41  ? -38.431 43.078  -6.403  1.00 33.35  ? 13  TYR C C     1 
ATOM   6059  O  O     . TYR C  1 41  ? -39.036 42.484  -5.504  1.00 29.33  ? 13  TYR C O     1 
ATOM   6060  C  CB    . TYR C  1 41  ? -39.604 44.847  -7.758  1.00 30.23  ? 13  TYR C CB    1 
ATOM   6061  C  CG    . TYR C  1 41  ? -40.956 44.202  -7.532  1.00 27.51  ? 13  TYR C CG    1 
ATOM   6062  C  CD1   . TYR C  1 41  ? -41.530 43.362  -8.480  1.00 28.94  ? 13  TYR C CD1   1 
ATOM   6063  C  CD2   . TYR C  1 41  ? -41.650 44.427  -6.350  1.00 29.59  ? 13  TYR C CD2   1 
ATOM   6064  C  CE1   . TYR C  1 41  ? -42.781 42.768  -8.255  1.00 32.25  ? 13  TYR C CE1   1 
ATOM   6065  C  CE2   . TYR C  1 41  ? -42.885 43.842  -6.114  1.00 32.92  ? 13  TYR C CE2   1 
ATOM   6066  C  CZ    . TYR C  1 41  ? -43.445 43.015  -7.058  1.00 32.66  ? 13  TYR C CZ    1 
ATOM   6067  O  OH    . TYR C  1 41  ? -44.674 42.461  -6.787  1.00 32.02  ? 13  TYR C OH    1 
ATOM   6068  N  N     . ALA C  1 42  ? -37.584 42.463  -7.234  1.00 28.17  ? 14  ALA C N     1 
ATOM   6069  C  CA    . ALA C  1 42  ? -37.343 41.025  -7.144  1.00 32.88  ? 14  ALA C CA    1 
ATOM   6070  C  C     . ALA C  1 42  ? -36.869 40.683  -5.747  1.00 33.90  ? 14  ALA C C     1 
ATOM   6071  O  O     . ALA C  1 42  ? -37.351 39.740  -5.138  1.00 33.09  ? 14  ALA C O     1 
ATOM   6072  C  CB    . ALA C  1 42  ? -36.308 40.555  -8.190  1.00 27.51  ? 14  ALA C CB    1 
ATOM   6073  N  N     . LYS C  1 43  ? -35.935 41.479  -5.236  1.00 34.45  ? 15  LYS C N     1 
ATOM   6074  C  CA    . LYS C  1 43  ? -35.367 41.220  -3.923  1.00 31.53  ? 15  LYS C CA    1 
ATOM   6075  C  C     . LYS C  1 43  ? -36.387 41.447  -2.815  1.00 34.58  ? 15  LYS C C     1 
ATOM   6076  O  O     . LYS C  1 43  ? -36.370 40.744  -1.796  1.00 35.72  ? 15  LYS C O     1 
ATOM   6077  C  CB    . LYS C  1 43  ? -34.128 42.087  -3.707  1.00 37.88  ? 15  LYS C CB    1 
ATOM   6078  C  CG    . LYS C  1 43  ? -32.919 41.552  -4.475  1.00 47.27  ? 15  LYS C CG    1 
ATOM   6079  C  CD    . LYS C  1 43  ? -31.720 42.489  -4.385  1.00 58.21  ? 15  LYS C CD    1 
ATOM   6080  C  CE    . LYS C  1 43  ? -30.469 41.839  -4.979  1.00 56.13  ? 15  LYS C CE    1 
ATOM   6081  N  NZ    . LYS C  1 43  ? -30.170 40.510  -4.345  1.00 58.55  ? 15  LYS C NZ    1 
ATOM   6082  N  N     . SER C  1 44  ? -37.285 42.408  -3.010  1.00 32.60  ? 16  SER C N     1 
ATOM   6083  C  CA    . SER C  1 44  ? -38.297 42.689  -1.995  1.00 33.70  ? 16  SER C CA    1 
ATOM   6084  C  C     . SER C  1 44  ? -39.250 41.498  -1.837  1.00 32.25  ? 16  SER C C     1 
ATOM   6085  O  O     . SER C  1 44  ? -39.769 41.252  -0.745  1.00 28.70  ? 16  SER C O     1 
ATOM   6086  C  CB    . SER C  1 44  ? -39.084 43.959  -2.333  1.00 32.06  ? 16  SER C CB    1 
ATOM   6087  O  OG    . SER C  1 44  ? -40.220 43.713  -3.153  1.00 28.21  ? 16  SER C OG    1 
ATOM   6088  N  N     . ILE C  1 45  ? -39.485 40.754  -2.918  1.00 28.81  ? 17  ILE C N     1 
ATOM   6089  C  CA    . ILE C  1 45  ? -40.403 39.621  -2.815  1.00 31.38  ? 17  ILE C CA    1 
ATOM   6090  C  C     . ILE C  1 45  ? -39.680 38.306  -2.511  1.00 32.11  ? 17  ILE C C     1 
ATOM   6091  O  O     . ILE C  1 45  ? -40.272 37.239  -2.596  1.00 28.16  ? 17  ILE C O     1 
ATOM   6092  C  CB    . ILE C  1 45  ? -41.256 39.451  -4.075  1.00 35.12  ? 17  ILE C CB    1 
ATOM   6093  C  CG1   . ILE C  1 45  ? -40.383 39.216  -5.315  1.00 32.45  ? 17  ILE C CG1   1 
ATOM   6094  C  CG2   . ILE C  1 45  ? -42.187 40.648  -4.243  1.00 29.68  ? 17  ILE C CG2   1 
ATOM   6095  C  CD1   . ILE C  1 45  ? -41.154 38.584  -6.471  1.00 31.37  ? 17  ILE C CD1   1 
ATOM   6096  N  N     . GLY C  1 46  ? -38.408 38.392  -2.139  1.00 31.23  ? 18  GLY C N     1 
ATOM   6097  C  CA    . GLY C  1 46  ? -37.693 37.233  -1.643  1.00 31.38  ? 18  GLY C CA    1 
ATOM   6098  C  C     . GLY C  1 46  ? -36.885 36.469  -2.677  1.00 34.20  ? 18  GLY C C     1 
ATOM   6099  O  O     . GLY C  1 46  ? -36.463 35.351  -2.412  1.00 35.55  ? 18  GLY C O     1 
ATOM   6100  N  N     . VAL C  1 47  ? -36.659 37.058  -3.847  1.00 31.39  ? 19  VAL C N     1 
ATOM   6101  C  CA    . VAL C  1 47  ? -35.691 36.490  -4.765  1.00 28.21  ? 19  VAL C CA    1 
ATOM   6102  C  C     . VAL C  1 47  ? -34.306 36.735  -4.179  1.00 31.88  ? 19  VAL C C     1 
ATOM   6103  O  O     . VAL C  1 47  ? -34.000 37.842  -3.731  1.00 30.03  ? 19  VAL C O     1 
ATOM   6104  C  CB    . VAL C  1 47  ? -35.793 37.103  -6.166  1.00 31.61  ? 19  VAL C CB    1 
ATOM   6105  C  CG1   . VAL C  1 47  ? -34.717 36.539  -7.056  1.00 27.33  ? 19  VAL C CG1   1 
ATOM   6106  C  CG2   . VAL C  1 47  ? -37.171 36.874  -6.754  1.00 24.00  ? 19  VAL C CG2   1 
ATOM   6107  N  N     . ASP C  1 48  ? -33.464 35.710  -4.151  1.00 27.57  ? 20  ASP C N     1 
ATOM   6108  C  CA    . ASP C  1 48  ? -32.198 35.837  -3.431  1.00 31.49  ? 20  ASP C CA    1 
ATOM   6109  C  C     . ASP C  1 48  ? -31.081 36.315  -4.354  1.00 34.28  ? 20  ASP C C     1 
ATOM   6110  O  O     . ASP C  1 48  ? -30.113 36.941  -3.916  1.00 33.00  ? 20  ASP C O     1 
ATOM   6111  C  CB    . ASP C  1 48  ? -31.835 34.502  -2.769  1.00 28.41  ? 20  ASP C CB    1 
ATOM   6112  C  CG    . ASP C  1 48  ? -32.774 34.152  -1.610  1.00 33.27  ? 20  ASP C CG    1 
ATOM   6113  O  OD1   . ASP C  1 48  ? -32.997 35.030  -0.735  1.00 29.91  ? 20  ASP C OD1   1 
ATOM   6114  O  OD2   . ASP C  1 48  ? -33.306 33.015  -1.575  1.00 30.18  ? 20  ASP C OD2   1 
ATOM   6115  N  N     . LYS C  1 49  ? -31.223 36.015  -5.640  1.00 30.46  ? 21  LYS C N     1 
ATOM   6116  C  CA    . LYS C  1 49  ? -30.224 36.412  -6.620  1.00 34.41  ? 21  LYS C CA    1 
ATOM   6117  C  C     . LYS C  1 49  ? -30.881 36.543  -7.980  1.00 29.77  ? 21  LYS C C     1 
ATOM   6118  O  O     . LYS C  1 49  ? -31.696 35.708  -8.368  1.00 29.09  ? 21  LYS C O     1 
ATOM   6119  C  CB    . LYS C  1 49  ? -29.055 35.413  -6.654  1.00 33.62  ? 21  LYS C CB    1 
ATOM   6120  C  CG    . LYS C  1 49  ? -27.861 35.953  -7.437  1.00 39.68  ? 21  LYS C CG    1 
ATOM   6121  C  CD    . LYS C  1 49  ? -26.515 35.517  -6.866  1.00 36.04  ? 21  LYS C CD    1 
ATOM   6122  C  CE    . LYS C  1 49  ? -25.389 36.067  -7.728  1.00 35.90  ? 21  LYS C CE    1 
ATOM   6123  N  NZ    . LYS C  1 49  ? -24.035 35.653  -7.290  1.00 41.09  ? 21  LYS C NZ    1 
ATOM   6124  N  N     . ILE C  1 50  ? -30.569 37.628  -8.685  1.00 30.39  ? 22  ILE C N     1 
ATOM   6125  C  CA    . ILE C  1 50  ? -31.168 37.877  -9.982  1.00 27.03  ? 22  ILE C CA    1 
ATOM   6126  C  C     . ILE C  1 50  ? -30.053 38.266  -10.935 1.00 33.05  ? 22  ILE C C     1 
ATOM   6127  O  O     . ILE C  1 50  ? -29.035 38.811  -10.511 1.00 32.12  ? 22  ILE C O     1 
ATOM   6128  C  CB    . ILE C  1 50  ? -32.280 38.961  -9.913  1.00 29.63  ? 22  ILE C CB    1 
ATOM   6129  C  CG1   . ILE C  1 50  ? -32.925 39.168  -11.287 1.00 29.72  ? 22  ILE C CG1   1 
ATOM   6130  C  CG2   . ILE C  1 50  ? -31.748 40.296  -9.303  1.00 29.78  ? 22  ILE C CG2   1 
ATOM   6131  C  CD1   . ILE C  1 50  ? -34.312 39.810  -11.248 1.00 31.03  ? 22  ILE C CD1   1 
ATOM   6132  N  N     . GLY C  1 51  ? -30.219 37.924  -12.211 1.00 32.50  ? 23  GLY C N     1 
ATOM   6133  C  CA    . GLY C  1 51  ? -29.193 38.145  -13.216 1.00 32.92  ? 23  GLY C CA    1 
ATOM   6134  C  C     . GLY C  1 51  ? -29.786 38.297  -14.603 1.00 31.67  ? 23  GLY C C     1 
ATOM   6135  O  O     . GLY C  1 51  ? -30.940 37.942  -14.854 1.00 33.12  ? 23  GLY C O     1 
ATOM   6136  N  N     . PHE C  1 52  ? -29.003 38.848  -15.519 1.00 30.99  ? 24  PHE C N     1 
ATOM   6137  C  CA    . PHE C  1 52  ? -29.539 39.158  -16.829 1.00 28.72  ? 24  PHE C CA    1 
ATOM   6138  C  C     . PHE C  1 52  ? -28.644 38.560  -17.892 1.00 29.70  ? 24  PHE C C     1 
ATOM   6139  O  O     . PHE C  1 52  ? -27.421 38.550  -17.760 1.00 34.42  ? 24  PHE C O     1 
ATOM   6140  C  CB    . PHE C  1 52  ? -29.700 40.678  -16.994 1.00 32.38  ? 24  PHE C CB    1 
ATOM   6141  C  CG    . PHE C  1 52  ? -30.720 41.262  -16.061 1.00 34.41  ? 24  PHE C CG    1 
ATOM   6142  C  CD1   . PHE C  1 52  ? -32.000 41.537  -16.501 1.00 30.55  ? 24  PHE C CD1   1 
ATOM   6143  C  CD2   . PHE C  1 52  ? -30.423 41.457  -14.722 1.00 32.60  ? 24  PHE C CD2   1 
ATOM   6144  C  CE1   . PHE C  1 52  ? -32.955 42.026  -15.641 1.00 33.12  ? 24  PHE C CE1   1 
ATOM   6145  C  CE2   . PHE C  1 52  ? -31.378 41.949  -13.856 1.00 33.47  ? 24  PHE C CE2   1 
ATOM   6146  C  CZ    . PHE C  1 52  ? -32.647 42.229  -14.317 1.00 32.92  ? 24  PHE C CZ    1 
ATOM   6147  N  N     . THR C  1 53  ? -29.265 38.010  -18.926 1.00 28.48  ? 25  THR C N     1 
ATOM   6148  C  CA    . THR C  1 53  ? -28.514 37.560  -20.082 1.00 32.60  ? 25  THR C CA    1 
ATOM   6149  C  C     . THR C  1 53  ? -29.312 37.904  -21.341 1.00 31.18  ? 25  THR C C     1 
ATOM   6150  O  O     . THR C  1 53  ? -30.478 38.314  -21.269 1.00 31.57  ? 25  THR C O     1 
ATOM   6151  C  CB    . THR C  1 53  ? -28.191 36.016  -20.000 1.00 33.54  ? 25  THR C CB    1 
ATOM   6152  O  OG1   . THR C  1 53  ? -27.273 35.645  -21.042 1.00 35.93  ? 25  THR C OG1   1 
ATOM   6153  C  CG2   . THR C  1 53  ? -29.459 35.157  -20.095 1.00 31.83  ? 25  THR C CG2   1 
ATOM   6154  N  N     . THR C  1 54  ? -28.684 37.740  -22.497 1.00 36.12  ? 26  THR C N     1 
ATOM   6155  C  CA    . THR C  1 54  ? -29.369 37.956  -23.772 1.00 36.66  ? 26  THR C CA    1 
ATOM   6156  C  C     . THR C  1 54  ? -30.294 36.799  -24.126 1.00 33.86  ? 26  THR C C     1 
ATOM   6157  O  O     . THR C  1 54  ? -30.401 35.826  -23.383 1.00 36.05  ? 26  THR C O     1 
ATOM   6158  C  CB    . THR C  1 54  ? -28.372 38.137  -24.925 1.00 36.16  ? 26  THR C CB    1 
ATOM   6159  O  OG1   . THR C  1 54  ? -27.695 36.894  -25.164 1.00 31.65  ? 26  THR C OG1   1 
ATOM   6160  C  CG2   . THR C  1 54  ? -27.362 39.238  -24.594 1.00 34.66  ? 26  THR C CG2   1 
ATOM   6161  N  N     . ALA C  1 55  ? -30.967 36.914  -25.263 1.00 31.01  ? 27  ALA C N     1 
ATOM   6162  C  CA    . ALA C  1 55  ? -31.823 35.846  -25.759 1.00 33.78  ? 27  ALA C CA    1 
ATOM   6163  C  C     . ALA C  1 55  ? -31.113 35.113  -26.894 1.00 37.41  ? 27  ALA C C     1 
ATOM   6164  O  O     . ALA C  1 55  ? -31.751 34.453  -27.719 1.00 30.39  ? 27  ALA C O     1 
ATOM   6165  C  CB    . ALA C  1 55  ? -33.166 36.401  -26.226 1.00 33.69  ? 27  ALA C CB    1 
ATOM   6166  N  N     . ASP C  1 56  ? -29.786 35.255  -26.939 1.00 34.15  ? 28  ASP C N     1 
ATOM   6167  C  CA    . ASP C  1 56  ? -29.000 34.613  -27.979 1.00 35.52  ? 28  ASP C CA    1 
ATOM   6168  C  C     . ASP C  1 56  ? -29.036 33.108  -27.774 1.00 38.20  ? 28  ASP C C     1 
ATOM   6169  O  O     . ASP C  1 56  ? -29.275 32.630  -26.651 1.00 31.57  ? 28  ASP C O     1 
ATOM   6170  C  CB    . ASP C  1 56  ? -27.553 35.103  -27.977 1.00 36.87  ? 28  ASP C CB    1 
ATOM   6171  C  CG    . ASP C  1 56  ? -27.416 36.551  -28.447 1.00 44.64  ? 28  ASP C CG    1 
ATOM   6172  O  OD1   . ASP C  1 56  ? -28.351 37.086  -29.088 1.00 38.56  ? 28  ASP C OD1   1 
ATOM   6173  O  OD2   . ASP C  1 56  ? -26.358 37.147  -28.160 1.00 44.52  ? 28  ASP C OD2   1 
ATOM   6174  N  N     . THR C  1 57  ? -28.775 32.376  -28.857 1.00 33.96  ? 29  THR C N     1 
ATOM   6175  C  CA    . THR C  1 57  ? -28.809 30.919  -28.836 1.00 33.14  ? 29  THR C CA    1 
ATOM   6176  C  C     . THR C  1 57  ? -27.703 30.360  -27.956 1.00 35.09  ? 29  THR C C     1 
ATOM   6177  O  O     . THR C  1 57  ? -26.647 30.964  -27.813 1.00 37.32  ? 29  THR C O     1 
ATOM   6178  C  CB    . THR C  1 57  ? -28.667 30.335  -30.256 1.00 40.70  ? 29  THR C CB    1 
ATOM   6179  O  OG1   . THR C  1 57  ? -27.368 30.645  -30.767 1.00 43.75  ? 29  THR C OG1   1 
ATOM   6180  C  CG2   . THR C  1 57  ? -29.695 30.930  -31.186 1.00 35.01  ? 29  THR C CG2   1 
ATOM   6181  N  N     . PHE C  1 58  ? -27.945 29.195  -27.367 1.00 36.69  ? 30  PHE C N     1 
ATOM   6182  C  CA    . PHE C  1 58  ? -26.950 28.579  -26.503 1.00 36.19  ? 30  PHE C CA    1 
ATOM   6183  C  C     . PHE C  1 58  ? -26.151 27.540  -27.282 1.00 40.22  ? 30  PHE C C     1 
ATOM   6184  O  O     . PHE C  1 58  ? -26.549 26.371  -27.359 1.00 39.73  ? 30  PHE C O     1 
ATOM   6185  C  CB    . PHE C  1 58  ? -27.616 27.937  -25.289 1.00 34.43  ? 30  PHE C CB    1 
ATOM   6186  C  CG    . PHE C  1 58  ? -28.204 28.923  -24.330 1.00 32.04  ? 30  PHE C CG    1 
ATOM   6187  C  CD1   . PHE C  1 58  ? -27.499 29.305  -23.203 1.00 29.82  ? 30  PHE C CD1   1 
ATOM   6188  C  CD2   . PHE C  1 58  ? -29.468 29.453  -24.542 1.00 30.50  ? 30  PHE C CD2   1 
ATOM   6189  C  CE1   . PHE C  1 58  ? -28.034 30.206  -22.303 1.00 30.74  ? 30  PHE C CE1   1 
ATOM   6190  C  CE2   . PHE C  1 58  ? -30.007 30.366  -23.652 1.00 33.16  ? 30  PHE C CE2   1 
ATOM   6191  C  CZ    . PHE C  1 58  ? -29.286 30.744  -22.528 1.00 33.23  ? 30  PHE C CZ    1 
ATOM   6192  N  N     . ASP C  1 59  ? -25.023 27.963  -27.845 1.00 40.00  ? 31  ASP C N     1 
ATOM   6193  C  CA    . ASP C  1 59  ? -24.292 27.124  -28.788 1.00 46.94  ? 31  ASP C CA    1 
ATOM   6194  C  C     . ASP C  1 59  ? -23.474 26.047  -28.106 1.00 41.83  ? 31  ASP C C     1 
ATOM   6195  O  O     . ASP C  1 59  ? -23.446 24.914  -28.568 1.00 39.83  ? 31  ASP C O     1 
ATOM   6196  C  CB    . ASP C  1 59  ? -23.373 27.964  -29.669 1.00 41.90  ? 31  ASP C CB    1 
ATOM   6197  C  CG    . ASP C  1 59  ? -24.116 29.014  -30.434 1.00 46.44  ? 31  ASP C CG    1 
ATOM   6198  O  OD1   . ASP C  1 59  ? -25.251 28.740  -30.875 1.00 45.33  ? 31  ASP C OD1   1 
ATOM   6199  O  OD2   . ASP C  1 59  ? -23.563 30.125  -30.585 1.00 60.89  ? 31  ASP C OD2   1 
ATOM   6200  N  N     . SER C  1 60  ? -22.776 26.419  -27.040 1.00 40.51  ? 32  SER C N     1 
ATOM   6201  C  CA    . SER C  1 60  ? -21.988 25.464  -26.281 1.00 40.94  ? 32  SER C CA    1 
ATOM   6202  C  C     . SER C  1 60  ? -22.894 24.366  -25.742 1.00 41.00  ? 32  SER C C     1 
ATOM   6203  O  O     . SER C  1 60  ? -22.555 23.175  -25.764 1.00 46.61  ? 32  SER C O     1 
ATOM   6204  C  CB    . SER C  1 60  ? -21.258 26.163  -25.138 1.00 44.19  ? 32  SER C CB    1 
ATOM   6205  O  OG    . SER C  1 60  ? -20.774 25.212  -24.203 1.00 48.88  ? 32  SER C OG    1 
ATOM   6206  N  N     . LEU C  1 61  ? -24.064 24.779  -25.272 1.00 37.40  ? 33  LEU C N     1 
ATOM   6207  C  CA    . LEU C  1 61  ? -25.032 23.857  -24.711 1.00 36.84  ? 33  LEU C CA    1 
ATOM   6208  C  C     . LEU C  1 61  ? -25.542 22.869  -25.766 1.00 33.12  ? 33  LEU C C     1 
ATOM   6209  O  O     . LEU C  1 61  ? -25.756 21.705  -25.465 1.00 33.08  ? 33  LEU C O     1 
ATOM   6210  C  CB    . LEU C  1 61  ? -26.199 24.621  -24.097 1.00 30.89  ? 33  LEU C CB    1 
ATOM   6211  C  CG    . LEU C  1 61  ? -27.255 23.726  -23.466 1.00 33.59  ? 33  LEU C CG    1 
ATOM   6212  C  CD1   . LEU C  1 61  ? -26.662 23.042  -22.253 1.00 33.55  ? 33  LEU C CD1   1 
ATOM   6213  C  CD2   . LEU C  1 61  ? -28.530 24.509  -23.113 1.00 29.30  ? 33  LEU C CD2   1 
ATOM   6214  N  N     . LYS C  1 62  ? -25.750 23.360  -26.981 1.00 36.03  ? 34  LYS C N     1 
ATOM   6215  C  CA    . LYS C  1 62  ? -26.202 22.543  -28.095 1.00 38.02  ? 34  LYS C CA    1 
ATOM   6216  C  C     . LYS C  1 62  ? -25.224 21.398  -28.374 1.00 37.43  ? 34  LYS C C     1 
ATOM   6217  O  O     . LYS C  1 62  ? -25.627 20.247  -28.433 1.00 34.83  ? 34  LYS C O     1 
ATOM   6218  C  CB    . LYS C  1 62  ? -26.378 23.402  -29.346 1.00 38.49  ? 34  LYS C CB    1 
ATOM   6219  C  CG    . LYS C  1 62  ? -26.954 22.642  -30.540 1.00 39.56  ? 34  LYS C CG    1 
ATOM   6220  C  CD    . LYS C  1 62  ? -26.878 23.476  -31.808 1.00 42.69  ? 34  LYS C CD    1 
ATOM   6221  C  CE    . LYS C  1 62  ? -27.677 22.842  -32.932 1.00 46.58  ? 34  LYS C CE    1 
ATOM   6222  N  NZ    . LYS C  1 62  ? -27.952 23.827  -34.012 1.00 53.76  ? 34  LYS C NZ    1 
ATOM   6223  N  N     . ASP C  1 63  ? -23.941 21.718  -28.520 1.00 38.31  ? 35  ASP C N     1 
ATOM   6224  C  CA    . ASP C  1 63  ? -22.922 20.685  -28.678 1.00 39.86  ? 35  ASP C CA    1 
ATOM   6225  C  C     . ASP C  1 63  ? -22.920 19.692  -27.527 1.00 37.85  ? 35  ASP C C     1 
ATOM   6226  O  O     . ASP C  1 63  ? -22.799 18.472  -27.729 1.00 33.56  ? 35  ASP C O     1 
ATOM   6227  C  CB    . ASP C  1 63  ? -21.528 21.302  -28.779 1.00 44.44  ? 35  ASP C CB    1 
ATOM   6228  C  CG    . ASP C  1 63  ? -21.402 22.281  -29.919 1.00 51.81  ? 35  ASP C CG    1 
ATOM   6229  O  OD1   . ASP C  1 63  ? -21.900 21.976  -31.025 1.00 46.67  ? 35  ASP C OD1   1 
ATOM   6230  O  OD2   . ASP C  1 63  ? -20.807 23.362  -29.696 1.00 49.29  ? 35  ASP C OD2   1 
ATOM   6231  N  N     . ARG C  1 64  ? -23.022 20.220  -26.312 1.00 34.35  ? 36  ARG C N     1 
ATOM   6232  C  CA    . ARG C  1 64  ? -22.927 19.377  -25.125 1.00 33.08  ? 36  ARG C CA    1 
ATOM   6233  C  C     . ARG C  1 64  ? -24.102 18.409  -25.055 1.00 30.76  ? 36  ARG C C     1 
ATOM   6234  O  O     . ARG C  1 64  ? -23.915 17.227  -24.757 1.00 33.01  ? 36  ARG C O     1 
ATOM   6235  C  CB    . ARG C  1 64  ? -22.876 20.227  -23.849 1.00 36.62  ? 36  ARG C CB    1 
ATOM   6236  C  CG    . ARG C  1 64  ? -22.570 19.404  -22.605 1.00 35.92  ? 36  ARG C CG    1 
ATOM   6237  C  CD    . ARG C  1 64  ? -21.199 18.773  -22.752 1.00 29.64  ? 36  ARG C CD    1 
ATOM   6238  N  NE    . ARG C  1 64  ? -20.742 18.168  -21.525 1.00 37.39  ? 36  ARG C NE    1 
ATOM   6239  C  CZ    . ARG C  1 64  ? -19.480 17.834  -21.295 1.00 38.76  ? 36  ARG C CZ    1 
ATOM   6240  N  NH1   . ARG C  1 64  ? -18.553 18.074  -22.212 1.00 32.70  ? 36  ARG C NH1   1 
ATOM   6241  N  NH2   . ARG C  1 64  ? -19.153 17.268  -20.146 1.00 37.07  ? 36  ARG C NH2   1 
ATOM   6242  N  N     . LEU C  1 65  ? -25.309 18.917  -25.328 1.00 28.15  ? 37  LEU C N     1 
ATOM   6243  C  CA    . LEU C  1 65  ? -26.511 18.093  -25.295 1.00 30.31  ? 37  LEU C CA    1 
ATOM   6244  C  C     . LEU C  1 65  ? -26.403 16.935  -26.287 1.00 33.19  ? 37  LEU C C     1 
ATOM   6245  O  O     . LEU C  1 65  ? -26.691 15.786  -25.943 1.00 30.33  ? 37  LEU C O     1 
ATOM   6246  C  CB    . LEU C  1 65  ? -27.753 18.927  -25.595 1.00 27.71  ? 37  LEU C CB    1 
ATOM   6247  C  CG    . LEU C  1 65  ? -28.234 19.841  -24.462 1.00 31.36  ? 37  LEU C CG    1 
ATOM   6248  C  CD1   . LEU C  1 65  ? -29.393 20.674  -24.908 1.00 28.49  ? 37  LEU C CD1   1 
ATOM   6249  C  CD2   . LEU C  1 65  ? -28.623 18.992  -23.253 1.00 33.26  ? 37  LEU C CD2   1 
ATOM   6250  N  N     . ILE C  1 66  ? -25.995 17.248  -27.515 1.00 36.01  ? 38  ILE C N     1 
ATOM   6251  C  CA    . ILE C  1 66  ? -25.792 16.220  -28.538 1.00 36.78  ? 38  ILE C CA    1 
ATOM   6252  C  C     . ILE C  1 66  ? -24.748 15.215  -28.083 1.00 35.82  ? 38  ILE C C     1 
ATOM   6253  O  O     . ILE C  1 66  ? -24.956 13.998  -28.171 1.00 36.27  ? 38  ILE C O     1 
ATOM   6254  C  CB    . ILE C  1 66  ? -25.357 16.839  -29.873 1.00 37.74  ? 38  ILE C CB    1 
ATOM   6255  C  CG1   . ILE C  1 66  ? -26.448 17.775  -30.385 1.00 34.76  ? 38  ILE C CG1   1 
ATOM   6256  C  CG2   . ILE C  1 66  ? -25.056 15.747  -30.896 1.00 40.96  ? 38  ILE C CG2   1 
ATOM   6257  C  CD1   . ILE C  1 66  ? -26.006 18.660  -31.536 1.00 38.02  ? 38  ILE C CD1   1 
ATOM   6258  N  N     . LEU C  1 67  ? -23.631 15.716  -27.564 1.00 34.22  ? 39  LEU C N     1 
ATOM   6259  C  CA    . LEU C  1 67  ? -22.587 14.817  -27.094 1.00 33.67  ? 39  LEU C CA    1 
ATOM   6260  C  C     . LEU C  1 67  ? -23.117 13.906  -25.983 1.00 39.94  ? 39  LEU C C     1 
ATOM   6261  O  O     . LEU C  1 67  ? -22.846 12.688  -25.989 1.00 34.35  ? 39  LEU C O     1 
ATOM   6262  C  CB    . LEU C  1 67  ? -21.370 15.604  -26.606 1.00 33.65  ? 39  LEU C CB    1 
ATOM   6263  C  CG    . LEU C  1 67  ? -20.335 14.747  -25.877 1.00 37.75  ? 39  LEU C CG    1 
ATOM   6264  C  CD1   . LEU C  1 67  ? -19.580 13.854  -26.880 1.00 34.98  ? 39  LEU C CD1   1 
ATOM   6265  C  CD2   . LEU C  1 67  ? -19.379 15.589  -25.002 1.00 33.61  ? 39  LEU C CD2   1 
ATOM   6266  N  N     . GLN C  1 68  ? -23.896 14.473  -25.054 1.00 31.94  ? 40  GLN C N     1 
ATOM   6267  C  CA    . GLN C  1 68  ? -24.377 13.676  -23.919 1.00 34.50  ? 40  GLN C CA    1 
ATOM   6268  C  C     . GLN C  1 68  ? -25.381 12.627  -24.388 1.00 33.64  ? 40  GLN C C     1 
ATOM   6269  O  O     . GLN C  1 68  ? -25.409 11.526  -23.843 1.00 32.00  ? 40  GLN C O     1 
ATOM   6270  C  CB    . GLN C  1 68  ? -25.016 14.538  -22.814 1.00 29.48  ? 40  GLN C CB    1 
ATOM   6271  C  CG    . GLN C  1 68  ? -24.063 15.440  -22.036 1.00 29.63  ? 40  GLN C CG    1 
ATOM   6272  C  CD    . GLN C  1 68  ? -23.035 14.699  -21.192 1.00 31.51  ? 40  GLN C CD    1 
ATOM   6273  O  OE1   . GLN C  1 68  ? -21.910 14.453  -21.641 1.00 36.32  ? 40  GLN C OE1   1 
ATOM   6274  N  NE2   . GLN C  1 68  ? -23.394 14.388  -19.943 1.00 28.75  ? 40  GLN C NE2   1 
ATOM   6275  N  N     . GLU C  1 69  ? -26.221 12.956  -25.371 1.00 33.14  ? 41  GLU C N     1 
ATOM   6276  C  CA    A GLU C  1 69  ? -27.172 12.004  -25.910 0.52 35.11  ? 41  GLU C CA    1 
ATOM   6277  C  CA    B GLU C  1 69  ? -27.159 11.944  -25.828 0.48 35.13  ? 41  GLU C CA    1 
ATOM   6278  C  C     . GLU C  1 69  ? -26.405 10.847  -26.558 1.00 38.95  ? 41  GLU C C     1 
ATOM   6279  O  O     . GLU C  1 69  ? -26.700 9.670   -26.338 1.00 33.78  ? 41  GLU C O     1 
ATOM   6280  C  CB    A GLU C  1 69  ? -28.088 12.683  -26.923 0.52 35.99  ? 41  GLU C CB    1 
ATOM   6281  C  CB    B GLU C  1 69  ? -28.253 12.496  -26.724 0.48 36.16  ? 41  GLU C CB    1 
ATOM   6282  C  CG    A GLU C  1 69  ? -29.263 11.832  -27.377 0.52 38.92  ? 41  GLU C CG    1 
ATOM   6283  C  CG    B GLU C  1 69  ? -29.477 11.556  -26.762 0.48 37.28  ? 41  GLU C CG    1 
ATOM   6284  C  CD    A GLU C  1 69  ? -30.499 11.994  -26.502 0.52 38.37  ? 41  GLU C CD    1 
ATOM   6285  C  CD    B GLU C  1 69  ? -29.256 10.270  -27.581 0.48 40.19  ? 41  GLU C CD    1 
ATOM   6286  O  OE1   A GLU C  1 69  ? -30.921 13.149  -26.256 0.52 42.02  ? 41  GLU C OE1   1 
ATOM   6287  O  OE1   B GLU C  1 69  ? -28.467 10.298  -28.556 0.48 41.16  ? 41  GLU C OE1   1 
ATOM   6288  O  OE2   A GLU C  1 69  ? -31.062 10.964  -26.085 0.52 34.14  ? 41  GLU C OE2   1 
ATOM   6289  O  OE2   B GLU C  1 69  ? -29.882 9.235   -27.261 0.48 40.76  ? 41  GLU C OE2   1 
ATOM   6290  N  N     . SER C  1 70  ? -25.430 11.228  -27.385 1.00 36.66  ? 42  SER C N     1 
ATOM   6291  C  CA    . SER C  1 70  ? -24.562 10.286  -28.079 1.00 39.20  ? 42  SER C CA    1 
ATOM   6292  C  C     . SER C  1 70  ? -24.006 9.241   -27.109 1.00 40.09  ? 42  SER C C     1 
ATOM   6293  O  O     . SER C  1 70  ? -24.043 8.039   -27.379 1.00 30.96  ? 42  SER C O     1 
ATOM   6294  C  CB    . SER C  1 70  ? -23.419 11.033  -28.765 1.00 33.48  ? 42  SER C CB    1 
ATOM   6295  O  OG    . SER C  1 70  ? -22.566 10.134  -29.453 1.00 43.04  ? 42  SER C OG    1 
ATOM   6296  N  N     . LEU C  1 71  ? -23.535 9.719   -25.961 1.00 30.31  ? 43  LEU C N     1 
ATOM   6297  C  CA    . LEU C  1 71  ? -22.942 8.873   -24.943 1.00 29.72  ? 43  LEU C CA    1 
ATOM   6298  C  C     . LEU C  1 71  ? -23.958 8.057   -24.133 1.00 32.76  ? 43  LEU C C     1 
ATOM   6299  O  O     . LEU C  1 71  ? -23.563 7.181   -23.377 1.00 31.95  ? 43  LEU C O     1 
ATOM   6300  C  CB    . LEU C  1 71  ? -22.105 9.725   -23.980 1.00 32.88  ? 43  LEU C CB    1 
ATOM   6301  C  CG    . LEU C  1 71  ? -20.795 10.278  -24.533 1.00 39.04  ? 43  LEU C CG    1 
ATOM   6302  C  CD1   . LEU C  1 71  ? -20.117 11.240  -23.537 1.00 37.23  ? 43  LEU C CD1   1 
ATOM   6303  C  CD2   . LEU C  1 71  ? -19.870 9.132   -24.904 1.00 35.25  ? 43  LEU C CD2   1 
ATOM   6304  N  N     . GLY C  1 72  ? -25.253 8.340   -24.279 1.00 33.76  ? 44  GLY C N     1 
ATOM   6305  C  CA    . GLY C  1 72  ? -26.263 7.683   -23.458 1.00 27.20  ? 44  GLY C CA    1 
ATOM   6306  C  C     . GLY C  1 72  ? -26.347 8.254   -22.030 1.00 36.87  ? 44  GLY C C     1 
ATOM   6307  O  O     . GLY C  1 72  ? -26.842 7.592   -21.115 1.00 29.28  ? 44  GLY C O     1 
ATOM   6308  N  N     . TYR C  1 73  ? -25.882 9.491   -21.832 1.00 29.06  ? 45  TYR C N     1 
ATOM   6309  C  CA    . TYR C  1 73  ? -25.713 10.031  -20.475 1.00 29.81  ? 45  TYR C CA    1 
ATOM   6310  C  C     . TYR C  1 73  ? -26.867 10.910  -20.004 1.00 32.01  ? 45  TYR C C     1 
ATOM   6311  O  O     . TYR C  1 73  ? -26.837 11.419  -18.876 1.00 29.86  ? 45  TYR C O     1 
ATOM   6312  C  CB    . TYR C  1 73  ? -24.424 10.861  -20.374 1.00 33.00  ? 45  TYR C CB    1 
ATOM   6313  C  CG    . TYR C  1 73  ? -23.126 10.083  -20.320 1.00 33.16  ? 45  TYR C CG    1 
ATOM   6314  C  CD1   . TYR C  1 73  ? -23.099 8.684   -20.369 1.00 31.57  ? 45  TYR C CD1   1 
ATOM   6315  C  CD2   . TYR C  1 73  ? -21.920 10.761  -20.207 1.00 34.00  ? 45  TYR C CD2   1 
ATOM   6316  C  CE1   . TYR C  1 73  ? -21.893 7.996   -20.303 1.00 29.19  ? 45  TYR C CE1   1 
ATOM   6317  C  CE2   . TYR C  1 73  ? -20.727 10.095  -20.143 1.00 38.85  ? 45  TYR C CE2   1 
ATOM   6318  C  CZ    . TYR C  1 73  ? -20.710 8.709   -20.194 1.00 36.89  ? 45  TYR C CZ    1 
ATOM   6319  O  OH    . TYR C  1 73  ? -19.492 8.079   -20.119 1.00 33.76  ? 45  TYR C OH    1 
ATOM   6320  N  N     . LEU C  1 74  ? -27.847 11.149  -20.874 1.00 32.88  ? 46  LEU C N     1 
ATOM   6321  C  CA    . LEU C  1 74  ? -28.973 11.992  -20.491 1.00 33.20  ? 46  LEU C CA    1 
ATOM   6322  C  C     . LEU C  1 74  ? -29.943 11.171  -19.644 1.00 37.34  ? 46  LEU C C     1 
ATOM   6323  O  O     . LEU C  1 74  ? -29.807 9.946   -19.551 1.00 34.14  ? 46  LEU C O     1 
ATOM   6324  C  CB    . LEU C  1 74  ? -29.664 12.588  -21.716 1.00 31.40  ? 46  LEU C CB    1 
ATOM   6325  C  CG    . LEU C  1 74  ? -28.947 13.740  -22.432 1.00 34.58  ? 46  LEU C CG    1 
ATOM   6326  C  CD1   . LEU C  1 74  ? -29.826 14.278  -23.564 1.00 29.73  ? 46  LEU C CD1   1 
ATOM   6327  C  CD2   . LEU C  1 74  ? -28.524 14.886  -21.464 1.00 27.46  ? 46  LEU C CD2   1 
ATOM   6328  N  N     . SER C  1 75  ? -30.901 11.843  -19.008 1.00 30.38  ? 47  SER C N     1 
ATOM   6329  C  CA    . SER C  1 75  ? -31.796 11.165  -18.085 1.00 32.55  ? 47  SER C CA    1 
ATOM   6330  C  C     . SER C  1 75  ? -33.134 10.840  -18.724 1.00 32.94  ? 47  SER C C     1 
ATOM   6331  O  O     . SER C  1 75  ? -33.800 9.916   -18.293 1.00 31.14  ? 47  SER C O     1 
ATOM   6332  C  CB    . SER C  1 75  ? -32.034 12.008  -16.827 1.00 28.96  ? 47  SER C CB    1 
ATOM   6333  O  OG    . SER C  1 75  ? -32.796 13.160  -17.140 1.00 26.35  ? 47  SER C OG    1 
ATOM   6334  N  N     . GLY C  1 76  ? -33.550 11.626  -19.713 1.00 33.08  ? 48  GLY C N     1 
ATOM   6335  C  CA    . GLY C  1 76  ? -34.892 11.489  -20.255 1.00 27.36  ? 48  GLY C CA    1 
ATOM   6336  C  C     . GLY C  1 76  ? -35.882 12.449  -19.618 1.00 31.75  ? 48  GLY C C     1 
ATOM   6337  O  O     . GLY C  1 76  ? -37.040 12.511  -20.024 1.00 34.71  ? 48  GLY C O     1 
ATOM   6338  N  N     . PHE C  1 77  ? -35.435 13.204  -18.614 1.00 27.94  ? 49  PHE C N     1 
ATOM   6339  C  CA    . PHE C  1 77  ? -36.284 14.237  -18.007 1.00 28.36  ? 49  PHE C CA    1 
ATOM   6340  C  C     . PHE C  1 77  ? -36.118 15.584  -18.721 1.00 32.61  ? 49  PHE C C     1 
ATOM   6341  O  O     . PHE C  1 77  ? -36.863 16.543  -18.455 1.00 36.00  ? 49  PHE C O     1 
ATOM   6342  C  CB    . PHE C  1 77  ? -35.979 14.387  -16.505 1.00 25.52  ? 49  PHE C CB    1 
ATOM   6343  C  CG    . PHE C  1 77  ? -36.351 13.162  -15.677 1.00 30.64  ? 49  PHE C CG    1 
ATOM   6344  C  CD1   . PHE C  1 77  ? -37.363 12.306  -16.086 1.00 30.53  ? 49  PHE C CD1   1 
ATOM   6345  C  CD2   . PHE C  1 77  ? -35.680 12.873  -14.492 1.00 31.14  ? 49  PHE C CD2   1 
ATOM   6346  C  CE1   . PHE C  1 77  ? -37.701 11.191  -15.320 1.00 35.99  ? 49  PHE C CE1   1 
ATOM   6347  C  CE2   . PHE C  1 77  ? -36.020 11.758  -13.722 1.00 24.44  ? 49  PHE C CE2   1 
ATOM   6348  C  CZ    . PHE C  1 77  ? -37.037 10.932  -14.130 1.00 27.84  ? 49  PHE C CZ    1 
ATOM   6349  N  N     . GLU C  1 78  ? -35.148 15.654  -19.633 1.00 34.14  ? 50  GLU C N     1 
ATOM   6350  C  CA    . GLU C  1 78  ? -34.894 16.884  -20.407 1.00 31.36  ? 50  GLU C CA    1 
ATOM   6351  C  C     . GLU C  1 78  ? -35.980 17.091  -21.446 1.00 28.40  ? 50  GLU C C     1 
ATOM   6352  O  O     . GLU C  1 78  ? -36.582 16.133  -21.922 1.00 30.39  ? 50  GLU C O     1 
ATOM   6353  C  CB    . GLU C  1 78  ? -33.521 16.833  -21.108 1.00 24.43  ? 50  GLU C CB    1 
ATOM   6354  C  CG    . GLU C  1 78  ? -32.321 16.552  -20.186 1.00 28.07  ? 50  GLU C CG    1 
ATOM   6355  C  CD    . GLU C  1 78  ? -32.165 15.064  -19.850 1.00 30.04  ? 50  GLU C CD    1 
ATOM   6356  O  OE1   . GLU C  1 78  ? -32.924 14.240  -20.416 1.00 27.16  ? 50  GLU C OE1   1 
ATOM   6357  O  OE2   . GLU C  1 78  ? -31.274 14.724  -19.039 1.00 28.23  ? 50  GLU C OE2   1 
ATOM   6358  N  N     . GLU C  1 79  ? -36.232 18.342  -21.806 1.00 31.12  ? 51  GLU C N     1 
ATOM   6359  C  CA    . GLU C  1 79  ? -37.005 18.612  -23.008 1.00 31.83  ? 51  GLU C CA    1 
ATOM   6360  C  C     . GLU C  1 79  ? -36.296 17.874  -24.168 1.00 30.79  ? 51  GLU C C     1 
ATOM   6361  O  O     . GLU C  1 79  ? -35.061 17.919  -24.277 1.00 31.95  ? 51  GLU C O     1 
ATOM   6362  C  CB    . GLU C  1 79  ? -37.126 20.129  -23.238 1.00 31.75  ? 51  GLU C CB    1 
ATOM   6363  C  CG    . GLU C  1 79  ? -37.390 20.548  -24.681 1.00 36.32  ? 51  GLU C CG    1 
ATOM   6364  C  CD    . GLU C  1 79  ? -38.765 20.153  -25.153 1.00 36.06  ? 51  GLU C CD    1 
ATOM   6365  O  OE1   . GLU C  1 79  ? -39.695 20.187  -24.325 1.00 43.91  ? 51  GLU C OE1   1 
ATOM   6366  O  OE2   . GLU C  1 79  ? -38.914 19.780  -26.341 1.00 35.41  ? 51  GLU C OE2   1 
ATOM   6367  N  N     . PRO C  1 80  ? -37.060 17.130  -24.995 1.00 29.88  ? 52  PRO C N     1 
ATOM   6368  C  CA    . PRO C  1 80  ? -36.455 16.330  -26.077 1.00 32.37  ? 52  PRO C CA    1 
ATOM   6369  C  C     . PRO C  1 80  ? -35.985 17.117  -27.311 1.00 37.03  ? 52  PRO C C     1 
ATOM   6370  O  O     . PRO C  1 80  ? -34.996 16.741  -27.934 1.00 37.64  ? 52  PRO C O     1 
ATOM   6371  C  CB    . PRO C  1 80  ? -37.579 15.357  -26.468 1.00 37.47  ? 52  PRO C CB    1 
ATOM   6372  C  CG    . PRO C  1 80  ? -38.837 16.036  -26.060 1.00 39.50  ? 52  PRO C CG    1 
ATOM   6373  C  CD    . PRO C  1 80  ? -38.505 16.873  -24.846 1.00 31.68  ? 52  PRO C CD    1 
ATOM   6374  N  N     . ASP C  1 81  ? -36.674 18.199  -27.654 1.00 39.59  ? 53  ASP C N     1 
ATOM   6375  C  CA    . ASP C  1 81  ? -36.287 19.014  -28.803 1.00 32.67  ? 53  ASP C CA    1 
ATOM   6376  C  C     . ASP C  1 81  ? -35.123 19.962  -28.504 1.00 36.17  ? 53  ASP C C     1 
ATOM   6377  O  O     . ASP C  1 81  ? -35.339 21.035  -27.933 1.00 37.17  ? 53  ASP C O     1 
ATOM   6378  C  CB    . ASP C  1 81  ? -37.482 19.823  -29.280 1.00 39.38  ? 53  ASP C CB    1 
ATOM   6379  C  CG    . ASP C  1 81  ? -37.269 20.407  -30.658 1.00 43.76  ? 53  ASP C CG    1 
ATOM   6380  O  OD1   . ASP C  1 81  ? -36.246 21.093  -30.875 1.00 41.67  ? 53  ASP C OD1   1 
ATOM   6381  O  OD2   . ASP C  1 81  ? -38.123 20.149  -31.530 1.00 49.92  ? 53  ASP C OD2   1 
ATOM   6382  N  N     . ILE C  1 82  ? -33.911 19.584  -28.915 1.00 31.77  ? 54  ILE C N     1 
ATOM   6383  C  CA    . ILE C  1 82  ? -32.711 20.380  -28.650 1.00 33.42  ? 54  ILE C CA    1 
ATOM   6384  C  C     . ILE C  1 82  ? -32.788 21.811  -29.231 1.00 40.17  ? 54  ILE C C     1 
ATOM   6385  O  O     . ILE C  1 82  ? -32.268 22.771  -28.631 1.00 38.49  ? 54  ILE C O     1 
ATOM   6386  C  CB    . ILE C  1 82  ? -31.451 19.665  -29.187 1.00 34.28  ? 54  ILE C CB    1 
ATOM   6387  C  CG1   . ILE C  1 82  ? -31.184 18.406  -28.371 1.00 43.20  ? 54  ILE C CG1   1 
ATOM   6388  C  CG2   . ILE C  1 82  ? -30.222 20.561  -29.119 1.00 37.70  ? 54  ILE C CG2   1 
ATOM   6389  C  CD1   . ILE C  1 82  ? -29.912 17.673  -28.770 1.00 43.41  ? 54  ILE C CD1   1 
ATOM   6390  N  N     . GLU C  1 83  ? -33.454 21.965  -30.375 1.00 37.97  ? 55  GLU C N     1 
ATOM   6391  C  CA    . GLU C  1 83  ? -33.587 23.290  -30.987 1.00 41.71  ? 55  GLU C CA    1 
ATOM   6392  C  C     . GLU C  1 83  ? -34.280 24.279  -30.041 1.00 38.86  ? 55  GLU C C     1 
ATOM   6393  O  O     . GLU C  1 83  ? -33.817 25.406  -29.871 1.00 38.30  ? 55  GLU C O     1 
ATOM   6394  C  CB    . GLU C  1 83  ? -34.358 23.213  -32.311 1.00 43.31  ? 55  GLU C CB    1 
ATOM   6395  C  CG    . GLU C  1 83  ? -33.647 22.452  -33.420 1.00 47.76  ? 55  GLU C CG    1 
ATOM   6396  C  CD    . GLU C  1 83  ? -32.382 23.138  -33.900 1.00 58.14  ? 55  GLU C CD    1 
ATOM   6397  O  OE1   . GLU C  1 83  ? -32.474 24.269  -34.435 1.00 60.99  ? 55  GLU C OE1   1 
ATOM   6398  O  OE2   . GLU C  1 83  ? -31.291 22.537  -33.753 1.00 62.59  ? 55  GLU C OE2   1 
ATOM   6399  N  N     . LYS C  1 84  ? -35.381 23.849  -29.426 1.00 37.33  ? 56  LYS C N     1 
ATOM   6400  C  CA    . LYS C  1 84  ? -36.099 24.674  -28.449 1.00 41.91  ? 56  LYS C CA    1 
ATOM   6401  C  C     . LYS C  1 84  ? -35.278 24.927  -27.182 1.00 36.72  ? 56  LYS C C     1 
ATOM   6402  O  O     . LYS C  1 84  ? -35.297 26.023  -26.644 1.00 40.43  ? 56  LYS C O     1 
ATOM   6403  C  CB    . LYS C  1 84  ? -37.417 24.017  -28.049 1.00 41.15  ? 56  LYS C CB    1 
ATOM   6404  C  CG    . LYS C  1 84  ? -38.428 23.831  -29.153 1.00 39.98  ? 56  LYS C CG    1 
ATOM   6405  C  CD    . LYS C  1 84  ? -39.576 22.970  -28.634 1.00 44.44  ? 56  LYS C CD    1 
ATOM   6406  C  CE    . LYS C  1 84  ? -40.748 22.943  -29.602 1.00 49.33  ? 56  LYS C CE    1 
ATOM   6407  N  NZ    . LYS C  1 84  ? -41.819 22.018  -29.128 1.00 57.22  ? 56  LYS C NZ    1 
ATOM   6408  N  N     . ARG C  1 85  ? -34.568 23.912  -26.706 1.00 34.73  ? 57  ARG C N     1 
ATOM   6409  C  CA    . ARG C  1 85  ? -33.702 24.061  -25.539 1.00 35.40  ? 57  ARG C CA    1 
ATOM   6410  C  C     . ARG C  1 85  ? -32.654 25.164  -25.685 1.00 37.09  ? 57  ARG C C     1 
ATOM   6411  O  O     . ARG C  1 85  ? -32.244 25.769  -24.690 1.00 38.14  ? 57  ARG C O     1 
ATOM   6412  C  CB    . ARG C  1 85  ? -32.975 22.755  -25.235 1.00 29.94  ? 57  ARG C CB    1 
ATOM   6413  C  CG    . ARG C  1 85  ? -33.868 21.548  -25.018 1.00 27.05  ? 57  ARG C CG    1 
ATOM   6414  C  CD    . ARG C  1 85  ? -33.235 20.627  -23.978 1.00 25.93  ? 57  ARG C CD    1 
ATOM   6415  N  NE    . ARG C  1 85  ? -33.340 21.177  -22.618 1.00 30.10  ? 57  ARG C NE    1 
ATOM   6416  C  CZ    . ARG C  1 85  ? -32.586 20.815  -21.580 1.00 33.39  ? 57  ARG C CZ    1 
ATOM   6417  N  NH1   . ARG C  1 85  ? -31.642 19.882  -21.732 1.00 26.34  ? 57  ARG C NH1   1 
ATOM   6418  N  NH2   . ARG C  1 85  ? -32.781 21.385  -20.378 1.00 25.95  ? 57  ARG C NH2   1 
ATOM   6419  N  N     . VAL C  1 86  ? -32.188 25.419  -26.903 1.00 36.16  ? 58  VAL C N     1 
ATOM   6420  C  CA    . VAL C  1 86  ? -31.045 26.320  -27.040 1.00 33.63  ? 58  VAL C CA    1 
ATOM   6421  C  C     . VAL C  1 86  ? -31.395 27.616  -27.755 1.00 31.52  ? 58  VAL C C     1 
ATOM   6422  O  O     . VAL C  1 86  ? -30.526 28.449  -27.985 1.00 29.26  ? 58  VAL C O     1 
ATOM   6423  C  CB    . VAL C  1 86  ? -29.853 25.635  -27.782 1.00 35.08  ? 58  VAL C CB    1 
ATOM   6424  C  CG1   . VAL C  1 86  ? -29.371 24.421  -27.004 1.00 32.41  ? 58  VAL C CG1   1 
ATOM   6425  C  CG2   . VAL C  1 86  ? -30.229 25.258  -29.220 1.00 37.35  ? 58  VAL C CG2   1 
ATOM   6426  N  N     . THR C  1 87  ? -32.663 27.800  -28.098 1.00 32.96  ? 59  THR C N     1 
ATOM   6427  C  CA    . THR C  1 87  ? -33.026 28.984  -28.859 1.00 34.59  ? 59  THR C CA    1 
ATOM   6428  C  C     . THR C  1 87  ? -34.183 29.746  -28.216 1.00 30.35  ? 59  THR C C     1 
ATOM   6429  O  O     . THR C  1 87  ? -35.354 29.533  -28.536 1.00 32.85  ? 59  THR C O     1 
ATOM   6430  C  CB    . THR C  1 87  ? -33.368 28.613  -30.309 1.00 37.35  ? 59  THR C CB    1 
ATOM   6431  O  OG1   . THR C  1 87  ? -32.432 27.630  -30.767 1.00 34.07  ? 59  THR C OG1   1 
ATOM   6432  C  CG2   . THR C  1 87  ? -33.296 29.860  -31.202 1.00 38.77  ? 59  THR C CG2   1 
ATOM   6433  N  N     . PRO C  1 88  ? -33.849 30.648  -27.296 1.00 33.02  ? 60  PRO C N     1 
ATOM   6434  C  CA    . PRO C  1 88  ? -34.858 31.454  -26.597 1.00 31.07  ? 60  PRO C CA    1 
ATOM   6435  C  C     . PRO C  1 88  ? -35.822 32.141  -27.566 1.00 34.26  ? 60  PRO C C     1 
ATOM   6436  O  O     . PRO C  1 88  ? -37.019 32.258  -27.274 1.00 31.90  ? 60  PRO C O     1 
ATOM   6437  C  CB    . PRO C  1 88  ? -34.013 32.479  -25.840 1.00 32.32  ? 60  PRO C CB    1 
ATOM   6438  C  CG    . PRO C  1 88  ? -32.699 31.808  -25.617 1.00 30.38  ? 60  PRO C CG    1 
ATOM   6439  C  CD    . PRO C  1 88  ? -32.478 30.985  -26.877 1.00 30.08  ? 60  PRO C CD    1 
ATOM   6440  N  N     . LYS C  1 89  ? -35.309 32.546  -28.729 1.00 33.86  ? 61  LYS C N     1 
ATOM   6441  C  CA    . LYS C  1 89  ? -36.105 33.297  -29.690 1.00 36.46  ? 61  LYS C CA    1 
ATOM   6442  C  C     . LYS C  1 89  ? -37.174 32.437  -30.371 1.00 41.42  ? 61  LYS C C     1 
ATOM   6443  O  O     . LYS C  1 89  ? -38.161 32.967  -30.904 1.00 41.13  ? 61  LYS C O     1 
ATOM   6444  C  CB    . LYS C  1 89  ? -35.193 33.948  -30.731 1.00 38.11  ? 61  LYS C CB    1 
ATOM   6445  C  CG    . LYS C  1 89  ? -34.405 35.150  -30.203 1.00 37.46  ? 61  LYS C CG    1 
ATOM   6446  C  CD    . LYS C  1 89  ? -33.648 35.835  -31.339 1.00 38.20  ? 61  LYS C CD    1 
ATOM   6447  C  CE    . LYS C  1 89  ? -32.985 37.146  -30.888 1.00 49.85  ? 61  LYS C CE    1 
ATOM   6448  N  NZ    . LYS C  1 89  ? -31.608 36.992  -30.309 1.00 43.81  ? 61  LYS C NZ    1 
ATOM   6449  N  N     . LEU C  1 90  ? -36.976 31.117  -30.347 1.00 37.98  ? 62  LEU C N     1 
ATOM   6450  C  CA    . LEU C  1 90  ? -37.997 30.158  -30.768 1.00 34.03  ? 62  LEU C CA    1 
ATOM   6451  C  C     . LEU C  1 90  ? -39.145 30.046  -29.781 1.00 38.41  ? 62  LEU C C     1 
ATOM   6452  O  O     . LEU C  1 90  ? -40.288 29.825  -30.173 1.00 39.59  ? 62  LEU C O     1 
ATOM   6453  C  CB    . LEU C  1 90  ? -37.391 28.761  -30.941 1.00 42.10  ? 62  LEU C CB    1 
ATOM   6454  C  CG    . LEU C  1 90  ? -36.926 28.355  -32.329 1.00 44.66  ? 62  LEU C CG    1 
ATOM   6455  C  CD1   . LEU C  1 90  ? -36.604 26.862  -32.344 1.00 45.47  ? 62  LEU C CD1   1 
ATOM   6456  C  CD2   . LEU C  1 90  ? -37.993 28.709  -33.356 1.00 48.18  ? 62  LEU C CD2   1 
ATOM   6457  N  N     . LEU C  1 91  ? -38.827 30.147  -28.494 1.00 39.29  ? 63  LEU C N     1 
ATOM   6458  C  CA    . LEU C  1 91  ? -39.823 29.977  -27.434 1.00 37.64  ? 63  LEU C CA    1 
ATOM   6459  C  C     . LEU C  1 91  ? -40.633 31.247  -27.244 1.00 40.47  ? 63  LEU C C     1 
ATOM   6460  O  O     . LEU C  1 91  ? -41.811 31.200  -26.876 1.00 40.02  ? 63  LEU C O     1 
ATOM   6461  C  CB    . LEU C  1 91  ? -39.143 29.593  -26.118 1.00 37.56  ? 63  LEU C CB    1 
ATOM   6462  C  CG    . LEU C  1 91  ? -38.149 28.430  -26.224 1.00 41.76  ? 63  LEU C CG    1 
ATOM   6463  C  CD1   . LEU C  1 91  ? -37.329 28.315  -24.946 1.00 36.64  ? 63  LEU C CD1   1 
ATOM   6464  C  CD2   . LEU C  1 91  ? -38.873 27.105  -26.554 1.00 32.63  ? 63  LEU C CD2   1 
ATOM   6465  N  N     . LEU C  1 92  ? -39.986 32.386  -27.476 1.00 37.75  ? 64  LEU C N     1 
ATOM   6466  C  CA    . LEU C  1 92  ? -40.664 33.681  -27.391 1.00 41.15  ? 64  LEU C CA    1 
ATOM   6467  C  C     . LEU C  1 92  ? -40.235 34.530  -28.583 1.00 38.46  ? 64  LEU C C     1 
ATOM   6468  O  O     . LEU C  1 92  ? -39.113 35.043  -28.630 1.00 36.01  ? 64  LEU C O     1 
ATOM   6469  C  CB    . LEU C  1 92  ? -40.367 34.397  -26.058 1.00 32.52  ? 64  LEU C CB    1 
ATOM   6470  C  CG    . LEU C  1 92  ? -41.157 35.695  -25.831 1.00 36.56  ? 64  LEU C CG    1 
ATOM   6471  C  CD1   . LEU C  1 92  ? -42.627 35.407  -25.569 1.00 30.49  ? 64  LEU C CD1   1 
ATOM   6472  C  CD2   . LEU C  1 92  ? -40.557 36.591  -24.734 1.00 33.40  ? 64  LEU C CD2   1 
ATOM   6473  N  N     . PRO C  1 93  ? -41.119 34.637  -29.575 1.00 45.14  ? 65  PRO C N     1 
ATOM   6474  C  CA    . PRO C  1 93  ? -40.824 35.404  -30.788 1.00 41.97  ? 65  PRO C CA    1 
ATOM   6475  C  C     . PRO C  1 93  ? -40.285 36.771  -30.415 1.00 43.34  ? 65  PRO C C     1 
ATOM   6476  O  O     . PRO C  1 93  ? -40.878 37.423  -29.555 1.00 40.07  ? 65  PRO C O     1 
ATOM   6477  C  CB    . PRO C  1 93  ? -42.185 35.508  -31.475 1.00 43.64  ? 65  PRO C CB    1 
ATOM   6478  C  CG    . PRO C  1 93  ? -42.951 34.304  -30.978 1.00 46.40  ? 65  PRO C CG    1 
ATOM   6479  C  CD    . PRO C  1 93  ? -42.489 34.093  -29.565 1.00 44.71  ? 65  PRO C CD    1 
ATOM   6480  N  N     . LYS C  1 94  ? -39.150 37.152  -30.994 1.00 41.17  ? 66  LYS C N     1 
ATOM   6481  C  CA    . LYS C  1 94  ? -38.580 38.491  -30.833 1.00 43.70  ? 66  LYS C CA    1 
ATOM   6482  C  C     . LYS C  1 94  ? -38.058 38.765  -29.415 1.00 41.71  ? 66  LYS C C     1 
ATOM   6483  O  O     . LYS C  1 94  ? -38.029 39.906  -28.951 1.00 44.42  ? 66  LYS C O     1 
ATOM   6484  C  CB    . LYS C  1 94  ? -39.610 39.556  -31.248 1.00 51.84  ? 66  LYS C CB    1 
ATOM   6485  C  CG    . LYS C  1 94  ? -39.937 39.554  -32.753 1.00 50.94  ? 66  LYS C CG    1 
ATOM   6486  C  CD    . LYS C  1 94  ? -41.040 40.551  -33.104 1.00 56.41  ? 66  LYS C CD    1 
ATOM   6487  C  CE    . LYS C  1 94  ? -42.364 40.181  -32.442 1.00 58.74  ? 66  LYS C CE    1 
ATOM   6488  N  NZ    . LYS C  1 94  ? -43.377 41.268  -32.580 1.00 65.29  ? 66  LYS C NZ    1 
ATOM   6489  N  N     . ALA C  1 95  ? -37.607 37.708  -28.755 1.00 37.00  ? 67  ALA C N     1 
ATOM   6490  C  CA    . ALA C  1 95  ? -36.981 37.800  -27.445 1.00 36.78  ? 67  ALA C CA    1 
ATOM   6491  C  C     . ALA C  1 95  ? -35.653 38.542  -27.503 1.00 37.98  ? 67  ALA C C     1 
ATOM   6492  O  O     . ALA C  1 95  ? -34.915 38.418  -28.474 1.00 36.24  ? 67  ALA C O     1 
ATOM   6493  C  CB    . ALA C  1 95  ? -36.778 36.404  -26.875 1.00 34.38  ? 67  ALA C CB    1 
ATOM   6494  N  N     . LYS C  1 96  ? -35.349 39.294  -26.447 1.00 30.69  ? 68  LYS C N     1 
ATOM   6495  C  CA    . LYS C  1 96  ? -34.141 40.097  -26.387 1.00 32.54  ? 68  LYS C CA    1 
ATOM   6496  C  C     . LYS C  1 96  ? -33.326 39.839  -25.131 1.00 36.73  ? 68  LYS C C     1 
ATOM   6497  O  O     . LYS C  1 96  ? -32.129 40.134  -25.099 1.00 34.51  ? 68  LYS C O     1 
ATOM   6498  C  CB    . LYS C  1 96  ? -34.490 41.591  -26.454 1.00 40.36  ? 68  LYS C CB    1 
ATOM   6499  C  CG    . LYS C  1 96  ? -35.323 41.991  -27.668 1.00 40.98  ? 68  LYS C CG    1 
ATOM   6500  C  CD    . LYS C  1 96  ? -34.546 41.798  -28.964 1.00 49.87  ? 68  LYS C CD    1 
ATOM   6501  C  CE    . LYS C  1 96  ? -35.197 42.576  -30.123 1.00 51.99  ? 68  LYS C CE    1 
ATOM   6502  N  NZ    . LYS C  1 96  ? -34.478 42.355  -31.413 1.00 61.97  ? 68  LYS C NZ    1 
ATOM   6503  N  N     . SER C  1 97  ? -33.975 39.332  -24.082 1.00 33.00  ? 69  SER C N     1 
ATOM   6504  C  CA    . SER C  1 97  ? -33.252 38.985  -22.859 1.00 31.79  ? 69  SER C CA    1 
ATOM   6505  C  C     . SER C  1 97  ? -33.890 37.821  -22.103 1.00 29.67  ? 69  SER C C     1 
ATOM   6506  O  O     . SER C  1 97  ? -35.023 37.411  -22.367 1.00 27.32  ? 69  SER C O     1 
ATOM   6507  C  CB    . SER C  1 97  ? -33.154 40.196  -21.917 1.00 30.38  ? 69  SER C CB    1 
ATOM   6508  O  OG    . SER C  1 97  ? -34.419 40.460  -21.334 1.00 31.43  ? 69  SER C OG    1 
ATOM   6509  N  N     . ILE C  1 98  ? -33.143 37.306  -21.142 1.00 29.15  ? 70  ILE C N     1 
ATOM   6510  C  CA    . ILE C  1 98  ? -33.686 36.356  -20.184 1.00 30.83  ? 70  ILE C CA    1 
ATOM   6511  C  C     . ILE C  1 98  ? -33.352 36.820  -18.778 1.00 29.27  ? 70  ILE C C     1 
ATOM   6512  O  O     . ILE C  1 98  ? -32.194 37.113  -18.474 1.00 31.79  ? 70  ILE C O     1 
ATOM   6513  C  CB    . ILE C  1 98  ? -33.132 34.928  -20.379 1.00 29.14  ? 70  ILE C CB    1 
ATOM   6514  C  CG1   . ILE C  1 98  ? -33.340 34.447  -21.821 1.00 31.30  ? 70  ILE C CG1   1 
ATOM   6515  C  CG2   . ILE C  1 98  ? -33.782 33.993  -19.373 1.00 25.00  ? 70  ILE C CG2   1 
ATOM   6516  C  CD1   . ILE C  1 98  ? -32.541 33.185  -22.181 1.00 25.67  ? 70  ILE C CD1   1 
ATOM   6517  N  N     . VAL C  1 99  ? -34.363 36.874  -17.922 1.00 26.52  ? 71  VAL C N     1 
ATOM   6518  C  CA    . VAL C  1 99  ? -34.149 37.189  -16.516 1.00 29.89  ? 71  VAL C CA    1 
ATOM   6519  C  C     . VAL C  1 99  ? -34.025 35.906  -15.684 1.00 30.13  ? 71  VAL C C     1 
ATOM   6520  O  O     . VAL C  1 99  ? -34.994 35.188  -15.533 1.00 31.36  ? 71  VAL C O     1 
ATOM   6521  C  CB    . VAL C  1 99  ? -35.306 38.064  -15.957 1.00 29.63  ? 71  VAL C CB    1 
ATOM   6522  C  CG1   . VAL C  1 99  ? -35.057 38.418  -14.502 1.00 28.20  ? 71  VAL C CG1   1 
ATOM   6523  C  CG2   . VAL C  1 99  ? -35.458 39.336  -16.779 1.00 32.13  ? 71  VAL C CG2   1 
ATOM   6524  N  N     . ALA C  1 100 ? -32.838 35.633  -15.144 1.00 33.18  ? 72  ALA C N     1 
ATOM   6525  C  CA    . ALA C  1 100 ? -32.598 34.460  -14.301 1.00 30.16  ? 72  ALA C CA    1 
ATOM   6526  C  C     . ALA C  1 100 ? -32.800 34.769  -12.808 1.00 33.56  ? 72  ALA C C     1 
ATOM   6527  O  O     . ALA C  1 100 ? -32.322 35.798  -12.301 1.00 31.42  ? 72  ALA C O     1 
ATOM   6528  C  CB    . ALA C  1 100 ? -31.183 33.932  -14.537 1.00 24.95  ? 72  ALA C CB    1 
ATOM   6529  N  N     . ILE C  1 101 ? -33.493 33.887  -12.090 1.00 30.79  ? 73  ILE C N     1 
ATOM   6530  C  CA    . ILE C  1 101 ? -33.599 34.051  -10.635 1.00 28.16  ? 73  ILE C CA    1 
ATOM   6531  C  C     . ILE C  1 101 ? -33.175 32.791  -9.876  1.00 31.84  ? 73  ILE C C     1 
ATOM   6532  O  O     . ILE C  1 101 ? -33.296 31.675  -10.385 1.00 28.76  ? 73  ILE C O     1 
ATOM   6533  C  CB    . ILE C  1 101 ? -35.037 34.454  -10.202 1.00 28.83  ? 73  ILE C CB    1 
ATOM   6534  C  CG1   . ILE C  1 101 ? -36.035 33.329  -10.466 1.00 28.74  ? 73  ILE C CG1   1 
ATOM   6535  C  CG2   . ILE C  1 101 ? -35.482 35.717  -10.934 1.00 29.40  ? 73  ILE C CG2   1 
ATOM   6536  C  CD1   . ILE C  1 101 ? -37.428 33.634  -9.956  1.00 27.13  ? 73  ILE C CD1   1 
ATOM   6537  N  N     . ALA C  1 102 ? -32.670 32.987  -8.660  1.00 25.81  ? 74  ALA C N     1 
ATOM   6538  C  CA    . ALA C  1 102 ? -32.336 31.891  -7.754  1.00 27.32  ? 74  ALA C CA    1 
ATOM   6539  C  C     . ALA C  1 102 ? -32.905 32.179  -6.362  1.00 32.42  ? 74  ALA C C     1 
ATOM   6540  O  O     . ALA C  1 102 ? -32.851 33.331  -5.890  1.00 29.31  ? 74  ALA C O     1 
ATOM   6541  C  CB    . ALA C  1 102 ? -30.833 31.695  -7.672  1.00 25.63  ? 74  ALA C CB    1 
ATOM   6542  N  N     . LEU C  1 103 ? -33.473 31.156  -5.728  1.00 26.18  ? 75  LEU C N     1 
ATOM   6543  C  CA    . LEU C  1 103 ? -33.844 31.243  -4.310  1.00 27.78  ? 75  LEU C CA    1 
ATOM   6544  C  C     . LEU C  1 103 ? -33.097 30.180  -3.530  1.00 27.96  ? 75  LEU C C     1 
ATOM   6545  O  O     . LEU C  1 103 ? -33.026 29.002  -3.957  1.00 26.12  ? 75  LEU C O     1 
ATOM   6546  C  CB    . LEU C  1 103 ? -35.353 31.079  -4.084  1.00 26.26  ? 75  LEU C CB    1 
ATOM   6547  C  CG    . LEU C  1 103 ? -36.245 32.309  -4.251  1.00 28.11  ? 75  LEU C CG    1 
ATOM   6548  C  CD1   . LEU C  1 103 ? -36.404 32.666  -5.719  1.00 28.09  ? 75  LEU C CD1   1 
ATOM   6549  C  CD2   . LEU C  1 103 ? -37.600 32.066  -3.572  1.00 29.75  ? 75  LEU C CD2   1 
ATOM   6550  N  N     . ALA C  1 104 ? -32.534 30.592  -2.398  1.00 21.20  ? 76  ALA C N     1 
ATOM   6551  C  CA    . ALA C  1 104 ? -31.708 29.698  -1.586  1.00 29.71  ? 76  ALA C CA    1 
ATOM   6552  C  C     . ALA C  1 104 ? -32.590 28.842  -0.681  1.00 29.16  ? 76  ALA C C     1 
ATOM   6553  O  O     . ALA C  1 104 ? -33.570 29.342  -0.118  1.00 34.46  ? 76  ALA C O     1 
ATOM   6554  C  CB    . ALA C  1 104 ? -30.691 30.499  -0.748  1.00 23.46  ? 76  ALA C CB    1 
ATOM   6555  N  N     . TYR C  1 105 ? -32.243 27.568  -0.519  1.00 26.81  ? 77  TYR C N     1 
ATOM   6556  C  CA    . TYR C  1 105 ? -33.061 26.704  0.325   1.00 25.77  ? 77  TYR C CA    1 
ATOM   6557  C  C     . TYR C  1 105 ? -32.300 26.075  1.500   1.00 30.15  ? 77  TYR C C     1 
ATOM   6558  O  O     . TYR C  1 105 ? -31.070 25.931  1.461   1.00 29.62  ? 77  TYR C O     1 
ATOM   6559  C  CB    . TYR C  1 105 ? -33.724 25.607  -0.524  1.00 25.29  ? 77  TYR C CB    1 
ATOM   6560  C  CG    . TYR C  1 105 ? -32.815 24.678  -1.284  1.00 27.84  ? 77  TYR C CG    1 
ATOM   6561  C  CD1   . TYR C  1 105 ? -32.176 23.600  -0.656  1.00 32.51  ? 77  TYR C CD1   1 
ATOM   6562  C  CD2   . TYR C  1 105 ? -32.652 24.820  -2.658  1.00 28.58  ? 77  TYR C CD2   1 
ATOM   6563  C  CE1   . TYR C  1 105 ? -31.365 22.698  -1.399  1.00 30.20  ? 77  TYR C CE1   1 
ATOM   6564  C  CE2   . TYR C  1 105 ? -31.852 23.941  -3.392  1.00 26.96  ? 77  TYR C CE2   1 
ATOM   6565  C  CZ    . TYR C  1 105 ? -31.204 22.889  -2.769  1.00 29.65  ? 77  TYR C CZ    1 
ATOM   6566  O  OH    . TYR C  1 105 ? -30.406 22.034  -3.550  1.00 27.24  ? 77  TYR C OH    1 
ATOM   6567  N  N     . PRO C  1 106 ? -33.039 25.709  2.564   1.00 26.72  ? 78  PRO C N     1 
ATOM   6568  C  CA    . PRO C  1 106 ? -32.379 25.187  3.766   1.00 29.55  ? 78  PRO C CA    1 
ATOM   6569  C  C     . PRO C  1 106 ? -31.663 23.880  3.511   1.00 33.54  ? 78  PRO C C     1 
ATOM   6570  O  O     . PRO C  1 106 ? -32.147 23.021  2.767   1.00 29.49  ? 78  PRO C O     1 
ATOM   6571  C  CB    . PRO C  1 106 ? -33.523 25.007  4.768   1.00 32.25  ? 78  PRO C CB    1 
ATOM   6572  C  CG    . PRO C  1 106 ? -34.782 25.284  4.046   1.00 35.92  ? 78  PRO C CG    1 
ATOM   6573  C  CD    . PRO C  1 106 ? -34.457 26.024  2.784   1.00 27.44  ? 78  PRO C CD    1 
ATOM   6574  N  N     . SER C  1 107 ? -30.486 23.759  4.116   1.00 32.64  ? 79  SER C N     1 
ATOM   6575  C  CA    . SER C  1 107 ? -29.650 22.587  3.951   1.00 31.22  ? 79  SER C CA    1 
ATOM   6576  C  C     . SER C  1 107 ? -29.518 21.780  5.252   1.00 35.19  ? 79  SER C C     1 
ATOM   6577  O  O     . SER C  1 107 ? -28.928 20.698  5.260   1.00 38.29  ? 79  SER C O     1 
ATOM   6578  C  CB    . SER C  1 107 ? -28.276 23.008  3.443   1.00 31.69  ? 79  SER C CB    1 
ATOM   6579  O  OG    . SER C  1 107 ? -27.551 23.683  4.452   1.00 35.12  ? 79  SER C OG    1 
ATOM   6580  N  N     . ARG C  1 108 ? -30.041 22.320  6.352   1.00 29.62  ? 80  ARG C N     1 
ATOM   6581  C  CA    A ARG C  1 108 ? -30.082 21.603  7.620   0.45 38.41  ? 80  ARG C CA    1 
ATOM   6582  C  CA    B ARG C  1 108 ? -30.089 21.583  7.605   0.55 38.41  ? 80  ARG C CA    1 
ATOM   6583  C  C     . ARG C  1 108 ? -31.513 21.543  8.131   1.00 39.58  ? 80  ARG C C     1 
ATOM   6584  O  O     . ARG C  1 108 ? -32.215 22.560  8.139   1.00 39.31  ? 80  ARG C O     1 
ATOM   6585  C  CB    A ARG C  1 108 ? -29.183 22.261  8.670   0.45 40.38  ? 80  ARG C CB    1 
ATOM   6586  C  CB    B ARG C  1 108 ? -29.152 22.188  8.652   0.55 40.38  ? 80  ARG C CB    1 
ATOM   6587  C  CG    A ARG C  1 108 ? -27.701 22.303  8.319   0.45 43.32  ? 80  ARG C CG    1 
ATOM   6588  C  CG    B ARG C  1 108 ? -27.690 21.779  8.491   0.55 43.85  ? 80  ARG C CG    1 
ATOM   6589  C  CD    A ARG C  1 108 ? -26.868 22.727  9.531   0.45 46.55  ? 80  ARG C CD    1 
ATOM   6590  C  CD    B ARG C  1 108 ? -26.923 21.946  9.803   0.55 47.53  ? 80  ARG C CD    1 
ATOM   6591  N  NE    A ARG C  1 108 ? -25.564 23.269  9.151   0.45 48.22  ? 80  ARG C NE    1 
ATOM   6592  N  NE    B ARG C  1 108 ? -25.480 21.791  9.623   0.55 50.65  ? 80  ARG C NE    1 
ATOM   6593  C  CZ    A ARG C  1 108 ? -25.184 24.523  9.374   0.45 48.09  ? 80  ARG C CZ    1 
ATOM   6594  C  CZ    B ARG C  1 108 ? -24.812 20.660  9.823   0.55 54.33  ? 80  ARG C CZ    1 
ATOM   6595  N  NH1   A ARG C  1 108 ? -26.006 25.367  9.984   0.45 44.06  ? 80  ARG C NH1   1 
ATOM   6596  N  NH1   B ARG C  1 108 ? -25.450 19.563  10.219  0.55 57.83  ? 80  ARG C NH1   1 
ATOM   6597  N  NH2   A ARG C  1 108 ? -23.981 24.934  8.993   0.45 47.92  ? 80  ARG C NH2   1 
ATOM   6598  N  NH2   B ARG C  1 108 ? -23.501 20.627  9.632   0.55 57.20  ? 80  ARG C NH2   1 
ATOM   6599  N  N     . MET C  1 109 ? -31.931 20.344  8.532   1.00 36.63  ? 81  MET C N     1 
ATOM   6600  C  CA    . MET C  1 109 ? -33.258 20.083  9.075   1.00 44.94  ? 81  MET C CA    1 
ATOM   6601  C  C     . MET C  1 109 ? -33.278 20.315  10.595  1.00 45.74  ? 81  MET C C     1 
ATOM   6602  O  O     . MET C  1 109 ? -32.586 19.626  11.341  1.00 50.57  ? 81  MET C O     1 
ATOM   6603  C  CB    . MET C  1 109 ? -33.673 18.639  8.741   1.00 41.86  ? 81  MET C CB    1 
ATOM   6604  C  CG    . MET C  1 109 ? -35.100 18.259  9.115   1.00 39.80  ? 81  MET C CG    1 
ATOM   6605  S  SD    . MET C  1 109 ? -35.453 16.529  8.718   1.00 41.37  ? 81  MET C SD    1 
ATOM   6606  C  CE    . MET C  1 109 ? -35.237 16.495  6.940   1.00 39.55  ? 81  MET C CE    1 
ATOM   6607  N  N     . LYS C  1 110 ? -34.070 21.278  11.052  1.00 44.42  ? 82  LYS C N     1 
ATOM   6608  C  CA    . LYS C  1 110 ? -34.154 21.581  12.485  1.00 54.81  ? 82  LYS C CA    1 
ATOM   6609  C  C     . LYS C  1 110 ? -34.947 20.512  13.231  1.00 50.01  ? 82  LYS C C     1 
ATOM   6610  O  O     . LYS C  1 110 ? -36.015 20.086  12.771  1.00 47.93  ? 82  LYS C O     1 
ATOM   6611  C  CB    . LYS C  1 110 ? -34.792 22.957  12.706  1.00 52.71  ? 82  LYS C CB    1 
ATOM   6612  C  CG    . LYS C  1 110 ? -34.643 23.516  14.113  1.00 65.38  ? 82  LYS C CG    1 
ATOM   6613  C  CD    . LYS C  1 110 ? -35.058 24.987  14.177  1.00 66.08  ? 82  LYS C CD    1 
ATOM   6614  C  CE    . LYS C  1 110 ? -36.560 25.168  13.963  1.00 68.84  ? 82  LYS C CE    1 
ATOM   6615  N  NZ    . LYS C  1 110 ? -37.373 24.601  15.079  1.00 68.60  ? 82  LYS C NZ    1 
ATOM   6616  N  N     . ASP C  1 111 ? -34.407 20.091  14.377  1.00 54.47  ? 83  ASP C N     1 
ATOM   6617  C  CA    . ASP C  1 111 ? -35.027 19.081  15.253  1.00 54.45  ? 83  ASP C CA    1 
ATOM   6618  C  C     . ASP C  1 111 ? -35.421 17.816  14.486  1.00 55.51  ? 83  ASP C C     1 
ATOM   6619  O  O     . ASP C  1 111 ? -36.533 17.300  14.644  1.00 52.06  ? 83  ASP C O     1 
ATOM   6620  C  CB    . ASP C  1 111 ? -36.257 19.658  15.969  1.00 54.64  ? 83  ASP C CB    1 
ATOM   6621  C  CG    . ASP C  1 111 ? -35.943 20.934  16.749  1.00 65.03  ? 83  ASP C CG    1 
ATOM   6622  O  OD1   . ASP C  1 111 ? -34.812 21.065  17.279  1.00 61.53  ? 83  ASP C OD1   1 
ATOM   6623  O  OD2   . ASP C  1 111 ? -36.835 21.812  16.823  1.00 69.16  ? 83  ASP C OD2   1 
ATOM   6624  N  N     . ALA C  1 112 ? -34.509 17.328  13.651  1.00 50.73  ? 84  ALA C N     1 
ATOM   6625  C  CA    . ALA C  1 112 ? -34.744 16.100  12.894  1.00 49.54  ? 84  ALA C CA    1 
ATOM   6626  C  C     . ALA C  1 112 ? -34.736 14.887  13.816  1.00 51.65  ? 84  ALA C C     1 
ATOM   6627  O  O     . ALA C  1 112 ? -33.817 14.720  14.615  1.00 53.16  ? 84  ALA C O     1 
ATOM   6628  C  CB    . ALA C  1 112 ? -33.702 15.939  11.803  1.00 42.94  ? 84  ALA C CB    1 
ATOM   6629  N  N     . PRO C  1 113 ? -35.756 14.024  13.695  1.00 49.51  ? 85  PRO C N     1 
ATOM   6630  C  CA    . PRO C  1 113 ? -35.810 12.830  14.539  1.00 50.87  ? 85  PRO C CA    1 
ATOM   6631  C  C     . PRO C  1 113 ? -34.738 11.849  14.104  1.00 46.37  ? 85  PRO C C     1 
ATOM   6632  O  O     . PRO C  1 113 ? -34.380 11.811  12.926  1.00 45.91  ? 85  PRO C O     1 
ATOM   6633  C  CB    . PRO C  1 113 ? -37.215 12.287  14.282  1.00 43.84  ? 85  PRO C CB    1 
ATOM   6634  C  CG    . PRO C  1 113 ? -37.479 12.658  12.864  1.00 45.91  ? 85  PRO C CG    1 
ATOM   6635  C  CD    . PRO C  1 113 ? -36.754 13.973  12.612  1.00 49.10  ? 85  PRO C CD    1 
ATOM   6636  N  N     A ARG C  1 114 ? -34.205 11.074  15.043  0.52 50.59  ? 86  ARG C N     1 
ATOM   6637  N  N     B ARG C  1 114 ? -34.234 11.062  15.048  0.48 50.58  ? 86  ARG C N     1 
ATOM   6638  C  CA    A ARG C  1 114 ? -33.168 10.110  14.697  0.52 51.96  ? 86  ARG C CA    1 
ATOM   6639  C  CA    B ARG C  1 114 ? -33.200 10.079  14.752  0.48 51.94  ? 86  ARG C CA    1 
ATOM   6640  C  C     A ARG C  1 114 ? -33.794 8.788   14.252  0.52 47.63  ? 86  ARG C C     1 
ATOM   6641  C  C     B ARG C  1 114 ? -33.820 8.778   14.245  0.48 47.63  ? 86  ARG C C     1 
ATOM   6642  O  O     A ARG C  1 114 ? -34.783 8.324   14.823  0.52 48.33  ? 86  ARG C O     1 
ATOM   6643  O  O     B ARG C  1 114 ? -34.826 8.308   14.780  0.48 48.32  ? 86  ARG C O     1 
ATOM   6644  C  CB    A ARG C  1 114 ? -32.199 9.895   15.869  0.52 51.66  ? 86  ARG C CB    1 
ATOM   6645  C  CB    B ARG C  1 114 ? -32.337 9.810   15.991  0.48 51.64  ? 86  ARG C CB    1 
ATOM   6646  C  CG    A ARG C  1 114 ? -32.792 9.223   17.097  0.52 50.71  ? 86  ARG C CG    1 
ATOM   6647  C  CG    B ARG C  1 114 ? -31.603 11.034  16.530  0.48 51.25  ? 86  ARG C CG    1 
ATOM   6648  C  CD    A ARG C  1 114 ? -31.739 9.040   18.181  0.52 50.39  ? 86  ARG C CD    1 
ATOM   6649  C  CD    B ARG C  1 114 ? -32.425 11.786  17.576  0.48 51.18  ? 86  ARG C CD    1 
ATOM   6650  N  NE    A ARG C  1 114 ? -32.251 8.250   19.297  0.52 48.25  ? 86  ARG C NE    1 
ATOM   6651  N  NE    B ARG C  1 114 ? -32.583 13.201  17.244  0.48 51.47  ? 86  ARG C NE    1 
ATOM   6652  C  CZ    A ARG C  1 114 ? -32.894 8.764   20.338  0.52 55.34  ? 86  ARG C CZ    1 
ATOM   6653  C  CZ    B ARG C  1 114 ? -31.680 14.141  17.514  0.48 55.10  ? 86  ARG C CZ    1 
ATOM   6654  N  NH1   A ARG C  1 114 ? -33.103 10.074  20.413  0.52 53.61  ? 86  ARG C NH1   1 
ATOM   6655  N  NH1   B ARG C  1 114 ? -30.547 13.814  18.122  0.48 50.23  ? 86  ARG C NH1   1 
ATOM   6656  N  NH2   A ARG C  1 114 ? -33.329 7.970   21.305  0.52 55.46  ? 86  ARG C NH2   1 
ATOM   6657  N  NH2   B ARG C  1 114 ? -31.905 15.407  17.172  0.48 53.11  ? 86  ARG C NH2   1 
ATOM   6658  N  N     . SER C  1 115 ? -33.229 8.208   13.200  1.00 48.36  ? 87  SER C N     1 
ATOM   6659  C  CA    . SER C  1 115 ? -33.637 6.888   12.730  1.00 46.99  ? 87  SER C CA    1 
ATOM   6660  C  C     . SER C  1 115 ? -32.985 5.834   13.633  1.00 46.20  ? 87  SER C C     1 
ATOM   6661  O  O     . SER C  1 115 ? -31.763 5.809   13.772  1.00 54.85  ? 87  SER C O     1 
ATOM   6662  C  CB    . SER C  1 115 ? -33.237 6.678   11.266  1.00 44.31  ? 87  SER C CB    1 
ATOM   6663  O  OG    . SER C  1 115 ? -33.331 5.310   10.889  1.00 43.52  ? 87  SER C OG    1 
ATOM   6664  N  N     . THR C  1 116 ? -33.788 4.984   14.258  1.00 41.55  ? 88  THR C N     1 
ATOM   6665  C  CA    . THR C  1 116 ? -33.243 3.968   15.173  1.00 50.52  ? 88  THR C CA    1 
ATOM   6666  C  C     . THR C  1 116 ? -33.477 2.549   14.668  1.00 45.76  ? 88  THR C C     1 
ATOM   6667  O  O     . THR C  1 116 ? -34.181 2.355   13.682  1.00 44.48  ? 88  THR C O     1 
ATOM   6668  C  CB    . THR C  1 116 ? -33.860 4.068   16.570  1.00 42.12  ? 88  THR C CB    1 
ATOM   6669  O  OG1   . THR C  1 116 ? -35.205 3.577   16.522  1.00 49.87  ? 88  THR C OG1   1 
ATOM   6670  C  CG2   . THR C  1 116 ? -33.836 5.508   17.073  1.00 42.40  ? 88  THR C CG2   1 
ATOM   6671  N  N     . ARG C  1 117 ? -32.924 1.560   15.371  1.00 45.22  ? 89  ARG C N     1 
ATOM   6672  C  CA    . ARG C  1 117 ? -33.013 0.175   14.916  1.00 49.82  ? 89  ARG C CA    1 
ATOM   6673  C  C     . ARG C  1 117 ? -34.460 -0.290  14.824  1.00 46.47  ? 89  ARG C C     1 
ATOM   6674  O  O     . ARG C  1 117 ? -34.827 -1.039  13.923  1.00 46.79  ? 89  ARG C O     1 
ATOM   6675  C  CB    . ARG C  1 117 ? -32.224 -0.759  15.840  1.00 56.24  ? 89  ARG C CB    1 
ATOM   6676  C  CG    . ARG C  1 117 ? -31.879 -2.090  15.188  1.00 57.08  ? 89  ARG C CG    1 
ATOM   6677  C  CD    . ARG C  1 117 ? -30.986 -2.947  16.076  1.00 72.91  ? 89  ARG C CD    1 
ATOM   6678  N  NE    . ARG C  1 117 ? -31.744 -3.626  17.127  1.00 78.24  ? 89  ARG C NE    1 
ATOM   6679  C  CZ    . ARG C  1 117 ? -32.267 -4.845  17.007  1.00 76.40  ? 89  ARG C CZ    1 
ATOM   6680  N  NH1   . ARG C  1 117 ? -32.116 -5.529  15.880  1.00 78.00  ? 89  ARG C NH1   1 
ATOM   6681  N  NH2   . ARG C  1 117 ? -32.943 -5.379  18.016  1.00 79.84  ? 89  ARG C NH2   1 
ATOM   6682  N  N     . THR C  1 118 ? -35.282 0.176   15.748  1.00 41.16  ? 90  THR C N     1 
ATOM   6683  C  CA    . THR C  1 118 ? -36.682 -0.229  15.795  1.00 47.18  ? 90  THR C CA    1 
ATOM   6684  C  C     . THR C  1 118 ? -37.568 0.638   14.897  1.00 53.16  ? 90  THR C C     1 
ATOM   6685  O  O     . THR C  1 118 ? -38.572 0.169   14.351  1.00 52.04  ? 90  THR C O     1 
ATOM   6686  C  CB    . THR C  1 118 ? -37.217 -0.170  17.243  1.00 50.19  ? 90  THR C CB    1 
ATOM   6687  O  OG1   . THR C  1 118 ? -38.627 -0.430  17.243  1.00 57.15  ? 90  THR C OG1   1 
ATOM   6688  C  CG2   . THR C  1 118 ? -36.946 1.210   17.864  1.00 51.37  ? 90  THR C CG2   1 
ATOM   6689  N  N     . GLU C  1 119 ? -37.169 1.900   14.741  1.00 48.94  ? 91  GLU C N     1 
ATOM   6690  C  CA    . GLU C  1 119 ? -37.934 2.880   13.988  1.00 49.79  ? 91  GLU C CA    1 
ATOM   6691  C  C     . GLU C  1 119 ? -37.073 3.503   12.886  1.00 44.46  ? 91  GLU C C     1 
ATOM   6692  O  O     . GLU C  1 119 ? -36.603 4.640   13.022  1.00 35.01  ? 91  GLU C O     1 
ATOM   6693  C  CB    . GLU C  1 119 ? -38.462 3.970   14.931  1.00 53.81  ? 91  GLU C CB    1 
ATOM   6694  C  CG    . GLU C  1 119 ? -39.393 3.464   16.032  1.00 56.93  ? 91  GLU C CG    1 
ATOM   6695  C  CD    . GLU C  1 119 ? -40.768 3.094   15.505  1.00 61.84  ? 91  GLU C CD    1 
ATOM   6696  O  OE1   . GLU C  1 119 ? -41.689 3.937   15.603  1.00 69.22  ? 91  GLU C OE1   1 
ATOM   6697  O  OE2   . GLU C  1 119 ? -40.926 1.965   14.990  1.00 59.67  ? 91  GLU C OE2   1 
ATOM   6698  N  N     . ARG C  1 120 ? -36.862 2.753   11.808  1.00 33.76  ? 92  ARG C N     1 
ATOM   6699  C  CA    . ARG C  1 120 ? -35.986 3.180   10.724  1.00 38.36  ? 92  ARG C CA    1 
ATOM   6700  C  C     . ARG C  1 120 ? -36.632 4.296   9.877   1.00 33.88  ? 92  ARG C C     1 
ATOM   6701  O  O     . ARG C  1 120 ? -37.851 4.325   9.681   1.00 31.67  ? 92  ARG C O     1 
ATOM   6702  C  CB    . ARG C  1 120 ? -35.621 1.977   9.834   1.00 38.75  ? 92  ARG C CB    1 
ATOM   6703  C  CG    . ARG C  1 120 ? -34.774 0.913   10.518  1.00 39.32  ? 92  ARG C CG    1 
ATOM   6704  C  CD    . ARG C  1 120 ? -33.388 1.445   10.882  1.00 42.72  ? 92  ARG C CD    1 
ATOM   6705  N  NE    . ARG C  1 120 ? -32.508 0.364   11.321  1.00 46.04  ? 92  ARG C NE    1 
ATOM   6706  C  CZ    . ARG C  1 120 ? -31.220 0.511   11.622  1.00 44.95  ? 92  ARG C CZ    1 
ATOM   6707  N  NH1   . ARG C  1 120 ? -30.641 1.701   11.547  1.00 46.92  ? 92  ARG C NH1   1 
ATOM   6708  N  NH2   . ARG C  1 120 ? -30.504 -0.538  12.003  1.00 48.52  ? 92  ARG C NH2   1 
ATOM   6709  N  N     . ARG C  1 121 ? -35.816 5.203   9.366   1.00 29.36  ? 93  ARG C N     1 
ATOM   6710  C  CA    . ARG C  1 121 ? -36.340 6.295   8.541   1.00 34.02  ? 93  ARG C CA    1 
ATOM   6711  C  C     . ARG C  1 121 ? -35.589 6.411   7.213   1.00 30.42  ? 93  ARG C C     1 
ATOM   6712  O  O     . ARG C  1 121 ? -34.404 6.087   7.130   1.00 28.90  ? 93  ARG C O     1 
ATOM   6713  C  CB    . ARG C  1 121 ? -36.268 7.639   9.309   1.00 31.03  ? 93  ARG C CB    1 
ATOM   6714  C  CG    . ARG C  1 121 ? -37.240 7.761   10.523  1.00 31.22  ? 93  ARG C CG    1 
ATOM   6715  C  CD    . ARG C  1 121 ? -36.944 8.984   11.427  1.00 32.56  ? 93  ARG C CD    1 
ATOM   6716  N  NE    . ARG C  1 121 ? -37.928 9.074   12.505  1.00 30.77  ? 93  ARG C NE    1 
ATOM   6717  C  CZ    . ARG C  1 121 ? -39.122 9.644   12.378  1.00 34.45  ? 93  ARG C CZ    1 
ATOM   6718  N  NH1   . ARG C  1 121 ? -39.471 10.228  11.229  1.00 36.20  ? 93  ARG C NH1   1 
ATOM   6719  N  NH2   . ARG C  1 121 ? -39.959 9.659   13.408  1.00 33.43  ? 93  ARG C NH2   1 
ATOM   6720  N  N     . GLY C  1 122 ? -36.281 6.896   6.181   1.00 28.74  ? 94  GLY C N     1 
ATOM   6721  C  CA    . GLY C  1 122 ? -35.637 7.267   4.928   1.00 28.33  ? 94  GLY C CA    1 
ATOM   6722  C  C     . GLY C  1 122 ? -35.481 8.780   4.813   1.00 32.05  ? 94  GLY C C     1 
ATOM   6723  O  O     . GLY C  1 122 ? -35.856 9.520   5.720   1.00 30.50  ? 94  GLY C O     1 
ATOM   6724  N  N     . ILE C  1 123 ? -34.930 9.266   3.711   1.00 29.71  ? 95  ILE C N     1 
ATOM   6725  C  CA    . ILE C  1 123 ? -34.699 10.702  3.619   1.00 28.66  ? 95  ILE C CA    1 
ATOM   6726  C  C     . ILE C  1 123 ? -34.943 11.215  2.195   1.00 29.80  ? 95  ILE C C     1 
ATOM   6727  O  O     . ILE C  1 123 ? -34.563 10.568  1.212   1.00 28.51  ? 95  ILE C O     1 
ATOM   6728  C  CB    . ILE C  1 123 ? -33.264 11.045  4.107   1.00 32.42  ? 95  ILE C CB    1 
ATOM   6729  C  CG1   . ILE C  1 123 ? -32.985 12.556  4.014   1.00 35.07  ? 95  ILE C CG1   1 
ATOM   6730  C  CG2   . ILE C  1 123 ? -32.212 10.236  3.350   1.00 31.53  ? 95  ILE C CG2   1 
ATOM   6731  C  CD1   . ILE C  1 123 ? -33.654 13.359  5.123   1.00 32.27  ? 95  ILE C CD1   1 
ATOM   6732  N  N     . PHE C  1 124 ? -35.645 12.342  2.102   1.00 27.72  ? 96  PHE C N     1 
ATOM   6733  C  CA    . PHE C  1 124 ? -35.796 13.099  0.857   1.00 28.49  ? 96  PHE C CA    1 
ATOM   6734  C  C     . PHE C  1 124 ? -34.663 14.103  0.758   1.00 27.80  ? 96  PHE C C     1 
ATOM   6735  O  O     . PHE C  1 124 ? -34.219 14.636  1.774   1.00 27.00  ? 96  PHE C O     1 
ATOM   6736  C  CB    . PHE C  1 124 ? -37.148 13.827  0.794   1.00 30.61  ? 96  PHE C CB    1 
ATOM   6737  C  CG    . PHE C  1 124 ? -38.318 12.921  0.536   1.00 31.44  ? 96  PHE C CG    1 
ATOM   6738  C  CD1   . PHE C  1 124 ? -39.039 13.019  -0.649  1.00 28.43  ? 96  PHE C CD1   1 
ATOM   6739  C  CD2   . PHE C  1 124 ? -38.694 11.955  1.480   1.00 30.88  ? 96  PHE C CD2   1 
ATOM   6740  C  CE1   . PHE C  1 124 ? -40.113 12.159  -0.905  1.00 32.98  ? 96  PHE C CE1   1 
ATOM   6741  C  CE2   . PHE C  1 124 ? -39.774 11.097  1.238   1.00 28.87  ? 96  PHE C CE2   1 
ATOM   6742  C  CZ    . PHE C  1 124 ? -40.486 11.199  0.044   1.00 31.49  ? 96  PHE C CZ    1 
ATOM   6743  N  N     . CYS C  1 125 ? -34.193 14.349  -0.460  1.00 23.11  ? 97  CYS C N     1 
ATOM   6744  C  CA    . CYS C  1 125 ? -33.146 15.317  -0.693  1.00 23.85  ? 97  CYS C CA    1 
ATOM   6745  C  C     . CYS C  1 125 ? -33.615 16.709  -0.274  1.00 26.96  ? 97  CYS C C     1 
ATOM   6746  O  O     . CYS C  1 125 ? -34.817 16.993  -0.196  1.00 22.37  ? 97  CYS C O     1 
ATOM   6747  C  CB    . CYS C  1 125 ? -32.737 15.347  -2.170  1.00 25.79  ? 97  CYS C CB    1 
ATOM   6748  S  SG    . CYS C  1 125 ? -34.039 15.978  -3.245  1.00 26.91  ? 97  CYS C SG    1 
ATOM   6749  N  N     . ARG C  1 126 ? -32.654 17.586  -0.049  1.00 26.13  ? 98  ARG C N     1 
ATOM   6750  C  CA    . ARG C  1 126 ? -32.965 18.956  0.350   1.00 30.56  ? 98  ARG C CA    1 
ATOM   6751  C  C     . ARG C  1 126 ? -33.868 19.691  -0.653  1.00 31.22  ? 98  ARG C C     1 
ATOM   6752  O  O     . ARG C  1 126 ? -34.671 20.537  -0.245  1.00 27.21  ? 98  ARG C O     1 
ATOM   6753  C  CB    . ARG C  1 126 ? -31.660 19.715  0.593   1.00 29.74  ? 98  ARG C CB    1 
ATOM   6754  C  CG    . ARG C  1 126 ? -30.961 19.260  1.886   1.00 25.79  ? 98  ARG C CG    1 
ATOM   6755  C  CD    . ARG C  1 126 ? -29.455 19.460  1.826   1.00 28.94  ? 98  ARG C CD    1 
ATOM   6756  N  NE    . ARG C  1 126 ? -28.846 19.109  3.098   1.00 31.00  ? 98  ARG C NE    1 
ATOM   6757  C  CZ    . ARG C  1 126 ? -28.449 17.881  3.422   1.00 37.00  ? 98  ARG C CZ    1 
ATOM   6758  N  NH1   . ARG C  1 126 ? -28.569 16.886  2.552   1.00 35.01  ? 98  ARG C NH1   1 
ATOM   6759  N  NH2   . ARG C  1 126 ? -27.918 17.652  4.615   1.00 39.34  ? 98  ARG C NH2   1 
ATOM   6760  N  N     . ALA C  1 127 ? -33.801 19.331  -1.944  1.00 29.40  ? 99  ALA C N     1 
ATOM   6761  C  CA    . ALA C  1 127 ? -34.627 20.026  -2.950  1.00 30.35  ? 99  ALA C CA    1 
ATOM   6762  C  C     . ALA C  1 127 ? -36.077 19.536  -2.906  1.00 26.55  ? 99  ALA C C     1 
ATOM   6763  O  O     . ALA C  1 127 ? -36.915 19.973  -3.689  1.00 25.78  ? 99  ALA C O     1 
ATOM   6764  C  CB    . ALA C  1 127 ? -34.046 19.859  -4.373  1.00 28.18  ? 99  ALA C CB    1 
ATOM   6765  N  N     . SER C  1 128 ? -36.372 18.648  -1.968  1.00 26.24  ? 100 SER C N     1 
ATOM   6766  C  CA    . SER C  1 128 ? -37.750 18.211  -1.745  1.00 31.76  ? 100 SER C CA    1 
ATOM   6767  C  C     . SER C  1 128 ? -38.221 18.487  -0.304  1.00 30.36  ? 100 SER C C     1 
ATOM   6768  O  O     . SER C  1 128 ? -39.124 17.826  0.208   1.00 27.34  ? 100 SER C O     1 
ATOM   6769  C  CB    . SER C  1 128 ? -37.892 16.716  -2.088  1.00 30.76  ? 100 SER C CB    1 
ATOM   6770  O  OG    . SER C  1 128 ? -39.250 16.340  -2.082  1.00 27.94  ? 100 SER C OG    1 
ATOM   6771  N  N     . TRP C  1 129 ? -37.622 19.480  0.344   1.00 28.39  ? 101 TRP C N     1 
ATOM   6772  C  CA    . TRP C  1 129 ? -38.096 19.914  1.651   1.00 28.15  ? 101 TRP C CA    1 
ATOM   6773  C  C     . TRP C  1 129 ? -39.073 21.079  1.497   1.00 32.26  ? 101 TRP C C     1 
ATOM   6774  O  O     . TRP C  1 129 ? -38.810 22.034  0.758   1.00 28.85  ? 101 TRP C O     1 
ATOM   6775  C  CB    . TRP C  1 129 ? -36.931 20.330  2.546   1.00 29.46  ? 101 TRP C CB    1 
ATOM   6776  C  CG    . TRP C  1 129 ? -35.984 19.210  2.925   1.00 29.54  ? 101 TRP C CG    1 
ATOM   6777  C  CD1   . TRP C  1 129 ? -36.100 17.877  2.613   1.00 30.48  ? 101 TRP C CD1   1 
ATOM   6778  C  CD2   . TRP C  1 129 ? -34.781 19.336  3.693   1.00 30.09  ? 101 TRP C CD2   1 
ATOM   6779  N  NE1   . TRP C  1 129 ? -35.034 17.174  3.137   1.00 31.30  ? 101 TRP C NE1   1 
ATOM   6780  C  CE2   . TRP C  1 129 ? -34.216 18.046  3.806   1.00 28.30  ? 101 TRP C CE2   1 
ATOM   6781  C  CE3   . TRP C  1 129 ? -34.125 20.421  4.303   1.00 34.19  ? 101 TRP C CE3   1 
ATOM   6782  C  CZ2   . TRP C  1 129 ? -33.031 17.811  4.506   1.00 29.74  ? 101 TRP C CZ2   1 
ATOM   6783  C  CZ3   . TRP C  1 129 ? -32.939 20.186  4.986   1.00 30.85  ? 101 TRP C CZ3   1 
ATOM   6784  C  CH2   . TRP C  1 129 ? -32.408 18.884  5.081   1.00 30.65  ? 101 TRP C CH2   1 
ATOM   6785  N  N     . GLY C  1 130 ? -40.209 20.986  2.175   1.00 30.51  ? 102 GLY C N     1 
ATOM   6786  C  CA    . GLY C  1 130 ? -41.189 22.058  2.169   1.00 27.82  ? 102 GLY C CA    1 
ATOM   6787  C  C     . GLY C  1 130 ? -41.972 22.095  0.870   1.00 33.79  ? 102 GLY C C     1 
ATOM   6788  O  O     . GLY C  1 130 ? -41.990 21.125  0.110   1.00 27.04  ? 102 GLY C O     1 
ATOM   6789  N  N     . LYS C  1 131 ? -42.609 23.232  0.620   1.00 27.46  ? 103 LYS C N     1 
ATOM   6790  C  CA    . LYS C  1 131 ? -43.468 23.419  -0.549  1.00 30.34  ? 103 LYS C CA    1 
ATOM   6791  C  C     . LYS C  1 131 ? -42.683 23.348  -1.868  1.00 27.87  ? 103 LYS C C     1 
ATOM   6792  O  O     . LYS C  1 131 ? -41.644 23.986  -2.018  1.00 24.81  ? 103 LYS C O     1 
ATOM   6793  C  CB    . LYS C  1 131 ? -44.202 24.760  -0.416  1.00 32.61  ? 103 LYS C CB    1 
ATOM   6794  C  CG    . LYS C  1 131 ? -44.960 25.239  -1.634  1.00 36.03  ? 103 LYS C CG    1 
ATOM   6795  C  CD    . LYS C  1 131 ? -46.272 24.505  -1.817  1.00 45.39  ? 103 LYS C CD    1 
ATOM   6796  C  CE    . LYS C  1 131 ? -47.268 25.356  -2.614  1.00 50.59  ? 103 LYS C CE    1 
ATOM   6797  N  NZ    . LYS C  1 131 ? -48.502 24.566  -2.928  1.00 60.94  ? 103 LYS C NZ    1 
ATOM   6798  N  N     . ASP C  1 132 ? -43.184 22.534  -2.798  1.00 26.15  ? 104 ASP C N     1 
ATOM   6799  C  CA    . ASP C  1 132 ? -42.597 22.318  -4.126  1.00 26.46  ? 104 ASP C CA    1 
ATOM   6800  C  C     . ASP C  1 132 ? -42.062 23.589  -4.784  1.00 26.90  ? 104 ASP C C     1 
ATOM   6801  O  O     . ASP C  1 132 ? -42.816 24.514  -5.089  1.00 26.43  ? 104 ASP C O     1 
ATOM   6802  C  CB    . ASP C  1 132 ? -43.653 21.674  -5.004  1.00 23.49  ? 104 ASP C CB    1 
ATOM   6803  C  CG    . ASP C  1 132 ? -43.161 21.318  -6.400  1.00 30.06  ? 104 ASP C CG    1 
ATOM   6804  O  OD1   . ASP C  1 132 ? -44.033 20.867  -7.161  1.00 33.57  ? 104 ASP C OD1   1 
ATOM   6805  O  OD2   . ASP C  1 132 ? -41.963 21.466  -6.756  1.00 27.76  ? 104 ASP C OD2   1 
ATOM   6806  N  N     . TYR C  1 133 ? -40.752 23.623  -5.001  1.00 25.94  ? 105 TYR C N     1 
ATOM   6807  C  CA    . TYR C  1 133 ? -40.110 24.799  -5.587  1.00 25.28  ? 105 TYR C CA    1 
ATOM   6808  C  C     . TYR C  1 133 ? -40.733 25.243  -6.928  1.00 27.80  ? 105 TYR C C     1 
ATOM   6809  O  O     . TYR C  1 133 ? -40.680 26.444  -7.277  1.00 25.62  ? 105 TYR C O     1 
ATOM   6810  C  CB    . TYR C  1 133 ? -38.604 24.538  -5.745  1.00 25.71  ? 105 TYR C CB    1 
ATOM   6811  C  CG    . TYR C  1 133 ? -38.227 23.606  -6.880  1.00 27.62  ? 105 TYR C CG    1 
ATOM   6812  C  CD1   . TYR C  1 133 ? -37.896 24.114  -8.133  1.00 26.34  ? 105 TYR C CD1   1 
ATOM   6813  C  CD2   . TYR C  1 133 ? -38.176 22.219  -6.695  1.00 25.89  ? 105 TYR C CD2   1 
ATOM   6814  C  CE1   . TYR C  1 133 ? -37.544 23.274  -9.186  1.00 24.98  ? 105 TYR C CE1   1 
ATOM   6815  C  CE2   . TYR C  1 133 ? -37.827 21.370  -7.748  1.00 27.26  ? 105 TYR C CE2   1 
ATOM   6816  C  CZ    . TYR C  1 133 ? -37.507 21.913  -8.988  1.00 28.45  ? 105 TYR C CZ    1 
ATOM   6817  O  OH    . TYR C  1 133 ? -37.150 21.098  -10.048 1.00 33.92  ? 105 TYR C OH    1 
ATOM   6818  N  N     . HIS C  1 134 ? -41.325 24.304  -7.672  1.00 21.79  ? 106 HIS C N     1 
ATOM   6819  C  CA    . HIS C  1 134 ? -42.000 24.657  -8.931  1.00 25.37  ? 106 HIS C CA    1 
ATOM   6820  C  C     . HIS C  1 134 ? -43.071 25.722  -8.666  1.00 32.91  ? 106 HIS C C     1 
ATOM   6821  O  O     . HIS C  1 134 ? -43.197 26.695  -9.438  1.00 29.75  ? 106 HIS C O     1 
ATOM   6822  C  CB    . HIS C  1 134 ? -42.655 23.455  -9.625  1.00 23.37  ? 106 HIS C CB    1 
ATOM   6823  C  CG    . HIS C  1 134 ? -41.700 22.364  -10.013 1.00 29.67  ? 106 HIS C CG    1 
ATOM   6824  N  ND1   . HIS C  1 134 ? -41.352 21.342  -9.154  1.00 26.03  ? 106 HIS C ND1   1 
ATOM   6825  C  CD2   . HIS C  1 134 ? -41.042 22.118  -11.173 1.00 29.60  ? 106 HIS C CD2   1 
ATOM   6826  C  CE1   . HIS C  1 134 ? -40.503 20.528  -9.758  1.00 23.39  ? 106 HIS C CE1   1 
ATOM   6827  N  NE2   . HIS C  1 134 ? -40.299 20.974  -10.985 1.00 27.90  ? 106 HIS C NE2   1 
ATOM   6828  N  N     . ASP C  1 135 ? -43.828 25.525  -7.586  1.00 24.30  ? 107 ASP C N     1 
ATOM   6829  C  CA    . ASP C  1 135 ? -44.914 26.425  -7.199  1.00 30.71  ? 107 ASP C CA    1 
ATOM   6830  C  C     . ASP C  1 135 ? -44.360 27.730  -6.631  1.00 31.30  ? 107 ASP C C     1 
ATOM   6831  O  O     . ASP C  1 135 ? -44.867 28.807  -6.927  1.00 32.60  ? 107 ASP C O     1 
ATOM   6832  C  CB    . ASP C  1 135 ? -45.832 25.773  -6.155  1.00 33.60  ? 107 ASP C CB    1 
ATOM   6833  C  CG    . ASP C  1 135 ? -46.595 24.571  -6.691  1.00 33.92  ? 107 ASP C CG    1 
ATOM   6834  O  OD1   . ASP C  1 135 ? -47.045 24.583  -7.852  1.00 41.38  ? 107 ASP C OD1   1 
ATOM   6835  O  OD2   . ASP C  1 135 ? -46.776 23.614  -5.932  1.00 40.91  ? 107 ASP C OD2   1 
ATOM   6836  N  N     . VAL C  1 136 ? -43.314 27.619  -5.815  1.00 30.53  ? 108 VAL C N     1 
ATOM   6837  C  CA    . VAL C  1 136 ? -42.766 28.783  -5.145  1.00 29.19  ? 108 VAL C CA    1 
ATOM   6838  C  C     . VAL C  1 136 ? -42.138 29.717  -6.170  1.00 33.95  ? 108 VAL C C     1 
ATOM   6839  O  O     . VAL C  1 136 ? -42.371 30.928  -6.141  1.00 30.95  ? 108 VAL C O     1 
ATOM   6840  C  CB    . VAL C  1 136 ? -41.708 28.423  -4.087  1.00 29.32  ? 108 VAL C CB    1 
ATOM   6841  C  CG1   . VAL C  1 136 ? -41.118 29.714  -3.464  1.00 24.36  ? 108 VAL C CG1   1 
ATOM   6842  C  CG2   . VAL C  1 136 ? -42.287 27.469  -3.000  1.00 24.23  ? 108 VAL C CG2   1 
ATOM   6843  N  N     . LEU C  1 137 ? -41.340 29.160  -7.076  1.00 29.78  ? 109 LEU C N     1 
ATOM   6844  C  CA    . LEU C  1 137 ? -40.636 29.999  -8.025  1.00 29.90  ? 109 LEU C CA    1 
ATOM   6845  C  C     . LEU C  1 137 ? -41.579 30.513  -9.121  1.00 32.42  ? 109 LEU C C     1 
ATOM   6846  O  O     . LEU C  1 137 ? -41.391 31.624  -9.626  1.00 32.88  ? 109 LEU C O     1 
ATOM   6847  C  CB    . LEU C  1 137 ? -39.428 29.260  -8.614  1.00 26.28  ? 109 LEU C CB    1 
ATOM   6848  C  CG    . LEU C  1 137 ? -38.166 29.564  -7.795  1.00 28.72  ? 109 LEU C CG    1 
ATOM   6849  C  CD1   . LEU C  1 137 ? -38.165 28.839  -6.433  1.00 25.96  ? 109 LEU C CD1   1 
ATOM   6850  C  CD2   . LEU C  1 137 ? -36.908 29.256  -8.582  1.00 27.17  ? 109 LEU C CD2   1 
ATOM   6851  N  N     . ARG C  1 138 ? -42.595 29.730  -9.477  1.00 34.55  ? 110 ARG C N     1 
ATOM   6852  C  CA    . ARG C  1 138 ? -43.605 30.209  -10.421 1.00 31.93  ? 110 ARG C CA    1 
ATOM   6853  C  C     . ARG C  1 138 ? -44.335 31.424  -9.842  1.00 33.83  ? 110 ARG C C     1 
ATOM   6854  O  O     . ARG C  1 138 ? -44.661 32.363  -10.564 1.00 35.71  ? 110 ARG C O     1 
ATOM   6855  C  CB    . ARG C  1 138 ? -44.625 29.118  -10.771 1.00 29.24  ? 110 ARG C CB    1 
ATOM   6856  C  CG    . ARG C  1 138 ? -45.531 29.511  -11.920 1.00 34.97  ? 110 ARG C CG    1 
ATOM   6857  C  CD    . ARG C  1 138 ? -44.695 30.221  -12.994 1.00 43.16  ? 110 ARG C CD    1 
ATOM   6858  N  NE    . ARG C  1 138 ? -45.488 30.799  -14.078 1.00 48.98  ? 110 ARG C NE    1 
ATOM   6859  C  CZ    . ARG C  1 138 ? -45.537 30.300  -15.310 1.00 49.56  ? 110 ARG C CZ    1 
ATOM   6860  N  NH1   . ARG C  1 138 ? -44.824 29.220  -15.616 1.00 44.47  ? 110 ARG C NH1   1 
ATOM   6861  N  NH2   . ARG C  1 138 ? -46.287 30.891  -16.236 1.00 52.29  ? 110 ARG C NH2   1 
ATOM   6862  N  N     . GLU C  1 139 ? -44.582 31.391  -8.541  1.00 27.15  ? 111 GLU C N     1 
ATOM   6863  C  CA    . GLU C  1 139 ? -45.301 32.456  -7.870  1.00 30.83  ? 111 GLU C CA    1 
ATOM   6864  C  C     . GLU C  1 139 ? -44.489 33.750  -7.960  1.00 33.50  ? 111 GLU C C     1 
ATOM   6865  O  O     . GLU C  1 139 ? -45.054 34.814  -8.205  1.00 34.21  ? 111 GLU C O     1 
ATOM   6866  C  CB    . GLU C  1 139 ? -45.594 32.071  -6.409  1.00 34.41  ? 111 GLU C CB    1 
ATOM   6867  C  CG    . GLU C  1 139 ? -46.560 32.993  -5.680  1.00 36.69  ? 111 GLU C CG    1 
ATOM   6868  C  CD    . GLU C  1 139 ? -45.852 34.106  -4.911  1.00 37.71  ? 111 GLU C CD    1 
ATOM   6869  O  OE1   . GLU C  1 139 ? -44.599 34.079  -4.836  1.00 34.39  ? 111 GLU C OE1   1 
ATOM   6870  O  OE2   . GLU C  1 139 ? -46.551 34.998  -4.372  1.00 35.66  ? 111 GLU C OE2   1 
ATOM   6871  N  N     . LYS C  1 140 ? -43.166 33.645  -7.798  1.00 29.47  ? 112 LYS C N     1 
ATOM   6872  C  CA    . LYS C  1 140 ? -42.285 34.798  -7.904  1.00 26.12  ? 112 LYS C CA    1 
ATOM   6873  C  C     . LYS C  1 140 ? -42.168 35.303  -9.353  1.00 33.11  ? 112 LYS C C     1 
ATOM   6874  O  O     . LYS C  1 140 ? -42.124 36.507  -9.576  1.00 30.99  ? 112 LYS C O     1 
ATOM   6875  C  CB    . LYS C  1 140 ? -40.886 34.483  -7.356  1.00 28.95  ? 112 LYS C CB    1 
ATOM   6876  C  CG    . LYS C  1 140 ? -40.824 34.051  -5.873  1.00 29.16  ? 112 LYS C CG    1 
ATOM   6877  C  CD    . LYS C  1 140 ? -41.483 35.036  -4.910  1.00 28.19  ? 112 LYS C CD    1 
ATOM   6878  C  CE    . LYS C  1 140 ? -41.484 34.479  -3.456  1.00 24.25  ? 112 LYS C CE    1 
ATOM   6879  N  NZ    . LYS C  1 140 ? -42.333 35.321  -2.529  1.00 27.00  ? 112 LYS C NZ    1 
ATOM   6880  N  N     . LEU C  1 141 ? -42.104 34.391  -10.330 1.00 31.13  ? 113 LEU C N     1 
ATOM   6881  C  CA    . LEU C  1 141 ? -42.091 34.789  -11.740 1.00 31.03  ? 113 LEU C CA    1 
ATOM   6882  C  C     . LEU C  1 141 ? -43.366 35.533  -12.129 1.00 30.44  ? 113 LEU C C     1 
ATOM   6883  O  O     . LEU C  1 141 ? -43.315 36.561  -12.817 1.00 30.13  ? 113 LEU C O     1 
ATOM   6884  C  CB    . LEU C  1 141 ? -41.919 33.564  -12.644 1.00 30.72  ? 113 LEU C CB    1 
ATOM   6885  C  CG    . LEU C  1 141 ? -40.585 32.831  -12.508 1.00 30.28  ? 113 LEU C CG    1 
ATOM   6886  C  CD1   . LEU C  1 141 ? -40.686 31.466  -13.187 1.00 31.92  ? 113 LEU C CD1   1 
ATOM   6887  C  CD2   . LEU C  1 141 ? -39.452 33.678  -13.093 1.00 25.06  ? 113 LEU C CD2   1 
ATOM   6888  N  N     . ASP C  1 142 ? -44.507 35.004  -11.700 1.00 27.77  ? 114 ASP C N     1 
ATOM   6889  C  CA    . ASP C  1 142 ? -45.791 35.637  -11.978 1.00 31.15  ? 114 ASP C CA    1 
ATOM   6890  C  C     . ASP C  1 142 ? -45.824 37.082  -11.469 1.00 33.25  ? 114 ASP C C     1 
ATOM   6891  O  O     . ASP C  1 142 ? -46.357 37.974  -12.144 1.00 32.71  ? 114 ASP C O     1 
ATOM   6892  C  CB    . ASP C  1 142 ? -46.929 34.846  -11.359 1.00 25.99  ? 114 ASP C CB    1 
ATOM   6893  C  CG    . ASP C  1 142 ? -47.173 33.521  -12.072 1.00 38.16  ? 114 ASP C CG    1 
ATOM   6894  O  OD1   . ASP C  1 142 ? -46.632 33.319  -13.179 1.00 34.53  ? 114 ASP C OD1   1 
ATOM   6895  O  OD2   . ASP C  1 142 ? -47.929 32.695  -11.527 1.00 40.01  ? 114 ASP C OD2   1 
ATOM   6896  N  N     . LEU C  1 143 ? -45.251 37.310  -10.295 1.00 31.29  ? 115 LEU C N     1 
ATOM   6897  C  CA    . LEU C  1 143 ? -45.146 38.673  -9.780  1.00 31.65  ? 115 LEU C CA    1 
ATOM   6898  C  C     . LEU C  1 143 ? -44.196 39.519  -10.629 1.00 35.84  ? 115 LEU C C     1 
ATOM   6899  O  O     . LEU C  1 143 ? -44.475 40.695  -10.877 1.00 33.33  ? 115 LEU C O     1 
ATOM   6900  C  CB    . LEU C  1 143 ? -44.682 38.678  -8.324  1.00 30.42  ? 115 LEU C CB    1 
ATOM   6901  C  CG    . LEU C  1 143 ? -45.710 38.165  -7.308  1.00 37.27  ? 115 LEU C CG    1 
ATOM   6902  C  CD1   . LEU C  1 143 ? -45.018 37.871  -5.983  1.00 34.96  ? 115 LEU C CD1   1 
ATOM   6903  C  CD2   . LEU C  1 143 ? -46.841 39.176  -7.117  1.00 33.03  ? 115 LEU C CD2   1 
ATOM   6904  N  N     . LEU C  1 144 ? -43.073 38.940  -11.061 1.00 34.86  ? 116 LEU C N     1 
ATOM   6905  C  CA    . LEU C  1 144 ? -42.102 39.710  -11.850 1.00 35.78  ? 116 LEU C CA    1 
ATOM   6906  C  C     . LEU C  1 144 ? -42.707 40.056  -13.206 1.00 41.18  ? 116 LEU C C     1 
ATOM   6907  O  O     . LEU C  1 144 ? -42.540 41.170  -13.722 1.00 39.88  ? 116 LEU C O     1 
ATOM   6908  C  CB    . LEU C  1 144 ? -40.783 38.948  -12.027 1.00 30.66  ? 116 LEU C CB    1 
ATOM   6909  C  CG    . LEU C  1 144 ? -39.967 38.725  -10.744 1.00 35.38  ? 116 LEU C CG    1 
ATOM   6910  C  CD1   . LEU C  1 144 ? -38.571 38.211  -11.052 1.00 33.16  ? 116 LEU C CD1   1 
ATOM   6911  C  CD2   . LEU C  1 144 ? -39.873 40.014  -9.913  1.00 33.71  ? 116 LEU C CD2   1 
ATOM   6912  N  N     . GLU C  1 145 ? -43.412 39.084  -13.769 1.00 33.41  ? 117 GLU C N     1 
ATOM   6913  C  CA    . GLU C  1 145 ? -44.185 39.270  -14.983 1.00 35.77  ? 117 GLU C CA    1 
ATOM   6914  C  C     . GLU C  1 145 ? -45.204 40.409  -14.858 1.00 42.24  ? 117 GLU C C     1 
ATOM   6915  O  O     . GLU C  1 145 ? -45.241 41.314  -15.709 1.00 43.19  ? 117 GLU C O     1 
ATOM   6916  C  CB    . GLU C  1 145 ? -44.882 37.959  -15.336 1.00 38.25  ? 117 GLU C CB    1 
ATOM   6917  C  CG    . GLU C  1 145 ? -45.946 38.063  -16.382 1.00 43.08  ? 117 GLU C CG    1 
ATOM   6918  C  CD    . GLU C  1 145 ? -46.456 36.705  -16.823 1.00 53.37  ? 117 GLU C CD    1 
ATOM   6919  O  OE1   . GLU C  1 145 ? -45.877 35.668  -16.396 1.00 49.54  ? 117 GLU C OE1   1 
ATOM   6920  O  OE2   . GLU C  1 145 ? -47.435 36.680  -17.603 1.00 57.59  ? 117 GLU C OE2   1 
ATOM   6921  N  N     . ASP C  1 146 ? -46.025 40.373  -13.809 1.00 36.50  ? 118 ASP C N     1 
ATOM   6922  C  CA    . ASP C  1 146 ? -47.074 41.382  -13.631 1.00 40.27  ? 118 ASP C CA    1 
ATOM   6923  C  C     . ASP C  1 146 ? -46.464 42.765  -13.399 1.00 40.34  ? 118 ASP C C     1 
ATOM   6924  O  O     . ASP C  1 146 ? -47.036 43.780  -13.803 1.00 40.89  ? 118 ASP C O     1 
ATOM   6925  C  CB    . ASP C  1 146 ? -48.010 41.012  -12.473 1.00 36.82  ? 118 ASP C CB    1 
ATOM   6926  C  CG    . ASP C  1 146 ? -49.275 41.870  -12.442 1.00 43.59  ? 118 ASP C CG    1 
ATOM   6927  O  OD1   . ASP C  1 146 ? -50.120 41.711  -13.351 1.00 46.81  ? 118 ASP C OD1   1 
ATOM   6928  O  OD2   . ASP C  1 146 ? -49.437 42.698  -11.506 1.00 41.03  ? 118 ASP C OD2   1 
ATOM   6929  N  N     . PHE C  1 147 ? -45.300 42.787  -12.753 1.00 32.41  ? 119 PHE C N     1 
ATOM   6930  C  CA    . PHE C  1 147 ? -44.513 43.998  -12.603 1.00 34.45  ? 119 PHE C CA    1 
ATOM   6931  C  C     . PHE C  1 147 ? -44.206 44.629  -13.959 1.00 43.18  ? 119 PHE C C     1 
ATOM   6932  O  O     . PHE C  1 147 ? -44.239 45.855  -14.112 1.00 37.80  ? 119 PHE C O     1 
ATOM   6933  C  CB    . PHE C  1 147 ? -43.204 43.699  -11.872 1.00 32.81  ? 119 PHE C CB    1 
ATOM   6934  C  CG    . PHE C  1 147 ? -42.219 44.849  -11.891 1.00 37.46  ? 119 PHE C CG    1 
ATOM   6935  C  CD1   . PHE C  1 147 ? -42.333 45.893  -10.994 1.00 38.94  ? 119 PHE C CD1   1 
ATOM   6936  C  CD2   . PHE C  1 147 ? -41.174 44.873  -12.798 1.00 41.79  ? 119 PHE C CD2   1 
ATOM   6937  C  CE1   . PHE C  1 147 ? -41.423 46.962  -11.013 1.00 44.51  ? 119 PHE C CE1   1 
ATOM   6938  C  CE2   . PHE C  1 147 ? -40.264 45.922  -12.820 1.00 36.25  ? 119 PHE C CE2   1 
ATOM   6939  C  CZ    . PHE C  1 147 ? -40.393 46.974  -11.931 1.00 41.03  ? 119 PHE C CZ    1 
ATOM   6940  N  N     . LEU C  1 148 ? -43.886 43.774  -14.931 1.00 38.92  ? 120 LEU C N     1 
ATOM   6941  C  CA    . LEU C  1 148 ? -43.504 44.215  -16.274 1.00 41.83  ? 120 LEU C CA    1 
ATOM   6942  C  C     . LEU C  1 148 ? -44.722 44.650  -17.086 1.00 40.81  ? 120 LEU C C     1 
ATOM   6943  O  O     . LEU C  1 148 ? -44.714 45.708  -17.708 1.00 47.58  ? 120 LEU C O     1 
ATOM   6944  C  CB    . LEU C  1 148 ? -42.743 43.099  -17.005 1.00 38.62  ? 120 LEU C CB    1 
ATOM   6945  C  CG    . LEU C  1 148 ? -41.336 42.797  -16.478 1.00 37.53  ? 120 LEU C CG    1 
ATOM   6946  C  CD1   . LEU C  1 148 ? -40.687 41.670  -17.270 1.00 38.92  ? 120 LEU C CD1   1 
ATOM   6947  C  CD2   . LEU C  1 148 ? -40.456 44.039  -16.498 1.00 34.01  ? 120 LEU C CD2   1 
ATOM   6948  N  N     . LYS C  1 149 ? -45.761 43.829  -17.064 1.00 40.66  ? 121 LYS C N     1 
ATOM   6949  C  CA    . LYS C  1 149 ? -47.013 44.138  -17.732 1.00 43.33  ? 121 LYS C CA    1 
ATOM   6950  C  C     . LYS C  1 149 ? -47.603 45.449  -17.232 1.00 48.39  ? 121 LYS C C     1 
ATOM   6951  O  O     . LYS C  1 149 ? -48.184 46.210  -18.007 1.00 49.94  ? 121 LYS C O     1 
ATOM   6952  C  CB    . LYS C  1 149 ? -48.023 43.008  -17.525 1.00 47.45  ? 121 LYS C CB    1 
ATOM   6953  C  CG    . LYS C  1 149 ? -48.016 41.946  -18.619 1.00 54.28  ? 121 LYS C CG    1 
ATOM   6954  C  CD    . LYS C  1 149 ? -46.699 41.183  -18.653 1.00 53.21  ? 121 LYS C CD    1 
ATOM   6955  C  CE    . LYS C  1 149 ? -46.701 40.122  -19.744 1.00 47.45  ? 121 LYS C CE    1 
ATOM   6956  N  NZ    . LYS C  1 149 ? -47.787 39.123  -19.564 1.00 58.93  ? 121 LYS C NZ    1 
ATOM   6957  N  N     . SER C  1 150 ? -47.441 45.705  -15.939 1.00 47.83  ? 122 SER C N     1 
ATOM   6958  C  CA    . SER C  1 150 ? -48.028 46.876  -15.294 1.00 46.69  ? 122 SER C CA    1 
ATOM   6959  C  C     . SER C  1 150 ? -47.393 48.175  -15.791 1.00 56.61  ? 122 SER C C     1 
ATOM   6960  O  O     . SER C  1 150 ? -47.972 49.255  -15.634 1.00 54.02  ? 122 SER C O     1 
ATOM   6961  C  CB    . SER C  1 150 ? -47.892 46.779  -13.777 1.00 38.77  ? 122 SER C CB    1 
ATOM   6962  O  OG    . SER C  1 150 ? -46.656 47.337  -13.339 1.00 48.35  ? 122 SER C OG    1 
ATOM   6963  N  N     . LYS C  1 151 ? -46.206 48.068  -16.386 1.00 56.66  ? 123 LYS C N     1 
ATOM   6964  C  CA    . LYS C  1 151 ? -45.561 49.217  -17.009 1.00 54.62  ? 123 LYS C CA    1 
ATOM   6965  C  C     . LYS C  1 151 ? -46.066 49.413  -18.436 1.00 62.08  ? 123 LYS C C     1 
ATOM   6966  O  O     . LYS C  1 151 ? -47.042 50.126  -18.676 1.00 66.23  ? 123 LYS C O     1 
ATOM   6967  C  CB    . LYS C  1 151 ? -44.040 49.059  -17.029 1.00 54.34  ? 123 LYS C CB    1 
ATOM   6968  C  CG    . LYS C  1 151 ? -43.409 48.713  -15.698 1.00 51.13  ? 123 LYS C CG    1 
ATOM   6969  C  CD    . LYS C  1 151 ? -43.471 49.860  -14.718 1.00 48.95  ? 123 LYS C CD    1 
ATOM   6970  C  CE    . LYS C  1 151 ? -42.425 49.678  -13.624 1.00 51.95  ? 123 LYS C CE    1 
ATOM   6971  N  NZ    . LYS C  1 151 ? -42.525 50.688  -12.534 1.00 47.95  ? 123 LYS C NZ    1 
ATOM   6972  N  N     . HIS C  1 152 ? -45.394 48.771  -19.384 1.00 68.09  ? 124 HIS C N     1 
ATOM   6973  C  CA    . HIS C  1 152 ? -45.672 49.002  -20.798 1.00 62.66  ? 124 HIS C CA    1 
ATOM   6974  C  C     . HIS C  1 152 ? -46.626 47.956  -21.347 1.00 65.22  ? 124 HIS C C     1 
ATOM   6975  O  O     . HIS C  1 152 ? -47.329 48.208  -22.325 1.00 63.12  ? 124 HIS C O     1 
ATOM   6976  C  CB    . HIS C  1 152 ? -44.365 49.022  -21.593 1.00 53.43  ? 124 HIS C CB    1 
ATOM   6977  C  CG    . HIS C  1 152 ? -43.350 49.978  -21.044 1.00 63.22  ? 124 HIS C CG    1 
ATOM   6978  N  ND1   . HIS C  1 152 ? -42.490 49.643  -20.019 1.00 64.45  ? 124 HIS C ND1   1 
ATOM   6979  C  CD2   . HIS C  1 152 ? -43.077 51.268  -21.356 1.00 65.15  ? 124 HIS C CD2   1 
ATOM   6980  C  CE1   . HIS C  1 152 ? -41.723 50.682  -19.732 1.00 65.62  ? 124 HIS C CE1   1 
ATOM   6981  N  NE2   . HIS C  1 152 ? -42.060 51.680  -20.528 1.00 67.76  ? 124 HIS C NE2   1 
ATOM   6982  N  N     . ASP C  1 154 ? -45.787 47.176  -24.019 1.00 46.59  ? 126 ASP C N     1 
ATOM   6983  C  CA    . ASP C  1 154 ? -45.969 45.972  -24.833 1.00 58.99  ? 126 ASP C CA    1 
ATOM   6984  C  C     . ASP C  1 154 ? -44.942 44.902  -24.493 1.00 48.04  ? 126 ASP C C     1 
ATOM   6985  O  O     . ASP C  1 154 ? -44.403 44.237  -25.378 1.00 43.44  ? 126 ASP C O     1 
ATOM   6986  C  CB    . ASP C  1 154 ? -45.873 46.305  -26.322 1.00 58.53  ? 126 ASP C CB    1 
ATOM   6987  C  CG    . ASP C  1 154 ? -47.122 46.970  -26.855 1.00 71.09  ? 126 ASP C CG    1 
ATOM   6988  O  OD1   . ASP C  1 154 ? -48.231 46.659  -26.360 1.00 70.54  ? 126 ASP C OD1   1 
ATOM   6989  O  OD2   . ASP C  1 154 ? -46.987 47.800  -27.780 1.00 74.92  ? 126 ASP C OD2   1 
ATOM   6990  N  N     . ILE C  1 155 ? -44.657 44.757  -23.205 1.00 49.05  ? 127 ILE C N     1 
ATOM   6991  C  CA    . ILE C  1 155 ? -43.696 43.764  -22.752 1.00 47.21  ? 127 ILE C CA    1 
ATOM   6992  C  C     . ILE C  1 155 ? -44.318 42.372  -22.854 1.00 37.01  ? 127 ILE C C     1 
ATOM   6993  O  O     . ILE C  1 155 ? -45.446 42.149  -22.435 1.00 45.13  ? 127 ILE C O     1 
ATOM   6994  C  CB    . ILE C  1 155 ? -43.219 44.078  -21.314 1.00 42.49  ? 127 ILE C CB    1 
ATOM   6995  C  CG1   . ILE C  1 155 ? -42.335 45.333  -21.346 1.00 46.22  ? 127 ILE C CG1   1 
ATOM   6996  C  CG2   . ILE C  1 155 ? -42.468 42.885  -20.708 1.00 40.44  ? 127 ILE C CG2   1 
ATOM   6997  C  CD1   . ILE C  1 155 ? -41.927 45.874  -19.989 1.00 48.71  ? 127 ILE C CD1   1 
ATOM   6998  N  N     . ARG C  1 156 ? -43.596 41.446  -23.469 1.00 46.00  ? 128 ARG C N     1 
ATOM   6999  C  CA    . ARG C  1 156 ? -44.077 40.066  -23.578 1.00 44.85  ? 128 ARG C CA    1 
ATOM   7000  C  C     . ARG C  1 156 ? -43.101 39.144  -22.852 1.00 39.73  ? 128 ARG C C     1 
ATOM   7001  O  O     . ARG C  1 156 ? -41.891 39.398  -22.821 1.00 37.63  ? 128 ARG C O     1 
ATOM   7002  C  CB    . ARG C  1 156 ? -44.248 39.656  -25.043 1.00 42.73  ? 128 ARG C CB    1 
ATOM   7003  C  CG    . ARG C  1 156 ? -45.297 40.467  -25.786 1.00 40.17  ? 128 ARG C CG    1 
ATOM   7004  C  CD    . ARG C  1 156 ? -45.329 40.091  -27.263 1.00 54.61  ? 128 ARG C CD    1 
ATOM   7005  N  NE    . ARG C  1 156 ? -44.075 40.414  -27.948 1.00 53.71  ? 128 ARG C NE    1 
ATOM   7006  C  CZ    . ARG C  1 156 ? -43.202 39.520  -28.412 1.00 55.27  ? 128 ARG C CZ    1 
ATOM   7007  N  NH1   . ARG C  1 156 ? -43.429 38.215  -28.283 1.00 49.59  ? 128 ARG C NH1   1 
ATOM   7008  N  NH2   . ARG C  1 156 ? -42.095 39.937  -29.019 1.00 53.43  ? 128 ARG C NH2   1 
ATOM   7009  N  N     . THR C  1 157 ? -43.627 38.091  -22.237 1.00 39.25  ? 129 THR C N     1 
ATOM   7010  C  CA    . THR C  1 157 ? -42.800 37.230  -21.385 1.00 41.49  ? 129 THR C CA    1 
ATOM   7011  C  C     . THR C  1 157 ? -43.136 35.748  -21.561 1.00 39.69  ? 129 THR C C     1 
ATOM   7012  O  O     . THR C  1 157 ? -44.218 35.398  -22.028 1.00 38.48  ? 129 THR C O     1 
ATOM   7013  C  CB    . THR C  1 157 ? -42.953 37.592  -19.883 1.00 34.43  ? 129 THR C CB    1 
ATOM   7014  O  OG1   . THR C  1 157 ? -44.310 37.381  -19.481 1.00 34.38  ? 129 THR C OG1   1 
ATOM   7015  C  CG2   . THR C  1 157 ? -42.569 39.063  -19.620 1.00 36.17  ? 129 THR C CG2   1 
ATOM   7016  N  N     . LYS C  1 158 ? -42.188 34.891  -21.193 1.00 37.26  ? 130 LYS C N     1 
ATOM   7017  C  CA    . LYS C  1 158 ? -42.431 33.459  -21.063 1.00 35.06  ? 130 LYS C CA    1 
ATOM   7018  C  C     . LYS C  1 158 ? -41.583 32.909  -19.908 1.00 33.65  ? 130 LYS C C     1 
ATOM   7019  O  O     . LYS C  1 158 ? -40.354 32.984  -19.925 1.00 32.55  ? 130 LYS C O     1 
ATOM   7020  C  CB    . LYS C  1 158 ? -42.117 32.714  -22.367 1.00 39.05  ? 130 LYS C CB    1 
ATOM   7021  C  CG    . LYS C  1 158 ? -42.282 31.192  -22.264 1.00 28.52  ? 130 LYS C CG    1 
ATOM   7022  C  CD    . LYS C  1 158 ? -42.391 30.564  -23.639 1.00 42.98  ? 130 LYS C CD    1 
ATOM   7023  C  CE    . LYS C  1 158 ? -42.561 29.052  -23.563 1.00 39.39  ? 130 LYS C CE    1 
ATOM   7024  N  NZ    . LYS C  1 158 ? -43.799 28.674  -22.816 1.00 44.31  ? 130 LYS C NZ    1 
ATOM   7025  N  N     . SER C  1 159 ? -42.246 32.359  -18.903 1.00 32.10  ? 131 SER C N     1 
ATOM   7026  C  CA    . SER C  1 159 ? -41.555 31.923  -17.703 1.00 34.91  ? 131 SER C CA    1 
ATOM   7027  C  C     . SER C  1 159 ? -41.521 30.410  -17.616 1.00 36.46  ? 131 SER C C     1 
ATOM   7028  O  O     . SER C  1 159 ? -42.408 29.729  -18.144 1.00 35.25  ? 131 SER C O     1 
ATOM   7029  C  CB    . SER C  1 159 ? -42.232 32.501  -16.464 1.00 30.97  ? 131 SER C CB    1 
ATOM   7030  O  OG    . SER C  1 159 ? -42.118 33.910  -16.462 1.00 32.51  ? 131 SER C OG    1 
ATOM   7031  N  N     . MET C  1 160 ? -40.495 29.898  -16.943 1.00 33.44  ? 132 MET C N     1 
ATOM   7032  C  CA    . MET C  1 160 ? -40.382 28.470  -16.700 1.00 31.89  ? 132 MET C CA    1 
ATOM   7033  C  C     . MET C  1 160 ? -39.501 28.175  -15.497 1.00 31.70  ? 132 MET C C     1 
ATOM   7034  O  O     . MET C  1 160 ? -38.593 28.936  -15.170 1.00 26.56  ? 132 MET C O     1 
ATOM   7035  C  CB    . MET C  1 160 ? -39.828 27.754  -17.934 1.00 26.55  ? 132 MET C CB    1 
ATOM   7036  C  CG    . MET C  1 160 ? -38.431 28.213  -18.355 1.00 30.92  ? 132 MET C CG    1 
ATOM   7037  S  SD    . MET C  1 160 ? -38.087 27.763  -20.084 1.00 38.88  ? 132 MET C SD    1 
ATOM   7038  C  CE    . MET C  1 160 ? -39.275 28.778  -20.958 1.00 36.30  ? 132 MET C CE    1 
ATOM   7039  N  N     . VAL C  1 161 ? -39.774 27.044  -14.849 1.00 32.81  ? 133 VAL C N     1 
ATOM   7040  C  CA    . VAL C  1 161 ? -38.904 26.544  -13.803 1.00 25.94  ? 133 VAL C CA    1 
ATOM   7041  C  C     . VAL C  1 161 ? -38.879 25.016  -13.924 1.00 27.06  ? 133 VAL C C     1 
ATOM   7042  O  O     . VAL C  1 161 ? -39.898 24.352  -13.760 1.00 27.53  ? 133 VAL C O     1 
ATOM   7043  C  CB    . VAL C  1 161 ? -39.361 27.015  -12.390 1.00 28.38  ? 133 VAL C CB    1 
ATOM   7044  C  CG1   . VAL C  1 161 ? -40.887 27.000  -12.270 1.00 28.80  ? 133 VAL C CG1   1 
ATOM   7045  C  CG2   . VAL C  1 161 ? -38.714 26.157  -11.285 1.00 30.41  ? 133 VAL C CG2   1 
ATOM   7046  N  N     . ASP C  1 162 ? -37.709 24.498  -14.298 1.00 27.89  ? 134 ASP C N     1 
ATOM   7047  C  CA    . ASP C  1 162 ? -37.404 23.067  -14.359 1.00 29.15  ? 134 ASP C CA    1 
ATOM   7048  C  C     . ASP C  1 162 ? -38.148 22.290  -15.450 1.00 26.02  ? 134 ASP C C     1 
ATOM   7049  O  O     . ASP C  1 162 ? -37.531 21.527  -16.188 1.00 27.66  ? 134 ASP C O     1 
ATOM   7050  C  CB    . ASP C  1 162 ? -37.662 22.416  -13.004 1.00 30.61  ? 134 ASP C CB    1 
ATOM   7051  C  CG    . ASP C  1 162 ? -37.486 20.898  -13.048 1.00 29.12  ? 134 ASP C CG    1 
ATOM   7052  O  OD1   . ASP C  1 162 ? -36.314 20.435  -13.040 1.00 24.08  ? 134 ASP C OD1   1 
ATOM   7053  O  OD2   . ASP C  1 162 ? -38.525 20.196  -13.084 1.00 24.73  ? 134 ASP C OD2   1 
ATOM   7054  N  N     . THR C  1 163 ? -39.458 22.486  -15.563 1.00 25.85  ? 135 THR C N     1 
ATOM   7055  C  CA    . THR C  1 163 ? -40.235 21.756  -16.563 1.00 30.90  ? 135 THR C CA    1 
ATOM   7056  C  C     . THR C  1 163 ? -40.345 22.477  -17.913 1.00 33.12  ? 135 THR C C     1 
ATOM   7057  O  O     . THR C  1 163 ? -41.080 22.033  -18.790 1.00 37.43  ? 135 THR C O     1 
ATOM   7058  C  CB    . THR C  1 163 ? -41.660 21.476  -16.057 1.00 32.72  ? 135 THR C CB    1 
ATOM   7059  O  OG1   . THR C  1 163 ? -42.302 22.722  -15.781 1.00 33.86  ? 135 THR C OG1   1 
ATOM   7060  C  CG2   . THR C  1 163 ? -41.644 20.584  -14.781 1.00 28.20  ? 135 THR C CG2   1 
ATOM   7061  N  N     . GLY C  1 164 ? -39.633 23.591  -18.073 1.00 28.27  ? 136 GLY C N     1 
ATOM   7062  C  CA    . GLY C  1 164 ? -39.619 24.299  -19.339 1.00 30.40  ? 136 GLY C CA    1 
ATOM   7063  C  C     . GLY C  1 164 ? -38.578 23.775  -20.313 1.00 31.12  ? 136 GLY C C     1 
ATOM   7064  O  O     . GLY C  1 164 ? -37.846 22.824  -20.017 1.00 29.70  ? 136 GLY C O     1 
ATOM   7065  N  N     . GLU C  1 165 ? -38.496 24.400  -21.482 1.00 28.25  ? 137 GLU C N     1 
ATOM   7066  C  CA    . GLU C  1 165 ? -37.599 23.899  -22.523 1.00 29.53  ? 137 GLU C CA    1 
ATOM   7067  C  C     . GLU C  1 165 ? -36.127 24.197  -22.235 1.00 25.91  ? 137 GLU C C     1 
ATOM   7068  O  O     . GLU C  1 165 ? -35.254 23.391  -22.538 1.00 24.47  ? 137 GLU C O     1 
ATOM   7069  C  CB    . GLU C  1 165 ? -37.991 24.481  -23.882 1.00 32.71  ? 137 GLU C CB    1 
ATOM   7070  C  CG    . GLU C  1 165 ? -39.334 23.998  -24.415 1.00 31.85  ? 137 GLU C CG    1 
ATOM   7071  C  CD    . GLU C  1 165 ? -40.541 24.803  -23.914 1.00 45.80  ? 137 GLU C CD    1 
ATOM   7072  O  OE1   . GLU C  1 165 ? -40.391 25.702  -23.031 1.00 36.94  ? 137 GLU C OE1   1 
ATOM   7073  O  OE2   . GLU C  1 165 ? -41.652 24.524  -24.425 1.00 39.32  ? 137 GLU C OE2   1 
ATOM   7074  N  N     . LEU C  1 166 ? -35.851 25.361  -21.657 1.00 29.28  ? 138 LEU C N     1 
ATOM   7075  C  CA    . LEU C  1 166 ? -34.473 25.797  -21.435 1.00 27.23  ? 138 LEU C CA    1 
ATOM   7076  C  C     . LEU C  1 166 ? -33.717 24.930  -20.415 1.00 24.13  ? 138 LEU C C     1 
ATOM   7077  O  O     . LEU C  1 166 ? -34.311 24.242  -19.588 1.00 26.14  ? 138 LEU C O     1 
ATOM   7078  C  CB    . LEU C  1 166 ? -34.442 27.273  -20.959 1.00 25.52  ? 138 LEU C CB    1 
ATOM   7079  C  CG    . LEU C  1 166 ? -34.940 28.368  -21.922 1.00 32.35  ? 138 LEU C CG    1 
ATOM   7080  C  CD1   . LEU C  1 166 ? -34.975 29.742  -21.250 1.00 30.65  ? 138 LEU C CD1   1 
ATOM   7081  C  CD2   . LEU C  1 166 ? -34.101 28.435  -23.175 1.00 30.77  ? 138 LEU C CD2   1 
ATOM   7082  N  N     . SER C  1 167 ? -32.394 24.992  -20.483 1.00 24.55  ? 139 SER C N     1 
ATOM   7083  C  CA    . SER C  1 167 ? -31.548 24.553  -19.394 1.00 23.38  ? 139 SER C CA    1 
ATOM   7084  C  C     . SER C  1 167 ? -31.450 25.698  -18.381 1.00 30.76  ? 139 SER C C     1 
ATOM   7085  O  O     . SER C  1 167 ? -30.877 26.755  -18.682 1.00 25.97  ? 139 SER C O     1 
ATOM   7086  C  CB    . SER C  1 167 ? -30.168 24.156  -19.922 1.00 27.41  ? 139 SER C CB    1 
ATOM   7087  O  OG    . SER C  1 167 ? -29.172 24.293  -18.933 1.00 31.14  ? 139 SER C OG    1 
ATOM   7088  N  N     . ASP C  1 168 ? -32.033 25.498  -17.200 1.00 27.38  ? 140 ASP C N     1 
ATOM   7089  C  CA    . ASP C  1 168 ? -32.013 26.514  -16.161 1.00 26.21  ? 140 ASP C CA    1 
ATOM   7090  C  C     . ASP C  1 168 ? -30.577 26.818  -15.757 1.00 28.58  ? 140 ASP C C     1 
ATOM   7091  O  O     . ASP C  1 168 ? -30.244 27.963  -15.446 1.00 30.17  ? 140 ASP C O     1 
ATOM   7092  C  CB    . ASP C  1 168 ? -32.832 26.080  -14.948 1.00 23.08  ? 140 ASP C CB    1 
ATOM   7093  C  CG    . ASP C  1 168 ? -34.269 25.701  -15.307 1.00 26.73  ? 140 ASP C CG    1 
ATOM   7094  O  OD1   . ASP C  1 168 ? -34.758 26.109  -16.385 1.00 25.50  ? 140 ASP C OD1   1 
ATOM   7095  O  OD2   . ASP C  1 168 ? -34.914 24.979  -14.508 1.00 27.75  ? 140 ASP C OD2   1 
ATOM   7096  N  N     . ARG C  1 169 ? -29.711 25.812  -15.795 1.00 23.65  ? 141 ARG C N     1 
ATOM   7097  C  CA    . ARG C  1 169 ? -28.317 26.040  -15.430 1.00 26.72  ? 141 ARG C CA    1 
ATOM   7098  C  C     . ARG C  1 169 ? -27.557 26.861  -16.454 1.00 31.25  ? 141 ARG C C     1 
ATOM   7099  O  O     . ARG C  1 169 ? -26.720 27.697  -16.075 1.00 26.11  ? 141 ARG C O     1 
ATOM   7100  C  CB    . ARG C  1 169 ? -27.586 24.729  -15.227 1.00 27.54  ? 141 ARG C CB    1 
ATOM   7101  C  CG    . ARG C  1 169 ? -27.830 24.090  -13.854 1.00 29.27  ? 141 ARG C CG    1 
ATOM   7102  C  CD    . ARG C  1 169 ? -27.020 22.821  -13.810 1.00 29.04  ? 141 ARG C CD    1 
ATOM   7103  N  NE    . ARG C  1 169 ? -27.175 22.055  -12.583 1.00 27.49  ? 141 ARG C NE    1 
ATOM   7104  C  CZ    . ARG C  1 169 ? -27.141 20.730  -12.566 1.00 28.74  ? 141 ARG C CZ    1 
ATOM   7105  N  NH1   . ARG C  1 169 ? -26.978 20.078  -13.710 1.00 22.72  ? 141 ARG C NH1   1 
ATOM   7106  N  NH2   . ARG C  1 169 ? -27.262 20.069  -11.425 1.00 26.23  ? 141 ARG C NH2   1 
ATOM   7107  N  N     . ALA C  1 170 ? -27.821 26.600  -17.740 1.00 28.29  ? 142 ALA C N     1 
ATOM   7108  C  CA    . ALA C  1 170 ? -27.138 27.314  -18.815 1.00 28.20  ? 142 ALA C CA    1 
ATOM   7109  C  C     . ALA C  1 170 ? -27.486 28.797  -18.712 1.00 28.26  ? 142 ALA C C     1 
ATOM   7110  O  O     . ALA C  1 170 ? -26.615 29.654  -18.800 1.00 30.61  ? 142 ALA C O     1 
ATOM   7111  C  CB    . ALA C  1 170 ? -27.519 26.747  -20.189 1.00 22.01  ? 142 ALA C CB    1 
ATOM   7112  N  N     . VAL C  1 171 ? -28.767 29.078  -18.496 1.00 26.15  ? 143 VAL C N     1 
ATOM   7113  C  CA    . VAL C  1 171 ? -29.250 30.437  -18.306 1.00 32.16  ? 143 VAL C CA    1 
ATOM   7114  C  C     . VAL C  1 171 ? -28.626 31.119  -17.081 1.00 33.31  ? 143 VAL C C     1 
ATOM   7115  O  O     . VAL C  1 171 ? -28.113 32.252  -17.174 1.00 30.30  ? 143 VAL C O     1 
ATOM   7116  C  CB    . VAL C  1 171 ? -30.792 30.452  -18.179 1.00 30.16  ? 143 VAL C CB    1 
ATOM   7117  C  CG1   . VAL C  1 171 ? -31.274 31.815  -17.787 1.00 25.24  ? 143 VAL C CG1   1 
ATOM   7118  C  CG2   . VAL C  1 171 ? -31.444 30.018  -19.506 1.00 27.23  ? 143 VAL C CG2   1 
ATOM   7119  N  N     . ALA C  1 172 ? -28.650 30.431  -15.944 1.00 29.35  ? 144 ALA C N     1 
ATOM   7120  C  CA    . ALA C  1 172 ? -28.102 30.976  -14.706 1.00 29.88  ? 144 ALA C CA    1 
ATOM   7121  C  C     . ALA C  1 172 ? -26.600 31.258  -14.860 1.00 33.69  ? 144 ALA C C     1 
ATOM   7122  O  O     . ALA C  1 172 ? -26.111 32.296  -14.412 1.00 30.53  ? 144 ALA C O     1 
ATOM   7123  C  CB    . ALA C  1 172 ? -28.368 30.019  -13.516 1.00 24.83  ? 144 ALA C CB    1 
ATOM   7124  N  N     . GLU C  1 173 ? -25.869 30.351  -15.502 1.00 26.92  ? 145 GLU C N     1 
ATOM   7125  C  CA    . GLU C  1 173 ? -24.442 30.593  -15.731 1.00 31.18  ? 145 GLU C CA    1 
ATOM   7126  C  C     . GLU C  1 173 ? -24.213 31.842  -16.594 1.00 34.13  ? 145 GLU C C     1 
ATOM   7127  O  O     . GLU C  1 173 ? -23.317 32.650  -16.319 1.00 31.34  ? 145 GLU C O     1 
ATOM   7128  C  CB    . GLU C  1 173 ? -23.779 29.388  -16.404 1.00 32.41  ? 145 GLU C CB    1 
ATOM   7129  C  CG    . GLU C  1 173 ? -22.294 29.599  -16.702 1.00 37.03  ? 145 GLU C CG    1 
ATOM   7130  C  CD    . GLU C  1 173 ? -21.653 28.419  -17.437 1.00 46.08  ? 145 GLU C CD    1 
ATOM   7131  O  OE1   . GLU C  1 173 ? -22.279 27.847  -18.354 1.00 49.44  ? 145 GLU C OE1   1 
ATOM   7132  O  OE2   . GLU C  1 173 ? -20.514 28.056  -17.090 1.00 51.88  ? 145 GLU C OE2   1 
ATOM   7133  N  N     . ARG C  1 174 ? -25.023 32.011  -17.632 1.00 30.09  ? 146 ARG C N     1 
ATOM   7134  C  CA    . ARG C  1 174 ? -24.753 33.088  -18.568 1.00 32.84  ? 146 ARG C CA    1 
ATOM   7135  C  C     . ARG C  1 174 ? -25.240 34.436  -18.016 1.00 34.98  ? 146 ARG C C     1 
ATOM   7136  O  O     . ARG C  1 174 ? -24.833 35.488  -18.504 1.00 35.79  ? 146 ARG C O     1 
ATOM   7137  C  CB    . ARG C  1 174 ? -25.385 32.800  -19.930 1.00 29.72  ? 146 ARG C CB    1 
ATOM   7138  C  CG    . ARG C  1 174 ? -24.707 33.586  -21.083 1.00 31.38  ? 146 ARG C CG    1 
ATOM   7139  C  CD    . ARG C  1 174 ? -25.160 33.090  -22.444 1.00 30.46  ? 146 ARG C CD    1 
ATOM   7140  N  NE    . ARG C  1 174 ? -26.513 33.515  -22.786 1.00 28.41  ? 146 ARG C NE    1 
ATOM   7141  C  CZ    . ARG C  1 174 ? -27.165 33.091  -23.864 1.00 32.26  ? 146 ARG C CZ    1 
ATOM   7142  N  NH1   . ARG C  1 174 ? -26.595 32.211  -24.683 1.00 34.90  ? 146 ARG C NH1   1 
ATOM   7143  N  NH2   . ARG C  1 174 ? -28.392 33.526  -24.120 1.00 30.85  ? 146 ARG C NH2   1 
ATOM   7144  N  N     . ALA C  1 175 ? -26.094 34.388  -16.993 1.00 32.64  ? 147 ALA C N     1 
ATOM   7145  C  CA    . ALA C  1 175 ? -26.626 35.585  -16.355 1.00 31.11  ? 147 ALA C CA    1 
ATOM   7146  C  C     . ALA C  1 175 ? -25.827 35.943  -15.114 1.00 32.41  ? 147 ALA C C     1 
ATOM   7147  O  O     . ALA C  1 175 ? -26.137 36.919  -14.428 1.00 35.22  ? 147 ALA C O     1 
ATOM   7148  C  CB    . ALA C  1 175 ? -28.086 35.406  -15.999 1.00 28.92  ? 147 ALA C CB    1 
ATOM   7149  N  N     . GLY C  1 176 ? -24.799 35.154  -14.829 1.00 30.21  ? 148 GLY C N     1 
ATOM   7150  C  CA    . GLY C  1 176 ? -23.935 35.419  -13.701 1.00 31.11  ? 148 GLY C CA    1 
ATOM   7151  C  C     . GLY C  1 176 ? -24.488 35.018  -12.339 1.00 35.73  ? 148 GLY C C     1 
ATOM   7152  O  O     . GLY C  1 176 ? -23.981 35.493  -11.321 1.00 30.42  ? 148 GLY C O     1 
ATOM   7153  N  N     . ILE C  1 177 ? -25.506 34.150  -12.303 1.00 32.40  ? 149 ILE C N     1 
ATOM   7154  C  CA    . ILE C  1 177 ? -26.056 33.703  -11.024 1.00 27.16  ? 149 ILE C CA    1 
ATOM   7155  C  C     . ILE C  1 177 ? -24.981 32.947  -10.255 1.00 31.61  ? 149 ILE C C     1 
ATOM   7156  O  O     . ILE C  1 177 ? -24.751 33.191  -9.077  1.00 28.34  ? 149 ILE C O     1 
ATOM   7157  C  CB    . ILE C  1 177 ? -27.310 32.802  -11.193 1.00 30.04  ? 149 ILE C CB    1 
ATOM   7158  C  CG1   . ILE C  1 177 ? -28.457 33.584  -11.805 1.00 28.49  ? 149 ILE C CG1   1 
ATOM   7159  C  CG2   . ILE C  1 177 ? -27.765 32.223  -9.821  1.00 27.03  ? 149 ILE C CG2   1 
ATOM   7160  C  CD1   . ILE C  1 177 ? -28.989 34.720  -10.891 1.00 33.52  ? 149 ILE C CD1   1 
ATOM   7161  N  N     . GLY C  1 178 ? -24.316 32.026  -10.939 1.00 29.78  ? 150 GLY C N     1 
ATOM   7162  C  CA    . GLY C  1 178 ? -23.291 31.209  -10.314 1.00 29.63  ? 150 GLY C CA    1 
ATOM   7163  C  C     . GLY C  1 178 ? -22.448 30.542  -11.385 1.00 31.00  ? 150 GLY C C     1 
ATOM   7164  O  O     . GLY C  1 178 ? -22.723 30.692  -12.575 1.00 29.58  ? 150 GLY C O     1 
ATOM   7165  N  N     . PHE C  1 179 ? -21.406 29.828  -10.986 1.00 27.56  ? 151 PHE C N     1 
ATOM   7166  C  CA    . PHE C  1 179 ? -20.581 29.172  -11.975 1.00 33.45  ? 151 PHE C CA    1 
ATOM   7167  C  C     . PHE C  1 179 ? -20.948 27.679  -12.041 1.00 35.12  ? 151 PHE C C     1 
ATOM   7168  O  O     . PHE C  1 179 ? -21.608 27.145  -11.147 1.00 32.02  ? 151 PHE C O     1 
ATOM   7169  C  CB    . PHE C  1 179 ? -19.088 29.375  -11.676 1.00 32.89  ? 151 PHE C CB    1 
ATOM   7170  C  CG    . PHE C  1 179 ? -18.605 28.650  -10.466 1.00 37.58  ? 151 PHE C CG    1 
ATOM   7171  C  CD1   . PHE C  1 179 ? -18.048 27.376  -10.576 1.00 39.91  ? 151 PHE C CD1   1 
ATOM   7172  C  CD2   . PHE C  1 179 ? -18.706 29.230  -9.209  1.00 36.40  ? 151 PHE C CD2   1 
ATOM   7173  C  CE1   . PHE C  1 179 ? -17.607 26.701  -9.454  1.00 35.52  ? 151 PHE C CE1   1 
ATOM   7174  C  CE2   . PHE C  1 179 ? -18.267 28.555  -8.077  1.00 37.86  ? 151 PHE C CE2   1 
ATOM   7175  C  CZ    . PHE C  1 179 ? -17.710 27.294  -8.203  1.00 38.37  ? 151 PHE C CZ    1 
ATOM   7176  N  N     . SER C  1 180 ? -20.535 27.027  -13.116 1.00 34.65  ? 152 SER C N     1 
ATOM   7177  C  CA    . SER C  1 180 ? -20.769 25.599  -13.303 1.00 34.55  ? 152 SER C CA    1 
ATOM   7178  C  C     . SER C  1 180 ? -19.657 24.824  -12.627 1.00 33.19  ? 152 SER C C     1 
ATOM   7179  O  O     . SER C  1 180 ? -18.532 24.782  -13.116 1.00 34.73  ? 152 SER C O     1 
ATOM   7180  C  CB    . SER C  1 180 ? -20.837 25.243  -14.799 1.00 36.53  ? 152 SER C CB    1 
ATOM   7181  O  OG    . SER C  1 180 ? -21.834 26.009  -15.457 1.00 34.28  ? 152 SER C OG    1 
ATOM   7182  N  N     . ALA C  1 181 ? -19.974 24.228  -11.488 1.00 30.21  ? 153 ALA C N     1 
ATOM   7183  C  CA    . ALA C  1 181 ? -19.001 23.472  -10.714 1.00 33.10  ? 153 ALA C CA    1 
ATOM   7184  C  C     . ALA C  1 181 ? -18.800 22.052  -11.266 1.00 31.90  ? 153 ALA C C     1 
ATOM   7185  O  O     . ALA C  1 181 ? -19.523 21.611  -12.162 1.00 31.22  ? 153 ALA C O     1 
ATOM   7186  C  CB    . ALA C  1 181 ? -19.437 23.417  -9.251  1.00 33.81  ? 153 ALA C CB    1 
ATOM   7187  N  N     . LYS C  1 182 ? -17.807 21.350  -10.728 1.00 32.57  ? 154 LYS C N     1 
ATOM   7188  C  CA    . LYS C  1 182 ? -17.458 20.014  -11.221 1.00 35.31  ? 154 LYS C CA    1 
ATOM   7189  C  C     . LYS C  1 182 ? -18.527 18.964  -10.923 1.00 35.16  ? 154 LYS C C     1 
ATOM   7190  O  O     . LYS C  1 182 ? -18.568 17.922  -11.587 1.00 32.42  ? 154 LYS C O     1 
ATOM   7191  C  CB    . LYS C  1 182 ? -16.120 19.567  -10.634 1.00 31.56  ? 154 LYS C CB    1 
ATOM   7192  C  CG    . LYS C  1 182 ? -14.937 20.387  -11.138 1.00 33.57  ? 154 LYS C CG    1 
ATOM   7193  C  CD    . LYS C  1 182 ? -13.648 19.916  -10.510 1.00 35.12  ? 154 LYS C CD    1 
ATOM   7194  C  CE    . LYS C  1 182 ? -12.442 20.613  -11.120 1.00 39.66  ? 154 LYS C CE    1 
ATOM   7195  N  NZ    . LYS C  1 182 ? -11.189 20.044  -10.549 1.00 42.02  ? 154 LYS C NZ    1 
ATOM   7196  N  N     . ASN C  1 183 ? -19.390 19.245  -9.944  1.00 30.19  ? 155 ASN C N     1 
ATOM   7197  C  CA    . ASN C  1 183 ? -20.515 18.352  -9.602  1.00 30.36  ? 155 ASN C CA    1 
ATOM   7198  C  C     . ASN C  1 183 ? -21.746 18.666  -10.448 1.00 29.76  ? 155 ASN C C     1 
ATOM   7199  O  O     . ASN C  1 183 ? -22.837 18.187  -10.152 1.00 31.00  ? 155 ASN C O     1 
ATOM   7200  C  CB    . ASN C  1 183 ? -20.862 18.451  -8.099  1.00 28.13  ? 155 ASN C CB    1 
ATOM   7201  C  CG    . ASN C  1 183 ? -21.262 19.886  -7.660  1.00 32.78  ? 155 ASN C CG    1 
ATOM   7202  O  OD1   . ASN C  1 183 ? -21.409 20.791  -8.488  1.00 28.20  ? 155 ASN C OD1   1 
ATOM   7203  N  ND2   . ASN C  1 183 ? -21.452 20.078  -6.347  1.00 29.12  ? 155 ASN C ND2   1 
ATOM   7204  N  N     . CYS C  1 184 ? -21.537 19.511  -11.469 1.00 31.62  ? 156 CYS C N     1 
ATOM   7205  C  CA    . CYS C  1 184 ? -22.553 20.023  -12.408 1.00 28.52  ? 156 CYS C CA    1 
ATOM   7206  C  C     . CYS C  1 184 ? -23.478 21.115  -11.849 1.00 29.29  ? 156 CYS C C     1 
ATOM   7207  O  O     . CYS C  1 184 ? -24.297 21.673  -12.583 1.00 28.58  ? 156 CYS C O     1 
ATOM   7208  C  CB    . CYS C  1 184 ? -23.419 18.876  -12.956 1.00 30.75  ? 156 CYS C CB    1 
ATOM   7209  S  SG    . CYS C  1 184 ? -22.473 17.585  -13.784 1.00 33.39  ? 156 CYS C SG    1 
ATOM   7210  N  N     . MET C  1 185 ? -23.354 21.427  -10.569 1.00 25.65  ? 157 MET C N     1 
ATOM   7211  C  CA    . MET C  1 185 ? -24.253 22.402  -9.956  1.00 29.40  ? 157 MET C CA    1 
ATOM   7212  C  C     . MET C  1 185 ? -23.882 23.845  -10.293 1.00 31.63  ? 157 MET C C     1 
ATOM   7213  O  O     . MET C  1 185 ? -22.705 24.217  -10.299 1.00 32.66  ? 157 MET C O     1 
ATOM   7214  C  CB    . MET C  1 185 ? -24.256 22.244  -8.431  1.00 27.70  ? 157 MET C CB    1 
ATOM   7215  C  CG    . MET C  1 185 ? -24.658 20.850  -7.925  1.00 28.41  ? 157 MET C CG    1 
ATOM   7216  S  SD    . MET C  1 185 ? -26.393 20.520  -8.263  1.00 27.92  ? 157 MET C SD    1 
ATOM   7217  C  CE    . MET C  1 185 ? -27.197 21.754  -7.263  1.00 28.56  ? 157 MET C CE    1 
ATOM   7218  N  N     . ILE C  1 186 ? -24.891 24.670  -10.542 1.00 30.73  ? 158 ILE C N     1 
ATOM   7219  C  CA    . ILE C  1 186 ? -24.667 26.098  -10.468 1.00 30.34  ? 158 ILE C CA    1 
ATOM   7220  C  C     . ILE C  1 186 ? -24.408 26.470  -8.991  1.00 34.30  ? 158 ILE C C     1 
ATOM   7221  O  O     . ILE C  1 186 ? -25.277 26.335  -8.122  1.00 27.25  ? 158 ILE C O     1 
ATOM   7222  C  CB    . ILE C  1 186 ? -25.839 26.900  -11.036 1.00 29.54  ? 158 ILE C CB    1 
ATOM   7223  C  CG1   . ILE C  1 186 ? -25.887 26.734  -12.554 1.00 25.81  ? 158 ILE C CG1   1 
ATOM   7224  C  CG2   . ILE C  1 186 ? -25.688 28.399  -10.675 1.00 25.61  ? 158 ILE C CG2   1 
ATOM   7225  C  CD1   . ILE C  1 186 ? -24.661 27.283  -13.288 1.00 30.87  ? 158 ILE C CD1   1 
ATOM   7226  N  N     . THR C  1 187 ? -23.187 26.919  -8.719  1.00 28.51  ? 159 THR C N     1 
ATOM   7227  C  CA    . THR C  1 187 ? -22.781 27.232  -7.370  1.00 27.85  ? 159 THR C CA    1 
ATOM   7228  C  C     . THR C  1 187 ? -22.583 28.741  -7.235  1.00 35.03  ? 159 THR C C     1 
ATOM   7229  O  O     . THR C  1 187 ? -21.877 29.349  -8.042  1.00 32.39  ? 159 THR C O     1 
ATOM   7230  C  CB    . THR C  1 187 ? -21.507 26.478  -7.024  1.00 29.21  ? 159 THR C CB    1 
ATOM   7231  O  OG1   . THR C  1 187 ? -21.716 25.085  -7.295  1.00 31.18  ? 159 THR C OG1   1 
ATOM   7232  C  CG2   . THR C  1 187 ? -21.156 26.662  -5.558  1.00 33.25  ? 159 THR C CG2   1 
ATOM   7233  N  N     . THR C  1 188 ? -23.241 29.340  -6.247  1.00 31.53  ? 160 THR C N     1 
ATOM   7234  C  CA    . THR C  1 188 ? -23.161 30.777  -6.029  1.00 29.12  ? 160 THR C CA    1 
ATOM   7235  C  C     . THR C  1 188 ? -22.221 31.095  -4.871  1.00 34.42  ? 160 THR C C     1 
ATOM   7236  O  O     . THR C  1 188 ? -22.066 30.296  -3.942  1.00 32.93  ? 160 THR C O     1 
ATOM   7237  C  CB    . THR C  1 188 ? -24.553 31.392  -5.739  1.00 35.42  ? 160 THR C CB    1 
ATOM   7238  O  OG1   . THR C  1 188 ? -25.029 30.941  -4.461  1.00 34.53  ? 160 THR C OG1   1 
ATOM   7239  C  CG2   . THR C  1 188 ? -25.553 30.991  -6.820  1.00 30.92  ? 160 THR C CG2   1 
ATOM   7240  N  N     . PRO C  1 189 ? -21.571 32.268  -4.922  1.00 35.00  ? 161 PRO C N     1 
ATOM   7241  C  CA    . PRO C  1 189 ? -20.669 32.627  -3.818  1.00 36.33  ? 161 PRO C CA    1 
ATOM   7242  C  C     . PRO C  1 189 ? -21.417 32.811  -2.488  1.00 33.50  ? 161 PRO C C     1 
ATOM   7243  O  O     . PRO C  1 189 ? -20.919 32.405  -1.444  1.00 35.60  ? 161 PRO C O     1 
ATOM   7244  C  CB    . PRO C  1 189 ? -20.036 33.949  -4.300  1.00 39.81  ? 161 PRO C CB    1 
ATOM   7245  C  CG    . PRO C  1 189 ? -20.136 33.871  -5.822  1.00 35.78  ? 161 PRO C CG    1 
ATOM   7246  C  CD    . PRO C  1 189 ? -21.474 33.216  -6.052  1.00 35.75  ? 161 PRO C CD    1 
ATOM   7247  N  N     . GLU C  1 190 ? -22.616 33.382  -2.540  1.00 34.08  ? 162 GLU C N     1 
ATOM   7248  C  CA    . GLU C  1 190 ? -23.353 33.709  -1.324  1.00 38.93  ? 162 GLU C CA    1 
ATOM   7249  C  C     . GLU C  1 190 ? -24.051 32.482  -0.724  1.00 36.78  ? 162 GLU C C     1 
ATOM   7250  O  O     . GLU C  1 190 ? -24.026 32.269  0.494   1.00 34.29  ? 162 GLU C O     1 
ATOM   7251  C  CB    . GLU C  1 190 ? -24.387 34.816  -1.610  1.00 38.47  ? 162 GLU C CB    1 
ATOM   7252  C  CG    . GLU C  1 190 ? -23.857 36.065  -2.371  1.00 43.47  ? 162 GLU C CG    1 
ATOM   7253  C  CD    . GLU C  1 190 ? -23.843 35.924  -3.909  1.00 48.22  ? 162 GLU C CD    1 
ATOM   7254  O  OE1   . GLU C  1 190 ? -23.979 34.804  -4.449  1.00 40.24  ? 162 GLU C OE1   1 
ATOM   7255  O  OE2   . GLU C  1 190 ? -23.696 36.959  -4.596  1.00 60.73  ? 162 GLU C OE2   1 
ATOM   7256  N  N     . TYR C  1 191 ? -24.655 31.665  -1.590  1.00 35.44  ? 163 TYR C N     1 
ATOM   7257  C  CA    . TYR C  1 191 ? -25.583 30.623  -1.161  1.00 34.91  ? 163 TYR C CA    1 
ATOM   7258  C  C     . TYR C  1 191 ? -25.115 29.202  -1.474  1.00 38.30  ? 163 TYR C C     1 
ATOM   7259  O  O     . TYR C  1 191 ? -25.826 28.240  -1.211  1.00 31.33  ? 163 TYR C O     1 
ATOM   7260  C  CB    . TYR C  1 191 ? -26.960 30.872  -1.801  1.00 31.66  ? 163 TYR C CB    1 
ATOM   7261  C  CG    . TYR C  1 191 ? -27.452 32.278  -1.592  1.00 32.80  ? 163 TYR C CG    1 
ATOM   7262  C  CD1   . TYR C  1 191 ? -27.825 32.712  -0.329  1.00 38.86  ? 163 TYR C CD1   1 
ATOM   7263  C  CD2   . TYR C  1 191 ? -27.533 33.177  -2.643  1.00 36.63  ? 163 TYR C CD2   1 
ATOM   7264  C  CE1   . TYR C  1 191 ? -28.272 33.998  -0.114  1.00 36.94  ? 163 TYR C CE1   1 
ATOM   7265  C  CE2   . TYR C  1 191 ? -27.982 34.476  -2.444  1.00 35.05  ? 163 TYR C CE2   1 
ATOM   7266  C  CZ    . TYR C  1 191 ? -28.341 34.880  -1.172  1.00 39.81  ? 163 TYR C CZ    1 
ATOM   7267  O  OH    . TYR C  1 191 ? -28.796 36.162  -0.942  1.00 40.11  ? 163 TYR C OH    1 
ATOM   7268  N  N     . GLY C  1 192 ? -23.912 29.066  -2.012  1.00 36.86  ? 164 GLY C N     1 
ATOM   7269  C  CA    . GLY C  1 192 ? -23.433 27.760  -2.419  1.00 33.51  ? 164 GLY C CA    1 
ATOM   7270  C  C     . GLY C  1 192 ? -24.236 27.205  -3.584  1.00 32.79  ? 164 GLY C C     1 
ATOM   7271  O  O     . GLY C  1 192 ? -24.732 27.971  -4.413  1.00 27.18  ? 164 GLY C O     1 
ATOM   7272  N  N     . SER C  1 193 ? -24.370 25.876  -3.653  1.00 29.86  ? 165 SER C N     1 
ATOM   7273  C  CA    . SER C  1 193 ? -25.172 25.240  -4.707  1.00 28.52  ? 165 SER C CA    1 
ATOM   7274  C  C     . SER C  1 193 ? -26.621 25.025  -4.268  1.00 31.70  ? 165 SER C C     1 
ATOM   7275  O  O     . SER C  1 193 ? -27.434 24.488  -5.034  1.00 27.82  ? 165 SER C O     1 
ATOM   7276  C  CB    . SER C  1 193 ? -24.566 23.890  -5.116  1.00 27.75  ? 165 SER C CB    1 
ATOM   7277  O  OG    . SER C  1 193 ? -24.492 23.029  -3.989  1.00 29.43  ? 165 SER C OG    1 
ATOM   7278  N  N     . TYR C  1 194 ? -26.941 25.431  -3.036  1.00 29.37  ? 166 TYR C N     1 
ATOM   7279  C  CA    . TYR C  1 194 ? -28.264 25.153  -2.475  1.00 29.30  ? 166 TYR C CA    1 
ATOM   7280  C  C     . TYR C  1 194 ? -29.278 26.194  -2.917  1.00 26.63  ? 166 TYR C C     1 
ATOM   7281  O  O     . TYR C  1 194 ? -29.886 26.883  -2.092  1.00 28.78  ? 166 TYR C O     1 
ATOM   7282  C  CB    . TYR C  1 194 ? -28.210 25.099  -0.938  1.00 29.80  ? 166 TYR C CB    1 
ATOM   7283  C  CG    . TYR C  1 194 ? -27.408 23.947  -0.380  1.00 30.73  ? 166 TYR C CG    1 
ATOM   7284  C  CD1   . TYR C  1 194 ? -27.566 22.656  -0.880  1.00 28.98  ? 166 TYR C CD1   1 
ATOM   7285  C  CD2   . TYR C  1 194 ? -26.482 24.147  0.640   1.00 31.31  ? 166 TYR C CD2   1 
ATOM   7286  C  CE1   . TYR C  1 194 ? -26.836 21.596  -0.376  1.00 26.43  ? 166 TYR C CE1   1 
ATOM   7287  C  CE2   . TYR C  1 194 ? -25.740 23.086  1.152   1.00 36.93  ? 166 TYR C CE2   1 
ATOM   7288  C  CZ    . TYR C  1 194 ? -25.926 21.810  0.630   1.00 29.16  ? 166 TYR C CZ    1 
ATOM   7289  O  OH    . TYR C  1 194 ? -25.207 20.761  1.122   1.00 30.42  ? 166 TYR C OH    1 
ATOM   7290  N  N     . VAL C  1 195 ? -29.469 26.302  -4.224  1.00 27.99  ? 167 VAL C N     1 
ATOM   7291  C  CA    . VAL C  1 195 ? -30.419 27.255  -4.772  1.00 23.46  ? 167 VAL C CA    1 
ATOM   7292  C  C     . VAL C  1 195 ? -31.328 26.605  -5.796  1.00 24.61  ? 167 VAL C C     1 
ATOM   7293  O  O     . VAL C  1 195 ? -30.885 25.775  -6.592  1.00 23.04  ? 167 VAL C O     1 
ATOM   7294  C  CB    . VAL C  1 195 ? -29.686 28.457  -5.415  1.00 26.30  ? 167 VAL C CB    1 
ATOM   7295  C  CG1   . VAL C  1 195 ? -28.965 29.292  -4.304  1.00 22.24  ? 167 VAL C CG1   1 
ATOM   7296  C  CG2   . VAL C  1 195 ? -28.702 27.988  -6.499  1.00 19.12  ? 167 VAL C CG2   1 
ATOM   7297  N  N     . TYR C  1 196 ? -32.598 26.993  -5.775  1.00 23.37  ? 168 TYR C N     1 
ATOM   7298  C  CA    . TYR C  1 196 ? -33.518 26.683  -6.868  1.00 24.83  ? 168 TYR C CA    1 
ATOM   7299  C  C     . TYR C  1 196 ? -33.387 27.704  -8.006  1.00 27.87  ? 168 TYR C C     1 
ATOM   7300  O  O     . TYR C  1 196 ? -33.290 28.898  -7.736  1.00 23.99  ? 168 TYR C O     1 
ATOM   7301  C  CB    . TYR C  1 196 ? -34.961 26.689  -6.363  1.00 23.61  ? 168 TYR C CB    1 
ATOM   7302  C  CG    . TYR C  1 196 ? -35.285 25.663  -5.296  1.00 25.95  ? 168 TYR C CG    1 
ATOM   7303  C  CD1   . TYR C  1 196 ? -35.139 24.306  -5.543  1.00 24.99  ? 168 TYR C CD1   1 
ATOM   7304  C  CD2   . TYR C  1 196 ? -35.777 26.061  -4.049  1.00 23.20  ? 168 TYR C CD2   1 
ATOM   7305  C  CE1   . TYR C  1 196 ? -35.457 23.358  -4.566  1.00 25.50  ? 168 TYR C CE1   1 
ATOM   7306  C  CE2   . TYR C  1 196 ? -36.101 25.137  -3.081  1.00 27.80  ? 168 TYR C CE2   1 
ATOM   7307  C  CZ    . TYR C  1 196 ? -35.937 23.781  -3.341  1.00 24.94  ? 168 TYR C CZ    1 
ATOM   7308  O  OH    . TYR C  1 196 ? -36.266 22.868  -2.370  1.00 24.53  ? 168 TYR C OH    1 
ATOM   7309  N  N     . LEU C  1 197 ? -33.431 27.254  -9.260  1.00 24.91  ? 169 LEU C N     1 
ATOM   7310  C  CA    . LEU C  1 197 ? -33.294 28.158  -10.419 1.00 24.75  ? 169 LEU C CA    1 
ATOM   7311  C  C     . LEU C  1 197 ? -34.591 28.318  -11.210 1.00 29.80  ? 169 LEU C C     1 
ATOM   7312  O  O     . LEU C  1 197 ? -35.412 27.400  -11.288 1.00 26.03  ? 169 LEU C O     1 
ATOM   7313  C  CB    . LEU C  1 197 ? -32.197 27.667  -11.390 1.00 19.73  ? 169 LEU C CB    1 
ATOM   7314  C  CG    . LEU C  1 197 ? -30.782 27.468  -10.825 1.00 22.22  ? 169 LEU C CG    1 
ATOM   7315  C  CD1   . LEU C  1 197 ? -29.823 27.016  -11.935 1.00 26.81  ? 169 LEU C CD1   1 
ATOM   7316  C  CD2   . LEU C  1 197 ? -30.252 28.724  -10.132 1.00 20.29  ? 169 LEU C CD2   1 
ATOM   7317  N  N     . ALA C  1 198 ? -34.760 29.498  -11.813 1.00 25.86  ? 170 ALA C N     1 
ATOM   7318  C  CA    . ALA C  1 198 ? -35.852 29.737  -12.744 1.00 27.49  ? 170 ALA C CA    1 
ATOM   7319  C  C     . ALA C  1 198 ? -35.494 30.960  -13.605 1.00 27.97  ? 170 ALA C C     1 
ATOM   7320  O  O     . ALA C  1 198 ? -34.467 31.605  -13.386 1.00 28.99  ? 170 ALA C O     1 
ATOM   7321  C  CB    . ALA C  1 198 ? -37.189 29.946  -12.003 1.00 21.82  ? 170 ALA C CB    1 
ATOM   7322  N  N     . GLU C  1 199 ? -36.332 31.262  -14.581 1.00 26.70  ? 171 GLU C N     1 
ATOM   7323  C  CA    . GLU C  1 199 ? -36.021 32.313  -15.538 1.00 26.49  ? 171 GLU C CA    1 
ATOM   7324  C  C     . GLU C  1 199 ? -37.241 32.702  -16.346 1.00 28.30  ? 171 GLU C C     1 
ATOM   7325  O  O     . GLU C  1 199 ? -38.204 31.939  -16.488 1.00 27.86  ? 171 GLU C O     1 
ATOM   7326  C  CB    . GLU C  1 199 ? -34.897 31.889  -16.485 1.00 22.81  ? 171 GLU C CB    1 
ATOM   7327  C  CG    . GLU C  1 199 ? -35.275 30.748  -17.416 1.00 24.00  ? 171 GLU C CG    1 
ATOM   7328  C  CD    . GLU C  1 199 ? -34.899 29.353  -16.874 1.00 25.92  ? 171 GLU C CD    1 
ATOM   7329  O  OE1   . GLU C  1 199 ? -34.278 29.262  -15.804 1.00 25.59  ? 171 GLU C OE1   1 
ATOM   7330  O  OE2   . GLU C  1 199 ? -35.235 28.351  -17.536 1.00 25.58  ? 171 GLU C OE2   1 
ATOM   7331  N  N     . MET C  1 200 ? -37.163 33.913  -16.882 1.00 33.03  ? 172 MET C N     1 
ATOM   7332  C  CA    . MET C  1 200 ? -38.234 34.527  -17.634 1.00 31.07  ? 172 MET C CA    1 
ATOM   7333  C  C     . MET C  1 200 ? -37.631 35.133  -18.898 1.00 31.57  ? 172 MET C C     1 
ATOM   7334  O  O     . MET C  1 200 ? -36.781 36.033  -18.824 1.00 30.25  ? 172 MET C O     1 
ATOM   7335  C  CB    . MET C  1 200 ? -38.927 35.597  -16.771 1.00 29.87  ? 172 MET C CB    1 
ATOM   7336  C  CG    . MET C  1 200 ? -40.081 36.302  -17.430 1.00 34.89  ? 172 MET C CG    1 
ATOM   7337  S  SD    . MET C  1 200 ? -40.824 37.555  -16.351 1.00 41.59  ? 172 MET C SD    1 
ATOM   7338  C  CE    . MET C  1 200 ? -39.410 38.556  -15.962 1.00 32.13  ? 172 MET C CE    1 
ATOM   7339  N  N     . ILE C  1 201 ? -38.043 34.634  -20.055 1.00 32.16  ? 173 ILE C N     1 
ATOM   7340  C  CA    . ILE C  1 201 ? -37.638 35.245  -21.325 1.00 28.47  ? 173 ILE C CA    1 
ATOM   7341  C  C     . ILE C  1 201 ? -38.447 36.515  -21.569 1.00 31.68  ? 173 ILE C C     1 
ATOM   7342  O  O     . ILE C  1 201 ? -39.669 36.513  -21.371 1.00 33.02  ? 173 ILE C O     1 
ATOM   7343  C  CB    . ILE C  1 201 ? -37.861 34.305  -22.508 1.00 29.84  ? 173 ILE C CB    1 
ATOM   7344  C  CG1   . ILE C  1 201 ? -37.346 32.889  -22.198 1.00 27.34  ? 173 ILE C CG1   1 
ATOM   7345  C  CG2   . ILE C  1 201 ? -37.200 34.862  -23.759 1.00 32.87  ? 173 ILE C CG2   1 
ATOM   7346  C  CD1   . ILE C  1 201 ? -37.596 31.932  -23.334 1.00 30.51  ? 173 ILE C CD1   1 
ATOM   7347  N  N     . THR C  1 202 ? -37.789 37.599  -21.984 1.00 26.35  ? 174 THR C N     1 
ATOM   7348  C  CA    . THR C  1 202 ? -38.533 38.812  -22.351 1.00 30.92  ? 174 THR C CA    1 
ATOM   7349  C  C     . THR C  1 202 ? -38.071 39.423  -23.670 1.00 33.17  ? 174 THR C C     1 
ATOM   7350  O  O     . THR C  1 202 ? -36.980 39.137  -24.170 1.00 31.67  ? 174 THR C O     1 
ATOM   7351  C  CB    . THR C  1 202 ? -38.431 39.944  -21.277 1.00 37.63  ? 174 THR C CB    1 
ATOM   7352  O  OG1   . THR C  1 202 ? -37.214 40.683  -21.468 1.00 31.08  ? 174 THR C OG1   1 
ATOM   7353  C  CG2   . THR C  1 202 ? -38.477 39.383  -19.852 1.00 32.66  ? 174 THR C CG2   1 
ATOM   7354  N  N     . ASN C  1 203 ? -38.915 40.297  -24.205 1.00 36.56  ? 175 ASN C N     1 
ATOM   7355  C  CA    . ASN C  1 203 ? -38.572 41.082  -25.379 1.00 38.37  ? 175 ASN C CA    1 
ATOM   7356  C  C     . ASN C  1 203 ? -37.918 42.394  -24.995 1.00 41.47  ? 175 ASN C C     1 
ATOM   7357  O  O     . ASN C  1 203 ? -37.850 43.304  -25.806 1.00 41.38  ? 175 ASN C O     1 
ATOM   7358  C  CB    . ASN C  1 203 ? -39.819 41.356  -26.228 1.00 39.97  ? 175 ASN C CB    1 
ATOM   7359  C  CG    . ASN C  1 203 ? -40.873 42.164  -25.481 1.00 43.22  ? 175 ASN C CG    1 
ATOM   7360  O  OD1   . ASN C  1 203 ? -40.787 42.353  -24.265 1.00 41.07  ? 175 ASN C OD1   1 
ATOM   7361  N  ND2   . ASN C  1 203 ? -41.885 42.627  -26.204 1.00 45.09  ? 175 ASN C ND2   1 
ATOM   7362  N  N     . ILE C  1 204 ? -37.449 42.494  -23.753 1.00 36.43  ? 176 ILE C N     1 
ATOM   7363  C  CA    . ILE C  1 204 ? -36.796 43.707  -23.281 1.00 40.35  ? 176 ILE C CA    1 
ATOM   7364  C  C     . ILE C  1 204 ? -35.282 43.602  -23.459 1.00 37.62  ? 176 ILE C C     1 
ATOM   7365  O  O     . ILE C  1 204 ? -34.673 42.644  -23.012 1.00 37.77  ? 176 ILE C O     1 
ATOM   7366  C  CB    . ILE C  1 204 ? -37.110 43.997  -21.776 1.00 39.90  ? 176 ILE C CB    1 
ATOM   7367  C  CG1   . ILE C  1 204 ? -38.619 43.994  -21.489 1.00 34.16  ? 176 ILE C CG1   1 
ATOM   7368  C  CG2   . ILE C  1 204 ? -36.513 45.317  -21.353 1.00 38.85  ? 176 ILE C CG2   1 
ATOM   7369  C  CD1   . ILE C  1 204 ? -38.945 43.724  -20.008 1.00 36.69  ? 176 ILE C CD1   1 
ATOM   7370  N  N     . PRO C  1 205 ? -34.663 44.591  -24.121 1.00 41.78  ? 177 PRO C N     1 
ATOM   7371  C  CA    . PRO C  1 205 ? -33.214 44.459  -24.302 1.00 39.55  ? 177 PRO C CA    1 
ATOM   7372  C  C     . PRO C  1 205 ? -32.405 44.844  -23.060 1.00 45.55  ? 177 PRO C C     1 
ATOM   7373  O  O     . PRO C  1 205 ? -31.638 45.800  -23.163 1.00 42.68  ? 177 PRO C O     1 
ATOM   7374  C  CB    . PRO C  1 205 ? -32.919 45.423  -25.463 1.00 41.90  ? 177 PRO C CB    1 
ATOM   7375  C  CG    . PRO C  1 205 ? -33.994 46.478  -25.352 1.00 41.93  ? 177 PRO C CG    1 
ATOM   7376  C  CD    . PRO C  1 205 ? -35.221 45.749  -24.854 1.00 43.63  ? 177 PRO C CD    1 
ATOM   7377  N  N     . PHE C  1 206 ? -32.552 44.137  -21.934 1.00 39.22  ? 178 PHE C N     1 
ATOM   7378  C  CA    . PHE C  1 206 ? -31.753 44.463  -20.754 1.00 36.04  ? 178 PHE C CA    1 
ATOM   7379  C  C     . PHE C  1 206 ? -30.286 44.266  -21.085 1.00 41.08  ? 178 PHE C C     1 
ATOM   7380  O  O     . PHE C  1 206 ? -29.943 43.406  -21.882 1.00 36.10  ? 178 PHE C O     1 
ATOM   7381  C  CB    . PHE C  1 206 ? -32.100 43.591  -19.535 1.00 35.44  ? 178 PHE C CB    1 
ATOM   7382  C  CG    . PHE C  1 206 ? -33.469 43.823  -18.977 1.00 36.91  ? 178 PHE C CG    1 
ATOM   7383  C  CD1   . PHE C  1 206 ? -34.408 42.808  -18.984 1.00 36.18  ? 178 PHE C CD1   1 
ATOM   7384  C  CD2   . PHE C  1 206 ? -33.812 45.052  -18.426 1.00 41.27  ? 178 PHE C CD2   1 
ATOM   7385  C  CE1   . PHE C  1 206 ? -35.670 43.009  -18.471 1.00 34.88  ? 178 PHE C CE1   1 
ATOM   7386  C  CE2   . PHE C  1 206 ? -35.072 45.261  -17.904 1.00 39.49  ? 178 PHE C CE2   1 
ATOM   7387  C  CZ    . PHE C  1 206 ? -36.005 44.243  -17.930 1.00 41.73  ? 178 PHE C CZ    1 
ATOM   7388  N  N     . GLU C  1 207 ? -29.419 45.052  -20.460 1.00 38.73  ? 179 GLU C N     1 
ATOM   7389  C  CA    . GLU C  1 207 ? -27.993 44.810  -20.574 1.00 41.08  ? 179 GLU C CA    1 
ATOM   7390  C  C     . GLU C  1 207 ? -27.662 43.515  -19.838 1.00 42.49  ? 179 GLU C C     1 
ATOM   7391  O  O     . GLU C  1 207 ? -28.076 43.336  -18.693 1.00 33.19  ? 179 GLU C O     1 
ATOM   7392  C  CB    . GLU C  1 207 ? -27.199 45.974  -19.994 1.00 43.25  ? 179 GLU C CB    1 
ATOM   7393  C  CG    . GLU C  1 207 ? -25.801 46.102  -20.559 1.00 58.34  ? 179 GLU C CG    1 
ATOM   7394  C  CD    . GLU C  1 207 ? -25.181 47.457  -20.264 1.00 68.43  ? 179 GLU C CD    1 
ATOM   7395  O  OE1   . GLU C  1 207 ? -25.110 47.832  -19.073 1.00 74.74  ? 179 GLU C OE1   1 
ATOM   7396  O  OE2   . GLU C  1 207 ? -24.779 48.150  -21.228 1.00 75.14  ? 179 GLU C OE2   1 
ATOM   7397  N  N     . PRO C  1 208 ? -26.917 42.608  -20.485 1.00 41.99  ? 180 PRO C N     1 
ATOM   7398  C  CA    . PRO C  1 208 ? -26.589 41.339  -19.829 1.00 37.47  ? 180 PRO C CA    1 
ATOM   7399  C  C     . PRO C  1 208 ? -25.502 41.488  -18.772 1.00 43.19  ? 180 PRO C C     1 
ATOM   7400  O  O     . PRO C  1 208 ? -24.708 42.426  -18.830 1.00 43.06  ? 180 PRO C O     1 
ATOM   7401  C  CB    . PRO C  1 208 ? -26.091 40.464  -20.982 1.00 37.78  ? 180 PRO C CB    1 
ATOM   7402  C  CG    . PRO C  1 208 ? -25.470 41.445  -21.934 1.00 44.84  ? 180 PRO C CG    1 
ATOM   7403  C  CD    . PRO C  1 208 ? -26.349 42.694  -21.846 1.00 44.28  ? 180 PRO C CD    1 
ATOM   7404  N  N     . ASP C  1 209 ? -25.462 40.557  -17.824 1.00 38.54  ? 181 ASP C N     1 
ATOM   7405  C  CA    . ASP C  1 209 ? -24.414 40.543  -16.819 1.00 40.13  ? 181 ASP C CA    1 
ATOM   7406  C  C     . ASP C  1 209 ? -23.232 39.717  -17.334 1.00 43.23  ? 181 ASP C C     1 
ATOM   7407  O  O     . ASP C  1 209 ? -23.235 39.273  -18.481 1.00 41.70  ? 181 ASP C O     1 
ATOM   7408  C  CB    . ASP C  1 209 ? -24.951 39.999  -15.486 1.00 40.61  ? 181 ASP C CB    1 
ATOM   7409  C  CG    . ASP C  1 209 ? -26.007 40.923  -14.858 1.00 44.28  ? 181 ASP C CG    1 
ATOM   7410  O  OD1   . ASP C  1 209 ? -25.985 42.149  -15.138 1.00 42.60  ? 181 ASP C OD1   1 
ATOM   7411  O  OD2   . ASP C  1 209 ? -26.864 40.427  -14.088 1.00 31.66  ? 181 ASP C OD2   1 
ATOM   7412  N  N     . VAL C  1 210 ? -22.222 39.529  -16.489 1.00 41.54  ? 182 VAL C N     1 
ATOM   7413  C  CA    . VAL C  1 210 ? -21.012 38.805  -16.858 1.00 41.64  ? 182 VAL C CA    1 
ATOM   7414  C  C     . VAL C  1 210 ? -20.909 37.493  -16.064 1.00 38.04  ? 182 VAL C C     1 
ATOM   7415  O  O     . VAL C  1 210 ? -21.160 37.480  -14.851 1.00 35.92  ? 182 VAL C O     1 
ATOM   7416  C  CB    . VAL C  1 210 ? -19.760 39.677  -16.609 1.00 42.33  ? 182 VAL C CB    1 
ATOM   7417  C  CG1   . VAL C  1 210 ? -18.473 38.844  -16.671 1.00 47.47  ? 182 VAL C CG1   1 
ATOM   7418  C  CG2   . VAL C  1 210 ? -19.710 40.832  -17.621 1.00 49.51  ? 182 VAL C CG2   1 
ATOM   7419  N  N     . PRO C  1 211 ? -20.566 36.385  -16.743 1.00 40.64  ? 183 PRO C N     1 
ATOM   7420  C  CA    . PRO C  1 211 ? -20.415 35.115  -16.016 1.00 39.67  ? 183 PRO C CA    1 
ATOM   7421  C  C     . PRO C  1 211 ? -19.367 35.256  -14.916 1.00 43.90  ? 183 PRO C C     1 
ATOM   7422  O  O     . PRO C  1 211 ? -18.404 36.000  -15.108 1.00 45.51  ? 183 PRO C O     1 
ATOM   7423  C  CB    . PRO C  1 211 ? -19.960 34.135  -17.105 1.00 37.29  ? 183 PRO C CB    1 
ATOM   7424  C  CG    . PRO C  1 211 ? -20.510 34.711  -18.377 1.00 32.33  ? 183 PRO C CG    1 
ATOM   7425  C  CD    . PRO C  1 211 ? -20.368 36.212  -18.194 1.00 43.94  ? 183 PRO C CD    1 
ATOM   7426  N  N     . ILE C  1 212 ? -19.551 34.590  -13.781 1.00 42.65  ? 184 ILE C N     1 
ATOM   7427  C  CA    . ILE C  1 212 ? -18.568 34.704  -12.713 1.00 36.93  ? 184 ILE C CA    1 
ATOM   7428  C  C     . ILE C  1 212 ? -17.570 33.543  -12.739 1.00 46.18  ? 184 ILE C C     1 
ATOM   7429  O  O     . ILE C  1 212 ? -17.788 32.526  -13.390 1.00 40.49  ? 184 ILE C O     1 
ATOM   7430  C  CB    . ILE C  1 212 ? -19.238 34.798  -11.342 1.00 40.35  ? 184 ILE C CB    1 
ATOM   7431  C  CG1   . ILE C  1 212 ? -19.823 33.454  -10.898 1.00 38.34  ? 184 ILE C CG1   1 
ATOM   7432  C  CG2   . ILE C  1 212 ? -20.305 35.893  -11.356 1.00 40.24  ? 184 ILE C CG2   1 
ATOM   7433  C  CD1   . ILE C  1 212 ? -20.383 33.511  -9.487  1.00 37.70  ? 184 ILE C CD1   1 
ATOM   7434  N  N     . GLU C  1 213 ? -16.467 33.725  -12.025 1.00 42.97  ? 185 GLU C N     1 
ATOM   7435  C  CA    . GLU C  1 213 ? -15.305 32.855  -12.116 1.00 40.92  ? 185 GLU C CA    1 
ATOM   7436  C  C     . GLU C  1 213 ? -15.565 31.455  -11.532 1.00 43.39  ? 185 GLU C C     1 
ATOM   7437  O  O     . GLU C  1 213 ? -16.312 31.307  -10.565 1.00 36.40  ? 185 GLU C O     1 
ATOM   7438  C  CB    . GLU C  1 213 ? -14.134 33.539  -11.398 1.00 42.91  ? 185 GLU C CB    1 
ATOM   7439  C  CG    . GLU C  1 213 ? -12.759 32.911  -11.568 1.00 56.03  ? 185 GLU C CG    1 
ATOM   7440  C  CD    . GLU C  1 213 ? -11.693 33.645  -10.739 1.00 64.87  ? 185 GLU C CD    1 
ATOM   7441  O  OE1   . GLU C  1 213 ? -11.816 34.887  -10.575 1.00 54.82  ? 185 GLU C OE1   1 
ATOM   7442  O  OE2   . GLU C  1 213 ? -10.747 32.977  -10.244 1.00 62.51  ? 185 GLU C OE2   1 
ATOM   7443  N  N     . ASP C  1 214 ? -14.946 30.437  -12.129 1.00 40.91  ? 186 ASP C N     1 
ATOM   7444  C  CA    . ASP C  1 214 ? -14.973 29.076  -11.595 1.00 40.77  ? 186 ASP C CA    1 
ATOM   7445  C  C     . ASP C  1 214 ? -14.066 28.965  -10.382 1.00 45.16  ? 186 ASP C C     1 
ATOM   7446  O  O     . ASP C  1 214 ? -12.864 29.204  -10.490 1.00 49.01  ? 186 ASP C O     1 
ATOM   7447  C  CB    . ASP C  1 214 ? -14.530 28.077  -12.664 1.00 43.87  ? 186 ASP C CB    1 
ATOM   7448  C  CG    . ASP C  1 214 ? -14.687 26.629  -12.227 1.00 44.55  ? 186 ASP C CG    1 
ATOM   7449  O  OD1   . ASP C  1 214 ? -15.262 25.864  -13.015 1.00 53.38  ? 186 ASP C OD1   1 
ATOM   7450  O  OD2   . ASP C  1 214 ? -14.233 26.247  -11.125 1.00 36.98  ? 186 ASP C OD2   1 
ATOM   7451  N  N     . MET C  1 215 ? -14.635 28.568  -9.244  1.00 42.35  ? 187 MET C N     1 
ATOM   7452  C  CA    . MET C  1 215 ? -13.892 28.482  -7.989  1.00 43.23  ? 187 MET C CA    1 
ATOM   7453  C  C     . MET C  1 215 ? -13.503 27.060  -7.555  1.00 48.28  ? 187 MET C C     1 
ATOM   7454  O  O     . MET C  1 215 ? -13.024 26.874  -6.426  1.00 44.68  ? 187 MET C O     1 
ATOM   7455  C  CB    . MET C  1 215 ? -14.699 29.133  -6.853  1.00 44.64  ? 187 MET C CB    1 
ATOM   7456  C  CG    . MET C  1 215 ? -14.969 30.626  -7.044  1.00 46.97  ? 187 MET C CG    1 
ATOM   7457  S  SD    . MET C  1 215 ? -13.441 31.539  -7.379  1.00 53.51  ? 187 MET C SD    1 
ATOM   7458  C  CE    . MET C  1 215 ? -12.619 31.382  -5.776  1.00 47.23  ? 187 MET C CE    1 
ATOM   7459  N  N     . CYS C  1 216 ? -13.696 26.060  -8.417  1.00 41.41  ? 188 CYS C N     1 
ATOM   7460  C  CA    . CYS C  1 216 ? -13.420 24.678  -8.003  1.00 40.15  ? 188 CYS C CA    1 
ATOM   7461  C  C     . CYS C  1 216 ? -11.932 24.372  -7.883  1.00 42.62  ? 188 CYS C C     1 
ATOM   7462  O  O     . CYS C  1 216 ? -11.524 23.617  -6.998  1.00 46.39  ? 188 CYS C O     1 
ATOM   7463  C  CB    . CYS C  1 216 ? -14.072 23.672  -8.960  1.00 34.09  ? 188 CYS C CB    1 
ATOM   7464  S  SG    . CYS C  1 216 ? -15.839 23.485  -8.671  1.00 31.75  ? 188 CYS C SG    1 
ATOM   7465  N  N     . GLY C  1 217 ? -11.119 24.948  -8.760  1.00 41.77  ? 189 GLY C N     1 
ATOM   7466  C  CA    . GLY C  1 217 ? -9.691  24.675  -8.740  1.00 42.89  ? 189 GLY C CA    1 
ATOM   7467  C  C     . GLY C  1 217 ? -9.354  23.196  -8.848  1.00 45.33  ? 189 GLY C C     1 
ATOM   7468  O  O     . GLY C  1 217 ? -10.019 22.449  -9.566  1.00 45.26  ? 189 GLY C O     1 
ATOM   7469  N  N     . SER C  1 218 ? -8.335  22.769  -8.111  1.00 42.67  ? 190 SER C N     1 
ATOM   7470  C  CA    . SER C  1 218 ? -7.837  21.395  -8.200  1.00 48.84  ? 190 SER C CA    1 
ATOM   7471  C  C     . SER C  1 218 ? -8.637  20.417  -7.336  1.00 45.16  ? 190 SER C C     1 
ATOM   7472  O  O     . SER C  1 218 ? -8.326  19.231  -7.279  1.00 51.91  ? 190 SER C O     1 
ATOM   7473  C  CB    . SER C  1 218 ? -6.356  21.345  -7.807  1.00 48.63  ? 190 SER C CB    1 
ATOM   7474  O  OG    . SER C  1 218 ? -6.145  21.872  -6.504  1.00 53.61  ? 190 SER C OG    1 
ATOM   7475  N  N     . CYS C  1 219 ? -9.669  20.922  -6.668  1.00 46.91  ? 191 CYS C N     1 
ATOM   7476  C  CA    . CYS C  1 219 ? -10.552 20.091  -5.849  1.00 46.90  ? 191 CYS C CA    1 
ATOM   7477  C  C     . CYS C  1 219 ? -11.283 19.039  -6.696  1.00 44.76  ? 191 CYS C C     1 
ATOM   7478  O  O     . CYS C  1 219 ? -11.582 19.273  -7.868  1.00 42.04  ? 191 CYS C O     1 
ATOM   7479  C  CB    . CYS C  1 219 ? -11.564 20.977  -5.113  1.00 35.59  ? 191 CYS C CB    1 
ATOM   7480  S  SG    . CYS C  1 219 ? -12.754 20.099  -4.067  1.00 39.36  ? 191 CYS C SG    1 
ATOM   7481  N  N     . THR C  1 220 ? -11.550 17.879  -6.096  1.00 43.39  ? 192 THR C N     1 
ATOM   7482  C  CA    . THR C  1 220 ? -12.322 16.816  -6.746  1.00 43.79  ? 192 THR C CA    1 
ATOM   7483  C  C     . THR C  1 220 ? -13.155 16.027  -5.744  1.00 44.33  ? 192 THR C C     1 
ATOM   7484  O  O     . THR C  1 220 ? -13.434 14.844  -5.975  1.00 41.91  ? 192 THR C O     1 
ATOM   7485  C  CB    . THR C  1 220 ? -11.425 15.782  -7.468  1.00 47.38  ? 192 THR C CB    1 
ATOM   7486  O  OG1   . THR C  1 220 ? -10.504 15.230  -6.525  1.00 47.55  ? 192 THR C OG1   1 
ATOM   7487  C  CG2   . THR C  1 220 ? -10.660 16.398  -8.628  1.00 48.71  ? 192 THR C CG2   1 
ATOM   7488  N  N     . LYS C  1 221 ? -13.529 16.649  -4.627  1.00 39.47  ? 193 LYS C N     1 
ATOM   7489  C  CA    . LYS C  1 221 ? -14.175 15.895  -3.551  1.00 46.20  ? 193 LYS C CA    1 
ATOM   7490  C  C     . LYS C  1 221 ? -15.528 15.321  -3.972  1.00 42.87  ? 193 LYS C C     1 
ATOM   7491  O  O     . LYS C  1 221 ? -15.879 14.216  -3.563  1.00 41.52  ? 193 LYS C O     1 
ATOM   7492  C  CB    . LYS C  1 221 ? -14.343 16.757  -2.304  1.00 41.64  ? 193 LYS C CB    1 
ATOM   7493  C  CG    . LYS C  1 221 ? -13.069 16.918  -1.486  1.00 49.44  ? 193 LYS C CG    1 
ATOM   7494  C  CD    . LYS C  1 221 ? -13.315 17.768  -0.239  1.00 54.57  ? 193 LYS C CD    1 
ATOM   7495  C  CE    . LYS C  1 221 ? -12.074 17.862  0.644   1.00 60.84  ? 193 LYS C CE    1 
ATOM   7496  N  NZ    . LYS C  1 221 ? -12.384 18.416  2.003   1.00 65.47  ? 193 LYS C NZ    1 
ATOM   7497  N  N     . CYS C  1 222 ? -16.272 16.051  -4.799  1.00 37.58  ? 194 CYS C N     1 
ATOM   7498  C  CA    . CYS C  1 222 ? -17.569 15.564  -5.260  1.00 40.58  ? 194 CYS C CA    1 
ATOM   7499  C  C     . CYS C  1 222 ? -17.450 14.344  -6.178  1.00 35.62  ? 194 CYS C C     1 
ATOM   7500  O  O     . CYS C  1 222 ? -18.244 13.412  -6.082  1.00 32.80  ? 194 CYS C O     1 
ATOM   7501  C  CB    . CYS C  1 222 ? -18.330 16.670  -5.987  1.00 36.06  ? 194 CYS C CB    1 
ATOM   7502  S  SG    . CYS C  1 222 ? -17.449 17.396  -7.349  1.00 33.50  ? 194 CYS C SG    1 
ATOM   7503  N  N     . LEU C  1 223 ? -16.483 14.377  -7.085  1.00 38.21  ? 195 LEU C N     1 
ATOM   7504  C  CA    . LEU C  1 223 ? -16.254 13.282  -8.024  1.00 38.45  ? 195 LEU C CA    1 
ATOM   7505  C  C     . LEU C  1 223 ? -15.862 12.015  -7.266  1.00 40.35  ? 195 LEU C C     1 
ATOM   7506  O  O     . LEU C  1 223 ? -16.350 10.929  -7.566  1.00 38.43  ? 195 LEU C O     1 
ATOM   7507  C  CB    . LEU C  1 223 ? -15.165 13.651  -9.043  1.00 40.79  ? 195 LEU C CB    1 
ATOM   7508  C  CG    . LEU C  1 223 ? -15.169 15.075  -9.626  1.00 40.24  ? 195 LEU C CG    1 
ATOM   7509  C  CD1   . LEU C  1 223 ? -13.917 15.352  -10.445 1.00 40.12  ? 195 LEU C CD1   1 
ATOM   7510  C  CD2   . LEU C  1 223 ? -16.399 15.313  -10.467 1.00 38.45  ? 195 LEU C CD2   1 
ATOM   7511  N  N     . ASP C  1 224 ? -14.994 12.177  -6.273  1.00 38.98  ? 196 ASP C N     1 
ATOM   7512  C  CA    . ASP C  1 224 ? -14.514 11.065  -5.458  1.00 43.72  ? 196 ASP C CA    1 
ATOM   7513  C  C     . ASP C  1 224 ? -15.583 10.526  -4.503  1.00 41.33  ? 196 ASP C C     1 
ATOM   7514  O  O     . ASP C  1 224 ? -15.573 9.347   -4.162  1.00 37.81  ? 196 ASP C O     1 
ATOM   7515  C  CB    . ASP C  1 224 ? -13.293 11.487  -4.636  1.00 45.87  ? 196 ASP C CB    1 
ATOM   7516  C  CG    . ASP C  1 224 ? -12.154 12.000  -5.486  1.00 47.68  ? 196 ASP C CG    1 
ATOM   7517  O  OD1   . ASP C  1 224 ? -12.113 11.704  -6.699  1.00 48.75  ? 196 ASP C OD1   1 
ATOM   7518  O  OD2   . ASP C  1 224 ? -11.285 12.696  -4.920  1.00 51.25  ? 196 ASP C OD2   1 
ATOM   7519  N  N     . ALA C  1 225 ? -16.495 11.392  -4.071  1.00 33.87  ? 197 ALA C N     1 
ATOM   7520  C  CA    . ALA C  1 225 ? -17.518 11.021  -3.088  1.00 34.92  ? 197 ALA C CA    1 
ATOM   7521  C  C     . ALA C  1 225 ? -18.747 10.362  -3.711  1.00 32.93  ? 197 ALA C C     1 
ATOM   7522  O  O     . ALA C  1 225 ? -19.436 9.589   -3.045  1.00 32.48  ? 197 ALA C O     1 
ATOM   7523  C  CB    . ALA C  1 225 ? -17.949 12.248  -2.284  1.00 34.08  ? 197 ALA C CB    1 
ATOM   7524  N  N     . CYS C  1 226 ? -19.036 10.687  -4.969  1.00 29.69  ? 198 CYS C N     1 
ATOM   7525  C  CA    . CYS C  1 226 ? -20.182 10.086  -5.644  1.00 35.07  ? 198 CYS C CA    1 
ATOM   7526  C  C     . CYS C  1 226 ? -20.168 8.565   -5.511  1.00 33.45  ? 198 CYS C C     1 
ATOM   7527  O  O     . CYS C  1 226 ? -19.196 7.921   -5.911  1.00 31.82  ? 198 CYS C O     1 
ATOM   7528  C  CB    . CYS C  1 226 ? -20.208 10.448  -7.117  1.00 30.93  ? 198 CYS C CB    1 
ATOM   7529  S  SG    . CYS C  1 226 ? -21.679 9.809   -7.918  1.00 33.05  ? 198 CYS C SG    1 
ATOM   7530  N  N     . PRO C  1 227 ? -21.252 7.994   -4.963  1.00 34.51  ? 199 PRO C N     1 
ATOM   7531  C  CA    . PRO C  1 227 ? -21.295 6.564   -4.638  1.00 35.15  ? 199 PRO C CA    1 
ATOM   7532  C  C     . PRO C  1 227 ? -21.371 5.653   -5.864  1.00 35.68  ? 199 PRO C C     1 
ATOM   7533  O  O     . PRO C  1 227 ? -21.192 4.449   -5.724  1.00 39.49  ? 199 PRO C O     1 
ATOM   7534  C  CB    . PRO C  1 227 ? -22.574 6.428   -3.794  1.00 37.30  ? 199 PRO C CB    1 
ATOM   7535  C  CG    . PRO C  1 227 ? -23.039 7.851   -3.511  1.00 40.31  ? 199 PRO C CG    1 
ATOM   7536  C  CD    . PRO C  1 227 ? -22.529 8.657   -4.657  1.00 30.88  ? 199 PRO C CD    1 
ATOM   7537  N  N     . THR C  1 228 ? -21.642 6.199   -7.042  1.00 37.70  ? 200 THR C N     1 
ATOM   7538  C  CA    . THR C  1 228 ? -21.844 5.344   -8.210  1.00 30.49  ? 200 THR C CA    1 
ATOM   7539  C  C     . THR C  1 228 ? -20.895 5.709   -9.335  1.00 32.09  ? 200 THR C C     1 
ATOM   7540  O  O     . THR C  1 228 ? -20.936 5.126   -10.426 1.00 33.02  ? 200 THR C O     1 
ATOM   7541  C  CB    . THR C  1 228 ? -23.292 5.440   -8.726  1.00 37.19  ? 200 THR C CB    1 
ATOM   7542  O  OG1   . THR C  1 228 ? -23.654 6.822   -8.847  1.00 38.52  ? 200 THR C OG1   1 
ATOM   7543  C  CG2   . THR C  1 228 ? -24.268 4.767   -7.767  1.00 26.40  ? 200 THR C CG2   1 
ATOM   7544  N  N     . GLY C  1 229 ? -20.050 6.703   -9.075  1.00 36.18  ? 201 GLY C N     1 
ATOM   7545  C  CA    . GLY C  1 229 ? -19.166 7.240   -10.099 1.00 39.89  ? 201 GLY C CA    1 
ATOM   7546  C  C     . GLY C  1 229 ? -19.893 7.943   -11.235 1.00 32.04  ? 201 GLY C C     1 
ATOM   7547  O  O     . GLY C  1 229 ? -19.336 8.128   -12.315 1.00 35.69  ? 201 GLY C O     1 
ATOM   7548  N  N     . ALA C  1 230 ? -21.140 8.341   -10.994 1.00 31.15  ? 202 ALA C N     1 
ATOM   7549  C  CA    . ALA C  1 230 ? -21.941 8.972   -12.034 1.00 27.26  ? 202 ALA C CA    1 
ATOM   7550  C  C     . ALA C  1 230 ? -21.311 10.284  -12.518 1.00 32.45  ? 202 ALA C C     1 
ATOM   7551  O  O     . ALA C  1 230 ? -21.514 10.672  -13.665 1.00 27.88  ? 202 ALA C O     1 
ATOM   7552  C  CB    . ALA C  1 230 ? -23.364 9.205   -11.542 1.00 28.68  ? 202 ALA C CB    1 
ATOM   7553  N  N     . LEU C  1 231 ? -20.544 10.972  -11.664 1.00 31.06  ? 203 LEU C N     1 
ATOM   7554  C  CA    . LEU C  1 231 ? -19.771 12.110  -12.167 1.00 33.22  ? 203 LEU C CA    1 
ATOM   7555  C  C     . LEU C  1 231 ? -18.516 11.539  -12.813 1.00 36.20  ? 203 LEU C C     1 
ATOM   7556  O  O     . LEU C  1 231 ? -17.509 11.326  -12.136 1.00 35.50  ? 203 LEU C O     1 
ATOM   7557  C  CB    . LEU C  1 231 ? -19.426 13.125  -11.060 1.00 30.41  ? 203 LEU C CB    1 
ATOM   7558  C  CG    . LEU C  1 231 ? -20.610 13.896  -10.464 1.00 32.04  ? 203 LEU C CG    1 
ATOM   7559  C  CD1   . LEU C  1 231 ? -20.305 14.427  -9.046  1.00 29.99  ? 203 LEU C CD1   1 
ATOM   7560  C  CD2   . LEU C  1 231 ? -21.038 15.037  -11.393 1.00 31.77  ? 203 LEU C CD2   1 
ATOM   7561  N  N     . VAL C  1 232 ? -18.596 11.277  -14.121 1.00 35.56  ? 204 VAL C N     1 
ATOM   7562  C  CA    . VAL C  1 232 ? -17.553 10.546  -14.840 1.00 36.40  ? 204 VAL C CA    1 
ATOM   7563  C  C     . VAL C  1 232 ? -16.397 11.457  -15.259 1.00 39.52  ? 204 VAL C C     1 
ATOM   7564  O  O     . VAL C  1 232 ? -15.260 11.012  -15.407 1.00 36.17  ? 204 VAL C O     1 
ATOM   7565  C  CB    . VAL C  1 232 ? -18.138 9.815   -16.089 1.00 37.64  ? 204 VAL C CB    1 
ATOM   7566  C  CG1   . VAL C  1 232 ? -19.050 8.662   -15.657 1.00 32.91  ? 204 VAL C CG1   1 
ATOM   7567  C  CG2   . VAL C  1 232 ? -18.912 10.763  -16.978 1.00 32.19  ? 204 VAL C CG2   1 
ATOM   7568  N  N     . ASN C  1 233 ? -16.696 12.738  -15.439 1.00 36.87  ? 205 ASN C N     1 
ATOM   7569  C  CA    . ASN C  1 233 ? -15.671 13.759  -15.629 1.00 35.32  ? 205 ASN C CA    1 
ATOM   7570  C  C     . ASN C  1 233 ? -16.128 15.025  -14.898 1.00 40.22  ? 205 ASN C C     1 
ATOM   7571  O  O     . ASN C  1 233 ? -17.322 15.165  -14.595 1.00 33.23  ? 205 ASN C O     1 
ATOM   7572  C  CB    . ASN C  1 233 ? -15.426 14.060  -17.125 1.00 34.82  ? 205 ASN C CB    1 
ATOM   7573  C  CG    . ASN C  1 233 ? -14.686 12.924  -17.868 1.00 40.30  ? 205 ASN C CG    1 
ATOM   7574  O  OD1   . ASN C  1 233 ? -13.526 12.622  -17.591 1.00 37.33  ? 205 ASN C OD1   1 
ATOM   7575  N  ND2   . ASN C  1 233 ? -15.354 12.337  -18.849 1.00 35.65  ? 205 ASN C ND2   1 
ATOM   7576  N  N     . PRO C  1 234 ? -15.191 15.947  -14.610 1.00 40.97  ? 206 PRO C N     1 
ATOM   7577  C  CA    . PRO C  1 234 ? -15.579 17.259  -14.072 1.00 34.37  ? 206 PRO C CA    1 
ATOM   7578  C  C     . PRO C  1 234 ? -16.709 17.868  -14.884 1.00 32.80  ? 206 PRO C C     1 
ATOM   7579  O  O     . PRO C  1 234 ? -16.535 18.058  -16.080 1.00 34.20  ? 206 PRO C O     1 
ATOM   7580  C  CB    . PRO C  1 234 ? -14.302 18.090  -14.220 1.00 37.41  ? 206 PRO C CB    1 
ATOM   7581  C  CG    . PRO C  1 234 ? -13.196 17.075  -14.086 1.00 42.79  ? 206 PRO C CG    1 
ATOM   7582  C  CD    . PRO C  1 234 ? -13.726 15.817  -14.743 1.00 36.18  ? 206 PRO C CD    1 
ATOM   7583  N  N     . GLY C  1 235 ? -17.852 18.123  -14.256 1.00 33.20  ? 207 GLY C N     1 
ATOM   7584  C  CA    . GLY C  1 235 ? -18.970 18.765  -14.921 1.00 32.43  ? 207 GLY C CA    1 
ATOM   7585  C  C     . GLY C  1 235 ? -19.687 17.879  -15.921 1.00 31.31  ? 207 GLY C C     1 
ATOM   7586  O  O     . GLY C  1 235 ? -20.452 18.373  -16.751 1.00 32.44  ? 207 GLY C O     1 
ATOM   7587  N  N     . GLN C  1 236 ? -19.440 16.574  -15.858 1.00 31.60  ? 208 GLN C N     1 
ATOM   7588  C  CA    . GLN C  1 236 ? -20.113 15.642  -16.768 1.00 29.48  ? 208 GLN C CA    1 
ATOM   7589  C  C     . GLN C  1 236 ? -20.807 14.527  -15.991 1.00 30.18  ? 208 GLN C C     1 
ATOM   7590  O  O     . GLN C  1 236 ? -20.163 13.709  -15.333 1.00 27.52  ? 208 GLN C O     1 
ATOM   7591  C  CB    . GLN C  1 236 ? -19.123 15.054  -17.779 1.00 29.35  ? 208 GLN C CB    1 
ATOM   7592  C  CG    . GLN C  1 236 ? -19.779 14.169  -18.827 1.00 33.95  ? 208 GLN C CG    1 
ATOM   7593  C  CD    . GLN C  1 236 ? -18.794 13.599  -19.838 1.00 37.13  ? 208 GLN C CD    1 
ATOM   7594  O  OE1   . GLN C  1 236 ? -17.670 13.217  -19.500 1.00 37.25  ? 208 GLN C OE1   1 
ATOM   7595  N  NE2   . GLN C  1 236 ? -19.212 13.553  -21.087 1.00 30.39  ? 208 GLN C NE2   1 
ATOM   7596  N  N     . LEU C  1 237 ? -22.133 14.517  -16.056 1.00 31.36  ? 209 LEU C N     1 
ATOM   7597  C  CA    . LEU C  1 237 ? -22.905 13.501  -15.360 1.00 30.93  ? 209 LEU C CA    1 
ATOM   7598  C  C     . LEU C  1 237 ? -23.365 12.409  -16.329 1.00 31.75  ? 209 LEU C C     1 
ATOM   7599  O  O     . LEU C  1 237 ? -23.863 12.699  -17.434 1.00 24.67  ? 209 LEU C O     1 
ATOM   7600  C  CB    . LEU C  1 237 ? -24.125 14.118  -14.654 1.00 27.82  ? 209 LEU C CB    1 
ATOM   7601  C  CG    . LEU C  1 237 ? -24.833 13.105  -13.733 1.00 27.46  ? 209 LEU C CG    1 
ATOM   7602  C  CD1   . LEU C  1 237 ? -24.006 12.885  -12.489 1.00 21.19  ? 209 LEU C CD1   1 
ATOM   7603  C  CD2   . LEU C  1 237 ? -26.252 13.500  -13.382 1.00 23.46  ? 209 LEU C CD2   1 
ATOM   7604  N  N     . ASN C  1 238 ? -23.186 11.157  -15.909 1.00 30.13  ? 210 ASN C N     1 
ATOM   7605  C  CA    . ASN C  1 238 ? -23.912 10.053  -16.522 1.00 29.43  ? 210 ASN C CA    1 
ATOM   7606  C  C     . ASN C  1 238 ? -25.197 9.860   -15.753 1.00 27.89  ? 210 ASN C C     1 
ATOM   7607  O  O     . ASN C  1 238 ? -25.211 9.141   -14.763 1.00 31.98  ? 210 ASN C O     1 
ATOM   7608  C  CB    . ASN C  1 238 ? -23.095 8.764   -16.517 1.00 28.27  ? 210 ASN C CB    1 
ATOM   7609  C  CG    . ASN C  1 238 ? -23.848 7.583   -17.136 1.00 28.03  ? 210 ASN C CG    1 
ATOM   7610  O  OD1   . ASN C  1 238 ? -25.009 7.698   -17.541 1.00 27.54  ? 210 ASN C OD1   1 
ATOM   7611  N  ND2   . ASN C  1 238 ? -23.173 6.447   -17.225 1.00 25.96  ? 210 ASN C ND2   1 
ATOM   7612  N  N     . ALA C  1 239 ? -26.281 10.473  -16.217 1.00 25.06  ? 211 ALA C N     1 
ATOM   7613  C  CA    . ALA C  1 239 ? -27.525 10.475  -15.444 1.00 27.44  ? 211 ALA C CA    1 
ATOM   7614  C  C     . ALA C  1 239 ? -28.091 9.066   -15.167 1.00 29.62  ? 211 ALA C C     1 
ATOM   7615  O  O     . ALA C  1 239 ? -28.755 8.861   -14.150 1.00 28.07  ? 211 ALA C O     1 
ATOM   7616  C  CB    . ALA C  1 239 ? -28.570 11.337  -16.138 1.00 30.92  ? 211 ALA C CB    1 
ATOM   7617  N  N     . GLN C  1 240 ? -27.805 8.094   -16.042 1.00 27.70  ? 212 GLN C N     1 
ATOM   7618  C  CA    . GLN C  1 240 ? -28.346 6.752   -15.871 1.00 29.67  ? 212 GLN C CA    1 
ATOM   7619  C  C     . GLN C  1 240 ? -27.771 6.065   -14.636 1.00 33.45  ? 212 GLN C C     1 
ATOM   7620  O  O     . GLN C  1 240 ? -28.351 5.089   -14.151 1.00 31.64  ? 212 GLN C O     1 
ATOM   7621  C  CB    . GLN C  1 240 ? -28.078 5.879   -17.115 1.00 34.45  ? 212 GLN C CB    1 
ATOM   7622  C  CG    . GLN C  1 240 ? -28.788 6.356   -18.384 1.00 30.52  ? 212 GLN C CG    1 
ATOM   7623  C  CD    . GLN C  1 240 ? -30.302 6.408   -18.233 1.00 35.85  ? 212 GLN C CD    1 
ATOM   7624  O  OE1   . GLN C  1 240 ? -30.916 5.452   -17.757 1.00 39.19  ? 212 GLN C OE1   1 
ATOM   7625  N  NE2   . GLN C  1 240 ? -30.911 7.530   -18.625 1.00 34.46  ? 212 GLN C NE2   1 
ATOM   7626  N  N     . ARG C  1 241 ? -26.636 6.564   -14.134 1.00 29.32  ? 213 ARG C N     1 
ATOM   7627  C  CA    . ARG C  1 241 ? -26.006 5.983   -12.942 1.00 31.00  ? 213 ARG C CA    1 
ATOM   7628  C  C     . ARG C  1 241 ? -26.129 6.876   -11.709 1.00 31.35  ? 213 ARG C C     1 
ATOM   7629  O  O     . ARG C  1 241 ? -25.558 6.560   -10.661 1.00 30.22  ? 213 ARG C O     1 
ATOM   7630  C  CB    . ARG C  1 241 ? -24.517 5.687   -13.196 1.00 32.80  ? 213 ARG C CB    1 
ATOM   7631  C  CG    . ARG C  1 241 ? -24.213 4.758   -14.406 1.00 28.64  ? 213 ARG C CG    1 
ATOM   7632  C  CD    . ARG C  1 241 ? -22.712 4.449   -14.460 1.00 34.41  ? 213 ARG C CD    1 
ATOM   7633  N  NE    . ARG C  1 241 ? -22.229 4.048   -13.131 1.00 41.75  ? 213 ARG C NE    1 
ATOM   7634  C  CZ    . ARG C  1 241 ? -22.255 2.800   -12.669 1.00 38.53  ? 213 ARG C CZ    1 
ATOM   7635  N  NH1   . ARG C  1 241 ? -22.713 1.816   -13.439 1.00 37.14  ? 213 ARG C NH1   1 
ATOM   7636  N  NH2   . ARG C  1 241 ? -21.811 2.535   -11.443 1.00 39.62  ? 213 ARG C NH2   1 
ATOM   7637  N  N     . CYS C  1 242 ? -26.841 7.997   -11.838 1.00 29.58  ? 214 CYS C N     1 
ATOM   7638  C  CA    . CYS C  1 242 ? -26.993 8.945   -10.733 1.00 28.13  ? 214 CYS C CA    1 
ATOM   7639  C  C     . CYS C  1 242 ? -28.127 8.517   -9.843  1.00 26.03  ? 214 CYS C C     1 
ATOM   7640  O  O     . CYS C  1 242 ? -29.248 8.317   -10.310 1.00 24.64  ? 214 CYS C O     1 
ATOM   7641  C  CB    . CYS C  1 242 ? -27.239 10.387  -11.249 1.00 26.32  ? 214 CYS C CB    1 
ATOM   7642  S  SG    . CYS C  1 242 ? -27.564 11.674  -9.939  1.00 26.10  ? 214 CYS C SG    1 
ATOM   7643  N  N     . ILE C  1 243 ? -27.834 8.385   -8.552  1.00 30.29  ? 215 ILE C N     1 
ATOM   7644  C  CA    . ILE C  1 243 ? -28.834 7.980   -7.571  1.00 24.29  ? 215 ILE C CA    1 
ATOM   7645  C  C     . ILE C  1 243 ? -30.071 8.863   -7.591  1.00 28.76  ? 215 ILE C C     1 
ATOM   7646  O  O     . ILE C  1 243 ? -31.186 8.383   -7.393  1.00 28.22  ? 215 ILE C O     1 
ATOM   7647  C  CB    . ILE C  1 243 ? -28.224 7.991   -6.154  1.00 33.08  ? 215 ILE C CB    1 
ATOM   7648  C  CG1   . ILE C  1 243 ? -27.104 6.949   -6.076  1.00 33.96  ? 215 ILE C CG1   1 
ATOM   7649  C  CG2   . ILE C  1 243 ? -29.299 7.790   -5.071  1.00 28.63  ? 215 ILE C CG2   1 
ATOM   7650  C  CD1   . ILE C  1 243 ? -26.392 6.916   -4.751  1.00 38.68  ? 215 ILE C CD1   1 
ATOM   7651  N  N     . SER C  1 244 ? -29.884 10.165  -7.824  1.00 29.25  ? 216 SER C N     1 
ATOM   7652  C  CA    . SER C  1 244 ? -31.018 11.054  -7.851  1.00 27.55  ? 216 SER C CA    1 
ATOM   7653  C  C     . SER C  1 244 ? -31.964 10.653  -8.982  1.00 26.15  ? 216 SER C C     1 
ATOM   7654  O  O     . SER C  1 244 ? -33.177 10.572  -8.783  1.00 26.35  ? 216 SER C O     1 
ATOM   7655  C  CB    . SER C  1 244 ? -30.574 12.508  -8.013  1.00 27.13  ? 216 SER C CB    1 
ATOM   7656  O  OG    . SER C  1 244 ? -31.707 13.328  -8.122  1.00 27.07  ? 216 SER C OG    1 
ATOM   7657  N  N     . PHE C  1 245 ? -31.415 10.418  -10.169 1.00 28.85  ? 217 PHE C N     1 
ATOM   7658  C  CA    . PHE C  1 245 ? -32.226 9.874   -11.264 1.00 28.28  ? 217 PHE C CA    1 
ATOM   7659  C  C     . PHE C  1 245 ? -32.849 8.523   -10.878 1.00 25.98  ? 217 PHE C C     1 
ATOM   7660  O  O     . PHE C  1 245 ? -34.057 8.305   -11.039 1.00 26.11  ? 217 PHE C O     1 
ATOM   7661  C  CB    . PHE C  1 245 ? -31.408 9.679   -12.543 1.00 26.50  ? 217 PHE C CB    1 
ATOM   7662  C  CG    . PHE C  1 245 ? -32.120 8.842   -13.583 1.00 26.17  ? 217 PHE C CG    1 
ATOM   7663  C  CD1   . PHE C  1 245 ? -33.183 9.368   -14.302 1.00 26.20  ? 217 PHE C CD1   1 
ATOM   7664  C  CD2   . PHE C  1 245 ? -31.748 7.515   -13.815 1.00 27.25  ? 217 PHE C CD2   1 
ATOM   7665  C  CE1   . PHE C  1 245 ? -33.848 8.596   -15.258 1.00 29.86  ? 217 PHE C CE1   1 
ATOM   7666  C  CE2   . PHE C  1 245 ? -32.404 6.748   -14.778 1.00 27.23  ? 217 PHE C CE2   1 
ATOM   7667  C  CZ    . PHE C  1 245 ? -33.456 7.284   -15.486 1.00 26.74  ? 217 PHE C CZ    1 
ATOM   7668  N  N     . LEU C  1 246 ? -32.015 7.623   -10.388 1.00 26.44  ? 218 LEU C N     1 
ATOM   7669  C  CA    . LEU C  1 246 ? -32.457 6.250   -10.075 1.00 24.58  ? 218 LEU C CA    1 
ATOM   7670  C  C     . LEU C  1 246 ? -33.615 6.175   -9.063  1.00 27.41  ? 218 LEU C C     1 
ATOM   7671  O  O     . LEU C  1 246 ? -34.541 5.370   -9.224  1.00 25.31  ? 218 LEU C O     1 
ATOM   7672  C  CB    . LEU C  1 246 ? -31.271 5.448   -9.569  1.00 29.71  ? 218 LEU C CB    1 
ATOM   7673  C  CG    . LEU C  1 246 ? -30.210 5.217   -10.637 1.00 26.44  ? 218 LEU C CG    1 
ATOM   7674  C  CD1   . LEU C  1 246 ? -28.953 4.664   -10.014 1.00 26.70  ? 218 LEU C CD1   1 
ATOM   7675  C  CD2   . LEU C  1 246 ? -30.724 4.272   -11.733 1.00 34.00  ? 218 LEU C CD2   1 
ATOM   7676  N  N     . THR C  1 247 ? -33.598 7.027   -8.040  1.00 24.75  ? 219 THR C N     1 
ATOM   7677  C  CA    . THR C  1 247 ? -34.700 7.052   -7.082  1.00 23.19  ? 219 THR C CA    1 
ATOM   7678  C  C     . THR C  1 247 ? -36.027 7.450   -7.742  1.00 26.31  ? 219 THR C C     1 
ATOM   7679  O  O     . THR C  1 247 ? -37.085 7.154   -7.212  1.00 27.37  ? 219 THR C O     1 
ATOM   7680  C  CB    . THR C  1 247 ? -34.440 8.035   -5.900  1.00 26.59  ? 219 THR C CB    1 
ATOM   7681  O  OG1   . THR C  1 247 ? -34.354 9.378   -6.396  1.00 25.65  ? 219 THR C OG1   1 
ATOM   7682  C  CG2   . THR C  1 247 ? -33.165 7.690   -5.153  1.00 27.24  ? 219 THR C CG2   1 
ATOM   7683  N  N     . GLN C  1 248 ? -35.987 8.119   -8.896  1.00 25.28  ? 220 GLN C N     1 
ATOM   7684  C  CA    . GLN C  1 248 ? -37.235 8.539   -9.540  1.00 26.66  ? 220 GLN C CA    1 
ATOM   7685  C  C     . GLN C  1 248 ? -37.742 7.575   -10.623 1.00 25.29  ? 220 GLN C C     1 
ATOM   7686  O  O     . GLN C  1 248 ? -38.761 7.832   -11.246 1.00 34.57  ? 220 GLN C O     1 
ATOM   7687  C  CB    . GLN C  1 248 ? -37.073 9.948   -10.141 1.00 20.56  ? 220 GLN C CB    1 
ATOM   7688  C  CG    . GLN C  1 248 ? -36.605 10.940  -9.099  1.00 30.30  ? 220 GLN C CG    1 
ATOM   7689  C  CD    . GLN C  1 248 ? -36.304 12.315  -9.653  1.00 27.79  ? 220 GLN C CD    1 
ATOM   7690  O  OE1   . GLN C  1 248 ? -37.184 12.994  -10.196 1.00 29.15  ? 220 GLN C OE1   1 
ATOM   7691  N  NE2   . GLN C  1 248 ? -35.047 12.726  -9.533  1.00 24.85  ? 220 GLN C NE2   1 
ATOM   7692  N  N     . THR C  1 249 ? -37.056 6.473   -10.857 1.00 24.44  ? 221 THR C N     1 
ATOM   7693  C  CA    . THR C  1 249 ? -37.527 5.547   -11.893 1.00 32.50  ? 221 THR C CA    1 
ATOM   7694  C  C     . THR C  1 249 ? -38.722 4.727   -11.415 1.00 32.00  ? 221 THR C C     1 
ATOM   7695  O  O     . THR C  1 249 ? -38.881 4.487   -10.223 1.00 29.94  ? 221 THR C O     1 
ATOM   7696  C  CB    . THR C  1 249 ? -36.419 4.600   -12.335 1.00 32.16  ? 221 THR C CB    1 
ATOM   7697  O  OG1   . THR C  1 249 ? -35.968 3.839   -11.205 1.00 30.25  ? 221 THR C OG1   1 
ATOM   7698  C  CG2   . THR C  1 249 ? -35.265 5.401   -12.903 1.00 28.39  ? 221 THR C CG2   1 
ATOM   7699  N  N     . LYS C  1 250 ? -39.563 4.297   -12.349 1.00 29.55  ? 222 LYS C N     1 
ATOM   7700  C  CA    . LYS C  1 250 ? -40.790 3.606   -11.988 1.00 34.47  ? 222 LYS C CA    1 
ATOM   7701  C  C     . LYS C  1 250 ? -40.719 2.076   -12.131 1.00 32.95  ? 222 LYS C C     1 
ATOM   7702  O  O     . LYS C  1 250 ? -41.671 1.392   -11.790 1.00 35.36  ? 222 LYS C O     1 
ATOM   7703  C  CB    . LYS C  1 250 ? -41.952 4.136   -12.823 1.00 36.19  ? 222 LYS C CB    1 
ATOM   7704  C  CG    . LYS C  1 250 ? -42.334 5.571   -12.504 1.00 44.40  ? 222 LYS C CG    1 
ATOM   7705  C  CD    . LYS C  1 250 ? -43.657 5.954   -13.138 1.00 47.15  ? 222 LYS C CD    1 
ATOM   7706  C  CE    . LYS C  1 250 ? -44.127 7.294   -12.585 1.00 45.68  ? 222 LYS C CE    1 
ATOM   7707  N  NZ    . LYS C  1 250 ? -45.234 7.886   -13.374 1.00 52.45  ? 222 LYS C NZ    1 
ATOM   7708  N  N     . GLY C  1 251 ? -39.605 1.551   -12.624 1.00 32.48  ? 223 GLY C N     1 
ATOM   7709  C  CA    . GLY C  1 251 ? -39.457 0.116   -12.793 1.00 33.46  ? 223 GLY C CA    1 
ATOM   7710  C  C     . GLY C  1 251 ? -38.583 -0.489  -11.719 1.00 37.50  ? 223 GLY C C     1 
ATOM   7711  O  O     . GLY C  1 251 ? -38.472 0.078   -10.622 1.00 30.47  ? 223 GLY C O     1 
ATOM   7712  N  N     . PHE C  1 252 ? -37.987 -1.648  -12.016 1.00 30.41  ? 224 PHE C N     1 
ATOM   7713  C  CA    . PHE C  1 252 ? -37.056 -2.296  -11.097 1.00 32.38  ? 224 PHE C CA    1 
ATOM   7714  C  C     . PHE C  1 252 ? -35.722 -1.556  -11.074 1.00 30.49  ? 224 PHE C C     1 
ATOM   7715  O  O     . PHE C  1 252 ? -35.183 -1.202  -12.114 1.00 36.02  ? 224 PHE C O     1 
ATOM   7716  C  CB    . PHE C  1 252 ? -36.832 -3.770  -11.484 1.00 30.93  ? 224 PHE C CB    1 
ATOM   7717  C  CG    . PHE C  1 252 ? -38.039 -4.648  -11.262 1.00 31.21  ? 224 PHE C CG    1 
ATOM   7718  C  CD1   . PHE C  1 252 ? -38.968 -4.839  -12.271 1.00 28.42  ? 224 PHE C CD1   1 
ATOM   7719  C  CD2   . PHE C  1 252 ? -38.253 -5.262  -10.030 1.00 32.57  ? 224 PHE C CD2   1 
ATOM   7720  C  CE1   . PHE C  1 252 ? -40.095 -5.634  -12.061 1.00 35.88  ? 224 PHE C CE1   1 
ATOM   7721  C  CE2   . PHE C  1 252 ? -39.372 -6.071  -9.814  1.00 29.55  ? 224 PHE C CE2   1 
ATOM   7722  C  CZ    . PHE C  1 252 ? -40.293 -6.261  -10.831 1.00 31.65  ? 224 PHE C CZ    1 
ATOM   7723  N  N     . LEU C  1 253 ? -35.193 -1.299  -9.887  1.00 34.13  ? 225 LEU C N     1 
ATOM   7724  C  CA    . LEU C  1 253 ? -33.820 -0.814  -9.789  1.00 28.15  ? 225 LEU C CA    1 
ATOM   7725  C  C     . LEU C  1 253 ? -32.856 -1.932  -10.208 1.00 36.11  ? 225 LEU C C     1 
ATOM   7726  O  O     . LEU C  1 253 ? -32.920 -3.040  -9.656  1.00 34.73  ? 225 LEU C O     1 
ATOM   7727  C  CB    . LEU C  1 253 ? -33.512 -0.347  -8.367  1.00 27.09  ? 225 LEU C CB    1 
ATOM   7728  C  CG    . LEU C  1 253 ? -32.361 0.658   -8.230  1.00 33.46  ? 225 LEU C CG    1 
ATOM   7729  C  CD1   . LEU C  1 253 ? -32.680 1.941   -9.005  1.00 31.10  ? 225 LEU C CD1   1 
ATOM   7730  C  CD2   . LEU C  1 253 ? -32.134 0.980   -6.787  1.00 33.29  ? 225 LEU C CD2   1 
ATOM   7731  N  N     . PRO C  1 254 ? -31.979 -1.661  -11.193 1.00 34.29  ? 226 PRO C N     1 
ATOM   7732  C  CA    . PRO C  1 254 ? -30.895 -2.615  -11.481 1.00 29.83  ? 226 PRO C CA    1 
ATOM   7733  C  C     . PRO C  1 254 ? -30.148 -2.999  -10.204 1.00 32.61  ? 226 PRO C C     1 
ATOM   7734  O  O     . PRO C  1 254 ? -29.915 -2.135  -9.359  1.00 31.91  ? 226 PRO C O     1 
ATOM   7735  C  CB    . PRO C  1 254 ? -29.982 -1.840  -12.451 1.00 28.32  ? 226 PRO C CB    1 
ATOM   7736  C  CG    . PRO C  1 254 ? -30.928 -0.885  -13.156 1.00 32.92  ? 226 PRO C CG    1 
ATOM   7737  C  CD    . PRO C  1 254 ? -31.936 -0.478  -12.083 1.00 33.24  ? 226 PRO C CD    1 
ATOM   7738  N  N     . ASP C  1 255 ? -29.806 -4.277  -10.064 1.00 28.18  ? 227 ASP C N     1 
ATOM   7739  C  CA    . ASP C  1 255 ? -29.235 -4.813  -8.832  1.00 32.67  ? 227 ASP C CA    1 
ATOM   7740  C  C     . ASP C  1 255 ? -28.016 -4.043  -8.313  1.00 32.55  ? 227 ASP C C     1 
ATOM   7741  O  O     . ASP C  1 255 ? -27.866 -3.839  -7.116  1.00 31.32  ? 227 ASP C O     1 
ATOM   7742  C  CB    . ASP C  1 255 ? -28.856 -6.277  -9.037  1.00 35.79  ? 227 ASP C CB    1 
ATOM   7743  C  CG    . ASP C  1 255 ? -30.070 -7.186  -9.129  1.00 40.58  ? 227 ASP C CG    1 
ATOM   7744  O  OD1   . ASP C  1 255 ? -31.074 -6.783  -9.741  1.00 44.58  ? 227 ASP C OD1   1 
ATOM   7745  O  OD2   . ASP C  1 255 ? -30.030 -8.300  -8.577  1.00 42.10  ? 227 ASP C OD2   1 
ATOM   7746  N  N     . GLU C  1 256 ? -27.145 -3.602  -9.205  1.00 30.15  ? 228 GLU C N     1 
ATOM   7747  C  CA    . GLU C  1 256 ? -25.919 -2.961  -8.737  1.00 35.98  ? 228 GLU C CA    1 
ATOM   7748  C  C     . GLU C  1 256 ? -26.161 -1.690  -7.896  1.00 34.01  ? 228 GLU C C     1 
ATOM   7749  O  O     . GLU C  1 256 ? -25.300 -1.301  -7.119  1.00 34.96  ? 228 GLU C O     1 
ATOM   7750  C  CB    . GLU C  1 256 ? -25.022 -2.619  -9.914  1.00 34.15  ? 228 GLU C CB    1 
ATOM   7751  C  CG    . GLU C  1 256 ? -25.637 -1.608  -10.859 1.00 35.53  ? 228 GLU C CG    1 
ATOM   7752  C  CD    . GLU C  1 256 ? -24.650 -1.159  -11.905 1.00 41.30  ? 228 GLU C CD    1 
ATOM   7753  O  OE1   . GLU C  1 256 ? -25.029 -1.160  -13.102 1.00 44.97  ? 228 GLU C OE1   1 
ATOM   7754  O  OE2   . GLU C  1 256 ? -23.498 -0.819  -11.523 1.00 38.97  ? 228 GLU C OE2   1 
ATOM   7755  N  N     . PHE C  1 257 ? -27.331 -1.068  -8.029  1.00 30.19  ? 229 PHE C N     1 
ATOM   7756  C  CA    . PHE C  1 257 ? -27.623 0.171   -7.292  1.00 32.04  ? 229 PHE C CA    1 
ATOM   7757  C  C     . PHE C  1 257 ? -28.403 -0.081  -6.008  1.00 34.80  ? 229 PHE C C     1 
ATOM   7758  O  O     . PHE C  1 257 ? -28.554 0.818   -5.178  1.00 32.73  ? 229 PHE C O     1 
ATOM   7759  C  CB    . PHE C  1 257 ? -28.400 1.157   -8.178  1.00 29.78  ? 229 PHE C CB    1 
ATOM   7760  C  CG    . PHE C  1 257 ? -27.695 1.498   -9.473  1.00 28.54  ? 229 PHE C CG    1 
ATOM   7761  C  CD1   . PHE C  1 257 ? -26.394 1.978   -9.464  1.00 32.80  ? 229 PHE C CD1   1 
ATOM   7762  C  CD2   . PHE C  1 257 ? -28.322 1.309   -10.690 1.00 28.00  ? 229 PHE C CD2   1 
ATOM   7763  C  CE1   . PHE C  1 257 ? -25.736 2.295   -10.656 1.00 32.92  ? 229 PHE C CE1   1 
ATOM   7764  C  CE2   . PHE C  1 257 ? -27.672 1.619   -11.895 1.00 31.10  ? 229 PHE C CE2   1 
ATOM   7765  C  CZ    . PHE C  1 257 ? -26.379 2.112   -11.874 1.00 31.49  ? 229 PHE C CZ    1 
ATOM   7766  N  N     . ARG C  1 258 ? -28.878 -1.313  -5.837  1.00 34.43  ? 230 ARG C N     1 
ATOM   7767  C  CA    . ARG C  1 258 ? -29.720 -1.644  -4.704  1.00 33.94  ? 230 ARG C CA    1 
ATOM   7768  C  C     . ARG C  1 258 ? -28.969 -1.526  -3.389  1.00 35.17  ? 230 ARG C C     1 
ATOM   7769  O  O     . ARG C  1 258 ? -29.574 -1.345  -2.322  1.00 37.07  ? 230 ARG C O     1 
ATOM   7770  C  CB    . ARG C  1 258 ? -30.296 -3.041  -4.879  1.00 34.69  ? 230 ARG C CB    1 
ATOM   7771  C  CG    . ARG C  1 258 ? -31.294 -3.088  -6.012  1.00 33.32  ? 230 ARG C CG    1 
ATOM   7772  C  CD    . ARG C  1 258 ? -32.011 -4.419  -6.102  1.00 31.10  ? 230 ARG C CD    1 
ATOM   7773  N  NE    . ARG C  1 258 ? -32.783 -4.488  -7.337  1.00 34.05  ? 230 ARG C NE    1 
ATOM   7774  C  CZ    . ARG C  1 258 ? -33.637 -5.458  -7.639  1.00 34.06  ? 230 ARG C CZ    1 
ATOM   7775  N  NH1   . ARG C  1 258 ? -33.853 -6.444  -6.775  1.00 32.49  ? 230 ARG C NH1   1 
ATOM   7776  N  NH2   . ARG C  1 258 ? -34.281 -5.435  -8.797  1.00 31.83  ? 230 ARG C NH2   1 
ATOM   7777  N  N     . THR C  1 259 ? -27.647 -1.593  -3.467  1.00 31.84  ? 231 THR C N     1 
ATOM   7778  C  CA    . THR C  1 259 ? -26.835 -1.506  -2.267  1.00 36.77  ? 231 THR C CA    1 
ATOM   7779  C  C     . THR C  1 259 ? -26.207 -0.122  -2.091  1.00 42.25  ? 231 THR C C     1 
ATOM   7780  O  O     . THR C  1 259 ? -25.590 0.148   -1.066  1.00 46.20  ? 231 THR C O     1 
ATOM   7781  C  CB    . THR C  1 259 ? -25.729 -2.558  -2.285  1.00 37.21  ? 231 THR C CB    1 
ATOM   7782  O  OG1   . THR C  1 259 ? -25.077 -2.513  -3.561  1.00 44.57  ? 231 THR C OG1   1 
ATOM   7783  C  CG2   . THR C  1 259 ? -26.327 -3.953  -2.079  1.00 42.05  ? 231 THR C CG2   1 
ATOM   7784  N  N     . LYS C  1 260 ? -26.373 0.752   -3.083  1.00 35.13  ? 232 LYS C N     1 
ATOM   7785  C  CA    . LYS C  1 260 ? -25.746 2.069   -3.044  1.00 37.46  ? 232 LYS C CA    1 
ATOM   7786  C  C     . LYS C  1 260 ? -26.744 3.175   -2.665  1.00 38.45  ? 232 LYS C C     1 
ATOM   7787  O  O     . LYS C  1 260 ? -26.346 4.269   -2.288  1.00 39.29  ? 232 LYS C O     1 
ATOM   7788  C  CB    . LYS C  1 260 ? -25.097 2.391   -4.402  1.00 40.81  ? 232 LYS C CB    1 
ATOM   7789  C  CG    . LYS C  1 260 ? -24.004 1.413   -4.853  1.00 43.14  ? 232 LYS C CG    1 
ATOM   7790  C  CD    . LYS C  1 260 ? -22.575 1.933   -4.620  1.00 51.90  ? 232 LYS C CD    1 
ATOM   7791  C  CE    . LYS C  1 260 ? -22.261 2.225   -3.134  1.00 59.84  ? 232 LYS C CE    1 
ATOM   7792  N  NZ    . LYS C  1 260 ? -21.014 3.058   -2.917  1.00 57.92  ? 232 LYS C NZ    1 
ATOM   7793  N  N     . ILE C  1 261 ? -28.035 2.876   -2.755  1.00 33.86  ? 233 ILE C N     1 
ATOM   7794  C  CA    . ILE C  1 261 ? -29.075 3.873   -2.559  1.00 37.99  ? 233 ILE C CA    1 
ATOM   7795  C  C     . ILE C  1 261 ? -29.195 4.265   -1.079  1.00 39.40  ? 233 ILE C C     1 
ATOM   7796  O  O     . ILE C  1 261 ? -29.540 5.408   -0.761  1.00 32.10  ? 233 ILE C O     1 
ATOM   7797  C  CB    . ILE C  1 261 ? -30.428 3.357   -3.119  1.00 39.49  ? 233 ILE C CB    1 
ATOM   7798  C  CG1   . ILE C  1 261 ? -31.556 4.353   -2.892  1.00 37.44  ? 233 ILE C CG1   1 
ATOM   7799  C  CG2   . ILE C  1 261 ? -30.799 2.003   -2.521  1.00 39.23  ? 233 ILE C CG2   1 
ATOM   7800  C  CD1   . ILE C  1 261 ? -32.925 3.780   -3.282  1.00 43.31  ? 233 ILE C CD1   1 
ATOM   7801  N  N     . GLY C  1 262 ? -28.865 3.331   -0.182  1.00 33.19  ? 234 GLY C N     1 
ATOM   7802  C  CA    . GLY C  1 262 ? -28.870 3.593   1.251   1.00 27.90  ? 234 GLY C CA    1 
ATOM   7803  C  C     . GLY C  1 262 ? -30.281 3.813   1.765   1.00 33.17  ? 234 GLY C C     1 
ATOM   7804  O  O     . GLY C  1 262 ? -31.183 3.038   1.480   1.00 33.26  ? 234 GLY C O     1 
ATOM   7805  N  N     . ASN C  1 263 ? -30.500 4.878   2.520   1.00 31.39  ? 235 ASN C N     1 
ATOM   7806  C  CA    . ASN C  1 263 ? -31.858 5.144   2.967   1.00 32.50  ? 235 ASN C CA    1 
ATOM   7807  C  C     . ASN C  1 263 ? -32.487 6.336   2.234   1.00 32.08  ? 235 ASN C C     1 
ATOM   7808  O  O     . ASN C  1 263 ? -33.406 6.981   2.740   1.00 30.53  ? 235 ASN C O     1 
ATOM   7809  C  CB    . ASN C  1 263 ? -31.878 5.370   4.479   1.00 34.13  ? 235 ASN C CB    1 
ATOM   7810  C  CG    . ASN C  1 263 ? -31.307 6.718   4.872   1.00 36.59  ? 235 ASN C CG    1 
ATOM   7811  O  OD1   . ASN C  1 263 ? -30.363 7.214   4.257   1.00 37.86  ? 235 ASN C OD1   1 
ATOM   7812  N  ND2   . ASN C  1 263 ? -31.889 7.323   5.898   1.00 34.29  ? 235 ASN C ND2   1 
ATOM   7813  N  N     . ARG C  1 264 ? -32.004 6.619   1.029   1.00 27.93  ? 236 ARG C N     1 
ATOM   7814  C  CA    . ARG C  1 264 ? -32.578 7.717   0.257   1.00 27.26  ? 236 ARG C CA    1 
ATOM   7815  C  C     . ARG C  1 264 ? -33.903 7.289   -0.341  1.00 27.65  ? 236 ARG C C     1 
ATOM   7816  O  O     . ARG C  1 264 ? -34.008 6.216   -0.929  1.00 29.84  ? 236 ARG C O     1 
ATOM   7817  C  CB    . ARG C  1 264 ? -31.626 8.165   -0.839  1.00 24.49  ? 236 ARG C CB    1 
ATOM   7818  C  CG    . ARG C  1 264 ? -30.264 8.612   -0.335  1.00 26.13  ? 236 ARG C CG    1 
ATOM   7819  C  CD    . ARG C  1 264 ? -29.411 8.994   -1.534  1.00 30.05  ? 236 ARG C CD    1 
ATOM   7820  N  NE    . ARG C  1 264 ? -28.041 9.379   -1.210  1.00 27.51  ? 236 ARG C NE    1 
ATOM   7821  C  CZ    . ARG C  1 264 ? -27.027 8.536   -1.102  1.00 28.76  ? 236 ARG C CZ    1 
ATOM   7822  N  NH1   . ARG C  1 264 ? -27.220 7.217   -1.237  1.00 35.81  ? 236 ARG C NH1   1 
ATOM   7823  N  NH2   . ARG C  1 264 ? -25.819 9.007   -0.830  1.00 30.61  ? 236 ARG C NH2   1 
ATOM   7824  N  N     . LEU C  1 265 ? -34.926 8.108   -0.168  1.00 24.23  ? 237 LEU C N     1 
ATOM   7825  C  CA    . LEU C  1 265 ? -36.225 7.808   -0.767  1.00 27.00  ? 237 LEU C CA    1 
ATOM   7826  C  C     . LEU C  1 265 ? -36.447 8.582   -2.069  1.00 30.53  ? 237 LEU C C     1 
ATOM   7827  O  O     . LEU C  1 265 ? -37.294 8.206   -2.878  1.00 29.91  ? 237 LEU C O     1 
ATOM   7828  C  CB    . LEU C  1 265 ? -37.341 8.114   0.231   1.00 27.34  ? 237 LEU C CB    1 
ATOM   7829  C  CG    . LEU C  1 265 ? -37.327 7.270   1.517   1.00 26.03  ? 237 LEU C CG    1 
ATOM   7830  C  CD1   . LEU C  1 265 ? -38.359 7.782   2.485   1.00 22.37  ? 237 LEU C CD1   1 
ATOM   7831  C  CD2   . LEU C  1 265 ? -37.575 5.768   1.197   1.00 22.56  ? 237 LEU C CD2   1 
ATOM   7832  N  N     . TYR C  1 266 ? -35.685 9.663   -2.247  1.00 25.51  ? 238 TYR C N     1 
ATOM   7833  C  CA    . TYR C  1 266 ? -35.865 10.598  -3.362  1.00 28.00  ? 238 TYR C CA    1 
ATOM   7834  C  C     . TYR C  1 266 ? -34.718 11.605  -3.407  1.00 25.93  ? 238 TYR C C     1 
ATOM   7835  O  O     . TYR C  1 266 ? -34.456 12.324  -2.429  1.00 28.01  ? 238 TYR C O     1 
ATOM   7836  C  CB    . TYR C  1 266 ? -37.198 11.337  -3.253  1.00 24.65  ? 238 TYR C CB    1 
ATOM   7837  C  CG    . TYR C  1 266 ? -37.448 12.278  -4.404  1.00 24.91  ? 238 TYR C CG    1 
ATOM   7838  C  CD1   . TYR C  1 266 ? -38.058 11.830  -5.563  1.00 22.03  ? 238 TYR C CD1   1 
ATOM   7839  C  CD2   . TYR C  1 266 ? -37.058 13.626  -4.338  1.00 26.24  ? 238 TYR C CD2   1 
ATOM   7840  C  CE1   . TYR C  1 266 ? -38.285 12.684  -6.637  1.00 26.30  ? 238 TYR C CE1   1 
ATOM   7841  C  CE2   . TYR C  1 266 ? -37.270 14.499  -5.416  1.00 28.09  ? 238 TYR C CE2   1 
ATOM   7842  C  CZ    . TYR C  1 266 ? -37.888 14.016  -6.561  1.00 29.35  ? 238 TYR C CZ    1 
ATOM   7843  O  OH    . TYR C  1 266 ? -38.115 14.849  -7.624  1.00 25.17  ? 238 TYR C OH    1 
ATOM   7844  N  N     . GLY C  1 267 ? -34.034 11.643  -4.539  1.00 24.64  ? 239 GLY C N     1 
ATOM   7845  C  CA    . GLY C  1 267 ? -32.926 12.556  -4.724  1.00 24.97  ? 239 GLY C CA    1 
ATOM   7846  C  C     . GLY C  1 267 ? -31.690 12.089  -3.997  1.00 27.68  ? 239 GLY C C     1 
ATOM   7847  O  O     . GLY C  1 267 ? -31.713 11.111  -3.232  1.00 24.17  ? 239 GLY C O     1 
ATOM   7848  N  N     . CYS C  1 268 ? -30.596 12.788  -4.259  1.00 25.12  ? 240 CYS C N     1 
ATOM   7849  C  CA    . CYS C  1 268 ? -29.324 12.510  -3.597  1.00 28.50  ? 240 CYS C CA    1 
ATOM   7850  C  C     . CYS C  1 268 ? -28.560 13.830  -3.445  1.00 29.48  ? 240 CYS C C     1 
ATOM   7851  O  O     . CYS C  1 268 ? -28.456 14.601  -4.411  1.00 28.21  ? 240 CYS C O     1 
ATOM   7852  C  CB    . CYS C  1 268 ? -28.513 11.476  -4.385  1.00 24.40  ? 240 CYS C CB    1 
ATOM   7853  S  SG    . CYS C  1 268 ? -26.793 11.268  -3.860  1.00 29.89  ? 240 CYS C SG    1 
ATOM   7854  N  N     . ASP C  1 269 ? -28.039 14.093  -2.246  1.00 29.87  ? 241 ASP C N     1 
ATOM   7855  C  CA    . ASP C  1 269 ? -27.384 15.387  -1.950  1.00 30.48  ? 241 ASP C CA    1 
ATOM   7856  C  C     . ASP C  1 269 ? -25.880 15.266  -1.736  1.00 32.12  ? 241 ASP C C     1 
ATOM   7857  O  O     . ASP C  1 269 ? -25.225 16.247  -1.391  1.00 29.25  ? 241 ASP C O     1 
ATOM   7858  C  CB    . ASP C  1 269 ? -27.991 16.034  -0.703  1.00 26.71  ? 241 ASP C CB    1 
ATOM   7859  C  CG    . ASP C  1 269 ? -29.379 16.582  -0.945  1.00 28.53  ? 241 ASP C CG    1 
ATOM   7860  O  OD1   . ASP C  1 269 ? -29.646 16.986  -2.095  1.00 29.32  ? 241 ASP C OD1   1 
ATOM   7861  O  OD2   . ASP C  1 269 ? -30.200 16.617  0.009   1.00 30.85  ? 241 ASP C OD2   1 
ATOM   7862  N  N     . THR C  1 270 ? -25.338 14.066  -1.938  1.00 30.36  ? 242 THR C N     1 
ATOM   7863  C  CA    . THR C  1 270 ? -23.953 13.779  -1.571  1.00 31.02  ? 242 THR C CA    1 
ATOM   7864  C  C     . THR C  1 270 ? -22.919 14.668  -2.290  1.00 34.64  ? 242 THR C C     1 
ATOM   7865  O  O     . THR C  1 270 ? -22.022 15.189  -1.636  1.00 35.52  ? 242 THR C O     1 
ATOM   7866  C  CB    . THR C  1 270 ? -23.631 12.292  -1.809  1.00 31.40  ? 242 THR C CB    1 
ATOM   7867  O  OG1   . THR C  1 270 ? -24.498 11.502  -0.991  1.00 35.10  ? 242 THR C OG1   1 
ATOM   7868  C  CG2   . THR C  1 270 ? -22.182 11.962  -1.445  1.00 25.25  ? 242 THR C CG2   1 
ATOM   7869  N  N     . CYS C  1 271 ? -23.024 14.877  -3.602  1.00 25.52  ? 243 CYS C N     1 
ATOM   7870  C  CA    . CYS C  1 271 ? -22.032 15.757  -4.237  1.00 27.23  ? 243 CYS C CA    1 
ATOM   7871  C  C     . CYS C  1 271 ? -22.153 17.227  -3.802  1.00 30.73  ? 243 CYS C C     1 
ATOM   7872  O  O     . CYS C  1 271 ? -21.290 18.029  -4.132  1.00 31.62  ? 243 CYS C O     1 
ATOM   7873  C  CB    . CYS C  1 271 ? -22.114 15.691  -5.756  1.00 27.01  ? 243 CYS C CB    1 
ATOM   7874  S  SG    . CYS C  1 271 ? -23.783 15.828  -6.383  1.00 28.26  ? 243 CYS C SG    1 
ATOM   7875  N  N     . GLN C  1 272 ? -23.204 17.576  -3.067  1.00 30.13  ? 244 GLN C N     1 
ATOM   7876  C  CA    . GLN C  1 272 ? -23.300 18.915  -2.493  1.00 33.08  ? 244 GLN C CA    1 
ATOM   7877  C  C     . GLN C  1 272 ? -22.854 18.998  -1.039  1.00 32.19  ? 244 GLN C C     1 
ATOM   7878  O  O     . GLN C  1 272 ? -22.235 19.985  -0.652  1.00 34.79  ? 244 GLN C O     1 
ATOM   7879  C  CB    . GLN C  1 272 ? -24.724 19.448  -2.596  1.00 33.44  ? 244 GLN C CB    1 
ATOM   7880  C  CG    . GLN C  1 272 ? -25.217 19.584  -4.008  1.00 30.21  ? 244 GLN C CG    1 
ATOM   7881  C  CD    . GLN C  1 272 ? -26.593 20.190  -4.058  1.00 32.99  ? 244 GLN C CD    1 
ATOM   7882  O  OE1   . GLN C  1 272 ? -26.756 21.421  -4.036  1.00 31.32  ? 244 GLN C OE1   1 
ATOM   7883  N  NE2   . GLN C  1 272 ? -27.601 19.333  -4.102  1.00 26.91  ? 244 GLN C NE2   1 
ATOM   7884  N  N     . THR C  1 273 ? -23.176 17.993  -0.222  1.00 31.82  ? 245 THR C N     1 
ATOM   7885  C  CA    . THR C  1 273 ? -22.844 18.090  1.199   1.00 35.03  ? 245 THR C CA    1 
ATOM   7886  C  C     . THR C  1 273 ? -21.340 17.945  1.419   1.00 37.17  ? 245 THR C C     1 
ATOM   7887  O  O     . THR C  1 273 ? -20.829 18.432  2.420   1.00 36.10  ? 245 THR C O     1 
ATOM   7888  C  CB    . THR C  1 273 ? -23.584 17.045  2.063   1.00 36.68  ? 245 THR C CB    1 
ATOM   7889  O  OG1   . THR C  1 273 ? -23.316 15.724  1.566   1.00 39.22  ? 245 THR C OG1   1 
ATOM   7890  C  CG2   . THR C  1 273 ? -25.091 17.314  2.060   1.00 35.66  ? 245 THR C CG2   1 
ATOM   7891  N  N     . VAL C  1 274 ? -20.635 17.303  0.483   1.00 31.39  ? 246 VAL C N     1 
ATOM   7892  C  CA    . VAL C  1 274 ? -19.178 17.143  0.589   1.00 34.20  ? 246 VAL C CA    1 
ATOM   7893  C  C     . VAL C  1 274 ? -18.420 18.342  0.012   1.00 37.88  ? 246 VAL C C     1 
ATOM   7894  O  O     . VAL C  1 274 ? -17.186 18.381  0.039   1.00 36.64  ? 246 VAL C O     1 
ATOM   7895  C  CB    . VAL C  1 274 ? -18.660 15.876  -0.155  1.00 36.00  ? 246 VAL C CB    1 
ATOM   7896  C  CG1   . VAL C  1 274 ? -19.315 14.572  0.382   1.00 33.43  ? 246 VAL C CG1   1 
ATOM   7897  C  CG2   . VAL C  1 274 ? -18.856 16.031  -1.648  1.00 33.02  ? 246 VAL C CG2   1 
ATOM   7898  N  N     . CYS C  1 275 ? -19.157 19.308  -0.529  1.00 30.40  ? 247 CYS C N     1 
ATOM   7899  C  CA    . CYS C  1 275 ? -18.531 20.416  -1.228  1.00 31.91  ? 247 CYS C CA    1 
ATOM   7900  C  C     . CYS C  1 275 ? -18.176 21.547  -0.270  1.00 34.44  ? 247 CYS C C     1 
ATOM   7901  O  O     . CYS C  1 275 ? -19.059 22.129  0.357   1.00 36.23  ? 247 CYS C O     1 
ATOM   7902  C  CB    . CYS C  1 275 ? -19.459 20.919  -2.328  1.00 36.65  ? 247 CYS C CB    1 
ATOM   7903  S  SG    . CYS C  1 275 ? -18.841 22.344  -3.237  1.00 34.09  ? 247 CYS C SG    1 
ATOM   7904  N  N     . PRO C  1 276 ? -16.877 21.857  -0.153  1.00 34.18  ? 248 PRO C N     1 
ATOM   7905  C  CA    . PRO C  1 276 ? -16.340 22.952  0.673   1.00 32.17  ? 248 PRO C CA    1 
ATOM   7906  C  C     . PRO C  1 276 ? -17.049 24.289  0.436   1.00 40.51  ? 248 PRO C C     1 
ATOM   7907  O  O     . PRO C  1 276 ? -17.233 25.091  1.361   1.00 40.77  ? 248 PRO C O     1 
ATOM   7908  C  CB    . PRO C  1 276 ? -14.877 23.034  0.229   1.00 35.33  ? 248 PRO C CB    1 
ATOM   7909  C  CG    . PRO C  1 276 ? -14.557 21.645  -0.225  1.00 40.14  ? 248 PRO C CG    1 
ATOM   7910  C  CD    . PRO C  1 276 ? -15.813 21.129  -0.868  1.00 33.57  ? 248 PRO C CD    1 
ATOM   7911  N  N     . LEU C  1 277 ? -17.458 24.520  -0.802  1.00 37.60  ? 249 LEU C N     1 
ATOM   7912  C  CA    . LEU C  1 277 ? -18.166 25.740  -1.153  1.00 35.12  ? 249 LEU C CA    1 
ATOM   7913  C  C     . LEU C  1 277 ? -19.581 25.783  -0.563  1.00 39.45  ? 249 LEU C C     1 
ATOM   7914  O  O     . LEU C  1 277 ? -20.248 26.813  -0.630  1.00 37.66  ? 249 LEU C O     1 
ATOM   7915  C  CB    . LEU C  1 277 ? -18.221 25.879  -2.669  1.00 36.55  ? 249 LEU C CB    1 
ATOM   7916  C  CG    . LEU C  1 277 ? -16.873 26.068  -3.367  1.00 42.53  ? 249 LEU C CG    1 
ATOM   7917  C  CD1   . LEU C  1 277 ? -17.085 26.222  -4.872  1.00 37.72  ? 249 LEU C CD1   1 
ATOM   7918  C  CD2   . LEU C  1 277 ? -16.129 27.284  -2.798  1.00 40.58  ? 249 LEU C CD2   1 
ATOM   7919  N  N     . ASN C  1 278 ? -20.037 24.664  0.001   1.00 34.37  ? 250 ASN C N     1 
ATOM   7920  C  CA    . ASN C  1 278 ? -21.315 24.622  0.722   1.00 38.99  ? 250 ASN C CA    1 
ATOM   7921  C  C     . ASN C  1 278 ? -21.151 24.598  2.228   1.00 36.50  ? 250 ASN C C     1 
ATOM   7922  O  O     . ASN C  1 278 ? -22.138 24.522  2.961   1.00 37.52  ? 250 ASN C O     1 
ATOM   7923  C  CB    . ASN C  1 278 ? -22.140 23.401  0.301   1.00 31.30  ? 250 ASN C CB    1 
ATOM   7924  C  CG    . ASN C  1 278 ? -22.807 23.596  -1.040  1.00 36.23  ? 250 ASN C CG    1 
ATOM   7925  O  OD1   . ASN C  1 278 ? -23.159 24.726  -1.426  1.00 30.29  ? 250 ASN C OD1   1 
ATOM   7926  N  ND2   . ASN C  1 278 ? -22.964 22.500  -1.778  1.00 30.77  ? 250 ASN C ND2   1 
ATOM   7927  N  N     . LYS C  1 279 ? -19.903 24.627  2.682   1.00 37.65  ? 251 LYS C N     1 
ATOM   7928  C  CA    . LYS C  1 279 ? -19.605 24.584  4.105   1.00 45.73  ? 251 LYS C CA    1 
ATOM   7929  C  C     . LYS C  1 279 ? -20.297 25.743  4.826   1.00 44.02  ? 251 LYS C C     1 
ATOM   7930  O  O     . LYS C  1 279 ? -20.114 26.901  4.457   1.00 41.94  ? 251 LYS C O     1 
ATOM   7931  C  CB    . LYS C  1 279 ? -18.090 24.642  4.336   1.00 47.66  ? 251 LYS C CB    1 
ATOM   7932  C  CG    . LYS C  1 279 ? -17.627 23.964  5.632   1.00 51.80  ? 251 LYS C CG    1 
ATOM   7933  C  CD    . LYS C  1 279 ? -16.106 23.851  5.673   1.00 56.50  ? 251 LYS C CD    1 
ATOM   7934  C  CE    . LYS C  1 279 ? -15.651 22.530  6.302   1.00 63.85  ? 251 LYS C CE    1 
ATOM   7935  N  NZ    . LYS C  1 279 ? -15.882 22.442  7.779   1.00 51.76  ? 251 LYS C NZ    1 
ATOM   7936  N  N     . GLY C  1 280 ? -21.114 25.420  5.825   1.00 48.85  ? 252 GLY C N     1 
ATOM   7937  C  CA    . GLY C  1 280 ? -21.783 26.432  6.631   1.00 50.66  ? 252 GLY C CA    1 
ATOM   7938  C  C     . GLY C  1 280 ? -22.847 27.228  5.893   1.00 54.50  ? 252 GLY C C     1 
ATOM   7939  O  O     . GLY C  1 280 ? -23.288 28.282  6.368   1.00 55.19  ? 252 GLY C O     1 
ATOM   7940  N  N     . LYS C  1 281 ? -23.250 26.749  4.719   1.00 44.66  ? 253 LYS C N     1 
ATOM   7941  C  CA    . LYS C  1 281 ? -24.351 27.379  4.002   1.00 41.52  ? 253 LYS C CA    1 
ATOM   7942  C  C     . LYS C  1 281 ? -25.636 26.703  4.453   1.00 45.79  ? 253 LYS C C     1 
ATOM   7943  O  O     . LYS C  1 281 ? -25.909 25.554  4.080   1.00 43.03  ? 253 LYS C O     1 
ATOM   7944  C  CB    . LYS C  1 281 ? -24.187 27.258  2.485   1.00 38.82  ? 253 LYS C CB    1 
ATOM   7945  C  CG    . LYS C  1 281 ? -23.496 28.429  1.800   1.00 42.19  ? 253 LYS C CG    1 
ATOM   7946  C  CD    . LYS C  1 281 ? -22.061 28.585  2.246   1.00 45.41  ? 253 LYS C CD    1 
ATOM   7947  C  CE    . LYS C  1 281 ? -21.283 29.438  1.268   1.00 37.31  ? 253 LYS C CE    1 
ATOM   7948  N  NZ    . LYS C  1 281 ? -21.998 30.709  0.964   1.00 46.09  ? 253 LYS C NZ    1 
ATOM   7949  N  N     . ASP C  1 282 ? -26.417 27.407  5.264   1.00 38.05  ? 254 ASP C N     1 
ATOM   7950  C  CA    . ASP C  1 282 ? -27.699 26.884  5.717   1.00 39.75  ? 254 ASP C CA    1 
ATOM   7951  C  C     . ASP C  1 282 ? -28.701 28.018  5.839   1.00 39.38  ? 254 ASP C C     1 
ATOM   7952  O  O     . ASP C  1 282 ? -28.908 28.563  6.926   1.00 37.29  ? 254 ASP C O     1 
ATOM   7953  C  CB    . ASP C  1 282 ? -27.549 26.150  7.047   1.00 37.38  ? 254 ASP C CB    1 
ATOM   7954  C  CG    . ASP C  1 282 ? -28.869 25.583  7.554   1.00 44.06  ? 254 ASP C CG    1 
ATOM   7955  O  OD1   . ASP C  1 282 ? -29.762 25.287  6.726   1.00 37.53  ? 254 ASP C OD1   1 
ATOM   7956  O  OD2   . ASP C  1 282 ? -29.013 25.435  8.790   1.00 43.23  ? 254 ASP C OD2   1 
ATOM   7957  N  N     . PHE C  1 283 ? -29.315 28.378  4.716   1.00 33.00  ? 255 PHE C N     1 
ATOM   7958  C  CA    . PHE C  1 283 ? -30.197 29.528  4.688   1.00 39.03  ? 255 PHE C CA    1 
ATOM   7959  C  C     . PHE C  1 283 ? -31.658 29.133  4.927   1.00 40.30  ? 255 PHE C C     1 
ATOM   7960  O  O     . PHE C  1 283 ? -32.173 28.198  4.301   1.00 34.37  ? 255 PHE C O     1 
ATOM   7961  C  CB    . PHE C  1 283 ? -30.042 30.281  3.358   1.00 36.05  ? 255 PHE C CB    1 
ATOM   7962  C  CG    . PHE C  1 283 ? -28.708 30.964  3.210   1.00 37.01  ? 255 PHE C CG    1 
ATOM   7963  C  CD1   . PHE C  1 283 ? -28.574 32.327  3.485   1.00 38.22  ? 255 PHE C CD1   1 
ATOM   7964  C  CD2   . PHE C  1 283 ? -27.588 30.243  2.826   1.00 34.53  ? 255 PHE C CD2   1 
ATOM   7965  C  CE1   . PHE C  1 283 ? -27.341 32.960  3.361   1.00 40.86  ? 255 PHE C CE1   1 
ATOM   7966  C  CE2   . PHE C  1 283 ? -26.361 30.858  2.694   1.00 39.24  ? 255 PHE C CE2   1 
ATOM   7967  C  CZ    . PHE C  1 283 ? -26.229 32.224  2.962   1.00 41.37  ? 255 PHE C CZ    1 
ATOM   7968  N  N     . HIS C  1 284 ? -32.297 29.855  5.848   1.00 29.69  ? 256 HIS C N     1 
ATOM   7969  C  CA    . HIS C  1 284 ? -33.728 29.755  6.101   1.00 32.44  ? 256 HIS C CA    1 
ATOM   7970  C  C     . HIS C  1 284 ? -34.420 31.087  5.853   1.00 36.00  ? 256 HIS C C     1 
ATOM   7971  O  O     . HIS C  1 284 ? -34.850 31.764  6.794   1.00 35.70  ? 256 HIS C O     1 
ATOM   7972  C  CB    . HIS C  1 284 ? -33.969 29.281  7.528   1.00 35.00  ? 256 HIS C CB    1 
ATOM   7973  C  CG    . HIS C  1 284 ? -33.380 27.933  7.800   1.00 42.39  ? 256 HIS C CG    1 
ATOM   7974  N  ND1   . HIS C  1 284 ? -34.146 26.792  7.919   1.00 42.45  ? 256 HIS C ND1   1 
ATOM   7975  C  CD2   . HIS C  1 284 ? -32.093 27.537  7.935   1.00 40.82  ? 256 HIS C CD2   1 
ATOM   7976  C  CE1   . HIS C  1 284 ? -33.359 25.755  8.135   1.00 40.90  ? 256 HIS C CE1   1 
ATOM   7977  N  NE2   . HIS C  1 284 ? -32.108 26.179  8.142   1.00 41.82  ? 256 HIS C NE2   1 
ATOM   7978  N  N     . LEU C  1 285 ? -34.533 31.446  4.573   1.00 29.53  ? 257 LEU C N     1 
ATOM   7979  C  CA    . LEU C  1 285 ? -35.057 32.736  4.163   1.00 30.45  ? 257 LEU C CA    1 
ATOM   7980  C  C     . LEU C  1 285 ? -36.507 32.674  3.698   1.00 31.65  ? 257 LEU C C     1 
ATOM   7981  O  O     . LEU C  1 285 ? -37.120 33.715  3.476   1.00 30.78  ? 257 LEU C O     1 
ATOM   7982  C  CB    . LEU C  1 285 ? -34.190 33.318  3.047   1.00 27.80  ? 257 LEU C CB    1 
ATOM   7983  C  CG    . LEU C  1 285 ? -32.750 33.614  3.469   1.00 36.79  ? 257 LEU C CG    1 
ATOM   7984  C  CD1   . LEU C  1 285 ? -31.835 33.691  2.262   1.00 31.02  ? 257 LEU C CD1   1 
ATOM   7985  C  CD2   . LEU C  1 285 ? -32.681 34.920  4.304   1.00 32.71  ? 257 LEU C CD2   1 
ATOM   7986  N  N     . HIS C  1 286 ? -37.042 31.458  3.558   1.00 26.42  ? 258 HIS C N     1 
ATOM   7987  C  CA    . HIS C  1 286 ? -38.389 31.239  3.021   1.00 26.60  ? 258 HIS C CA    1 
ATOM   7988  C  C     . HIS C  1 286 ? -39.153 30.225  3.879   1.00 31.20  ? 258 HIS C C     1 
ATOM   7989  O  O     . HIS C  1 286 ? -38.906 29.026  3.755   1.00 27.25  ? 258 HIS C O     1 
ATOM   7990  C  CB    . HIS C  1 286 ? -38.290 30.756  1.558   1.00 26.08  ? 258 HIS C CB    1 
ATOM   7991  C  CG    . HIS C  1 286 ? -37.316 31.560  0.755   1.00 31.79  ? 258 HIS C CG    1 
ATOM   7992  N  ND1   . HIS C  1 286 ? -37.603 32.834  0.314   1.00 27.94  ? 258 HIS C ND1   1 
ATOM   7993  C  CD2   . HIS C  1 286 ? -36.032 31.317  0.397   1.00 28.12  ? 258 HIS C CD2   1 
ATOM   7994  C  CE1   . HIS C  1 286 ? -36.546 33.334  -0.301  1.00 31.37  ? 258 HIS C CE1   1 
ATOM   7995  N  NE2   . HIS C  1 286 ? -35.576 32.438  -0.259  1.00 28.36  ? 258 HIS C NE2   1 
ATOM   7996  N  N     . PRO C  1 287 ? -40.078 30.701  4.746   1.00 28.22  ? 259 PRO C N     1 
ATOM   7997  C  CA    . PRO C  1 287 ? -40.797 29.822  5.694   1.00 28.46  ? 259 PRO C CA    1 
ATOM   7998  C  C     . PRO C  1 287 ? -41.411 28.580  5.054   1.00 27.74  ? 259 PRO C C     1 
ATOM   7999  O  O     . PRO C  1 287 ? -41.429 27.528  5.695   1.00 31.16  ? 259 PRO C O     1 
ATOM   8000  C  CB    . PRO C  1 287 ? -41.898 30.739  6.251   1.00 27.06  ? 259 PRO C CB    1 
ATOM   8001  C  CG    . PRO C  1 287 ? -41.270 32.106  6.190   1.00 31.50  ? 259 PRO C CG    1 
ATOM   8002  C  CD    . PRO C  1 287 ? -40.469 32.115  4.912   1.00 26.60  ? 259 PRO C CD    1 
ATOM   8003  N  N     . GLU C  1 288 ? -41.884 28.679  3.812   1.00 24.41  ? 260 GLU C N     1 
ATOM   8004  C  CA    . GLU C  1 288 ? -42.634 27.555  3.221   1.00 29.30  ? 260 GLU C CA    1 
ATOM   8005  C  C     . GLU C  1 288 ? -41.698 26.441  2.753   1.00 26.02  ? 260 GLU C C     1 
ATOM   8006  O  O     . GLU C  1 288 ? -42.128 25.327  2.485   1.00 31.83  ? 260 GLU C O     1 
ATOM   8007  C  CB    . GLU C  1 288 ? -43.532 28.045  2.066   1.00 34.64  ? 260 GLU C CB    1 
ATOM   8008  C  CG    . GLU C  1 288 ? -42.835 28.360  0.749   1.00 26.03  ? 260 GLU C CG    1 
ATOM   8009  C  CD    . GLU C  1 288 ? -42.436 29.823  0.598   1.00 31.62  ? 260 GLU C CD    1 
ATOM   8010  O  OE1   . GLU C  1 288 ? -41.880 30.374  1.557   1.00 30.62  ? 260 GLU C OE1   1 
ATOM   8011  O  OE2   . GLU C  1 288 ? -42.669 30.417  -0.484  1.00 27.88  ? 260 GLU C OE2   1 
ATOM   8012  N  N     . MET C  1 289 ? -40.407 26.752  2.696   1.00 27.84  ? 261 MET C N     1 
ATOM   8013  C  CA    . MET C  1 289 ? -39.382 25.795  2.335   1.00 30.47  ? 261 MET C CA    1 
ATOM   8014  C  C     . MET C  1 289 ? -38.883 24.935  3.497   1.00 35.25  ? 261 MET C C     1 
ATOM   8015  O  O     . MET C  1 289 ? -38.110 23.996  3.275   1.00 31.32  ? 261 MET C O     1 
ATOM   8016  C  CB    . MET C  1 289 ? -38.189 26.513  1.726   1.00 29.24  ? 261 MET C CB    1 
ATOM   8017  C  CG    . MET C  1 289 ? -38.465 27.212  0.395   1.00 25.07  ? 261 MET C CG    1 
ATOM   8018  S  SD    . MET C  1 289 ? -36.886 27.779  -0.214  1.00 27.98  ? 261 MET C SD    1 
ATOM   8019  C  CE    . MET C  1 289 ? -37.386 28.543  -1.760  1.00 23.58  ? 261 MET C CE    1 
ATOM   8020  N  N     . GLU C  1 290 ? -39.281 25.278  4.721   1.00 29.37  ? 262 GLU C N     1 
ATOM   8021  C  CA    . GLU C  1 290 ? -38.859 24.526  5.898   1.00 33.80  ? 262 GLU C CA    1 
ATOM   8022  C  C     . GLU C  1 290 ? -39.381 23.101  5.817   1.00 26.78  ? 262 GLU C C     1 
ATOM   8023  O  O     . GLU C  1 290 ? -40.566 22.884  5.584   1.00 30.00  ? 262 GLU C O     1 
ATOM   8024  C  CB    . GLU C  1 290 ? -39.346 25.193  7.193   1.00 30.78  ? 262 GLU C CB    1 
ATOM   8025  C  CG    . GLU C  1 290 ? -38.657 26.513  7.507   1.00 32.60  ? 262 GLU C CG    1 
ATOM   8026  C  CD    . GLU C  1 290 ? -37.162 26.351  7.676   1.00 39.49  ? 262 GLU C CD    1 
ATOM   8027  O  OE1   . GLU C  1 290 ? -36.740 25.472  8.457   1.00 49.96  ? 262 GLU C OE1   1 
ATOM   8028  O  OE2   . GLU C  1 290 ? -36.401 27.091  7.013   1.00 42.03  ? 262 GLU C OE2   1 
ATOM   8029  N  N     . PRO C  1 291 ? -38.489 22.127  5.995   1.00 27.31  ? 263 PRO C N     1 
ATOM   8030  C  CA    . PRO C  1 291 ? -38.900 20.719  5.954   1.00 29.00  ? 263 PRO C CA    1 
ATOM   8031  C  C     . PRO C  1 291 ? -39.790 20.387  7.122   1.00 36.59  ? 263 PRO C C     1 
ATOM   8032  O  O     . PRO C  1 291 ? -39.597 20.892  8.231   1.00 38.23  ? 263 PRO C O     1 
ATOM   8033  C  CB    . PRO C  1 291 ? -37.583 19.962  6.065   1.00 31.36  ? 263 PRO C CB    1 
ATOM   8034  C  CG    . PRO C  1 291 ? -36.685 20.917  6.825   1.00 32.70  ? 263 PRO C CG    1 
ATOM   8035  C  CD    . PRO C  1 291 ? -37.066 22.281  6.330   1.00 29.09  ? 263 PRO C CD    1 
ATOM   8036  N  N     . ASP C  1 292 ? -40.793 19.568  6.871   1.00 34.41  ? 264 ASP C N     1 
ATOM   8037  C  CA    . ASP C  1 292 ? -41.504 18.937  7.952   1.00 32.06  ? 264 ASP C CA    1 
ATOM   8038  C  C     . ASP C  1 292 ? -40.822 17.577  8.151   1.00 33.59  ? 264 ASP C C     1 
ATOM   8039  O  O     . ASP C  1 292 ? -40.843 16.743  7.250   1.00 31.06  ? 264 ASP C O     1 
ATOM   8040  C  CB    . ASP C  1 292 ? -42.996 18.828  7.621   1.00 35.32  ? 264 ASP C CB    1 
ATOM   8041  C  CG    . ASP C  1 292 ? -43.765 17.998  8.631   1.00 40.54  ? 264 ASP C CG    1 
ATOM   8042  O  OD1   . ASP C  1 292 ? -43.174 17.565  9.638   1.00 42.95  ? 264 ASP C OD1   1 
ATOM   8043  O  OD2   . ASP C  1 292 ? -44.972 17.784  8.422   1.00 46.19  ? 264 ASP C OD2   1 
ATOM   8044  N  N     . PRO C  1 293 ? -40.179 17.370  9.323   1.00 35.89  ? 265 PRO C N     1 
ATOM   8045  C  CA    . PRO C  1 293 ? -39.368 16.166  9.571   1.00 40.63  ? 265 PRO C CA    1 
ATOM   8046  C  C     . PRO C  1 293 ? -40.142 14.866  9.388   1.00 33.51  ? 265 PRO C C     1 
ATOM   8047  O  O     . PRO C  1 293 ? -39.588 13.892  8.900   1.00 35.53  ? 265 PRO C O     1 
ATOM   8048  C  CB    . PRO C  1 293 ? -38.922 16.337  11.028  1.00 39.16  ? 265 PRO C CB    1 
ATOM   8049  C  CG    . PRO C  1 293 ? -38.932 17.823  11.246  1.00 36.23  ? 265 PRO C CG    1 
ATOM   8050  C  CD    . PRO C  1 293 ? -40.109 18.316  10.457  1.00 38.78  ? 265 PRO C CD    1 
ATOM   8051  N  N     . GLU C  1 294 ? -41.417 14.858  9.750   1.00 37.12  ? 266 GLU C N     1 
ATOM   8052  C  CA    . GLU C  1 294 ? -42.197 13.642  9.625   1.00 40.12  ? 266 GLU C CA    1 
ATOM   8053  C  C     . GLU C  1 294 ? -42.358 13.178  8.175   1.00 36.05  ? 266 GLU C C     1 
ATOM   8054  O  O     . GLU C  1 294 ? -42.561 11.990  7.938   1.00 31.16  ? 266 GLU C O     1 
ATOM   8055  C  CB    . GLU C  1 294 ? -43.574 13.816  10.273  1.00 41.53  ? 266 GLU C CB    1 
ATOM   8056  C  CG    . GLU C  1 294 ? -43.566 13.726  11.816  1.00 41.95  ? 266 GLU C CG    1 
ATOM   8057  C  CD    . GLU C  1 294 ? -42.522 12.751  12.374  1.00 53.24  ? 266 GLU C CD    1 
ATOM   8058  O  OE1   . GLU C  1 294 ? -42.576 11.529  12.061  1.00 51.42  ? 266 GLU C OE1   1 
ATOM   8059  O  OE2   . GLU C  1 294 ? -41.646 13.219  13.140  1.00 56.00  ? 266 GLU C OE2   1 
ATOM   8060  N  N     . ILE C  1 295 ? -42.277 14.083  7.196   1.00 34.85  ? 267 ILE C N     1 
ATOM   8061  C  CA    . ILE C  1 295 ? -42.397 13.600  5.809   1.00 34.74  ? 267 ILE C CA    1 
ATOM   8062  C  C     . ILE C  1 295 ? -41.108 13.751  5.031   1.00 34.06  ? 267 ILE C C     1 
ATOM   8063  O  O     . ILE C  1 295 ? -40.910 13.062  4.034   1.00 33.84  ? 267 ILE C O     1 
ATOM   8064  C  CB    . ILE C  1 295 ? -43.526 14.289  5.028   1.00 36.31  ? 267 ILE C CB    1 
ATOM   8065  C  CG1   . ILE C  1 295 ? -43.239 15.770  4.817   1.00 34.00  ? 267 ILE C CG1   1 
ATOM   8066  C  CG2   . ILE C  1 295 ? -44.858 14.119  5.747   1.00 43.75  ? 267 ILE C CG2   1 
ATOM   8067  C  CD1   . ILE C  1 295 ? -44.316 16.453  3.999   1.00 32.86  ? 267 ILE C CD1   1 
ATOM   8068  N  N     . ALA C  1 296 ? -40.222 14.624  5.496   1.00 31.24  ? 268 ALA C N     1 
ATOM   8069  C  CA    . ALA C  1 296 ? -38.936 14.820  4.838   1.00 29.49  ? 268 ALA C CA    1 
ATOM   8070  C  C     . ALA C  1 296 ? -37.983 13.720  5.251   1.00 31.54  ? 268 ALA C C     1 
ATOM   8071  O  O     . ALA C  1 296 ? -37.092 13.332  4.496   1.00 31.82  ? 268 ALA C O     1 
ATOM   8072  C  CB    . ALA C  1 296 ? -38.345 16.205  5.176   1.00 26.91  ? 268 ALA C CB    1 
ATOM   8073  N  N     . LYS C  1 297 ? -38.163 13.234  6.471   1.00 29.37  ? 269 LYS C N     1 
ATOM   8074  C  CA    . LYS C  1 297 ? -37.402 12.089  6.957   1.00 31.72  ? 269 LYS C CA    1 
ATOM   8075  C  C     . LYS C  1 297 ? -38.370 11.060  7.539   1.00 34.86  ? 269 LYS C C     1 
ATOM   8076  O  O     . LYS C  1 297 ? -38.388 10.818  8.754   1.00 35.40  ? 269 LYS C O     1 
ATOM   8077  C  CB    . LYS C  1 297 ? -36.376 12.527  8.002   1.00 37.01  ? 269 LYS C CB    1 
ATOM   8078  C  CG    . LYS C  1 297 ? -35.341 11.466  8.332   1.00 36.31  ? 269 LYS C CG    1 
ATOM   8079  C  CD    . LYS C  1 297 ? -34.303 11.990  9.314   1.00 41.77  ? 269 LYS C CD    1 
ATOM   8080  C  CE    . LYS C  1 297 ? -33.355 10.871  9.725   1.00 51.85  ? 269 LYS C CE    1 
ATOM   8081  N  NZ    . LYS C  1 297 ? -32.362 11.289  10.741  1.00 56.16  ? 269 LYS C NZ    1 
ATOM   8082  N  N     . PRO C  1 298 ? -39.187 10.450  6.668   1.00 33.41  ? 270 PRO C N     1 
ATOM   8083  C  CA    . PRO C  1 298 ? -40.313 9.658   7.169   1.00 30.12  ? 270 PRO C CA    1 
ATOM   8084  C  C     . PRO C  1 298 ? -39.909 8.265   7.634   1.00 33.87  ? 270 PRO C C     1 
ATOM   8085  O  O     . PRO C  1 298 ? -38.889 7.735   7.174   1.00 29.03  ? 270 PRO C O     1 
ATOM   8086  C  CB    . PRO C  1 298 ? -41.246 9.578   5.960   1.00 30.33  ? 270 PRO C CB    1 
ATOM   8087  C  CG    . PRO C  1 298 ? -40.326 9.611   4.772   1.00 29.47  ? 270 PRO C CG    1 
ATOM   8088  C  CD    . PRO C  1 298 ? -39.100 10.433  5.191   1.00 34.16  ? 270 PRO C CD    1 
ATOM   8089  N  N     . LEU C  1 299 ? -40.702 7.706   8.555   1.00 34.18  ? 271 LEU C N     1 
ATOM   8090  C  CA    . LEU C  1 299 ? -40.582 6.305   8.968   1.00 35.30  ? 271 LEU C CA    1 
ATOM   8091  C  C     . LEU C  1 299 ? -40.808 5.409   7.768   1.00 31.21  ? 271 LEU C C     1 
ATOM   8092  O  O     . LEU C  1 299 ? -41.751 5.609   7.004   1.00 29.07  ? 271 LEU C O     1 
ATOM   8093  C  CB    . LEU C  1 299 ? -41.587 5.968   10.074  1.00 32.55  ? 271 LEU C CB    1 
ATOM   8094  C  CG    . LEU C  1 299 ? -41.335 6.706   11.391  1.00 41.34  ? 271 LEU C CG    1 
ATOM   8095  C  CD1   . LEU C  1 299 ? -42.603 6.785   12.222  1.00 43.55  ? 271 LEU C CD1   1 
ATOM   8096  C  CD2   . LEU C  1 299 ? -40.222 6.003   12.153  1.00 39.27  ? 271 LEU C CD2   1 
ATOM   8097  N  N     . LEU C  1 300 ? -39.943 4.424   7.604   1.00 26.93  ? 272 LEU C N     1 
ATOM   8098  C  CA    . LEU C  1 300 ? -40.016 3.546   6.439   1.00 30.15  ? 272 LEU C CA    1 
ATOM   8099  C  C     . LEU C  1 300 ? -41.240 2.632   6.424   1.00 32.57  ? 272 LEU C C     1 
ATOM   8100  O  O     . LEU C  1 300 ? -41.925 2.554   5.400   1.00 30.59  ? 272 LEU C O     1 
ATOM   8101  C  CB    . LEU C  1 300 ? -38.743 2.704   6.343   1.00 30.36  ? 272 LEU C CB    1 
ATOM   8102  C  CG    . LEU C  1 300 ? -37.519 3.574   6.072   1.00 29.19  ? 272 LEU C CG    1 
ATOM   8103  C  CD1   . LEU C  1 300 ? -36.243 2.771   6.179   1.00 23.64  ? 272 LEU C CD1   1 
ATOM   8104  C  CD2   . LEU C  1 300 ? -37.638 4.222   4.691   1.00 25.04  ? 272 LEU C CD2   1 
ATOM   8105  N  N     . LYS C  1 301 ? -41.514 1.946   7.542   1.00 30.29  ? 273 LYS C N     1 
ATOM   8106  C  CA    . LYS C  1 301 ? -42.564 0.913   7.576   1.00 32.56  ? 273 LYS C CA    1 
ATOM   8107  C  C     . LYS C  1 301 ? -43.993 1.410   7.295   1.00 30.10  ? 273 LYS C C     1 
ATOM   8108  O  O     . LYS C  1 301 ? -44.741 0.728   6.594   1.00 30.55  ? 273 LYS C O     1 
ATOM   8109  C  CB    . LYS C  1 301 ? -42.531 0.142   8.923   1.00 33.10  ? 273 LYS C CB    1 
ATOM   8110  C  CG    . LYS C  1 301 ? -41.208 -0.605  9.159   1.00 31.85  ? 273 LYS C CG    1 
ATOM   8111  C  CD    . LYS C  1 301 ? -41.288 -1.748  10.168  1.00 39.03  ? 273 LYS C CD    1 
ATOM   8112  C  CE    . LYS C  1 301 ? -41.375 -1.264  11.584  1.00 43.64  ? 273 LYS C CE    1 
ATOM   8113  N  NZ    . LYS C  1 301 ? -41.174 -2.403  12.538  1.00 47.50  ? 273 LYS C NZ    1 
ATOM   8114  N  N     . PRO C  1 302 ? -44.392 2.584   7.823   1.00 29.08  ? 274 PRO C N     1 
ATOM   8115  C  CA    . PRO C  1 302 ? -45.709 3.082   7.393   1.00 30.34  ? 274 PRO C CA    1 
ATOM   8116  C  C     . PRO C  1 302 ? -45.827 3.343   5.880   1.00 29.31  ? 274 PRO C C     1 
ATOM   8117  O  O     . PRO C  1 302 ? -46.936 3.302   5.355   1.00 32.95  ? 274 PRO C O     1 
ATOM   8118  C  CB    . PRO C  1 302 ? -45.859 4.398   8.175   1.00 30.51  ? 274 PRO C CB    1 
ATOM   8119  C  CG    . PRO C  1 302 ? -45.018 4.196   9.388   1.00 30.65  ? 274 PRO C CG    1 
ATOM   8120  C  CD    . PRO C  1 302 ? -43.838 3.393   8.927   1.00 32.14  ? 274 PRO C CD    1 
ATOM   8121  N  N     . LEU C  1 303 ? -44.712 3.586   5.195   1.00 29.19  ? 275 LEU C N     1 
ATOM   8122  C  CA    . LEU C  1 303 ? -44.736 3.791   3.737   1.00 30.21  ? 275 LEU C CA    1 
ATOM   8123  C  C     . LEU C  1 303 ? -45.056 2.524   2.946   1.00 38.94  ? 275 LEU C C     1 
ATOM   8124  O  O     . LEU C  1 303 ? -45.443 2.621   1.778   1.00 37.83  ? 275 LEU C O     1 
ATOM   8125  C  CB    . LEU C  1 303 ? -43.399 4.353   3.244   1.00 32.08  ? 275 LEU C CB    1 
ATOM   8126  C  CG    . LEU C  1 303 ? -43.089 5.820   3.565   1.00 32.01  ? 275 LEU C CG    1 
ATOM   8127  C  CD1   . LEU C  1 303 ? -41.685 6.183   3.110   1.00 32.10  ? 275 LEU C CD1   1 
ATOM   8128  C  CD2   . LEU C  1 303 ? -44.109 6.740   2.925   1.00 29.15  ? 275 LEU C CD2   1 
ATOM   8129  N  N     . LEU C  1 304 ? -44.911 1.340   3.552   1.00 28.07  ? 276 LEU C N     1 
ATOM   8130  C  CA    . LEU C  1 304 ? -45.195 0.116   2.795   1.00 31.71  ? 276 LEU C CA    1 
ATOM   8131  C  C     . LEU C  1 304 ? -46.681 -0.051  2.498   1.00 31.24  ? 276 LEU C C     1 
ATOM   8132  O  O     . LEU C  1 304 ? -47.037 -0.749  1.555   1.00 35.76  ? 276 LEU C O     1 
ATOM   8133  C  CB    . LEU C  1 304 ? -44.689 -1.125  3.530   1.00 32.42  ? 276 LEU C CB    1 
ATOM   8134  C  CG    . LEU C  1 304 ? -43.199 -1.094  3.880   1.00 37.17  ? 276 LEU C CG    1 
ATOM   8135  C  CD1   . LEU C  1 304 ? -42.781 -2.317  4.675   1.00 34.72  ? 276 LEU C CD1   1 
ATOM   8136  C  CD2   . LEU C  1 304 ? -42.367 -0.963  2.637   1.00 29.85  ? 276 LEU C CD2   1 
ATOM   8137  N  N     . ALA C  1 305 ? -47.548 0.584   3.289   1.00 32.24  ? 277 ALA C N     1 
ATOM   8138  C  CA    . ALA C  1 305 ? -48.993 0.348   3.159   1.00 41.23  ? 277 ALA C CA    1 
ATOM   8139  C  C     . ALA C  1 305 ? -49.844 1.603   2.931   1.00 43.57  ? 277 ALA C C     1 
ATOM   8140  O  O     . ALA C  1 305 ? -51.072 1.551   3.058   1.00 50.34  ? 277 ALA C O     1 
ATOM   8141  C  CB    . ALA C  1 305 ? -49.503 -0.397  4.403   1.00 52.63  ? 277 ALA C CB    1 
ATOM   8142  N  N     . ILE C  1 306 ? -49.205 2.715   2.573   1.00 45.09  ? 278 ILE C N     1 
ATOM   8143  C  CA    . ILE C  1 306 ? -49.892 4.001   2.492   1.00 38.45  ? 278 ILE C CA    1 
ATOM   8144  C  C     . ILE C  1 306 ? -50.848 4.063   1.293   1.00 36.08  ? 278 ILE C C     1 
ATOM   8145  O  O     . ILE C  1 306 ? -50.500 3.667   0.177   1.00 38.81  ? 278 ILE C O     1 
ATOM   8146  C  CB    . ILE C  1 306 ? -48.860 5.181   2.447   1.00 38.87  ? 278 ILE C CB    1 
ATOM   8147  C  CG1   . ILE C  1 306 ? -49.539 6.524   2.690   1.00 40.53  ? 278 ILE C CG1   1 
ATOM   8148  C  CG2   . ILE C  1 306 ? -48.059 5.194   1.149   1.00 32.36  ? 278 ILE C CG2   1 
ATOM   8149  C  CD1   . ILE C  1 306 ? -48.555 7.690   2.852   1.00 40.86  ? 278 ILE C CD1   1 
ATOM   8150  N  N     . SER C  1 307 ? -52.069 4.536   1.532   1.00 38.96  ? 279 SER C N     1 
ATOM   8151  C  CA    . SER C  1 307 ? -53.050 4.651   0.452   1.00 42.20  ? 279 SER C CA    1 
ATOM   8152  C  C     . SER C  1 307 ? -52.698 5.799   -0.492  1.00 42.93  ? 279 SER C C     1 
ATOM   8153  O  O     . SER C  1 307 ? -51.862 6.646   -0.165  1.00 41.10  ? 279 SER C O     1 
ATOM   8154  C  CB    . SER C  1 307 ? -54.455 4.851   1.018   1.00 44.71  ? 279 SER C CB    1 
ATOM   8155  O  OG    . SER C  1 307 ? -54.554 6.071   1.730   1.00 47.85  ? 279 SER C OG    1 
ATOM   8156  N  N     . ASN C  1 308 ? -53.316 5.806   -1.671  1.00 41.22  ? 280 ASN C N     1 
ATOM   8157  C  CA    . ASN C  1 308 ? -53.177 6.925   -2.596  1.00 43.99  ? 280 ASN C CA    1 
ATOM   8158  C  C     . ASN C  1 308 ? -53.587 8.218   -1.929  1.00 41.12  ? 280 ASN C C     1 
ATOM   8159  O  O     . ASN C  1 308 ? -52.895 9.232   -2.051  1.00 42.66  ? 280 ASN C O     1 
ATOM   8160  C  CB    . ASN C  1 308 ? -54.024 6.728   -3.850  1.00 49.17  ? 280 ASN C CB    1 
ATOM   8161  C  CG    . ASN C  1 308 ? -53.382 5.802   -4.855  1.00 55.03  ? 280 ASN C CG    1 
ATOM   8162  O  OD1   . ASN C  1 308 ? -52.188 5.512   -4.778  1.00 59.14  ? 280 ASN C OD1   1 
ATOM   8163  N  ND2   . ASN C  1 308 ? -54.171 5.346   -5.824  1.00 59.44  ? 280 ASN C ND2   1 
ATOM   8164  N  N     . ARG C  1 309 ? -54.718 8.173   -1.227  1.00 39.84  ? 281 ARG C N     1 
ATOM   8165  C  CA    . ARG C  1 309 ? -55.262 9.363   -0.592  1.00 50.03  ? 281 ARG C CA    1 
ATOM   8166  C  C     . ARG C  1 309 ? -54.322 9.866   0.487   1.00 46.91  ? 281 ARG C C     1 
ATOM   8167  O  O     . ARG C  1 309 ? -54.050 11.059  0.568   1.00 40.77  ? 281 ARG C O     1 
ATOM   8168  C  CB    . ARG C  1 309 ? -56.640 9.102   0.018   1.00 52.63  ? 281 ARG C CB    1 
ATOM   8169  C  CG    . ARG C  1 309 ? -57.243 10.363  0.658   1.00 48.43  ? 281 ARG C CG    1 
ATOM   8170  C  CD    . ARG C  1 309 ? -58.257 10.036  1.742   1.00 55.89  ? 281 ARG C CD    1 
ATOM   8171  N  NE    . ARG C  1 309 ? -57.696 9.145   2.756   1.00 70.78  ? 281 ARG C NE    1 
ATOM   8172  C  CZ    . ARG C  1 309 ? -57.027 9.558   3.832   1.00 70.43  ? 281 ARG C CZ    1 
ATOM   8173  N  NH1   . ARG C  1 309 ? -56.836 10.857  4.037   1.00 66.16  ? 281 ARG C NH1   1 
ATOM   8174  N  NH2   . ARG C  1 309 ? -56.549 8.672   4.704   1.00 67.28  ? 281 ARG C NH2   1 
ATOM   8175  N  N     . GLU C  1 310 ? -53.826 8.956   1.314   1.00 41.97  ? 282 GLU C N     1 
ATOM   8176  C  CA    . GLU C  1 310 ? -52.958 9.354   2.411   1.00 44.38  ? 282 GLU C CA    1 
ATOM   8177  C  C     . GLU C  1 310 ? -51.649 9.942   1.877   1.00 36.06  ? 282 GLU C C     1 
ATOM   8178  O  O     . GLU C  1 310 ? -51.183 10.972  2.363   1.00 36.70  ? 282 GLU C O     1 
ATOM   8179  C  CB    . GLU C  1 310 ? -52.683 8.171   3.334   1.00 45.31  ? 282 GLU C CB    1 
ATOM   8180  C  CG    . GLU C  1 310 ? -52.173 8.566   4.713   1.00 56.04  ? 282 GLU C CG    1 
ATOM   8181  C  CD    . GLU C  1 310 ? -51.901 7.362   5.619   1.00 63.98  ? 282 GLU C CD    1 
ATOM   8182  O  OE1   . GLU C  1 310 ? -52.177 6.204   5.201   1.00 64.62  ? 282 GLU C OE1   1 
ATOM   8183  O  OE2   . GLU C  1 310 ? -51.407 7.580   6.752   1.00 72.97  ? 282 GLU C OE2   1 
ATOM   8184  N  N     . PHE C  1 311 ? -51.079 9.293   0.864   1.00 37.27  ? 283 PHE C N     1 
ATOM   8185  C  CA    . PHE C  1 311 ? -49.865 9.785   0.231   1.00 35.06  ? 283 PHE C CA    1 
ATOM   8186  C  C     . PHE C  1 311 ? -50.061 11.189  -0.341  1.00 34.27  ? 283 PHE C C     1 
ATOM   8187  O  O     . PHE C  1 311 ? -49.193 12.052  -0.187  1.00 32.98  ? 283 PHE C O     1 
ATOM   8188  C  CB    . PHE C  1 311 ? -49.392 8.859   -0.888  1.00 30.78  ? 283 PHE C CB    1 
ATOM   8189  C  CG    . PHE C  1 311 ? -48.136 9.356   -1.575  1.00 28.99  ? 283 PHE C CG    1 
ATOM   8190  C  CD1   . PHE C  1 311 ? -48.205 10.013  -2.785  1.00 29.27  ? 283 PHE C CD1   1 
ATOM   8191  C  CD2   . PHE C  1 311 ? -46.891 9.198   -0.968  1.00 30.73  ? 283 PHE C CD2   1 
ATOM   8192  C  CE1   . PHE C  1 311 ? -47.060 10.482  -3.407  1.00 31.44  ? 283 PHE C CE1   1 
ATOM   8193  C  CE2   . PHE C  1 311 ? -45.737 9.663   -1.569  1.00 30.06  ? 283 PHE C CE2   1 
ATOM   8194  C  CZ    . PHE C  1 311 ? -45.823 10.311  -2.801  1.00 33.14  ? 283 PHE C CZ    1 
ATOM   8195  N  N     . LYS C  1 312 ? -51.179 11.417  -1.021  1.00 30.39  ? 284 LYS C N     1 
ATOM   8196  C  CA    A LYS C  1 312 ? -51.404 12.725  -1.630  0.61 37.63  ? 284 LYS C CA    1 
ATOM   8197  C  CA    B LYS C  1 312 ? -51.430 12.717  -1.634  0.39 37.60  ? 284 LYS C CA    1 
ATOM   8198  C  C     . LYS C  1 312 ? -51.591 13.768  -0.536  1.00 37.63  ? 284 LYS C C     1 
ATOM   8199  O  O     . LYS C  1 312 ? -51.086 14.876  -0.642  1.00 35.06  ? 284 LYS C O     1 
ATOM   8200  C  CB    A LYS C  1 312 ? -52.602 12.694  -2.577  0.61 39.06  ? 284 LYS C CB    1 
ATOM   8201  C  CB    B LYS C  1 312 ? -52.670 12.664  -2.529  0.39 39.05  ? 284 LYS C CB    1 
ATOM   8202  C  CG    A LYS C  1 312 ? -52.255 12.178  -3.955  0.61 34.72  ? 284 LYS C CG    1 
ATOM   8203  C  CG    B LYS C  1 312 ? -52.947 13.944  -3.297  0.39 41.56  ? 284 LYS C CG    1 
ATOM   8204  C  CD    A LYS C  1 312 ? -53.487 11.700  -4.704  0.61 42.36  ? 284 LYS C CD    1 
ATOM   8205  C  CD    B LYS C  1 312 ? -52.298 13.946  -4.671  0.39 38.53  ? 284 LYS C CD    1 
ATOM   8206  C  CE    A LYS C  1 312 ? -53.096 10.900  -5.948  0.61 41.95  ? 284 LYS C CE    1 
ATOM   8207  C  CE    B LYS C  1 312 ? -52.672 15.209  -5.434  0.39 39.84  ? 284 LYS C CE    1 
ATOM   8208  N  NZ    A LYS C  1 312 ? -54.263 10.272  -6.623  0.61 42.62  ? 284 LYS C NZ    1 
ATOM   8209  N  NZ    B LYS C  1 312 ? -52.298 15.124  -6.867  0.39 44.19  ? 284 LYS C NZ    1 
ATOM   8210  N  N     . GLU C  1 313 ? -52.274 13.380  0.534   1.00 37.70  ? 285 GLU C N     1 
ATOM   8211  C  CA    . GLU C  1 313 ? -52.484 14.226  1.690   1.00 38.35  ? 285 GLU C CA    1 
ATOM   8212  C  C     . GLU C  1 313 ? -51.178 14.547  2.429   1.00 40.58  ? 285 GLU C C     1 
ATOM   8213  O  O     . GLU C  1 313 ? -50.960 15.678  2.854   1.00 39.99  ? 285 GLU C O     1 
ATOM   8214  C  CB    . GLU C  1 313 ? -53.474 13.557  2.640   1.00 43.11  ? 285 GLU C CB    1 
ATOM   8215  C  CG    . GLU C  1 313 ? -53.891 14.416  3.808   1.00 46.72  ? 285 GLU C CG    1 
ATOM   8216  C  CD    . GLU C  1 313 ? -55.072 15.297  3.459   1.00 68.09  ? 285 GLU C CD    1 
ATOM   8217  O  OE1   . GLU C  1 313 ? -54.979 16.535  3.638   1.00 70.10  ? 285 GLU C OE1   1 
ATOM   8218  O  OE2   . GLU C  1 313 ? -56.099 14.741  3.004   1.00 72.76  ? 285 GLU C OE2   1 
ATOM   8219  N  N     . LYS C  1 314 ? -50.298 13.567  2.580   1.00 31.91  ? 286 LYS C N     1 
ATOM   8220  C  CA    . LYS C  1 314 ? -49.068 13.828  3.320   1.00 34.61  ? 286 LYS C CA    1 
ATOM   8221  C  C     . LYS C  1 314 ? -47.951 14.434  2.465   1.00 37.14  ? 286 LYS C C     1 
ATOM   8222  O  O     . LYS C  1 314 ? -47.272 15.362  2.895   1.00 33.06  ? 286 LYS C O     1 
ATOM   8223  C  CB    . LYS C  1 314 ? -48.575 12.544  3.995   1.00 37.44  ? 286 LYS C CB    1 
ATOM   8224  C  CG    . LYS C  1 314 ? -49.331 12.215  5.286   1.00 40.25  ? 286 LYS C CG    1 
ATOM   8225  C  CD    . LYS C  1 314 ? -48.739 11.020  6.027   1.00 55.62  ? 286 LYS C CD    1 
ATOM   8226  C  CE    . LYS C  1 314 ? -49.728 10.486  7.069   1.00 72.97  ? 286 LYS C CE    1 
ATOM   8227  N  NZ    . LYS C  1 314 ? -49.212 9.325   7.858   1.00 71.11  ? 286 LYS C NZ    1 
ATOM   8228  N  N     . PHE C  1 315 ? -47.781 13.921  1.252   1.00 32.99  ? 287 PHE C N     1 
ATOM   8229  C  CA    . PHE C  1 315 ? -46.602 14.210  0.444   1.00 28.25  ? 287 PHE C CA    1 
ATOM   8230  C  C     . PHE C  1 315 ? -46.917 15.039  -0.797  1.00 27.88  ? 287 PHE C C     1 
ATOM   8231  O  O     . PHE C  1 315 ? -46.020 15.422  -1.538  1.00 30.19  ? 287 PHE C O     1 
ATOM   8232  C  CB    . PHE C  1 315 ? -45.941 12.883  0.015   1.00 28.47  ? 287 PHE C CB    1 
ATOM   8233  C  CG    . PHE C  1 315 ? -45.420 12.063  1.165   1.00 28.75  ? 287 PHE C CG    1 
ATOM   8234  C  CD1   . PHE C  1 315 ? -44.123 12.239  1.627   1.00 28.26  ? 287 PHE C CD1   1 
ATOM   8235  C  CD2   . PHE C  1 315 ? -46.230 11.125  1.790   1.00 29.08  ? 287 PHE C CD2   1 
ATOM   8236  C  CE1   . PHE C  1 315 ? -43.642 11.497  2.700   1.00 32.76  ? 287 PHE C CE1   1 
ATOM   8237  C  CE2   . PHE C  1 315 ? -45.758 10.369  2.863   1.00 28.37  ? 287 PHE C CE2   1 
ATOM   8238  C  CZ    . PHE C  1 315 ? -44.465 10.555  3.319   1.00 33.41  ? 287 PHE C CZ    1 
ATOM   8239  N  N     . GLY C  1 316 ? -48.193 15.298  -1.030  1.00 30.24  ? 288 GLY C N     1 
ATOM   8240  C  CA    . GLY C  1 316 ? -48.628 15.827  -2.309  1.00 29.68  ? 288 GLY C CA    1 
ATOM   8241  C  C     . GLY C  1 316 ? -48.150 17.230  -2.635  1.00 36.27  ? 288 GLY C C     1 
ATOM   8242  O  O     . GLY C  1 316 ? -48.247 17.659  -3.783  1.00 36.20  ? 288 GLY C O     1 
ATOM   8243  N  N     . HIS C  1 317 ? -47.633 17.948  -1.646  1.00 31.84  ? 289 HIS C N     1 
ATOM   8244  C  CA    . HIS C  1 317 ? -47.169 19.305  -1.892  1.00 37.81  ? 289 HIS C CA    1 
ATOM   8245  C  C     . HIS C  1 317 ? -45.645 19.450  -1.936  1.00 32.87  ? 289 HIS C C     1 
ATOM   8246  O  O     . HIS C  1 317 ? -45.139 20.571  -2.090  1.00 31.87  ? 289 HIS C O     1 
ATOM   8247  C  CB    . HIS C  1 317 ? -47.746 20.261  -0.837  1.00 38.03  ? 289 HIS C CB    1 
ATOM   8248  C  CG    . HIS C  1 317 ? -49.200 20.563  -1.026  1.00 42.28  ? 289 HIS C CG    1 
ATOM   8249  N  ND1   . HIS C  1 317 ? -49.723 20.988  -2.232  1.00 49.71  ? 289 HIS C ND1   1 
ATOM   8250  C  CD2   . HIS C  1 317 ? -50.240 20.514  -0.160  1.00 41.67  ? 289 HIS C CD2   1 
ATOM   8251  C  CE1   . HIS C  1 317 ? -51.025 21.171  -2.102  1.00 49.79  ? 289 HIS C CE1   1 
ATOM   8252  N  NE2   . HIS C  1 317 ? -51.364 20.888  -0.856  1.00 50.65  ? 289 HIS C NE2   1 
ATOM   8253  N  N     . VAL C  1 318 ? -44.902 18.345  -1.807  1.00 27.17  ? 290 VAL C N     1 
ATOM   8254  C  CA    . VAL C  1 318 ? -43.444 18.433  -1.914  1.00 24.83  ? 290 VAL C CA    1 
ATOM   8255  C  C     . VAL C  1 318 ? -43.036 18.040  -3.324  1.00 28.08  ? 290 VAL C C     1 
ATOM   8256  O  O     . VAL C  1 318 ? -43.796 17.362  -4.000  1.00 27.71  ? 290 VAL C O     1 
ATOM   8257  C  CB    . VAL C  1 318 ? -42.721 17.552  -0.883  1.00 29.04  ? 290 VAL C CB    1 
ATOM   8258  C  CG1   . VAL C  1 318 ? -43.165 17.941  0.505   1.00 30.76  ? 290 VAL C CG1   1 
ATOM   8259  C  CG2   . VAL C  1 318 ? -42.958 16.046  -1.164  1.00 27.02  ? 290 VAL C CG2   1 
ATOM   8260  N  N     . SER C  1 319 ? -41.860 18.477  -3.784  1.00 25.82  ? 291 SER C N     1 
ATOM   8261  C  CA    . SER C  1 319 ? -41.472 18.209  -5.173  1.00 28.36  ? 291 SER C CA    1 
ATOM   8262  C  C     . SER C  1 319 ? -41.254 16.704  -5.419  1.00 29.70  ? 291 SER C C     1 
ATOM   8263  O  O     . SER C  1 319 ? -41.418 16.238  -6.533  1.00 27.85  ? 291 SER C O     1 
ATOM   8264  C  CB    . SER C  1 319 ? -40.216 18.989  -5.563  1.00 28.31  ? 291 SER C CB    1 
ATOM   8265  O  OG    . SER C  1 319 ? -39.066 18.556  -4.851  1.00 28.84  ? 291 SER C OG    1 
ATOM   8266  N  N     . GLY C  1 320 ? -40.912 15.955  -4.373  1.00 30.40  ? 292 GLY C N     1 
ATOM   8267  C  CA    . GLY C  1 320 ? -40.600 14.535  -4.505  1.00 26.91  ? 292 GLY C CA    1 
ATOM   8268  C  C     . GLY C  1 320 ? -41.801 13.628  -4.689  1.00 26.43  ? 292 GLY C C     1 
ATOM   8269  O  O     . GLY C  1 320 ? -41.656 12.413  -4.769  1.00 27.52  ? 292 GLY C O     1 
ATOM   8270  N  N     . SER C  1 321 ? -42.998 14.203  -4.715  1.00 28.98  ? 293 SER C N     1 
ATOM   8271  C  CA    . SER C  1 321 ? -44.201 13.414  -4.959  1.00 27.83  ? 293 SER C CA    1 
ATOM   8272  C  C     . SER C  1 321 ? -44.610 13.418  -6.426  1.00 32.55  ? 293 SER C C     1 
ATOM   8273  O  O     . SER C  1 321 ? -45.646 12.846  -6.775  1.00 31.61  ? 293 SER C O     1 
ATOM   8274  C  CB    . SER C  1 321 ? -45.360 13.948  -4.149  1.00 30.07  ? 293 SER C CB    1 
ATOM   8275  O  OG    . SER C  1 321 ? -45.641 15.282  -4.540  1.00 32.85  ? 293 SER C OG    1 
ATOM   8276  N  N     . TRP C  1 322 ? -43.810 14.062  -7.276  1.00 28.11  ? 294 TRP C N     1 
ATOM   8277  C  CA    . TRP C  1 322 ? -44.237 14.324  -8.646  1.00 29.38  ? 294 TRP C CA    1 
ATOM   8278  C  C     . TRP C  1 322 ? -44.344 13.056  -9.505  1.00 29.91  ? 294 TRP C C     1 
ATOM   8279  O  O     . TRP C  1 322 ? -45.006 13.080  -10.535 1.00 33.29  ? 294 TRP C O     1 
ATOM   8280  C  CB    . TRP C  1 322 ? -43.302 15.343  -9.311  1.00 28.42  ? 294 TRP C CB    1 
ATOM   8281  C  CG    . TRP C  1 322 ? -42.013 14.793  -9.826  1.00 25.75  ? 294 TRP C CG    1 
ATOM   8282  C  CD1   . TRP C  1 322 ? -40.892 14.526  -9.109  1.00 27.10  ? 294 TRP C CD1   1 
ATOM   8283  C  CD2   . TRP C  1 322 ? -41.707 14.482  -11.186 1.00 27.91  ? 294 TRP C CD2   1 
ATOM   8284  N  NE1   . TRP C  1 322 ? -39.906 14.044  -9.934  1.00 23.89  ? 294 TRP C NE1   1 
ATOM   8285  C  CE2   . TRP C  1 322 ? -40.383 14.011  -11.216 1.00 26.07  ? 294 TRP C CE2   1 
ATOM   8286  C  CE3   . TRP C  1 322 ? -42.426 14.559  -12.383 1.00 28.41  ? 294 TRP C CE3   1 
ATOM   8287  C  CZ2   . TRP C  1 322 ? -39.756 13.617  -12.399 1.00 32.43  ? 294 TRP C CZ2   1 
ATOM   8288  C  CZ3   . TRP C  1 322 ? -41.809 14.155  -13.556 1.00 35.14  ? 294 TRP C CZ3   1 
ATOM   8289  C  CH2   . TRP C  1 322 ? -40.484 13.695  -13.556 1.00 34.13  ? 294 TRP C CH2   1 
ATOM   8290  N  N     . ARG C  1 323 ? -43.729 11.956  -9.070  1.00 31.66  ? 295 ARG C N     1 
ATOM   8291  C  CA    . ARG C  1 323 ? -43.823 10.666  -9.791  1.00 32.11  ? 295 ARG C CA    1 
ATOM   8292  C  C     . ARG C  1 323 ? -44.799 9.700   -9.121  1.00 36.68  ? 295 ARG C C     1 
ATOM   8293  O  O     . ARG C  1 323 ? -44.843 8.510   -9.461  1.00 32.19  ? 295 ARG C O     1 
ATOM   8294  C  CB    . ARG C  1 323 ? -42.454 9.991   -9.881  1.00 30.66  ? 295 ARG C CB    1 
ATOM   8295  C  CG    . ARG C  1 323 ? -41.386 10.833  -10.574 1.00 30.80  ? 295 ARG C CG    1 
ATOM   8296  C  CD    . ARG C  1 323 ? -41.526 10.710  -12.061 1.00 32.47  ? 295 ARG C CD    1 
ATOM   8297  N  NE    . ARG C  1 323 ? -40.813 9.546   -12.561 1.00 34.94  ? 295 ARG C NE    1 
ATOM   8298  C  CZ    . ARG C  1 323 ? -40.872 9.115   -13.818 1.00 40.50  ? 295 ARG C CZ    1 
ATOM   8299  N  NH1   . ARG C  1 323 ? -41.619 9.752   -14.703 1.00 51.83  ? 295 ARG C NH1   1 
ATOM   8300  N  NH2   . ARG C  1 323 ? -40.178 8.053   -14.190 1.00 35.22  ? 295 ARG C NH2   1 
ATOM   8301  N  N     . GLY C  1 324 ? -45.553 10.204  -8.143  1.00 31.81  ? 296 GLY C N     1 
ATOM   8302  C  CA    . GLY C  1 324 ? -46.482 9.362   -7.408  1.00 28.65  ? 296 GLY C CA    1 
ATOM   8303  C  C     . GLY C  1 324 ? -45.766 8.574   -6.326  1.00 30.47  ? 296 GLY C C     1 
ATOM   8304  O  O     . GLY C  1 324 ? -44.563 8.739   -6.116  1.00 31.14  ? 296 GLY C O     1 
ATOM   8305  N  N     . LYS C  1 325 ? -46.493 7.698   -5.645  1.00 32.99  ? 297 LYS C N     1 
ATOM   8306  C  CA    . LYS C  1 325 ? -45.923 7.002   -4.496  1.00 34.27  ? 297 LYS C CA    1 
ATOM   8307  C  C     . LYS C  1 325 ? -45.108 5.741   -4.836  1.00 30.30  ? 297 LYS C C     1 
ATOM   8308  O  O     . LYS C  1 325 ? -44.328 5.279   -3.998  1.00 29.25  ? 297 LYS C O     1 
ATOM   8309  C  CB    . LYS C  1 325 ? -47.031 6.635   -3.504  1.00 30.84  ? 297 LYS C CB    1 
ATOM   8310  C  CG    . LYS C  1 325 ? -48.004 5.581   -4.005  1.00 34.18  ? 297 LYS C CG    1 
ATOM   8311  C  CD    . LYS C  1 325 ? -48.986 5.201   -2.901  1.00 38.49  ? 297 LYS C CD    1 
ATOM   8312  C  CE    . LYS C  1 325 ? -49.682 3.850   -3.168  1.00 37.95  ? 297 LYS C CE    1 
ATOM   8313  N  NZ    . LYS C  1 325 ? -50.387 3.877   -4.480  1.00 50.20  ? 297 LYS C NZ    1 
ATOM   8314  N  N     . LYS C  1 326 ? -45.238 5.193   -6.043  1.00 31.08  ? 298 LYS C N     1 
ATOM   8315  C  CA    . LYS C  1 326 ? -44.594 3.888   -6.305  1.00 29.28  ? 298 LYS C CA    1 
ATOM   8316  C  C     . LYS C  1 326 ? -43.051 3.891   -6.168  1.00 27.94  ? 298 LYS C C     1 
ATOM   8317  O  O     . LYS C  1 326 ? -42.516 3.026   -5.476  1.00 28.82  ? 298 LYS C O     1 
ATOM   8318  C  CB    . LYS C  1 326 ? -44.977 3.314   -7.683  1.00 25.96  ? 298 LYS C CB    1 
ATOM   8319  C  CG    . LYS C  1 326 ? -44.177 2.038   -7.998  1.00 34.26  ? 298 LYS C CG    1 
ATOM   8320  C  CD    . LYS C  1 326 ? -44.786 1.138   -9.083  1.00 37.89  ? 298 LYS C CD    1 
ATOM   8321  C  CE    . LYS C  1 326 ? -44.423 1.602   -10.484 1.00 43.81  ? 298 LYS C CE    1 
ATOM   8322  N  NZ    . LYS C  1 326 ? -44.562 0.492   -11.463 1.00 46.00  ? 298 LYS C NZ    1 
ATOM   8323  N  N     . PRO C  1 327 ? -42.338 4.862   -6.797  1.00 29.03  ? 299 PRO C N     1 
ATOM   8324  C  CA    . PRO C  1 327 ? -40.887 4.923   -6.588  1.00 28.08  ? 299 PRO C CA    1 
ATOM   8325  C  C     . PRO C  1 327 ? -40.500 5.086   -5.111  1.00 27.88  ? 299 PRO C C     1 
ATOM   8326  O  O     . PRO C  1 327 ? -39.448 4.572   -4.705  1.00 29.90  ? 299 PRO C O     1 
ATOM   8327  C  CB    . PRO C  1 327 ? -40.459 6.187   -7.379  1.00 25.27  ? 299 PRO C CB    1 
ATOM   8328  C  CG    . PRO C  1 327 ? -41.523 6.376   -8.378  1.00 28.46  ? 299 PRO C CG    1 
ATOM   8329  C  CD    . PRO C  1 327 ? -42.790 5.943   -7.696  1.00 26.42  ? 299 PRO C CD    1 
ATOM   8330  N  N     . ILE C  1 328 ? -41.324 5.810   -4.349  1.00 26.42  ? 300 ILE C N     1 
ATOM   8331  C  CA    . ILE C  1 328 ? -41.060 6.086   -2.938  1.00 28.18  ? 300 ILE C CA    1 
ATOM   8332  C  C     . ILE C  1 328 ? -41.199 4.771   -2.146  1.00 26.40  ? 300 ILE C C     1 
ATOM   8333  O  O     . ILE C  1 328 ? -40.371 4.463   -1.302  1.00 27.43  ? 300 ILE C O     1 
ATOM   8334  C  CB    . ILE C  1 328 ? -42.023 7.168   -2.346  1.00 24.72  ? 300 ILE C CB    1 
ATOM   8335  C  CG1   . ILE C  1 328 ? -42.004 8.474   -3.156  1.00 28.88  ? 300 ILE C CG1   1 
ATOM   8336  C  CG2   . ILE C  1 328 ? -41.745 7.424   -0.821  1.00 24.11  ? 300 ILE C CG2   1 
ATOM   8337  C  CD1   . ILE C  1 328 ? -40.656 9.090   -3.324  1.00 31.56  ? 300 ILE C CD1   1 
ATOM   8338  N  N     . GLN C  1 329 ? -42.235 3.997   -2.446  1.00 28.33  ? 301 GLN C N     1 
ATOM   8339  C  CA    . GLN C  1 329 ? -42.456 2.706   -1.784  1.00 29.24  ? 301 GLN C CA    1 
ATOM   8340  C  C     . GLN C  1 329 ? -41.373 1.697   -2.149  1.00 23.99  ? 301 GLN C C     1 
ATOM   8341  O  O     . GLN C  1 329 ? -40.847 1.012   -1.278  1.00 26.66  ? 301 GLN C O     1 
ATOM   8342  C  CB    . GLN C  1 329 ? -43.848 2.160   -2.130  1.00 26.79  ? 301 GLN C CB    1 
ATOM   8343  C  CG    . GLN C  1 329 ? -44.973 2.984   -1.501  1.00 30.06  ? 301 GLN C CG    1 
ATOM   8344  C  CD    . GLN C  1 329 ? -46.358 2.428   -1.776  1.00 29.53  ? 301 GLN C CD    1 
ATOM   8345  O  OE1   . GLN C  1 329 ? -46.817 2.379   -2.925  1.00 29.63  ? 301 GLN C OE1   1 
ATOM   8346  N  NE2   . GLN C  1 329 ? -47.040 2.016   -0.720  1.00 31.91  ? 301 GLN C NE2   1 
ATOM   8347  N  N     . ARG C  1 330 ? -41.003 1.634   -3.423  1.00 27.19  ? 302 ARG C N     1 
ATOM   8348  C  CA    . ARG C  1 330 ? -39.897 0.770   -3.833  1.00 23.01  ? 302 ARG C CA    1 
ATOM   8349  C  C     . ARG C  1 330 ? -38.618 1.097   -3.079  1.00 23.84  ? 302 ARG C C     1 
ATOM   8350  O  O     . ARG C  1 330 ? -37.909 0.203   -2.620  1.00 26.79  ? 302 ARG C O     1 
ATOM   8351  C  CB    . ARG C  1 330 ? -39.634 0.883   -5.338  1.00 26.93  ? 302 ARG C CB    1 
ATOM   8352  C  CG    . ARG C  1 330 ? -38.516 -0.031  -5.834  1.00 21.64  ? 302 ARG C CG    1 
ATOM   8353  C  CD    . ARG C  1 330 ? -37.954 0.442   -7.171  1.00 27.64  ? 302 ARG C CD    1 
ATOM   8354  N  NE    . ARG C  1 330 ? -37.339 1.760   -7.008  1.00 28.40  ? 302 ARG C NE    1 
ATOM   8355  C  CZ    . ARG C  1 330 ? -36.776 2.469   -7.979  1.00 29.36  ? 302 ARG C CZ    1 
ATOM   8356  N  NH1   . ARG C  1 330 ? -36.746 2.001   -9.219  1.00 24.03  ? 302 ARG C NH1   1 
ATOM   8357  N  NH2   . ARG C  1 330 ? -36.256 3.665   -7.706  1.00 27.65  ? 302 ARG C NH2   1 
ATOM   8358  N  N     . ASN C  1 331 ? -38.317 2.389   -2.960  1.00 27.22  ? 303 ASN C N     1 
ATOM   8359  C  CA    . ASN C  1 331 ? -37.101 2.831   -2.279  1.00 26.86  ? 303 ASN C CA    1 
ATOM   8360  C  C     . ASN C  1 331 ? -37.151 2.581   -0.776  1.00 22.67  ? 303 ASN C C     1 
ATOM   8361  O  O     . ASN C  1 331 ? -36.125 2.310   -0.172  1.00 28.68  ? 303 ASN C O     1 
ATOM   8362  C  CB    . ASN C  1 331 ? -36.841 4.325   -2.556  1.00 23.38  ? 303 ASN C CB    1 
ATOM   8363  C  CG    . ASN C  1 331 ? -36.631 4.603   -4.031  1.00 29.03  ? 303 ASN C CG    1 
ATOM   8364  O  OD1   . ASN C  1 331 ? -36.358 3.678   -4.828  1.00 27.33  ? 303 ASN C OD1   1 
ATOM   8365  N  ND2   . ASN C  1 331 ? -36.764 5.863   -4.414  1.00 25.77  ? 303 ASN C ND2   1 
ATOM   8366  N  N     . ALA C  1 332 ? -38.338 2.663   -0.181  1.00 19.06  ? 304 ALA C N     1 
ATOM   8367  C  CA    . ALA C  1 332 ? -38.511 2.357   1.242   1.00 24.08  ? 304 ALA C CA    1 
ATOM   8368  C  C     . ALA C  1 332 ? -38.272 0.869   1.523   1.00 25.75  ? 304 ALA C C     1 
ATOM   8369  O  O     . ALA C  1 332 ? -37.736 0.505   2.564   1.00 29.27  ? 304 ALA C O     1 
ATOM   8370  C  CB    . ALA C  1 332 ? -39.915 2.773   1.718   1.00 26.66  ? 304 ALA C CB    1 
ATOM   8371  N  N     . ILE C  1 333 ? -38.657 0.021   0.577   1.00 29.33  ? 305 ILE C N     1 
ATOM   8372  C  CA    . ILE C  1 333 ? -38.396 -1.413  0.670   1.00 24.10  ? 305 ILE C CA    1 
ATOM   8373  C  C     . ILE C  1 333 ? -36.883 -1.646  0.605   1.00 29.45  ? 305 ILE C C     1 
ATOM   8374  O  O     . ILE C  1 333 ? -36.315 -2.326  1.445   1.00 28.44  ? 305 ILE C O     1 
ATOM   8375  C  CB    . ILE C  1 333 ? -39.100 -2.178  -0.456  1.00 25.16  ? 305 ILE C CB    1 
ATOM   8376  C  CG1   . ILE C  1 333 ? -40.612 -2.101  -0.267  1.00 23.52  ? 305 ILE C CG1   1 
ATOM   8377  C  CG2   . ILE C  1 333 ? -38.641 -3.628  -0.494  1.00 24.47  ? 305 ILE C CG2   1 
ATOM   8378  C  CD1   . ILE C  1 333 ? -41.401 -2.616  -1.438  1.00 26.94  ? 305 ILE C CD1   1 
ATOM   8379  N  N     . LEU C  1 334 ? -36.230 -1.058  -0.391  1.00 27.10  ? 306 LEU C N     1 
ATOM   8380  C  CA    . LEU C  1 334 ? -34.773 -1.158  -0.511  1.00 27.70  ? 306 LEU C CA    1 
ATOM   8381  C  C     . LEU C  1 334 ? -34.032 -0.632  0.720   1.00 28.48  ? 306 LEU C C     1 
ATOM   8382  O  O     . LEU C  1 334 ? -33.039 -1.223  1.158   1.00 28.94  ? 306 LEU C O     1 
ATOM   8383  C  CB    . LEU C  1 334 ? -34.295 -0.404  -1.752  1.00 25.02  ? 306 LEU C CB    1 
ATOM   8384  C  CG    . LEU C  1 334 ? -34.805 -0.970  -3.080  1.00 31.49  ? 306 LEU C CG    1 
ATOM   8385  C  CD1   . LEU C  1 334 ? -34.457 -0.037  -4.245  1.00 27.45  ? 306 LEU C CD1   1 
ATOM   8386  C  CD2   . LEU C  1 334 ? -34.288 -2.422  -3.321  1.00 28.26  ? 306 LEU C CD2   1 
ATOM   8387  N  N     . ALA C  1 335 ? -34.507 0.497   1.260   1.00 29.86  ? 307 ALA C N     1 
ATOM   8388  C  CA    . ALA C  1 335 ? -33.917 1.067   2.461   1.00 31.10  ? 307 ALA C CA    1 
ATOM   8389  C  C     . ALA C  1 335 ? -34.080 0.091   3.633   1.00 31.71  ? 307 ALA C C     1 
ATOM   8390  O  O     . ALA C  1 335 ? -33.161 -0.073  4.440   1.00 31.68  ? 307 ALA C O     1 
ATOM   8391  C  CB    . ALA C  1 335 ? -34.551 2.427   2.796   1.00 23.16  ? 307 ALA C CB    1 
ATOM   8392  N  N     . LEU C  1 336 ? -35.240 -0.549  3.729   1.00 28.89  ? 308 LEU C N     1 
ATOM   8393  C  CA    . LEU C  1 336 ? -35.454 -1.529  4.804   1.00 29.57  ? 308 LEU C CA    1 
ATOM   8394  C  C     . LEU C  1 336 ? -34.486 -2.699  4.634   1.00 34.89  ? 308 LEU C C     1 
ATOM   8395  O  O     . LEU C  1 336 ? -33.914 -3.165  5.613   1.00 34.75  ? 308 LEU C O     1 
ATOM   8396  C  CB    . LEU C  1 336 ? -36.910 -2.010  4.842   1.00 28.02  ? 308 LEU C CB    1 
ATOM   8397  C  CG    . LEU C  1 336 ? -37.917 -1.016  5.437   1.00 30.88  ? 308 LEU C CG    1 
ATOM   8398  C  CD1   . LEU C  1 336 ? -39.341 -1.495  5.294   1.00 27.49  ? 308 LEU C CD1   1 
ATOM   8399  C  CD2   . LEU C  1 336 ? -37.596 -0.679  6.900   1.00 29.52  ? 308 LEU C CD2   1 
ATOM   8400  N  N     . ALA C  1 337 ? -34.278 -3.150  3.396   1.00 31.11  ? 309 ALA C N     1 
ATOM   8401  C  CA    . ALA C  1 337 ? -33.304 -4.213  3.131   1.00 31.19  ? 309 ALA C CA    1 
ATOM   8402  C  C     . ALA C  1 337 ? -31.886 -3.780  3.511   1.00 33.19  ? 309 ALA C C     1 
ATOM   8403  O  O     . ALA C  1 337 ? -31.122 -4.552  4.086   1.00 30.98  ? 309 ALA C O     1 
ATOM   8404  C  CB    . ALA C  1 337 ? -33.355 -4.628  1.672   1.00 27.70  ? 309 ALA C CB    1 
ATOM   8405  N  N     . HIS C  1 338 ? -31.549 -2.540  3.177   1.00 31.53  ? 310 HIS C N     1 
ATOM   8406  C  CA    . HIS C  1 338 ? -30.271 -1.923  3.541   1.00 35.34  ? 310 HIS C CA    1 
ATOM   8407  C  C     . HIS C  1 338 ? -30.042 -1.988  5.045   1.00 35.34  ? 310 HIS C C     1 
ATOM   8408  O  O     . HIS C  1 338 ? -28.948 -2.295  5.505   1.00 32.15  ? 310 HIS C O     1 
ATOM   8409  C  CB    . HIS C  1 338 ? -30.242 -0.463  3.061   1.00 33.02  ? 310 HIS C CB    1 
ATOM   8410  C  CG    . HIS C  1 338 ? -29.168 0.375   3.688   1.00 35.13  ? 310 HIS C CG    1 
ATOM   8411  N  ND1   . HIS C  1 338 ? -27.834 0.243   3.365   1.00 33.36  ? 310 HIS C ND1   1 
ATOM   8412  C  CD2   . HIS C  1 338 ? -29.240 1.378   4.601   1.00 36.13  ? 310 HIS C CD2   1 
ATOM   8413  C  CE1   . HIS C  1 338 ? -27.128 1.118   4.064   1.00 37.13  ? 310 HIS C CE1   1 
ATOM   8414  N  NE2   . HIS C  1 338 ? -27.957 1.820   4.820   1.00 38.35  ? 310 HIS C NE2   1 
ATOM   8415  N  N     . PHE C  1 339 ? -31.094 -1.709  5.803   1.00 33.78  ? 311 PHE C N     1 
ATOM   8416  C  CA    . PHE C  1 339 ? -31.012 -1.689  7.257   1.00 35.31  ? 311 PHE C CA    1 
ATOM   8417  C  C     . PHE C  1 339 ? -31.115 -3.098  7.862   1.00 38.30  ? 311 PHE C C     1 
ATOM   8418  O  O     . PHE C  1 339 ? -30.910 -3.257  9.056   1.00 36.17  ? 311 PHE C O     1 
ATOM   8419  C  CB    . PHE C  1 339 ? -32.108 -0.783  7.835   1.00 36.96  ? 311 PHE C CB    1 
ATOM   8420  C  CG    . PHE C  1 339 ? -31.795 0.695   7.752   1.00 34.91  ? 311 PHE C CG    1 
ATOM   8421  C  CD1   . PHE C  1 339 ? -30.562 1.184   8.156   1.00 39.32  ? 311 PHE C CD1   1 
ATOM   8422  C  CD2   . PHE C  1 339 ? -32.738 1.590   7.277   1.00 35.31  ? 311 PHE C CD2   1 
ATOM   8423  C  CE1   . PHE C  1 339 ? -30.265 2.556   8.083   1.00 38.25  ? 311 PHE C CE1   1 
ATOM   8424  C  CE2   . PHE C  1 339 ? -32.453 2.962   7.194   1.00 39.08  ? 311 PHE C CE2   1 
ATOM   8425  C  CZ    . PHE C  1 339 ? -31.212 3.441   7.597   1.00 32.84  ? 311 PHE C CZ    1 
ATOM   8426  N  N     . LYS C  1 340 ? -31.415 -4.099  7.026   1.00 33.55  ? 312 LYS C N     1 
ATOM   8427  C  CA    . LYS C  1 340 ? -31.665 -5.484  7.450   1.00 38.74  ? 312 LYS C CA    1 
ATOM   8428  C  C     . LYS C  1 340 ? -32.747 -5.579  8.512   1.00 40.00  ? 312 LYS C C     1 
ATOM   8429  O  O     . LYS C  1 340 ? -32.628 -6.350  9.459   1.00 42.13  ? 312 LYS C O     1 
ATOM   8430  C  CB    . LYS C  1 340 ? -30.387 -6.133  7.969   1.00 36.27  ? 312 LYS C CB    1 
ATOM   8431  C  CG    . LYS C  1 340 ? -29.360 -6.388  6.888   1.00 46.99  ? 312 LYS C CG    1 
ATOM   8432  C  CD    . LYS C  1 340 ? -28.049 -6.874  7.480   1.00 53.30  ? 312 LYS C CD    1 
ATOM   8433  C  CE    . LYS C  1 340 ? -27.108 -7.333  6.388   1.00 51.21  ? 312 LYS C CE    1 
ATOM   8434  N  NZ    . LYS C  1 340 ? -27.812 -8.309  5.515   1.00 55.58  ? 312 LYS C NZ    1 
ATOM   8435  N  N     . ASP C  1 341 ? -33.815 -4.805  8.338   1.00 40.01  ? 313 ASP C N     1 
ATOM   8436  C  CA    . ASP C  1 341 ? -34.872 -4.696  9.346   1.00 41.26  ? 313 ASP C CA    1 
ATOM   8437  C  C     . ASP C  1 341 ? -35.799 -5.910  9.314   1.00 37.70  ? 313 ASP C C     1 
ATOM   8438  O  O     . ASP C  1 341 ? -36.712 -5.975  8.487   1.00 36.10  ? 313 ASP C O     1 
ATOM   8439  C  CB    . ASP C  1 341 ? -35.661 -3.401  9.114   1.00 39.34  ? 313 ASP C CB    1 
ATOM   8440  C  CG    . ASP C  1 341 ? -36.656 -3.094  10.221  1.00 43.93  ? 313 ASP C CG    1 
ATOM   8441  O  OD1   . ASP C  1 341 ? -36.754 -3.873  11.200  1.00 37.77  ? 313 ASP C OD1   1 
ATOM   8442  O  OD2   . ASP C  1 341 ? -37.336 -2.045  10.104  1.00 42.21  ? 313 ASP C OD2   1 
ATOM   8443  N  N     . ALA C  1 342 ? -35.576 -6.856  10.227  1.00 32.69  ? 314 ALA C N     1 
ATOM   8444  C  CA    . ALA C  1 342 ? -36.348 -8.090  10.241  1.00 32.80  ? 314 ALA C CA    1 
ATOM   8445  C  C     . ALA C  1 342 ? -37.786 -7.847  10.676  1.00 33.45  ? 314 ALA C C     1 
ATOM   8446  O  O     . ALA C  1 342 ? -38.686 -8.590  10.289  1.00 31.40  ? 314 ALA C O     1 
ATOM   8447  C  CB    . ALA C  1 342 ? -35.686 -9.122  11.136  1.00 36.55  ? 314 ALA C CB    1 
ATOM   8448  N  N     . SER C  1 343 ? -38.017 -6.782  11.436  1.00 31.16  ? 315 SER C N     1 
ATOM   8449  C  CA    . SER C  1 343 ? -39.370 -6.483  11.885  1.00 29.22  ? 315 SER C CA    1 
ATOM   8450  C  C     . SER C  1 343 ? -40.277 -6.024  10.729  1.00 35.30  ? 315 SER C C     1 
ATOM   8451  O  O     . SER C  1 343 ? -41.504 -6.003  10.865  1.00 36.32  ? 315 SER C O     1 
ATOM   8452  C  CB    . SER C  1 343 ? -39.345 -5.426  13.003  1.00 36.63  ? 315 SER C CB    1 
ATOM   8453  O  OG    . SER C  1 343 ? -39.362 -4.108  12.485  1.00 42.36  ? 315 SER C OG    1 
ATOM   8454  N  N     . ALA C  1 344 ? -39.680 -5.679  9.588   1.00 29.07  ? 316 ALA C N     1 
ATOM   8455  C  CA    . ALA C  1 344 ? -40.453 -5.474  8.354   1.00 29.78  ? 316 ALA C CA    1 
ATOM   8456  C  C     . ALA C  1 344 ? -40.767 -6.763  7.573   1.00 28.80  ? 316 ALA C C     1 
ATOM   8457  O  O     . ALA C  1 344 ? -41.548 -6.726  6.613   1.00 29.22  ? 316 ALA C O     1 
ATOM   8458  C  CB    . ALA C  1 344 ? -39.714 -4.496  7.423   1.00 31.70  ? 316 ALA C CB    1 
ATOM   8459  N  N     . LEU C  1 345 ? -40.174 -7.895  7.947   1.00 28.54  ? 317 LEU C N     1 
ATOM   8460  C  CA    . LEU C  1 345 ? -40.398 -9.128  7.164   1.00 31.48  ? 317 LEU C CA    1 
ATOM   8461  C  C     . LEU C  1 345 ? -41.882 -9.512  6.975   1.00 27.47  ? 317 LEU C C     1 
ATOM   8462  O  O     . LEU C  1 345 ? -42.272 -9.836  5.850   1.00 32.39  ? 317 LEU C O     1 
ATOM   8463  C  CB    . LEU C  1 345 ? -39.612 -10.311 7.761   1.00 26.60  ? 317 LEU C CB    1 
ATOM   8464  C  CG    . LEU C  1 345 ? -38.100 -10.156 7.534   1.00 27.57  ? 317 LEU C CG    1 
ATOM   8465  C  CD1   . LEU C  1 345 ? -37.316 -11.251 8.217   1.00 27.18  ? 317 LEU C CD1   1 
ATOM   8466  C  CD2   . LEU C  1 345 ? -37.753 -10.100 6.037   1.00 25.55  ? 317 LEU C CD2   1 
ATOM   8467  N  N     . PRO C  1 346 ? -42.720 -9.452  8.035   1.00 29.20  ? 318 PRO C N     1 
ATOM   8468  C  CA    . PRO C  1 346 ? -44.121 -9.821  7.791   1.00 26.36  ? 318 PRO C CA    1 
ATOM   8469  C  C     . PRO C  1 346 ? -44.806 -8.909  6.776   1.00 29.20  ? 318 PRO C C     1 
ATOM   8470  O  O     . PRO C  1 346 ? -45.421 -9.387  5.821   1.00 30.34  ? 318 PRO C O     1 
ATOM   8471  C  CB    . PRO C  1 346 ? -44.770 -9.672  9.178   1.00 28.77  ? 318 PRO C CB    1 
ATOM   8472  C  CG    . PRO C  1 346 ? -43.666 -9.825  10.119  1.00 30.59  ? 318 PRO C CG    1 
ATOM   8473  C  CD    . PRO C  1 346 ? -42.483 -9.198  9.467   1.00 31.45  ? 318 PRO C CD    1 
ATOM   8474  N  N     . GLU C  1 347 ? -44.691 -7.601  6.968   1.00 28.10  ? 319 GLU C N     1 
ATOM   8475  C  CA    . GLU C  1 347 ? -45.299 -6.670  6.018   1.00 29.42  ? 319 GLU C CA    1 
ATOM   8476  C  C     . GLU C  1 347 ? -44.768 -6.845  4.583   1.00 27.36  ? 319 GLU C C     1 
ATOM   8477  O  O     . GLU C  1 347 ? -45.543 -6.809  3.627   1.00 26.40  ? 319 GLU C O     1 
ATOM   8478  C  CB    . GLU C  1 347 ? -45.099 -5.227  6.486   1.00 29.46  ? 319 GLU C CB    1 
ATOM   8479  C  CG    . GLU C  1 347 ? -45.630 -4.193  5.507   1.00 35.36  ? 319 GLU C CG    1 
ATOM   8480  C  CD    . GLU C  1 347 ? -47.099 -4.377  5.172   1.00 45.59  ? 319 GLU C CD    1 
ATOM   8481  O  OE1   . GLU C  1 347 ? -47.838 -4.955  6.003   1.00 49.65  ? 319 GLU C OE1   1 
ATOM   8482  O  OE2   . GLU C  1 347 ? -47.511 -3.945  4.067   1.00 47.67  ? 319 GLU C OE2   1 
ATOM   8483  N  N     . LEU C  1 348 ? -43.463 -7.056  4.425   1.00 28.64  ? 320 LEU C N     1 
ATOM   8484  C  CA    . LEU C  1 348 ? -42.903 -7.283  3.088   1.00 25.15  ? 320 LEU C CA    1 
ATOM   8485  C  C     . LEU C  1 348 ? -43.480 -8.533  2.431   1.00 29.78  ? 320 LEU C C     1 
ATOM   8486  O  O     . LEU C  1 348 ? -43.711 -8.555  1.224   1.00 26.73  ? 320 LEU C O     1 
ATOM   8487  C  CB    . LEU C  1 348 ? -41.375 -7.382  3.144   1.00 27.08  ? 320 LEU C CB    1 
ATOM   8488  C  CG    . LEU C  1 348 ? -40.663 -6.065  3.462   1.00 27.65  ? 320 LEU C CG    1 
ATOM   8489  C  CD1   . LEU C  1 348 ? -39.189 -6.312  3.778   1.00 28.84  ? 320 LEU C CD1   1 
ATOM   8490  C  CD2   . LEU C  1 348 ? -40.820 -5.059  2.304   1.00 28.94  ? 320 LEU C CD2   1 
ATOM   8491  N  N     . THR C  1 349 ? -43.715 -9.564  3.245   1.00 27.66  ? 321 THR C N     1 
ATOM   8492  C  CA    . THR C  1 349 ? -44.319 -10.805 2.795   1.00 29.20  ? 321 THR C CA    1 
ATOM   8493  C  C     . THR C  1 349 ? -45.739 -10.573 2.314   1.00 26.52  ? 321 THR C C     1 
ATOM   8494  O  O     . THR C  1 349 ? -46.160 -11.113 1.294   1.00 24.23  ? 321 THR C O     1 
ATOM   8495  C  CB    . THR C  1 349 ? -44.325 -11.864 3.948   1.00 22.44  ? 321 THR C CB    1 
ATOM   8496  O  OG1   . THR C  1 349 ? -42.977 -12.182 4.283   1.00 23.84  ? 321 THR C OG1   1 
ATOM   8497  C  CG2   . THR C  1 349 ? -45.063 -13.116 3.538   1.00 22.07  ? 321 THR C CG2   1 
ATOM   8498  N  N     . GLU C  1 350 ? -46.494 -9.765  3.050   1.00 25.95  ? 322 GLU C N     1 
ATOM   8499  C  CA    . GLU C  1 350 ? -47.847 -9.454  2.600   1.00 27.50  ? 322 GLU C CA    1 
ATOM   8500  C  C     . GLU C  1 350 ? -47.813 -8.714  1.243   1.00 29.97  ? 322 GLU C C     1 
ATOM   8501  O  O     . GLU C  1 350 ? -48.615 -9.001  0.348   1.00 30.19  ? 322 GLU C O     1 
ATOM   8502  C  CB    . GLU C  1 350 ? -48.584 -8.626  3.652   1.00 32.65  ? 322 GLU C CB    1 
ATOM   8503  C  CG    . GLU C  1 350 ? -49.999 -8.255  3.235   1.00 34.98  ? 322 GLU C CG    1 
ATOM   8504  C  CD    . GLU C  1 350 ? -50.794 -7.610  4.348   1.00 39.36  ? 322 GLU C CD    1 
ATOM   8505  O  OE1   . GLU C  1 350 ? -50.805 -8.150  5.473   1.00 36.78  ? 322 GLU C OE1   1 
ATOM   8506  O  OE2   . GLU C  1 350 ? -51.410 -6.556  4.095   1.00 48.32  ? 322 GLU C OE2   1 
ATOM   8507  N  N     . LEU C  1 351 ? -46.872 -7.781  1.097   1.00 31.29  ? 323 LEU C N     1 
ATOM   8508  C  CA    . LEU C  1 351 ? -46.723 -7.011  -0.147  1.00 31.02  ? 323 LEU C CA    1 
ATOM   8509  C  C     . LEU C  1 351 ? -46.346 -7.922  -1.314  1.00 28.98  ? 323 LEU C C     1 
ATOM   8510  O  O     . LEU C  1 351 ? -46.944 -7.847  -2.389  1.00 28.03  ? 323 LEU C O     1 
ATOM   8511  C  CB    . LEU C  1 351 ? -45.669 -5.908  0.014   1.00 27.65  ? 323 LEU C CB    1 
ATOM   8512  C  CG    . LEU C  1 351 ? -46.044 -4.632  0.774   1.00 33.55  ? 323 LEU C CG    1 
ATOM   8513  C  CD1   . LEU C  1 351 ? -44.834 -3.719  0.869   1.00 35.27  ? 323 LEU C CD1   1 
ATOM   8514  C  CD2   . LEU C  1 351 ? -47.189 -3.905  0.070   1.00 31.93  ? 323 LEU C CD2   1 
ATOM   8515  N  N     . MET C  1 352 ? -45.352 -8.774  -1.092  1.00 31.68  ? 324 MET C N     1 
ATOM   8516  C  CA    . MET C  1 352 ? -44.950 -9.776  -2.095  1.00 29.21  ? 324 MET C CA    1 
ATOM   8517  C  C     . MET C  1 352 ? -46.128 -10.570 -2.647  1.00 30.80  ? 324 MET C C     1 
ATOM   8518  O  O     . MET C  1 352 ? -46.153 -10.921 -3.829  1.00 34.17  ? 324 MET C O     1 
ATOM   8519  C  CB    . MET C  1 352 ? -43.935 -10.744 -1.510  1.00 28.41  ? 324 MET C CB    1 
ATOM   8520  C  CG    . MET C  1 352 ? -43.659 -11.954 -2.415  1.00 31.55  ? 324 MET C CG    1 
ATOM   8521  S  SD    . MET C  1 352 ? -42.440 -13.042 -1.692  1.00 31.72  ? 324 MET C SD    1 
ATOM   8522  C  CE    . MET C  1 352 ? -43.398 -13.667 -0.302  1.00 26.57  ? 324 MET C CE    1 
ATOM   8523  N  N     . HIS C  1 353 ? -47.113 -10.839 -1.796  1.00 31.29  ? 325 HIS C N     1 
ATOM   8524  C  CA    . HIS C  1 353 ? -48.284 -11.607 -2.219  1.00 33.97  ? 325 HIS C CA    1 
ATOM   8525  C  C     . HIS C  1 353 ? -49.412 -10.763 -2.807  1.00 30.60  ? 325 HIS C C     1 
ATOM   8526  O  O     . HIS C  1 353 ? -50.053 -11.171 -3.763  1.00 34.56  ? 325 HIS C O     1 
ATOM   8527  C  CB    . HIS C  1 353 ? -48.838 -12.413 -1.036  1.00 29.98  ? 325 HIS C CB    1 
ATOM   8528  C  CG    . HIS C  1 353 ? -48.015 -13.618 -0.689  1.00 30.11  ? 325 HIS C CG    1 
ATOM   8529  N  ND1   . HIS C  1 353 ? -47.734 -14.610 -1.601  1.00 31.76  ? 325 HIS C ND1   1 
ATOM   8530  C  CD2   . HIS C  1 353 ? -47.413 -13.986 0.466   1.00 29.94  ? 325 HIS C CD2   1 
ATOM   8531  C  CE1   . HIS C  1 353 ? -46.992 -15.539 -1.024  1.00 31.40  ? 325 HIS C CE1   1 
ATOM   8532  N  NE2   . HIS C  1 353 ? -46.783 -15.184 0.229   1.00 30.79  ? 325 HIS C NE2   1 
ATOM   8533  N  N     . LYS C  1 354 ? -49.675 -9.605  -2.217  1.00 29.60  ? 326 LYS C N     1 
ATOM   8534  C  CA    . LYS C  1 354 ? -50.938 -8.920  -2.483  1.00 36.34  ? 326 LYS C CA    1 
ATOM   8535  C  C     . LYS C  1 354 ? -50.840 -7.592  -3.247  1.00 34.81  ? 326 LYS C C     1 
ATOM   8536  O  O     . LYS C  1 354 ? -51.836 -7.155  -3.826  1.00 33.32  ? 326 LYS C O     1 
ATOM   8537  C  CB    . LYS C  1 354 ? -51.692 -8.677  -1.163  1.00 36.32  ? 326 LYS C CB    1 
ATOM   8538  C  CG    . LYS C  1 354 ? -52.394 -9.924  -0.602  1.00 38.76  ? 326 LYS C CG    1 
ATOM   8539  C  CD    . LYS C  1 354 ? -52.902 -10.860 -1.722  1.00 41.29  ? 326 LYS C CD    1 
ATOM   8540  C  CE    . LYS C  1 354 ? -53.618 -12.110 -1.168  1.00 45.45  ? 326 LYS C CE    1 
ATOM   8541  N  NZ    . LYS C  1 354 ? -53.624 -13.309 -2.096  1.00 49.14  ? 326 LYS C NZ    1 
ATOM   8542  N  N     . ASP C  1 355 ? -49.675 -6.947  -3.270  1.00 33.82  ? 327 ASP C N     1 
ATOM   8543  C  CA    . ASP C  1 355 ? -49.588 -5.669  -3.991  1.00 28.69  ? 327 ASP C CA    1 
ATOM   8544  C  C     . ASP C  1 355 ? -49.875 -5.865  -5.485  1.00 28.59  ? 327 ASP C C     1 
ATOM   8545  O  O     . ASP C  1 355 ? -49.308 -6.739  -6.111  1.00 31.11  ? 327 ASP C O     1 
ATOM   8546  C  CB    . ASP C  1 355 ? -48.226 -5.000  -3.813  1.00 24.51  ? 327 ASP C CB    1 
ATOM   8547  C  CG    . ASP C  1 355 ? -48.247 -3.506  -4.249  1.00 32.49  ? 327 ASP C CG    1 
ATOM   8548  O  OD1   . ASP C  1 355 ? -48.171 -3.201  -5.462  1.00 29.77  ? 327 ASP C OD1   1 
ATOM   8549  O  OD2   . ASP C  1 355 ? -48.361 -2.640  -3.368  1.00 25.78  ? 327 ASP C OD2   1 
ATOM   8550  N  N     . PRO C  1 356 ? -50.774 -5.039  -6.061  1.00 36.60  ? 328 PRO C N     1 
ATOM   8551  C  CA    . PRO C  1 356 ? -51.128 -5.182  -7.481  1.00 34.40  ? 328 PRO C CA    1 
ATOM   8552  C  C     . PRO C  1 356 ? -49.986 -4.855  -8.446  1.00 30.81  ? 328 PRO C C     1 
ATOM   8553  O  O     . PRO C  1 356 ? -50.130 -5.117  -9.638  1.00 33.10  ? 328 PRO C O     1 
ATOM   8554  C  CB    . PRO C  1 356 ? -52.276 -4.181  -7.656  1.00 34.08  ? 328 PRO C CB    1 
ATOM   8555  C  CG    . PRO C  1 356 ? -52.055 -3.168  -6.591  1.00 34.22  ? 328 PRO C CG    1 
ATOM   8556  C  CD    . PRO C  1 356 ? -51.511 -3.934  -5.421  1.00 30.90  ? 328 PRO C CD    1 
ATOM   8557  N  N     . ARG C  1 357 ? -48.871 -4.324  -7.948  1.00 27.62  ? 329 ARG C N     1 
ATOM   8558  C  CA    . ARG C  1 357 ? -47.798 -3.834  -8.819  1.00 31.40  ? 329 ARG C CA    1 
ATOM   8559  C  C     . ARG C  1 357 ? -46.564 -4.735  -8.768  1.00 29.18  ? 329 ARG C C     1 
ATOM   8560  O  O     . ARG C  1 357 ? -45.963 -4.882  -7.712  1.00 30.83  ? 329 ARG C O     1 
ATOM   8561  C  CB    . ARG C  1 357 ? -47.415 -2.392  -8.417  1.00 30.34  ? 329 ARG C CB    1 
ATOM   8562  C  CG    . ARG C  1 357 ? -48.566 -1.379  -8.493  1.00 34.08  ? 329 ARG C CG    1 
ATOM   8563  C  CD    . ARG C  1 357 ? -48.299 -0.147  -7.630  1.00 29.49  ? 329 ARG C CD    1 
ATOM   8564  N  NE    . ARG C  1 357 ? -48.171 -0.507  -6.215  1.00 32.21  ? 329 ARG C NE    1 
ATOM   8565  C  CZ    . ARG C  1 357 ? -47.811 0.341   -5.260  1.00 33.20  ? 329 ARG C CZ    1 
ATOM   8566  N  NH1   . ARG C  1 357 ? -47.540 1.600   -5.574  1.00 33.74  ? 329 ARG C NH1   1 
ATOM   8567  N  NH2   . ARG C  1 357 ? -47.722 -0.060  -3.993  1.00 23.51  ? 329 ARG C NH2   1 
ATOM   8568  N  N     . PRO C  1 358 ? -46.167 -5.327  -9.914  1.00 32.06  ? 330 PRO C N     1 
ATOM   8569  C  CA    . PRO C  1 358 ? -45.064 -6.302  -9.937  1.00 30.68  ? 330 PRO C CA    1 
ATOM   8570  C  C     . PRO C  1 358 ? -43.754 -5.768  -9.369  1.00 30.55  ? 330 PRO C C     1 
ATOM   8571  O  O     . PRO C  1 358 ? -43.049 -6.505  -8.676  1.00 26.74  ? 330 PRO C O     1 
ATOM   8572  C  CB    . PRO C  1 358 ? -44.909 -6.621  -11.434 1.00 30.36  ? 330 PRO C CB    1 
ATOM   8573  C  CG    . PRO C  1 358 ? -46.270 -6.402  -11.987 1.00 33.53  ? 330 PRO C CG    1 
ATOM   8574  C  CD    . PRO C  1 358 ? -46.817 -5.211  -11.232 1.00 30.12  ? 330 PRO C CD    1 
ATOM   8575  N  N     . VAL C  1 359 ? -43.428 -4.509  -9.666  1.00 32.31  ? 331 VAL C N     1 
ATOM   8576  C  CA    . VAL C  1 359 ? -42.224 -3.881  -9.135  1.00 28.93  ? 331 VAL C CA    1 
ATOM   8577  C  C     . VAL C  1 359 ? -42.218 -3.920  -7.598  1.00 27.86  ? 331 VAL C C     1 
ATOM   8578  O  O     . VAL C  1 359 ? -41.173 -4.108  -6.975  1.00 28.69  ? 331 VAL C O     1 
ATOM   8579  C  CB    . VAL C  1 359 ? -42.099 -2.404  -9.623  1.00 31.79  ? 331 VAL C CB    1 
ATOM   8580  C  CG1   . VAL C  1 359 ? -41.078 -1.644  -8.810  1.00 24.03  ? 331 VAL C CG1   1 
ATOM   8581  C  CG2   . VAL C  1 359 ? -41.764 -2.357  -11.108 1.00 33.77  ? 331 VAL C CG2   1 
ATOM   8582  N  N     . ILE C  1 360 ? -43.386 -3.739  -6.990  1.00 24.33  ? 332 ILE C N     1 
ATOM   8583  C  CA    . ILE C  1 360 ? -43.489 -3.772  -5.525  1.00 28.36  ? 332 ILE C CA    1 
ATOM   8584  C  C     . ILE C  1 360 ? -43.465 -5.225  -4.985  1.00 28.26  ? 332 ILE C C     1 
ATOM   8585  O  O     . ILE C  1 360 ? -42.721 -5.518  -4.039  1.00 32.15  ? 332 ILE C O     1 
ATOM   8586  C  CB    . ILE C  1 360 ? -44.759 -3.050  -5.041  1.00 25.44  ? 332 ILE C CB    1 
ATOM   8587  C  CG1   . ILE C  1 360 ? -44.739 -1.579  -5.477  1.00 29.29  ? 332 ILE C CG1   1 
ATOM   8588  C  CG2   . ILE C  1 360 ? -44.889 -3.099  -3.514  1.00 25.19  ? 332 ILE C CG2   1 
ATOM   8589  C  CD1   . ILE C  1 360 ? -43.602 -0.767  -4.835  1.00 27.91  ? 332 ILE C CD1   1 
ATOM   8590  N  N     . ARG C  1 361 ? -44.255 -6.127  -5.575  1.00 28.04  ? 333 ARG C N     1 
ATOM   8591  C  CA    . ARG C  1 361 ? -44.169 -7.558  -5.207  1.00 29.16  ? 333 ARG C CA    1 
ATOM   8592  C  C     . ARG C  1 361 ? -42.736 -8.047  -5.316  1.00 26.48  ? 333 ARG C C     1 
ATOM   8593  O  O     . ARG C  1 361 ? -42.195 -8.573  -4.359  1.00 24.19  ? 333 ARG C O     1 
ATOM   8594  C  CB    . ARG C  1 361 ? -45.078 -8.437  -6.080  1.00 28.33  ? 333 ARG C CB    1 
ATOM   8595  C  CG    . ARG C  1 361 ? -46.568 -8.160  -5.893  1.00 30.24  ? 333 ARG C CG    1 
ATOM   8596  C  CD    . ARG C  1 361 ? -47.456 -9.308  -6.365  1.00 29.48  ? 333 ARG C CD    1 
ATOM   8597  N  NE    . ARG C  1 361 ? -47.231 -9.719  -7.761  1.00 29.96  ? 333 ARG C NE    1 
ATOM   8598  C  CZ    . ARG C  1 361 ? -47.680 -9.050  -8.820  1.00 34.36  ? 333 ARG C CZ    1 
ATOM   8599  N  NH1   . ARG C  1 361 ? -48.351 -7.898  -8.664  1.00 30.78  ? 333 ARG C NH1   1 
ATOM   8600  N  NH2   . ARG C  1 361 ? -47.435 -9.513  -10.037 1.00 30.25  ? 333 ARG C NH2   1 
ATOM   8601  N  N     . GLY C  1 362 ? -42.110 -7.831  -6.470  1.00 25.91  ? 334 GLY C N     1 
ATOM   8602  C  CA    . GLY C  1 362 ? -40.752 -8.302  -6.696  1.00 27.12  ? 334 GLY C CA    1 
ATOM   8603  C  C     . GLY C  1 362 ? -39.660 -7.700  -5.816  1.00 29.53  ? 334 GLY C C     1 
ATOM   8604  O  O     . GLY C  1 362 ? -38.791 -8.412  -5.277  1.00 29.01  ? 334 GLY C O     1 
ATOM   8605  N  N     . THR C  1 363 ? -39.687 -6.380  -5.658  1.00 28.85  ? 335 THR C N     1 
ATOM   8606  C  CA    . THR C  1 363 ? -38.682 -5.730  -4.829  1.00 27.09  ? 335 THR C CA    1 
ATOM   8607  C  C     . THR C  1 363 ? -38.846 -6.197  -3.393  1.00 24.55  ? 335 THR C C     1 
ATOM   8608  O  O     . THR C  1 363 ? -37.860 -6.381  -2.690  1.00 23.73  ? 335 THR C O     1 
ATOM   8609  C  CB    . THR C  1 363 ? -38.767 -4.184  -4.913  1.00 28.91  ? 335 THR C CB    1 
ATOM   8610  O  OG1   . THR C  1 363 ? -38.604 -3.768  -6.281  1.00 30.06  ? 335 THR C OG1   1 
ATOM   8611  C  CG2   . THR C  1 363 ? -37.696 -3.519  -4.036  1.00 25.05  ? 335 THR C CG2   1 
ATOM   8612  N  N     . ALA C  1 364 ? -40.090 -6.401  -2.968  1.00 22.55  ? 336 ALA C N     1 
ATOM   8613  C  CA    . ALA C  1 364 ? -40.354 -6.893  -1.612  1.00 28.97  ? 336 ALA C CA    1 
ATOM   8614  C  C     . ALA C  1 364 ? -39.732 -8.284  -1.396  1.00 23.27  ? 336 ALA C C     1 
ATOM   8615  O  O     . ALA C  1 364 ? -39.122 -8.551  -0.360  1.00 26.99  ? 336 ALA C O     1 
ATOM   8616  C  CB    . ALA C  1 364 ? -41.862 -6.933  -1.332  1.00 26.70  ? 336 ALA C CB    1 
ATOM   8617  N  N     . ALA C  1 365 ? -39.872 -9.150  -2.388  1.00 26.48  ? 337 ALA C N     1 
ATOM   8618  C  CA    . ALA C  1 365 ? -39.360 -10.516 -2.293  1.00 27.31  ? 337 ALA C CA    1 
ATOM   8619  C  C     . ALA C  1 365 ? -37.830 -10.481 -2.255  1.00 26.57  ? 337 ALA C C     1 
ATOM   8620  O  O     . ALA C  1 365 ? -37.192 -11.180 -1.472  1.00 28.89  ? 337 ALA C O     1 
ATOM   8621  C  CB    . ALA C  1 365 ? -39.866 -11.345 -3.455  1.00 25.50  ? 337 ALA C CB    1 
ATOM   8622  N  N     . TRP C  1 366 ? -37.244 -9.639  -3.091  1.00 26.04  ? 338 TRP C N     1 
ATOM   8623  C  CA    . TRP C  1 366 ? -35.804 -9.437  -3.062  1.00 26.20  ? 338 TRP C CA    1 
ATOM   8624  C  C     . TRP C  1 366 ? -35.364 -8.968  -1.672  1.00 28.31  ? 338 TRP C C     1 
ATOM   8625  O  O     . TRP C  1 366 ? -34.371 -9.441  -1.132  1.00 31.93  ? 338 TRP C O     1 
ATOM   8626  C  CB    . TRP C  1 366 ? -35.375 -8.417  -4.136  1.00 21.28  ? 338 TRP C CB    1 
ATOM   8627  C  CG    . TRP C  1 366 ? -33.877 -8.198  -4.179  1.00 24.31  ? 338 TRP C CG    1 
ATOM   8628  C  CD1   . TRP C  1 366 ? -32.972 -8.900  -4.919  1.00 28.97  ? 338 TRP C CD1   1 
ATOM   8629  C  CD2   . TRP C  1 366 ? -33.118 -7.211  -3.453  1.00 27.22  ? 338 TRP C CD2   1 
ATOM   8630  N  NE1   . TRP C  1 366 ? -31.702 -8.416  -4.699  1.00 27.15  ? 338 TRP C NE1   1 
ATOM   8631  C  CE2   . TRP C  1 366 ? -31.762 -7.386  -3.802  1.00 27.62  ? 338 TRP C CE2   1 
ATOM   8632  C  CE3   . TRP C  1 366 ? -33.460 -6.186  -2.553  1.00 27.72  ? 338 TRP C CE3   1 
ATOM   8633  C  CZ2   . TRP C  1 366 ? -30.742 -6.581  -3.287  1.00 30.31  ? 338 TRP C CZ2   1 
ATOM   8634  C  CZ3   . TRP C  1 366 ? -32.445 -5.387  -2.032  1.00 26.96  ? 338 TRP C CZ3   1 
ATOM   8635  C  CH2   . TRP C  1 366 ? -31.100 -5.588  -2.404  1.00 28.28  ? 338 TRP C CH2   1 
ATOM   8636  N  N     . ALA C  1 367 ? -36.115 -8.040  -1.091  1.00 27.17  ? 339 ALA C N     1 
ATOM   8637  C  CA    . ALA C  1 367 ? -35.731 -7.474  0.209   1.00 32.61  ? 339 ALA C CA    1 
ATOM   8638  C  C     . ALA C  1 367 ? -35.814 -8.541  1.311   1.00 30.70  ? 339 ALA C C     1 
ATOM   8639  O  O     . ALA C  1 367 ? -34.973 -8.589  2.204   1.00 32.30  ? 339 ALA C O     1 
ATOM   8640  C  CB    . ALA C  1 367 ? -36.601 -6.298  0.556   1.00 22.44  ? 339 ALA C CB    1 
ATOM   8641  N  N     . ILE C  1 368 ? -36.825 -9.395  1.239   1.00 30.58  ? 340 ILE C N     1 
ATOM   8642  C  CA    . ILE C  1 368 ? -36.933 -10.516 2.181   1.00 28.31  ? 340 ILE C CA    1 
ATOM   8643  C  C     . ILE C  1 368 ? -35.642 -11.348 2.169   1.00 28.20  ? 340 ILE C C     1 
ATOM   8644  O  O     . ILE C  1 368 ? -35.078 -11.640 3.218   1.00 33.47  ? 340 ILE C O     1 
ATOM   8645  C  CB    . ILE C  1 368 ? -38.156 -11.390 1.846   1.00 27.67  ? 340 ILE C CB    1 
ATOM   8646  C  CG1   . ILE C  1 368 ? -39.437 -10.646 2.247   1.00 26.20  ? 340 ILE C CG1   1 
ATOM   8647  C  CG2   . ILE C  1 368 ? -38.063 -12.781 2.520   1.00 27.57  ? 340 ILE C CG2   1 
ATOM   8648  C  CD1   . ILE C  1 368 ? -40.690 -11.198 1.564   1.00 22.59  ? 340 ILE C CD1   1 
ATOM   8649  N  N     . GLY C  1 369 ? -35.166 -11.717 0.987   1.00 27.73  ? 341 GLY C N     1 
ATOM   8650  C  CA    . GLY C  1 369 ? -33.908 -12.446 0.871   1.00 31.01  ? 341 GLY C CA    1 
ATOM   8651  C  C     . GLY C  1 369 ? -32.687 -11.662 1.351   1.00 34.84  ? 341 GLY C C     1 
ATOM   8652  O  O     . GLY C  1 369 ? -31.847 -12.180 2.086   1.00 30.92  ? 341 GLY C O     1 
ATOM   8653  N  N     . LYS C  1 370 ? -32.582 -10.401 0.930   1.00 33.88  ? 342 LYS C N     1 
ATOM   8654  C  CA    . LYS C  1 370 ? -31.451 -9.551  1.316   1.00 30.58  ? 342 LYS C CA    1 
ATOM   8655  C  C     . LYS C  1 370 ? -31.364 -9.330  2.837   1.00 34.99  ? 342 LYS C C     1 
ATOM   8656  O  O     . LYS C  1 370 ? -30.261 -9.237  3.406   1.00 34.50  ? 342 LYS C O     1 
ATOM   8657  C  CB    . LYS C  1 370 ? -31.544 -8.196  0.598   1.00 33.98  ? 342 LYS C CB    1 
ATOM   8658  C  CG    . LYS C  1 370 ? -30.344 -7.296  0.822   1.00 35.27  ? 342 LYS C CG    1 
ATOM   8659  C  CD    . LYS C  1 370 ? -29.094 -7.841  0.116   1.00 29.78  ? 342 LYS C CD    1 
ATOM   8660  C  CE    . LYS C  1 370 ? -27.875 -7.033  0.533   1.00 36.80  ? 342 LYS C CE    1 
ATOM   8661  N  NZ    . LYS C  1 370 ? -26.673 -7.417  -0.250  1.00 50.61  ? 342 LYS C NZ    1 
ATOM   8662  N  N     . ILE C  1 371 ? -32.523 -9.249  3.494   1.00 31.21  ? 343 ILE C N     1 
ATOM   8663  C  CA    . ILE C  1 371 ? -32.567 -9.033  4.945   1.00 34.17  ? 343 ILE C CA    1 
ATOM   8664  C  C     . ILE C  1 371 ? -31.956 -10.231 5.706   1.00 38.23  ? 343 ILE C C     1 
ATOM   8665  O  O     . ILE C  1 371 ? -31.288 -10.043 6.720   1.00 37.75  ? 343 ILE C O     1 
ATOM   8666  C  CB    . ILE C  1 371 ? -34.007 -8.735  5.424   1.00 31.57  ? 343 ILE C CB    1 
ATOM   8667  C  CG1   . ILE C  1 371 ? -34.377 -7.282  5.068   1.00 30.66  ? 343 ILE C CG1   1 
ATOM   8668  C  CG2   . ILE C  1 371 ? -34.113 -8.875  6.924   1.00 33.29  ? 343 ILE C CG2   1 
ATOM   8669  C  CD1   . ILE C  1 371 ? -35.864 -6.965  5.198   1.00 29.14  ? 343 ILE C CD1   1 
ATOM   8670  N  N     . GLY C  1 372 ? -32.152 -11.449 5.201   1.00 32.76  ? 344 GLY C N     1 
ATOM   8671  C  CA    . GLY C  1 372 ? -31.285 -12.554 5.582   1.00 37.98  ? 344 GLY C CA    1 
ATOM   8672  C  C     . GLY C  1 372 ? -31.765 -13.491 6.670   1.00 40.90  ? 344 GLY C C     1 
ATOM   8673  O  O     . GLY C  1 372 ? -30.970 -14.201 7.273   1.00 41.02  ? 344 GLY C O     1 
ATOM   8674  N  N     . ASP C  1 373 ? -33.068 -13.486 6.924   1.00 45.36  ? 345 ASP C N     1 
ATOM   8675  C  CA    . ASP C  1 373 ? -33.689 -14.394 7.885   1.00 44.05  ? 345 ASP C CA    1 
ATOM   8676  C  C     . ASP C  1 373 ? -34.166 -15.646 7.157   1.00 43.18  ? 345 ASP C C     1 
ATOM   8677  O  O     . ASP C  1 373 ? -35.120 -15.577 6.378   1.00 39.89  ? 345 ASP C O     1 
ATOM   8678  C  CB    . ASP C  1 373 ? -34.858 -13.695 8.579   1.00 41.04  ? 345 ASP C CB    1 
ATOM   8679  C  CG    . ASP C  1 373 ? -35.424 -14.484 9.746   1.00 44.94  ? 345 ASP C CG    1 
ATOM   8680  O  OD1   . ASP C  1 373 ? -36.048 -13.839 10.617  1.00 49.39  ? 345 ASP C OD1   1 
ATOM   8681  O  OD2   . ASP C  1 373 ? -35.256 -15.722 9.800   1.00 47.70  ? 345 ASP C OD2   1 
ATOM   8682  N  N     . PRO C  1 374 ? -33.519 -16.797 7.419   1.00 48.03  ? 346 PRO C N     1 
ATOM   8683  C  CA    . PRO C  1 374 ? -33.798 -18.055 6.704   1.00 39.36  ? 346 PRO C CA    1 
ATOM   8684  C  C     . PRO C  1 374 ? -35.218 -18.548 6.942   1.00 36.89  ? 346 PRO C C     1 
ATOM   8685  O  O     . PRO C  1 374 ? -35.745 -19.334 6.160   1.00 43.97  ? 346 PRO C O     1 
ATOM   8686  C  CB    . PRO C  1 374 ? -32.784 -19.041 7.294   1.00 42.12  ? 346 PRO C CB    1 
ATOM   8687  C  CG    . PRO C  1 374 ? -31.840 -18.226 8.124   1.00 48.05  ? 346 PRO C CG    1 
ATOM   8688  C  CD    . PRO C  1 374 ? -32.576 -16.993 8.529   1.00 47.37  ? 346 PRO C CD    1 
ATOM   8689  N  N     . ALA C  1 375 ? -35.843 -18.073 8.010   1.00 41.48  ? 347 ALA C N     1 
ATOM   8690  C  CA    . ALA C  1 375 ? -37.223 -18.459 8.322   1.00 45.06  ? 347 ALA C CA    1 
ATOM   8691  C  C     . ALA C  1 375 ? -38.210 -18.129 7.197   1.00 42.54  ? 347 ALA C C     1 
ATOM   8692  O  O     . ALA C  1 375 ? -39.261 -18.754 7.092   1.00 41.28  ? 347 ALA C O     1 
ATOM   8693  C  CB    . ALA C  1 375 ? -37.674 -17.790 9.614   1.00 41.71  ? 347 ALA C CB    1 
ATOM   8694  N  N     . TYR C  1 376 ? -37.875 -17.147 6.357   1.00 35.55  ? 348 TYR C N     1 
ATOM   8695  C  CA    . TYR C  1 376 ? -38.780 -16.725 5.307   1.00 31.38  ? 348 TYR C CA    1 
ATOM   8696  C  C     . TYR C  1 376 ? -38.493 -17.444 3.982   1.00 36.17  ? 348 TYR C C     1 
ATOM   8697  O  O     . TYR C  1 376 ? -39.185 -17.215 2.993   1.00 33.75  ? 348 TYR C O     1 
ATOM   8698  C  CB    . TYR C  1 376 ? -38.716 -15.184 5.156   1.00 29.56  ? 348 TYR C CB    1 
ATOM   8699  C  CG    . TYR C  1 376 ? -39.524 -14.525 6.246   1.00 30.83  ? 348 TYR C CG    1 
ATOM   8700  C  CD1   . TYR C  1 376 ? -40.849 -14.151 6.026   1.00 28.27  ? 348 TYR C CD1   1 
ATOM   8701  C  CD2   . TYR C  1 376 ? -38.997 -14.366 7.528   1.00 28.18  ? 348 TYR C CD2   1 
ATOM   8702  C  CE1   . TYR C  1 376 ? -41.608 -13.595 7.040   1.00 26.44  ? 348 TYR C CE1   1 
ATOM   8703  C  CE2   . TYR C  1 376 ? -39.747 -13.818 8.543   1.00 31.18  ? 348 TYR C CE2   1 
ATOM   8704  C  CZ    . TYR C  1 376 ? -41.052 -13.434 8.301   1.00 31.05  ? 348 TYR C CZ    1 
ATOM   8705  O  OH    . TYR C  1 376 ? -41.796 -12.879 9.321   1.00 31.27  ? 348 TYR C OH    1 
ATOM   8706  N  N     . ALA C  1 377 ? -37.501 -18.336 3.980   1.00 35.77  ? 349 ALA C N     1 
ATOM   8707  C  CA    . ALA C  1 377 ? -37.065 -19.020 2.753   1.00 38.10  ? 349 ALA C CA    1 
ATOM   8708  C  C     . ALA C  1 377 ? -38.174 -19.862 2.142   1.00 37.67  ? 349 ALA C C     1 
ATOM   8709  O  O     . ALA C  1 377 ? -38.437 -19.798 0.930   1.00 33.60  ? 349 ALA C O     1 
ATOM   8710  C  CB    . ALA C  1 377 ? -35.838 -19.892 3.028   1.00 33.12  ? 349 ALA C CB    1 
ATOM   8711  N  N     . GLU C  1 378 ? -38.816 -20.651 2.991   1.00 35.69  ? 350 GLU C N     1 
ATOM   8712  C  CA    . GLU C  1 378 ? -39.945 -21.464 2.572   1.00 36.03  ? 350 GLU C CA    1 
ATOM   8713  C  C     . GLU C  1 378 ? -41.050 -20.655 1.912   1.00 31.81  ? 350 GLU C C     1 
ATOM   8714  O  O     . GLU C  1 378 ? -41.522 -21.017 0.842   1.00 34.06  ? 350 GLU C O     1 
ATOM   8715  C  CB    . GLU C  1 378 ? -40.517 -22.221 3.769   1.00 37.44  ? 350 GLU C CB    1 
ATOM   8716  C  CG    . GLU C  1 378 ? -40.052 -23.648 3.840   1.00 46.32  ? 350 GLU C CG    1 
ATOM   8717  C  CD    . GLU C  1 378 ? -40.964 -24.590 3.082   1.00 57.38  ? 350 GLU C CD    1 
ATOM   8718  O  OE1   . GLU C  1 378 ? -41.587 -25.435 3.769   1.00 56.89  ? 350 GLU C OE1   1 
ATOM   8719  O  OE2   . GLU C  1 378 ? -41.054 -24.491 1.819   1.00 49.72  ? 350 GLU C OE2   1 
ATOM   8720  N  N     . GLU C  1 379 ? -41.467 -19.560 2.546   1.00 29.28  ? 351 GLU C N     1 
ATOM   8721  C  CA    . GLU C  1 379 ? -42.534 -18.760 1.968   1.00 33.83  ? 351 GLU C CA    1 
ATOM   8722  C  C     . GLU C  1 379 ? -42.116 -18.090 0.639   1.00 30.98  ? 351 GLU C C     1 
ATOM   8723  O  O     . GLU C  1 379 ? -42.961 -17.849 -0.227  1.00 26.81  ? 351 GLU C O     1 
ATOM   8724  C  CB    . GLU C  1 379 ? -43.010 -17.697 2.960   1.00 37.97  ? 351 GLU C CB    1 
ATOM   8725  C  CG    . GLU C  1 379 ? -44.235 -16.928 2.481   1.00 31.41  ? 351 GLU C CG    1 
ATOM   8726  C  CD    . GLU C  1 379 ? -45.486 -17.779 2.390   1.00 31.92  ? 351 GLU C CD    1 
ATOM   8727  O  OE1   . GLU C  1 379 ? -45.486 -18.936 2.881   1.00 32.65  ? 351 GLU C OE1   1 
ATOM   8728  O  OE2   . GLU C  1 379 ? -46.491 -17.284 1.828   1.00 33.14  ? 351 GLU C OE2   1 
ATOM   8729  N  N     . LEU C  1 380 ? -40.834 -17.774 0.470   1.00 28.50  ? 352 LEU C N     1 
ATOM   8730  C  CA    . LEU C  1 380 ? -40.389 -17.335 -0.859  1.00 28.65  ? 352 LEU C CA    1 
ATOM   8731  C  C     . LEU C  1 380 ? -40.607 -18.489 -1.863  1.00 32.49  ? 352 LEU C C     1 
ATOM   8732  O  O     . LEU C  1 380 ? -41.057 -18.256 -2.992  1.00 32.05  ? 352 LEU C O     1 
ATOM   8733  C  CB    . LEU C  1 380 ? -38.919 -16.904 -0.862  1.00 23.07  ? 352 LEU C CB    1 
ATOM   8734  C  CG    . LEU C  1 380 ? -38.559 -15.575 -0.185  1.00 34.62  ? 352 LEU C CG    1 
ATOM   8735  C  CD1   . LEU C  1 380 ? -37.053 -15.329 -0.263  1.00 30.51  ? 352 LEU C CD1   1 
ATOM   8736  C  CD2   . LEU C  1 380 ? -39.309 -14.410 -0.838  1.00 29.42  ? 352 LEU C CD2   1 
ATOM   8737  N  N     . GLU C  1 381 ? -40.314 -19.726 -1.449  1.00 28.47  ? 353 GLU C N     1 
ATOM   8738  C  CA    . GLU C  1 381 ? -40.421 -20.876 -2.375  1.00 31.03  ? 353 GLU C CA    1 
ATOM   8739  C  C     . GLU C  1 381 ? -41.852 -21.008 -2.830  1.00 30.70  ? 353 GLU C C     1 
ATOM   8740  O  O     . GLU C  1 381 ? -42.130 -21.265 -3.997  1.00 30.84  ? 353 GLU C O     1 
ATOM   8741  C  CB    . GLU C  1 381 ? -39.963 -22.184 -1.726  1.00 31.91  ? 353 GLU C CB    1 
ATOM   8742  C  CG    . GLU C  1 381 ? -38.527 -22.178 -1.226  1.00 37.15  ? 353 GLU C CG    1 
ATOM   8743  C  CD    . GLU C  1 381 ? -37.499 -22.477 -2.306  1.00 55.92  ? 353 GLU C CD    1 
ATOM   8744  O  OE1   . GLU C  1 381 ? -37.873 -22.678 -3.497  1.00 54.69  ? 353 GLU C OE1   1 
ATOM   8745  O  OE2   . GLU C  1 381 ? -36.298 -22.519 -1.949  1.00 58.55  ? 353 GLU C OE2   1 
ATOM   8746  N  N     . LYS C  1 382 ? -42.765 -20.794 -1.891  1.00 33.12  ? 354 LYS C N     1 
ATOM   8747  C  CA    . LYS C  1 382 ? -44.186 -20.944 -2.155  1.00 28.98  ? 354 LYS C CA    1 
ATOM   8748  C  C     . LYS C  1 382 ? -44.730 -19.788 -2.978  1.00 32.25  ? 354 LYS C C     1 
ATOM   8749  O  O     . LYS C  1 382 ? -45.646 -19.966 -3.788  1.00 31.58  ? 354 LYS C O     1 
ATOM   8750  C  CB    . LYS C  1 382 ? -44.947 -21.068 -0.834  1.00 29.42  ? 354 LYS C CB    1 
ATOM   8751  C  CG    . LYS C  1 382 ? -44.668 -22.397 -0.082  1.00 29.05  ? 354 LYS C CG    1 
ATOM   8752  C  CD    . LYS C  1 382 ? -45.473 -22.436 1.203   1.00 29.22  ? 354 LYS C CD    1 
ATOM   8753  C  CE    . LYS C  1 382 ? -45.074 -23.630 2.072   1.00 33.90  ? 354 LYS C CE    1 
ATOM   8754  N  NZ    . LYS C  1 382 ? -45.407 -24.939 1.436   1.00 31.57  ? 354 LYS C NZ    1 
ATOM   8755  N  N     . ALA C  1 383 ? -44.186 -18.592 -2.758  1.00 32.27  ? 355 ALA C N     1 
ATOM   8756  C  CA    . ALA C  1 383 ? -44.577 -17.415 -3.550  1.00 28.74  ? 355 ALA C CA    1 
ATOM   8757  C  C     . ALA C  1 383 ? -44.179 -17.612 -5.010  1.00 30.96  ? 355 ALA C C     1 
ATOM   8758  O  O     . ALA C  1 383 ? -44.937 -17.295 -5.936  1.00 31.74  ? 355 ALA C O     1 
ATOM   8759  C  CB    . ALA C  1 383 ? -43.939 -16.154 -2.977  1.00 32.93  ? 355 ALA C CB    1 
ATOM   8760  N  N     . LEU C  1 384 ? -42.982 -18.154 -5.198  1.00 32.17  ? 356 LEU C N     1 
ATOM   8761  C  CA    . LEU C  1 384 ? -42.470 -18.503 -6.515  1.00 34.95  ? 356 LEU C CA    1 
ATOM   8762  C  C     . LEU C  1 384 ? -43.470 -19.298 -7.351  1.00 37.76  ? 356 LEU C C     1 
ATOM   8763  O  O     . LEU C  1 384 ? -43.671 -19.003 -8.536  1.00 37.55  ? 356 LEU C O     1 
ATOM   8764  C  CB    . LEU C  1 384 ? -41.171 -19.300 -6.381  1.00 31.66  ? 356 LEU C CB    1 
ATOM   8765  C  CG    . LEU C  1 384 ? -40.505 -19.633 -7.716  1.00 33.86  ? 356 LEU C CG    1 
ATOM   8766  C  CD1   . LEU C  1 384 ? -40.232 -18.353 -8.538  1.00 35.00  ? 356 LEU C CD1   1 
ATOM   8767  C  CD2   . LEU C  1 384 ? -39.240 -20.408 -7.453  1.00 38.05  ? 356 LEU C CD2   1 
ATOM   8768  N  N     . GLU C  1 385 ? -44.113 -20.286 -6.737  1.00 33.05  ? 357 GLU C N     1 
ATOM   8769  C  CA    . GLU C  1 385 ? -45.028 -21.151 -7.477  1.00 33.81  ? 357 GLU C CA    1 
ATOM   8770  C  C     . GLU C  1 385 ? -46.384 -20.503 -7.700  1.00 35.83  ? 357 GLU C C     1 
ATOM   8771  O  O     . GLU C  1 385 ? -47.229 -21.054 -8.402  1.00 39.25  ? 357 GLU C O     1 
ATOM   8772  C  CB    . GLU C  1 385 ? -45.212 -22.490 -6.750  1.00 34.44  ? 357 GLU C CB    1 
ATOM   8773  C  CG    . GLU C  1 385 ? -43.912 -23.231 -6.526  1.00 33.21  ? 357 GLU C CG    1 
ATOM   8774  C  CD    . GLU C  1 385 ? -43.141 -23.434 -7.816  1.00 41.66  ? 357 GLU C CD    1 
ATOM   8775  O  OE1   . GLU C  1 385 ? -43.784 -23.746 -8.836  1.00 43.70  ? 357 GLU C OE1   1 
ATOM   8776  O  OE2   . GLU C  1 385 ? -41.899 -23.285 -7.813  1.00 46.28  ? 357 GLU C OE2   1 
ATOM   8777  N  N     . LYS C  1 386 ? -46.610 -19.342 -7.095  1.00 30.85  ? 358 LYS C N     1 
ATOM   8778  C  CA    . LYS C  1 386 ? -47.907 -18.684 -7.237  1.00 34.63  ? 358 LYS C CA    1 
ATOM   8779  C  C     . LYS C  1 386 ? -47.841 -17.384 -8.064  1.00 37.17  ? 358 LYS C C     1 
ATOM   8780  O  O     . LYS C  1 386 ? -48.850 -16.954 -8.641  1.00 34.88  ? 358 LYS C O     1 
ATOM   8781  C  CB    . LYS C  1 386 ? -48.499 -18.397 -5.854  1.00 29.12  ? 358 LYS C CB    1 
ATOM   8782  C  CG    . LYS C  1 386 ? -48.716 -19.667 -5.009  1.00 33.28  ? 358 LYS C CG    1 
ATOM   8783  C  CD    . LYS C  1 386 ? -49.166 -19.338 -3.591  1.00 36.70  ? 358 LYS C CD    1 
ATOM   8784  C  CE    . LYS C  1 386 ? -50.679 -19.170 -3.482  1.00 28.53  ? 358 LYS C CE    1 
ATOM   8785  N  NZ    . LYS C  1 386 ? -51.074 -18.932 -2.039  1.00 31.21  ? 358 LYS C NZ    1 
ATOM   8786  N  N     . GLU C  1 387 ? -46.666 -16.759 -8.107  1.00 34.37  ? 359 GLU C N     1 
ATOM   8787  C  CA    . GLU C  1 387 ? -46.490 -15.501 -8.838  1.00 33.78  ? 359 GLU C CA    1 
ATOM   8788  C  C     . GLU C  1 387 ? -46.545 -15.745 -10.342 1.00 35.12  ? 359 GLU C C     1 
ATOM   8789  O  O     . GLU C  1 387 ? -45.847 -16.614 -10.852 1.00 38.49  ? 359 GLU C O     1 
ATOM   8790  C  CB    . GLU C  1 387 ? -45.163 -14.845 -8.458  1.00 33.23  ? 359 GLU C CB    1 
ATOM   8791  C  CG    . GLU C  1 387 ? -44.834 -13.583 -9.253  1.00 31.81  ? 359 GLU C CG    1 
ATOM   8792  C  CD    . GLU C  1 387 ? -45.866 -12.490 -9.025  1.00 39.14  ? 359 GLU C CD    1 
ATOM   8793  O  OE1   . GLU C  1 387 ? -46.053 -12.097 -7.840  1.00 32.59  ? 359 GLU C OE1   1 
ATOM   8794  O  OE2   . GLU C  1 387 ? -46.503 -12.049 -10.020 1.00 36.66  ? 359 GLU C OE2   1 
ATOM   8795  N  N     . LYS C  1 388 ? -47.362 -14.980 -11.058 1.00 34.90  ? 360 LYS C N     1 
ATOM   8796  C  CA    . LYS C  1 388 ? -47.477 -15.193 -12.503 1.00 38.88  ? 360 LYS C CA    1 
ATOM   8797  C  C     . LYS C  1 388 ? -46.677 -14.195 -13.342 1.00 37.56  ? 360 LYS C C     1 
ATOM   8798  O  O     . LYS C  1 388 ? -46.355 -14.494 -14.484 1.00 43.84  ? 360 LYS C O     1 
ATOM   8799  C  CB    . LYS C  1 388 ? -48.950 -15.168 -12.930 1.00 41.21  ? 360 LYS C CB    1 
ATOM   8800  C  CG    . LYS C  1 388 ? -49.780 -16.329 -12.338 1.00 43.96  ? 360 LYS C CG    1 
ATOM   8801  C  CD    . LYS C  1 388 ? -49.125 -17.689 -12.572 1.00 44.33  ? 360 LYS C CD    1 
ATOM   8802  C  CE    . LYS C  1 388 ? -49.809 -18.776 -11.733 1.00 52.72  ? 360 LYS C CE    1 
ATOM   8803  N  NZ    . LYS C  1 388 ? -49.169 -20.130 -11.857 1.00 54.47  ? 360 LYS C NZ    1 
ATOM   8804  N  N     . ASP C  1 389 ? -46.353 -13.025 -12.792 1.00 35.68  ? 361 ASP C N     1 
ATOM   8805  C  CA    . ASP C  1 389 ? -45.519 -12.050 -13.505 1.00 35.38  ? 361 ASP C CA    1 
ATOM   8806  C  C     . ASP C  1 389 ? -44.060 -12.501 -13.546 1.00 33.60  ? 361 ASP C C     1 
ATOM   8807  O  O     . ASP C  1 389 ? -43.472 -12.777 -12.504 1.00 32.05  ? 361 ASP C O     1 
ATOM   8808  C  CB    . ASP C  1 389 ? -45.606 -10.668 -12.844 1.00 37.19  ? 361 ASP C CB    1 
ATOM   8809  C  CG    . ASP C  1 389 ? -44.753 -9.626  -13.565 1.00 34.84  ? 361 ASP C CG    1 
ATOM   8810  O  OD1   . ASP C  1 389 ? -45.305 -8.861  -14.379 1.00 31.82  ? 361 ASP C OD1   1 
ATOM   8811  O  OD2   . ASP C  1 389 ? -43.527 -9.585  -13.326 1.00 37.31  ? 361 ASP C OD2   1 
ATOM   8812  N  N     . GLU C  1 390 ? -43.467 -12.556 -14.732 1.00 33.85  ? 362 GLU C N     1 
ATOM   8813  C  CA    . GLU C  1 390 ? -42.157 -13.196 -14.887 1.00 35.36  ? 362 GLU C CA    1 
ATOM   8814  C  C     . GLU C  1 390 ? -41.029 -12.407 -14.225 1.00 32.47  ? 362 GLU C C     1 
ATOM   8815  O  O     . GLU C  1 390 ? -40.070 -12.983 -13.709 1.00 34.46  ? 362 GLU C O     1 
ATOM   8816  C  CB    . GLU C  1 390 ? -41.824 -13.408 -16.376 1.00 39.49  ? 362 GLU C CB    1 
ATOM   8817  C  CG    . GLU C  1 390 ? -42.555 -14.576 -17.073 1.00 40.67  ? 362 GLU C CG    1 
ATOM   8818  C  CD    . GLU C  1 390 ? -42.368 -15.937 -16.394 1.00 44.86  ? 362 GLU C CD    1 
ATOM   8819  O  OE1   . GLU C  1 390 ? -41.289 -16.208 -15.816 1.00 44.63  ? 362 GLU C OE1   1 
ATOM   8820  O  OE2   . GLU C  1 390 ? -43.322 -16.744 -16.430 1.00 51.41  ? 362 GLU C OE2   1 
ATOM   8821  N  N     . GLU C  1 391 ? -41.129 -11.085 -14.272 1.00 33.37  ? 363 GLU C N     1 
ATOM   8822  C  CA    . GLU C  1 391 ? -40.130 -10.238 -13.627 1.00 36.58  ? 363 GLU C CA    1 
ATOM   8823  C  C     . GLU C  1 391 ? -40.229 -10.339 -12.114 1.00 30.65  ? 363 GLU C C     1 
ATOM   8824  O  O     . GLU C  1 391 ? -39.221 -10.392 -11.419 1.00 29.88  ? 363 GLU C O     1 
ATOM   8825  C  CB    . GLU C  1 391 ? -40.285 -8.785  -14.056 1.00 37.34  ? 363 GLU C CB    1 
ATOM   8826  C  CG    . GLU C  1 391 ? -39.899 -8.532  -15.485 1.00 38.60  ? 363 GLU C CG    1 
ATOM   8827  C  CD    . GLU C  1 391 ? -39.905 -7.047  -15.785 1.00 50.67  ? 363 GLU C CD    1 
ATOM   8828  O  OE1   . GLU C  1 391 ? -40.995 -6.514  -16.094 1.00 47.28  ? 363 GLU C OE1   1 
ATOM   8829  O  OE2   . GLU C  1 391 ? -38.828 -6.416  -15.668 1.00 46.90  ? 363 GLU C OE2   1 
ATOM   8830  N  N     . ALA C  1 392 ? -41.449 -10.373 -11.608 1.00 31.17  ? 364 ALA C N     1 
ATOM   8831  C  CA    . ALA C  1 392 ? -41.639 -10.640 -10.189 1.00 31.69  ? 364 ALA C CA    1 
ATOM   8832  C  C     . ALA C  1 392 ? -41.068 -12.013 -9.809  1.00 34.48  ? 364 ALA C C     1 
ATOM   8833  O  O     . ALA C  1 392 ? -40.324 -12.095 -8.832  1.00 33.90  ? 364 ALA C O     1 
ATOM   8834  C  CB    . ALA C  1 392 ? -43.099 -10.536 -9.823  1.00 30.92  ? 364 ALA C CB    1 
ATOM   8835  N  N     . LYS C  1 393 ? -41.373 -13.071 -10.582 1.00 33.70  ? 365 LYS C N     1 
ATOM   8836  C  CA    . LYS C  1 393 ? -40.867 -14.419 -10.268 1.00 34.07  ? 365 LYS C CA    1 
ATOM   8837  C  C     . LYS C  1 393 ? -39.359 -14.387 -10.188 1.00 33.46  ? 365 LYS C C     1 
ATOM   8838  O  O     . LYS C  1 393 ? -38.744 -14.990 -9.319  1.00 30.98  ? 365 LYS C O     1 
ATOM   8839  C  CB    . LYS C  1 393 ? -41.267 -15.475 -11.326 1.00 38.14  ? 365 LYS C CB    1 
ATOM   8840  C  CG    . LYS C  1 393 ? -42.729 -15.873 -11.374 1.00 33.12  ? 365 LYS C CG    1 
ATOM   8841  C  CD    . LYS C  1 393 ? -42.946 -17.027 -12.376 1.00 44.74  ? 365 LYS C CD    1 
ATOM   8842  C  CE    . LYS C  1 393 ? -42.229 -18.301 -11.925 1.00 48.75  ? 365 LYS C CE    1 
ATOM   8843  N  NZ    . LYS C  1 393 ? -42.729 -19.521 -12.625 1.00 55.81  ? 365 LYS C NZ    1 
ATOM   8844  N  N     . LEU C  1 394 ? -38.765 -13.678 -11.133 1.00 30.41  ? 366 LEU C N     1 
ATOM   8845  C  CA    . LEU C  1 394 ? -37.325 -13.566 -11.180 1.00 33.15  ? 366 LEU C CA    1 
ATOM   8846  C  C     . LEU C  1 394 ? -36.784 -12.886 -9.906  1.00 33.11  ? 366 LEU C C     1 
ATOM   8847  O  O     . LEU C  1 394 ? -35.743 -13.270 -9.364  1.00 30.83  ? 366 LEU C O     1 
ATOM   8848  C  CB    . LEU C  1 394 ? -36.925 -12.794 -12.436 1.00 35.40  ? 366 LEU C CB    1 
ATOM   8849  C  CG    . LEU C  1 394 ? -35.497 -12.278 -12.449 1.00 42.50  ? 366 LEU C CG    1 
ATOM   8850  C  CD1   . LEU C  1 394 ? -34.522 -13.435 -12.724 1.00 43.95  ? 366 LEU C CD1   1 
ATOM   8851  C  CD2   . LEU C  1 394 ? -35.396 -11.174 -13.480 1.00 42.04  ? 366 LEU C CD2   1 
ATOM   8852  N  N     . GLU C  1 395 ? -37.497 -11.872 -9.421  1.00 31.37  ? 367 GLU C N     1 
ATOM   8853  C  CA    . GLU C  1 395 ? -37.066 -11.225 -8.197  1.00 27.28  ? 367 GLU C CA    1 
ATOM   8854  C  C     . GLU C  1 395 ? -37.193 -12.211 -7.017  1.00 30.09  ? 367 GLU C C     1 
ATOM   8855  O  O     . GLU C  1 395 ? -36.327 -12.234 -6.139  1.00 28.83  ? 367 GLU C O     1 
ATOM   8856  C  CB    . GLU C  1 395 ? -37.863 -9.944  -7.939  1.00 26.69  ? 367 GLU C CB    1 
ATOM   8857  C  CG    . GLU C  1 395 ? -37.533 -8.755  -8.861  1.00 27.07  ? 367 GLU C CG    1 
ATOM   8858  C  CD    . GLU C  1 395 ? -36.092 -8.280  -8.728  1.00 31.89  ? 367 GLU C CD    1 
ATOM   8859  O  OE1   . GLU C  1 395 ? -35.484 -8.467  -7.656  1.00 30.12  ? 367 GLU C OE1   1 
ATOM   8860  O  OE2   . GLU C  1 395 ? -35.546 -7.753  -9.716  1.00 37.01  ? 367 GLU C OE2   1 
ATOM   8861  N  N     . ILE C  1 396 ? -38.238 -13.036 -7.000  1.00 29.15  ? 368 ILE C N     1 
ATOM   8862  C  CA    . ILE C  1 396 ? -38.361 -14.045 -5.930  1.00 30.82  ? 368 ILE C CA    1 
ATOM   8863  C  C     . ILE C  1 396 ? -37.188 -15.029 -5.991  1.00 28.66  ? 368 ILE C C     1 
ATOM   8864  O  O     . ILE C  1 396 ? -36.615 -15.385 -4.961  1.00 30.06  ? 368 ILE C O     1 
ATOM   8865  C  CB    . ILE C  1 396 ? -39.693 -14.821 -5.997  1.00 34.08  ? 368 ILE C CB    1 
ATOM   8866  C  CG1   . ILE C  1 396 ? -40.876 -13.855 -5.857  1.00 30.02  ? 368 ILE C CG1   1 
ATOM   8867  C  CG2   . ILE C  1 396 ? -39.738 -15.929 -4.913  1.00 28.00  ? 368 ILE C CG2   1 
ATOM   8868  C  CD1   . ILE C  1 396 ? -42.190 -14.431 -6.327  1.00 31.36  ? 368 ILE C CD1   1 
ATOM   8869  N  N     . GLU C  1 397 ? -36.829 -15.428 -7.207  1.00 29.37  ? 369 GLU C N     1 
ATOM   8870  C  CA    . GLU C  1 397 ? -35.652 -16.261 -7.470  1.00 36.85  ? 369 GLU C CA    1 
ATOM   8871  C  C     . GLU C  1 397 ? -34.373 -15.676 -6.865  1.00 33.68  ? 369 GLU C C     1 
ATOM   8872  O  O     . GLU C  1 397 ? -33.645 -16.358 -6.150  1.00 37.44  ? 369 GLU C O     1 
ATOM   8873  C  CB    . GLU C  1 397 ? -35.466 -16.438 -8.986  1.00 34.37  ? 369 GLU C CB    1 
ATOM   8874  C  CG    . GLU C  1 397 ? -36.552 -17.265 -9.685  1.00 41.40  ? 369 GLU C CG    1 
ATOM   8875  C  CD    . GLU C  1 397 ? -36.289 -18.768 -9.637  1.00 51.32  ? 369 GLU C CD    1 
ATOM   8876  O  OE1   . GLU C  1 397 ? -36.663 -19.459 -10.611 1.00 51.86  ? 369 GLU C OE1   1 
ATOM   8877  O  OE2   . GLU C  1 397 ? -35.715 -19.263 -8.635  1.00 51.12  ? 369 GLU C OE2   1 
ATOM   8878  N  N     . LYS C  1 398 ? -34.101 -14.411 -7.179  1.00 32.55  ? 370 LYS C N     1 
ATOM   8879  C  CA    . LYS C  1 398 ? -32.993 -13.682 -6.574  1.00 34.94  ? 370 LYS C CA    1 
ATOM   8880  C  C     . LYS C  1 398 ? -33.075 -13.718 -5.060  1.00 32.36  ? 370 LYS C C     1 
ATOM   8881  O  O     . LYS C  1 398 ? -32.076 -13.941 -4.383  1.00 33.90  ? 370 LYS C O     1 
ATOM   8882  C  CB    . LYS C  1 398 ? -32.968 -12.220 -7.035  1.00 32.35  ? 370 LYS C CB    1 
ATOM   8883  C  CG    . LYS C  1 398 ? -32.835 -11.996 -8.533  1.00 35.52  ? 370 LYS C CG    1 
ATOM   8884  C  CD    . LYS C  1 398 ? -32.656 -10.501 -8.797  1.00 35.87  ? 370 LYS C CD    1 
ATOM   8885  C  CE    . LYS C  1 398 ? -32.953 -10.118 -10.226 1.00 42.98  ? 370 LYS C CE    1 
ATOM   8886  N  NZ    . LYS C  1 398 ? -33.046 -8.623  -10.354 1.00 38.40  ? 370 LYS C NZ    1 
ATOM   8887  N  N     . GLY C  1 399 ? -34.269 -13.489 -4.530  1.00 29.01  ? 371 GLY C N     1 
ATOM   8888  C  CA    . GLY C  1 399 ? -34.460 -13.490 -3.090  1.00 32.21  ? 371 GLY C CA    1 
ATOM   8889  C  C     . GLY C  1 399 ? -34.129 -14.834 -2.455  1.00 32.00  ? 371 GLY C C     1 
ATOM   8890  O  O     . GLY C  1 399 ? -33.475 -14.885 -1.430  1.00 27.20  ? 371 GLY C O     1 
ATOM   8891  N  N     . ILE C  1 400 ? -34.580 -15.923 -3.076  1.00 34.09  ? 372 ILE C N     1 
ATOM   8892  C  CA    . ILE C  1 400 ? -34.264 -17.268 -2.583  1.00 34.34  ? 372 ILE C CA    1 
ATOM   8893  C  C     . ILE C  1 400 ? -32.756 -17.482 -2.584  1.00 35.51  ? 372 ILE C C     1 
ATOM   8894  O  O     . ILE C  1 400 ? -32.183 -17.971 -1.607  1.00 41.65  ? 372 ILE C O     1 
ATOM   8895  C  CB    . ILE C  1 400 ? -34.939 -18.350 -3.429  1.00 35.96  ? 372 ILE C CB    1 
ATOM   8896  C  CG1   . ILE C  1 400 ? -36.457 -18.290 -3.238  1.00 29.86  ? 372 ILE C CG1   1 
ATOM   8897  C  CG2   . ILE C  1 400 ? -34.352 -19.739 -3.105  1.00 33.76  ? 372 ILE C CG2   1 
ATOM   8898  C  CD1   . ILE C  1 400 ? -37.241 -19.028 -4.301  1.00 31.86  ? 372 ILE C CD1   1 
ATOM   8899  N  N     . GLU C  1 401 ? -32.124 -17.081 -3.680  1.00 33.37  ? 373 GLU C N     1 
ATOM   8900  C  CA    . GLU C  1 401 ? -30.684 -17.206 -3.834  1.00 35.06  ? 373 GLU C CA    1 
ATOM   8901  C  C     . GLU C  1 401 ? -29.948 -16.474 -2.721  1.00 42.71  ? 373 GLU C C     1 
ATOM   8902  O  O     . GLU C  1 401 ? -28.981 -16.996 -2.168  1.00 43.77  ? 373 GLU C O     1 
ATOM   8903  C  CB    . GLU C  1 401 ? -30.255 -16.675 -5.208  1.00 37.14  ? 373 GLU C CB    1 
ATOM   8904  C  CG    . GLU C  1 401 ? -28.838 -17.039 -5.617  1.00 46.28  ? 373 GLU C CG    1 
ATOM   8905  C  CD    . GLU C  1 401 ? -28.758 -18.392 -6.344  1.00 59.13  ? 373 GLU C CD    1 
ATOM   8906  O  OE1   . GLU C  1 401 ? -29.822 -18.986 -6.646  1.00 57.95  ? 373 GLU C OE1   1 
ATOM   8907  O  OE2   . GLU C  1 401 ? -27.625 -18.854 -6.622  1.00 57.38  ? 373 GLU C OE2   1 
ATOM   8908  N  N     . LEU C  1 402 ? -30.415 -15.268 -2.385  1.00 38.74  ? 374 LEU C N     1 
ATOM   8909  C  CA    . LEU C  1 402 ? -29.805 -14.490 -1.310  1.00 39.89  ? 374 LEU C CA    1 
ATOM   8910  C  C     . LEU C  1 402 ? -29.916 -15.158 0.059   1.00 43.37  ? 374 LEU C C     1 
ATOM   8911  O  O     . LEU C  1 402 ? -29.007 -15.027 0.886   1.00 46.05  ? 374 LEU C O     1 
ATOM   8912  C  CB    . LEU C  1 402 ? -30.420 -13.094 -1.238  1.00 33.54  ? 374 LEU C CB    1 
ATOM   8913  C  CG    . LEU C  1 402 ? -29.983 -12.129 -2.336  1.00 33.94  ? 374 LEU C CG    1 
ATOM   8914  C  CD1   . LEU C  1 402 ? -30.785 -10.835 -2.235  1.00 33.22  ? 374 LEU C CD1   1 
ATOM   8915  C  CD2   . LEU C  1 402 ? -28.483 -11.844 -2.264  1.00 35.43  ? 374 LEU C CD2   1 
ATOM   8916  N  N     . LEU C  1 403 ? -31.018 -15.862 0.314   1.00 39.11  ? 375 LEU C N     1 
ATOM   8917  C  CA    . LEU C  1 403 ? -31.154 -16.583 1.575   1.00 46.40  ? 375 LEU C CA    1 
ATOM   8918  C  C     . LEU C  1 403 ? -30.321 -17.874 1.569   1.00 52.26  ? 375 LEU C C     1 
ATOM   8919  O  O     . LEU C  1 403 ? -29.811 -18.286 2.608   1.00 62.24  ? 375 LEU C O     1 
ATOM   8920  C  CB    . LEU C  1 403 ? -32.623 -16.903 1.879   1.00 42.54  ? 375 LEU C CB    1 
ATOM   8921  C  CG    . LEU C  1 403 ? -33.440 -15.789 2.538   1.00 46.65  ? 375 LEU C CG    1 
ATOM   8922  C  CD1   . LEU C  1 403 ? -34.842 -16.279 2.894   1.00 37.32  ? 375 LEU C CD1   1 
ATOM   8923  C  CD2   . LEU C  1 403 ? -32.732 -15.227 3.773   1.00 42.80  ? 375 LEU C CD2   1 
ATOM   8924  N  N     . LYS C  1 404 ? -30.199 -18.516 0.411   1.00 48.84  ? 376 LYS C N     1 
ATOM   8925  C  CA    . LYS C  1 404 ? -29.347 -19.701 0.288   1.00 55.70  ? 376 LYS C CA    1 
ATOM   8926  C  C     . LYS C  1 404 ? -27.900 -19.322 0.563   1.00 61.54  ? 376 LYS C C     1 
ATOM   8927  O  O     . LYS C  1 404 ? -27.226 -19.941 1.382   1.00 67.04  ? 376 LYS C O     1 
ATOM   8928  C  CB    . LYS C  1 404 ? -29.460 -20.335 -1.105  1.00 54.07  ? 376 LYS C CB    1 
ATOM   8929  C  CG    . LYS C  1 404 ? -30.800 -21.001 -1.402  1.00 59.79  ? 376 LYS C CG    1 
ATOM   8930  C  CD    . LYS C  1 404 ? -31.211 -21.984 -0.297  1.00 66.61  ? 376 LYS C CD    1 
ATOM   8931  C  CE    . LYS C  1 404 ? -32.656 -22.477 -0.473  1.00 59.11  ? 376 LYS C CE    1 
ATOM   8932  N  NZ    . LYS C  1 404 ? -33.159 -23.220 0.728   1.00 66.74  ? 376 LYS C NZ    1 
ATOM   8933  N  N     . ALA C  1 405 ? -27.443 -18.283 -0.132  1.00 68.18  ? 377 ALA C N     1 
ATOM   8934  C  CA    . ALA C  1 405 ? -26.068 -17.804 -0.037  1.00 70.20  ? 377 ALA C CA    1 
ATOM   8935  C  C     . ALA C  1 405 ? -25.682 -17.427 1.393   1.00 75.76  ? 377 ALA C C     1 
ATOM   8936  O  O     . ALA C  1 405 ? -24.786 -18.046 1.978   1.00 88.44  ? 377 ALA C O     1 
ATOM   8937  C  CB    . ALA C  1 405 ? -25.863 -16.621 -0.965  1.00 60.01  ? 377 ALA C CB    1 
ATOM   8938  N  N     . SER C  1 406 ? -26.359 -16.425 1.953   1.00 70.04  ? 378 SER C N     1 
ATOM   8939  C  CA    . SER C  1 406 ? -26.061 -15.963 3.312   1.00 76.52  ? 378 SER C CA    1 
ATOM   8940  C  C     . SER C  1 406 ? -26.461 -16.998 4.365   1.00 73.38  ? 378 SER C C     1 
ATOM   8941  O  O     . SER C  1 406 ? -26.024 -16.928 5.517   1.00 78.45  ? 378 SER C O     1 
ATOM   8942  C  CB    . SER C  1 406 ? -26.766 -14.632 3.604   1.00 68.49  ? 378 SER C CB    1 
ATOM   8943  O  OG    . SER C  1 406 ? -28.134 -14.836 3.912   1.00 63.11  ? 378 SER C OG    1 
ATOM   8944  N  N     . ASN D  1 30  ? 11.176  52.717  -19.128 1.00 38.10  ? 2   ASN D N     1 
ATOM   8945  C  CA    . ASN D  1 30  ? 9.945   52.120  -19.641 1.00 52.17  ? 2   ASN D CA    1 
ATOM   8946  C  C     . ASN D  1 30  ? 10.002  50.598  -19.486 1.00 55.50  ? 2   ASN D C     1 
ATOM   8947  O  O     . ASN D  1 30  ? 9.466   50.051  -18.524 1.00 50.49  ? 2   ASN D O     1 
ATOM   8948  C  CB    . ASN D  1 30  ? 9.710   52.499  -21.106 1.00 58.86  ? 2   ASN D CB    1 
ATOM   8949  C  CG    . ASN D  1 30  ? 8.501   51.774  -21.725 1.00 62.82  ? 2   ASN D CG    1 
ATOM   8950  O  OD1   . ASN D  1 30  ? 8.536   51.334  -22.894 1.00 48.94  ? 2   ASN D OD1   1 
ATOM   8951  N  ND2   . ASN D  1 30  ? 7.428   51.652  -20.944 1.00 59.29  ? 2   ASN D ND2   1 
ATOM   8952  N  N     . VAL D  1 31  ? 10.663  49.919  -20.416 1.00 48.24  ? 3   VAL D N     1 
ATOM   8953  C  CA    . VAL D  1 31  ? 10.853  48.485  -20.283 1.00 49.62  ? 3   VAL D CA    1 
ATOM   8954  C  C     . VAL D  1 31  ? 11.769  48.207  -19.091 1.00 51.12  ? 3   VAL D C     1 
ATOM   8955  O  O     . VAL D  1 31  ? 11.568  47.233  -18.354 1.00 49.18  ? 3   VAL D O     1 
ATOM   8956  C  CB    . VAL D  1 31  ? 11.410  47.864  -21.576 1.00 48.38  ? 3   VAL D CB    1 
ATOM   8957  C  CG1   . VAL D  1 31  ? 11.986  46.485  -21.314 1.00 44.16  ? 3   VAL D CG1   1 
ATOM   8958  C  CG2   . VAL D  1 31  ? 10.303  47.792  -22.622 1.00 47.94  ? 3   VAL D CG2   1 
ATOM   8959  N  N     . TYR D  1 32  ? 12.744  49.082  -18.880 1.00 45.81  ? 4   TYR D N     1 
ATOM   8960  C  CA    . TYR D  1 32  ? 13.576  49.021  -17.685 1.00 51.13  ? 4   TYR D CA    1 
ATOM   8961  C  C     . TYR D  1 32  ? 12.760  49.340  -16.435 1.00 52.62  ? 4   TYR D C     1 
ATOM   8962  O  O     . TYR D  1 32  ? 13.020  48.801  -15.352 1.00 51.45  ? 4   TYR D O     1 
ATOM   8963  C  CB    . TYR D  1 32  ? 14.760  49.984  -17.791 1.00 54.22  ? 4   TYR D CB    1 
ATOM   8964  C  CG    . TYR D  1 32  ? 15.488  50.193  -16.478 1.00 59.68  ? 4   TYR D CG    1 
ATOM   8965  C  CD1   . TYR D  1 32  ? 16.330  49.211  -15.962 1.00 67.08  ? 4   TYR D CD1   1 
ATOM   8966  C  CD2   . TYR D  1 32  ? 15.332  51.366  -15.748 1.00 57.66  ? 4   TYR D CD2   1 
ATOM   8967  C  CE1   . TYR D  1 32  ? 17.000  49.398  -14.757 1.00 68.75  ? 4   TYR D CE1   1 
ATOM   8968  C  CE2   . TYR D  1 32  ? 15.993  51.560  -14.546 1.00 57.51  ? 4   TYR D CE2   1 
ATOM   8969  C  CZ    . TYR D  1 32  ? 16.827  50.579  -14.056 1.00 63.42  ? 4   TYR D CZ    1 
ATOM   8970  O  OH    . TYR D  1 32  ? 17.485  50.776  -12.861 1.00 71.73  ? 4   TYR D OH    1 
ATOM   8971  N  N     . GLN D  1 33  ? 11.776  50.220  -16.576 1.00 54.27  ? 5   GLN D N     1 
ATOM   8972  C  CA    . GLN D  1 33  ? 10.950  50.577  -15.426 1.00 54.76  ? 5   GLN D CA    1 
ATOM   8973  C  C     . GLN D  1 33  ? 10.082  49.393  -15.028 1.00 43.55  ? 5   GLN D C     1 
ATOM   8974  O  O     . GLN D  1 33  ? 10.026  49.016  -13.862 1.00 44.11  ? 5   GLN D O     1 
ATOM   8975  C  CB    . GLN D  1 33  ? 10.079  51.798  -15.722 1.00 52.51  ? 5   GLN D CB    1 
ATOM   8976  C  CG    . GLN D  1 33  ? 9.396   52.375  -14.482 1.00 58.83  ? 5   GLN D CG    1 
ATOM   8977  C  CD    . GLN D  1 33  ? 8.685   53.693  -14.766 1.00 67.75  ? 5   GLN D CD    1 
ATOM   8978  O  OE1   . GLN D  1 33  ? 8.517   54.086  -15.925 1.00 67.45  ? 5   GLN D OE1   1 
ATOM   8979  N  NE2   . GLN D  1 33  ? 8.270   54.385  -13.707 1.00 55.45  ? 5   GLN D NE2   1 
ATOM   8980  N  N     . LEU D  1 34  ? 9.404   48.816  -16.016 1.00 46.37  ? 6   LEU D N     1 
ATOM   8981  C  CA    . LEU D  1 34  ? 8.559   47.649  -15.803 1.00 46.39  ? 6   LEU D CA    1 
ATOM   8982  C  C     . LEU D  1 34  ? 9.358   46.499  -15.158 1.00 44.54  ? 6   LEU D C     1 
ATOM   8983  O  O     . LEU D  1 34  ? 8.869   45.821  -14.248 1.00 42.58  ? 6   LEU D O     1 
ATOM   8984  C  CB    . LEU D  1 34  ? 7.937   47.211  -17.126 1.00 40.23  ? 6   LEU D CB    1 
ATOM   8985  C  CG    . LEU D  1 34  ? 6.874   46.110  -17.078 1.00 44.80  ? 6   LEU D CG    1 
ATOM   8986  C  CD1   . LEU D  1 34  ? 5.645   46.568  -16.300 1.00 38.95  ? 6   LEU D CD1   1 
ATOM   8987  C  CD2   . LEU D  1 34  ? 6.490   45.649  -18.490 1.00 38.96  ? 6   LEU D CD2   1 
ATOM   8988  N  N     . LYS D  1 35  ? 10.599  46.312  -15.603 1.00 41.95  ? 7   LYS D N     1 
ATOM   8989  C  CA    . LYS D  1 35  ? 11.455  45.265  -15.060 1.00 41.48  ? 7   LYS D CA    1 
ATOM   8990  C  C     . LYS D  1 35  ? 11.736  45.476  -13.587 1.00 42.41  ? 7   LYS D C     1 
ATOM   8991  O  O     . LYS D  1 35  ? 11.739  44.516  -12.801 1.00 39.77  ? 7   LYS D O     1 
ATOM   8992  C  CB    . LYS D  1 35  ? 12.780  45.188  -15.820 1.00 43.16  ? 7   LYS D CB    1 
ATOM   8993  C  CG    . LYS D  1 35  ? 13.687  44.063  -15.351 1.00 40.77  ? 7   LYS D CG    1 
ATOM   8994  C  CD    . LYS D  1 35  ? 14.951  44.037  -16.165 1.00 40.57  ? 7   LYS D CD    1 
ATOM   8995  C  CE    . LYS D  1 35  ? 15.884  42.955  -15.697 1.00 42.77  ? 7   LYS D CE    1 
ATOM   8996  N  NZ    . LYS D  1 35  ? 17.045  42.815  -16.614 1.00 44.88  ? 7   LYS D NZ    1 
ATOM   8997  N  N     . GLU D  1 36  ? 11.984  46.724  -13.210 1.00 41.16  ? 8   GLU D N     1 
ATOM   8998  C  CA    . GLU D  1 36  ? 12.254  47.046  -11.814 1.00 38.13  ? 8   GLU D CA    1 
ATOM   8999  C  C     . GLU D  1 36  ? 11.018  46.811  -10.956 1.00 34.75  ? 8   GLU D C     1 
ATOM   9000  O  O     . GLU D  1 36  ? 11.119  46.249  -9.866  1.00 33.79  ? 8   GLU D O     1 
ATOM   9001  C  CB    . GLU D  1 36  ? 12.748  48.489  -11.675 1.00 43.99  ? 8   GLU D CB    1 
ATOM   9002  C  CG    . GLU D  1 36  ? 14.216  48.660  -12.079 1.00 51.65  ? 8   GLU D CG    1 
ATOM   9003  C  CD    . GLU D  1 36  ? 15.125  47.559  -11.523 1.00 64.11  ? 8   GLU D CD    1 
ATOM   9004  O  OE1   . GLU D  1 36  ? 15.473  47.619  -10.320 1.00 66.20  ? 8   GLU D OE1   1 
ATOM   9005  O  OE2   . GLU D  1 36  ? 15.492  46.631  -12.290 1.00 61.58  ? 8   GLU D OE2   1 
ATOM   9006  N  N     . GLU D  1 37  ? 9.854   47.221  -11.450 1.00 35.88  ? 9   GLU D N     1 
ATOM   9007  C  CA    . GLU D  1 37  ? 8.611   47.010  -10.711 1.00 35.67  ? 9   GLU D CA    1 
ATOM   9008  C  C     . GLU D  1 37  ? 8.273   45.517  -10.587 1.00 37.94  ? 9   GLU D C     1 
ATOM   9009  O  O     . GLU D  1 37  ? 7.864   45.052  -9.519  1.00 34.83  ? 9   GLU D O     1 
ATOM   9010  C  CB    . GLU D  1 37  ? 7.451   47.740  -11.378 1.00 36.34  ? 9   GLU D CB    1 
ATOM   9011  C  CG    . GLU D  1 37  ? 7.616   49.261  -11.429 1.00 50.67  ? 9   GLU D CG    1 
ATOM   9012  C  CD    . GLU D  1 37  ? 6.469   49.942  -12.155 1.00 57.94  ? 9   GLU D CD    1 
ATOM   9013  O  OE1   . GLU D  1 37  ? 5.429   49.275  -12.374 1.00 60.05  ? 9   GLU D OE1   1 
ATOM   9014  O  OE2   . GLU D  1 37  ? 6.605   51.136  -12.503 1.00 67.44  ? 9   GLU D OE2   1 
ATOM   9015  N  N     . LEU D  1 38  ? 8.426   44.777  -11.683 1.00 36.02  ? 10  LEU D N     1 
ATOM   9016  C  CA    . LEU D  1 38  ? 8.140   43.341  -11.672 1.00 36.01  ? 10  LEU D CA    1 
ATOM   9017  C  C     . LEU D  1 38  ? 8.977   42.634  -10.607 1.00 34.27  ? 10  LEU D C     1 
ATOM   9018  O  O     . LEU D  1 38  ? 8.463   41.804  -9.851  1.00 34.44  ? 10  LEU D O     1 
ATOM   9019  C  CB    . LEU D  1 38  ? 8.395   42.723  -13.050 1.00 31.90  ? 10  LEU D CB    1 
ATOM   9020  C  CG    . LEU D  1 38  ? 8.271   41.196  -13.158 1.00 31.06  ? 10  LEU D CG    1 
ATOM   9021  C  CD1   . LEU D  1 38  ? 6.833   40.735  -12.889 1.00 24.53  ? 10  LEU D CD1   1 
ATOM   9022  C  CD2   . LEU D  1 38  ? 8.755   40.718  -14.536 1.00 39.31  ? 10  LEU D CD2   1 
ATOM   9023  N  N     . ILE D  1 39  ? 10.260  42.987  -10.548 1.00 33.34  ? 11  ILE D N     1 
ATOM   9024  C  CA    . ILE D  1 39  ? 11.188  42.409  -9.592  1.00 29.08  ? 11  ILE D CA    1 
ATOM   9025  C  C     . ILE D  1 39  ? 10.706  42.690  -8.189  1.00 38.53  ? 11  ILE D C     1 
ATOM   9026  O  O     . ILE D  1 39  ? 10.587  41.780  -7.363  1.00 35.35  ? 11  ILE D O     1 
ATOM   9027  C  CB    . ILE D  1 39  ? 12.611  42.964  -9.783  1.00 32.38  ? 11  ILE D CB    1 
ATOM   9028  C  CG1   . ILE D  1 39  ? 13.248  42.353  -11.041 1.00 37.16  ? 11  ILE D CG1   1 
ATOM   9029  C  CG2   . ILE D  1 39  ? 13.480  42.697  -8.564  1.00 29.51  ? 11  ILE D CG2   1 
ATOM   9030  C  CD1   . ILE D  1 39  ? 14.604  42.943  -11.386 1.00 33.09  ? 11  ILE D CD1   1 
ATOM   9031  N  N     . GLU D  1 40  ? 10.393  43.955  -7.933  1.00 32.22  ? 12  GLU D N     1 
ATOM   9032  C  CA    . GLU D  1 40  ? 9.982   44.386  -6.610  1.00 32.92  ? 12  GLU D CA    1 
ATOM   9033  C  C     . GLU D  1 40  ? 8.682   43.695  -6.219  1.00 31.99  ? 12  GLU D C     1 
ATOM   9034  O  O     . GLU D  1 40  ? 8.559   43.200  -5.105  1.00 37.11  ? 12  GLU D O     1 
ATOM   9035  C  CB    . GLU D  1 40  ? 9.828   45.920  -6.567  1.00 36.24  ? 12  GLU D CB    1 
ATOM   9036  C  CG    . GLU D  1 40  ? 9.464   46.492  -5.186  1.00 43.34  ? 12  GLU D CG    1 
ATOM   9037  C  CD    . GLU D  1 40  ? 9.387   48.026  -5.180  1.00 52.44  ? 12  GLU D CD    1 
ATOM   9038  O  OE1   . GLU D  1 40  ? 8.451   48.582  -5.795  1.00 51.88  ? 12  GLU D OE1   1 
ATOM   9039  O  OE2   . GLU D  1 40  ? 10.262  48.679  -4.565  1.00 59.97  ? 12  GLU D OE2   1 
ATOM   9040  N  N     . TYR D  1 41  ? 7.720   43.653  -7.134  1.00 27.33  ? 13  TYR D N     1 
ATOM   9041  C  CA    . TYR D  1 41  ? 6.466   42.946  -6.870  1.00 32.78  ? 13  TYR D CA    1 
ATOM   9042  C  C     . TYR D  1 41  ? 6.696   41.437  -6.629  1.00 38.13  ? 13  TYR D C     1 
ATOM   9043  O  O     . TYR D  1 41  ? 6.124   40.854  -5.694  1.00 30.33  ? 13  TYR D O     1 
ATOM   9044  C  CB    . TYR D  1 41  ? 5.486   43.135  -8.033  1.00 30.95  ? 13  TYR D CB    1 
ATOM   9045  C  CG    . TYR D  1 41  ? 4.111   42.520  -7.811  1.00 28.36  ? 13  TYR D CG    1 
ATOM   9046  C  CD1   . TYR D  1 41  ? 3.512   41.745  -8.793  1.00 30.88  ? 13  TYR D CD1   1 
ATOM   9047  C  CD2   . TYR D  1 41  ? 3.413   42.722  -6.617  1.00 30.98  ? 13  TYR D CD2   1 
ATOM   9048  C  CE1   . TYR D  1 41  ? 2.250   41.182  -8.601  1.00 32.22  ? 13  TYR D CE1   1 
ATOM   9049  C  CE2   . TYR D  1 41  ? 2.147   42.157  -6.410  1.00 28.17  ? 13  TYR D CE2   1 
ATOM   9050  C  CZ    . TYR D  1 41  ? 1.575   41.395  -7.403  1.00 32.80  ? 13  TYR D CZ    1 
ATOM   9051  O  OH    . TYR D  1 41  ? 0.329   40.839  -7.212  1.00 34.01  ? 13  TYR D OH    1 
ATOM   9052  N  N     . ALA D  1 42  ? 7.516   40.810  -7.475  1.00 30.52  ? 14  ALA D N     1 
ATOM   9053  C  CA    . ALA D  1 42  ? 7.788   39.377  -7.345  1.00 33.28  ? 14  ALA D CA    1 
ATOM   9054  C  C     . ALA D  1 42  ? 8.311   39.056  -5.944  1.00 34.53  ? 14  ALA D C     1 
ATOM   9055  O  O     . ALA D  1 42  ? 7.769   38.190  -5.269  1.00 31.31  ? 14  ALA D O     1 
ATOM   9056  C  CB    . ALA D  1 42  ? 8.782   38.900  -8.432  1.00 27.90  ? 14  ALA D CB    1 
ATOM   9057  N  N     . LYS D  1 43  ? 9.321   39.792  -5.483  1.00 36.64  ? 15  LYS D N     1 
ATOM   9058  C  CA    . LYS D  1 43  ? 9.857   39.600  -4.133  1.00 35.06  ? 15  LYS D CA    1 
ATOM   9059  C  C     . LYS D  1 43  ? 8.812   39.833  -3.039  1.00 39.32  ? 15  LYS D C     1 
ATOM   9060  O  O     . LYS D  1 43  ? 8.832   39.169  -2.007  1.00 37.33  ? 15  LYS D O     1 
ATOM   9061  C  CB    . LYS D  1 43  ? 11.056  40.523  -3.897  1.00 37.63  ? 15  LYS D CB    1 
ATOM   9062  C  CG    . LYS D  1 43  ? 12.176  40.285  -4.906  1.00 47.18  ? 15  LYS D CG    1 
ATOM   9063  C  CD    . LYS D  1 43  ? 13.450  41.048  -4.564  1.00 54.22  ? 15  LYS D CD    1 
ATOM   9064  C  CE    . LYS D  1 43  ? 14.642  40.425  -5.282  1.00 51.09  ? 15  LYS D CE    1 
ATOM   9065  N  NZ    . LYS D  1 43  ? 14.603  38.924  -5.190  1.00 54.70  ? 15  LYS D NZ    1 
ATOM   9066  N  N     . SER D  1 44  ? 7.889   40.760  -3.259  1.00 34.44  ? 16  SER D N     1 
ATOM   9067  C  CA    . SER D  1 44  ? 6.881   41.020  -2.234  1.00 36.22  ? 16  SER D CA    1 
ATOM   9068  C  C     . SER D  1 44  ? 5.887   39.851  -2.097  1.00 35.73  ? 16  SER D C     1 
ATOM   9069  O  O     . SER D  1 44  ? 5.368   39.608  -1.015  1.00 34.87  ? 16  SER D O     1 
ATOM   9070  C  CB    . SER D  1 44  ? 6.130   42.319  -2.536  1.00 32.68  ? 16  SER D CB    1 
ATOM   9071  O  OG    . SER D  1 44  ? 5.007   42.075  -3.359  1.00 30.66  ? 16  SER D OG    1 
ATOM   9072  N  N     . ILE D  1 45  ? 5.615   39.122  -3.178  1.00 29.64  ? 17  ILE D N     1 
ATOM   9073  C  CA    . ILE D  1 45  ? 4.642   38.038  -3.076  1.00 33.99  ? 17  ILE D CA    1 
ATOM   9074  C  C     . ILE D  1 45  ? 5.358   36.730  -2.754  1.00 35.25  ? 17  ILE D C     1 
ATOM   9075  O  O     . ILE D  1 45  ? 4.757   35.654  -2.766  1.00 35.53  ? 17  ILE D O     1 
ATOM   9076  C  CB    . ILE D  1 45  ? 3.791   37.890  -4.358  1.00 39.33  ? 17  ILE D CB    1 
ATOM   9077  C  CG1   . ILE D  1 45  ? 4.678   37.547  -5.571  1.00 37.84  ? 17  ILE D CG1   1 
ATOM   9078  C  CG2   . ILE D  1 45  ? 2.933   39.150  -4.570  1.00 29.00  ? 17  ILE D CG2   1 
ATOM   9079  C  CD1   . ILE D  1 45  ? 3.922   37.044  -6.809  1.00 35.50  ? 17  ILE D CD1   1 
ATOM   9080  N  N     . GLY D  1 46  ? 6.649   36.838  -2.456  1.00 36.37  ? 18  GLY D N     1 
ATOM   9081  C  CA    . GLY D  1 46  ? 7.417   35.714  -1.962  1.00 35.87  ? 18  GLY D CA    1 
ATOM   9082  C  C     . GLY D  1 46  ? 8.319   34.985  -2.946  1.00 36.14  ? 18  GLY D C     1 
ATOM   9083  O  O     . GLY D  1 46  ? 8.800   33.900  -2.637  1.00 33.73  ? 18  GLY D O     1 
ATOM   9084  N  N     . VAL D  1 47  ? 8.565   35.556  -4.119  1.00 30.39  ? 19  VAL D N     1 
ATOM   9085  C  CA    . VAL D  1 47  ? 9.515   34.937  -5.031  1.00 31.15  ? 19  VAL D CA    1 
ATOM   9086  C  C     . VAL D  1 47  ? 10.899  35.162  -4.443  1.00 31.62  ? 19  VAL D C     1 
ATOM   9087  O  O     . VAL D  1 47  ? 11.224  36.271  -4.032  1.00 26.87  ? 19  VAL D O     1 
ATOM   9088  C  CB    . VAL D  1 47  ? 9.402   35.514  -6.463  1.00 33.97  ? 19  VAL D CB    1 
ATOM   9089  C  CG1   . VAL D  1 47  ? 10.598  35.120  -7.317  1.00 30.64  ? 19  VAL D CG1   1 
ATOM   9090  C  CG2   . VAL D  1 47  ? 8.115   35.053  -7.110  1.00 27.49  ? 19  VAL D CG2   1 
ATOM   9091  N  N     . ASP D  1 48  ? 11.715  34.113  -4.379  1.00 32.24  ? 20  ASP D N     1 
ATOM   9092  C  CA    . ASP D  1 48  ? 13.013  34.240  -3.704  1.00 37.93  ? 20  ASP D CA    1 
ATOM   9093  C  C     . ASP D  1 48  ? 14.124  34.635  -4.664  1.00 36.59  ? 20  ASP D C     1 
ATOM   9094  O  O     . ASP D  1 48  ? 15.114  35.248  -4.269  1.00 37.98  ? 20  ASP D O     1 
ATOM   9095  C  CB    . ASP D  1 48  ? 13.371  32.940  -2.982  1.00 32.65  ? 20  ASP D CB    1 
ATOM   9096  C  CG    . ASP D  1 48  ? 12.426  32.648  -1.863  1.00 34.93  ? 20  ASP D CG    1 
ATOM   9097  O  OD1   . ASP D  1 48  ? 12.203  33.561  -1.031  1.00 36.45  ? 20  ASP D OD1   1 
ATOM   9098  O  OD2   . ASP D  1 48  ? 11.861  31.542  -1.838  1.00 29.06  ? 20  ASP D OD2   1 
ATOM   9099  N  N     . LYS D  1 49  ? 13.963  34.281  -5.931  1.00 34.60  ? 21  LYS D N     1 
ATOM   9100  C  CA    . LYS D  1 49  ? 14.920  34.712  -6.938  1.00 32.81  ? 21  LYS D CA    1 
ATOM   9101  C  C     . LYS D  1 49  ? 14.190  34.873  -8.255  1.00 32.94  ? 21  LYS D C     1 
ATOM   9102  O  O     . LYS D  1 49  ? 13.328  34.063  -8.604  1.00 30.72  ? 21  LYS D O     1 
ATOM   9103  C  CB    . LYS D  1 49  ? 16.092  33.721  -7.057  1.00 33.68  ? 21  LYS D CB    1 
ATOM   9104  C  CG    . LYS D  1 49  ? 17.441  34.415  -7.365  1.00 39.88  ? 21  LYS D CG    1 
ATOM   9105  C  CD    . LYS D  1 49  ? 18.640  33.492  -7.188  1.00 42.24  ? 21  LYS D CD    1 
ATOM   9106  C  CE    . LYS D  1 49  ? 19.964  34.252  -7.281  1.00 41.98  ? 21  LYS D CE    1 
ATOM   9107  N  NZ    . LYS D  1 49  ? 20.387  34.528  -8.678  1.00 47.39  ? 21  LYS D NZ    1 
ATOM   9108  N  N     . ILE D  1 50  ? 14.520  35.942  -8.970  1.00 30.91  ? 22  ILE D N     1 
ATOM   9109  C  CA    . ILE D  1 50  ? 13.906  36.208  -10.254 1.00 28.35  ? 22  ILE D CA    1 
ATOM   9110  C  C     . ILE D  1 50  ? 14.975  36.647  -11.248 1.00 36.69  ? 22  ILE D C     1 
ATOM   9111  O  O     . ILE D  1 50  ? 15.924  37.338  -10.892 1.00 35.07  ? 22  ILE D O     1 
ATOM   9112  C  CB    . ILE D  1 50  ? 12.795  37.271  -10.164 1.00 31.30  ? 22  ILE D CB    1 
ATOM   9113  C  CG1   . ILE D  1 50  ? 12.134  37.448  -11.534 1.00 32.49  ? 22  ILE D CG1   1 
ATOM   9114  C  CG2   . ILE D  1 50  ? 13.352  38.609  -9.611  1.00 31.90  ? 22  ILE D CG2   1 
ATOM   9115  C  CD1   . ILE D  1 50  ? 10.844  38.269  -11.522 1.00 30.91  ? 22  ILE D CD1   1 
ATOM   9116  N  N     . GLY D  1 51  ? 14.825  36.193  -12.490 1.00 38.81  ? 23  GLY D N     1 
ATOM   9117  C  CA    . GLY D  1 51  ? 15.809  36.437  -13.522 1.00 37.75  ? 23  GLY D CA    1 
ATOM   9118  C  C     . GLY D  1 51  ? 15.179  36.571  -14.890 1.00 33.76  ? 23  GLY D C     1 
ATOM   9119  O  O     . GLY D  1 51  ? 13.994  36.266  -15.090 1.00 33.26  ? 23  GLY D O     1 
ATOM   9120  N  N     . PHE D  1 52  ? 15.979  37.038  -15.843 1.00 34.92  ? 24  PHE D N     1 
ATOM   9121  C  CA    . PHE D  1 52  ? 15.459  37.390  -17.151 1.00 32.51  ? 24  PHE D CA    1 
ATOM   9122  C  C     . PHE D  1 52  ? 16.352  36.821  -18.234 1.00 33.60  ? 24  PHE D C     1 
ATOM   9123  O  O     . PHE D  1 52  ? 17.579  36.817  -18.115 1.00 33.53  ? 24  PHE D O     1 
ATOM   9124  C  CB    . PHE D  1 52  ? 15.327  38.921  -17.281 1.00 33.06  ? 24  PHE D CB    1 
ATOM   9125  C  CG    . PHE D  1 52  ? 14.275  39.515  -16.364 1.00 33.50  ? 24  PHE D CG    1 
ATOM   9126  C  CD1   . PHE D  1 52  ? 13.008  39.820  -16.844 1.00 31.34  ? 24  PHE D CD1   1 
ATOM   9127  C  CD2   . PHE D  1 52  ? 14.543  39.722  -15.019 1.00 31.51  ? 24  PHE D CD2   1 
ATOM   9128  C  CE1   . PHE D  1 52  ? 12.029  40.346  -16.007 1.00 31.61  ? 24  PHE D CE1   1 
ATOM   9129  C  CE2   . PHE D  1 52  ? 13.572  40.257  -14.169 1.00 36.77  ? 24  PHE D CE2   1 
ATOM   9130  C  CZ    . PHE D  1 52  ? 12.312  40.564  -14.662 1.00 34.95  ? 24  PHE D CZ    1 
ATOM   9131  N  N     . THR D  1 53  ? 15.726  36.306  -19.280 1.00 29.63  ? 25  THR D N     1 
ATOM   9132  C  CA    . THR D  1 53  ? 16.474  35.841  -20.424 1.00 33.04  ? 25  THR D CA    1 
ATOM   9133  C  C     . THR D  1 53  ? 15.645  36.156  -21.661 1.00 35.06  ? 25  THR D C     1 
ATOM   9134  O  O     . THR D  1 53  ? 14.433  36.400  -21.555 1.00 35.49  ? 25  THR D O     1 
ATOM   9135  C  CB    . THR D  1 53  ? 16.790  34.302  -20.321 1.00 38.34  ? 25  THR D CB    1 
ATOM   9136  O  OG1   . THR D  1 53  ? 17.857  33.950  -21.215 1.00 40.25  ? 25  THR D OG1   1 
ATOM   9137  C  CG2   . THR D  1 53  ? 15.554  33.463  -20.652 1.00 31.57  ? 25  THR D CG2   1 
ATOM   9138  N  N     . THR D  1 54  ? 16.299  36.160  -22.822 1.00 35.26  ? 26  THR D N     1 
ATOM   9139  C  CA    . THR D  1 54  ? 15.638  36.302  -24.120 1.00 35.82  ? 26  THR D CA    1 
ATOM   9140  C  C     . THR D  1 54  ? 14.743  35.123  -24.460 1.00 37.00  ? 26  THR D C     1 
ATOM   9141  O  O     . THR D  1 54  ? 14.743  34.117  -23.760 1.00 40.09  ? 26  THR D O     1 
ATOM   9142  C  CB    . THR D  1 54  ? 16.668  36.420  -25.259 1.00 43.29  ? 26  THR D CB    1 
ATOM   9143  O  OG1   . THR D  1 54  ? 17.396  35.180  -25.365 1.00 37.07  ? 26  THR D OG1   1 
ATOM   9144  C  CG2   . THR D  1 54  ? 17.629  37.583  -25.008 1.00 31.94  ? 26  THR D CG2   1 
ATOM   9145  N  N     . ALA D  1 55  ? 14.006  35.235  -25.560 1.00 34.61  ? 27  ALA D N     1 
ATOM   9146  C  CA    . ALA D  1 55  ? 13.183  34.134  -26.047 1.00 35.36  ? 27  ALA D CA    1 
ATOM   9147  C  C     . ALA D  1 55  ? 13.890  33.390  -27.186 1.00 32.03  ? 27  ALA D C     1 
ATOM   9148  O  O     . ALA D  1 55  ? 13.239  32.758  -28.006 1.00 30.85  ? 27  ALA D O     1 
ATOM   9149  C  CB    . ALA D  1 55  ? 11.818  34.644  -26.513 1.00 34.85  ? 27  ALA D CB    1 
ATOM   9150  N  N     . ASP D  1 56  ? 15.217  33.494  -27.231 1.00 32.21  ? 28  ASP D N     1 
ATOM   9151  C  CA    . ASP D  1 56  ? 16.011  32.809  -28.241 1.00 34.67  ? 28  ASP D CA    1 
ATOM   9152  C  C     . ASP D  1 56  ? 16.040  31.302  -28.004 1.00 40.05  ? 28  ASP D C     1 
ATOM   9153  O  O     . ASP D  1 56  ? 15.944  30.832  -26.855 1.00 34.73  ? 28  ASP D O     1 
ATOM   9154  C  CB    . ASP D  1 56  ? 17.436  33.336  -28.246 1.00 35.96  ? 28  ASP D CB    1 
ATOM   9155  C  CG    . ASP D  1 56  ? 17.520  34.782  -28.690 1.00 44.38  ? 28  ASP D CG    1 
ATOM   9156  O  OD1   . ASP D  1 56  ? 16.608  35.239  -29.415 1.00 40.08  ? 28  ASP D OD1   1 
ATOM   9157  O  OD2   . ASP D  1 56  ? 18.497  35.456  -28.302 1.00 47.34  ? 28  ASP D OD2   1 
ATOM   9158  N  N     . THR D  1 57  ? 16.208  30.559  -29.093 1.00 37.82  ? 29  THR D N     1 
ATOM   9159  C  CA    . THR D  1 57  ? 16.296  29.104  -29.042 1.00 35.10  ? 29  THR D CA    1 
ATOM   9160  C  C     . THR D  1 57  ? 17.383  28.600  -28.087 1.00 35.79  ? 29  THR D C     1 
ATOM   9161  O  O     . THR D  1 57  ? 18.424  29.230  -27.911 1.00 32.19  ? 29  THR D O     1 
ATOM   9162  C  CB    . THR D  1 57  ? 16.569  28.513  -30.442 1.00 38.84  ? 29  THR D CB    1 
ATOM   9163  O  OG1   . THR D  1 57  ? 17.760  29.098  -30.966 1.00 43.04  ? 29  THR D OG1   1 
ATOM   9164  C  CG2   . THR D  1 57  ? 15.411  28.792  -31.391 1.00 32.14  ? 29  THR D CG2   1 
ATOM   9165  N  N     . PHE D  1 58  ? 17.135  27.438  -27.486 1.00 37.60  ? 30  PHE D N     1 
ATOM   9166  C  CA    . PHE D  1 58  ? 18.126  26.809  -26.628 1.00 36.32  ? 30  PHE D CA    1 
ATOM   9167  C  C     . PHE D  1 58  ? 18.939  25.781  -27.436 1.00 40.83  ? 30  PHE D C     1 
ATOM   9168  O  O     . PHE D  1 58  ? 18.661  24.569  -27.413 1.00 34.93  ? 30  PHE D O     1 
ATOM   9169  C  CB    . PHE D  1 58  ? 17.441  26.154  -25.413 1.00 35.23  ? 30  PHE D CB    1 
ATOM   9170  C  CG    . PHE D  1 58  ? 16.859  27.151  -24.431 1.00 34.20  ? 30  PHE D CG    1 
ATOM   9171  C  CD1   . PHE D  1 58  ? 17.601  27.570  -23.335 1.00 28.56  ? 30  PHE D CD1   1 
ATOM   9172  C  CD2   . PHE D  1 58  ? 15.571  27.667  -24.609 1.00 31.15  ? 30  PHE D CD2   1 
ATOM   9173  C  CE1   . PHE D  1 58  ? 17.083  28.498  -22.428 1.00 25.10  ? 30  PHE D CE1   1 
ATOM   9174  C  CE2   . PHE D  1 58  ? 15.036  28.598  -23.698 1.00 35.55  ? 30  PHE D CE2   1 
ATOM   9175  C  CZ    . PHE D  1 58  ? 15.796  29.009  -22.609 1.00 28.35  ? 30  PHE D CZ    1 
ATOM   9176  N  N     . ASP D  1 59  ? 19.952  26.273  -28.142 1.00 42.92  ? 31  ASP D N     1 
ATOM   9177  C  CA    . ASP D  1 59  ? 20.739  25.435  -29.050 1.00 43.31  ? 31  ASP D CA    1 
ATOM   9178  C  C     . ASP D  1 59  ? 21.491  24.317  -28.320 1.00 42.29  ? 31  ASP D C     1 
ATOM   9179  O  O     . ASP D  1 59  ? 21.457  23.160  -28.736 1.00 40.75  ? 31  ASP D O     1 
ATOM   9180  C  CB    . ASP D  1 59  ? 21.731  26.295  -29.835 1.00 46.98  ? 31  ASP D CB    1 
ATOM   9181  C  CG    . ASP D  1 59  ? 21.047  27.351  -30.680 1.00 48.53  ? 31  ASP D CG    1 
ATOM   9182  O  OD1   . ASP D  1 59  ? 19.965  27.064  -31.241 1.00 50.80  ? 31  ASP D OD1   1 
ATOM   9183  O  OD2   . ASP D  1 59  ? 21.592  28.473  -30.780 1.00 62.28  ? 31  ASP D OD2   1 
ATOM   9184  N  N     . SER D  1 60  ? 22.180  24.684  -27.248 1.00 41.03  ? 32  SER D N     1 
ATOM   9185  C  CA    . SER D  1 60  ? 22.912  23.734  -26.430 1.00 42.74  ? 32  SER D CA    1 
ATOM   9186  C  C     . SER D  1 60  ? 21.992  22.634  -25.920 1.00 43.00  ? 32  SER D C     1 
ATOM   9187  O  O     . SER D  1 60  ? 22.286  21.445  -26.065 1.00 41.80  ? 32  SER D O     1 
ATOM   9188  C  CB    . SER D  1 60  ? 23.577  24.444  -25.249 1.00 44.24  ? 32  SER D CB    1 
ATOM   9189  O  OG    . SER D  1 60  ? 24.035  23.490  -24.300 1.00 50.03  ? 32  SER D OG    1 
ATOM   9190  N  N     . LEU D  1 61  ? 20.873  23.049  -25.329 1.00 37.41  ? 33  LEU D N     1 
ATOM   9191  C  CA    . LEU D  1 61  ? 19.867  22.128  -24.846 1.00 36.10  ? 33  LEU D CA    1 
ATOM   9192  C  C     . LEU D  1 61  ? 19.458  21.134  -25.923 1.00 36.87  ? 33  LEU D C     1 
ATOM   9193  O  O     . LEU D  1 61  ? 19.234  19.964  -25.629 1.00 32.62  ? 33  LEU D O     1 
ATOM   9194  C  CB    . LEU D  1 61  ? 18.634  22.881  -24.350 1.00 37.85  ? 33  LEU D CB    1 
ATOM   9195  C  CG    . LEU D  1 61  ? 17.480  21.981  -23.891 1.00 39.64  ? 33  LEU D CG    1 
ATOM   9196  C  CD1   . LEU D  1 61  ? 17.910  21.115  -22.709 1.00 36.08  ? 33  LEU D CD1   1 
ATOM   9197  C  CD2   . LEU D  1 61  ? 16.222  22.783  -23.548 1.00 34.56  ? 33  LEU D CD2   1 
ATOM   9198  N  N     . LYS D  1 62  ? 19.370  21.618  -27.163 1.00 36.07  ? 34  LYS D N     1 
ATOM   9199  C  CA    . LYS D  1 62  ? 18.898  20.829  -28.296 1.00 36.76  ? 34  LYS D CA    1 
ATOM   9200  C  C     . LYS D  1 62  ? 19.839  19.664  -28.588 1.00 36.40  ? 34  LYS D C     1 
ATOM   9201  O  O     . LYS D  1 62  ? 19.394  18.531  -28.725 1.00 36.64  ? 34  LYS D O     1 
ATOM   9202  C  CB    . LYS D  1 62  ? 18.739  21.710  -29.544 1.00 37.77  ? 34  LYS D CB    1 
ATOM   9203  C  CG    . LYS D  1 62  ? 18.057  21.005  -30.713 1.00 39.85  ? 34  LYS D CG    1 
ATOM   9204  C  CD    . LYS D  1 62  ? 18.117  21.845  -31.969 1.00 46.53  ? 34  LYS D CD    1 
ATOM   9205  C  CE    . LYS D  1 62  ? 17.277  21.261  -33.097 1.00 50.86  ? 34  LYS D CE    1 
ATOM   9206  N  NZ    . LYS D  1 62  ? 17.281  22.203  -34.266 1.00 54.70  ? 34  LYS D NZ    1 
ATOM   9207  N  N     . ASP D  1 63  ? 21.137  19.944  -28.662 1.00 38.69  ? 35  ASP D N     1 
ATOM   9208  C  CA    . ASP D  1 63  ? 22.132  18.898  -28.859 1.00 39.12  ? 35  ASP D CA    1 
ATOM   9209  C  C     . ASP D  1 63  ? 22.139  17.929  -27.676 1.00 38.27  ? 35  ASP D C     1 
ATOM   9210  O  O     . ASP D  1 63  ? 22.307  16.718  -27.836 1.00 31.37  ? 35  ASP D O     1 
ATOM   9211  C  CB    . ASP D  1 63  ? 23.529  19.502  -29.040 1.00 39.25  ? 35  ASP D CB    1 
ATOM   9212  C  CG    . ASP D  1 63  ? 23.588  20.525  -30.174 1.00 47.80  ? 35  ASP D CG    1 
ATOM   9213  O  OD1   . ASP D  1 63  ? 22.947  20.293  -31.227 1.00 47.77  ? 35  ASP D OD1   1 
ATOM   9214  O  OD2   . ASP D  1 63  ? 24.271  21.566  -30.004 1.00 51.36  ? 35  ASP D OD2   1 
ATOM   9215  N  N     . ARG D  1 64  ? 21.963  18.474  -26.484 1.00 34.35  ? 36  ARG D N     1 
ATOM   9216  C  CA    . ARG D  1 64  ? 22.030  17.666  -25.276 1.00 32.36  ? 36  ARG D CA    1 
ATOM   9217  C  C     . ARG D  1 64  ? 20.864  16.697  -25.219 1.00 30.80  ? 36  ARG D C     1 
ATOM   9218  O  O     . ARG D  1 64  ? 21.054  15.521  -24.943 1.00 31.18  ? 36  ARG D O     1 
ATOM   9219  C  CB    . ARG D  1 64  ? 22.038  18.544  -24.027 1.00 31.55  ? 36  ARG D CB    1 
ATOM   9220  C  CG    . ARG D  1 64  ? 22.389  17.746  -22.788 1.00 39.11  ? 36  ARG D CG    1 
ATOM   9221  C  CD    . ARG D  1 64  ? 23.782  17.158  -22.963 1.00 38.28  ? 36  ARG D CD    1 
ATOM   9222  N  NE    . ARG D  1 64  ? 24.265  16.522  -21.753 1.00 37.81  ? 36  ARG D NE    1 
ATOM   9223  C  CZ    . ARG D  1 64  ? 25.526  16.163  -21.554 1.00 38.67  ? 36  ARG D CZ    1 
ATOM   9224  N  NH1   . ARG D  1 64  ? 26.439  16.391  -22.493 1.00 36.68  ? 36  ARG D NH1   1 
ATOM   9225  N  NH2   . ARG D  1 64  ? 25.873  15.573  -20.417 1.00 37.82  ? 36  ARG D NH2   1 
ATOM   9226  N  N     . LEU D  1 65  ? 19.659  17.194  -25.495 1.00 29.84  ? 37  LEU D N     1 
ATOM   9227  C  CA    . LEU D  1 65  ? 18.485  16.340  -25.487 1.00 27.81  ? 37  LEU D CA    1 
ATOM   9228  C  C     . LEU D  1 65  ? 18.647  15.196  -26.493 1.00 32.58  ? 37  LEU D C     1 
ATOM   9229  O  O     . LEU D  1 65  ? 18.284  14.037  -26.204 1.00 32.74  ? 37  LEU D O     1 
ATOM   9230  C  CB    . LEU D  1 65  ? 17.219  17.150  -25.781 1.00 28.88  ? 37  LEU D CB    1 
ATOM   9231  C  CG    . LEU D  1 65  ? 16.822  18.173  -24.700 1.00 35.25  ? 37  LEU D CG    1 
ATOM   9232  C  CD1   . LEU D  1 65  ? 15.702  19.060  -25.173 1.00 35.03  ? 37  LEU D CD1   1 
ATOM   9233  C  CD2   . LEU D  1 65  ? 16.433  17.493  -23.404 1.00 35.75  ? 37  LEU D CD2   1 
ATOM   9234  N  N     . ILE D  1 66  ? 19.209  15.506  -27.661 1.00 34.84  ? 38  ILE D N     1 
ATOM   9235  C  CA    . ILE D  1 66  ? 19.374  14.484  -28.696 1.00 35.67  ? 38  ILE D CA    1 
ATOM   9236  C  C     . ILE D  1 66  ? 20.388  13.450  -28.231 1.00 32.24  ? 38  ILE D C     1 
ATOM   9237  O  O     . ILE D  1 66  ? 20.155  12.260  -28.343 1.00 36.11  ? 38  ILE D O     1 
ATOM   9238  C  CB    . ILE D  1 66  ? 19.812  15.087  -30.048 1.00 37.50  ? 38  ILE D CB    1 
ATOM   9239  C  CG1   . ILE D  1 66  ? 18.718  16.006  -30.596 1.00 32.19  ? 38  ILE D CG1   1 
ATOM   9240  C  CG2   . ILE D  1 66  ? 20.128  13.967  -31.064 1.00 41.25  ? 38  ILE D CG2   1 
ATOM   9241  C  CD1   . ILE D  1 66  ? 19.196  16.930  -31.704 1.00 38.31  ? 38  ILE D CD1   1 
ATOM   9242  N  N     . LEU D  1 67  ? 21.500  13.914  -27.677 1.00 34.56  ? 39  LEU D N     1 
ATOM   9243  C  CA    . LEU D  1 67  ? 22.516  13.017  -27.155 1.00 31.02  ? 39  LEU D CA    1 
ATOM   9244  C  C     . LEU D  1 67  ? 21.948  12.089  -26.069 1.00 37.93  ? 39  LEU D C     1 
ATOM   9245  O  O     . LEU D  1 67  ? 22.114  10.860  -26.145 1.00 33.25  ? 39  LEU D O     1 
ATOM   9246  C  CB    . LEU D  1 67  ? 23.689  13.828  -26.608 1.00 34.64  ? 39  LEU D CB    1 
ATOM   9247  C  CG    . LEU D  1 67  ? 24.781  12.986  -25.962 1.00 37.34  ? 39  LEU D CG    1 
ATOM   9248  C  CD1   . LEU D  1 67  ? 25.546  12.167  -27.011 1.00 39.36  ? 39  LEU D CD1   1 
ATOM   9249  C  CD2   . LEU D  1 67  ? 25.717  13.859  -25.151 1.00 39.62  ? 39  LEU D CD2   1 
ATOM   9250  N  N     . GLN D  1 68  ? 21.256  12.668  -25.083 1.00 33.62  ? 40  GLN D N     1 
ATOM   9251  C  CA    . GLN D  1 68  ? 20.679  11.892  -23.977 1.00 31.91  ? 40  GLN D CA    1 
ATOM   9252  C  C     . GLN D  1 68  ? 19.685  10.850  -24.468 1.00 31.46  ? 40  GLN D C     1 
ATOM   9253  O  O     . GLN D  1 68  ? 19.644  9.721   -23.965 1.00 32.61  ? 40  GLN D O     1 
ATOM   9254  C  CB    . GLN D  1 68  ? 19.991  12.811  -22.964 1.00 29.66  ? 40  GLN D CB    1 
ATOM   9255  C  CG    . GLN D  1 68  ? 20.941  13.717  -22.205 1.00 29.14  ? 40  GLN D CG    1 
ATOM   9256  C  CD    . GLN D  1 68  ? 21.915  12.939  -21.332 1.00 34.94  ? 40  GLN D CD    1 
ATOM   9257  O  OE1   . GLN D  1 68  ? 23.036  12.634  -21.756 1.00 31.66  ? 40  GLN D OE1   1 
ATOM   9258  N  NE2   . GLN D  1 68  ? 21.495  12.616  -20.102 1.00 25.89  ? 40  GLN D NE2   1 
ATOM   9259  N  N     . GLU D  1 69  ? 18.881  11.217  -25.457 1.00 30.58  ? 41  GLU D N     1 
ATOM   9260  C  CA    A GLU D  1 69  ? 17.899  10.307  -25.999 0.59 35.35  ? 41  GLU D CA    1 
ATOM   9261  C  CA    B GLU D  1 69  ? 17.899  10.272  -25.968 0.41 35.37  ? 41  GLU D CA    1 
ATOM   9262  C  C     . GLU D  1 69  ? 18.614  9.127   -26.680 1.00 37.82  ? 41  GLU D C     1 
ATOM   9263  O  O     . GLU D  1 69  ? 18.243  7.965   -26.504 1.00 31.72  ? 41  GLU D O     1 
ATOM   9264  C  CB    A GLU D  1 69  ? 16.987  11.047  -26.971 0.59 37.07  ? 41  GLU D CB    1 
ATOM   9265  C  CB    B GLU D  1 69  ? 16.896  10.941  -26.906 0.41 37.10  ? 41  GLU D CB    1 
ATOM   9266  C  CG    A GLU D  1 69  ? 15.766  10.270  -27.377 0.59 39.80  ? 41  GLU D CG    1 
ATOM   9267  C  CG    B GLU D  1 69  ? 15.507  10.287  -26.881 0.41 39.26  ? 41  GLU D CG    1 
ATOM   9268  C  CD    A GLU D  1 69  ? 14.558  10.529  -26.499 0.59 40.63  ? 41  GLU D CD    1 
ATOM   9269  C  CD    B GLU D  1 69  ? 15.497  8.837   -27.376 0.41 42.31  ? 41  GLU D CD    1 
ATOM   9270  O  OE1   A GLU D  1 69  ? 14.054  11.681  -26.485 0.59 43.66  ? 41  GLU D OE1   1 
ATOM   9271  O  OE1   B GLU D  1 69  ? 16.245  8.517   -28.328 0.41 40.95  ? 41  GLU D OE1   1 
ATOM   9272  O  OE2   A GLU D  1 69  ? 14.103  9.574   -25.835 0.59 40.17  ? 41  GLU D OE2   1 
ATOM   9273  O  OE2   B GLU D  1 69  ? 14.732  8.018   -26.820 0.41 44.54  ? 41  GLU D OE2   1 
ATOM   9274  N  N     . SER D  1 70  ? 19.656  9.442   -27.445 1.00 35.93  ? 42  SER D N     1 
ATOM   9275  C  CA    . SER D  1 70  ? 20.371  8.412   -28.186 1.00 37.71  ? 42  SER D CA    1 
ATOM   9276  C  C     . SER D  1 70  ? 21.137  7.471   -27.240 1.00 39.84  ? 42  SER D C     1 
ATOM   9277  O  O     . SER D  1 70  ? 21.372  6.307   -27.567 1.00 38.90  ? 42  SER D O     1 
ATOM   9278  C  CB    . SER D  1 70  ? 21.310  9.051   -29.213 1.00 39.62  ? 42  SER D CB    1 
ATOM   9279  O  OG    . SER D  1 70  ? 22.604  9.256   -28.684 1.00 49.43  ? 42  SER D OG    1 
ATOM   9280  N  N     . LEU D  1 71  ? 21.492  7.965   -26.057 1.00 36.18  ? 43  LEU D N     1 
ATOM   9281  C  CA    . LEU D  1 71  ? 22.125  7.136   -25.033 1.00 33.68  ? 43  LEU D CA    1 
ATOM   9282  C  C     . LEU D  1 71  ? 21.102  6.352   -24.214 1.00 32.74  ? 43  LEU D C     1 
ATOM   9283  O  O     . LEU D  1 71  ? 21.475  5.546   -23.379 1.00 32.43  ? 43  LEU D O     1 
ATOM   9284  C  CB    . LEU D  1 71  ? 22.976  7.993   -24.093 1.00 33.41  ? 43  LEU D CB    1 
ATOM   9285  C  CG    . LEU D  1 71  ? 24.171  8.653   -24.788 1.00 40.38  ? 43  LEU D CG    1 
ATOM   9286  C  CD1   . LEU D  1 71  ? 24.891  9.675   -23.887 1.00 33.92  ? 43  LEU D CD1   1 
ATOM   9287  C  CD2   . LEU D  1 71  ? 25.128  7.570   -25.282 1.00 35.91  ? 43  LEU D CD2   1 
ATOM   9288  N  N     . GLY D  1 72  ? 19.815  6.591   -24.454 1.00 31.77  ? 44  GLY D N     1 
ATOM   9289  C  CA    . GLY D  1 72  ? 18.781  6.012   -23.611 1.00 27.08  ? 44  GLY D CA    1 
ATOM   9290  C  C     . GLY D  1 72  ? 18.810  6.556   -22.184 1.00 34.99  ? 44  GLY D C     1 
ATOM   9291  O  O     . GLY D  1 72  ? 18.479  5.839   -21.245 1.00 30.19  ? 44  GLY D O     1 
ATOM   9292  N  N     . TYR D  1 73  ? 19.197  7.819   -22.005 1.00 31.79  ? 45  TYR D N     1 
ATOM   9293  C  CA    . TYR D  1 73  ? 19.349  8.347   -20.649 1.00 29.74  ? 45  TYR D CA    1 
ATOM   9294  C  C     . TYR D  1 73  ? 18.192  9.210   -20.157 1.00 33.58  ? 45  TYR D C     1 
ATOM   9295  O  O     . TYR D  1 73  ? 18.195  9.628   -18.999 1.00 32.19  ? 45  TYR D O     1 
ATOM   9296  C  CB    . TYR D  1 73  ? 20.629  9.173   -20.524 1.00 32.73  ? 45  TYR D CB    1 
ATOM   9297  C  CG    . TYR D  1 73  ? 21.915  8.384   -20.433 1.00 30.50  ? 45  TYR D CG    1 
ATOM   9298  C  CD1   . TYR D  1 73  ? 21.919  6.988   -20.436 1.00 31.20  ? 45  TYR D CD1   1 
ATOM   9299  C  CD2   . TYR D  1 73  ? 23.132  9.050   -20.324 1.00 28.83  ? 45  TYR D CD2   1 
ATOM   9300  C  CE1   . TYR D  1 73  ? 23.112  6.287   -20.345 1.00 32.34  ? 45  TYR D CE1   1 
ATOM   9301  C  CE2   . TYR D  1 73  ? 24.303  8.377   -20.228 1.00 29.39  ? 45  TYR D CE2   1 
ATOM   9302  C  CZ    . TYR D  1 73  ? 24.300  6.991   -20.244 1.00 35.38  ? 45  TYR D CZ    1 
ATOM   9303  O  OH    . TYR D  1 73  ? 25.496  6.332   -20.145 1.00 40.06  ? 45  TYR D OH    1 
ATOM   9304  N  N     . LEU D  1 74  ? 17.219  9.514   -21.012 1.00 33.31  ? 46  LEU D N     1 
ATOM   9305  C  CA    . LEU D  1 74  ? 16.088  10.318  -20.540 1.00 32.60  ? 46  LEU D CA    1 
ATOM   9306  C  C     . LEU D  1 74  ? 15.162  9.468   -19.678 1.00 35.72  ? 46  LEU D C     1 
ATOM   9307  O  O     . LEU D  1 74  ? 15.356  8.255   -19.544 1.00 31.55  ? 46  LEU D O     1 
ATOM   9308  C  CB    . LEU D  1 74  ? 15.325  10.934  -21.706 1.00 31.91  ? 46  LEU D CB    1 
ATOM   9309  C  CG    . LEU D  1 74  ? 16.119  11.947  -22.536 1.00 32.89  ? 46  LEU D CG    1 
ATOM   9310  C  CD1   . LEU D  1 74  ? 15.271  12.396  -23.706 1.00 35.93  ? 46  LEU D CD1   1 
ATOM   9311  C  CD2   . LEU D  1 74  ? 16.558  13.144  -21.695 1.00 23.91  ? 46  LEU D CD2   1 
ATOM   9312  N  N     . SER D  1 75  ? 14.177  10.116  -19.069 1.00 28.97  ? 47  SER D N     1 
ATOM   9313  C  CA    . SER D  1 75  ? 13.271  9.447   -18.157 1.00 30.26  ? 47  SER D CA    1 
ATOM   9314  C  C     . SER D  1 75  ? 11.930  9.089   -18.805 1.00 30.52  ? 47  SER D C     1 
ATOM   9315  O  O     . SER D  1 75  ? 11.290  8.128   -18.392 1.00 29.59  ? 47  SER D O     1 
ATOM   9316  C  CB    . SER D  1 75  ? 13.017  10.326  -16.924 1.00 26.14  ? 47  SER D CB    1 
ATOM   9317  O  OG    . SER D  1 75  ? 12.322  11.485  -17.322 1.00 25.87  ? 47  SER D OG    1 
ATOM   9318  N  N     . GLY D  1 76  ? 11.495  9.871   -19.790 1.00 31.44  ? 48  GLY D N     1 
ATOM   9319  C  CA    . GLY D  1 76  ? 10.159  9.717   -20.360 1.00 24.84  ? 48  GLY D CA    1 
ATOM   9320  C  C     . GLY D  1 76  ? 9.181   10.698  -19.712 1.00 32.96  ? 48  GLY D C     1 
ATOM   9321  O  O     . GLY D  1 76  ? 8.024   10.802  -20.119 1.00 36.87  ? 48  GLY D O     1 
ATOM   9322  N  N     . PHE D  1 77  ? 9.639   11.412  -18.687 1.00 27.32  ? 49  PHE D N     1 
ATOM   9323  C  CA    . PHE D  1 77  ? 8.821   12.467  -18.083 1.00 33.76  ? 49  PHE D CA    1 
ATOM   9324  C  C     . PHE D  1 77  ? 9.031   13.826  -18.775 1.00 29.71  ? 49  PHE D C     1 
ATOM   9325  O  O     . PHE D  1 77  ? 8.389   14.821  -18.419 1.00 34.72  ? 49  PHE D O     1 
ATOM   9326  C  CB    . PHE D  1 77  ? 9.120   12.615  -16.586 1.00 29.10  ? 49  PHE D CB    1 
ATOM   9327  C  CG    . PHE D  1 77  ? 8.740   11.414  -15.756 1.00 33.13  ? 49  PHE D CG    1 
ATOM   9328  C  CD1   . PHE D  1 77  ? 7.671   10.616  -16.108 1.00 34.47  ? 49  PHE D CD1   1 
ATOM   9329  C  CD2   . PHE D  1 77  ? 9.455   11.098  -14.613 1.00 32.54  ? 49  PHE D CD2   1 
ATOM   9330  C  CE1   . PHE D  1 77  ? 7.330   9.521   -15.341 1.00 36.11  ? 49  PHE D CE1   1 
ATOM   9331  C  CE2   . PHE D  1 77  ? 9.117   10.012  -13.838 1.00 26.09  ? 49  PHE D CE2   1 
ATOM   9332  C  CZ    . PHE D  1 77  ? 8.049   9.221   -14.202 1.00 32.03  ? 49  PHE D CZ    1 
ATOM   9333  N  N     . GLU D  1 78  ? 9.938   13.876  -19.746 1.00 32.50  ? 50  GLU D N     1 
ATOM   9334  C  CA    . GLU D  1 78  ? 10.207  15.128  -20.481 1.00 33.98  ? 50  GLU D CA    1 
ATOM   9335  C  C     . GLU D  1 78  ? 9.160   15.357  -21.572 1.00 30.20  ? 50  GLU D C     1 
ATOM   9336  O  O     . GLU D  1 78  ? 8.585   14.409  -22.076 1.00 28.84  ? 50  GLU D O     1 
ATOM   9337  C  CB    . GLU D  1 78  ? 11.605  15.102  -21.123 1.00 27.62  ? 50  GLU D CB    1 
ATOM   9338  C  CG    . GLU D  1 78  ? 12.751  14.815  -20.167 1.00 27.21  ? 50  GLU D CG    1 
ATOM   9339  C  CD    . GLU D  1 78  ? 12.929  13.317  -19.863 1.00 32.41  ? 50  GLU D CD    1 
ATOM   9340  O  OE1   . GLU D  1 78  ? 12.271  12.473  -20.518 1.00 27.37  ? 50  GLU D OE1   1 
ATOM   9341  O  OE2   . GLU D  1 78  ? 13.734  12.984  -18.968 1.00 28.11  ? 50  GLU D OE2   1 
ATOM   9342  N  N     . GLU D  1 79  ? 8.920   16.610  -21.960 1.00 29.33  ? 51  GLU D N     1 
ATOM   9343  C  CA    . GLU D  1 79  ? 8.186   16.853  -23.210 1.00 32.34  ? 51  GLU D CA    1 
ATOM   9344  C  C     . GLU D  1 79  ? 8.876   16.086  -24.366 1.00 29.98  ? 51  GLU D C     1 
ATOM   9345  O  O     . GLU D  1 79  ? 10.090  16.179  -24.529 1.00 34.32  ? 51  GLU D O     1 
ATOM   9346  C  CB    . GLU D  1 79  ? 8.119   18.358  -23.506 1.00 35.24  ? 51  GLU D CB    1 
ATOM   9347  C  CG    . GLU D  1 79  ? 7.849   18.696  -24.951 1.00 33.39  ? 51  GLU D CG    1 
ATOM   9348  C  CD    . GLU D  1 79  ? 6.449   18.328  -25.377 1.00 39.19  ? 51  GLU D CD    1 
ATOM   9349  O  OE1   . GLU D  1 79  ? 5.509   18.553  -24.581 1.00 39.19  ? 51  GLU D OE1   1 
ATOM   9350  O  OE2   . GLU D  1 79  ? 6.294   17.798  -26.505 1.00 38.77  ? 51  GLU D OE2   1 
ATOM   9351  N  N     . PRO D  1 80  ? 8.113   15.300  -25.149 1.00 30.71  ? 52  PRO D N     1 
ATOM   9352  C  CA    . PRO D  1 80  ? 8.780   14.484  -26.179 1.00 32.55  ? 52  PRO D CA    1 
ATOM   9353  C  C     . PRO D  1 80  ? 9.193   15.251  -27.432 1.00 40.83  ? 52  PRO D C     1 
ATOM   9354  O  O     . PRO D  1 80  ? 10.115  14.808  -28.112 1.00 40.27  ? 52  PRO D O     1 
ATOM   9355  C  CB    . PRO D  1 80  ? 7.729   13.414  -26.527 1.00 40.22  ? 52  PRO D CB    1 
ATOM   9356  C  CG    . PRO D  1 80  ? 6.421   13.994  -26.108 1.00 38.54  ? 52  PRO D CG    1 
ATOM   9357  C  CD    . PRO D  1 80  ? 6.697   14.932  -24.961 1.00 33.57  ? 52  PRO D CD    1 
ATOM   9358  N  N     . ASP D  1 81  ? 8.556   16.386  -27.715 1.00 41.92  ? 53  ASP D N     1 
ATOM   9359  C  CA    . ASP D  1 81  ? 8.856   17.152  -28.931 1.00 37.37  ? 53  ASP D CA    1 
ATOM   9360  C  C     . ASP D  1 81  ? 9.982   18.141  -28.661 1.00 37.20  ? 53  ASP D C     1 
ATOM   9361  O  O     . ASP D  1 81  ? 9.751   19.203  -28.075 1.00 33.90  ? 53  ASP D O     1 
ATOM   9362  C  CB    . ASP D  1 81  ? 7.604   17.883  -29.431 1.00 41.87  ? 53  ASP D CB    1 
ATOM   9363  C  CG    . ASP D  1 81  ? 7.755   18.402  -30.856 1.00 47.08  ? 53  ASP D CG    1 
ATOM   9364  O  OD1   . ASP D  1 81  ? 8.366   19.466  -31.045 1.00 40.22  ? 53  ASP D OD1   1 
ATOM   9365  O  OD2   . ASP D  1 81  ? 7.259   17.736  -31.787 1.00 56.72  ? 53  ASP D OD2   1 
ATOM   9366  N  N     . ILE D  1 82  ? 11.197  17.776  -29.078 1.00 33.31  ? 54  ILE D N     1 
ATOM   9367  C  CA    . ILE D  1 82  ? 12.401  18.557  -28.782 1.00 34.71  ? 54  ILE D CA    1 
ATOM   9368  C  C     . ILE D  1 82  ? 12.332  19.974  -29.359 1.00 34.12  ? 54  ILE D C     1 
ATOM   9369  O  O     . ILE D  1 82  ? 12.837  20.915  -28.746 1.00 35.48  ? 54  ILE D O     1 
ATOM   9370  C  CB    . ILE D  1 82  ? 13.683  17.850  -29.304 1.00 32.91  ? 54  ILE D CB    1 
ATOM   9371  C  CG1   . ILE D  1 82  ? 13.994  16.617  -28.458 1.00 38.66  ? 54  ILE D CG1   1 
ATOM   9372  C  CG2   . ILE D  1 82  ? 14.897  18.784  -29.252 1.00 34.87  ? 54  ILE D CG2   1 
ATOM   9373  C  CD1   . ILE D  1 82  ? 15.169  15.804  -28.990 1.00 38.19  ? 54  ILE D CD1   1 
ATOM   9374  N  N     . GLU D  1 83  ? 11.686  20.125  -30.513 1.00 34.86  ? 55  GLU D N     1 
ATOM   9375  C  CA    . GLU D  1 83  ? 11.544  21.444  -31.140 1.00 40.18  ? 55  GLU D CA    1 
ATOM   9376  C  C     . GLU D  1 83  ? 10.800  22.424  -30.223 1.00 36.92  ? 55  GLU D C     1 
ATOM   9377  O  O     . GLU D  1 83  ? 11.246  23.549  -30.031 1.00 32.56  ? 55  GLU D O     1 
ATOM   9378  C  CB    . GLU D  1 83  ? 10.824  21.334  -32.491 1.00 40.79  ? 55  GLU D CB    1 
ATOM   9379  C  CG    . GLU D  1 83  ? 11.715  20.812  -33.609 1.00 49.12  ? 55  GLU D CG    1 
ATOM   9380  C  CD    . GLU D  1 83  ? 12.869  21.757  -33.911 1.00 60.75  ? 55  GLU D CD    1 
ATOM   9381  O  OE1   . GLU D  1 83  ? 12.647  22.755  -34.638 1.00 65.27  ? 55  GLU D OE1   1 
ATOM   9382  O  OE2   . GLU D  1 83  ? 13.996  21.503  -33.421 1.00 59.46  ? 55  GLU D OE2   1 
ATOM   9383  N  N     . LYS D  1 84  ? 9.691   21.973  -29.643 1.00 41.31  ? 56  LYS D N     1 
ATOM   9384  C  CA    . LYS D  1 84  ? 8.926   22.782  -28.697 1.00 35.47  ? 56  LYS D CA    1 
ATOM   9385  C  C     . LYS D  1 84  ? 9.732   23.121  -27.442 1.00 34.47  ? 56  LYS D C     1 
ATOM   9386  O  O     . LYS D  1 84  ? 9.664   24.242  -26.955 1.00 36.62  ? 56  LYS D O     1 
ATOM   9387  C  CB    . LYS D  1 84  ? 7.644   22.063  -28.291 1.00 31.76  ? 56  LYS D CB    1 
ATOM   9388  C  CG    . LYS D  1 84  ? 6.629   21.871  -29.384 1.00 38.73  ? 56  LYS D CG    1 
ATOM   9389  C  CD    . LYS D  1 84  ? 5.342   21.318  -28.786 1.00 40.09  ? 56  LYS D CD    1 
ATOM   9390  C  CE    . LYS D  1 84  ? 4.331   20.942  -29.853 1.00 41.46  ? 56  LYS D CE    1 
ATOM   9391  N  NZ    . LYS D  1 84  ? 2.999   20.729  -29.214 1.00 50.88  ? 56  LYS D NZ    1 
ATOM   9392  N  N     . ARG D  1 85  ? 10.488  22.152  -26.924 1.00 33.66  ? 57  ARG D N     1 
ATOM   9393  C  CA    . ARG D  1 85  ? 11.267  22.337  -25.693 1.00 33.20  ? 57  ARG D CA    1 
ATOM   9394  C  C     . ARG D  1 85  ? 12.315  23.433  -25.808 1.00 33.83  ? 57  ARG D C     1 
ATOM   9395  O  O     . ARG D  1 85  ? 12.642  24.095  -24.824 1.00 38.25  ? 57  ARG D O     1 
ATOM   9396  C  CB    . ARG D  1 85  ? 11.985  21.048  -25.296 1.00 32.82  ? 57  ARG D CB    1 
ATOM   9397  C  CG    . ARG D  1 85  ? 11.105  19.838  -25.085 1.00 31.59  ? 57  ARG D CG    1 
ATOM   9398  C  CD    . ARG D  1 85  ? 11.741  18.900  -24.072 1.00 27.94  ? 57  ARG D CD    1 
ATOM   9399  N  NE    . ARG D  1 85  ? 11.674  19.453  -22.717 1.00 29.72  ? 57  ARG D NE    1 
ATOM   9400  C  CZ    . ARG D  1 85  ? 12.458  19.089  -21.707 1.00 32.09  ? 57  ARG D CZ    1 
ATOM   9401  N  NH1   . ARG D  1 85  ? 13.395  18.159  -21.885 1.00 28.97  ? 57  ARG D NH1   1 
ATOM   9402  N  NH2   . ARG D  1 85  ? 12.305  19.652  -20.510 1.00 28.56  ? 57  ARG D NH2   1 
ATOM   9403  N  N     . VAL D  1 86  ? 12.868  23.604  -27.007 1.00 35.64  ? 58  VAL D N     1 
ATOM   9404  C  CA    . VAL D  1 86  ? 14.023  24.481  -27.182 1.00 33.87  ? 58  VAL D CA    1 
ATOM   9405  C  C     . VAL D  1 86  ? 13.699  25.804  -27.873 1.00 28.40  ? 58  VAL D C     1 
ATOM   9406  O  O     . VAL D  1 86  ? 14.593  26.611  -28.080 1.00 27.72  ? 58  VAL D O     1 
ATOM   9407  C  CB    . VAL D  1 86  ? 15.152  23.791  -28.000 1.00 37.68  ? 58  VAL D CB    1 
ATOM   9408  C  CG1   . VAL D  1 86  ? 15.618  22.516  -27.313 1.00 37.74  ? 58  VAL D CG1   1 
ATOM   9409  C  CG2   . VAL D  1 86  ? 14.705  23.527  -29.465 1.00 35.61  ? 58  VAL D CG2   1 
ATOM   9410  N  N     . THR D  1 87  ? 12.437  26.016  -28.235 1.00 31.11  ? 59  THR D N     1 
ATOM   9411  C  CA    . THR D  1 87  ? 12.069  27.173  -29.057 1.00 30.37  ? 59  THR D CA    1 
ATOM   9412  C  C     . THR D  1 87  ? 10.931  27.984  -28.433 1.00 32.11  ? 59  THR D C     1 
ATOM   9413  O  O     . THR D  1 87  ? 9.762   27.757  -28.738 1.00 32.74  ? 59  THR D O     1 
ATOM   9414  C  CB    . THR D  1 87  ? 11.650  26.735  -30.484 1.00 38.49  ? 59  THR D CB    1 
ATOM   9415  O  OG1   . THR D  1 87  ? 12.552  25.729  -30.970 1.00 40.27  ? 59  THR D OG1   1 
ATOM   9416  C  CG2   . THR D  1 87  ? 11.645  27.941  -31.454 1.00 38.51  ? 59  THR D CG2   1 
ATOM   9417  N  N     . PRO D  1 88  ? 11.268  28.936  -27.553 1.00 33.07  ? 60  PRO D N     1 
ATOM   9418  C  CA    . PRO D  1 88  ? 10.238  29.719  -26.853 1.00 31.30  ? 60  PRO D CA    1 
ATOM   9419  C  C     . PRO D  1 88  ? 9.225   30.379  -27.793 1.00 36.18  ? 60  PRO D C     1 
ATOM   9420  O  O     . PRO D  1 88  ? 8.036   30.466  -27.456 1.00 32.52  ? 60  PRO D O     1 
ATOM   9421  C  CB    . PRO D  1 88  ? 11.056  30.766  -26.105 1.00 34.87  ? 60  PRO D CB    1 
ATOM   9422  C  CG    . PRO D  1 88  ? 12.356  30.054  -25.800 1.00 33.38  ? 60  PRO D CG    1 
ATOM   9423  C  CD    . PRO D  1 88  ? 12.621  29.215  -27.048 1.00 31.43  ? 60  PRO D CD    1 
ATOM   9424  N  N     . LYS D  1 89  ? 9.670   30.783  -28.980 1.00 33.70  ? 61  LYS D N     1 
ATOM   9425  C  CA    . LYS D  1 89  ? 8.777   31.462  -29.913 1.00 38.28  ? 61  LYS D CA    1 
ATOM   9426  C  C     . LYS D  1 89  ? 7.733   30.539  -30.551 1.00 41.90  ? 61  LYS D C     1 
ATOM   9427  O  O     . LYS D  1 89  ? 6.692   31.013  -31.006 1.00 40.51  ? 61  LYS D O     1 
ATOM   9428  C  CB    . LYS D  1 89  ? 9.595   32.162  -30.988 1.00 39.58  ? 61  LYS D CB    1 
ATOM   9429  C  CG    . LYS D  1 89  ? 10.527  33.230  -30.433 1.00 34.84  ? 61  LYS D CG    1 
ATOM   9430  C  CD    . LYS D  1 89  ? 11.119  34.054  -31.576 1.00 39.49  ? 61  LYS D CD    1 
ATOM   9431  C  CE    . LYS D  1 89  ? 11.922  35.245  -31.078 1.00 46.94  ? 61  LYS D CE    1 
ATOM   9432  N  NZ    . LYS D  1 89  ? 13.290  34.894  -30.586 1.00 44.26  ? 61  LYS D NZ    1 
ATOM   9433  N  N     . LEU D  1 90  ? 7.999   29.229  -30.576 1.00 37.41  ? 62  LEU D N     1 
ATOM   9434  C  CA    . LEU D  1 90  ? 6.982   28.251  -30.966 1.00 35.16  ? 62  LEU D CA    1 
ATOM   9435  C  C     . LEU D  1 90  ? 5.859   28.153  -29.940 1.00 37.11  ? 62  LEU D C     1 
ATOM   9436  O  O     . LEU D  1 90  ? 4.708   27.892  -30.290 1.00 41.45  ? 62  LEU D O     1 
ATOM   9437  C  CB    . LEU D  1 90  ? 7.600   26.861  -31.160 1.00 35.35  ? 62  LEU D CB    1 
ATOM   9438  C  CG    . LEU D  1 90  ? 8.195   26.590  -32.528 1.00 42.66  ? 62  LEU D CG    1 
ATOM   9439  C  CD1   . LEU D  1 90  ? 8.648   25.112  -32.659 1.00 44.06  ? 62  LEU D CD1   1 
ATOM   9440  C  CD2   . LEU D  1 90  ? 7.169   26.972  -33.592 1.00 39.68  ? 62  LEU D CD2   1 
ATOM   9441  N  N     . LEU D  1 91  ? 6.203   28.339  -28.671 1.00 40.26  ? 63  LEU D N     1 
ATOM   9442  C  CA    . LEU D  1 91  ? 5.230   28.241  -27.585 1.00 41.48  ? 63  LEU D CA    1 
ATOM   9443  C  C     . LEU D  1 91  ? 4.425   29.542  -27.456 1.00 39.85  ? 63  LEU D C     1 
ATOM   9444  O  O     . LEU D  1 91  ? 3.203   29.515  -27.304 1.00 38.29  ? 63  LEU D O     1 
ATOM   9445  C  CB    . LEU D  1 91  ? 5.941   27.904  -26.268 1.00 36.38  ? 63  LEU D CB    1 
ATOM   9446  C  CG    . LEU D  1 91  ? 6.894   26.708  -26.363 1.00 39.25  ? 63  LEU D CG    1 
ATOM   9447  C  CD1   . LEU D  1 91  ? 7.624   26.470  -25.056 1.00 39.26  ? 63  LEU D CD1   1 
ATOM   9448  C  CD2   . LEU D  1 91  ? 6.132   25.460  -26.780 1.00 31.88  ? 63  LEU D CD2   1 
ATOM   9449  N  N     . LEU D  1 92  ? 5.106   30.680  -27.535 1.00 36.14  ? 64  LEU D N     1 
ATOM   9450  C  CA    . LEU D  1 92  ? 4.398   31.957  -27.510 1.00 40.08  ? 64  LEU D CA    1 
ATOM   9451  C  C     . LEU D  1 92  ? 4.771   32.792  -28.727 1.00 41.44  ? 64  LEU D C     1 
ATOM   9452  O  O     . LEU D  1 92  ? 5.883   33.320  -28.796 1.00 37.92  ? 64  LEU D O     1 
ATOM   9453  C  CB    . LEU D  1 92  ? 4.703   32.732  -26.236 1.00 33.79  ? 64  LEU D CB    1 
ATOM   9454  C  CG    . LEU D  1 92  ? 3.911   34.028  -26.040 1.00 38.75  ? 64  LEU D CG    1 
ATOM   9455  C  CD1   . LEU D  1 92  ? 2.459   33.745  -25.681 1.00 37.36  ? 64  LEU D CD1   1 
ATOM   9456  C  CD2   . LEU D  1 92  ? 4.556   34.902  -24.989 1.00 31.18  ? 64  LEU D CD2   1 
ATOM   9457  N  N     . PRO D  1 93  ? 3.849   32.881  -29.700 1.00 45.66  ? 65  PRO D N     1 
ATOM   9458  C  CA    . PRO D  1 93  ? 4.044   33.701  -30.902 1.00 48.02  ? 65  PRO D CA    1 
ATOM   9459  C  C     . PRO D  1 93  ? 4.660   35.054  -30.565 1.00 42.26  ? 65  PRO D C     1 
ATOM   9460  O  O     . PRO D  1 93  ? 4.165   35.749  -29.679 1.00 44.80  ? 65  PRO D O     1 
ATOM   9461  C  CB    . PRO D  1 93  ? 2.621   33.855  -31.441 1.00 49.48  ? 65  PRO D CB    1 
ATOM   9462  C  CG    . PRO D  1 93  ? 1.963   32.554  -31.069 1.00 48.00  ? 65  PRO D CG    1 
ATOM   9463  C  CD    . PRO D  1 93  ? 2.533   32.210  -29.703 1.00 47.74  ? 65  PRO D CD    1 
ATOM   9464  N  N     . LYS D  1 94  ? 5.770   35.376  -31.218 1.00 43.91  ? 66  LYS D N     1 
ATOM   9465  C  CA    . LYS D  1 94  ? 6.373   36.693  -31.114 1.00 46.53  ? 66  LYS D CA    1 
ATOM   9466  C  C     . LYS D  1 94  ? 6.814   36.990  -29.683 1.00 46.42  ? 66  LYS D C     1 
ATOM   9467  O  O     . LYS D  1 94  ? 6.680   38.113  -29.198 1.00 44.28  ? 66  LYS D O     1 
ATOM   9468  C  CB    . LYS D  1 94  ? 5.389   37.764  -31.616 1.00 48.58  ? 66  LYS D CB    1 
ATOM   9469  C  CG    . LYS D  1 94  ? 4.875   37.500  -33.036 1.00 50.22  ? 66  LYS D CG    1 
ATOM   9470  C  CD    . LYS D  1 94  ? 3.839   38.539  -33.487 1.00 63.48  ? 66  LYS D CD    1 
ATOM   9471  C  CE    . LYS D  1 94  ? 2.596   38.508  -32.599 1.00 61.71  ? 66  LYS D CE    1 
ATOM   9472  N  NZ    . LYS D  1 94  ? 1.604   39.552  -32.976 1.00 65.33  ? 66  LYS D NZ    1 
ATOM   9473  N  N     . ALA D  1 95  ? 7.346   35.966  -29.024 1.00 38.25  ? 67  ALA D N     1 
ATOM   9474  C  CA    . ALA D  1 95  ? 7.935   36.086  -27.697 1.00 36.27  ? 67  ALA D CA    1 
ATOM   9475  C  C     . ALA D  1 95  ? 9.277   36.811  -27.748 1.00 34.85  ? 67  ALA D C     1 
ATOM   9476  O  O     . ALA D  1 95  ? 10.017  36.681  -28.719 1.00 36.74  ? 67  ALA D O     1 
ATOM   9477  C  CB    . ALA D  1 95  ? 8.112   34.678  -27.070 1.00 35.66  ? 67  ALA D CB    1 
ATOM   9478  N  N     . LYS D  1 96  ? 9.602   37.541  -26.684 1.00 32.99  ? 68  LYS D N     1 
ATOM   9479  C  CA    . LYS D  1 96  ? 10.825  38.344  -26.624 1.00 36.99  ? 68  LYS D CA    1 
ATOM   9480  C  C     . LYS D  1 96  ? 11.679  38.064  -25.399 1.00 36.26  ? 68  LYS D C     1 
ATOM   9481  O  O     . LYS D  1 96  ? 12.887  38.301  -25.415 1.00 35.46  ? 68  LYS D O     1 
ATOM   9482  C  CB    . LYS D  1 96  ? 10.484  39.835  -26.641 1.00 36.86  ? 68  LYS D CB    1 
ATOM   9483  C  CG    . LYS D  1 96  ? 9.503   40.228  -27.719 1.00 39.91  ? 68  LYS D CG    1 
ATOM   9484  C  CD    . LYS D  1 96  ? 10.078  39.975  -29.087 1.00 43.99  ? 68  LYS D CD    1 
ATOM   9485  C  CE    . LYS D  1 96  ? 9.170   40.572  -30.172 1.00 53.54  ? 68  LYS D CE    1 
ATOM   9486  N  NZ    . LYS D  1 96  ? 9.650   40.240  -31.539 1.00 50.04  ? 68  LYS D NZ    1 
ATOM   9487  N  N     . SER D  1 97  ? 11.050  37.600  -24.320 1.00 33.70  ? 69  SER D N     1 
ATOM   9488  C  CA    . SER D  1 97  ? 11.788  37.310  -23.093 1.00 30.40  ? 69  SER D CA    1 
ATOM   9489  C  C     . SER D  1 97  ? 11.223  36.095  -22.344 1.00 31.26  ? 69  SER D C     1 
ATOM   9490  O  O     . SER D  1 97  ? 10.119  35.611  -22.623 1.00 29.54  ? 69  SER D O     1 
ATOM   9491  C  CB    . SER D  1 97  ? 11.787  38.528  -22.154 1.00 31.99  ? 69  SER D CB    1 
ATOM   9492  O  OG    . SER D  1 97  ? 10.474  38.814  -21.687 1.00 31.84  ? 69  SER D OG    1 
ATOM   9493  N  N     . ILE D  1 98  ? 11.982  35.615  -21.378 1.00 30.34  ? 70  ILE D N     1 
ATOM   9494  C  CA    . ILE D  1 98  ? 11.422  34.661  -20.430 1.00 29.52  ? 70  ILE D CA    1 
ATOM   9495  C  C     . ILE D  1 98  ? 11.748  35.180  -19.040 1.00 30.81  ? 70  ILE D C     1 
ATOM   9496  O  O     . ILE D  1 98  ? 12.892  35.570  -18.755 1.00 30.65  ? 70  ILE D O     1 
ATOM   9497  C  CB    . ILE D  1 98  ? 11.971  33.220  -20.615 1.00 32.73  ? 70  ILE D CB    1 
ATOM   9498  C  CG1   . ILE D  1 98  ? 11.903  32.774  -22.076 1.00 33.26  ? 70  ILE D CG1   1 
ATOM   9499  C  CG2   . ILE D  1 98  ? 11.193  32.233  -19.752 1.00 26.98  ? 70  ILE D CG2   1 
ATOM   9500  C  CD1   . ILE D  1 98  ? 12.556  31.405  -22.336 1.00 30.98  ? 70  ILE D CD1   1 
ATOM   9501  N  N     . VAL D  1 99  ? 10.731  35.222  -18.187 1.00 27.24  ? 71  VAL D N     1 
ATOM   9502  C  CA    . VAL D  1 99  ? 10.955  35.514  -16.776 1.00 34.66  ? 71  VAL D CA    1 
ATOM   9503  C  C     . VAL D  1 99  ? 11.013  34.214  -15.981 1.00 28.93  ? 71  VAL D C     1 
ATOM   9504  O  O     . VAL D  1 99  ? 10.020  33.510  -15.905 1.00 28.34  ? 71  VAL D O     1 
ATOM   9505  C  CB    . VAL D  1 99  ? 9.849   36.411  -16.186 1.00 32.13  ? 71  VAL D CB    1 
ATOM   9506  C  CG1   . VAL D  1 99  ? 10.142  36.704  -14.720 1.00 29.62  ? 71  VAL D CG1   1 
ATOM   9507  C  CG2   . VAL D  1 99  ? 9.712   37.695  -17.000 1.00 36.56  ? 71  VAL D CG2   1 
ATOM   9508  N  N     . ALA D  1 100 ? 12.172  33.930  -15.389 1.00 30.28  ? 72  ALA D N     1 
ATOM   9509  C  CA    . ALA D  1 100 ? 12.387  32.763  -14.540 1.00 30.06  ? 72  ALA D CA    1 
ATOM   9510  C  C     . ALA D  1 100 ? 12.164  33.109  -13.078 1.00 34.16  ? 72  ALA D C     1 
ATOM   9511  O  O     . ALA D  1 100 ? 12.606  34.175  -12.622 1.00 30.94  ? 72  ALA D O     1 
ATOM   9512  C  CB    . ALA D  1 100 ? 13.803  32.222  -14.723 1.00 23.26  ? 72  ALA D CB    1 
ATOM   9513  N  N     . ILE D  1 101 ? 11.503  32.215  -12.333 1.00 28.34  ? 73  ILE D N     1 
ATOM   9514  C  CA    . ILE D  1 101 ? 11.404  32.403  -10.882 1.00 30.94  ? 73  ILE D CA    1 
ATOM   9515  C  C     . ILE D  1 101 ? 11.826  31.167  -10.105 1.00 29.29  ? 73  ILE D C     1 
ATOM   9516  O  O     . ILE D  1 101 ? 11.757  30.037  -10.605 1.00 32.97  ? 73  ILE D O     1 
ATOM   9517  C  CB    . ILE D  1 101 ? 9.973   32.795  -10.421 1.00 30.93  ? 73  ILE D CB    1 
ATOM   9518  C  CG1   . ILE D  1 101 ? 8.974   31.673  -10.677 1.00 30.88  ? 73  ILE D CG1   1 
ATOM   9519  C  CG2   . ILE D  1 101 ? 9.523   34.117  -11.063 1.00 28.89  ? 73  ILE D CG2   1 
ATOM   9520  C  CD1   . ILE D  1 101 ? 7.651   31.888  -9.999  1.00 28.77  ? 73  ILE D CD1   1 
ATOM   9521  N  N     . ALA D  1 102 ? 12.257  31.389  -8.869  1.00 28.48  ? 74  ALA D N     1 
ATOM   9522  C  CA    . ALA D  1 102 ? 12.630  30.300  -7.979  1.00 27.54  ? 74  ALA D CA    1 
ATOM   9523  C  C     . ALA D  1 102 ? 12.154  30.620  -6.573  1.00 34.23  ? 74  ALA D C     1 
ATOM   9524  O  O     . ALA D  1 102 ? 12.228  31.774  -6.131  1.00 29.65  ? 74  ALA D O     1 
ATOM   9525  C  CB    . ALA D  1 102 ? 14.151  30.064  -7.987  1.00 25.31  ? 74  ALA D CB    1 
ATOM   9526  N  N     . LEU D  1 103 ? 11.635  29.598  -5.896  1.00 29.05  ? 75  LEU D N     1 
ATOM   9527  C  CA    . LEU D  1 103 ? 11.327  29.684  -4.475  1.00 29.86  ? 75  LEU D CA    1 
ATOM   9528  C  C     . LEU D  1 103 ? 12.121  28.611  -3.753  1.00 30.74  ? 75  LEU D C     1 
ATOM   9529  O  O     . LEU D  1 103 ? 12.220  27.456  -4.222  1.00 27.42  ? 75  LEU D O     1 
ATOM   9530  C  CB    . LEU D  1 103 ? 9.827   29.516  -4.198  1.00 26.60  ? 75  LEU D CB    1 
ATOM   9531  C  CG    . LEU D  1 103 ? 8.873   30.689  -4.430  1.00 28.13  ? 75  LEU D CG    1 
ATOM   9532  C  CD1   . LEU D  1 103 ? 8.787   31.087  -5.912  1.00 27.03  ? 75  LEU D CD1   1 
ATOM   9533  C  CD2   . LEU D  1 103 ? 7.497   30.357  -3.856  1.00 28.82  ? 75  LEU D CD2   1 
ATOM   9534  N  N     . ALA D  1 104 ? 12.709  29.008  -2.634  1.00 29.09  ? 76  ALA D N     1 
ATOM   9535  C  CA    . ALA D  1 104 ? 13.483  28.116  -1.779  1.00 30.20  ? 76  ALA D CA    1 
ATOM   9536  C  C     . ALA D  1 104 ? 12.563  27.256  -0.909  1.00 29.31  ? 76  ALA D C     1 
ATOM   9537  O  O     . ALA D  1 104 ? 11.596  27.763  -0.343  1.00 31.88  ? 76  ALA D O     1 
ATOM   9538  C  CB    . ALA D  1 104 ? 14.429  28.923  -0.904  1.00 23.08  ? 76  ALA D CB    1 
ATOM   9539  N  N     . TYR D  1 105 ? 12.870  25.965  -0.787  1.00 29.39  ? 77  TYR D N     1 
ATOM   9540  C  CA    . TYR D  1 105 ? 12.073  25.097  0.073   1.00 26.24  ? 77  TYR D CA    1 
ATOM   9541  C  C     . TYR D  1 105 ? 12.888  24.545  1.230   1.00 28.48  ? 77  TYR D C     1 
ATOM   9542  O  O     . TYR D  1 105 ? 14.110  24.442  1.144   1.00 31.34  ? 77  TYR D O     1 
ATOM   9543  C  CB    . TYR D  1 105 ? 11.432  23.952  -0.734  1.00 29.44  ? 77  TYR D CB    1 
ATOM   9544  C  CG    . TYR D  1 105 ? 12.348  23.026  -1.511  1.00 27.31  ? 77  TYR D CG    1 
ATOM   9545  C  CD1   . TYR D  1 105 ? 13.020  21.983  -0.877  1.00 31.70  ? 77  TYR D CD1   1 
ATOM   9546  C  CD2   . TYR D  1 105 ? 12.489  23.151  -2.893  1.00 28.77  ? 77  TYR D CD2   1 
ATOM   9547  C  CE1   . TYR D  1 105 ? 13.834  21.095  -1.603  1.00 31.86  ? 77  TYR D CE1   1 
ATOM   9548  C  CE2   . TYR D  1 105 ? 13.312  22.278  -3.626  1.00 29.60  ? 77  TYR D CE2   1 
ATOM   9549  C  CZ    . TYR D  1 105 ? 13.973  21.252  -2.974  1.00 29.80  ? 77  TYR D CZ    1 
ATOM   9550  O  OH    . TYR D  1 105 ? 14.778  20.384  -3.679  1.00 28.60  ? 77  TYR D OH    1 
ATOM   9551  N  N     . PRO D  1 106 ? 12.212  24.212  2.338   1.00 28.20  ? 78  PRO D N     1 
ATOM   9552  C  CA    . PRO D  1 106 ? 12.903  23.724  3.534   1.00 31.05  ? 78  PRO D CA    1 
ATOM   9553  C  C     . PRO D  1 106 ? 13.622  22.404  3.313   1.00 33.47  ? 78  PRO D C     1 
ATOM   9554  O  O     . PRO D  1 106 ? 13.122  21.529  2.605   1.00 30.74  ? 78  PRO D O     1 
ATOM   9555  C  CB    . PRO D  1 106 ? 11.773  23.569  4.556   1.00 32.46  ? 78  PRO D CB    1 
ATOM   9556  C  CG    . PRO D  1 106 ? 10.525  23.534  3.760   1.00 36.51  ? 78  PRO D CG    1 
ATOM   9557  C  CD    . PRO D  1 106 ? 10.776  24.407  2.577   1.00 30.73  ? 78  PRO D CD    1 
ATOM   9558  N  N     . SER D  1 107 ? 14.807  22.278  3.902   1.00 33.26  ? 79  SER D N     1 
ATOM   9559  C  CA    . SER D  1 107 ? 15.599  21.076  3.743   1.00 33.50  ? 79  SER D CA    1 
ATOM   9560  C  C     . SER D  1 107 ? 15.732  20.283  5.052   1.00 36.00  ? 79  SER D C     1 
ATOM   9561  O  O     . SER D  1 107 ? 16.326  19.208  5.052   1.00 36.07  ? 79  SER D O     1 
ATOM   9562  C  CB    . SER D  1 107 ? 16.981  21.419  3.220   1.00 31.40  ? 79  SER D CB    1 
ATOM   9563  O  OG    . SER D  1 107 ? 17.721  22.075  4.231   1.00 36.27  ? 79  SER D OG    1 
ATOM   9564  N  N     . ARG D  1 108 ? 15.201  20.821  6.151   1.00 33.55  ? 80  ARG D N     1 
ATOM   9565  C  CA    . ARG D  1 108 ? 15.148  20.101  7.437   1.00 40.22  ? 80  ARG D CA    1 
ATOM   9566  C  C     . ARG D  1 108 ? 13.723  20.062  7.964   1.00 39.27  ? 80  ARG D C     1 
ATOM   9567  O  O     . ARG D  1 108 ? 13.031  21.071  7.956   1.00 37.62  ? 80  ARG D O     1 
ATOM   9568  C  CB    . ARG D  1 108 ? 16.052  20.744  8.497   1.00 36.97  ? 80  ARG D CB    1 
ATOM   9569  C  CG    . ARG D  1 108 ? 17.542  20.506  8.308   1.00 43.86  ? 80  ARG D CG    1 
ATOM   9570  C  CD    . ARG D  1 108 ? 18.330  20.822  9.591   1.00 49.33  ? 80  ARG D CD    1 
ATOM   9571  N  NE    . ARG D  1 108 ? 19.705  21.224  9.286   1.00 60.32  ? 80  ARG D NE    1 
ATOM   9572  C  CZ    . ARG D  1 108 ? 20.147  22.482  9.320   1.00 69.10  ? 80  ARG D CZ    1 
ATOM   9573  N  NH1   . ARG D  1 108 ? 19.327  23.472  9.672   1.00 61.08  ? 80  ARG D NH1   1 
ATOM   9574  N  NH2   . ARG D  1 108 ? 21.414  22.754  9.013   1.00 67.14  ? 80  ARG D NH2   1 
ATOM   9575  N  N     . MET D  1 109 ? 13.296  18.892  8.426   1.00 36.11  ? 81  MET D N     1 
ATOM   9576  C  CA    . MET D  1 109 ? 11.933  18.681  8.899   1.00 38.46  ? 81  MET D CA    1 
ATOM   9577  C  C     . MET D  1 109 ? 11.859  18.918  10.407  1.00 48.42  ? 81  MET D C     1 
ATOM   9578  O  O     . MET D  1 109 ? 12.484  18.190  11.174  1.00 49.54  ? 81  MET D O     1 
ATOM   9579  C  CB    . MET D  1 109 ? 11.488  17.252  8.550   1.00 39.90  ? 81  MET D CB    1 
ATOM   9580  C  CG    . MET D  1 109 ? 10.031  16.905  8.800   1.00 34.75  ? 81  MET D CG    1 
ATOM   9581  S  SD    . MET D  1 109 ? 9.758   15.122  8.568   1.00 40.86  ? 81  MET D SD    1 
ATOM   9582  C  CE    . MET D  1 109 ? 10.201  14.879  6.848   1.00 41.28  ? 81  MET D CE    1 
ATOM   9583  N  N     . LYS D  1 110 ? 11.112  19.927  10.841  1.00 43.54  ? 82  LYS D N     1 
ATOM   9584  C  CA    . LYS D  1 110 ? 11.007  20.205  12.278  1.00 55.92  ? 82  LYS D CA    1 
ATOM   9585  C  C     . LYS D  1 110 ? 10.239  19.100  13.007  1.00 50.60  ? 82  LYS D C     1 
ATOM   9586  O  O     . LYS D  1 110 ? 9.153   18.699  12.573  1.00 48.91  ? 82  LYS D O     1 
ATOM   9587  C  CB    . LYS D  1 110 ? 10.328  21.555  12.523  1.00 52.21  ? 82  LYS D CB    1 
ATOM   9588  C  CG    . LYS D  1 110 ? 10.446  22.062  13.958  1.00 63.11  ? 82  LYS D CG    1 
ATOM   9589  C  CD    . LYS D  1 110 ? 9.941   23.508  14.111  1.00 62.62  ? 82  LYS D CD    1 
ATOM   9590  C  CE    . LYS D  1 110 ? 8.417   23.594  14.081  1.00 63.83  ? 82  LYS D CE    1 
ATOM   9591  N  NZ    . LYS D  1 110 ? 7.769   22.867  15.213  1.00 64.84  ? 82  LYS D NZ    1 
ATOM   9592  N  N     . ASP D  1 111 ? 10.812  18.612  14.106  1.00 51.63  ? 83  ASP D N     1 
ATOM   9593  C  CA    . ASP D  1 111 ? 10.162  17.595  14.941  1.00 50.04  ? 83  ASP D CA    1 
ATOM   9594  C  C     . ASP D  1 111 ? 9.856   16.323  14.150  1.00 51.64  ? 83  ASP D C     1 
ATOM   9595  O  O     . ASP D  1 111 ? 8.764   15.753  14.256  1.00 50.62  ? 83  ASP D O     1 
ATOM   9596  C  CB    . ASP D  1 111 ? 8.871   18.147  15.556  1.00 53.22  ? 83  ASP D CB    1 
ATOM   9597  C  CG    . ASP D  1 111 ? 9.091   19.458  16.297  1.00 57.91  ? 83  ASP D CG    1 
ATOM   9598  O  OD1   . ASP D  1 111 ? 10.187  19.646  16.865  1.00 56.55  ? 83  ASP D OD1   1 
ATOM   9599  O  OD2   . ASP D  1 111 ? 8.171   20.302  16.300  1.00 61.95  ? 83  ASP D OD2   1 
ATOM   9600  N  N     . ALA D  1 112 ? 10.823  15.893  13.346  1.00 47.38  ? 84  ALA D N     1 
ATOM   9601  C  CA    . ALA D  1 112 ? 10.718  14.621  12.630  1.00 53.91  ? 84  ALA D CA    1 
ATOM   9602  C  C     . ALA D  1 112 ? 10.601  13.460  13.617  1.00 50.50  ? 84  ALA D C     1 
ATOM   9603  O  O     . ALA D  1 112 ? 11.379  13.368  14.562  1.00 51.09  ? 84  ALA D O     1 
ATOM   9604  C  CB    . ALA D  1 112 ? 11.918  14.423  11.712  1.00 38.85  ? 84  ALA D CB    1 
ATOM   9605  N  N     . PRO D  1 113 ? 9.615   12.574  13.411  1.00 53.38  ? 85  PRO D N     1 
ATOM   9606  C  CA    . PRO D  1 113 ? 9.495   11.389  14.275  1.00 53.93  ? 85  PRO D CA    1 
ATOM   9607  C  C     . PRO D  1 113 ? 10.576  10.366  13.940  1.00 48.03  ? 85  PRO D C     1 
ATOM   9608  O  O     . PRO D  1 113 ? 10.860  10.167  12.760  1.00 49.50  ? 85  PRO D O     1 
ATOM   9609  C  CB    . PRO D  1 113 ? 8.102   10.851  13.940  1.00 50.93  ? 85  PRO D CB    1 
ATOM   9610  C  CG    . PRO D  1 113 ? 7.896   11.246  12.504  1.00 52.28  ? 85  PRO D CG    1 
ATOM   9611  C  CD    . PRO D  1 113 ? 8.617   12.578  12.327  1.00 50.59  ? 85  PRO D CD    1 
ATOM   9612  N  N     . ARG D  1 114 ? 11.183  9.732   14.935  1.00 54.26  ? 86  ARG D N     1 
ATOM   9613  C  CA    A ARG D  1 114 ? 12.212  8.736   14.665  0.45 52.96  ? 86  ARG D CA    1 
ATOM   9614  C  CA    B ARG D  1 114 ? 12.215  8.737   14.653  0.55 52.97  ? 86  ARG D CA    1 
ATOM   9615  C  C     . ARG D  1 114 ? 11.593  7.420   14.185  1.00 46.17  ? 86  ARG D C     1 
ATOM   9616  O  O     . ARG D  1 114 ? 10.522  7.023   14.648  1.00 50.57  ? 86  ARG D O     1 
ATOM   9617  C  CB    A ARG D  1 114 ? 13.070  8.508   15.910  0.45 54.57  ? 86  ARG D CB    1 
ATOM   9618  C  CB    B ARG D  1 114 ? 13.111  8.502   15.877  0.55 54.58  ? 86  ARG D CB    1 
ATOM   9619  C  CG    A ARG D  1 114 ? 12.314  8.674   17.222  0.45 55.44  ? 86  ARG D CG    1 
ATOM   9620  C  CG    B ARG D  1 114 ? 12.402  7.947   17.108  0.55 55.64  ? 86  ARG D CG    1 
ATOM   9621  C  CD    A ARG D  1 114 ? 12.765  9.917   17.983  0.45 56.13  ? 86  ARG D CD    1 
ATOM   9622  C  CD    B ARG D  1 114 ? 13.381  7.756   18.265  0.55 55.54  ? 86  ARG D CD    1 
ATOM   9623  N  NE    A ARG D  1 114 ? 12.412  11.161  17.300  0.45 55.97  ? 86  ARG D NE    1 
ATOM   9624  N  NE    B ARG D  1 114 ? 12.699  7.638   19.553  0.55 55.02  ? 86  ARG D NE    1 
ATOM   9625  C  CZ    A ARG D  1 114 ? 12.735  12.373  17.742  0.45 54.48  ? 86  ARG D CZ    1 
ATOM   9626  C  CZ    B ARG D  1 114 ? 12.368  8.672   20.320  0.55 56.71  ? 86  ARG D CZ    1 
ATOM   9627  N  NH1   A ARG D  1 114 ? 13.424  12.506  18.865  0.45 56.67  ? 86  ARG D NH1   1 
ATOM   9628  N  NH1   B ARG D  1 114 ? 12.654  9.910   19.935  0.55 58.24  ? 86  ARG D NH1   1 
ATOM   9629  N  NH2   A ARG D  1 114 ? 12.374  13.455  17.061  0.45 48.26  ? 86  ARG D NH2   1 
ATOM   9630  N  NH2   B ARG D  1 114 ? 11.748  8.473   21.475  0.55 59.84  ? 86  ARG D NH2   1 
ATOM   9631  N  N     . SER D  1 115 ? 12.258  6.760   13.241  1.00 48.37  ? 87  SER D N     1 
ATOM   9632  C  CA    . SER D  1 115 ? 11.828  5.441   12.772  1.00 44.46  ? 87  SER D CA    1 
ATOM   9633  C  C     . SER D  1 115 ? 12.410  4.406   13.732  1.00 49.35  ? 87  SER D C     1 
ATOM   9634  O  O     . SER D  1 115 ? 13.608  4.442   14.021  1.00 52.38  ? 87  SER D O     1 
ATOM   9635  C  CB    . SER D  1 115 ? 12.293  5.188   11.330  1.00 40.37  ? 87  SER D CB    1 
ATOM   9636  O  OG    . SER D  1 115 ? 11.901  3.906   10.830  1.00 38.75  ? 87  SER D OG    1 
ATOM   9637  N  N     . THR D  1 116 ? 11.572  3.502   14.237  1.00 45.68  ? 88  THR D N     1 
ATOM   9638  C  CA    . THR D  1 116 ? 12.006  2.505   15.223  1.00 45.54  ? 88  THR D CA    1 
ATOM   9639  C  C     . THR D  1 116 ? 11.833  1.080   14.706  1.00 48.05  ? 88  THR D C     1 
ATOM   9640  O  O     . THR D  1 116 ? 11.117  0.861   13.733  1.00 40.76  ? 88  THR D O     1 
ATOM   9641  C  CB    . THR D  1 116 ? 11.218  2.611   16.521  1.00 41.06  ? 88  THR D CB    1 
ATOM   9642  O  OG1   . THR D  1 116 ? 9.914   2.059   16.312  1.00 49.60  ? 88  THR D OG1   1 
ATOM   9643  C  CG2   . THR D  1 116 ? 11.095  4.062   16.961  1.00 49.82  ? 88  THR D CG2   1 
ATOM   9644  N  N     . ARG D  1 117 ? 12.447  0.108   15.382  1.00 43.80  ? 89  ARG D N     1 
ATOM   9645  C  CA    . ARG D  1 117 ? 12.361  -1.278  14.937  1.00 47.30  ? 89  ARG D CA    1 
ATOM   9646  C  C     . ARG D  1 117 ? 10.899  -1.707  14.792  1.00 45.96  ? 89  ARG D C     1 
ATOM   9647  O  O     . ARG D  1 117 ? 10.528  -2.391  13.836  1.00 43.86  ? 89  ARG D O     1 
ATOM   9648  C  CB    . ARG D  1 117 ? 13.099  -2.207  15.904  1.00 56.50  ? 89  ARG D CB    1 
ATOM   9649  C  CG    . ARG D  1 117 ? 13.282  -3.626  15.378  1.00 60.28  ? 89  ARG D CG    1 
ATOM   9650  C  CD    . ARG D  1 117 ? 13.810  -4.558  16.459  1.00 65.08  ? 89  ARG D CD    1 
ATOM   9651  N  NE    . ARG D  1 117 ? 12.818  -4.802  17.501  1.00 66.35  ? 89  ARG D NE    1 
ATOM   9652  C  CZ    . ARG D  1 117 ? 11.873  -5.736  17.429  1.00 76.04  ? 89  ARG D CZ    1 
ATOM   9653  N  NH1   . ARG D  1 117 ? 11.782  -6.521  16.358  1.00 70.88  ? 89  ARG D NH1   1 
ATOM   9654  N  NH2   . ARG D  1 117 ? 11.010  -5.884  18.426  1.00 73.89  ? 89  ARG D NH2   1 
ATOM   9655  N  N     . THR D  1 118 ? 10.069  -1.248  15.720  1.00 41.25  ? 90  THR D N     1 
ATOM   9656  C  CA    . THR D  1 118 ? 8.661   -1.627  15.760  1.00 45.46  ? 90  THR D CA    1 
ATOM   9657  C  C     . THR D  1 118 ? 7.764   -0.725  14.903  1.00 53.48  ? 90  THR D C     1 
ATOM   9658  O  O     . THR D  1 118 ? 6.727   -1.167  14.393  1.00 56.19  ? 90  THR D O     1 
ATOM   9659  C  CB    . THR D  1 118 ? 8.139   -1.623  17.214  1.00 49.35  ? 90  THR D CB    1 
ATOM   9660  O  OG1   . THR D  1 118 ? 6.777   -2.064  17.232  1.00 57.18  ? 90  THR D OG1   1 
ATOM   9661  C  CG2   . THR D  1 118 ? 8.247   -0.216  17.845  1.00 51.75  ? 90  THR D CG2   1 
ATOM   9662  N  N     . GLU D  1 119 ? 8.183   0.529   14.737  1.00 49.16  ? 91  GLU D N     1 
ATOM   9663  C  CA    . GLU D  1 119 ? 7.419   1.525   13.986  1.00 52.06  ? 91  GLU D CA    1 
ATOM   9664  C  C     . GLU D  1 119 ? 8.250   2.117   12.853  1.00 41.35  ? 91  GLU D C     1 
ATOM   9665  O  O     . GLU D  1 119 ? 8.710   3.251   12.944  1.00 40.87  ? 91  GLU D O     1 
ATOM   9666  C  CB    . GLU D  1 119 ? 6.945   2.643   14.913  1.00 44.65  ? 91  GLU D CB    1 
ATOM   9667  C  CG    . GLU D  1 119 ? 5.953   2.190   15.969  1.00 57.27  ? 91  GLU D CG    1 
ATOM   9668  C  CD    . GLU D  1 119 ? 4.601   1.846   15.369  1.00 64.23  ? 91  GLU D CD    1 
ATOM   9669  O  OE1   . GLU D  1 119 ? 3.711   2.728   15.357  1.00 71.76  ? 91  GLU D OE1   1 
ATOM   9670  O  OE2   . GLU D  1 119 ? 4.433   0.697   14.904  1.00 59.47  ? 91  GLU D OE2   1 
ATOM   9671  N  N     . ARG D  1 120 ? 8.436   1.344   11.789  1.00 35.13  ? 92  ARG D N     1 
ATOM   9672  C  CA    . ARG D  1 120 ? 9.328   1.746   10.707  1.00 35.54  ? 92  ARG D CA    1 
ATOM   9673  C  C     . ARG D  1 120 ? 8.672   2.797   9.798   1.00 29.04  ? 92  ARG D C     1 
ATOM   9674  O  O     . ARG D  1 120 ? 7.463   2.753   9.536   1.00 32.08  ? 92  ARG D O     1 
ATOM   9675  C  CB    . ARG D  1 120 ? 9.750   0.519   9.897   1.00 34.29  ? 92  ARG D CB    1 
ATOM   9676  C  CG    . ARG D  1 120 ? 10.604  -0.463  10.673  1.00 39.71  ? 92  ARG D CG    1 
ATOM   9677  C  CD    . ARG D  1 120 ? 12.007  0.077   10.923  1.00 38.05  ? 92  ARG D CD    1 
ATOM   9678  N  NE    . ARG D  1 120 ? 12.887  -1.004  11.360  1.00 44.75  ? 92  ARG D NE    1 
ATOM   9679  C  CZ    . ARG D  1 120 ? 14.172  -0.854  11.667  1.00 44.12  ? 92  ARG D CZ    1 
ATOM   9680  N  NH1   . ARG D  1 120 ? 14.740  0.343   11.602  1.00 41.35  ? 92  ARG D NH1   1 
ATOM   9681  N  NH2   . ARG D  1 120 ? 14.889  -1.906  12.032  1.00 43.50  ? 92  ARG D NH2   1 
ATOM   9682  N  N     . ARG D  1 121 ? 9.467   3.740   9.321   1.00 29.40  ? 93  ARG D N     1 
ATOM   9683  C  CA    . ARG D  1 121 ? 8.925   4.807   8.477   1.00 31.86  ? 93  ARG D CA    1 
ATOM   9684  C  C     . ARG D  1 121 ? 9.628   4.876   7.135   1.00 25.56  ? 93  ARG D C     1 
ATOM   9685  O  O     . ARG D  1 121 ? 10.791  4.489   7.016   1.00 28.95  ? 93  ARG D O     1 
ATOM   9686  C  CB    . ARG D  1 121 ? 9.031   6.162   9.186   1.00 29.62  ? 93  ARG D CB    1 
ATOM   9687  C  CG    . ARG D  1 121 ? 7.985   6.361   10.260  1.00 29.01  ? 93  ARG D CG    1 
ATOM   9688  C  CD    . ARG D  1 121 ? 8.345   7.510   11.210  1.00 31.72  ? 93  ARG D CD    1 
ATOM   9689  N  NE    . ARG D  1 121 ? 7.380   7.550   12.301  1.00 34.79  ? 93  ARG D NE    1 
ATOM   9690  C  CZ    . ARG D  1 121 ? 6.195   8.149   12.235  1.00 40.04  ? 93  ARG D CZ    1 
ATOM   9691  N  NH1   . ARG D  1 121 ? 5.823   8.819   11.139  1.00 36.03  ? 93  ARG D NH1   1 
ATOM   9692  N  NH2   . ARG D  1 121 ? 5.391   8.095   13.285  1.00 42.84  ? 93  ARG D NH2   1 
ATOM   9693  N  N     . GLY D  1 122 ? 8.925   5.377   6.127   1.00 28.21  ? 94  GLY D N     1 
ATOM   9694  C  CA    . GLY D  1 122 ? 9.565   5.737   4.865   1.00 29.59  ? 94  GLY D CA    1 
ATOM   9695  C  C     . GLY D  1 122 ? 9.760   7.244   4.745   1.00 32.55  ? 94  GLY D C     1 
ATOM   9696  O  O     . GLY D  1 122 ? 9.359   7.991   5.635   1.00 28.96  ? 94  GLY D O     1 
ATOM   9697  N  N     . ILE D  1 123 ? 10.347  7.712   3.644   1.00 30.34  ? 95  ILE D N     1 
ATOM   9698  C  CA    . ILE D  1 123 ? 10.597  9.146   3.504   1.00 29.18  ? 95  ILE D CA    1 
ATOM   9699  C  C     . ILE D  1 123 ? 10.317  9.656   2.086   1.00 29.46  ? 95  ILE D C     1 
ATOM   9700  O  O     . ILE D  1 123 ? 10.743  9.054   1.085   1.00 27.76  ? 95  ILE D O     1 
ATOM   9701  C  CB    . ILE D  1 123 ? 12.050  9.494   3.911   1.00 30.12  ? 95  ILE D CB    1 
ATOM   9702  C  CG1   . ILE D  1 123 ? 12.300  10.997  3.824   1.00 31.26  ? 95  ILE D CG1   1 
ATOM   9703  C  CG2   . ILE D  1 123 ? 13.077  8.735   3.069   1.00 28.72  ? 95  ILE D CG2   1 
ATOM   9704  C  CD1   . ILE D  1 123 ? 11.581  11.781  4.898   1.00 34.01  ? 95  ILE D CD1   1 
ATOM   9705  N  N     . PHE D  1 124 ? 9.548   10.734  2.014   1.00 29.28  ? 96  PHE D N     1 
ATOM   9706  C  CA    . PHE D  1 124 ? 9.380   11.519  0.790   1.00 30.58  ? 96  PHE D CA    1 
ATOM   9707  C  C     . PHE D  1 124 ? 10.507  12.535  0.664   1.00 29.07  ? 96  PHE D C     1 
ATOM   9708  O  O     . PHE D  1 124 ? 10.942  13.106  1.662   1.00 28.09  ? 96  PHE D O     1 
ATOM   9709  C  CB    . PHE D  1 124 ? 8.028   12.253  0.781   1.00 31.16  ? 96  PHE D CB    1 
ATOM   9710  C  CG    . PHE D  1 124 ? 6.852   11.363  0.480   1.00 30.41  ? 96  PHE D CG    1 
ATOM   9711  C  CD1   . PHE D  1 124 ? 6.196   11.451  -0.736  1.00 27.98  ? 96  PHE D CD1   1 
ATOM   9712  C  CD2   . PHE D  1 124 ? 6.412   10.429  1.410   1.00 30.21  ? 96  PHE D CD2   1 
ATOM   9713  C  CE1   . PHE D  1 124 ? 5.115   10.625  -1.031  1.00 30.00  ? 96  PHE D CE1   1 
ATOM   9714  C  CE2   . PHE D  1 124 ? 5.324   9.599   1.131   1.00 28.77  ? 96  PHE D CE2   1 
ATOM   9715  C  CZ    . PHE D  1 124 ? 4.679   9.691   -0.093  1.00 32.18  ? 96  PHE D CZ    1 
ATOM   9716  N  N     . CYS D  1 125 ? 10.964  12.770  -0.563  1.00 26.22  ? 97  CYS D N     1 
ATOM   9717  C  CA    . CYS D  1 125 ? 12.000  13.750  -0.810  1.00 29.69  ? 97  CYS D CA    1 
ATOM   9718  C  C     . CYS D  1 125 ? 11.540  15.176  -0.428  1.00 28.41  ? 97  CYS D C     1 
ATOM   9719  O  O     . CYS D  1 125 ? 10.337  15.464  -0.335  1.00 22.59  ? 97  CYS D O     1 
ATOM   9720  C  CB    . CYS D  1 125 ? 12.429  13.721  -2.278  1.00 25.04  ? 97  CYS D CB    1 
ATOM   9721  S  SG    . CYS D  1 125 ? 11.178  14.334  -3.400  1.00 26.66  ? 97  CYS D SG    1 
ATOM   9722  N  N     . ARG D  1 126 ? 12.506  16.058  -0.242  1.00 22.10  ? 98  ARG D N     1 
ATOM   9723  C  CA    . ARG D  1 126 ? 12.204  17.439  0.150   1.00 28.34  ? 98  ARG D CA    1 
ATOM   9724  C  C     . ARG D  1 126 ? 11.310  18.177  -0.848  1.00 32.20  ? 98  ARG D C     1 
ATOM   9725  O  O     . ARG D  1 126 ? 10.534  19.052  -0.441  1.00 28.65  ? 98  ARG D O     1 
ATOM   9726  C  CB    . ARG D  1 126 ? 13.507  18.201  0.379   1.00 24.69  ? 98  ARG D CB    1 
ATOM   9727  C  CG    . ARG D  1 126 ? 14.260  17.676  1.615   1.00 29.93  ? 98  ARG D CG    1 
ATOM   9728  C  CD    . ARG D  1 126 ? 15.767  17.884  1.528   1.00 28.57  ? 98  ARG D CD    1 
ATOM   9729  N  NE    . ARG D  1 126 ? 16.391  17.635  2.826   1.00 31.21  ? 98  ARG D NE    1 
ATOM   9730  C  CZ    . ARG D  1 126 ? 16.843  16.449  3.222   1.00 33.04  ? 98  ARG D CZ    1 
ATOM   9731  N  NH1   . ARG D  1 126 ? 16.763  15.400  2.414   1.00 28.46  ? 98  ARG D NH1   1 
ATOM   9732  N  NH2   . ARG D  1 126 ? 17.391  16.314  4.418   1.00 30.79  ? 98  ARG D NH2   1 
ATOM   9733  N  N     . ALA D  1 127 ? 11.379  17.790  -2.134  1.00 27.55  ? 99  ALA D N     1 
ATOM   9734  C  CA    . ALA D  1 127 ? 10.557  18.412  -3.172  1.00 26.12  ? 99  ALA D CA    1 
ATOM   9735  C  C     . ALA D  1 127 ? 9.101   17.955  -3.138  1.00 28.11  ? 99  ALA D C     1 
ATOM   9736  O  O     . ALA D  1 127 ? 8.291   18.371  -3.970  1.00 26.67  ? 99  ALA D O     1 
ATOM   9737  C  CB    . ALA D  1 127 ? 11.145  18.141  -4.544  1.00 25.51  ? 99  ALA D CB    1 
ATOM   9738  N  N     . SER D  1 128 ? 8.771   17.094  -2.181  1.00 21.69  ? 100 SER D N     1 
ATOM   9739  C  CA    . SER D  1 128 ? 7.399   16.662  -1.969  1.00 24.99  ? 100 SER D CA    1 
ATOM   9740  C  C     . SER D  1 128 ? 6.947   16.917  -0.516  1.00 33.15  ? 100 SER D C     1 
ATOM   9741  O  O     . SER D  1 128 ? 6.054   16.231  -0.008  1.00 31.18  ? 100 SER D O     1 
ATOM   9742  C  CB    . SER D  1 128 ? 7.257   15.164  -2.343  1.00 27.94  ? 100 SER D CB    1 
ATOM   9743  O  OG    . SER D  1 128 ? 5.918   14.728  -2.247  1.00 25.25  ? 100 SER D OG    1 
ATOM   9744  N  N     . TRP D  1 129 ? 7.574   17.897  0.148   1.00 28.49  ? 101 TRP D N     1 
ATOM   9745  C  CA    . TRP D  1 129 ? 7.125   18.376  1.465   1.00 32.91  ? 101 TRP D CA    1 
ATOM   9746  C  C     . TRP D  1 129 ? 6.155   19.558  1.319   1.00 32.58  ? 101 TRP D C     1 
ATOM   9747  O  O     . TRP D  1 129 ? 6.457   20.531  0.632   1.00 27.57  ? 101 TRP D O     1 
ATOM   9748  C  CB    . TRP D  1 129 ? 8.307   18.831  2.337   1.00 27.36  ? 101 TRP D CB    1 
ATOM   9749  C  CG    . TRP D  1 129 ? 9.257   17.758  2.738   1.00 30.12  ? 101 TRP D CG    1 
ATOM   9750  C  CD1   . TRP D  1 129 ? 9.168   16.429  2.446   1.00 28.56  ? 101 TRP D CD1   1 
ATOM   9751  C  CD2   . TRP D  1 129 ? 10.458  17.923  3.511   1.00 34.26  ? 101 TRP D CD2   1 
ATOM   9752  N  NE1   . TRP D  1 129 ? 10.238  15.757  2.977   1.00 29.73  ? 101 TRP D NE1   1 
ATOM   9753  C  CE2   . TRP D  1 129 ? 11.041  16.641  3.649   1.00 34.19  ? 101 TRP D CE2   1 
ATOM   9754  C  CE3   . TRP D  1 129 ? 11.097  19.024  4.097   1.00 27.21  ? 101 TRP D CE3   1 
ATOM   9755  C  CZ2   . TRP D  1 129 ? 12.238  16.429  4.355   1.00 29.29  ? 101 TRP D CZ2   1 
ATOM   9756  C  CZ3   . TRP D  1 129 ? 12.281  18.813  4.802   1.00 29.63  ? 101 TRP D CZ3   1 
ATOM   9757  C  CH2   . TRP D  1 129 ? 12.833  17.517  4.931   1.00 27.55  ? 101 TRP D CH2   1 
ATOM   9758  N  N     . GLY D  1 130 ? 5.003   19.476  1.975   1.00 33.22  ? 102 GLY D N     1 
ATOM   9759  C  CA    . GLY D  1 130 ? 4.054   20.572  1.969   1.00 32.95  ? 102 GLY D CA    1 
ATOM   9760  C  C     . GLY D  1 130 ? 3.198   20.617  0.722   1.00 35.66  ? 102 GLY D C     1 
ATOM   9761  O  O     . GLY D  1 130 ? 3.086   19.610  0.012   1.00 33.42  ? 102 GLY D O     1 
ATOM   9762  N  N     . LYS D  1 131 ? 2.596   21.780  0.457   1.00 31.64  ? 103 LYS D N     1 
ATOM   9763  C  CA    . LYS D  1 131 ? 1.701   21.953  -0.690  1.00 32.68  ? 103 LYS D CA    1 
ATOM   9764  C  C     . LYS D  1 131 ? 2.497   21.771  -1.995  1.00 27.55  ? 103 LYS D C     1 
ATOM   9765  O  O     . LYS D  1 131 ? 3.588   22.308  -2.151  1.00 26.15  ? 103 LYS D O     1 
ATOM   9766  C  CB    . LYS D  1 131 ? 1.006   23.339  -0.642  1.00 29.92  ? 103 LYS D CB    1 
ATOM   9767  C  CG    . LYS D  1 131 ? -0.088  23.606  -1.715  1.00 32.53  ? 103 LYS D CG    1 
ATOM   9768  C  CD    . LYS D  1 131 ? -0.496  25.135  -1.766  1.00 46.04  ? 103 LYS D CD    1 
ATOM   9769  C  CE    . LYS D  1 131 ? -1.228  25.582  -3.073  1.00 41.91  ? 103 LYS D CE    1 
ATOM   9770  N  NZ    . LYS D  1 131 ? -0.978  27.048  -3.536  1.00 31.78  ? 103 LYS D NZ    1 
ATOM   9771  N  N     . ASP D  1 132 ? 1.948   20.970  -2.899  1.00 31.16  ? 104 ASP D N     1 
ATOM   9772  C  CA    . ASP D  1 132 ? 2.543   20.679  -4.201  1.00 27.82  ? 104 ASP D CA    1 
ATOM   9773  C  C     . ASP D  1 132 ? 3.096   21.948  -4.873  1.00 29.05  ? 104 ASP D C     1 
ATOM   9774  O  O     . ASP D  1 132 ? 2.363   22.926  -5.075  1.00 27.58  ? 104 ASP D O     1 
ATOM   9775  C  CB    . ASP D  1 132 ? 1.474   20.005  -5.060  1.00 31.56  ? 104 ASP D CB    1 
ATOM   9776  C  CG    . ASP D  1 132 ? 1.963   19.598  -6.443  1.00 29.25  ? 104 ASP D CG    1 
ATOM   9777  O  OD1   . ASP D  1 132 ? 1.115   19.087  -7.198  1.00 30.45  ? 104 ASP D OD1   1 
ATOM   9778  O  OD2   . ASP D  1 132 ? 3.154   19.783  -6.782  1.00 28.67  ? 104 ASP D OD2   1 
ATOM   9779  N  N     . TYR D  1 133 ? 4.391   21.948  -5.188  1.00 28.05  ? 105 TYR D N     1 
ATOM   9780  C  CA    . TYR D  1 133 ? 5.035   23.155  -5.724  1.00 24.91  ? 105 TYR D CA    1 
ATOM   9781  C  C     . TYR D  1 133 ? 4.413   23.627  -7.045  1.00 28.29  ? 105 TYR D C     1 
ATOM   9782  O  O     . TYR D  1 133 ? 4.501   24.829  -7.400  1.00 22.52  ? 105 TYR D O     1 
ATOM   9783  C  CB    . TYR D  1 133 ? 6.552   22.933  -5.907  1.00 25.39  ? 105 TYR D CB    1 
ATOM   9784  C  CG    . TYR D  1 133 ? 6.944   22.031  -7.061  1.00 26.76  ? 105 TYR D CG    1 
ATOM   9785  C  CD1   . TYR D  1 133 ? 7.334   22.560  -8.292  1.00 28.50  ? 105 TYR D CD1   1 
ATOM   9786  C  CD2   . TYR D  1 133 ? 6.936   20.644  -6.918  1.00 29.96  ? 105 TYR D CD2   1 
ATOM   9787  C  CE1   . TYR D  1 133 ? 7.699   21.715  -9.352  1.00 28.50  ? 105 TYR D CE1   1 
ATOM   9788  C  CE2   . TYR D  1 133 ? 7.289   19.802  -7.958  1.00 28.87  ? 105 TYR D CE2   1 
ATOM   9789  C  CZ    . TYR D  1 133 ? 7.669   20.340  -9.172  1.00 30.77  ? 105 TYR D CZ    1 
ATOM   9790  O  OH    . TYR D  1 133 ? 8.022   19.486  -10.195 1.00 30.22  ? 105 TYR D OH    1 
ATOM   9791  N  N     . HIS D  1 134 ? 3.809   22.684  -7.777  1.00 27.38  ? 106 HIS D N     1 
ATOM   9792  C  CA    . HIS D  1 134 ? 3.164   22.984  -9.052  1.00 26.48  ? 106 HIS D CA    1 
ATOM   9793  C  C     . HIS D  1 134 ? 2.102   24.054  -8.785  1.00 31.01  ? 106 HIS D C     1 
ATOM   9794  O  O     . HIS D  1 134 ? 2.001   25.039  -9.523  1.00 30.10  ? 106 HIS D O     1 
ATOM   9795  C  CB    . HIS D  1 134 ? 2.506   21.745  -9.691  1.00 26.16  ? 106 HIS D CB    1 
ATOM   9796  C  CG    . HIS D  1 134 ? 3.462   20.675  -10.136 1.00 29.60  ? 106 HIS D CG    1 
ATOM   9797  N  ND1   . HIS D  1 134 ? 3.934   19.691  -9.287  1.00 30.82  ? 106 HIS D ND1   1 
ATOM   9798  C  CD2   . HIS D  1 134 ? 3.967   20.382  -11.360 1.00 31.71  ? 106 HIS D CD2   1 
ATOM   9799  C  CE1   . HIS D  1 134 ? 4.711   18.859  -9.961  1.00 27.14  ? 106 HIS D CE1   1 
ATOM   9800  N  NE2   . HIS D  1 134 ? 4.747   19.254  -11.223 1.00 30.18  ? 106 HIS D NE2   1 
ATOM   9801  N  N     . ASP D  1 135 ? 1.324   23.846  -7.722  1.00 26.74  ? 107 ASP D N     1 
ATOM   9802  C  CA    . ASP D  1 135 ? 0.230   24.752  -7.337  1.00 32.55  ? 107 ASP D CA    1 
ATOM   9803  C  C     . ASP D  1 135 ? 0.761   26.064  -6.762  1.00 27.16  ? 107 ASP D C     1 
ATOM   9804  O  O     . ASP D  1 135 ? 0.236   27.130  -7.058  1.00 29.54  ? 107 ASP D O     1 
ATOM   9805  C  CB    . ASP D  1 135 ? -0.697  24.108  -6.291  1.00 34.66  ? 107 ASP D CB    1 
ATOM   9806  C  CG    . ASP D  1 135 ? -1.436  22.876  -6.810  1.00 40.33  ? 107 ASP D CG    1 
ATOM   9807  O  OD1   . ASP D  1 135 ? -1.928  22.893  -7.958  1.00 47.59  ? 107 ASP D OD1   1 
ATOM   9808  O  OD2   . ASP D  1 135 ? -1.551  21.895  -6.044  1.00 37.51  ? 107 ASP D OD2   1 
ATOM   9809  N  N     . VAL D  1 136 ? 1.787   25.977  -5.920  1.00 28.66  ? 108 VAL D N     1 
ATOM   9810  C  CA    . VAL D  1 136 ? 2.334   27.172  -5.288  1.00 27.82  ? 108 VAL D CA    1 
ATOM   9811  C  C     . VAL D  1 136 ? 2.925   28.124  -6.328  1.00 34.93  ? 108 VAL D C     1 
ATOM   9812  O  O     . VAL D  1 136 ? 2.602   29.319  -6.332  1.00 31.38  ? 108 VAL D O     1 
ATOM   9813  C  CB    . VAL D  1 136 ? 3.423   26.851  -4.254  1.00 29.42  ? 108 VAL D CB    1 
ATOM   9814  C  CG1   . VAL D  1 136 ? 4.029   28.166  -3.716  1.00 24.52  ? 108 VAL D CG1   1 
ATOM   9815  C  CG2   . VAL D  1 136 ? 2.874   25.954  -3.085  1.00 27.24  ? 108 VAL D CG2   1 
ATOM   9816  N  N     . LEU D  1 137 ? 3.784   27.597  -7.206  1.00 28.96  ? 109 LEU D N     1 
ATOM   9817  C  CA    . LEU D  1 137 ? 4.487   28.443  -8.153  1.00 32.91  ? 109 LEU D CA    1 
ATOM   9818  C  C     . LEU D  1 137 ? 3.556   28.950  -9.256  1.00 30.15  ? 109 LEU D C     1 
ATOM   9819  O  O     . LEU D  1 137 ? 3.734   30.057  -9.746  1.00 35.37  ? 109 LEU D O     1 
ATOM   9820  C  CB    . LEU D  1 137 ? 5.691   27.710  -8.748  1.00 28.63  ? 109 LEU D CB    1 
ATOM   9821  C  CG    . LEU D  1 137 ? 6.973   27.930  -7.936  1.00 31.77  ? 109 LEU D CG    1 
ATOM   9822  C  CD1   . LEU D  1 137 ? 6.872   27.291  -6.540  1.00 30.24  ? 109 LEU D CD1   1 
ATOM   9823  C  CD2   . LEU D  1 137 ? 8.185   27.412  -8.676  1.00 27.02  ? 109 LEU D CD2   1 
ATOM   9824  N  N     . ARG D  1 138 ? 2.548   28.161  -9.620  1.00 30.98  ? 110 ARG D N     1 
ATOM   9825  C  CA    . ARG D  1 138 ? 1.564   28.611  -10.598 1.00 31.01  ? 110 ARG D CA    1 
ATOM   9826  C  C     . ARG D  1 138 ? 0.725   29.758  -10.025 1.00 35.05  ? 110 ARG D C     1 
ATOM   9827  O  O     . ARG D  1 138 ? 0.274   30.635  -10.756 1.00 33.49  ? 110 ARG D O     1 
ATOM   9828  C  CB    . ARG D  1 138 ? 0.652   27.470  -11.040 1.00 30.26  ? 110 ARG D CB    1 
ATOM   9829  C  CG    . ARG D  1 138 ? -0.283  27.851  -12.177 1.00 39.55  ? 110 ARG D CG    1 
ATOM   9830  C  CD    . ARG D  1 138 ? 0.487   28.672  -13.232 1.00 44.32  ? 110 ARG D CD    1 
ATOM   9831  N  NE    . ARG D  1 138 ? -0.352  29.216  -14.300 1.00 50.19  ? 110 ARG D NE    1 
ATOM   9832  C  CZ    . ARG D  1 138 ? -0.537  28.618  -15.477 1.00 53.98  ? 110 ARG D CZ    1 
ATOM   9833  N  NH1   . ARG D  1 138 ? 0.056   27.454  -15.723 1.00 40.34  ? 110 ARG D NH1   1 
ATOM   9834  N  NH2   . ARG D  1 138 ? -1.313  29.182  -16.403 1.00 50.26  ? 110 ARG D NH2   1 
ATOM   9835  N  N     . GLU D  1 139 ? 0.513   29.730  -8.717  1.00 30.03  ? 111 GLU D N     1 
ATOM   9836  C  CA    . GLU D  1 139 ? -0.213  30.788  -8.039  1.00 34.59  ? 111 GLU D CA    1 
ATOM   9837  C  C     . GLU D  1 139 ? 0.568   32.111  -8.145  1.00 31.07  ? 111 GLU D C     1 
ATOM   9838  O  O     . GLU D  1 139 ? -0.009  33.159  -8.391  1.00 33.32  ? 111 GLU D O     1 
ATOM   9839  C  CB    . GLU D  1 139 ? -0.457  30.400  -6.573  1.00 32.91  ? 111 GLU D CB    1 
ATOM   9840  C  CG    . GLU D  1 139 ? -1.398  31.337  -5.801  1.00 37.80  ? 111 GLU D CG    1 
ATOM   9841  C  CD    . GLU D  1 139 ? -0.672  32.484  -5.105  1.00 35.90  ? 111 GLU D CD    1 
ATOM   9842  O  OE1   . GLU D  1 139 ? 0.575   32.435  -5.026  1.00 31.04  ? 111 GLU D OE1   1 
ATOM   9843  O  OE2   . GLU D  1 139 ? -1.352  33.438  -4.643  1.00 34.87  ? 111 GLU D OE2   1 
ATOM   9844  N  N     . LYS D  1 140 ? 1.885   32.037  -7.962  1.00 29.68  ? 112 LYS D N     1 
ATOM   9845  C  CA    . LYS D  1 140 ? 2.778   33.179  -8.068  1.00 28.93  ? 112 LYS D CA    1 
ATOM   9846  C  C     . LYS D  1 140 ? 2.883   33.700  -9.504  1.00 35.88  ? 112 LYS D C     1 
ATOM   9847  O  O     . LYS D  1 140 ? 2.838   34.908  -9.734  1.00 33.36  ? 112 LYS D O     1 
ATOM   9848  C  CB    . LYS D  1 140 ? 4.169   32.809  -7.554  1.00 28.98  ? 112 LYS D CB    1 
ATOM   9849  C  CG    . LYS D  1 140 ? 4.188   32.383  -6.092  1.00 31.41  ? 112 LYS D CG    1 
ATOM   9850  C  CD    . LYS D  1 140 ? 3.517   33.422  -5.162  1.00 27.32  ? 112 LYS D CD    1 
ATOM   9851  C  CE    . LYS D  1 140 ? 3.523   32.904  -3.704  1.00 32.43  ? 112 LYS D CE    1 
ATOM   9852  N  NZ    . LYS D  1 140 ? 2.831   33.798  -2.720  1.00 33.16  ? 112 LYS D NZ    1 
ATOM   9853  N  N     . LEU D  1 141 ? 3.040   32.787  -10.467 1.00 30.48  ? 113 LEU D N     1 
ATOM   9854  C  CA    . LEU D  1 141 ? 3.093   33.190  -11.872 1.00 31.83  ? 113 LEU D CA    1 
ATOM   9855  C  C     . LEU D  1 141 ? 1.795   33.874  -12.264 1.00 30.77  ? 113 LEU D C     1 
ATOM   9856  O  O     . LEU D  1 141 ? 1.829   34.876  -12.949 1.00 32.01  ? 113 LEU D O     1 
ATOM   9857  C  CB    . LEU D  1 141 ? 3.341   31.996  -12.799 1.00 34.08  ? 113 LEU D CB    1 
ATOM   9858  C  CG    . LEU D  1 141 ? 4.651   31.218  -12.739 1.00 32.73  ? 113 LEU D CG    1 
ATOM   9859  C  CD1   . LEU D  1 141 ? 4.445   29.905  -13.486 1.00 39.04  ? 113 LEU D CD1   1 
ATOM   9860  C  CD2   . LEU D  1 141 ? 5.794   32.010  -13.349 1.00 25.89  ? 113 LEU D CD2   1 
ATOM   9861  N  N     . ASP D  1 142 ? 0.656   33.332  -11.826 1.00 32.02  ? 114 ASP D N     1 
ATOM   9862  C  CA    . ASP D  1 142 ? -0.636  33.960  -12.113 1.00 32.77  ? 114 ASP D CA    1 
ATOM   9863  C  C     . ASP D  1 142 ? -0.701  35.410  -11.611 1.00 36.88  ? 114 ASP D C     1 
ATOM   9864  O  O     . ASP D  1 142 ? -1.229  36.280  -12.301 1.00 35.64  ? 114 ASP D O     1 
ATOM   9865  C  CB    . ASP D  1 142 ? -1.782  33.177  -11.495 1.00 29.47  ? 114 ASP D CB    1 
ATOM   9866  C  CG    . ASP D  1 142 ? -2.058  31.855  -12.214 1.00 40.74  ? 114 ASP D CG    1 
ATOM   9867  O  OD1   . ASP D  1 142 ? -1.495  31.605  -13.307 1.00 35.74  ? 114 ASP D OD1   1 
ATOM   9868  O  OD2   . ASP D  1 142 ? -2.859  31.071  -11.670 1.00 37.06  ? 114 ASP D OD2   1 
ATOM   9869  N  N     . LEU D  1 143 ? -0.170  35.664  -10.418 1.00 33.64  ? 115 LEU D N     1 
ATOM   9870  C  CA    . LEU D  1 143 ? -0.119  37.034  -9.892  1.00 31.72  ? 115 LEU D CA    1 
ATOM   9871  C  C     . LEU D  1 143 ? 0.768   37.931  -10.753 1.00 34.51  ? 115 LEU D C     1 
ATOM   9872  O  O     . LEU D  1 143 ? 0.438   39.096  -10.999 1.00 32.20  ? 115 LEU D O     1 
ATOM   9873  C  CB    . LEU D  1 143 ? 0.381   37.036  -8.450  1.00 32.02  ? 115 LEU D CB    1 
ATOM   9874  C  CG    . LEU D  1 143 ? -0.556  36.453  -7.387  1.00 32.20  ? 115 LEU D CG    1 
ATOM   9875  C  CD1   . LEU D  1 143 ? 0.170   36.345  -6.057  1.00 34.98  ? 115 LEU D CD1   1 
ATOM   9876  C  CD2   . LEU D  1 143 ? -1.816  37.296  -7.233  1.00 30.74  ? 115 LEU D CD2   1 
ATOM   9877  N  N     . LEU D  1 144 ? 1.906   37.392  -11.186 1.00 32.95  ? 116 LEU D N     1 
ATOM   9878  C  CA    . LEU D  1 144 ? 2.834   38.142  -12.024 1.00 36.64  ? 116 LEU D CA    1 
ATOM   9879  C  C     . LEU D  1 144 ? 2.223   38.442  -13.390 1.00 39.96  ? 116 LEU D C     1 
ATOM   9880  O  O     . LEU D  1 144 ? 2.408   39.527  -13.939 1.00 37.90  ? 116 LEU D O     1 
ATOM   9881  C  CB    . LEU D  1 144 ? 4.148   37.389  -12.204 1.00 28.07  ? 116 LEU D CB    1 
ATOM   9882  C  CG    . LEU D  1 144 ? 4.992   37.234  -10.947 1.00 38.93  ? 116 LEU D CG    1 
ATOM   9883  C  CD1   . LEU D  1 144 ? 6.336   36.608  -11.295 1.00 31.21  ? 116 LEU D CD1   1 
ATOM   9884  C  CD2   . LEU D  1 144 ? 5.162   38.590  -10.233 1.00 35.06  ? 116 LEU D CD2   1 
ATOM   9885  N  N     . GLU D  1 145 ? 1.505   37.467  -13.936 1.00 37.10  ? 117 GLU D N     1 
ATOM   9886  C  CA    . GLU D  1 145 ? 0.810   37.656  -15.199 1.00 41.15  ? 117 GLU D CA    1 
ATOM   9887  C  C     . GLU D  1 145 ? -0.247  38.764  -15.075 1.00 42.95  ? 117 GLU D C     1 
ATOM   9888  O  O     . GLU D  1 145 ? -0.304  39.658  -15.922 1.00 41.07  ? 117 GLU D O     1 
ATOM   9889  C  CB    . GLU D  1 145 ? 0.189   36.331  -15.656 1.00 36.75  ? 117 GLU D CB    1 
ATOM   9890  C  CG    . GLU D  1 145 ? -0.987  36.435  -16.597 1.00 39.85  ? 117 GLU D CG    1 
ATOM   9891  C  CD    . GLU D  1 145 ? -1.363  35.080  -17.158 1.00 53.37  ? 117 GLU D CD    1 
ATOM   9892  O  OE1   . GLU D  1 145 ? -0.587  34.123  -16.926 1.00 55.86  ? 117 GLU D OE1   1 
ATOM   9893  O  OE2   . GLU D  1 145 ? -2.421  34.964  -17.823 1.00 53.59  ? 117 GLU D OE2   1 
ATOM   9894  N  N     . ASP D  1 146 ? -1.055  38.727  -14.015 1.00 41.34  ? 118 ASP D N     1 
ATOM   9895  C  CA    . ASP D  1 146 ? -2.071  39.770  -13.791 1.00 48.15  ? 118 ASP D CA    1 
ATOM   9896  C  C     . ASP D  1 146 ? -1.465  41.161  -13.555 1.00 41.49  ? 118 ASP D C     1 
ATOM   9897  O  O     . ASP D  1 146 ? -2.049  42.172  -13.922 1.00 44.73  ? 118 ASP D O     1 
ATOM   9898  C  CB    . ASP D  1 146 ? -2.982  39.405  -12.619 1.00 40.86  ? 118 ASP D CB    1 
ATOM   9899  C  CG    . ASP D  1 146 ? -4.223  40.271  -12.569 1.00 46.72  ? 118 ASP D CG    1 
ATOM   9900  O  OD1   . ASP D  1 146 ? -5.072  40.134  -13.478 1.00 47.98  ? 118 ASP D OD1   1 
ATOM   9901  O  OD2   . ASP D  1 146 ? -4.354  41.095  -11.631 1.00 47.29  ? 118 ASP D OD2   1 
ATOM   9902  N  N     . PHE D  1 147 ? -0.287  41.204  -12.955 1.00 37.88  ? 119 PHE D N     1 
ATOM   9903  C  CA    . PHE D  1 147 ? 0.469   42.436  -12.824 1.00 31.99  ? 119 PHE D CA    1 
ATOM   9904  C  C     . PHE D  1 147 ? 0.828   43.054  -14.180 1.00 43.72  ? 119 PHE D C     1 
ATOM   9905  O  O     . PHE D  1 147 ? 0.803   44.282  -14.355 1.00 41.89  ? 119 PHE D O     1 
ATOM   9906  C  CB    . PHE D  1 147 ? 1.744   42.170  -12.025 1.00 32.54  ? 119 PHE D CB    1 
ATOM   9907  C  CG    . PHE D  1 147 ? 2.757   43.274  -12.111 1.00 39.50  ? 119 PHE D CG    1 
ATOM   9908  C  CD1   . PHE D  1 147 ? 2.676   44.369  -11.278 1.00 42.51  ? 119 PHE D CD1   1 
ATOM   9909  C  CD2   . PHE D  1 147 ? 3.805   43.210  -13.019 1.00 43.65  ? 119 PHE D CD2   1 
ATOM   9910  C  CE1   . PHE D  1 147 ? 3.616   45.388  -11.353 1.00 43.64  ? 119 PHE D CE1   1 
ATOM   9911  C  CE2   . PHE D  1 147 ? 4.744   44.224  -13.094 1.00 39.13  ? 119 PHE D CE2   1 
ATOM   9912  C  CZ    . PHE D  1 147 ? 4.647   45.312  -12.266 1.00 39.14  ? 119 PHE D CZ    1 
ATOM   9913  N  N     . LEU D  1 148 ? 1.193   42.207  -15.137 1.00 42.61  ? 120 LEU D N     1 
ATOM   9914  C  CA    . LEU D  1 148 ? 1.590   42.695  -16.458 1.00 44.24  ? 120 LEU D CA    1 
ATOM   9915  C  C     . LEU D  1 148 ? 0.354   43.029  -17.288 1.00 41.45  ? 120 LEU D C     1 
ATOM   9916  O  O     . LEU D  1 148 ? 0.318   44.047  -17.969 1.00 45.39  ? 120 LEU D O     1 
ATOM   9917  C  CB    . LEU D  1 148 ? 2.477   41.669  -17.176 1.00 43.74  ? 120 LEU D CB    1 
ATOM   9918  C  CG    . LEU D  1 148 ? 3.845   41.441  -16.519 1.00 40.21  ? 120 LEU D CG    1 
ATOM   9919  C  CD1   . LEU D  1 148 ? 4.516   40.164  -16.996 1.00 39.15  ? 120 LEU D CD1   1 
ATOM   9920  C  CD2   . LEU D  1 148 ? 4.747   42.618  -16.752 1.00 36.39  ? 120 LEU D CD2   1 
ATOM   9921  N  N     . LYS D  1 149 ? -0.667  42.186  -17.202 1.00 39.64  ? 121 LYS D N     1 
ATOM   9922  C  CA    . LYS D  1 149 ? -1.922  42.457  -17.891 1.00 44.48  ? 121 LYS D CA    1 
ATOM   9923  C  C     . LYS D  1 149 ? -2.499  43.802  -17.454 1.00 49.55  ? 121 LYS D C     1 
ATOM   9924  O  O     . LYS D  1 149 ? -3.056  44.534  -18.267 1.00 49.37  ? 121 LYS D O     1 
ATOM   9925  C  CB    . LYS D  1 149 ? -2.942  41.348  -17.630 1.00 48.51  ? 121 LYS D CB    1 
ATOM   9926  C  CG    . LYS D  1 149 ? -3.205  40.433  -18.822 1.00 54.29  ? 121 LYS D CG    1 
ATOM   9927  C  CD    . LYS D  1 149 ? -2.053  39.461  -19.076 1.00 50.44  ? 121 LYS D CD    1 
ATOM   9928  C  CE    . LYS D  1 149 ? -2.459  38.407  -20.107 1.00 55.91  ? 121 LYS D CE    1 
ATOM   9929  N  NZ    . LYS D  1 149 ? -1.430  37.341  -20.335 1.00 52.14  ? 121 LYS D NZ    1 
ATOM   9930  N  N     . SER D  1 150 ? -2.338  44.121  -16.171 1.00 50.02  ? 122 SER D N     1 
ATOM   9931  C  CA    . SER D  1 150 ? -2.920  45.322  -15.580 1.00 49.76  ? 122 SER D CA    1 
ATOM   9932  C  C     . SER D  1 150 ? -2.260  46.604  -16.105 1.00 55.46  ? 122 SER D C     1 
ATOM   9933  O  O     . SER D  1 150 ? -2.714  47.707  -15.814 1.00 54.92  ? 122 SER D O     1 
ATOM   9934  C  CB    . SER D  1 150 ? -2.823  45.264  -14.055 1.00 36.48  ? 122 SER D CB    1 
ATOM   9935  O  OG    . SER D  1 150 ? -1.526  45.638  -13.599 1.00 44.42  ? 122 SER D OG    1 
ATOM   9936  N  N     . LYS D  1 151 ? -1.201  46.455  -16.897 1.00 56.46  ? 123 LYS D N     1 
ATOM   9937  C  CA    . LYS D  1 151 ? -0.489  47.607  -17.433 1.00 54.39  ? 123 LYS D CA    1 
ATOM   9938  C  C     . LYS D  1 151 ? -0.973  48.010  -18.827 1.00 61.10  ? 123 LYS D C     1 
ATOM   9939  O  O     . LYS D  1 151 ? -1.766  48.944  -18.970 1.00 64.30  ? 123 LYS D O     1 
ATOM   9940  C  CB    . LYS D  1 151 ? 1.012   47.330  -17.477 1.00 54.25  ? 123 LYS D CB    1 
ATOM   9941  C  CG    . LYS D  1 151 ? 1.642   47.060  -16.126 1.00 50.00  ? 123 LYS D CG    1 
ATOM   9942  C  CD    . LYS D  1 151 ? 1.415   48.204  -15.163 1.00 51.25  ? 123 LYS D CD    1 
ATOM   9943  C  CE    . LYS D  1 151 ? 2.396   48.153  -14.006 1.00 52.89  ? 123 LYS D CE    1 
ATOM   9944  N  NZ    . LYS D  1 151 ? 2.257   49.331  -13.094 1.00 61.34  ? 123 LYS D NZ    1 
ATOM   9945  N  N     . HIS D  1 152 ? -0.491  47.307  -19.851 1.00 65.01  ? 124 HIS D N     1 
ATOM   9946  C  CA    . HIS D  1 152 ? -0.685  47.729  -21.244 1.00 64.86  ? 124 HIS D CA    1 
ATOM   9947  C  C     . HIS D  1 152 ? -1.709  46.885  -21.996 1.00 56.56  ? 124 HIS D C     1 
ATOM   9948  O  O     . HIS D  1 152 ? -2.915  47.057  -21.831 1.00 64.25  ? 124 HIS D O     1 
ATOM   9949  C  CB    . HIS D  1 152 ? 0.655   47.703  -21.982 1.00 59.83  ? 124 HIS D CB    1 
ATOM   9950  C  CG    . HIS D  1 152 ? 1.725   48.497  -21.297 1.00 60.13  ? 124 HIS D CG    1 
ATOM   9951  N  ND1   . HIS D  1 152 ? 1.824   49.868  -21.412 1.00 66.02  ? 124 HIS D ND1   1 
ATOM   9952  C  CD2   . HIS D  1 152 ? 2.728   48.116  -20.471 1.00 59.50  ? 124 HIS D CD2   1 
ATOM   9953  C  CE1   . HIS D  1 152 ? 2.847   50.295  -20.695 1.00 67.07  ? 124 HIS D CE1   1 
ATOM   9954  N  NE2   . HIS D  1 152 ? 3.412   49.253  -20.111 1.00 62.82  ? 124 HIS D NE2   1 
ATOM   9955  N  N     . ASP D  1 154 ? -0.604  45.593  -24.291 1.00 46.67  ? 126 ASP D N     1 
ATOM   9956  C  CA    . ASP D  1 154 ? -1.023  44.360  -24.964 1.00 58.24  ? 126 ASP D CA    1 
ATOM   9957  C  C     . ASP D  1 154 ? -0.035  43.236  -24.686 1.00 53.77  ? 126 ASP D C     1 
ATOM   9958  O  O     . ASP D  1 154 ? 0.403   42.526  -25.602 1.00 42.18  ? 126 ASP D O     1 
ATOM   9959  C  CB    . ASP D  1 154 ? -1.149  44.571  -26.480 1.00 56.38  ? 126 ASP D CB    1 
ATOM   9960  C  CG    . ASP D  1 154 ? -2.484  45.187  -26.883 1.00 70.85  ? 126 ASP D CG    1 
ATOM   9961  O  OD1   . ASP D  1 154 ? -3.519  44.814  -26.289 1.00 66.85  ? 126 ASP D OD1   1 
ATOM   9962  O  OD2   . ASP D  1 154 ? -2.493  46.045  -27.800 1.00 73.85  ? 126 ASP D OD2   1 
ATOM   9963  N  N     . ILE D  1 155 ? 0.333   43.088  -23.419 1.00 50.99  ? 127 ILE D N     1 
ATOM   9964  C  CA    . ILE D  1 155 ? 1.319   42.091  -23.036 1.00 48.51  ? 127 ILE D CA    1 
ATOM   9965  C  C     . ILE D  1 155 ? 0.746   40.676  -23.112 1.00 44.50  ? 127 ILE D C     1 
ATOM   9966  O  O     . ILE D  1 155 ? -0.383  40.417  -22.694 1.00 47.54  ? 127 ILE D O     1 
ATOM   9967  C  CB    . ILE D  1 155 ? 1.848   42.387  -21.633 1.00 47.29  ? 127 ILE D CB    1 
ATOM   9968  C  CG1   . ILE D  1 155 ? 2.619   43.705  -21.673 1.00 44.93  ? 127 ILE D CG1   1 
ATOM   9969  C  CG2   . ILE D  1 155 ? 2.714   41.237  -21.129 1.00 48.80  ? 127 ILE D CG2   1 
ATOM   9970  C  CD1   . ILE D  1 155 ? 3.089   44.198  -20.348 1.00 41.96  ? 127 ILE D CD1   1 
ATOM   9971  N  N     . ARG D  1 156 ? 1.520   39.756  -23.675 1.00 48.04  ? 128 ARG D N     1 
ATOM   9972  C  CA    . ARG D  1 156 ? 1.069   38.371  -23.764 1.00 44.42  ? 128 ARG D CA    1 
ATOM   9973  C  C     . ARG D  1 156 ? 2.057   37.432  -23.051 1.00 42.76  ? 128 ARG D C     1 
ATOM   9974  O  O     . ARG D  1 156 ? 3.280   37.644  -23.073 1.00 40.74  ? 128 ARG D O     1 
ATOM   9975  C  CB    . ARG D  1 156 ? 0.861   37.967  -25.232 1.00 44.05  ? 128 ARG D CB    1 
ATOM   9976  C  CG    . ARG D  1 156 ? -0.235  38.783  -25.953 1.00 41.47  ? 128 ARG D CG    1 
ATOM   9977  C  CD    . ARG D  1 156 ? -0.328  38.437  -27.440 1.00 46.94  ? 128 ARG D CD    1 
ATOM   9978  N  NE    . ARG D  1 156 ? 0.962   38.617  -28.102 1.00 53.96  ? 128 ARG D NE    1 
ATOM   9979  C  CZ    . ARG D  1 156 ? 1.782   37.623  -28.440 1.00 54.11  ? 128 ARG D CZ    1 
ATOM   9980  N  NH1   . ARG D  1 156 ? 1.438   36.363  -28.200 1.00 46.65  ? 128 ARG D NH1   1 
ATOM   9981  N  NH2   . ARG D  1 156 ? 2.948   37.891  -29.024 1.00 54.01  ? 128 ARG D NH2   1 
ATOM   9982  N  N     . THR D  1 157 ? 1.514   36.408  -22.397 1.00 34.52  ? 129 THR D N     1 
ATOM   9983  C  CA    . THR D  1 157 ? 2.321   35.548  -21.533 1.00 36.62  ? 129 THR D CA    1 
ATOM   9984  C  C     . THR D  1 157 ? 1.956   34.075  -21.679 1.00 35.95  ? 129 THR D C     1 
ATOM   9985  O  O     . THR D  1 157 ? 0.803   33.735  -21.943 1.00 34.04  ? 129 THR D O     1 
ATOM   9986  C  CB    . THR D  1 157 ? 2.152   35.931  -20.047 1.00 37.12  ? 129 THR D CB    1 
ATOM   9987  O  OG1   . THR D  1 157 ? 0.791   35.698  -19.653 1.00 33.77  ? 129 THR D OG1   1 
ATOM   9988  C  CG2   . THR D  1 157 ? 2.510   37.398  -19.814 1.00 36.14  ? 129 THR D CG2   1 
ATOM   9989  N  N     . LYS D  1 158 ? 2.943   33.202  -21.503 1.00 38.10  ? 130 LYS D N     1 
ATOM   9990  C  CA    . LYS D  1 158 ? 2.677   31.775  -21.341 1.00 34.72  ? 130 LYS D CA    1 
ATOM   9991  C  C     . LYS D  1 158 ? 3.478   31.246  -20.142 1.00 34.66  ? 130 LYS D C     1 
ATOM   9992  O  O     . LYS D  1 158 ? 4.707   31.338  -20.113 1.00 32.17  ? 130 LYS D O     1 
ATOM   9993  C  CB    . LYS D  1 158 ? 3.017   30.994  -22.620 1.00 35.35  ? 130 LYS D CB    1 
ATOM   9994  C  CG    . LYS D  1 158 ? 2.698   29.488  -22.517 1.00 33.19  ? 130 LYS D CG    1 
ATOM   9995  C  CD    . LYS D  1 158 ? 2.896   28.773  -23.840 1.00 44.01  ? 130 LYS D CD    1 
ATOM   9996  C  CE    . LYS D  1 158 ? 2.639   27.278  -23.710 1.00 46.13  ? 130 LYS D CE    1 
ATOM   9997  N  NZ    . LYS D  1 158 ? 1.328   26.999  -23.034 1.00 52.08  ? 130 LYS D NZ    1 
ATOM   9998  N  N     . SER D  1 159 ? 2.787   30.703  -19.145 1.00 32.16  ? 131 SER D N     1 
ATOM   9999  C  CA    . SER D  1 159 ? 3.476   30.274  -17.926 1.00 38.63  ? 131 SER D CA    1 
ATOM   10000 C  C     . SER D  1 159 ? 3.547   28.763  -17.806 1.00 31.73  ? 131 SER D C     1 
ATOM   10001 O  O     . SER D  1 159 ? 2.661   28.058  -18.286 1.00 31.24  ? 131 SER D O     1 
ATOM   10002 C  CB    . SER D  1 159 ? 2.784   30.843  -16.686 1.00 40.90  ? 131 SER D CB    1 
ATOM   10003 O  OG    . SER D  1 159 ? 2.865   32.255  -16.660 1.00 39.02  ? 131 SER D OG    1 
ATOM   10004 N  N     . MET D  1 160 ? 4.597   28.267  -17.156 1.00 29.59  ? 132 MET D N     1 
ATOM   10005 C  CA    . MET D  1 160 ? 4.673   26.838  -16.852 1.00 31.90  ? 132 MET D CA    1 
ATOM   10006 C  C     . MET D  1 160 ? 5.539   26.554  -15.632 1.00 32.00  ? 132 MET D C     1 
ATOM   10007 O  O     . MET D  1 160 ? 6.418   27.342  -15.271 1.00 30.03  ? 132 MET D O     1 
ATOM   10008 C  CB    . MET D  1 160 ? 5.199   26.048  -18.072 1.00 26.53  ? 132 MET D CB    1 
ATOM   10009 C  CG    . MET D  1 160 ? 6.599   26.437  -18.520 1.00 30.89  ? 132 MET D CG    1 
ATOM   10010 S  SD    . MET D  1 160 ? 6.986   25.932  -20.221 1.00 38.72  ? 132 MET D SD    1 
ATOM   10011 C  CE    . MET D  1 160 ? 5.813   26.886  -21.180 1.00 33.09  ? 132 MET D CE    1 
ATOM   10012 N  N     . VAL D  1 161 ? 5.270   25.419  -14.990 1.00 35.56  ? 133 VAL D N     1 
ATOM   10013 C  CA    . VAL D  1 161 ? 6.103   24.914  -13.904 1.00 29.65  ? 133 VAL D CA    1 
ATOM   10014 C  C     . VAL D  1 161 ? 6.190   23.388  -14.066 1.00 30.68  ? 133 VAL D C     1 
ATOM   10015 O  O     . VAL D  1 161 ? 5.192   22.674  -13.932 1.00 28.48  ? 133 VAL D O     1 
ATOM   10016 C  CB    . VAL D  1 161 ? 5.541   25.320  -12.506 1.00 32.24  ? 133 VAL D CB    1 
ATOM   10017 C  CG1   . VAL D  1 161 ? 4.033   25.063  -12.413 1.00 31.56  ? 133 VAL D CG1   1 
ATOM   10018 C  CG2   . VAL D  1 161