data_5D4C
# 
_entry.id   5D4C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5D4C         
WWPDB D_1000212641 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '4G7h contains a Thermus thermophilus RPo complex' 4G7H unspecified 
PDB .                                                  5D4E unspecified 
PDB .                                                  5D4D unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5D4C 
_pdbx_database_status.recvd_initial_deposition_date   2015-08-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'     1 
'Ebright, R.H.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            535 
_citation.language                  ? 
_citation.page_first                444 
_citation.page_last                 447 
_citation.title                     
;The mechanism of RNA 5' capping with NAD(+), NADH and desphospho-CoA.
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature18622 
_citation.pdbx_database_id_PubMed   27383794 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bird, J.G.'    1  
primary 'Zhang, Y.'     2  
primary 'Tian, Y.'      3  
primary 'Panova, N.'    4  
primary 'Barvik, I.'    5  
primary 'Greene, L.'    6  
primary 'Liu, M.'       7  
primary 'Buckley, B.'   8  
primary 'Krasny, L.'    9  
primary 'Lee, J.K.'     10 
primary 'Kaplan, C.D.'  11 
primary 'Ebright, R.H.' 12 
primary 'Nickels, B.E.' 13 
# 
_cell.entry_id           5D4C 
_cell.length_a           185.960 
_cell.length_b           103.640 
_cell.length_c           297.420 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.30 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5D4C 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                              35056.164  4  2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                               125436.539 2  2.7.7.6 ? ? ? 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 2  2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                              11533.316  2  2.7.7.6 ? ? ? 
5  polymer     man 'RNA polymerase sigma factor SigA'                                       50769.398  2  ?       ? ? ? 
6  polymer     syn 
;DNA (5'-D(*CP*CP*T*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*AP*GP*AP*G)-3')
;
5845.786   2  ?       ? ? ? 
7  polymer     syn 'DNA (27-MER)'                                                           8421.432   2  ?       ? ? ? 
8  non-polymer syn 'MAGNESIUM ION'                                                          24.305     11 ?       ? ? ? 
9  non-polymer syn 'ZINC ION'                                                               65.409     4  ?       ? ? ? 
10 non-polymer syn "CYTIDINE-5'-MONOPHOSPHATE"                                              323.197    2  ?       ? ? ? 
11 non-polymer syn "CYTIDINE-5'-TRIPHOSPHATE"                                               483.156    2  ?       ? ? ? 
12 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                                              507.181    2  ?       ? ? ? 
13 water       nat water                                                                    18.015     58 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B,K,L ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C,M     ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D,N     ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E,O     ? 
5 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F,P     ? 
6 polydeoxyribonucleotide no no '(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DA)(DG)(DA)(DG)' CCTGCATCCGTGAGTAGAG 
G,R     ? 
7 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H,S     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DA  n 
6 17   DG  n 
6 18   DA  n 
6 19   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   443 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'sigA, TTHA0532' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB8 / ATCC 27634 / DSM 579' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 315  ? 'Thermus thermophilus'                                     274    ? ? ?                            ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2 1 sample 1 1119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3 1 sample 1 1524 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 19 'Thermus thermophilus' ? 274 ? 
7 1 sample 1 27 'Thermus thermophilus' ? 274 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_THETH   Q9Z9H6 ? 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 
2 UNP RPOB_THET8   Q8RQE9 ? 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 
3 UNP RPOC_THET8   Q8RQE8 ? 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 
4 UNP RPOZ_THET8   Q8RQE7 ? 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 
5 UNP Q5SKW1_THET8 Q5SKW1 ? 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 
6 PDB 5D4C         5D4C   ? 6 ? 1 
7 PDB 5D4C         5D4C   ? 7 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5D4C A 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
2  1 5D4C B 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
3  2 5D4C C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4  3 5D4C D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5  4 5D4C E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6  5 5D4C F 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
7  6 5D4C G 1  ? 19   ? 5D4C   1 ? 19   ? 1 19   
8  7 5D4C H 1  ? 27   ? 5D4C   1 ? 27   ? 1 27   
9  1 5D4C K 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
10 1 5D4C L 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
11 2 5D4C M 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
12 3 5D4C N 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
13 4 5D4C O 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
14 5 5D4C P 21 ? 443  ? Q5SKW1 1 ? 423  ? 1 423  
15 6 5D4C R 1  ? 19   ? 5D4C   1 ? 19   ? 1 19   
16 7 5D4C S 1  ? 27   ? 5D4C   1 ? 27   ? 1 27   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6  5D4C MET F 1  ? UNP Q5SKW1 ? ? 'initiating methionine' -19 1  
6  5D4C GLY F 2  ? UNP Q5SKW1 ? ? 'expression tag'        -18 2  
6  5D4C SER F 3  ? UNP Q5SKW1 ? ? 'expression tag'        -17 3  
6  5D4C SER F 4  ? UNP Q5SKW1 ? ? 'expression tag'        -16 4  
6  5D4C HIS F 5  ? UNP Q5SKW1 ? ? 'expression tag'        -15 5  
6  5D4C HIS F 6  ? UNP Q5SKW1 ? ? 'expression tag'        -14 6  
6  5D4C HIS F 7  ? UNP Q5SKW1 ? ? 'expression tag'        -13 7  
6  5D4C HIS F 8  ? UNP Q5SKW1 ? ? 'expression tag'        -12 8  
6  5D4C HIS F 9  ? UNP Q5SKW1 ? ? 'expression tag'        -11 9  
6  5D4C HIS F 10 ? UNP Q5SKW1 ? ? 'expression tag'        -10 10 
6  5D4C SER F 11 ? UNP Q5SKW1 ? ? 'expression tag'        -9  11 
6  5D4C SER F 12 ? UNP Q5SKW1 ? ? 'expression tag'        -8  12 
6  5D4C GLY F 13 ? UNP Q5SKW1 ? ? 'expression tag'        -7  13 
6  5D4C LEU F 14 ? UNP Q5SKW1 ? ? 'expression tag'        -6  14 
6  5D4C VAL F 15 ? UNP Q5SKW1 ? ? 'expression tag'        -5  15 
6  5D4C PRO F 16 ? UNP Q5SKW1 ? ? 'expression tag'        -4  16 
6  5D4C ARG F 17 ? UNP Q5SKW1 ? ? 'expression tag'        -3  17 
6  5D4C GLY F 18 ? UNP Q5SKW1 ? ? 'expression tag'        -2  18 
6  5D4C SER F 19 ? UNP Q5SKW1 ? ? 'expression tag'        -1  19 
6  5D4C HIS F 20 ? UNP Q5SKW1 ? ? 'expression tag'        0   20 
14 5D4C MET P 1  ? UNP Q5SKW1 ? ? 'initiating methionine' -19 21 
14 5D4C GLY P 2  ? UNP Q5SKW1 ? ? 'expression tag'        -18 22 
14 5D4C SER P 3  ? UNP Q5SKW1 ? ? 'expression tag'        -17 23 
14 5D4C SER P 4  ? UNP Q5SKW1 ? ? 'expression tag'        -16 24 
14 5D4C HIS P 5  ? UNP Q5SKW1 ? ? 'expression tag'        -15 25 
14 5D4C HIS P 6  ? UNP Q5SKW1 ? ? 'expression tag'        -14 26 
14 5D4C HIS P 7  ? UNP Q5SKW1 ? ? 'expression tag'        -13 27 
14 5D4C HIS P 8  ? UNP Q5SKW1 ? ? 'expression tag'        -12 28 
14 5D4C HIS P 9  ? UNP Q5SKW1 ? ? 'expression tag'        -11 29 
14 5D4C HIS P 10 ? UNP Q5SKW1 ? ? 'expression tag'        -10 30 
14 5D4C SER P 11 ? UNP Q5SKW1 ? ? 'expression tag'        -9  31 
14 5D4C SER P 12 ? UNP Q5SKW1 ? ? 'expression tag'        -8  32 
14 5D4C GLY P 13 ? UNP Q5SKW1 ? ? 'expression tag'        -7  33 
14 5D4C LEU P 14 ? UNP Q5SKW1 ? ? 'expression tag'        -6  34 
14 5D4C VAL P 15 ? UNP Q5SKW1 ? ? 'expression tag'        -5  35 
14 5D4C PRO P 16 ? UNP Q5SKW1 ? ? 'expression tag'        -4  36 
14 5D4C ARG P 17 ? UNP Q5SKW1 ? ? 'expression tag'        -3  37 
14 5D4C GLY P 18 ? UNP Q5SKW1 ? ? 'expression tag'        -2  38 
14 5D4C SER P 19 ? UNP Q5SKW1 ? ? 'expression tag'        -1  39 
14 5D4C HIS P 20 ? UNP Q5SKW1 ? ? 'expression tag'        0   40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE"          ? 'C10 H16 N5 O13 P3' 507.181 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'    323.197 
CTP non-polymer         . "CYTIDINE-5'-TRIPHOSPHATE"           ? 'C9 H16 N3 O14 P3'  483.156 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5D4C 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.22 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.76 
_exptl_crystal.description                 rod 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.4 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM Tris-HCl, pH 8.4, 200 mM potassium chloride, 50 mM magnesium chloride, 9.5% PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-06-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            57.720 
_reflns.entry_id                         5D4C 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.300 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       892176 
_reflns.number_obs                       164255 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.400 
_reflns.pdbx_Rmerge_I_obs                0.185 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.185 
_reflns.pdbx_netI_over_av_sigmaI         8.672 
_reflns.pdbx_netI_over_sigmaI            5.600 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.112 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.197 
_reflns.pdbx_Rpim_I_all                  0.084 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         892176 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.300 3.360  ? 1.667 ? ? ? 7475 ? 87.500  ? ? ? ? 0.954 ? ? ? ? ? ? ? ? 5.000 ? 0.971 ? ? ?     0.441 0 1  1 0.776 ? 
3.360 3.420  ? ?     ? ? ? 7559 ? 89.800  ? ? ? ? 0.891 ? ? ? ? ? ? ? ? 5.200 ? 0.986 ? ? 0.983 0.406 0 2  1 0.793 ? 
3.420 3.480  ? ?     ? ? ? 7714 ? 90.500  ? ? ? ? 0.745 ? ? ? ? ? ? ? ? 5.300 ? 1.003 ? ? 0.820 0.336 0 3  1 0.849 ? 
3.480 3.550  ? ?     ? ? ? 7768 ? 91.600  ? ? ? ? 0.681 ? ? ? ? ? ? ? ? 5.400 ? 1.017 ? ? 0.750 0.308 0 4  1 0.883 ? 
3.550 3.630  ? ?     ? ? ? 7829 ? 92.200  ? ? ? ? 0.556 ? ? ? ? ? ? ? ? 5.400 ? 1.015 ? ? 0.612 0.250 0 5  1 0.897 ? 
3.630 3.720  ? ?     ? ? ? 7932 ? 92.900  ? ? ? ? 0.463 ? ? ? ? ? ? ? ? 5.400 ? 1.047 ? ? 0.510 0.210 0 6  1 0.925 ? 
3.720 3.810  ? ?     ? ? ? 7947 ? 93.400  ? ? ? ? 0.401 ? ? ? ? ? ? ? ? 5.400 ? 1.055 ? ? 0.441 0.181 0 7  1 0.944 ? 
3.810 3.910  ? ?     ? ? ? 8010 ? 94.800  ? ? ? ? 0.344 ? ? ? ? ? ? ? ? 5.400 ? 1.101 ? ? 0.379 0.155 0 8  1 0.957 ? 
3.910 4.030  ? ?     ? ? ? 8154 ? 95.600  ? ? ? ? 0.288 ? ? ? ? ? ? ? ? 5.400 ? 1.134 ? ? 0.317 0.130 0 9  1 0.970 ? 
4.030 4.160  ? ?     ? ? ? 8248 ? 96.600  ? ? ? ? 0.241 ? ? ? ? ? ? ? ? 5.400 ? 1.160 ? ? 0.265 0.109 0 10 1 0.976 ? 
4.160 4.310  ? ?     ? ? ? 8331 ? 97.900  ? ? ? ? 0.211 ? ? ? ? ? ? ? ? 5.400 ? 1.166 ? ? 0.233 0.095 0 11 1 0.981 ? 
4.310 4.480  ? ?     ? ? ? 8389 ? 98.700  ? ? ? ? 0.180 ? ? ? ? ? ? ? ? 5.400 ? 1.215 ? ? 0.198 0.082 0 12 1 0.985 ? 
4.480 4.680  ? ?     ? ? ? 8503 ? 99.500  ? ? ? ? 0.168 ? ? ? ? ? ? ? ? 5.400 ? 1.244 ? ? 0.186 0.076 0 13 1 0.985 ? 
4.680 4.930  ? ?     ? ? ? 8563 ? 99.900  ? ? ? ? 0.154 ? ? ? ? ? ? ? ? 5.500 ? 1.197 ? ? 0.170 0.070 0 14 1 0.989 ? 
4.930 5.240  ? ?     ? ? ? 8528 ? 99.900  ? ? ? ? 0.153 ? ? ? ? ? ? ? ? 5.600 ? 1.182 ? ? 0.169 0.070 0 15 1 0.988 ? 
5.240 5.640  ? ?     ? ? ? 8557 ? 100.000 ? ? ? ? 0.156 ? ? ? ? ? ? ? ? 5.700 ? 1.181 ? ? 0.172 0.071 0 16 1 0.987 ? 
5.640 6.210  ? ?     ? ? ? 8591 ? 100.000 ? ? ? ? 0.152 ? ? ? ? ? ? ? ? 5.700 ? 1.180 ? ? 0.167 0.069 0 17 1 0.989 ? 
6.210 7.100  ? ?     ? ? ? 8605 ? 100.000 ? ? ? ? 0.138 ? ? ? ? ? ? ? ? 5.600 ? 1.204 ? ? 0.152 0.063 0 18 1 0.988 ? 
7.100 8.940  ? ?     ? ? ? 8665 ? 100.000 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 5.500 ? 1.132 ? ? 0.107 0.046 0 19 1 0.993 ? 
8.940 50.000 ? ?     ? ? ? 8887 ? 99.900  ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 5.500 ? 0.960 ? ? 0.079 0.034 0 20 1 0.994 ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5D4C 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     154105 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.32 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.196 
_refine.ls_d_res_high                            3.280 
_refine.ls_percent_reflns_obs                    89.49 
_refine.ls_R_factor_obs                          0.2138 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2115 
_refine.ls_R_factor_R_free                       0.2572 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_number_reflns_R_free                  7724 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4H7H 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.39 
_refine.pdbx_overall_phase_error                 27.54 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        55006 
_refine_hist.pdbx_number_atoms_nucleic_acid   1401 
_refine_hist.pdbx_number_atoms_ligand         135 
_refine_hist.number_atoms_solvent             58 
_refine_hist.number_atoms_total               56600 
_refine_hist.d_res_high                       3.280 
_refine_hist.d_res_low                        49.196 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 57707 'X-RAY DIFFRACTION' ? 
f_angle_d          0.810  ? ? 78356 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.046 ? ? 22384 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.059  ? ? 8817  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 10021 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 3.2803  3.3176  503  0.2898 9.00   0.3436 . . 21  . . 
'X-RAY DIFFRACTION' . 3.3176  3.3566  1457 0.2918 27.00  0.3908 . . 93  . . 
'X-RAY DIFFRACTION' . 3.3566  3.3975  2846 0.2972 53.00  0.3457 . . 139 . . 
'X-RAY DIFFRACTION' . 3.3975  3.4405  4156 0.2875 76.00  0.3027 . . 224 . . 
'X-RAY DIFFRACTION' . 3.4405  3.4858  4842 0.2952 90.00  0.3337 . . 263 . . 
'X-RAY DIFFRACTION' . 3.4858  3.5335  4926 0.2828 92.00  0.3321 . . 259 . . 
'X-RAY DIFFRACTION' . 3.5335  3.5840  5061 0.2662 92.00  0.3229 . . 272 . . 
'X-RAY DIFFRACTION' . 3.5840  3.6374  4890 0.2569 92.00  0.3159 . . 255 . . 
'X-RAY DIFFRACTION' . 3.6374  3.6943  5105 0.2508 93.00  0.2964 . . 275 . . 
'X-RAY DIFFRACTION' . 3.6943  3.7548  5044 0.2385 93.00  0.2941 . . 263 . . 
'X-RAY DIFFRACTION' . 3.7548  3.8195  5144 0.2443 94.00  0.2667 . . 267 . . 
'X-RAY DIFFRACTION' . 3.8195  3.8890  5095 0.2331 94.00  0.2510 . . 268 . . 
'X-RAY DIFFRACTION' . 3.8890  3.9637  5180 0.2276 95.00  0.2900 . . 277 . . 
'X-RAY DIFFRACTION' . 3.9637  4.0446  5206 0.2216 96.00  0.2370 . . 272 . . 
'X-RAY DIFFRACTION' . 4.0446  4.1325  5284 0.2133 97.00  0.2518 . . 282 . . 
'X-RAY DIFFRACTION' . 4.1325  4.2286  5270 0.2145 97.00  0.2314 . . 277 . . 
'X-RAY DIFFRACTION' . 4.2286  4.3343  5391 0.2063 99.00  0.2754 . . 282 . . 
'X-RAY DIFFRACTION' . 4.3343  4.4514  5342 0.1996 99.00  0.2587 . . 284 . . 
'X-RAY DIFFRACTION' . 4.4514  4.5823  5409 0.1912 99.00  0.2291 . . 285 . . 
'X-RAY DIFFRACTION' . 4.5823  4.7301  5477 0.1930 100.00 0.2289 . . 286 . . 
'X-RAY DIFFRACTION' . 4.7301  4.8990  5447 0.1896 100.00 0.2373 . . 287 . . 
'X-RAY DIFFRACTION' . 4.8990  5.0949  5406 0.1931 100.00 0.2477 . . 285 . . 
'X-RAY DIFFRACTION' . 5.0949  5.3266  5469 0.1911 100.00 0.2321 . . 287 . . 
'X-RAY DIFFRACTION' . 5.3266  5.6070  5472 0.1926 100.00 0.2519 . . 287 . . 
'X-RAY DIFFRACTION' . 5.6070  5.9578  5453 0.1981 100.00 0.2619 . . 286 . . 
'X-RAY DIFFRACTION' . 5.9578  6.4168  5519 0.1999 100.00 0.2657 . . 290 . . 
'X-RAY DIFFRACTION' . 6.4168  7.0609  5467 0.1892 100.00 0.2292 . . 288 . . 
'X-RAY DIFFRACTION' . 7.0609  8.0787  5551 0.1709 100.00 0.1954 . . 293 . . 
'X-RAY DIFFRACTION' . 8.0787  10.1636 5532 0.1482 100.00 0.2101 . . 292 . . 
'X-RAY DIFFRACTION' . 10.1636 49.2018 5437 0.1996 95.00  0.2423 . . 285 . . 
# 
_struct.entry_id                     5D4C 
_struct.title                        
'Crystal structure of Thermus thermophilus product complex for transcription initiation with ATP and CTP' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5D4C 
_struct_keywords.text            
;RNA polymerase, transcription initiation, bacterial, NCIN, non-canonical initiating nucleotide, primer-dependent initiation, DNA, Single-Stranded, DNA-Directed RNA Polymerases, Gene Expression Regulation, Promoter Regions, Genetic, Protein Conformation, Sigma Factor, Thermus thermophilus, TRANSCRIPTION, transcription-dna complex
;
_struct_keywords.pdbx_keywords   transcription/dna 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 4  ? 
F  N N 5  ? 
G  N N 6  ? 
H  N N 7  ? 
I  N N 1  ? 
J  N N 1  ? 
K  N N 2  ? 
L  N N 3  ? 
M  N N 4  ? 
N  N N 5  ? 
O  N N 6  ? 
P  N N 7  ? 
Q  N N 8  ? 
R  N N 9  ? 
S  N N 9  ? 
T  N N 8  ? 
U  N N 8  ? 
V  N N 10 ? 
W  N N 11 ? 
X  N N 8  ? 
Y  N N 12 ? 
Z  N N 8  ? 
AA N N 8  ? 
BA N N 8  ? 
CA N N 8  ? 
DA N N 9  ? 
EA N N 9  ? 
FA N N 8  ? 
GA N N 10 ? 
HA N N 11 ? 
IA N N 8  ? 
JA N N 12 ? 
KA N N 8  ? 
LA N N 13 ? 
MA N N 13 ? 
NA N N 13 ? 
OA N N 13 ? 
PA N N 13 ? 
QA N N 13 ? 
RA N N 13 ? 
SA N N 13 ? 
TA N N 13 ? 
UA N N 13 ? 
VA N N 13 ? 
WA N N 13 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   AA2 ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? TYR A 224  ? THR A 206  TYR A 224  1 ? 19 
HELX_P HELX_P6   AA6 GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P7   AA7 ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P8   AA8 ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P9   AA9 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P10  AB1 THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P11  AB2 TYR B 224  ? SER B 226  ? TYR B 224  SER B 226  5 ? 3  
HELX_P HELX_P12  AB3 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P13  AB4 PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P14  AB5 GLY C 43   ? PHE C 52   ? GLY C 43   PHE C 52   1 ? 10 
HELX_P HELX_P15  AB6 PRO C 79   ? ASP C 87   ? PRO C 79   ASP C 87   1 ? 9  
HELX_P HELX_P16  AB7 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P17  AB8 ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P18  AB9 LEU C 217  ? MET C 222  ? LEU C 217  MET C 222  5 ? 6  
HELX_P HELX_P19  AC1 ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P20  AC2 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P21  AC3 LYS C 249  ? ILE C 261  ? LYS C 249  ILE C 261  1 ? 13 
HELX_P HELX_P22  AC4 GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P23  AC5 VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P24  AC6 THR C 335  ? MET C 361  ? THR C 335  MET C 361  1 ? 27 
HELX_P HELX_P25  AC7 THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P26  AC8 SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P27  AC9 ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P28  AD1 GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P29  AD2 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P30  AD3 THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P31  AD4 SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P32  AD5 SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P33  AD6 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P34  AD7 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P35  AD8 ASP C 554  ? GLN C 565  ? ASP C 554  GLN C 565  1 ? 12 
HELX_P HELX_P36  AD9 LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P37  AE1 ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P38  AE2 GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P39  AE3 SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P40  AE4 THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P41  AE5 ASN C 872  ? LEU C 874  ? ASN C 872  LEU C 874  5 ? 3  
HELX_P HELX_P42  AE6 GLY C 875  ? MET C 880  ? GLY C 875  MET C 880  1 ? 6  
HELX_P HELX_P43  AE7 LEU C 882  ? LEU C 897  ? LEU C 882  LEU C 897  1 ? 16 
HELX_P HELX_P44  AE8 LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P45  AE9 ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P46  AF1 THR C 958  ? LEU C 968  ? THR C 958  LEU C 968  1 ? 11 
HELX_P HELX_P47  AF2 MET C 1000 ? LYS C 1004 ? MET C 1000 LYS C 1004 5 ? 5  
HELX_P HELX_P48  AF3 GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P49  AF4 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P50  AF5 ASP C 1059 ? LYS C 1072 ? ASP C 1059 LYS C 1072 1 ? 14 
HELX_P HELX_P51  AF6 PRO C 1082 ? LEU C 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P52  AF7 SER D 14   ? SER D 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P53  AF8 ASP D 46   ? GLY D 51   ? ASP D 46   GLY D 51   1 ? 6  
HELX_P HELX_P54  AF9 ILE D 84   ? ARG D 89   ? ILE D 84   ARG D 89   1 ? 6  
HELX_P HELX_P55  AG1 HIS D 101  ? ASP D 107  ? HIS D 101  ASP D 107  1 ? 7  
HELX_P HELX_P56  AG2 SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P57  AG3 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P58  AG4 THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P59  AG5 ASP D 372  ? GLU D 376  ? ASP D 372  GLU D 376  5 ? 5  
HELX_P HELX_P60  AG6 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P61  AG7 GLY D 457  ? GLU D 467  ? GLY D 457  GLU D 467  1 ? 11 
HELX_P HELX_P62  AG8 ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P63  AG9 SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P64  AH1 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P65  AH2 PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P66  AH3 SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P67  AH4 PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P68  AH5 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P69  AH6 GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P70  AH7 LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P71  AH8 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P72  AH9 ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P73  AI1 GLN D 680  ? ILE D 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P74  AI2 LYS D 684  ? ILE D 695  ? LYS D 684  ILE D 695  1 ? 12 
HELX_P HELX_P75  AI3 HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P76  AI4 HIS D 729  ? ASN D 737  ? HIS D 729  ASN D 737  1 ? 9  
HELX_P HELX_P77  AI5 SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P78  AI6 LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P79  AI7 ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P80  AI8 THR D 808  ? GLY D 819  ? THR D 808  GLY D 819  1 ? 12 
HELX_P HELX_P81  AI9 VAL D 836  ? TYR D 841  ? VAL D 836  TYR D 841  1 ? 6  
HELX_P HELX_P82  AJ1 ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P83  AJ2 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P84  AJ3 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P85  AJ4 GLU D 907  ? GLY D 946  ? GLU D 907  GLY D 946  1 ? 40 
HELX_P HELX_P86  AJ5 GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P87  AJ6 GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P88  AJ7 THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P89  AJ8 ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P90  AJ9 ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P91  AK1 THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P92  AK2 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P93  AK3 SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P94  AK4 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P95  AK5 ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P96  AK6 PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P97  AK7 GLN D 1254 ? GLU D 1264 ? GLN D 1254 GLU D 1264 1 ? 11 
HELX_P HELX_P98  AK8 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P99  AK9 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P100 AL1 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P101 AL2 LYS D 1397 ? GLU D 1410 ? LYS D 1397 GLU D 1410 1 ? 14 
HELX_P HELX_P102 AL3 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P103 AL4 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P104 AL5 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P105 AL6 GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P106 AL7 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P107 AL8 GLN D 1489 ? ALA D 1502 ? GLN D 1489 ALA D 1502 1 ? 14 
HELX_P HELX_P108 AL9 GLY E 5    ? MET E 12   ? GLY E 5    MET E 12   1 ? 8  
HELX_P HELX_P109 AM1 SER E 15   ? GLY E 34   ? SER E 15   GLY E 34   1 ? 20 
HELX_P HELX_P110 AM2 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P111 AM3 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P112 AM4 ASP F 99   ? GLN F 110  ? ASP F 79   GLN F 90   1 ? 12 
HELX_P HELX_P113 AM5 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P114 AM6 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P115 AM7 ASP F 172  ? SER F 185  ? ASP F 152  SER F 165  1 ? 14 
HELX_P HELX_P116 AM8 PRO F 187  ? LYS F 220  ? PRO F 167  LYS F 200  1 ? 34 
HELX_P HELX_P117 AM9 LYS F 221  ? THR F 223  ? LYS F 201  THR F 203  5 ? 3  
HELX_P HELX_P118 AN1 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P119 AN2 GLU F 248  ? ARG F 252  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P120 AN3 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P121 AN4 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P122 AN5 THR F 307  ? MET F 315  ? THR F 287  MET F 295  1 ? 9  
HELX_P HELX_P123 AN6 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P124 AN7 PHE F 348  ? ILE F 353  ? PHE F 328  ILE F 333  5 ? 6  
HELX_P HELX_P125 AN8 SER F 360  ? SER F 379  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P126 AN9 SER F 382  ? LYS F 393  ? SER F 362  LYS F 373  1 ? 12 
HELX_P HELX_P127 AO1 THR F 402  ? GLY F 411  ? THR F 382  GLY F 391  1 ? 10 
HELX_P HELX_P128 AO2 THR F 413  ? ARG F 436  ? THR F 393  ARG F 416  1 ? 24 
HELX_P HELX_P129 AO3 ARG F 439  ? ASP F 443  ? ARG F 419  ASP F 423  5 ? 5  
HELX_P HELX_P130 AO4 GLY I 31   ? SER I 47   ? GLY K 31   SER K 47   1 ? 17 
HELX_P HELX_P131 AO5 ASP I 74   ? LYS I 83   ? ASP K 74   LYS K 83   1 ? 10 
HELX_P HELX_P132 AO6 ARG I 112  ? PHE I 114  ? ARG K 112  PHE K 114  5 ? 3  
HELX_P HELX_P133 AO7 PRO I 152  ? GLY I 157  ? PRO K 152  GLY K 157  1 ? 6  
HELX_P HELX_P134 AO8 THR I 206  ? THR I 223  ? THR K 206  THR K 223  1 ? 18 
HELX_P HELX_P135 AO9 TYR I 224  ? SER I 226  ? TYR K 224  SER K 226  5 ? 3  
HELX_P HELX_P136 AP1 GLY J 31   ? SER J 47   ? GLY L 31   SER L 47   1 ? 17 
HELX_P HELX_P137 AP2 ASP J 74   ? LEU J 85   ? ASP L 74   LEU L 85   1 ? 12 
HELX_P HELX_P138 AP3 ARG J 112  ? PHE J 114  ? ARG L 112  PHE L 114  5 ? 3  
HELX_P HELX_P139 AP4 PRO J 152  ? GLY J 157  ? PRO L 152  GLY L 157  1 ? 6  
HELX_P HELX_P140 AP5 THR J 206  ? THR J 223  ? THR L 206  THR L 223  1 ? 18 
HELX_P HELX_P141 AP6 TYR J 224  ? SER J 226  ? TYR L 224  SER L 226  5 ? 3  
HELX_P HELX_P142 AP7 THR K 19   ? GLN K 31   ? THR M 19   GLN M 31   1 ? 13 
HELX_P HELX_P143 AP8 PRO K 35   ? ARG K 39   ? PRO M 35   ARG M 39   5 ? 5  
HELX_P HELX_P144 AP9 GLY K 43   ? PHE K 52   ? GLY M 43   PHE M 52   1 ? 10 
HELX_P HELX_P145 AQ1 PRO K 79   ? ASP K 87   ? PRO M 79   ASP M 87   1 ? 9  
HELX_P HELX_P146 AQ2 LEU K 193  ? LEU K 200  ? LEU M 193  LEU M 200  1 ? 8  
HELX_P HELX_P147 AQ3 ASP K 203  ? GLY K 212  ? ASP M 203  GLY M 212  1 ? 10 
HELX_P HELX_P148 AQ4 LEU K 217  ? MET K 222  ? LEU M 217  MET M 222  5 ? 6  
HELX_P HELX_P149 AQ5 ASP K 223  ? ALA K 228  ? ASP M 223  ALA M 228  1 ? 6  
HELX_P HELX_P150 AQ6 ARG K 230  ? ARG K 243  ? ARG M 230  ARG M 243  1 ? 14 
HELX_P HELX_P151 AQ7 LYS K 249  ? ILE K 261  ? LYS M 249  ILE M 261  1 ? 13 
HELX_P HELX_P152 AQ8 GLY K 270  ? GLY K 282  ? GLY M 270  GLY M 282  1 ? 13 
HELX_P HELX_P153 AQ9 VAL K 302  ? GLY K 316  ? VAL M 302  GLY M 316  1 ? 15 
HELX_P HELX_P154 AR1 THR K 335  ? MET K 361  ? THR M 335  MET M 361  1 ? 27 
HELX_P HELX_P155 AR2 THR K 368  ? VAL K 373  ? THR M 368  VAL M 373  1 ? 6  
HELX_P HELX_P156 AR3 SER K 375  ? ARG K 388  ? SER M 375  ARG M 388  1 ? 14 
HELX_P HELX_P157 AR4 ASN K 399  ? ARG K 408  ? ASN M 399  ARG M 408  1 ? 10 
HELX_P HELX_P158 AR5 GLY K 424  ? ASP K 429  ? GLY M 424  ASP M 429  1 ? 6  
HELX_P HELX_P159 AR6 THR K 487  ? ASP K 492  ? THR M 487  ASP M 492  1 ? 6  
HELX_P HELX_P160 AR7 SER K 525  ? VAL K 529  ? SER M 525  VAL M 529  5 ? 5  
HELX_P HELX_P161 AR8 SER K 535  ? PHE K 540  ? SER M 535  PHE M 540  5 ? 6  
HELX_P HELX_P162 AR9 ASN K 543  ? ILE K 547  ? ASN M 543  ILE M 547  5 ? 5  
HELX_P HELX_P163 AS1 PHE K 549  ? ASP K 553  ? PHE M 549  ASP M 553  5 ? 5  
HELX_P HELX_P164 AS2 ASP K 554  ? THR K 566  ? ASP M 554  THR M 566  1 ? 13 
HELX_P HELX_P165 AS3 LEU K 583  ? SER K 591  ? LEU M 583  SER M 591  1 ? 9  
HELX_P HELX_P166 AS4 GLU K 692  ? ARG K 697  ? GLU M 692  ARG M 697  1 ? 6  
HELX_P HELX_P167 AS5 SER K 730  ? ARG K 735  ? SER M 730  ARG M 735  1 ? 6  
HELX_P HELX_P168 AS6 PRO K 769  ? PHE K 778  ? PRO M 769  PHE M 778  1 ? 10 
HELX_P HELX_P169 AS7 PRO K 854  ? MET K 858  ? PRO M 854  MET M 858  5 ? 5  
HELX_P HELX_P170 AS8 LEU K 874  ? MET K 880  ? LEU M 874  MET M 880  1 ? 7  
HELX_P HELX_P171 AS9 LEU K 882  ? LEU K 897  ? LEU M 882  LEU M 897  1 ? 16 
HELX_P HELX_P172 AT1 LYS K 910  ? GLU K 932  ? LYS M 910  GLU M 932  1 ? 23 
HELX_P HELX_P173 AT2 ASP K 937  ? GLY K 951  ? ASP M 937  GLY M 951  1 ? 15 
HELX_P HELX_P174 AT3 THR K 958  ? GLN K 969  ? THR M 958  GLN M 969  1 ? 12 
HELX_P HELX_P175 AT4 MET K 1000 ? MET K 1005 ? MET M 1000 MET M 1005 1 ? 6  
HELX_P HELX_P176 AT5 GLY K 1033 ? GLY K 1044 ? GLY M 1033 GLY M 1044 1 ? 12 
HELX_P HELX_P177 AT6 ALA K 1045 ? THR K 1054 ? ALA M 1045 THR M 1054 1 ? 10 
HELX_P HELX_P178 AT7 ASP K 1059 ? LYS K 1072 ? ASP M 1059 LYS M 1072 1 ? 14 
HELX_P HELX_P179 AT8 PRO K 1082 ? ALA K 1094 ? PRO M 1082 ALA M 1094 1 ? 13 
HELX_P HELX_P180 AT9 SER L 14   ? SER L 22   ? SER N 14   SER N 22   1 ? 9  
HELX_P HELX_P181 AU1 ASP L 46   ? GLY L 51   ? ASP N 46   GLY N 51   1 ? 6  
HELX_P HELX_P182 AU2 ILE L 84   ? ARG L 89   ? ILE N 84   ARG N 89   1 ? 6  
HELX_P HELX_P183 AU3 ILE L 102  ? VAL L 105  ? ILE N 102  VAL N 105  5 ? 4  
HELX_P HELX_P184 AU4 SER L 110  ? LEU L 116  ? SER N 110  LEU N 116  1 ? 7  
HELX_P HELX_P185 AU5 SER L 119  ? TYR L 128  ? SER N 119  TYR N 128  1 ? 10 
HELX_P HELX_P186 AU6 THR L 154  ? GLY L 164  ? THR N 154  GLY N 164  1 ? 11 
HELX_P HELX_P187 AU7 ASP L 423  ? LYS L 426  ? ASP N 423  LYS N 426  5 ? 4  
HELX_P HELX_P188 AU8 MET L 456  ? LEU L 468  ? MET N 456  LEU N 468  1 ? 13 
HELX_P HELX_P189 AU9 ASP L 469  ? MET L 481  ? ASP N 469  MET N 481  1 ? 13 
HELX_P HELX_P190 AV1 SER L 485  ? GLY L 506  ? SER N 485  GLY N 506  1 ? 22 
HELX_P HELX_P191 AV2 ARG L 508  ? TRP L 511  ? ARG N 508  TRP N 511  5 ? 4  
HELX_P HELX_P192 AV3 PRO L 521  ? ARG L 525  ? PRO N 521  ARG N 525  5 ? 5  
HELX_P HELX_P193 AV4 SER L 538  ? GLN L 560  ? SER N 538  GLN N 560  1 ? 23 
HELX_P HELX_P194 AV5 PRO L 563  ? ASP L 583  ? PRO N 563  ASP N 583  1 ? 21 
HELX_P HELX_P195 AV6 SER L 602  ? SER L 608  ? SER N 602  SER N 608  1 ? 7  
HELX_P HELX_P196 AV7 GLY L 612  ? LEU L 618  ? GLY N 612  LEU N 618  1 ? 7  
HELX_P HELX_P197 AV8 LYS L 646  ? PHE L 653  ? LYS N 646  PHE N 653  1 ? 8  
HELX_P HELX_P198 AV9 PHE L 653  ? LYS L 664  ? PHE N 653  LYS N 664  1 ? 12 
HELX_P HELX_P199 AW1 ASN L 669  ? ARG L 679  ? ASN N 669  ARG N 679  1 ? 11 
HELX_P HELX_P200 AW2 GLN L 680  ? ILE L 683  ? GLN N 680  ILE N 683  5 ? 4  
HELX_P HELX_P201 AW3 ASP L 685  ? ILE L 695  ? ASP N 685  ILE N 695  1 ? 11 
HELX_P HELX_P202 AW4 HIS L 709  ? LEU L 711  ? HIS N 709  LEU N 711  5 ? 3  
HELX_P HELX_P203 AW5 HIS L 729  ? LEU L 731  ? HIS N 729  LEU N 731  5 ? 3  
HELX_P HELX_P204 AW6 VAL L 732  ? ASN L 737  ? VAL N 732  ASN N 737  1 ? 6  
HELX_P HELX_P205 AW7 SER L 752  ? GLN L 762  ? SER N 752  GLN N 762  1 ? 11 
HELX_P HELX_P206 AW8 LEU L 764  ? ASN L 768  ? LEU N 764  ASN N 768  5 ? 5  
HELX_P HELX_P207 AW9 ARG L 783  ? GLN L 794  ? ARG N 783  GLN N 794  1 ? 12 
HELX_P HELX_P208 AX1 THR L 808  ? GLY L 819  ? THR N 808  GLY N 819  1 ? 12 
HELX_P HELX_P209 AX2 VAL L 836  ? TYR L 841  ? VAL N 836  TYR N 841  1 ? 6  
HELX_P HELX_P210 AX3 ASN L 845  ? HIS L 855  ? ASN N 845  HIS N 855  1 ? 11 
HELX_P HELX_P211 AX4 SER L 876  ? GLU L 891  ? SER N 876  GLU N 891  1 ? 16 
HELX_P HELX_P212 AX5 ASP L 892  ? ILE L 900  ? ASP N 892  ILE N 900  1 ? 9  
HELX_P HELX_P213 AX6 GLU L 907  ? GLY L 946  ? GLU N 907  GLY N 946  1 ? 40 
HELX_P HELX_P214 AX7 GLU L 958  ? MET L 980  ? GLU N 958  MET N 980  1 ? 23 
HELX_P HELX_P215 AX8 THR L 984  ? TYR L 1015 ? THR N 984  TYR N 1015 1 ? 32 
HELX_P HELX_P216 AX9 ASN L 1018 ? GLY L 1027 ? ASN N 1018 GLY N 1027 1 ? 10 
HELX_P HELX_P217 AY1 ASN L 1031 ? GLY L 1040 ? ASN N 1031 GLY N 1040 1 ? 10 
HELX_P HELX_P218 AY2 THR L 1066 ? HIS L 1103 ? THR N 1066 HIS N 1103 1 ? 38 
HELX_P HELX_P219 AY3 LYS L 1136 ? TYR L 1145 ? LYS N 1136 TYR N 1145 1 ? 10 
HELX_P HELX_P220 AY4 SER L 1167 ? ALA L 1180 ? SER N 1167 ALA N 1180 1 ? 14 
HELX_P HELX_P221 AY5 GLN L 1202 ? GLY L 1206 ? GLN N 1202 GLY N 1206 1 ? 5  
HELX_P HELX_P222 AY6 ALA L 1220 ? GLU L 1231 ? ALA N 1220 GLU N 1231 1 ? 12 
HELX_P HELX_P223 AY7 PRO L 1232 ? LEU L 1236 ? PRO N 1232 LEU N 1236 5 ? 5  
HELX_P HELX_P224 AY8 GLN L 1254 ? GLU L 1264 ? GLN N 1254 GLU N 1264 1 ? 11 
HELX_P HELX_P225 AY9 ASP L 1331 ? GLY L 1340 ? ASP N 1331 GLY N 1340 1 ? 10 
HELX_P HELX_P226 AZ1 GLY L 1340 ? GLN L 1359 ? GLY N 1340 GLN N 1359 1 ? 20 
HELX_P HELX_P227 AZ2 HIS L 1364 ? MET L 1376 ? HIS N 1364 MET N 1376 1 ? 13 
HELX_P HELX_P228 AZ3 LYS L 1397 ? ALA L 1409 ? LYS N 1397 ALA N 1409 1 ? 13 
HELX_P HELX_P229 AZ4 GLY L 1423 ? SER L 1430 ? GLY N 1423 SER N 1430 1 ? 8  
HELX_P HELX_P230 AZ5 SER L 1433 ? SER L 1439 ? SER N 1433 SER N 1439 1 ? 7  
HELX_P HELX_P231 AZ6 ASN L 1442 ? GLY L 1454 ? ASN N 1442 GLY N 1454 1 ? 13 
HELX_P HELX_P232 AZ7 GLY L 1461 ? LEU L 1468 ? GLY N 1461 LEU N 1468 1 ? 8  
HELX_P HELX_P233 AZ8 ALA L 1474 ? SER L 1478 ? ALA N 1474 SER N 1478 5 ? 5  
HELX_P HELX_P234 AZ9 GLN L 1489 ? GLU L 1501 ? GLN N 1489 GLU N 1501 1 ? 13 
HELX_P HELX_P235 BA1 GLY M 5    ? MET M 12   ? GLY O 5    MET O 12   1 ? 8  
HELX_P HELX_P236 BA2 SER M 15   ? HIS M 33   ? SER O 15   HIS O 33   1 ? 19 
HELX_P HELX_P237 BA3 ASN M 59   ? GLY M 71   ? ASN O 59   GLY O 71   1 ? 13 
HELX_P HELX_P238 BA4 PRO M 81   ? TYR M 93   ? PRO O 81   TYR O 93   1 ? 13 
HELX_P HELX_P239 BA5 ASP N 99   ? GLY N 109  ? ASP P 79   GLY P 89   1 ? 11 
HELX_P HELX_P240 BA6 THR N 115  ? GLY N 141  ? THR P 95   GLY P 121  1 ? 27 
HELX_P HELX_P241 BA7 ASP N 143  ? GLY N 157  ? ASP P 123  GLY P 137  1 ? 15 
HELX_P HELX_P242 BA8 ASP N 172  ? SER N 185  ? ASP P 152  SER P 165  1 ? 14 
HELX_P HELX_P243 BA9 PRO N 187  ? ASN N 211  ? PRO P 167  ASN P 191  1 ? 25 
HELX_P HELX_P244 BB1 ASN N 211  ? LYS N 220  ? ASN P 191  LYS P 200  1 ? 10 
HELX_P HELX_P245 BB2 SER N 228  ? PHE N 247  ? SER P 208  PHE P 227  1 ? 20 
HELX_P HELX_P246 BB3 GLU N 248  ? ARG N 252  ? GLU P 228  ARG P 232  5 ? 5  
HELX_P HELX_P247 BB4 LYS N 254  ? ALA N 275  ? LYS P 234  ALA P 255  1 ? 22 
HELX_P HELX_P248 BB5 PRO N 281  ? GLY N 303  ? PRO P 261  GLY P 283  1 ? 23 
HELX_P HELX_P249 BB6 THR N 307  ? MET N 315  ? THR P 287  MET P 295  1 ? 9  
HELX_P HELX_P250 BB7 ASP N 320  ? GLN N 332  ? ASP P 300  GLN P 312  1 ? 13 
HELX_P HELX_P251 BB8 PHE N 348  ? ILE N 353  ? PHE P 328  ILE P 333  5 ? 6  
HELX_P HELX_P252 BB9 SER N 360  ? SER N 382  ? SER P 340  SER P 362  1 ? 23 
HELX_P HELX_P253 BC1 SER N 382  ? LYS N 393  ? SER P 362  LYS P 373  1 ? 12 
HELX_P HELX_P254 BC2 THR N 402  ? PHE N 410  ? THR P 382  PHE P 390  1 ? 9  
HELX_P HELX_P255 BC3 THR N 413  ? ARG N 436  ? THR P 393  ARG P 416  1 ? 24 
HELX_P HELX_P256 BC4 LEU N 438  ? ASP N 443  ? LEU P 418  ASP P 423  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?   ? D  CYS 1201 SG  ? ? ? 1_555 D  CYS 1204 SG    ? ? D CYS 1201 D CYS 1204 1_555 ? ? ? ? ? ? ?            2.095 
? 
disulf2  disulf ?   ? L  CYS 1201 SG  ? ? ? 1_555 L  CYS 1204 SG    ? ? N CYS 1201 N CYS 1204 1_555 ? ? ? ? ? ? ?            2.087 
? 
metalc1  metalc ?   ? B  ASP 183  OD1 ? ? ? 1_555 Q  MG  .    MG    ? ? B ASP 183  B MG  2001 1_555 ? ? ? ? ? ? ?            2.220 
? 
metalc2  metalc ?   ? B  ASP 191  O   ? ? ? 1_555 Q  MG  .    MG    ? ? B ASP 191  B MG  2001 1_555 ? ? ? ? ? ? ?            2.380 
? 
metalc3  metalc ?   ? B  ASP 193  OD1 ? ? ? 1_555 Q  MG  .    MG    ? ? B ASP 193  B MG  2001 1_555 ? ? ? ? ? ? ?            2.475 
? 
metalc4  metalc ?   ? D  CYS 58   SG  ? ? ? 1_555 S  ZN  .    ZN    ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.837 
? 
metalc5  metalc ?   ? D  CYS 60   SG  ? ? ? 1_555 S  ZN  .    ZN    ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.390 
? 
metalc6  metalc ?   ? D  CYS 73   SG  ? ? ? 1_555 S  ZN  .    ZN    ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.583 
? 
metalc7  metalc ?   ? D  CYS 76   SG  ? ? ? 1_555 S  ZN  .    ZN    ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.278 
? 
metalc8  metalc ?   ? D  ASP 739  OD1 ? ? ? 1_555 T  MG  .    MG    ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?            1.992 
? 
metalc9  metalc ?   ? D  ASP 739  OD2 ? ? ? 1_555 X  MG  .    MG    ? ? D ASP 739  D MG  2007 1_555 ? ? ? ? ? ? ?            2.291 
? 
metalc10 metalc ?   ? D  ASP 741  OD1 ? ? ? 1_555 T  MG  .    MG    ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.120 
? 
metalc11 metalc ?   ? D  ASP 741  OD2 ? ? ? 1_555 T  MG  .    MG    ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.881 
? 
metalc12 metalc ?   ? D  ASP 743  OD1 ? ? ? 1_555 T  MG  .    MG    ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.177 
? 
metalc13 metalc ?   ? D  LYS 840  O   ? ? ? 1_555 U  MG  .    MG    ? ? D LYS 840  D MG  2004 1_555 ? ? ? ? ? ? ?            2.221 
? 
metalc14 metalc ?   ? D  CYS 1112 SG  ? ? ? 1_555 R  ZN  .    ZN    ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.310 
? 
metalc15 metalc ?   ? D  CYS 1194 SG  ? ? ? 1_555 R  ZN  .    ZN    ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.453 
? 
metalc16 metalc ?   ? D  CYS 1201 SG  ? ? ? 1_555 R  ZN  .    ZN    ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.216 
? 
metalc17 metalc ?   ? D  CYS 1204 SG  ? ? ? 1_555 R  ZN  .    ZN    ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.188 
? 
metalc18 metalc ?   ? F  ALA 312  O   ? ? ? 1_555 Z  MG  .    MG    ? ? F ALA 292  F MG  2001 1_555 ? ? ? ? ? ? ?            2.591 
? 
metalc19 metalc ?   ? F  GLY 316  O   ? ? ? 1_555 Z  MG  .    MG    ? ? F GLY 296  F MG  2001 1_555 ? ? ? ? ? ? ?            2.579 
? 
metalc20 metalc ?   ? F  TRP 319  O   ? ? ? 1_555 Z  MG  .    MG    ? ? F TRP 299  F MG  2001 1_555 ? ? ? ? ? ? ?            2.828 
? 
metalc21 metalc ?   ? I  PHE 171  O   ? ? ? 1_555 AA MG  .    MG    ? ? K PHE 171  K MG  901  1_555 ? ? ? ? ? ? ?            2.917 
? 
metalc22 metalc ?   ? J  ASP 183  OD1 ? ? ? 1_555 BA MG  .    MG    ? ? L ASP 183  L MG  2001 1_555 ? ? ? ? ? ? ?            2.430 
? 
metalc23 metalc ?   ? J  ASP 191  O   ? ? ? 1_555 BA MG  .    MG    ? ? L ASP 191  L MG  2001 1_555 ? ? ? ? ? ? ?            2.304 
? 
metalc24 metalc ?   ? J  ASP 193  OD1 ? ? ? 1_555 BA MG  .    MG    ? ? L ASP 193  L MG  2001 1_555 ? ? ? ? ? ? ?            2.411 
? 
metalc25 metalc ?   ? L  CYS 58   SG  ? ? ? 1_555 EA ZN  .    ZN    ? ? N CYS 58   N ZN  1603 1_555 ? ? ? ? ? ? ?            2.467 
? 
metalc26 metalc ?   ? L  CYS 60   SG  ? ? ? 1_555 EA ZN  .    ZN    ? ? N CYS 60   N ZN  1603 1_555 ? ? ? ? ? ? ?            2.446 
? 
metalc27 metalc ?   ? L  CYS 73   SG  ? ? ? 1_555 EA ZN  .    ZN    ? ? N CYS 73   N ZN  1603 1_555 ? ? ? ? ? ? ?            2.541 
? 
metalc28 metalc ?   ? L  CYS 76   SG  ? ? ? 1_555 EA ZN  .    ZN    ? ? N CYS 76   N ZN  1603 1_555 ? ? ? ? ? ? ?            2.620 
? 
metalc29 metalc ?   ? L  ASP 739  OD1 ? ? ? 1_555 FA MG  .    MG    ? ? N ASP 739  N MG  1604 1_555 ? ? ? ? ? ? ?            2.009 
? 
metalc30 metalc ?   ? L  ASP 739  OD2 ? ? ? 1_555 IA MG  .    MG    ? ? N ASP 739  N MG  1607 1_555 ? ? ? ? ? ? ?            2.060 
? 
metalc31 metalc ?   ? L  ASP 741  OD1 ? ? ? 1_555 FA MG  .    MG    ? ? N ASP 741  N MG  1604 1_555 ? ? ? ? ? ? ?            2.159 
? 
metalc32 metalc ?   ? L  ASP 741  OD2 ? ? ? 1_555 FA MG  .    MG    ? ? N ASP 741  N MG  1604 1_555 ? ? ? ? ? ? ?            2.926 
? 
metalc33 metalc ?   ? L  ASP 743  OD1 ? ? ? 1_555 FA MG  .    MG    ? ? N ASP 743  N MG  1604 1_555 ? ? ? ? ? ? ?            2.144 
? 
metalc34 metalc ?   ? L  LYS 840  O   ? ? ? 1_555 CA MG  .    MG    ? ? N LYS 840  N MG  1601 1_555 ? ? ? ? ? ? ?            2.096 
? 
metalc35 metalc ?   ? L  CYS 1112 SG  ? ? ? 1_555 DA ZN  .    ZN    ? ? N CYS 1112 N ZN  1602 1_555 ? ? ? ? ? ? ?            2.452 
? 
metalc36 metalc ?   ? L  CYS 1194 SG  ? ? ? 1_555 DA ZN  .    ZN    ? ? N CYS 1194 N ZN  1602 1_555 ? ? ? ? ? ? ?            2.503 
? 
metalc37 metalc ?   ? L  CYS 1201 SG  ? ? ? 1_555 DA ZN  .    ZN    ? ? N CYS 1201 N ZN  1602 1_555 ? ? ? ? ? ? ?            2.193 
? 
metalc38 metalc ?   ? L  CYS 1204 SG  ? ? ? 1_555 DA ZN  .    ZN    ? ? N CYS 1204 N ZN  1602 1_555 ? ? ? ? ? ? ?            2.149 
? 
metalc39 metalc ?   ? N  ALA 312  O   ? ? ? 1_555 KA MG  .    MG    ? ? P ALA 292  P MG  2001 1_555 ? ? ? ? ? ? ?            2.013 
? 
metalc40 metalc ?   ? N  GLY 316  O   ? ? ? 1_555 KA MG  .    MG    ? ? P GLY 296  P MG  2001 1_555 ? ? ? ? ? ? ?            2.325 
? 
metalc41 metalc ?   ? N  TRP 319  O   ? ? ? 1_555 KA MG  .    MG    ? ? P TRP 299  P MG  2001 1_555 ? ? ? ? ? ? ?            2.367 
? 
metalc42 metalc ?   ? T  MG  .    MG  ? ? ? 1_555 V  C   .    "O3'" ? ? D MG  2003 D C   2005 1_555 ? ? ? ? ? ? ?            1.887 
? 
metalc43 metalc ?   ? U  MG  .    MG  ? ? ? 1_555 OA HOH .    O     ? ? D MG  2004 D HOH 2104 1_555 ? ? ? ? ? ? ?            2.013 
? 
metalc44 metalc ?   ? U  MG  .    MG  ? ? ? 1_555 OA HOH .    O     ? ? D MG  2004 D HOH 2102 1_555 ? ? ? ? ? ? ?            1.920 
? 
covale1  covale one ? V  C   .    P   ? ? ? 1_555 Y  ATP .    "O3'" ? ? D C   2005 D ATP 2008 1_555 ? ? ? ? ? ? ?            1.597 
? 
metalc45 metalc ?   ? W  CTP .    O2A ? ? ? 1_555 X  MG  .    MG    ? ? D CTP 2006 D MG  2007 1_555 ? ? ? ? ? ? ?            2.681 
? 
metalc46 metalc ?   ? W  CTP .    O3B ? ? ? 1_555 X  MG  .    MG    ? ? D CTP 2006 D MG  2007 1_555 ? ? ? ? ? ? ?            2.471 
? 
metalc47 metalc ?   ? AA MG  .    MG  ? ? ? 1_555 RA HOH .    O     ? ? K MG  901  K HOH 1001 1_555 ? ? ? ? ? ? ?            2.097 
? 
metalc48 metalc ?   ? CA MG  .    MG  ? ? ? 1_555 UA HOH .    O     ? ? N MG  1601 N HOH 2102 1_555 ? ? ? ? ? ? ?            2.020 
? 
metalc49 metalc ?   ? CA MG  .    MG  ? ? ? 1_555 UA HOH .    O     ? ? N MG  1601 N HOH 2103 1_555 ? ? ? ? ? ? ?            1.957 
? 
metalc50 metalc ?   ? FA MG  .    MG  ? ? ? 1_555 GA C   .    "O3'" ? ? N MG  1604 N C   1605 1_555 ? ? ? ? ? ? ?            1.961 
? 
covale2  covale one ? GA C   .    P   ? ? ? 1_555 JA ATP .    "O3'" ? ? N C   1605 N ATP 1608 1_555 ? ? ? ? ? ? ?            1.595 
? 
metalc51 metalc ?   ? HA CTP .    O1A ? ? ? 1_555 IA MG  .    MG    ? ? N CTP 1606 N MG  1607 1_555 ? ? ? ? ? ? ?            2.770 
? 
metalc52 metalc ?   ? HA CTP .    O1B ? ? ? 1_555 IA MG  .    MG    ? ? N CTP 1606 N MG  1607 1_555 ? ? ? ? ? ? ?            2.826 
? 
hydrog1  hydrog ?   ? G  DG  4    N1  ? ? ? 1_555 H  DC  24   N3    ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     
? 
hydrog2  hydrog ?   ? G  DC  5    O2  ? ? ? 1_555 H  DG  23   N2    ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     
? 
hydrog3  hydrog ?   ? G  DA  6    N1  ? ? ? 1_555 H  DT  22   N3    ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog4  hydrog ?   ? G  DA  6    N6  ? ? ? 1_555 H  DT  22   O4    ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog5  hydrog ?   ? G  DT  7    N3  ? ? ? 1_555 H  DA  21   N1    ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog6  hydrog ?   ? G  DT  7    O4  ? ? ? 1_555 H  DA  21   N6    ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog7  hydrog ?   ? G  DC  8    N3  ? ? ? 1_555 H  DG  20   N1    ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog8  hydrog ?   ? G  DC  8    N4  ? ? ? 1_555 H  DG  20   O6    ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog9  hydrog ?   ? G  DC  8    O2  ? ? ? 1_555 H  DG  20   N2    ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog10 hydrog ?   ? G  DC  9    N3  ? ? ? 1_555 H  DG  19   N1    ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog11 hydrog ?   ? G  DC  9    N4  ? ? ? 1_555 H  DG  19   O6    ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog12 hydrog ?   ? G  DC  9    O2  ? ? ? 1_555 H  DG  19   N2    ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog13 hydrog ?   ? G  DG  10   N1  ? ? ? 1_555 H  DC  18   N3    ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     
? 
hydrog14 hydrog ?   ? G  DT  11   N3  ? ? ? 1_555 H  DA  17   N1    ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog15 hydrog ?   ? G  DT  11   O4  ? ? ? 1_555 H  DA  17   N6    ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog16 hydrog ?   ? G  DG  12   N1  ? ? ? 1_555 H  DC  16   N3    ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog17 hydrog ?   ? G  DG  12   N2  ? ? ? 1_555 H  DC  16   O2    ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog18 hydrog ?   ? G  DG  12   O6  ? ? ? 1_555 H  DC  16   N4    ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog19 hydrog ?   ? O  DG  4    N1  ? ? ? 1_555 P  DC  24   N3    ? ? R DG  4    S DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog20 hydrog ?   ? O  DG  4    N2  ? ? ? 1_555 P  DC  24   O2    ? ? R DG  4    S DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog21 hydrog ?   ? O  DG  4    O6  ? ? ? 1_555 P  DC  24   N4    ? ? R DG  4    S DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog22 hydrog ?   ? O  DC  5    O2  ? ? ? 1_555 P  DG  23   N2    ? ? R DC  5    S DG  23   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     
? 
hydrog23 hydrog ?   ? O  DA  6    N1  ? ? ? 1_555 P  DT  22   N3    ? ? R DA  6    S DT  22   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     
? 
hydrog24 hydrog ?   ? O  DT  7    N3  ? ? ? 1_555 P  DA  21   N1    ? ? R DT  7    S DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog25 hydrog ?   ? O  DT  7    O4  ? ? ? 1_555 P  DA  21   N6    ? ? R DT  7    S DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog26 hydrog ?   ? O  DC  8    N3  ? ? ? 1_555 P  DG  20   N1    ? ? R DC  8    S DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog27 hydrog ?   ? O  DC  8    N4  ? ? ? 1_555 P  DG  20   O6    ? ? R DC  8    S DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog28 hydrog ?   ? O  DC  8    O2  ? ? ? 1_555 P  DG  20   N2    ? ? R DC  8    S DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog29 hydrog ?   ? O  DC  9    N3  ? ? ? 1_555 P  DG  19   N1    ? ? R DC  9    S DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog30 hydrog ?   ? O  DC  9    N4  ? ? ? 1_555 P  DG  19   O6    ? ? R DC  9    S DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog31 hydrog ?   ? O  DC  9    O2  ? ? ? 1_555 P  DG  19   N2    ? ? R DC  9    S DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog32 hydrog ?   ? O  DG  10   N1  ? ? ? 1_555 P  DC  18   N3    ? ? R DG  10   S DC  18   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     
? 
hydrog33 hydrog ?   ? O  DT  11   N3  ? ? ? 1_555 P  DA  17   N1    ? ? R DT  11   S DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog34 hydrog ?   ? O  DT  11   O4  ? ? ? 1_555 P  DA  17   N6    ? ? R DT  11   S DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog35 hydrog ?   ? O  DG  12   N1  ? ? ? 1_555 P  DC  16   N3    ? ? R DG  12   S DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog36 hydrog ?   ? O  DG  12   N2  ? ? ? 1_555 P  DC  16   O2    ? ? R DG  12   S DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog37 hydrog ?   ? O  DG  12   O6  ? ? ? 1_555 P  DC  16   N4    ? ? R DG  12   S DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -13.17 
2  ALA 8   B . ? ALA 8   B PRO 9   B ? PRO 9   B 1 9.49   
3  GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -13.83 
4  PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 0.43   
5  VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -5.85  
6  ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 -0.99  
7  GLU 26  I . ? GLU 26  K PRO 27  I ? PRO 27  K 1 -11.39 
8  GLU 26  J . ? GLU 26  L PRO 27  J ? PRO 27  L 1 -12.50 
9  PHE 52  K . ? PHE 52  M PRO 53  K ? PRO 53  M 1 -2.55  
10 VAL 108 L . ? VAL 108 N PRO 109 L ? PRO 109 N 1 -7.20  
11 ALA 705 L . ? ALA 705 N PRO 706 L ? PRO 706 N 1 -5.18  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 3 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 8 ? 
AD2 ? 2 ? 
AD3 ? 4 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 5 ? 
AD8 ? 4 ? 
AD9 ? 2 ? 
AE1 ? 3 ? 
AE2 ? 3 ? 
AE3 ? 4 ? 
AE4 ? 3 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 3 ? 
AE8 ? 3 ? 
AE9 ? 3 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 4 ? 
AF6 ? 3 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
AF9 ? 4 ? 
AG1 ? 4 ? 
AG2 ? 2 ? 
AG3 ? 2 ? 
AG4 ? 2 ? 
AG5 ? 4 ? 
AG6 ? 4 ? 
AG7 ? 2 ? 
AG8 ? 2 ? 
AG9 ? 2 ? 
AH1 ? 3 ? 
AH2 ? 2 ? 
AH3 ? 3 ? 
AH4 ? 4 ? 
AH5 ? 5 ? 
AH6 ? 2 ? 
AH7 ? 3 ? 
AH8 ? 6 ? 
AH9 ? 2 ? 
AI1 ? 3 ? 
AI2 ? 4 ? 
AI3 ? 2 ? 
AI4 ? 2 ? 
AI5 ? 8 ? 
AI6 ? 4 ? 
AI7 ? 2 ? 
AI8 ? 2 ? 
AI9 ? 8 ? 
AJ1 ? 2 ? 
AJ2 ? 3 ? 
AJ3 ? 2 ? 
AJ4 ? 3 ? 
AJ5 ? 2 ? 
AJ6 ? 5 ? 
AJ7 ? 4 ? 
AJ8 ? 2 ? 
AJ9 ? 3 ? 
AK1 ? 3 ? 
AK2 ? 4 ? 
AK3 ? 2 ? 
AK4 ? 4 ? 
AK5 ? 2 ? 
AK6 ? 3 ? 
AK7 ? 3 ? 
AK8 ? 3 ? 
AK9 ? 2 ? 
AL1 ? 2 ? 
AL2 ? 2 ? 
AL3 ? 2 ? 
AL4 ? 2 ? 
AL5 ? 4 ? 
AL6 ? 3 ? 
AL7 ? 2 ? 
AL8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? parallel      
AD1 6 7 ? anti-parallel 
AD1 7 8 ? parallel      
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? parallel      
AE8 1 2 ? parallel      
AE8 2 3 ? anti-parallel 
AE9 1 2 ? parallel      
AE9 2 3 ? anti-parallel 
AF1 1 2 ? parallel      
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AF9 3 4 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? parallel      
AH1 2 3 ? parallel      
AH2 1 2 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH3 2 3 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH4 2 3 ? parallel      
AH4 3 4 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH5 2 3 ? anti-parallel 
AH5 3 4 ? anti-parallel 
AH5 4 5 ? anti-parallel 
AH6 1 2 ? anti-parallel 
AH7 1 2 ? anti-parallel 
AH7 2 3 ? anti-parallel 
AH8 1 2 ? anti-parallel 
AH8 2 3 ? anti-parallel 
AH8 3 4 ? parallel      
AH8 4 5 ? anti-parallel 
AH8 5 6 ? anti-parallel 
AH9 1 2 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI1 2 3 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI2 3 4 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI5 2 3 ? anti-parallel 
AI5 3 4 ? anti-parallel 
AI5 4 5 ? parallel      
AI5 5 6 ? anti-parallel 
AI5 6 7 ? parallel      
AI5 7 8 ? anti-parallel 
AI6 1 2 ? anti-parallel 
AI6 2 3 ? anti-parallel 
AI6 3 4 ? anti-parallel 
AI7 1 2 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI9 1 2 ? anti-parallel 
AI9 2 3 ? anti-parallel 
AI9 3 4 ? anti-parallel 
AI9 4 5 ? anti-parallel 
AI9 5 6 ? parallel      
AI9 6 7 ? anti-parallel 
AI9 7 8 ? parallel      
AJ1 1 2 ? anti-parallel 
AJ2 1 2 ? anti-parallel 
AJ2 2 3 ? anti-parallel 
AJ3 1 2 ? anti-parallel 
AJ4 1 2 ? anti-parallel 
AJ4 2 3 ? anti-parallel 
AJ5 1 2 ? anti-parallel 
AJ6 1 2 ? anti-parallel 
AJ6 2 3 ? anti-parallel 
AJ6 3 4 ? anti-parallel 
AJ6 4 5 ? anti-parallel 
AJ7 1 2 ? anti-parallel 
AJ7 2 3 ? anti-parallel 
AJ7 3 4 ? anti-parallel 
AJ8 1 2 ? anti-parallel 
AJ9 1 2 ? anti-parallel 
AJ9 2 3 ? anti-parallel 
AK1 1 2 ? anti-parallel 
AK1 2 3 ? anti-parallel 
AK2 1 2 ? anti-parallel 
AK2 2 3 ? anti-parallel 
AK2 3 4 ? anti-parallel 
AK3 1 2 ? anti-parallel 
AK4 1 2 ? anti-parallel 
AK4 2 3 ? anti-parallel 
AK4 3 4 ? anti-parallel 
AK5 1 2 ? anti-parallel 
AK6 1 2 ? anti-parallel 
AK6 2 3 ? parallel      
AK7 1 2 ? parallel      
AK7 2 3 ? anti-parallel 
AK8 1 2 ? parallel      
AK8 2 3 ? anti-parallel 
AK9 1 2 ? parallel      
AL1 1 2 ? anti-parallel 
AL2 1 2 ? anti-parallel 
AL3 1 2 ? anti-parallel 
AL4 1 2 ? anti-parallel 
AL5 1 2 ? anti-parallel 
AL5 2 3 ? anti-parallel 
AL5 3 4 ? anti-parallel 
AL6 1 2 ? anti-parallel 
AL6 2 3 ? anti-parallel 
AL7 1 2 ? anti-parallel 
AL8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
AA1 2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
AA1 3 ARG A 189  ? THR A 201  ? ARG A 189  THR A 201  
AA1 4 VAL A 174  ? LEU A 186  ? VAL A 174  LEU A 186  
AA2 1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
AA2 2 ARG A 137  ? GLY A 147  ? ARG A 137  GLY A 147  
AA2 3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
AA3 2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
AA4 1 LYS A 107  ? LYS A 110  ? LYS A 107  LYS A 110  
AA4 2 HIS A 128  ? LEU A 132  ? HIS A 128  LEU A 132  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
AA6 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA6 3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
AA6 4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
AA7 1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
AA7 2 ARG B 137  ? GLY B 147  ? ARG B 137  GLY B 147  
AA7 3 GLY B 50   ? ILE B 58   ? GLY B 50   ILE B 58   
AA7 4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
AA8 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA8 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AA9 1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
AA9 2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
AB1 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB1 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB2 1 ILE C 3    ? ARG C 5    ? ILE C 3    ARG C 5    
AB2 2 ARG C 900  ? ILE C 902  ? ARG C 900  ILE C 902  
AB2 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB3 1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
AB3 2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
AB3 3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
AB4 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB4 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB4 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB5 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB5 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB5 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB5 4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
AB6 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB6 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB6 3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
AB6 4 VAL C 182  ? VAL C 186  ? VAL C 182  VAL C 186  
AB6 5 LYS C 190  ? PRO C 192  ? LYS C 190  PRO C 192  
AB7 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB7 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB8 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB8 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB8 3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
AB9 4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
AB9 5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AB9 6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
AC1 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC1 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC2 1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
AC2 2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
AC2 3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC3 1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
AC3 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC3 3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
AC3 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC4 1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
AC4 2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
AC5 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC5 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC6 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AC6 2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC6 3 LYS C 838  ? ALA C 840  ? LYS C 838  ALA C 840  
AC6 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC6 5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
AC6 6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC6 7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
AC6 8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC7 1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
AC7 2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC7 3 ILE C 799  ? ARG C 807  ? ILE C 799  ARG C 807  
AC8 1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
AC8 2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
AC8 3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AC9 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AC9 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AD1 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD1 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD1 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AD1 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AD1 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AD1 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AD1 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AD1 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD2 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AD2 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AD3 1 PRO C 1108 ? VAL C 1109 ? PRO C 1108 VAL C 1109 
AD3 2 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD3 3 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD3 4 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD4 1 GLY D 91   ? ALA D 100  ? GLY D 91   ALA D 100  
AD4 2 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AD5 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AD5 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AD5 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AD6 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AD6 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AD7 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AD7 2 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD7 3 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD7 4 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AD7 5 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AD8 1 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AD8 2 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD8 3 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD8 4 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AD9 1 GLU D 190  ? ALA D 192  ? GLU D 190  ALA D 192  
AD9 2 VAL D 195  ? VAL D 196  ? VAL D 195  VAL D 196  
AE1 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE1 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE1 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AE2 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE2 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE2 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AE3 1 PRO D 278  ? LEU D 284  ? PRO D 278  LEU D 284  
AE3 2 ALA D 268  ? ARG D 273  ? ALA D 268  ARG D 273  
AE3 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AE3 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AE4 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AE4 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AE4 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AE5 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AE5 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AE5 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AE5 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE6 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE6 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE7 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AE7 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AE7 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AE8 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AE8 2 PRO D 826  ? VAL D 829  ? PRO D 826  VAL D 829  
AE8 3 ARG D 832  ? SER D 835  ? ARG D 832  SER D 835  
AE9 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AE9 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE9 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AF1 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AF1 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AF2 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AF2 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AF3 1 PHE D 1123 ? PRO D 1125 ? PHE D 1123 PRO D 1125 
AF3 2 LEU D 1132 ? LEU D 1134 ? LEU D 1132 LEU D 1134 
AF4 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AF4 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AF5 1 SER D 1300 ? LEU D 1305 ? SER D 1300 LEU D 1305 
AF5 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AF5 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AF5 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AF6 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF6 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF6 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AF7 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AF7 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AF8 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF8 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
AF9 1 VAL I 10   ? GLN I 16   ? VAL K 10   GLN K 16   
AF9 2 TYR I 20   ? LEU I 28   ? TYR K 20   LEU K 28   
AF9 3 ARG I 189  ? THR I 201  ? ARG K 189  THR K 201  
AF9 4 VAL I 174  ? LEU I 186  ? VAL K 174  LEU K 186  
AG1 1 THR I 96   ? GLU I 104  ? THR K 96   GLU K 104  
AG1 2 ARG I 137  ? GLY I 147  ? ARG K 137  GLY K 147  
AG1 3 GLY I 50   ? ILE I 58   ? GLY K 50   ILE K 58   
AG1 4 ILE I 165  ? PRO I 166  ? ILE K 165  PRO K 166  
AG2 1 VAL I 87   ? PHE I 89   ? VAL K 87   PHE K 89   
AG2 2 VAL I 120  ? ILE I 122  ? VAL K 120  ILE K 122  
AG3 1 LYS I 107  ? LYS I 110  ? LYS K 107  LYS K 110  
AG3 2 HIS I 128  ? LEU I 132  ? HIS K 128  LEU K 132  
AG4 1 TYR I 150  ? VAL I 151  ? TYR K 150  VAL K 151  
AG4 2 ALA I 169  ? VAL I 170  ? ALA K 169  VAL K 170  
AG5 1 VAL J 10   ? GLN J 16   ? VAL L 10   GLN L 16   
AG5 2 TYR J 20   ? LEU J 28   ? TYR L 20   LEU L 28   
AG5 3 ARG J 189  ? THR J 201  ? ARG L 189  THR L 201  
AG5 4 VAL J 174  ? LEU J 186  ? VAL L 174  LEU L 186  
AG6 1 THR J 96   ? GLU J 104  ? THR L 96   GLU L 104  
AG6 2 ARG J 137  ? GLY J 147  ? ARG L 137  GLY L 147  
AG6 3 GLY J 50   ? ILE J 58   ? GLY L 50   ILE L 58   
AG6 4 ILE J 165  ? PRO J 166  ? ILE L 165  PRO L 166  
AG7 1 VAL J 87   ? PHE J 89   ? VAL L 87   PHE L 89   
AG7 2 VAL J 120  ? ILE J 122  ? VAL L 120  ILE L 122  
AG8 1 LYS J 107  ? LYS J 110  ? LYS L 107  LYS L 110  
AG8 2 HIS J 128  ? LEU J 132  ? HIS L 128  LEU L 132  
AG9 1 TYR J 150  ? VAL J 151  ? TYR L 150  VAL L 151  
AG9 2 ALA J 169  ? VAL J 170  ? ALA L 169  VAL L 170  
AH1 1 ILE K 3    ? ARG K 5    ? ILE M 3    ARG M 5    
AH1 2 ARG K 900  ? ILE K 902  ? ARG M 900  ILE M 902  
AH1 3 VAL K 579  ? MET K 580  ? VAL M 579  MET M 580  
AH2 1 GLN K 91   ? PRO K 93   ? GLN M 91   PRO M 93   
AH2 2 HIS K 117  ? PRO K 119  ? HIS M 117  PRO M 119  
AH3 1 PHE K 127  ? ILE K 129  ? PHE M 127  ILE M 129  
AH3 2 ALA K 132  ? ILE K 136  ? ALA M 132  ILE M 136  
AH3 3 SER K 392  ? PHE K 394  ? SER M 392  PHE M 394  
AH4 1 ARG K 331  ? ARG K 334  ? ARG M 331  ARG M 334  
AH4 2 SER K 138  ? ARG K 142  ? SER M 138  ARG M 142  
AH4 3 ARG K 409  ? SER K 411  ? ARG M 409  SER M 411  
AH4 4 ILE K 452  ? SER K 454  ? ILE M 452  SER M 454  
AH5 1 GLY K 145  ? PRO K 150  ? GLY M 145  PRO M 150  
AH5 2 TYR K 158  ? ILE K 163  ? TYR M 158  ILE M 163  
AH5 3 ILE K 172  ? VAL K 176  ? ILE M 172  VAL M 176  
AH5 4 VAL K 182  ? VAL K 186  ? VAL M 182  VAL M 186  
AH5 5 LYS K 190  ? PRO K 192  ? LYS M 190  PRO M 192  
AH6 1 ALA K 291  ? GLU K 294  ? ALA M 291  GLU M 294  
AH6 2 GLU K 297  ? ASP K 300  ? GLU M 297  ASP M 300  
AH7 1 ARG K 460  ? VAL K 461  ? ARG M 460  VAL M 461  
AH7 2 ILE K 467  ? VAL K 475  ? ILE M 467  VAL M 475  
AH7 3 VAL K 478  ? MET K 486  ? VAL M 478  MET M 486  
AH8 1 ARG K 460  ? VAL K 461  ? ARG M 460  VAL M 461  
AH8 2 ILE K 467  ? VAL K 475  ? ILE M 467  VAL M 475  
AH8 3 PHE K 531  ? ASP K 533  ? PHE M 531  ASP M 533  
AH8 4 THR K 495  ? ALA K 497  ? THR M 495  ALA M 497  
AH8 5 VAL K 513  ? ARG K 517  ? VAL M 513  ARG M 517  
AH8 6 GLU K 520  ? VAL K 524  ? GLU M 520  VAL M 524  
AH9 1 LEU K 503  ? GLU K 504  ? LEU M 503  GLU M 504  
AH9 2 ARG K 507  ? ILE K 508  ? ARG M 507  ILE M 508  
AI1 1 LEU K 595  ? TYR K 596  ? LEU M 595  TYR M 596  
AI1 2 LEU K 654  ? ASP K 657  ? LEU M 654  ASP M 657  
AI1 3 ARG K 640  ? PRO K 641  ? ARG M 640  PRO M 641  
AI2 1 LEU K 620  ? PRO K 624  ? LEU M 620  PRO M 624  
AI2 2 ARG K 610  ? TYR K 615  ? ARG M 610  TYR M 615  
AI2 3 GLY K 601  ? VAL K 606  ? GLY M 601  VAL M 606  
AI2 4 ARG K 648  ? VAL K 649  ? ARG M 648  VAL M 649  
AI3 1 TYR K 629  ? ARG K 630  ? TYR M 629  ARG M 630  
AI3 2 ALA K 636  ? LEU K 637  ? ALA M 636  LEU M 637  
AI4 1 SER K 661  ? GLU K 662  ? SER M 661  GLU M 662  
AI4 2 PHE K 665  ? LEU K 666  ? PHE M 665  LEU M 666  
AI5 1 LYS K 971  ? VAL K 972  ? LYS M 971  VAL M 972  
AI5 2 ILE K 987  ? LYS K 996  ? ILE M 987  LYS M 996  
AI5 3 LYS K 838  ? ASN K 841  ? LYS M 838  ASN M 841  
AI5 4 LYS K 846  ? LEU K 853  ? LYS M 846  LEU M 853  
AI5 5 ILE K 688  ? SER K 691  ? ILE M 688  SER M 691  
AI5 6 VAL K 869  ? LEU K 871  ? VAL M 869  LEU M 871  
AI5 7 GLN K 670  ? ILE K 676  ? GLN M 670  ILE M 676  
AI5 8 ILE K 987  ? LYS K 996  ? ILE M 987  LYS M 996  
AI6 1 SER K 702  ? ARG K 713  ? SER M 702  ARG M 713  
AI6 2 VAL K 819  ? ARG K 831  ? VAL M 819  ARG M 831  
AI6 3 GLY K 798  ? ARG K 807  ? GLY M 798  ARG M 807  
AI6 4 GLU K 748  ? VAL K 749  ? GLU M 748  VAL M 749  
AI7 1 ILE K 754  ? VAL K 756  ? ILE M 754  VAL M 756  
AI7 2 LEU K 790  ? ARG K 791  ? LEU M 790  ARG M 791  
AI8 1 THR K 759  ? PHE K 761  ? THR M 759  PHE M 761  
AI8 2 VAL K 785  ? ASP K 787  ? VAL M 785  ASP M 787  
AI9 1 HIS K 1006 ? ARG K 1008 ? HIS M 1006 ARG M 1008 
AI9 2 SER L 626  ? VAL L 633  ? SER N 626  VAL N 633  
AI9 3 GLN L 744  ? HIS L 748  ? GLN N 744  HIS N 748  
AI9 4 VAL L 700  ? ASN L 703  ? VAL N 700  ASN N 703  
AI9 5 ILE L 713  ? VAL L 721  ? ILE N 713  VAL N 721  
AI9 6 GLN L 641  ? PRO L 645  ? GLN N 641  PRO N 645  
AI9 7 ILE L 726  ? LEU L 728  ? ILE N 726  LEU N 728  
AI9 8 SER L 626  ? VAL L 633  ? SER N 626  VAL N 633  
AJ1 1 GLN K 1030 ? PHE K 1032 ? GLN M 1030 PHE M 1032 
AJ1 2 LYS L 621  ? VAL L 623  ? LYS N 621  VAL N 623  
AJ2 1 LEU K 1097 ? LEU K 1102 ? LEU M 1097 LEU M 1102 
AJ2 2 LYS L 7    ? LEU L 12   ? LYS N 7    LEU N 12   
AJ2 3 LYS L 1456 ? ASP L 1457 ? LYS N 1456 ASP N 1457 
AJ3 1 GLY L 91   ? ALA L 100  ? GLY N 91   ALA N 100  
AJ3 2 ILE L 513  ? VAL L 519  ? ILE N 513  VAL N 519  
AJ4 1 LEU L 152  ? LEU L 153  ? LEU N 152  LEU N 153  
AJ4 2 TYR L 132  ? ASP L 136  ? TYR N 132  ASP N 136  
AJ4 3 ASP L 453  ? ARG L 455  ? ASP N 453  ARG N 455  
AJ5 1 ILE L 141  ? LEU L 142  ? ILE N 141  LEU N 142  
AJ5 2 VAL L 145  ? PRO L 146  ? VAL N 145  PRO N 146  
AJ6 1 GLN L 166  ? PRO L 170  ? GLN N 166  PRO N 170  
AJ6 2 GLY L 383  ? VAL L 396  ? GLY N 383  VAL N 396  
AJ6 3 GLY L 201  ? PRO L 226  ? GLY N 201  PRO N 226  
AJ6 4 THR L 330  ? ARG L 346  ? THR N 330  ARG N 346  
AJ6 5 ARG L 318  ? GLU L 327  ? ARG N 318  GLU N 327  
AJ7 1 GLU L 184  ? VAL L 185  ? GLU N 184  VAL N 185  
AJ7 2 GLY L 201  ? PRO L 226  ? GLY N 201  PRO N 226  
AJ7 3 GLY L 383  ? VAL L 396  ? GLY N 383  VAL N 396  
AJ7 4 ARG L 360  ? VAL L 361  ? ARG N 360  VAL N 361  
AJ8 1 GLU L 190  ? ALA L 192  ? GLU N 190  ALA N 192  
AJ8 2 VAL L 195  ? VAL L 196  ? VAL N 195  VAL N 196  
AJ9 1 ILE L 241  ? GLU L 244  ? ILE N 241  GLU N 244  
AJ9 2 PRO L 303  ? ARG L 312  ? PRO N 303  ARG N 312  
AJ9 3 TYR L 249  ? ARG L 252  ? TYR N 249  ARG N 252  
AK1 1 ILE L 241  ? GLU L 244  ? ILE N 241  GLU N 244  
AK1 2 PRO L 303  ? ARG L 312  ? PRO N 303  ARG N 312  
AK1 3 VAL L 286  ? PRO L 290  ? VAL N 286  PRO N 290  
AK2 1 PRO L 278  ? LEU L 284  ? PRO N 278  LEU N 284  
AK2 2 ALA L 268  ? ARG L 273  ? ALA N 268  ARG N 273  
AK2 3 GLY L 257  ? GLU L 263  ? GLY N 257  GLU N 263  
AK2 4 ILE L 297  ? VAL L 298  ? ILE N 297  VAL N 298  
AK3 1 ASN L 352  ? VAL L 353  ? ASN N 352  VAL N 353  
AK3 2 VAL L 368  ? ALA L 369  ? VAL N 368  ALA N 369  
AK4 1 ALA L 398  ? PRO L 402  ? ALA N 398  PRO N 402  
AK4 2 VAL L 443  ? GLU L 448  ? VAL N 443  GLU N 448  
AK4 3 GLY L 433  ? ASP L 438  ? GLY N 433  ASP N 438  
AK4 4 ARG L 414  ? VAL L 415  ? ARG N 414  VAL N 415  
AK5 1 VAL L 420  ? ALA L 422  ? VAL N 420  ALA N 422  
AK5 2 VAL L 427  ? LYS L 428  ? VAL N 427  LYS N 428  
AK6 1 MET L 527  ? GLN L 529  ? MET N 527  GLN N 529  
AK6 2 PHE L 535  ? THR L 537  ? PHE N 535  THR N 537  
AK6 3 VAL N 335  ? SER N 336  ? VAL P 315  SER P 316  
AK7 1 GLU L 805  ? PHE L 806  ? GLU N 805  PHE N 806  
AK7 2 PRO L 826  ? VAL L 829  ? PRO N 826  VAL N 829  
AK7 3 ARG L 832  ? SER L 835  ? ARG N 832  SER N 835  
AK8 1 VAL L 842  ? PHE L 843  ? VAL N 842  PHE N 843  
AK8 2 VAL L 864  ? TYR L 868  ? VAL N 864  TYR N 868  
AK8 3 LYS L 871  ? THR L 875  ? LYS N 871  THR N 875  
AK9 1 VAL L 1106 ? GLU L 1109 ? VAL N 1106 GLU N 1109 
AK9 2 GLY L 1199 ? CYS L 1201 ? GLY N 1199 CYS N 1201 
AL1 1 ILE L 1118 ? PRO L 1121 ? ILE N 1118 PRO N 1121 
AL1 2 GLU L 1185 ? VAL L 1188 ? GLU N 1185 VAL N 1188 
AL2 1 PHE L 1123 ? PRO L 1125 ? PHE N 1123 PRO N 1125 
AL2 2 LEU L 1132 ? LEU L 1134 ? LEU N 1132 LEU N 1134 
AL3 1 VAL L 1153 ? VAL L 1155 ? VAL N 1153 VAL N 1155 
AL3 2 VAL L 1158 ? LEU L 1160 ? VAL N 1158 LEU N 1160 
AL4 1 TYR L 1207 ? ASP L 1208 ? TYR N 1207 ASP N 1208 
AL4 2 ARG L 1213 ? PRO L 1214 ? ARG N 1213 PRO N 1214 
AL5 1 SER L 1300 ? LYS L 1304 ? SER N 1300 LYS N 1304 
AL5 2 LEU L 1290 ? GLU L 1295 ? LEU N 1290 GLU N 1295 
AL5 3 GLY L 1279 ? GLU L 1285 ? GLY N 1279 GLU N 1285 
AL5 4 TYR L 1318 ? VAL L 1319 ? TYR N 1318 VAL N 1319 
AL6 1 VAL L 1394 ? GLU L 1396 ? VAL N 1394 GLU N 1396 
AL6 2 TYR L 1378 ? ASP L 1383 ? TYR N 1378 ASP N 1383 
AL6 3 ALA L 1416 ? PRO L 1419 ? ALA N 1416 PRO N 1419 
AL7 1 GLN L 1485 ? ASP L 1488 ? GLN N 1485 ASP N 1488 
AL7 2 LEU M 73   ? GLY M 76   ? LEU O 73   GLY O 76   
AL8 1 LYS M 47   ? GLN M 49   ? LYS O 47   GLN O 49   
AL8 2 LEU M 54   ? ASP M 56   ? LEU O 54   ASP O 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
AA1 2 3 N LEU A 28   ? N LEU A 28   O ASP A 193  ? O ASP A 193  
AA1 3 4 O ARG A 198  ? O ARG A 198  N ALA A 178  ? N ALA A 178  
AA2 1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
AA2 2 3 O GLY A 147  ? O GLY A 147  N GLY A 50   ? N GLY A 50   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
AA4 1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N VAL B 10   ? N VAL B 10   O GLU B 26   ? O GLU B 26   
AA6 2 3 N LEU B 25   ? N LEU B 25   O LEU B 195  ? O LEU B 195  
AA6 3 4 O THR B 196  ? O THR B 196  N GLN B 180  ? N GLN B 180  
AA7 1 2 N VAL B 97   ? N VAL B 97   O VAL B 144  ? O VAL B 144  
AA7 2 3 O ARG B 143  ? O ARG B 143  N SER B 55   ? N SER B 55   
AA7 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA8 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AA9 1 2 N VAL B 109  ? N VAL B 109  O ILE B 129  ? O ILE B 129  
AB1 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB2 1 2 N LYS C 4    ? N LYS C 4    O ARG C 900  ? O ARG C 900  
AB2 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB3 1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
AB3 2 3 N LEU C 94   ? N LEU C 94   O GLY C 116  ? O GLY C 116  
AB4 1 2 N PHE C 127  ? N PHE C 127  O ARG C 134  ? O ARG C 134  
AB4 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB5 1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
AB5 2 3 N SER C 138  ? N SER C 138  O SER C 411  ? O SER C 411  
AB5 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB6 1 2 N THR C 149  ? N THR C 149  O ILE C 159  ? O ILE C 159  
AB6 2 3 N ALA C 160  ? N ALA C 160  O LEU C 174  ? O LEU C 174  
AB6 3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
AB6 4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
AB7 1 2 N GLU C 294  ? N GLU C 294  O GLU C 297  ? O GLU C 297  
AB8 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB8 2 3 N ARG C 473  ? N ARG C 473  O THR C 480  ? O THR C 480  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AB9 3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
AB9 4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AB9 5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
AC1 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC2 1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
AC2 2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
AC3 1 2 O VAL C 621  ? O VAL C 621  N VAL C 613  ? N VAL C 613  
AC3 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC3 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC4 1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
AC5 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC6 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AC6 2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
AC6 3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
AC6 4 5 O ALA C 850  ? O ALA C 850  N ILE C 688  ? N ILE C 688  
AC6 5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
AC6 6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
AC6 7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
AC7 1 2 N SER C 702  ? N SER C 702  O ARG C 831  ? O ARG C 831  
AC7 2 3 O ALA C 828  ? O ALA C 828  N ILE C 799  ? N ILE C 799  
AC8 1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
AC8 2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AC9 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AD1 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD1 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AD1 3 4 O ALA D 746  ? O ALA D 746  N ASN D 703  ? N ASN D 703  
AD1 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AD1 5 6 O VAL D 719  ? O VAL D 719  N LEU D 644  ? N LEU D 644  
AD1 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AD1 7 8 O ILE D 726  ? O ILE D 726  N VAL D 632  ? N VAL D 632  
AD2 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD3 1 2 O VAL C 1109 ? O VAL C 1109 N THR C 1101 ? N THR C 1101 
AD3 2 3 N GLN C 1100 ? N GLN C 1100 O ARG D 9    ? O ARG D 9    
AD3 3 4 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD4 1 2 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD5 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD5 2 3 N ASP D 136  ? N ASP D 136  O ASP D 453  ? O ASP D 453  
AD6 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AD7 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AD7 2 3 O GLU D 389  ? O GLU D 389  N ARG D 209  ? N ARG D 209  
AD7 3 4 N LEU D 225  ? N LEU D 225  O VAL D 331  ? O VAL D 331  
AD7 4 5 O THR D 330  ? O THR D 330  N GLU D 327  ? N GLU D 327  
AD8 1 2 N VAL D 185  ? N VAL D 185  O GLY D 201  ? O GLY D 201  
AD8 2 3 N ARG D 209  ? N ARG D 209  O GLU D 389  ? O GLU D 389  
AD8 3 4 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AD9 1 2 N LEU D 191  ? N LEU D 191  O VAL D 195  ? O VAL D 195  
AE1 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AE1 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AE2 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AE2 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AE3 1 2 O LEU D 284  ? O LEU D 284  N ALA D 268  ? N ALA D 268  
AE3 2 3 O PHE D 269  ? O PHE D 269  N LYS D 262  ? N LYS D 262  
AE3 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AE4 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AE4 2 3 N VAL D 368  ? N VAL D 368  O VAL D 377  ? O VAL D 377  
AE5 1 2 N TYR D 401  ? N TYR D 401  O VAL D 444  ? O VAL D 444  
AE5 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AE5 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE6 1 2 N LEU D 421  ? N LEU D 421  O VAL D 427  ? O VAL D 427  
AE7 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AE7 2 3 N PHE D 535  ? N PHE D 535  O VAL F 335  ? O VAL F 315  
AE8 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AE8 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AE9 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AE9 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AF1 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AF2 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AF3 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AF4 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AF5 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AF5 2 3 O GLU D 1295 ? O GLU D 1295 N VAL D 1280 ? N VAL D 1280 
AF5 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AF6 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF6 2 3 N GLU D 1380 ? N GLU D 1380 O LYS D 1418 ? O LYS D 1418 
AF7 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AF8 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
AF9 1 2 N ARG I 14   ? N ARG K 14   O GLU I 22   ? O GLU K 22   
AF9 2 3 N LEU I 28   ? N LEU K 28   O ASP I 193  ? O ASP K 193  
AF9 3 4 O TRP I 200  ? O TRP K 200  N ARG I 176  ? N ARG K 176  
AG1 1 2 N VAL I 97   ? N VAL K 97   O VAL I 144  ? O VAL K 144  
AG1 2 3 O GLY I 147  ? O GLY K 147  N GLY I 50   ? N GLY K 50   
AG1 3 4 N VAL I 56   ? N VAL K 56   O ILE I 165  ? O ILE K 165  
AG2 1 2 N ARG I 88   ? N ARG K 88   O GLU I 121  ? O GLU K 121  
AG3 1 2 N LYS I 107  ? N LYS K 107  O LEU I 132  ? O LEU K 132  
AG4 1 2 N VAL I 151  ? N VAL K 151  O ALA I 169  ? O ALA K 169  
AG5 1 2 N THR J 12   ? N THR L 12   O VAL J 24   ? O VAL L 24   
AG5 2 3 N PHE J 23   ? N PHE L 23   O LEU J 197  ? O LEU L 197  
AG5 3 4 O TRP J 200  ? O TRP L 200  N ARG J 175  ? N ARG L 175  
AG6 1 2 N VAL J 97   ? N VAL L 97   O VAL J 144  ? O VAL L 144  
AG6 2 3 O ARG J 143  ? O ARG L 143  N SER J 55   ? N SER L 55   
AG6 3 4 N VAL J 56   ? N VAL L 56   O ILE J 165  ? O ILE L 165  
AG7 1 2 N ARG J 88   ? N ARG L 88   O GLU J 121  ? O GLU L 121  
AG8 1 2 N LYS J 107  ? N LYS L 107  O LEU J 132  ? O LEU L 132  
AG9 1 2 N VAL J 151  ? N VAL L 151  O ALA J 169  ? O ALA L 169  
AH1 1 2 N LYS K 4    ? N LYS M 4    O ARG K 900  ? O ARG M 900  
AH1 2 3 O TYR K 901  ? O TYR M 901  N MET K 580  ? N MET M 580  
AH2 1 2 N ALA K 92   ? N ALA M 92   O ILE K 118  ? O ILE M 118  
AH3 1 2 N PHE K 127  ? N PHE M 127  O ARG K 134  ? O ARG M 134  
AH3 2 3 N VAL K 135  ? N VAL M 135  O GLN K 393  ? O GLN M 393  
AH4 1 2 O ARG K 332  ? O ARG M 332  N HIS K 141  ? N HIS M 141  
AH4 2 3 N SER K 138  ? N SER M 138  O SER K 411  ? O SER M 411  
AH4 3 4 N ILE K 410  ? N ILE M 410  O THR K 453  ? O THR M 453  
AH5 1 2 N THR K 149  ? N THR M 149  O ILE K 159  ? O ILE M 159  
AH5 2 3 N ALA K 160  ? N ALA M 160  O LEU K 174  ? O LEU M 174  
AH5 3 4 N GLU K 175  ? N GLU M 175  O SER K 183  ? O SER M 183  
AH5 4 5 N MET K 184  ? N MET M 184  O PHE K 191  ? O PHE M 191  
AH6 1 2 N GLU K 294  ? N GLU M 294  O GLU K 297  ? O GLU M 297  
AH7 1 2 N ARG K 460  ? N ARG M 460  O ARG K 468  ? O ARG M 468  
AH7 2 3 N TYR K 471  ? N TYR M 471  O VAL K 484  ? O VAL M 484  
AH8 1 2 N ARG K 460  ? N ARG M 460  O ARG K 468  ? O ARG M 468  
AH8 2 3 N ARG K 472  ? N ARG M 472  O MET K 532  ? O MET M 532  
AH8 3 4 O PHE K 531  ? O PHE M 531  N ALA K 497  ? N ALA M 497  
AH8 4 5 N ILE K 496  ? N ILE M 496  O ARG K 516  ? O ARG M 516  
AH8 5 6 N ALA K 515  ? N ALA M 515  O VAL K 522  ? O VAL M 522  
AH9 1 2 N GLU K 504  ? N GLU M 504  O ARG K 507  ? O ARG M 507  
AI1 1 2 N LEU K 595  ? N LEU M 595  O LEU K 655  ? O LEU M 655  
AI1 2 3 O ASP K 657  ? O ASP M 657  N ARG K 640  ? N ARG M 640  
AI2 1 2 O VAL K 621  ? O VAL M 621  N VAL K 613  ? N VAL M 613  
AI2 2 3 O ARG K 614  ? O ARG M 614  N GLU K 602  ? N GLU M 602  
AI2 3 4 N GLY K 601  ? N GLY M 601  O VAL K 649  ? O VAL M 649  
AI3 1 2 N TYR K 629  ? N TYR M 629  O LEU K 637  ? O LEU M 637  
AI4 1 2 N GLU K 662  ? N GLU M 662  O PHE K 665  ? O PHE M 665  
AI5 1 2 N VAL K 972  ? N VAL M 972  O ILE K 987  ? O ILE M 987  
AI5 2 3 O MET K 995  ? O MET M 995  N ALA K 840  ? N ALA M 840  
AI5 3 4 N LEU K 839  ? N LEU M 839  O GLY K 847  ? O GLY M 847  
AI5 4 5 O LEU K 853  ? O LEU M 853  N ILE K 690  ? N ILE M 690  
AI5 5 6 N VAL K 689  ? N VAL M 689  O ILE K 870  ? O ILE M 870  
AI5 6 7 O VAL K 869  ? O VAL M 869  N ALA K 675  ? N ALA M 675  
AI5 7 8 N VAL K 674  ? N VAL M 674  O GLY K 990  ? O GLY M 990  
AI6 1 2 N GLU K 706  ? N GLU M 706  O VAL K 827  ? O VAL M 827  
AI6 2 3 O ALA K 828  ? O ALA M 828  N ILE K 799  ? N ILE M 799  
AI6 3 4 O GLY K 798  ? O GLY M 798  N VAL K 749  ? N VAL M 749  
AI7 1 2 N VAL K 756  ? N VAL M 756  O LEU K 790  ? O LEU M 790  
AI8 1 2 N SER K 760  ? N SER M 760  O LYS K 786  ? O LYS M 786  
AI9 1 2 N HIS K 1006 ? N HIS M 1006 O ARG L 628  ? O ARG N 628  
AI9 2 3 N SER L 629  ? N SER N 629  O MET L 745  ? O MET N 745  
AI9 3 4 O ALA L 746  ? O ALA N 746  N ASN L 703  ? N ASN N 703  
AI9 4 5 N VAL L 700  ? N VAL N 700  O PHE L 716  ? O PHE N 716  
AI9 5 6 O VAL L 719  ? O VAL N 719  N CYS L 642  ? N CYS N 642  
AI9 6 7 N GLY L 643  ? N GLY N 643  O GLN L 727  ? O GLN N 727  
AI9 7 8 O ILE L 726  ? O ILE N 726  N VAL L 632  ? N VAL N 632  
AJ1 1 2 N PHE K 1032 ? N PHE M 1032 O LYS L 621  ? O LYS N 621  
AJ2 1 2 N GLN K 1100 ? N GLN M 1100 O ARG L 9    ? O ARG N 9    
AJ2 2 3 N VAL L 8    ? N VAL N 8    O ASP L 1457 ? O ASP N 1457 
AJ3 1 2 N ALA L 99   ? N ALA N 99   O LEU L 514  ? O LEU N 514  
AJ4 1 2 O LEU L 153  ? O LEU N 153  N TYR L 132  ? N TYR N 132  
AJ4 2 3 N LEU L 135  ? N LEU N 135  O ASP L 453  ? O ASP N 453  
AJ5 1 2 N LEU L 142  ? N LEU N 142  O VAL L 145  ? O VAL N 145  
AJ6 1 2 N TYR L 169  ? N TYR N 169  O ILE L 393  ? O ILE N 393  
AJ6 2 3 O VAL L 396  ? O VAL N 396  N VAL L 202  ? N VAL N 202  
AJ6 3 4 N LEU L 223  ? N LEU N 223  O LEU L 333  ? O LEU N 333  
AJ6 4 5 O THR L 334  ? O THR N 334  N GLU L 323  ? N GLU N 323  
AJ7 1 2 N VAL L 185  ? N VAL N 185  O GLY L 201  ? O GLY N 201  
AJ7 2 3 N VAL L 202  ? N VAL N 202  O VAL L 396  ? O VAL N 396  
AJ7 3 4 O GLY L 383  ? O GLY N 383  N VAL L 361  ? N VAL N 361  
AJ8 1 2 N LEU L 191  ? N LEU N 191  O VAL L 195  ? O VAL N 195  
AJ9 1 2 N LEU L 242  ? N LEU N 242  O LEU L 311  ? O LEU N 311  
AJ9 2 3 O ALA L 307  ? O ALA N 307  N TYR L 249  ? N TYR N 249  
AK1 1 2 N LEU L 242  ? N LEU N 242  O LEU L 311  ? O LEU N 311  
AK1 2 3 O ARG L 312  ? O ARG N 312  N VAL L 286  ? N VAL N 286  
AK2 1 2 O LEU L 284  ? O LEU N 284  N ALA L 268  ? N ALA N 268  
AK2 2 3 O VAL L 271  ? O VAL N 271  N GLU L 260  ? N GLU N 260  
AK2 3 4 N GLY L 257  ? N GLY N 257  O VAL L 298  ? O VAL N 298  
AK3 1 2 N ASN L 352  ? N ASN N 352  O ALA L 369  ? O ALA N 369  
AK4 1 2 N ARG L 399  ? N ARG N 399  O VAL L 446  ? O VAL N 446  
AK4 2 3 O ARG L 445  ? O ARG N 445  N GLU L 436  ? N GLU N 436  
AK4 3 4 O GLY L 433  ? O GLY N 433  N VAL L 415  ? N VAL N 415  
AK5 1 2 N LEU L 421  ? N LEU N 421  O VAL L 427  ? O VAL N 427  
AK6 1 2 N VAL L 528  ? N VAL N 528  O ALA L 536  ? O ALA N 536  
AK6 2 3 N PHE L 535  ? N PHE N 535  O VAL N 335  ? O VAL P 315  
AK7 1 2 N PHE L 806  ? N PHE N 806  O LYS L 828  ? O LYS N 828  
AK7 2 3 N ILE L 827  ? N ILE N 827  O THR L 834  ? O THR N 834  
AK8 1 2 N PHE L 843  ? N PHE N 843  O THR L 865  ? O THR N 865  
AK8 2 3 N VAL L 866  ? N VAL N 866  O LEU L 873  ? O LEU N 873  
AK9 1 2 N ARG L 1108 ? N ARG N 1108 O VAL L 1200 ? O VAL N 1200 
AL1 1 2 N ILE L 1118 ? N ILE N 1118 O VAL L 1188 ? O VAL N 1188 
AL2 1 2 N GLN L 1124 ? N GLN N 1124 O ARG L 1133 ? O ARG N 1133 
AL3 1 2 N VAL L 1153 ? N VAL N 1153 O LEU L 1160 ? O LEU N 1160 
AL4 1 2 N ASP L 1208 ? N ASP N 1208 O ARG L 1213 ? O ARG N 1213 
AL5 1 2 O TYR L 1303 ? O TYR N 1303 N VAL L 1292 ? N VAL N 1292 
AL5 2 3 O GLU L 1295 ? O GLU N 1295 N VAL L 1280 ? N VAL N 1280 
AL5 3 4 N GLY L 1279 ? N GLY N 1279 O VAL L 1319 ? O VAL N 1319 
AL6 1 2 O LEU L 1395 ? O LEU N 1395 N VAL L 1379 ? N VAL N 1379 
AL6 2 3 N GLU L 1380 ? N GLU N 1380 O LYS L 1418 ? O LYS N 1418 
AL7 1 2 N GLN L 1485 ? N GLN N 1485 O GLY M 76   ? O GLY O 76   
AL8 1 2 N MET M 48   ? N MET O 48   O PHE M 55   ? O PHE O 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MG  2001 ? 4 'binding site for residue MG B 2001'  
AC2 Software D ZN  2001 ? 4 'binding site for residue ZN D 2001'  
AC3 Software D ZN  2002 ? 4 'binding site for residue ZN D 2002'  
AC4 Software D MG  2003 ? 4 'binding site for residue MG D 2003'  
AC5 Software D MG  2004 ? 3 'binding site for residue MG D 2004'  
AC6 Software D C   2005 ? 9 'binding site for residue C D 2005'   
AC7 Software D CTP 2006 ? 5 'binding site for residue CTP D 2006' 
AC8 Software D MG  2007 ? 3 'binding site for residue MG D 2007'  
AC9 Software F MG  2001 ? 3 'binding site for residue MG F 2001'  
AD1 Software K MG  901  ? 7 'binding site for residue MG K 901'   
AD2 Software L MG  2001 ? 4 'binding site for residue MG L 2001'  
AD3 Software N MG  1601 ? 4 'binding site for residue MG N 1601'  
AD4 Software N ZN  1602 ? 4 'binding site for residue ZN N 1602'  
AD5 Software N ZN  1603 ? 4 'binding site for residue ZN N 1603'  
AD6 Software N MG  1604 ? 4 'binding site for residue MG N 1604'  
AD7 Software N C   1605 ? 8 'binding site for residue C N 1605'   
AD8 Software N CTP 1606 ? 4 'binding site for residue CTP N 1606' 
AD9 Software N MG  1607 ? 3 'binding site for residue MG N 1607'  
AE1 Software P MG  2001 ? 3 'binding site for residue MG P 2001'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ASP B  183  ? ASP B 183  . ? 1_555 ? 
2  AC1 4 ASP B  191  ? ASP B 191  . ? 1_555 ? 
3  AC1 4 LEU B  192  ? LEU B 192  . ? 1_555 ? 
4  AC1 4 ASP B  193  ? ASP B 193  . ? 1_555 ? 
5  AC2 4 CYS D  1112 ? CYS D 1112 . ? 1_555 ? 
6  AC2 4 CYS D  1194 ? CYS D 1194 . ? 1_555 ? 
7  AC2 4 CYS D  1201 ? CYS D 1201 . ? 1_555 ? 
8  AC2 4 CYS D  1204 ? CYS D 1204 . ? 1_555 ? 
9  AC3 4 CYS D  58   ? CYS D 58   . ? 1_555 ? 
10 AC3 4 CYS D  60   ? CYS D 60   . ? 1_555 ? 
11 AC3 4 CYS D  73   ? CYS D 73   . ? 1_555 ? 
12 AC3 4 CYS D  76   ? CYS D 76   . ? 1_555 ? 
13 AC4 4 ASP D  739  ? ASP D 739  . ? 1_555 ? 
14 AC4 4 ASP D  741  ? ASP D 741  . ? 1_555 ? 
15 AC4 4 ASP D  743  ? ASP D 743  . ? 1_555 ? 
16 AC4 4 C   V  .    ? C   D 2005 . ? 1_555 ? 
17 AC5 3 LYS D  840  ? LYS D 840  . ? 1_555 ? 
18 AC5 3 HOH OA .    ? HOH D 2102 . ? 1_555 ? 
19 AC5 3 HOH OA .    ? HOH D 2104 . ? 1_555 ? 
20 AC6 9 LYS C  838  ? LYS C 838  . ? 1_555 ? 
21 AC6 9 LYS C  846  ? LYS C 846  . ? 1_555 ? 
22 AC6 9 ARG D  704  ? ARG D 704  . ? 1_555 ? 
23 AC6 9 ASP D  739  ? ASP D 739  . ? 1_555 ? 
24 AC6 9 ASP D  741  ? ASP D 741  . ? 1_555 ? 
25 AC6 9 ASP D  743  ? ASP D 743  . ? 1_555 ? 
26 AC6 9 MG  T  .    ? MG  D 2003 . ? 1_555 ? 
27 AC6 9 HOH OA .    ? HOH D 2112 . ? 1_555 ? 
28 AC6 9 DG  G  14   ? DG  G 14   . ? 1_555 ? 
29 AC7 5 ARG C  879  ? ARG C 879  . ? 1_555 ? 
30 AC7 5 ASP D  739  ? ASP D 739  . ? 1_555 ? 
31 AC7 5 ARG D  1029 ? ARG D 1029 . ? 1_555 ? 
32 AC7 5 MG  X  .    ? MG  D 2007 . ? 1_555 ? 
33 AC7 5 HOH OA .    ? HOH D 2107 . ? 1_555 ? 
34 AC8 3 ASP C  686  ? ASP C 686  . ? 1_555 ? 
35 AC8 3 ASP D  739  ? ASP D 739  . ? 1_555 ? 
36 AC8 3 CTP W  .    ? CTP D 2006 . ? 1_555 ? 
37 AC9 3 ALA F  312  ? ALA F 292  . ? 1_555 ? 
38 AC9 3 GLY F  316  ? GLY F 296  . ? 1_555 ? 
39 AC9 3 TRP F  319  ? TRP F 299  . ? 1_555 ? 
40 AD1 7 THR I  51   ? THR K 51   . ? 1_555 ? 
41 AD1 7 VAL I  170  ? VAL K 170  . ? 1_555 ? 
42 AD1 7 PHE I  171  ? PHE K 171  . ? 1_555 ? 
43 AD1 7 SER I  172  ? SER K 172  . ? 1_555 ? 
44 AD1 7 ASP I  202  ? ASP K 202  . ? 1_555 ? 
45 AD1 7 HOH RA .    ? HOH K 1001 . ? 1_555 ? 
46 AD1 7 HOH RA .    ? HOH K 1003 . ? 1_555 ? 
47 AD2 4 ASP J  183  ? ASP L 183  . ? 1_555 ? 
48 AD2 4 ASP J  191  ? ASP L 191  . ? 1_555 ? 
49 AD2 4 LEU J  192  ? LEU L 192  . ? 1_555 ? 
50 AD2 4 ASP J  193  ? ASP L 193  . ? 1_555 ? 
51 AD3 4 ASP J  168  ? ASP L 168  . ? 1_555 ? 
52 AD3 4 LYS L  840  ? LYS N 840  . ? 1_555 ? 
53 AD3 4 HOH UA .    ? HOH N 2102 . ? 1_555 ? 
54 AD3 4 HOH UA .    ? HOH N 2103 . ? 1_555 ? 
55 AD4 4 CYS L  1112 ? CYS N 1112 . ? 1_555 ? 
56 AD4 4 CYS L  1194 ? CYS N 1194 . ? 1_555 ? 
57 AD4 4 CYS L  1201 ? CYS N 1201 . ? 1_555 ? 
58 AD4 4 CYS L  1204 ? CYS N 1204 . ? 1_555 ? 
59 AD5 4 CYS L  58   ? CYS N 58   . ? 1_555 ? 
60 AD5 4 CYS L  60   ? CYS N 60   . ? 1_555 ? 
61 AD5 4 CYS L  73   ? CYS N 73   . ? 1_555 ? 
62 AD5 4 CYS L  76   ? CYS N 76   . ? 1_555 ? 
63 AD6 4 ASP L  739  ? ASP N 739  . ? 1_555 ? 
64 AD6 4 ASP L  741  ? ASP N 741  . ? 1_555 ? 
65 AD6 4 ASP L  743  ? ASP N 743  . ? 1_555 ? 
66 AD6 4 C   GA .    ? C   N 1605 . ? 1_555 ? 
67 AD7 8 LYS K  838  ? LYS M 838  . ? 1_555 ? 
68 AD7 8 LYS K  846  ? LYS M 846  . ? 1_555 ? 
69 AD7 8 ARG L  704  ? ARG N 704  . ? 1_555 ? 
70 AD7 8 ASP L  741  ? ASP N 741  . ? 1_555 ? 
71 AD7 8 ASP L  743  ? ASP N 743  . ? 1_555 ? 
72 AD7 8 MG  FA .    ? MG  N 1604 . ? 1_555 ? 
73 AD7 8 DG  O  14   ? DG  R 14   . ? 1_555 ? 
74 AD7 8 DT  O  15   ? DT  R 15   . ? 1_555 ? 
75 AD8 4 ARG K  879  ? ARG M 879  . ? 1_555 ? 
76 AD8 4 ASP L  739  ? ASP N 739  . ? 1_555 ? 
77 AD8 4 ARG L  1029 ? ARG N 1029 . ? 1_555 ? 
78 AD8 4 MG  IA .    ? MG  N 1607 . ? 1_555 ? 
79 AD9 3 ASP K  686  ? ASP M 686  . ? 1_555 ? 
80 AD9 3 ASP L  739  ? ASP N 739  . ? 1_555 ? 
81 AD9 3 CTP HA .    ? CTP N 1606 . ? 1_555 ? 
82 AE1 3 ALA N  312  ? ALA P 292  . ? 1_555 ? 
83 AE1 3 GLY N  316  ? GLY P 296  . ? 1_555 ? 
84 AE1 3 TRP N  319  ? TRP P 299  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5D4C 
_atom_sites.fract_transf_matrix[1][1]   0.005378 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000784 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009649 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003398 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1  4    ? 31.766  17.521  145.302  1.00 60.38  ? 4    SER A N     1 
ATOM   2     C  CA    . SER A  1  4    ? 31.651  16.467  144.297  1.00 75.98  ? 4    SER A CA    1 
ATOM   3     C  C     . SER A  1  4    ? 32.812  16.519  143.308  1.00 71.38  ? 4    SER A C     1 
ATOM   4     O  O     . SER A  1  4    ? 32.908  15.695  142.398  1.00 68.58  ? 4    SER A O     1 
ATOM   5     C  CB    . SER A  1  4    ? 30.317  16.575  143.553  1.00 74.23  ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A  1  4    ? 30.175  15.536  142.598  1.00 58.84  ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A  1  5    ? 33.691  17.497  143.494  1.00 71.10  ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A  1  5    ? 34.859  17.655  142.637  1.00 66.66  ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A  1  5    ? 36.018  16.794  143.129  1.00 68.33  ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A  1  5    ? 36.415  16.875  144.293  1.00 66.31  ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A  1  5    ? 35.281  19.125  142.586  1.00 73.06  ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A  1  5    ? 36.582  19.388  141.841  1.00 65.14  ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A  1  5    ? 36.424  19.196  140.342  1.00 59.87  ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A  1  5    ? 37.721  19.508  139.610  1.00 62.07  ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A  1  5    ? 38.180  20.907  139.843  1.00 49.53  ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A  1  6    ? 36.550  15.966  142.235  1.00 61.76  ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A  1  6    ? 37.724  15.158  142.534  1.00 51.08  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A  1  6    ? 38.904  16.092  142.785  1.00 51.15  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A  1  6    ? 38.980  17.167  142.193  1.00 58.01  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A  1  6    ? 38.023  14.226  141.358  1.00 49.14  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A  1  6    ? 38.453  12.779  141.624  1.00 49.12  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A  1  6    ? 39.854  12.709  142.205  1.00 50.38  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A  1  6    ? 37.461  12.082  142.537  1.00 54.67  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A  1  7    ? 39.822  15.689  143.659  1.00 44.50  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A  1  7    ? 40.987  16.516  143.966  1.00 41.52  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A  1  7    ? 42.258  15.866  143.426  1.00 36.46  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A  1  7    ? 42.204  14.779  142.853  1.00 34.63  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A  1  7    ? 41.103  16.749  145.476  1.00 50.03  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A  1  7    ? 39.989  17.601  146.081  1.00 56.78  ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A  1  7    ? 40.278  19.095  145.967  1.00 64.16  ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A  1  7    ? 39.229  19.924  146.707  1.00 65.11  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A  1  7    ? 39.600  21.368  146.825  1.00 48.13  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A  1  8    ? 43.396  16.531  143.614  1.00 39.99  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A  1  8    ? 44.665  16.087  143.033  1.00 33.19  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A  1  8    ? 45.003  14.644  143.399  1.00 35.97  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A  1  8    ? 45.079  14.296  144.576  1.00 43.71  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A  1  8    ? 45.798  17.022  143.434  1.00 28.25  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A  1  9    ? 45.196  13.799  142.376  1.00 40.12  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A  1  9    ? 45.452  12.363  142.513  1.00 33.82  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A  1  9    ? 46.889  12.051  142.906  1.00 28.17  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A  1  9    ? 47.790  12.858  142.673  1.00 25.46  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A  1  9    ? 45.181  11.836  141.105  1.00 31.92  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A  1  9    ? 45.565  12.967  140.223  1.00 35.70  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A  1  9    ? 45.156  14.214  140.963  1.00 40.30  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A  1  10   ? 47.092  10.876  143.493  1.00 29.03  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A  1  10   ? 48.426  10.417  143.849  1.00 34.58  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A  1  10   ? 49.202  9.968   142.605  1.00 36.36  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A  1  10   ? 48.645  9.336   141.688  1.00 35.00  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A  1  10   ? 48.391  9.304   144.933  1.00 28.93  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A  1  10   ? 47.685  8.057   144.422  1.00 33.33  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A  1  10   ? 49.796  8.968   145.407  1.00 33.15  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A  1  11   ? 50.485  10.324  142.588  1.00 35.29  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A  1  11   ? 51.377  10.065  141.466  1.00 34.49  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A  1  11   ? 52.525  9.158   141.892  1.00 37.52  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A  1  11   ? 53.386  9.556   142.675  1.00 43.30  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A  1  11   ? 51.924  11.389  140.932  1.00 38.14  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A  1  11   ? 53.025  11.233  139.920  1.00 40.56  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A  1  11   ? 52.834  10.485  138.771  1.00 37.47  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A  1  11   ? 54.248  11.855  140.111  1.00 48.31  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A  1  11   ? 53.844  10.352  137.837  1.00 42.08  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A  1  11   ? 55.263  11.727  139.181  1.00 42.02  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A  1  11   ? 55.061  10.975  138.043  1.00 42.82  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A  1  12   ? 52.533  7.941   141.359  1.00 35.35  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A  1  12   ? 53.508  6.925   141.739  1.00 36.38  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A  1  12   ? 54.572  6.752   140.659  1.00 31.47  ? 12   THR A C     1 
ATOM   66    O  O     . THR A  1  12   ? 54.278  6.862   139.471  1.00 36.19  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A  1  12   ? 52.813  5.574   141.978  1.00 42.06  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A  1  12   ? 51.633  5.779   142.767  1.00 45.79  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A  1  12   ? 53.745  4.600   142.689  1.00 43.64  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A  1  13   ? 55.807  6.487   141.073  1.00 27.77  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A  1  13   ? 56.909  6.316   140.133  1.00 23.96  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A  1  13   ? 57.676  5.029   140.400  1.00 26.55  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A  1  13   ? 58.241  4.848   141.478  1.00 33.82  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A  1  13   ? 57.904  7.493   140.202  1.00 24.90  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A  1  13   ? 59.091  7.235   139.291  1.00 26.95  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A  1  13   ? 57.220  8.798   139.835  1.00 31.89  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A  1  14   ? 57.691  4.137   139.415  1.00 26.63  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A  1  14   ? 58.497  2.923   139.489  1.00 29.25  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A  1  14   ? 59.573  2.966   138.409  1.00 30.78  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A  1  14   ? 59.287  3.307   137.267  1.00 35.51  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A  1  14   ? 57.619  1.682   139.317  1.00 28.38  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A  1  14   ? 56.621  1.475   140.445  1.00 30.47  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A  1  14   ? 55.878  0.155   140.306  1.00 30.11  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A  1  14   ? 54.806  0.211   139.314  1.00 30.66  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A  1  14   ? 53.529  0.452   139.603  1.00 33.77  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A  1  14   ? 53.156  0.669   140.857  1.00 32.99  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A  1  14   ? 52.620  0.478   138.636  1.00 35.77  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A  1  15   ? 60.813  2.643   138.766  1.00 35.91  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A  1  15   ? 61.911  2.687   137.799  1.00 42.56  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A  1  15   ? 62.844  1.480   137.904  1.00 49.49  ? 15   THR A C     1 
ATOM   91    O  O     . THR A  1  15   ? 63.212  1.061   139.004  1.00 55.40  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A  1  15   ? 62.763  3.977   137.940  1.00 37.22  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A  1  15   ? 63.425  3.983   139.211  1.00 41.62  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A  1  15   ? 61.902  5.229   137.811  1.00 28.90  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A  1  16   ? 63.215  0.922   136.754  1.00 49.95  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A  1  16   ? 64.271  -0.082  136.689  1.00 49.56  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A  1  16   ? 65.383  0.436   135.787  1.00 45.81  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A  1  16   ? 65.222  0.497   134.569  1.00 46.69  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A  1  16   ? 63.730  -1.397  136.126  1.00 48.29  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A  1  16   ? 62.507  -1.934  136.850  1.00 64.76  ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A  1  16   ? 61.965  -3.197  136.210  1.00 75.23  ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A  1  16   ? 62.549  -3.722  135.261  1.00 75.24  ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A  1  16   ? 60.842  -3.692  136.724  1.00 66.17  ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A  1  17   ? 66.520  0.781   136.382  1.00 48.14  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A  1  17   ? 67.621  1.355   135.629  1.00 55.37  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A  1  17   ? 67.237  2.641   134.916  1.00 47.94  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A  1  17   ? 66.265  3.304   135.286  1.00 41.81  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A  1  18   ? 68.010  3.002   133.896  1.00 38.13  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A  1  18   ? 67.703  4.172   133.084  1.00 40.05  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A  1  18   ? 66.913  3.774   131.838  1.00 49.15  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A  1  18   ? 66.512  4.628   131.047  1.00 50.67  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A  1  18   ? 68.993  4.882   132.671  1.00 46.13  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A  1  18   ? 69.910  5.250   133.827  1.00 44.87  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A  1  18   ? 71.198  5.907   133.337  1.00 38.64  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A  1  18   ? 70.946  7.160   132.629  1.00 41.85  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A  1  18   ? 70.869  8.349   133.218  1.00 49.25  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A  1  18   ? 71.026  8.451   134.530  1.00 49.27  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A  1  18   ? 70.634  9.439   132.495  1.00 47.86  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A  1  19   ? 66.700  2.472   131.670  1.00 49.41  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A  1  19   ? 66.062  1.930   130.470  1.00 48.53  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A  1  19   ? 64.534  2.014   130.481  1.00 45.83  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A  1  19   ? 63.910  2.306   129.461  1.00 42.93  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A  1  19   ? 66.485  0.471   130.257  1.00 50.67  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A  1  19   ? 67.979  0.200   130.428  1.00 65.39  ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A  1  19   ? 68.800  0.519   129.188  1.00 73.63  ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A  1  19   ? 68.477  1.501   128.484  1.00 79.73  ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A  1  19   ? 69.771  -0.220  128.915  1.00 64.76  ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A  1  20   ? 63.937  1.746   131.638  1.00 44.96  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A  1  20   ? 62.499  1.519   131.722  1.00 33.00  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A  1  20   ? 61.857  2.277   132.879  1.00 30.23  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A  1  20   ? 62.499  2.539   133.895  1.00 34.56  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A  1  20   ? 62.242  0.018   131.870  1.00 29.68  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A  1  20   ? 60.796  -0.367  132.059  1.00 27.04  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A  1  20   ? 59.866  -0.157  131.052  1.00 30.75  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A  1  20   ? 60.364  -0.959  133.237  1.00 29.82  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A  1  20   ? 58.543  -0.513  131.216  1.00 30.19  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A  1  20   ? 59.043  -1.322  133.411  1.00 32.34  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A  1  20   ? 58.137  -1.096  132.396  1.00 31.28  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A  1  20   ? 56.819  -1.455  132.557  1.00 30.24  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A  1  21   ? 60.588  2.635   132.719  1.00 29.17  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A  1  21   ? 59.860  3.302   133.782  1.00 28.87  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A  1  21   ? 58.355  3.129   133.710  1.00 27.63  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A  1  21   ? 57.792  2.899   132.639  1.00 33.56  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A  1  22   ? 57.708  3.252   134.865  1.00 28.52  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A  1  22   ? 56.257  3.188   134.977  1.00 28.10  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A  1  22   ? 55.783  4.351   135.828  1.00 23.91  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A  1  22   ? 56.349  4.625   136.884  1.00 27.40  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A  1  22   ? 55.815  1.876   135.623  1.00 25.67  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A  1  22   ? 56.140  0.639   134.815  1.00 29.56  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A  1  22   ? 55.567  -0.618  135.437  1.00 36.31  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A  1  22   ? 55.037  -0.528  136.564  1.00 41.95  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A  1  22   ? 55.642  -1.693  134.803  1.00 33.85  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A  1  23   ? 54.749  5.042   135.370  1.00 19.31  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A  1  23   ? 54.280  6.222   136.074  1.00 20.42  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A  1  23   ? 52.770  6.183   136.239  1.00 24.84  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A  1  23   ? 52.033  6.242   135.263  1.00 27.63  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A  1  23   ? 54.720  7.477   135.323  1.00 24.02  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A  1  23   ? 56.201  7.530   135.064  1.00 30.70  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A  1  23   ? 56.749  6.899   133.958  1.00 32.08  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A  1  23   ? 57.046  8.195   135.935  1.00 35.12  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A  1  23   ? 58.109  6.933   133.723  1.00 30.52  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A  1  23   ? 58.407  8.238   135.702  1.00 37.07  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A  1  23   ? 58.938  7.605   134.594  1.00 37.23  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A  1  24   ? 52.313  6.096   137.482  1.00 27.08  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A  1  24   ? 50.889  5.945   137.755  1.00 26.38  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A  1  24   ? 50.267  7.246   138.252  1.00 26.33  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A  1  24   ? 50.884  7.996   138.998  1.00 33.62  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A  1  24   ? 50.629  4.819   138.781  1.00 27.70  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A  1  24   ? 49.139  4.524   138.891  1.00 27.67  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A  1  24   ? 51.381  3.562   138.387  1.00 27.67  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A  1  25   ? 49.047  7.515   137.809  1.00 21.42  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A  1  25   ? 48.281  8.641   138.302  1.00 18.90  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A  1  25   ? 46.897  8.114   138.638  1.00 25.98  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A  1  25   ? 46.174  7.655   137.743  1.00 28.47  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A  1  25   ? 48.182  9.707   137.218  1.00 19.41  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A  1  25   ? 48.184  11.160  137.679  1.00 26.68  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A  1  25   ? 49.554  11.531  138.202  1.00 26.42  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A  1  25   ? 47.775  12.077  136.541  1.00 33.64  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A  1  26   ? 46.538  8.134   139.923  1.00 34.01  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A  1  26   ? 45.200  7.683   140.329  1.00 30.03  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A  1  26   ? 44.650  8.377   141.574  1.00 26.26  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A  1  26   ? 45.413  8.794   142.435  1.00 28.46  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A  1  26   ? 45.174  6.166   140.530  1.00 29.33  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A  1  26   ? 45.946  5.677   141.740  1.00 33.59  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A  1  26   ? 45.652  4.222   142.057  1.00 51.59  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A  1  26   ? 44.578  3.729   141.643  1.00 38.74  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A  1  26   ? 46.494  3.573   142.715  1.00 61.68  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A  1  27   ? 43.317  8.495   141.679  1.00 23.65  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A  1  27   ? 42.306  8.282   140.639  1.00 25.29  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A  1  27   ? 42.139  9.506   139.738  1.00 31.35  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A  1  27   ? 42.385  10.633  140.174  1.00 29.69  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A  1  27   ? 41.032  8.047   141.446  1.00 26.30  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A  1  27   ? 41.231  8.861   142.666  1.00 31.70  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A  1  27   ? 42.699  8.786   142.985  1.00 25.64  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A  1  28   ? 41.711  9.281   138.499  1.00 31.11  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A  1  28   ? 41.385  10.367  137.581  1.00 26.53  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A  1  28   ? 39.921  10.265  137.171  1.00 25.07  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A  1  28   ? 39.326  9.190   137.243  1.00 24.91  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A  1  28   ? 42.281  10.316  136.341  1.00 26.72  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A  1  28   ? 43.747  10.727  136.500  1.00 27.12  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A  1  28   ? 44.526  10.454  135.223  1.00 23.84  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A  1  28   ? 43.849  12.195  136.880  1.00 35.28  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A  1  29   ? 39.343  11.379  136.734  1.00 25.46  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A  1  29   ? 37.948  11.386  136.309  1.00 29.78  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A  1  29   ? 37.768  10.481  135.099  1.00 31.01  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A  1  29   ? 38.726  10.206  134.379  1.00 34.52  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A  1  29   ? 37.486  12.808  135.980  1.00 35.43  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A  1  29   ? 37.139  13.663  137.195  1.00 51.67  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A  1  29   ? 35.806  13.286  137.829  1.00 64.03  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A  1  29   ? 35.069  12.464  137.241  1.00 61.43  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A  1  29   ? 35.493  13.817  138.918  1.00 61.65  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A  1  30   ? 36.546  10.006  134.889  1.00 29.55  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A  1  30   ? 36.259  9.088   133.791  1.00 31.23  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A  1  30   ? 36.673  9.660   132.438  1.00 34.69  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A  1  30   ? 36.296  10.778  132.080  1.00 36.20  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A  1  30   ? 34.773  8.728   133.773  1.00 44.01  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A  1  30   ? 34.353  7.865   132.591  1.00 50.80  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A  1  30   ? 32.861  7.569   132.626  1.00 49.37  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A  1  30   ? 32.049  8.769   132.448  1.00 53.70  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A  1  30   ? 31.392  9.067   131.331  1.00 51.03  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A  1  30   ? 31.445  8.246   130.291  1.00 39.16  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A  1  30   ? 30.676  10.182  131.256  1.00 51.77  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A  1  31   ? 37.458  8.887   131.696  1.00 33.68  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A  1  31   ? 37.884  9.284   130.367  1.00 31.30  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A  1  31   ? 39.201  10.037  130.332  1.00 28.64  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A  1  31   ? 39.828  10.145  129.279  1.00 29.67  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A  1  32   ? 39.628  10.557  131.479  1.00 29.49  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A  1  32   ? 40.859  11.342  131.540  1.00 23.59  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A  1  32   ? 42.113  10.490  131.436  1.00 21.51  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A  1  32   ? 43.215  11.018  131.268  1.00 24.59  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A  1  32   ? 40.906  12.197  132.804  1.00 23.24  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A  1  32   ? 40.321  13.561  132.624  1.00 27.45  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A  1  32   ? 38.956  13.760  132.722  1.00 29.12  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A  1  32   ? 41.137  14.646  132.345  1.00 26.31  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A  1  32   ? 38.413  15.015  132.553  1.00 28.17  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A  1  32   ? 40.600  15.909  132.174  1.00 24.25  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A  1  32   ? 39.236  16.094  132.279  1.00 25.82  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A  1  33   ? 41.944  9.176   131.540  1.00 19.06  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A  1  33   ? 43.054  8.263   131.354  1.00 20.36  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A  1  33   ? 43.635  8.465   129.972  1.00 15.73  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A  1  33   ? 44.846  8.603   129.805  1.00 14.96  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A  1  34   ? 42.753  8.510   128.982  1.00 18.05  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A  1  34   ? 43.152  8.738   127.601  1.00 19.11  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A  1  34   ? 43.506  10.206  127.359  1.00 18.61  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A  1  34   ? 44.509  10.510  126.712  1.00 18.92  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A  1  34   ? 42.043  8.303   126.624  1.00 15.28  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A  1  34   ? 42.443  8.599   125.190  1.00 15.65  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A  1  34   ? 41.731  6.824   126.806  1.00 14.99  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A  1  35   ? 42.681  11.104  127.890  1.00 16.90  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A  1  35   ? 42.879  12.543  127.731  1.00 15.98  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A  1  35   ? 44.284  12.987  128.141  1.00 16.43  ? 35   THR A C     1 
ATOM   252   O  O     . THR A  1  35   ? 44.911  13.796  127.461  1.00 15.80  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A  1  35   ? 41.845  13.341  128.548  1.00 16.97  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A  1  35   ? 40.536  12.809  128.314  1.00 16.02  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A  1  35   ? 41.874  14.812  128.161  1.00 16.05  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A  1  36   ? 44.768  12.471  129.265  1.00 17.05  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A  1  36   ? 46.140  12.733  129.684  1.00 16.79  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A  1  36   ? 47.152  11.827  128.991  1.00 18.45  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A  1  36   ? 48.226  12.273  128.589  1.00 17.08  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A  1  36   ? 46.281  12.595  131.199  1.00 17.84  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A  1  36   ? 45.853  13.816  132.006  1.00 24.74  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A  1  36   ? 46.221  13.637  133.470  1.00 33.55  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A  1  36   ? 46.493  15.070  131.433  1.00 27.34  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A  1  37   ? 46.803  10.551  128.863  1.00 22.19  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A  1  37   ? 47.740  9.548   128.388  1.00 20.57  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A  1  37   ? 48.188  9.717   126.951  1.00 20.08  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A  1  37   ? 49.384  9.804   126.672  1.00 21.79  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A  1  38   ? 47.226  9.776   126.038  1.00 15.53  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A  1  38   ? 47.533  9.800   124.611  1.00 14.87  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A  1  38   ? 48.430  10.939  124.103  1.00 14.63  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A  1  38   ? 49.387  10.675  123.378  1.00 16.78  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A  1  38   ? 46.258  9.697   123.772  1.00 19.18  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A  1  38   ? 46.548  9.423   122.311  1.00 20.64  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A  1  38   ? 47.034  8.347   121.954  1.00 17.15  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A  1  38   ? 46.248  10.394  121.456  1.00 20.50  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A  1  39   ? 48.129  12.201  124.468  1.00 13.38  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A  1  39   ? 48.991  13.278  123.970  1.00 12.94  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A  1  39   ? 50.410  13.130  124.495  1.00 15.46  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A  1  39   ? 51.367  13.438  123.786  1.00 14.64  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A  1  39   ? 48.356  14.541  124.557  1.00 10.61  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A  1  39   ? 46.988  14.159  124.904  1.00 10.36  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A  1  39   ? 47.034  12.728  125.296  1.00 16.14  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A  1  40   ? 50.538  12.657  125.729  1.00 15.48  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A  1  40   ? 51.853  12.421  126.307  1.00 19.74  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A  1  40   ? 52.607  11.361  125.515  1.00 20.39  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A  1  40   ? 53.798  11.510  125.254  1.00 24.64  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A  1  40   ? 51.748  12.021  127.779  1.00 21.00  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A  1  40   ? 51.564  13.171  128.767  1.00 19.71  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A  1  40   ? 51.577  12.649  130.191  1.00 19.40  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A  1  40   ? 52.642  14.226  128.565  1.00 18.14  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A  1  41   ? 51.910  10.298  125.126  1.00 16.19  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A  1  41   ? 52.524  9.247   124.324  1.00 15.61  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A  1  41   ? 53.031  9.812   123.007  1.00 15.19  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A  1  41   ? 54.138  9.503   122.573  1.00 18.71  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A  1  41   ? 51.532  8.117   124.047  1.00 17.58  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A  1  41   ? 52.081  7.051   123.110  1.00 17.72  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A  1  41   ? 51.037  6.010   122.760  1.00 18.59  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A  1  41   ? 51.613  4.907   121.997  1.00 20.85  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A  1  41   ? 51.753  4.902   120.675  1.00 22.37  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A  1  41   ? 51.362  5.949   119.959  1.00 20.37  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A  1  41   ? 52.291  3.852   120.070  1.00 21.46  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A  1  42   ? 52.214  10.649  122.379  1.00 13.57  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A  1  42   ? 52.570  11.238  121.096  1.00 16.26  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A  1  42   ? 53.800  12.135  121.212  1.00 18.61  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A  1  42   ? 54.733  12.030  120.414  1.00 19.32  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A  1  42   ? 51.382  12.011  120.515  1.00 16.23  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A  1  42   ? 50.169  11.136  120.224  1.00 13.91  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A  1  42   ? 49.015  11.943  119.657  1.00 14.28  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A  1  42   ? 49.396  12.662  118.446  1.00 13.01  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A  1  42   ? 49.408  12.121  117.234  1.00 14.35  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A  1  42   ? 49.062  10.854  117.072  1.00 18.80  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A  1  42   ? 49.768  12.844  116.184  1.00 19.08  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A  1  43   ? 53.803  13.006  122.216  1.00 17.30  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A  1  43   ? 54.924  13.911  122.431  1.00 15.20  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A  1  43   ? 56.195  13.144  122.788  1.00 17.51  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A  1  43   ? 57.292  13.518  122.376  1.00 21.22  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A  1  43   ? 54.596  14.953  123.511  1.00 14.62  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A  1  43   ? 53.374  15.768  123.086  1.00 18.62  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A  1  43   ? 55.777  15.876  123.746  1.00 19.53  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A  1  43   ? 52.971  16.836  124.068  1.00 20.96  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A  1  44   ? 56.036  12.055  123.534  1.00 17.59  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A  1  44   ? 57.165  11.210  123.914  1.00 17.49  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A  1  44   ? 57.793  10.490  122.724  1.00 19.65  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A  1  44   ? 59.012  10.340  122.656  1.00 25.42  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A  1  44   ? 56.738  10.182  124.961  1.00 17.36  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A  1  44   ? 56.620  10.683  126.400  1.00 20.45  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A  1  44   ? 55.783  9.720   127.215  1.00 19.82  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A  1  44   ? 57.994  10.863  127.024  1.00 20.68  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A  1  45   ? 56.960  10.047  121.789  1.00 16.99  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A  1  45   ? 57.441  9.273   120.650  1.00 14.62  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A  1  45   ? 58.037  10.145  119.552  1.00 20.53  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A  1  45   ? 58.754  9.652   118.682  1.00 25.11  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A  1  45   ? 56.313  8.418   120.073  1.00 14.37  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A  1  45   ? 55.920  7.186   120.889  1.00 15.69  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A  1  45   ? 54.704  6.508   120.293  1.00 11.57  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A  1  45   ? 57.083  6.210   120.981  1.00 17.34  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A  1  46   ? 57.755  11.442  119.602  1.00 24.02  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A  1  46   ? 58.151  12.349  118.527  1.00 23.25  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A  1  46   ? 59.113  13.462  118.957  1.00 29.59  ? 46   SER A C     1 
ATOM   340   O  O     . SER A  1  46   ? 60.243  13.539  118.470  1.00 34.05  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A  1  46   ? 56.912  12.953  117.860  1.00 17.83  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A  1  46   ? 56.077  13.587  118.814  1.00 16.83  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A  1  47   ? 58.655  14.322  119.863  1.00 23.76  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A  1  47   ? 59.327  15.591  120.142  1.00 24.76  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A  1  47   ? 60.390  15.583  121.248  1.00 24.21  ? 47   SER A C     1 
ATOM   346   O  O     . SER A  1  47   ? 60.904  16.639  121.621  1.00 22.11  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A  1  47   ? 58.290  16.685  120.412  1.00 26.47  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A  1  47   ? 57.485  16.904  119.265  1.00 23.91  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A  1  48   ? 60.707  14.408  121.783  1.00 25.27  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A  1  48   ? 61.735  14.305  122.819  1.00 27.97  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A  1  48   ? 63.151  14.355  122.245  1.00 30.02  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A  1  48   ? 63.544  13.475  121.478  1.00 34.81  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A  1  48   ? 61.585  13.016  123.643  1.00 28.12  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A  1  48   ? 60.258  13.025  124.402  1.00 24.98  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A  1  48   ? 62.743  12.872  124.612  1.00 29.23  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A  1  48   ? 60.070  14.237  125.283  1.00 25.70  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A  1  49   ? 63.925  15.387  122.625  1.00 25.80  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A  1  49   ? 65.299  15.583  122.145  1.00 27.50  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A  1  49   ? 66.227  14.445  122.561  1.00 29.49  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A  1  49   ? 65.925  13.728  123.514  1.00 34.07  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A  1  49   ? 65.725  16.886  122.830  1.00 22.83  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A  1  49   ? 64.448  17.583  123.152  1.00 24.63  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A  1  49   ? 63.490  16.488  123.499  1.00 26.61  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A  1  50   ? 67.344  14.294  121.855  1.00 27.45  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A  1  50   ? 68.287  13.225  122.129  1.00 28.53  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A  1  50   ? 69.554  13.343  121.303  1.00 31.01  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A  1  50   ? 69.860  14.410  120.767  1.00 29.76  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A  1  51   ? 70.301  12.246  121.207  1.00 32.31  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A  1  51   ? 71.542  12.231  120.435  1.00 38.35  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A  1  51   ? 71.619  11.061  119.450  1.00 38.39  ? 51   THR A C     1 
ATOM   371   O  O     . THR A  1  51   ? 71.038  9.997   119.679  1.00 36.28  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A  1  51   ? 72.784  12.206  121.352  1.00 37.29  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A  1  51   ? 72.734  11.053  122.202  1.00 37.20  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A  1  51   ? 72.846  13.464  122.206  1.00 37.28  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A  1  52   ? 72.341  11.274  118.352  1.00 34.54  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A  1  52   ? 72.537  10.251  117.327  1.00 31.44  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A  1  52   ? 73.805  10.543  116.533  1.00 24.09  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A  1  52   ? 74.316  11.660  116.573  1.00 30.74  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A  1  52   ? 71.337  10.193  116.402  1.00 37.34  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A  1  53   ? 74.307  9.552   115.802  1.00 19.64  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A  1  53   ? 75.530  9.746   115.035  1.00 20.29  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A  1  53   ? 75.167  10.394  113.714  1.00 20.78  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A  1  53   ? 74.487  9.790   112.888  1.00 26.73  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A  1  53   ? 76.217  8.400   114.735  1.00 22.15  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A  1  53   ? 77.390  8.596   113.793  1.00 22.24  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A  1  53   ? 76.666  7.730   116.021  1.00 28.39  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A  1  54   ? 75.617  11.627  113.515  1.00 20.64  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A  1  54   ? 75.261  12.359  112.305  1.00 23.80  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A  1  54   ? 76.287  12.281  111.171  1.00 28.52  ? 54   THR A C     1 
ATOM   390   O  O     . THR A  1  54   ? 75.976  12.654  110.038  1.00 31.36  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A  1  54   ? 74.948  13.836  112.612  1.00 21.14  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A  1  54   ? 76.167  14.552  112.833  1.00 25.51  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A  1  54   ? 74.068  13.945  113.843  1.00 21.51  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A  1  55   ? 77.495  11.792  111.455  1.00 28.58  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A  1  55   ? 78.500  11.657  110.388  1.00 23.22  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A  1  55   ? 79.561  10.591  110.666  1.00 22.11  ? 55   SER A C     1 
ATOM   397   O  O     . SER A  1  55   ? 79.848  10.281  111.815  1.00 28.50  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A  1  55   ? 79.171  13.005  110.104  1.00 24.32  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A  1  55   ? 80.031  12.919  108.983  1.00 22.70  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A  1  56   ? 80.147  10.028  109.614  1.00 20.73  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A  1  56   ? 81.214  9.040   109.786  1.00 25.43  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A  1  56   ? 82.337  9.229   108.773  1.00 28.51  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A  1  56   ? 82.093  9.275   107.570  1.00 30.92  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A  1  56   ? 80.692  7.586   109.654  1.00 30.03  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A  1  56   ? 81.855  6.601   109.612  1.00 25.29  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A  1  56   ? 79.742  7.238   110.789  1.00 30.13  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A  1  57   ? 83.570  9.332   109.259  1.00 30.22  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A  1  57   ? 84.727  9.307   108.374  1.00 29.63  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A  1  57   ? 85.568  8.075   108.647  1.00 31.18  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A  1  57   ? 85.872  7.767   109.797  1.00 37.20  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A  1  57   ? 85.593  10.555  108.540  1.00 30.33  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A  1  57   ? 86.966  10.414  107.909  1.00 34.35  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A  1  57   ? 87.127  10.465  106.530  1.00 40.78  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A  1  57   ? 88.097  10.225  108.692  1.00 38.09  ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A  1  57   ? 88.378  10.338  105.948  1.00 42.04  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A  1  57   ? 89.353  10.094  108.120  1.00 42.34  ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A  1  57   ? 89.487  10.152  106.748  1.00 45.32  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A  1  57   ? 90.733  10.021  106.174  1.00 42.33  ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A  1  58   ? 85.936  7.366   107.587  1.00 30.06  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A  1  58   ? 86.855  6.246   107.717  1.00 33.91  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A  1  58   ? 88.077  6.517   106.857  1.00 38.41  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A  1  58   ? 87.955  7.015   105.738  1.00 44.11  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A  1  58   ? 86.211  4.912   107.296  1.00 33.21  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A  1  58   ? 84.911  4.680   108.067  1.00 29.85  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A  1  58   ? 87.175  3.759   107.527  1.00 29.46  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A  1  58   ? 84.251  3.351   107.766  1.00 26.45  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A  1  59   ? 89.253  6.205   107.391  1.00 38.17  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A  1  59   ? 90.496  6.425   106.669  1.00 41.12  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A  1  59   ? 90.567  5.506   105.453  1.00 43.18  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A  1  59   ? 90.220  4.325   105.535  1.00 40.51  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A  1  59   ? 91.698  6.202   107.590  1.00 48.55  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A  1  59   ? 93.033  6.625   106.988  1.00 64.97  ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A  1  59   ? 94.202  6.429   107.939  1.00 60.60  ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A  1  59   ? 93.969  6.342   109.165  1.00 55.19  ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A  1  59   ? 95.354  6.359   107.457  1.00 55.20  ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A  1  60   ? 91.001  6.069   104.328  1.00 44.63  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A  1  60   ? 91.142  5.339   103.066  1.00 47.76  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A  1  60   ? 89.812  4.806   102.526  1.00 42.36  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A  1  60   ? 89.785  3.844   101.759  1.00 45.33  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A  1  60   ? 92.175  4.208   103.192  1.00 52.77  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A  1  60   ? 93.577  4.722   103.497  1.00 65.04  ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A  1  60   ? 93.932  5.820   103.013  1.00 67.05  ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A  1  60   ? 94.326  4.029   104.220  1.00 64.52  ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A  1  61   ? 88.715  5.445   102.921  1.00 40.63  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A  1  61   ? 87.388  5.091   102.423  1.00 32.11  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A  1  61   ? 86.716  6.317   101.807  1.00 35.85  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A  1  61   ? 86.473  7.316   102.487  1.00 32.99  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A  1  61   ? 86.496  4.494   103.533  1.00 27.66  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A  1  61   ? 85.062  4.364   103.053  1.00 26.74  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A  1  61   ? 87.033  3.144   103.971  1.00 31.30  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A  1  62   ? 86.441  6.233   100.508  1.00 36.00  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A  1  62   ? 85.927  7.363   99.739   1.00 30.82  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A  1  62   ? 84.419  7.586   99.871   1.00 26.34  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A  1  62   ? 83.959  8.727   99.941   1.00 28.07  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A  1  62   ? 86.313  7.206   98.266   1.00 24.79  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A  1  62   ? 87.787  6.874   98.036   1.00 19.76  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A  1  62   ? 88.083  6.739   96.553   1.00 23.06  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A  1  62   ? 88.669  7.933   98.669   1.00 27.70  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A  1  63   ? 83.652  6.500   99.890   1.00 23.56  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A  1  63   ? 82.198  6.607   99.917   1.00 27.13  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A  1  63   ? 81.543  5.432   100.628  1.00 27.98  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A  1  63   ? 82.223  4.502   101.061  1.00 27.81  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A  1  63   ? 81.654  6.721   98.498   1.00 26.75  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A  1  63   ? 82.199  5.690   97.561   1.00 23.20  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A  1  63   ? 81.892  4.352   97.665   1.00 17.86  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A  1  63   ? 83.039  5.804   96.506   1.00 27.48  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A  1  63   ? 82.516  3.686   96.708   1.00 22.58  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A  1  63   ? 83.221  4.543   95.994   1.00 22.81  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A  1  64   ? 80.216  5.467   100.718  1.00 25.07  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A  1  64   ? 79.487  4.520   101.554  1.00 24.62  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A  1  64   ? 79.542  3.071   101.065  1.00 26.36  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A  1  64   ? 79.483  2.143   101.874  1.00 25.75  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A  1  64   ? 78.036  4.968   101.776  1.00 25.23  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A  1  64   ? 77.271  4.079   102.755  1.00 31.53  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A  1  64   ? 76.018  4.729   103.310  1.00 49.05  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A  1  64   ? 75.825  5.947   103.095  1.00 54.04  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A  1  64   ? 75.229  4.015   103.968  1.00 44.41  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A  1  65   ? 79.689  2.861   99.760   1.00 28.94  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A  1  65   ? 79.686  1.489   99.270   1.00 27.65  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A  1  65   ? 81.128  1.065   99.055   1.00 25.51  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A  1  65   ? 81.709  1.310   98.002   1.00 20.58  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A  1  65   ? 78.935  1.424   97.938   1.00 21.06  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A  1  65   ? 77.740  2.338   97.868   1.00 18.22  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A  1  65   ? 77.880  3.659   97.467   1.00 18.75  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A  1  65   ? 76.476  1.876   98.198   1.00 18.92  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A  1  65   ? 76.784  4.502   97.405   1.00 21.16  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A  1  65   ? 75.374  2.713   98.135   1.00 17.82  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A  1  65   ? 75.529  4.027   97.738   1.00 21.15  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A  1  66   ? 81.663  0.334   100.028  1.00 24.85  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A  1  66   ? 83.092  0.053   100.088  1.00 23.26  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A  1  66   ? 83.372  -1.146  100.978  1.00 25.92  ? 66   SER A C     1 
ATOM   492   O  O     . SER A  1  66   ? 82.538  -1.534  101.797  1.00 26.98  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A  1  66   ? 83.863  1.262   100.629  1.00 22.97  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A  1  66   ? 83.653  2.426   99.849   1.00 27.85  ? 66   SER A OG    1 
ATOM   495   N  N     . THR A  1  67   ? 84.558  -1.720  100.822  1.00 25.98  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A  1  67   ? 85.013  -2.792  101.693  1.00 26.40  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A  1  67   ? 86.436  -2.496  102.126  1.00 34.99  ? 67   THR A C     1 
ATOM   498   O  O     . THR A  1  67   ? 87.315  -2.295  101.287  1.00 42.35  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A  1  67   ? 85.006  -4.146  100.976  1.00 29.72  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A  1  67   ? 85.820  -4.063  99.801   1.00 31.61  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A  1  67   ? 83.591  -4.539  100.582  1.00 32.67  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A  1  68   ? 86.661  -2.459  103.434  1.00 35.84  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A  1  68   ? 88.002  -2.255  103.963  1.00 36.38  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A  1  68   ? 88.667  -3.612  104.111  1.00 38.10  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A  1  68   ? 88.085  -4.519  104.703  1.00 42.68  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A  1  68   ? 87.969  -1.557  105.328  1.00 33.87  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A  1  68   ? 87.076  -0.317  105.265  1.00 39.64  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A  1  68   ? 89.374  -1.185  105.770  1.00 36.44  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A  1  68   ? 86.714  0.241   106.616  1.00 32.85  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A  1  69   ? 89.877  -3.767  103.550  1.00 36.99  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A  1  69   ? 90.596  -5.043  103.627  1.00 32.38  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A  1  69   ? 90.831  -5.449  105.076  1.00 37.55  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A  1  69   ? 91.134  -4.597  105.913  1.00 38.43  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A  1  69   ? 91.927  -4.738  102.935  1.00 32.88  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A  1  69   ? 91.628  -3.592  102.032  1.00 39.73  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A  1  69   ? 90.617  -2.764  102.765  1.00 40.30  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A  1  70   ? 90.671  -6.735  105.367  1.00 37.52  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A  1  70   ? 90.812  -7.237  106.720  1.00 32.22  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A  1  70   ? 89.549  -7.060  107.540  1.00 35.53  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A  1  70   ? 89.466  -7.532  108.671  1.00 44.52  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A  1  71   ? 88.562  -6.374  106.975  1.00 38.22  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A  1  71   ? 87.298  -6.153  107.668  1.00 34.15  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A  1  71   ? 86.184  -6.951  107.005  1.00 36.31  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A  1  71   ? 86.046  -6.948  105.781  1.00 38.29  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A  1  71   ? 86.913  -4.660  107.697  1.00 33.88  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A  1  71   ? 85.677  -4.449  108.555  1.00 32.90  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A  1  71   ? 88.069  -3.820  108.216  1.00 35.11  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A  1  72   ? 85.393  -7.639  107.821  1.00 37.17  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A  1  72   ? 84.307  -8.471  107.320  1.00 36.51  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A  1  72   ? 83.120  -7.630  106.852  1.00 37.70  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A  1  72   ? 82.528  -7.896  105.804  1.00 42.88  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A  1  72   ? 83.863  -9.467  108.395  1.00 27.46  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A  1  72   ? 82.718  -10.362 107.970  1.00 27.08  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A  1  72   ? 82.446  -11.448 108.994  1.00 28.46  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A  1  72   ? 81.269  -12.311 108.566  1.00 32.09  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A  1  72   ? 81.004  -13.435 109.506  1.00 31.41  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A  1  73   ? 82.781  -6.610  107.632  1.00 31.62  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A  1  73   ? 81.621  -5.777  107.341  1.00 34.02  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A  1  73   ? 81.898  -4.765  106.236  1.00 33.28  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A  1  73   ? 82.962  -4.150  106.197  1.00 34.32  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A  1  73   ? 81.161  -5.040  108.604  1.00 33.13  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A  1  73   ? 80.495  -5.919  109.659  1.00 36.13  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A  1  73   ? 81.479  -6.776  110.437  1.00 36.92  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A  1  73   ? 82.685  -6.747  110.116  1.00 37.84  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A  1  73   ? 81.043  -7.479  111.374  1.00 37.75  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A  1  74   ? 80.935  -4.603  105.334  1.00 36.11  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A  1  74   ? 80.983  -3.516  104.363  1.00 35.46  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A  1  74   ? 80.660  -2.208  105.080  1.00 32.28  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A  1  74   ? 80.042  -2.219  106.146  1.00 32.04  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A  1  74   ? 80.012  -3.765  103.201  1.00 34.15  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A  1  74   ? 78.594  -4.066  103.669  1.00 50.66  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A  1  74   ? 77.858  -3.112  103.998  1.00 49.55  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A  1  74   ? 78.210  -5.257  103.698  1.00 55.03  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A  1  75   ? 81.085  -1.089  104.502  1.00 27.83  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A  1  75   ? 80.904  0.217   105.129  1.00 23.61  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A  1  75   ? 79.433  0.515   105.423  1.00 26.98  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A  1  75   ? 79.108  1.136   106.436  1.00 28.65  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A  1  75   ? 81.526  1.337   104.275  1.00 22.15  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A  1  75   ? 81.253  2.702   104.883  1.00 22.59  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A  1  75   ? 83.017  1.112   104.145  1.00 28.15  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A  1  76   ? 78.547  0.048   104.548  1.00 28.79  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A  1  76   ? 77.112  0.202   104.765  1.00 27.95  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A  1  76   ? 76.690  -0.471  106.067  1.00 30.43  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A  1  76   ? 75.944  0.109   106.856  1.00 34.82  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A  1  76   ? 76.291  -0.377  103.599  1.00 26.24  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A  1  76   ? 74.807  -0.340  103.921  1.00 23.99  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A  1  76   ? 76.580  0.390   102.323  1.00 33.61  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A  1  77   ? 77.186  -1.686  106.294  1.00 31.68  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A  1  77   ? 76.866  -2.429  107.512  1.00 31.75  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A  1  77   ? 77.506  -1.800  108.745  1.00 31.54  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A  1  77   ? 76.914  -1.791  109.826  1.00 33.43  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A  1  77   ? 77.294  -3.894  107.396  1.00 32.77  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A  1  77   ? 76.948  -4.726  108.623  1.00 34.99  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A  1  77   ? 77.231  -6.203  108.433  1.00 41.19  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A  1  77   ? 76.826  -7.000  109.306  1.00 31.74  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A  1  77   ? 77.855  -6.567  107.412  1.00 40.65  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A  1  78   ? 78.720  -1.283  108.579  1.00 31.94  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A  1  78   ? 79.413  -0.597  109.663  1.00 28.98  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A  1  78   ? 78.606  0.615   110.114  1.00 24.11  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A  1  78   ? 78.408  0.827   111.307  1.00 26.19  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A  1  78   ? 80.838  -0.171  109.249  1.00 25.46  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A  1  78   ? 81.700  -1.409  108.989  1.00 27.27  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A  1  78   ? 81.475  0.695   110.322  1.00 20.57  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A  1  78   ? 83.069  -1.099  108.427  1.00 30.22  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A  1  79   ? 78.122  1.392   109.154  1.00 21.76  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A  1  79   ? 77.279  2.538   109.466  1.00 25.73  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A  1  79   ? 75.956  2.086   110.082  1.00 27.66  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A  1  79   ? 75.450  2.714   111.014  1.00 29.21  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A  1  79   ? 77.029  3.409   108.222  1.00 23.00  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A  1  79   ? 78.341  4.042   107.763  1.00 22.80  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A  1  79   ? 76.009  4.494   108.516  1.00 21.69  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A  1  79   ? 78.199  4.922   106.555  1.00 29.38  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A  1  80   ? 75.411  0.985   109.571  1.00 26.95  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A  1  80   ? 74.181  0.416   110.115  1.00 25.46  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A  1  80   ? 74.343  0.042   111.582  1.00 28.23  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A  1  80   ? 73.387  0.099   112.354  1.00 34.65  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A  1  80   ? 73.749  -0.815  109.321  1.00 24.39  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A  1  80   ? 72.949  -0.579  108.043  1.00 22.02  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A  1  80   ? 72.436  -1.906  107.520  1.00 19.28  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A  1  80   ? 71.802  0.391   108.291  1.00 28.34  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A  1  81   ? 75.555  -0.349  111.957  1.00 29.78  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A  1  81   ? 75.862  -0.628  113.351  1.00 26.98  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A  1  81   ? 76.061  0.666   114.132  1.00 26.61  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A  1  81   ? 75.626  0.787   115.275  1.00 29.38  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A  1  81   ? 77.101  -1.518  113.458  1.00 24.28  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A  1  81   ? 76.880  -2.893  112.862  1.00 29.40  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A  1  81   ? 75.759  -3.403  112.847  1.00 33.58  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A  1  81   ? 77.951  -3.503  112.367  1.00 31.77  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A  1  82   ? 76.702  1.640   113.495  1.00 23.69  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A  1  82   ? 76.972  2.922   114.132  1.00 24.70  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A  1  82   ? 75.703  3.752   114.331  1.00 28.01  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A  1  82   ? 75.727  4.785   114.997  1.00 32.56  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A  1  82   ? 78.014  3.715   113.337  1.00 25.68  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A  1  82   ? 79.422  3.114   113.259  1.00 27.49  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A  1  82   ? 80.375  4.034   112.506  1.00 26.77  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A  1  82   ? 79.965  2.794   114.646  1.00 27.50  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A  1  83   ? 74.597  3.305   113.745  1.00 27.26  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A  1  83   ? 73.318  3.968   113.959  1.00 28.50  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A  1  83   ? 72.730  3.563   115.304  1.00 32.19  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A  1  83   ? 71.920  4.288   115.881  1.00 41.03  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A  1  83   ? 72.337  3.648   112.827  1.00 28.31  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A  1  83   ? 72.670  4.332   111.510  1.00 33.99  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A  1  83   ? 71.724  3.911   110.392  1.00 42.04  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A  1  83   ? 70.302  4.396   110.637  1.00 41.80  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A  1  83   ? 69.401  4.070   109.491  1.00 33.18  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A  1  84   ? 73.149  2.404   115.803  1.00 29.81  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A  1  84   ? 72.625  1.876   117.059  1.00 36.38  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A  1  84   ? 73.438  2.296   118.284  1.00 36.68  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A  1  84   ? 73.156  1.866   119.401  1.00 35.16  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A  1  84   ? 72.508  0.353   116.996  1.00 37.96  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A  1  84   ? 71.381  -0.141  116.108  1.00 50.21  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A  1  84   ? 71.208  -1.645  116.176  1.00 82.71  ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A  1  84   ? 70.157  -2.142  115.719  1.00 98.73  ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A  1  84   ? 72.123  -2.329  116.686  1.00 82.59  ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A  1  85   ? 74.450  3.130   118.071  1.00 34.31  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A  1  85   ? 75.261  3.632   119.172  1.00 32.17  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A  1  85   ? 74.479  4.634   120.020  1.00 34.25  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A  1  85   ? 73.944  5.617   119.502  1.00 33.13  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A  1  85   ? 76.544  4.274   118.641  1.00 31.85  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A  1  85   ? 77.564  4.715   119.692  1.00 30.68  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A  1  85   ? 78.025  3.527   120.506  1.00 31.64  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A  1  85   ? 78.746  5.406   119.040  1.00 30.54  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A  1  86   ? 74.415  4.375   121.323  1.00 31.58  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A  1  86   ? 73.714  5.255   122.250  1.00 31.73  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A  1  86   ? 74.710  6.114   123.017  1.00 38.47  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A  1  86   ? 75.432  5.615   123.880  1.00 40.78  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A  1  86   ? 72.896  4.451   123.270  1.00 32.92  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A  1  86   ? 72.066  5.386   124.129  1.00 41.91  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A  1  86   ? 72.011  3.436   122.566  1.00 35.60  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A  1  87   ? 74.735  7.408   122.718  1.00 39.27  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A  1  87   ? 75.721  8.301   123.319  1.00 40.95  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A  1  87   ? 75.082  9.337   124.234  1.00 42.29  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A  1  87   ? 74.304  10.182  123.790  1.00 43.50  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A  1  87   ? 76.564  9.022   122.248  1.00 47.79  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A  1  87   ? 77.531  9.992   122.902  1.00 52.96  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A  1  87   ? 77.318  8.014   121.397  1.00 44.30  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A  1  88   ? 75.427  9.267   125.515  1.00 42.09  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A  1  88   ? 74.885  10.175  126.514  1.00 43.94  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A  1  88   ? 75.826  11.344  126.778  1.00 45.37  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A  1  88   ? 77.020  11.150  127.023  1.00 45.32  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A  1  88   ? 74.618  9.429   127.821  1.00 41.06  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A  1  88   ? 74.109  10.323  128.934  1.00 47.56  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A  1  88   ? 74.178  9.635   130.284  1.00 47.06  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A  1  88   ? 73.771  10.528  131.364  1.00 42.41  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A  1  88   ? 73.821  10.211  132.652  1.00 43.61  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A  1  88   ? 74.266  9.019   133.026  1.00 40.46  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A  1  88   ? 73.429  11.087  133.567  1.00 50.62  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A  1  89   ? 75.277  12.555  126.724  1.00 45.81  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A  1  89   ? 76.027  13.761  127.055  1.00 46.46  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A  1  89   ? 75.716  14.179  128.485  1.00 53.44  ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A  1  89   ? 74.553  14.363  128.843  1.00 55.92  ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A  1  89   ? 75.661  14.913  126.116  1.00 45.78  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A  1  89   ? 76.145  14.736  124.704  1.00 51.39  ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A  1  89   ? 76.939  13.656  124.350  1.00 48.05  ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A  1  89   ? 75.812  15.664  123.729  1.00 52.23  ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A  1  89   ? 77.382  13.502  123.047  1.00 46.60  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A  1  89   ? 76.253  15.518  122.426  1.00 46.05  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A  1  89   ? 77.038  14.435  122.084  1.00 45.36  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A  1  90   ? 76.754  14.326  129.301  1.00 50.24  ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A  1  90   ? 76.579  14.787  130.673  1.00 44.83  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A  1  90   ? 76.411  16.305  130.738  1.00 41.92  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A  1  90   ? 75.655  16.818  131.561  1.00 37.78  ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A  1  90   ? 77.747  14.335  131.553  1.00 51.77  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A  1  90   ? 77.713  12.904  132.107  1.00 45.87  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A  1  90   ? 76.399  12.639  132.826  1.00 50.19  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A  1  90   ? 77.957  11.863  131.024  1.00 39.27  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A  1  91   ? 77.115  17.016  129.864  1.00 50.17  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A  1  91   ? 77.048  18.474  129.826  1.00 55.73  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A  1  91   ? 75.931  18.975  128.910  1.00 58.04  ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A  1  91   ? 75.957  18.735  127.702  1.00 57.92  ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A  1  91   ? 78.396  19.056  129.389  1.00 60.62  ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A  1  91   ? 78.522  20.543  129.688  1.00 61.55  ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A  1  91   ? 77.576  21.313  129.512  1.00 56.93  ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A  1  91   ? 79.701  20.953  130.144  1.00 61.52  ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A  1  92   ? 74.948  19.683  129.490  1.00 52.67  ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A  1  92   ? 73.792  20.234  128.771  1.00 51.67  ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A  1  92   ? 74.175  21.288  127.738  1.00 55.57  ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A  1  92   ? 73.369  21.605  126.866  1.00 63.50  ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A  1  92   ? 72.968  20.887  129.886  1.00 53.84  ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A  1  92   ? 73.397  20.197  131.135  1.00 52.08  ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A  1  92   ? 74.852  19.916  130.940  1.00 49.70  ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A  1  93   ? 75.385  21.827  127.842  1.00 60.19  ? 93   SER A N     1 
ATOM   703   C  CA    . SER A  1  93   ? 75.830  22.878  126.933  1.00 66.59  ? 93   SER A CA    1 
ATOM   704   C  C     . SER A  1  93   ? 76.514  22.311  125.690  1.00 66.41  ? 93   SER A C     1 
ATOM   705   O  O     . SER A  1  93   ? 76.865  23.054  124.773  1.00 63.53  ? 93   SER A O     1 
ATOM   706   C  CB    . SER A  1  93   ? 76.780  23.837  127.658  1.00 63.28  ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A  1  93   ? 76.187  24.356  128.837  1.00 59.37  ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A  1  94   ? 76.685  20.992  125.660  1.00 65.70  ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A  1  94   ? 77.469  20.333  124.616  1.00 66.63  ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A  1  94   ? 76.597  19.842  123.456  1.00 63.13  ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A  1  94   ? 75.822  18.898  123.610  1.00 60.25  ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A  1  94   ? 78.231  19.159  125.237  1.00 61.00  ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A  1  94   ? 79.180  18.310  124.393  1.00 48.67  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A  1  94   ? 80.295  19.161  123.810  1.00 51.90  ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A  1  94   ? 79.744  17.191  125.252  1.00 40.11  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A  1  95   ? 76.726  20.491  122.299  1.00 59.30  ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A  1  95   ? 75.909  20.152  121.133  1.00 54.64  ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A  1  95   ? 76.504  19.099  120.195  1.00 53.14  ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A  1  95   ? 75.783  18.519  119.384  1.00 55.07  ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A  1  95   ? 75.598  21.415  120.324  1.00 58.86  ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A  1  95   ? 74.832  22.480  121.089  1.00 69.19  ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A  1  95   ? 73.391  22.092  121.340  1.00 74.66  ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A  1  95   ? 72.859  21.186  120.695  1.00 65.99  ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A  1  95   ? 72.749  22.777  122.280  1.00 79.68  ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A  1  96   ? 77.806  18.852  120.293  1.00 52.73  ? 96   THR A N     1 
ATOM   726   C  CA    . THR A  1  96   ? 78.450  17.891  119.398  1.00 41.15  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A  1  96   ? 79.729  17.266  119.950  1.00 38.52  ? 96   THR A C     1 
ATOM   728   O  O     . THR A  1  96   ? 80.487  17.909  120.674  1.00 43.38  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A  1  96   ? 78.759  18.513  118.028  1.00 38.70  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A  1  96   ? 79.608  17.627  117.288  1.00 35.17  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A  1  96   ? 79.458  19.853  118.199  1.00 52.80  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A  1  97   ? 79.972  16.014  119.577  1.00 35.66  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A  1  97   ? 81.164  15.290  120.005  1.00 36.29  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A  1  97   ? 81.690  14.439  118.860  1.00 37.90  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A  1  97   ? 80.914  13.796  118.157  1.00 44.28  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A  1  97   ? 80.859  14.357  121.199  1.00 36.77  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A  1  97   ? 82.057  13.477  121.519  1.00 35.53  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A  1  97   ? 80.466  15.162  122.416  1.00 49.38  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A  1  98   ? 83.004  14.436  118.663  1.00 35.06  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A  1  98   ? 83.603  13.544  117.679  1.00 35.25  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A  1  98   ? 84.367  12.403  118.352  1.00 34.53  ? 98   THR A C     1 
ATOM   742   O  O     . THR A  1  98   ? 85.437  12.612  118.922  1.00 40.52  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A  1  98   ? 84.541  14.306  116.728  1.00 39.88  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A  1  98   ? 83.802  15.330  116.051  1.00 46.04  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A  1  98   ? 85.149  13.357  115.701  1.00 37.25  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A  1  99   ? 83.814  11.195  118.271  1.00 35.18  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A  1  99   ? 84.458  10.014  118.843  1.00 31.94  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A  1  99   ? 85.490  9.462   117.873  1.00 34.56  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A  1  99   ? 85.270  9.450   116.665  1.00 38.05  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A  1  99   ? 83.431  8.925   119.159  1.00 31.21  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A  1  99   ? 82.585  8.997   120.433  1.00 38.78  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A  1  99   ? 81.595  10.150  120.398  1.00 35.94  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A  1  99   ? 81.859  7.676   120.637  1.00 40.50  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A  1  100  ? 86.614  8.995   118.401  1.00 39.41  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A  1  100  ? 87.668  8.444   117.560  1.00 30.96  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A  1  100  ? 87.868  6.967   117.874  1.00 32.22  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A  1  100  ? 87.907  6.572   119.040  1.00 34.50  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A  1  100  ? 88.972  9.211   117.777  1.00 23.53  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A  1  100  ? 88.815  10.728  117.906  1.00 29.95  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A  1  100  ? 90.119  11.367  118.344  1.00 42.18  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A  1  100  ? 88.324  11.344  116.603  1.00 32.77  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A  1  101  ? 87.980  6.146   116.835  1.00 28.42  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A  1  101  ? 88.252  4.728   117.040  1.00 34.18  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A  1  101  ? 89.437  4.278   116.200  1.00 37.26  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A  1  101  ? 89.391  4.317   114.978  1.00 41.58  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A  1  101  ? 87.016  3.880   116.721  1.00 39.42  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A  1  101  ? 87.022  2.404   117.144  1.00 36.23  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A  1  101  ? 85.604  1.947   117.448  1.00 36.44  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A  1  101  ? 87.650  1.499   116.087  1.00 29.68  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A  1  102  ? 90.503  3.851   116.861  1.00 41.52  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A  1  102  ? 91.663  3.337   116.151  1.00 39.73  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A  1  102  ? 91.920  1.909   116.607  1.00 43.56  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A  1  102  ? 92.270  1.675   117.765  1.00 56.62  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A  1  102  ? 92.878  4.224   116.421  1.00 46.98  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A  1  102  ? 93.865  4.306   115.271  1.00 53.37  ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A  1  102  ? 94.849  5.448   115.488  1.00 66.30  ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A  1  102  ? 94.120  6.778   115.641  1.00 67.22  ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A  1  102  ? 95.048  7.907   115.937  1.00 65.06  ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A  1  103  ? 91.735  0.953   115.703  1.00 40.63  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A  1  103  ? 91.885  -0.455  116.058  1.00 41.02  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A  1  103  ? 92.558  -1.254  114.953  1.00 37.71  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A  1  103  ? 92.596  -0.829  113.798  1.00 43.02  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A  1  103  ? 90.533  -1.064  116.401  1.00 44.37  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A  1  104  ? 93.079  -2.421  115.317  1.00 39.68  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A  1  104  ? 93.788  -3.271  114.371  1.00 43.92  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A  1  104  ? 93.927  -4.700  114.887  1.00 39.32  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A  1  104  ? 93.447  -5.030  115.971  1.00 39.63  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A  1  104  ? 95.168  -2.684  114.067  1.00 51.12  ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A  1  104  ? 95.963  -2.306  115.306  1.00 64.15  ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A  1  104  ? 97.271  -1.619  114.970  1.00 82.62  ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A  1  104  ? 98.015  -1.261  115.909  1.00 93.24  ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A  1  104  ? 97.552  -1.436  113.765  1.00 81.46  ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A  1  105  ? 94.570  -5.547  114.090  1.00 39.57  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A  1  105  ? 94.824  -6.924  114.473  1.00 40.73  ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A  1  105  ? 93.543  -7.727  114.547  1.00 43.23  ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A  1  105  ? 92.456  -7.174  114.386  1.00 45.92  ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A  1  106  ? 93.657  -9.041  114.795  1.00 43.90  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A  1  106  ? 92.447  -9.858  114.924  1.00 40.37  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A  1  106  ? 91.674  -9.465  116.170  1.00 46.63  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A  1  106  ? 92.259  -9.466  117.255  1.00 58.34  ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A  1  106  ? 92.999  -11.276 115.100  1.00 40.23  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A  1  106  ? 94.398  -11.222 114.598  1.00 51.04  ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A  1  106  ? 94.885  -9.844  114.895  1.00 53.85  ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A  1  107  ? 90.382  -9.180  116.016  1.00 45.24  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A  1  107  ? 89.521  -8.797  117.137  1.00 45.52  ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A  1  107  ? 88.131  -8.433  116.645  1.00 44.53  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A  1  107  ? 87.921  -8.215  115.454  1.00 44.84  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A  1  107  ? 90.093  -7.599  117.902  1.00 52.18  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A  1  107  ? 90.161  -6.314  117.093  1.00 49.50  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A  1  107  ? 90.674  -5.161  117.940  1.00 54.54  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A  1  107  ? 89.782  -4.924  119.150  1.00 46.01  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A  1  107  ? 90.274  -3.789  119.978  1.00 51.04  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A  1  108  ? 87.181  -8.358  117.568  1.00 45.05  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A  1  108  ? 85.870  -7.825  117.242  1.00 40.13  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A  1  108  ? 85.712  -6.470  117.915  1.00 38.58  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A  1  108  ? 85.532  -6.385  119.128  1.00 43.46  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A  1  108  ? 84.779  -8.788  117.704  1.00 38.84  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A  1  108  ? 84.885  -10.168 117.079  1.00 40.74  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A  1  108  ? 83.760  -11.092 117.503  1.00 62.16  ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A  1  108  ? 83.023  -10.742 118.451  1.00 56.54  ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A  1  108  ? 83.613  -12.168 116.886  1.00 76.69  ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A  1  109  ? 85.764  -5.410  117.117  1.00 33.74  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A  1  109  ? 85.708  -4.057  117.650  1.00 35.57  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A  1  109  ? 84.305  -3.729  118.137  1.00 34.72  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A  1  109  ? 83.334  -3.876  117.398  1.00 37.30  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A  1  109  ? 86.139  -3.018  116.601  1.00 34.17  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A  1  109  ? 85.994  -1.613  117.156  1.00 28.06  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A  1  109  ? 87.569  -3.277  116.160  1.00 35.58  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A  1  110  ? 84.206  -3.286  119.385  1.00 36.00  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A  1  110  ? 82.921  -2.922  119.966  1.00 34.68  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A  1  110  ? 82.864  -1.419  120.209  1.00 32.80  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A  1  110  ? 83.815  -0.699  119.911  1.00 39.41  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A  1  110  ? 82.692  -3.675  121.277  1.00 37.68  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A  1  110  ? 82.895  -5.180  121.177  1.00 35.97  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A  1  110  ? 81.871  -5.830  120.261  1.00 34.47  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A  1  110  ? 82.070  -7.336  120.206  1.00 36.45  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A  1  110  ? 80.976  -8.024  119.469  1.00 33.75  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A  1  111  ? 81.747  -0.951  120.753  1.00 33.12  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A  1  111  ? 81.557  0.473   121.002  1.00 36.85  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A  1  111  ? 82.484  0.950   122.112  1.00 42.16  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A  1  111  ? 82.714  2.148   122.276  1.00 41.15  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A  1  111  ? 80.111  0.749   121.365  1.00 44.64  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A  1  112  ? 83.010  -0.008  122.868  1.00 47.54  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A  1  112  ? 83.911  0.263   123.979  1.00 44.25  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A  1  112  ? 85.208  0.899   123.499  1.00 44.63  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A  1  112  ? 85.771  1.765   124.169  1.00 53.50  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A  1  112  ? 84.244  -1.045  124.691  1.00 38.24  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A  1  112  ? 84.023  -1.031  126.185  1.00 46.90  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A  1  112  ? 84.547  -2.318  126.789  1.00 59.18  ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A  1  112  ? 84.249  -3.464  125.935  1.00 50.95  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A  1  112  ? 83.197  -4.260  126.092  1.00 56.17  ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A  1  112  ? 82.339  -4.041  127.080  1.00 57.25  ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A  1  112  ? 83.007  -5.278  125.263  1.00 53.00  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A  1  113  ? 85.664  0.474   122.324  1.00 36.47  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A  1  113  ? 86.992  0.823   121.831  1.00 36.10  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A  1  113  ? 87.147  2.287   121.424  1.00 38.78  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A  1  113  ? 88.246  2.728   121.087  1.00 42.43  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A  1  113  ? 87.387  -0.097  120.675  1.00 40.54  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A  1  113  ? 87.395  -1.560  121.074  1.00 45.29  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A  1  113  ? 88.419  -2.020  121.619  1.00 58.15  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A  1  113  ? 86.379  -2.250  120.847  1.00 41.75  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A  1  114  ? 86.047  3.033   121.444  1.00 35.90  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A  1  114  ? 86.106  4.468   121.199  1.00 37.92  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A  1  114  ? 86.926  5.149   122.286  1.00 36.63  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A  1  114  ? 86.757  4.857   123.470  1.00 36.40  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A  1  114  ? 84.699  5.072   121.154  1.00 46.87  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A  1  114  ? 83.968  4.819   119.864  1.00 45.22  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A  1  114  ? 84.352  5.462   118.696  1.00 40.64  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A  1  114  ? 82.893  3.948   119.821  1.00 40.16  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A  1  114  ? 83.683  5.234   117.509  1.00 35.94  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A  1  114  ? 82.219  3.718   118.638  1.00 42.68  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A  1  114  ? 82.615  4.361   117.479  1.00 38.07  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A  1  115  ? 87.819  6.048   121.883  1.00 39.61  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A  1  115  ? 88.637  6.784   122.842  1.00 44.99  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A  1  115  ? 87.771  7.720   123.678  1.00 47.96  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A  1  115  ? 87.074  8.579   123.133  1.00 44.62  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A  1  115  ? 89.753  7.561   122.138  1.00 43.23  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A  1  115  ? 90.805  6.714   121.414  1.00 42.90  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A  1  115  ? 92.001  7.560   120.990  1.00 35.69  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A  1  115  ? 91.247  5.545   122.282  1.00 42.08  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A  1  116  ? 87.818  7.546   125.010  1.00 47.65  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A  1  116  ? 86.975  8.246   125.988  1.00 47.23  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A  1  116  ? 87.044  9.766   125.871  1.00 49.54  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A  1  116  ? 88.106  10.326  125.601  1.00 53.23  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A  1  116  ? 87.557  7.794   127.331  1.00 46.26  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A  1  116  ? 88.175  6.470   127.043  1.00 36.88  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A  1  116  ? 88.739  6.598   125.662  1.00 41.22  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A  1  117  ? 85.905  10.422  126.066  1.00 43.66  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A  1  117  ? 85.835  11.876  126.026  1.00 55.37  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A  1  117  ? 85.080  12.369  127.258  1.00 65.34  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A  1  117  ? 84.131  11.724  127.709  1.00 66.79  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A  1  117  ? 85.146  12.373  124.729  1.00 56.67  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A  1  117  ? 84.982  13.892  124.734  1.00 52.31  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A  1  117  ? 85.933  11.926  123.501  1.00 44.48  ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A  1  118  ? 85.518  13.498  127.812  1.00 62.91  ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A  1  118  ? 84.887  14.081  128.992  1.00 61.86  ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A  1  118  ? 83.417  14.405  128.745  1.00 61.11  ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A  1  118  ? 83.046  14.847  127.656  1.00 55.52  ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A  1  118  ? 85.637  15.328  129.431  1.00 71.40  ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A  1  119  ? 82.593  14.173  129.766  1.00 59.66  ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A  1  119  ? 81.152  14.431  129.710  1.00 65.80  ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A  1  119  ? 80.444  13.610  128.632  1.00 60.32  ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A  1  119  ? 79.390  14.007  128.131  1.00 59.07  ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A  1  119  ? 80.866  15.926  129.510  1.00 63.64  ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A  1  119  ? 81.499  16.791  130.581  1.00 70.22  ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A  1  119  ? 81.613  16.329  131.738  1.00 67.50  ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A  1  119  ? 81.884  17.936  130.262  1.00 70.66  ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A  1  120  ? 81.026  12.467  128.279  1.00 54.93  ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A  1  120  ? 80.458  11.599  127.250  1.00 55.21  ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A  1  120  ? 80.494  10.139  127.685  1.00 45.66  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A  1  120  ? 81.560  9.605   127.989  1.00 45.15  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A  1  120  ? 81.218  11.731  125.911  1.00 57.63  ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A  1  120  ? 80.702  10.716  124.900  1.00 54.08  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A  1  120  ? 81.102  13.145  125.362  1.00 51.58  ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A  1  121  ? 79.331  9.492   127.703  1.00 40.24  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A  1  121  ? 79.255  8.095   128.120  1.00 42.42  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A  1  121  ? 78.504  7.233   127.113  1.00 50.18  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A  1  121  ? 77.369  7.539   126.754  1.00 55.67  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A  1  121  ? 78.581  7.979   129.486  1.00 46.29  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A  1  121  ? 78.412  6.544   129.961  1.00 52.44  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A  1  121  ? 77.349  6.404   131.033  1.00 59.58  ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A  1  121  ? 76.760  7.435   131.425  1.00 55.51  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A  1  121  ? 77.101  5.261   131.477  1.00 53.42  ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A  1  122  ? 79.130  6.144   126.676  1.00 46.68  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A  1  122  ? 78.481  5.214   125.756  1.00 41.86  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A  1  122  ? 77.624  4.236   126.546  1.00 43.23  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A  1  122  ? 78.130  3.480   127.374  1.00 52.88  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A  1  122  ? 79.503  4.434   124.901  1.00 39.44  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A  1  122  ? 80.001  5.295   123.735  1.00 41.28  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A  1  122  ? 78.887  3.150   124.364  1.00 35.42  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A  1  122  ? 81.032  6.338   124.119  1.00 40.91  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A  1  123  ? 76.322  4.257   126.285  1.00 40.20  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A  1  123  ? 75.374  3.477   127.072  1.00 44.90  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A  1  123  ? 75.378  1.998   126.691  1.00 45.30  ? 123  MET A C     1 
ATOM   935   O  O     . MET A  1  123  ? 74.988  1.146   127.490  1.00 43.52  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A  1  123  ? 73.965  4.057   126.937  1.00 47.55  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A  1  123  ? 73.867  5.537   127.279  1.00 51.43  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A  1  123  ? 74.251  5.895   129.004  1.00 63.49  ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A  1  123  ? 73.043  4.867   129.840  1.00 46.27  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A  1  124  ? 75.814  1.700   125.471  1.00 48.93  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A  1  124  ? 75.892  0.318   125.000  1.00 46.97  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A  1  124  ? 77.286  -0.042  124.490  1.00 49.37  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A  1  124  ? 77.522  -0.100  123.282  1.00 48.29  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A  1  124  ? 74.829  0.040   123.929  1.00 40.53  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A  1  124  ? 74.842  1.064   122.808  1.00 39.92  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A  1  124  ? 75.245  2.211   123.000  1.00 42.41  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A  1  124  ? 74.398  0.651   121.627  1.00 43.44  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A  1  125  ? 78.217  -0.293  125.420  1.00 45.58  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A  1  125  ? 79.619  -0.549  125.085  1.00 45.65  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A  1  125  ? 79.811  -1.876  124.359  1.00 45.83  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A  1  125  ? 80.803  -2.044  123.651  1.00 48.33  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A  1  125  ? 80.296  -0.595  126.456  1.00 44.93  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A  1  125  ? 79.228  -1.054  127.374  1.00 43.92  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A  1  125  ? 77.964  -0.429  126.864  1.00 42.93  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A  1  126  ? 78.870  -2.801  124.523  1.00 42.23  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A  1  126  ? 79.001  -4.126  123.922  1.00 50.58  ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A  1  126  ? 78.522  -4.169  122.474  1.00 53.31  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A  1  126  ? 78.565  -5.221  121.831  1.00 46.12  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A  1  126  ? 78.256  -5.175  124.752  1.00 57.48  ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A  1  126  ? 79.024  -5.591  125.991  1.00 69.38  ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A  1  126  ? 79.718  -4.736  126.581  1.00 69.75  ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A  1  126  ? 78.935  -6.777  126.373  1.00 70.87  ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A  1  127  ? 78.071  -3.024  121.966  1.00 53.79  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A  1  127  ? 77.563  -2.938  120.602  1.00 43.54  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A  1  127  ? 78.649  -3.264  119.585  1.00 43.71  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A  1  127  ? 79.696  -2.621  119.559  1.00 49.14  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A  1  127  ? 77.024  -1.535  120.332  1.00 37.54  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A  1  127  ? 76.722  -1.225  118.867  1.00 37.76  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A  1  127  ? 75.564  -2.076  118.363  1.00 41.36  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A  1  127  ? 76.431  0.254   118.690  1.00 39.68  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A  1  128  ? 78.381  -4.246  118.730  1.00 41.10  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A  1  128  ? 79.353  -4.673  117.731  1.00 38.15  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A  1  128  ? 79.450  -3.660  116.596  1.00 31.55  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A  1  128  ? 78.435  -3.160  116.117  1.00 36.77  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A  1  128  ? 78.974  -6.047  117.173  1.00 38.45  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A  1  128  ? 79.952  -6.586  116.175  1.00 37.21  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A  1  128  ? 80.959  -7.461  116.518  1.00 34.74  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A  1  128  ? 80.078  -6.370  114.844  1.00 40.68  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A  1  128  ? 81.663  -7.763  115.441  1.00 34.76  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A  1  128  ? 81.150  -7.115  114.412  1.00 37.40  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A  1  129  ? 80.671  -3.357  116.170  1.00 27.74  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A  1  129  ? 80.877  -2.463  115.036  1.00 31.70  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A  1  129  ? 81.407  -3.223  113.829  1.00 33.88  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A  1  129  ? 80.715  -3.360  112.822  1.00 42.40  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A  1  129  ? 81.843  -1.314  115.372  1.00 30.58  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A  1  129  ? 81.258  -0.439  116.479  1.00 31.37  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A  1  129  ? 82.127  -0.472  114.132  1.00 22.76  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A  1  129  ? 82.111  0.751   116.812  1.00 36.27  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A  1  130  ? 82.633  -3.720  113.936  1.00 31.81  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A  1  130  ? 83.261  -4.432  112.831  1.00 33.34  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A  1  130  ? 84.135  -5.574  113.334  1.00 36.57  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A  1  130  ? 84.645  -5.528  114.451  1.00 42.89  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A  1  130  ? 84.082  -3.470  111.987  1.00 33.34  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A  1  131  ? 84.298  -6.600  112.505  1.00 35.50  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A  1  131  ? 85.192  -7.706  112.826  1.00 33.90  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A  1  131  ? 86.493  -7.569  112.043  1.00 36.30  ? 131  THR A C     1 
ATOM   997   O  O     . THR A  1  131  ? 86.521  -7.744  110.825  1.00 38.79  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A  1  131  ? 84.546  -9.070  112.514  1.00 30.25  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A  1  131  ? 83.397  -9.259  113.348  1.00 34.39  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A  1  131  ? 85.534  -10.199 112.762  1.00 32.33  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A  1  132  ? 87.573  -7.255  112.748  1.00 35.74  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A  1  132  ? 88.865  -7.060  112.106  1.00 30.12  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A  1  132  ? 89.703  -8.332  112.114  1.00 33.86  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A  1  132  ? 89.803  -9.033  113.126  1.00 39.54  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A  1  132  ? 89.634  -5.901  112.747  1.00 34.02  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A  1  132  ? 89.344  -4.497  112.207  1.00 34.02  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A  1  132  ? 87.929  -4.041  112.539  1.00 31.68  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A  1  132  ? 90.367  -3.506  112.734  1.00 38.99  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A  1  133  ? 90.303  -8.605  110.963  1.00 39.35  ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A  1  133  ? 91.087  -9.805  110.724  1.00 41.83  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A  1  133  ? 92.555  -9.508  111.008  1.00 44.68  ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A  1  133  ? 92.895  -8.411  111.452  1.00 46.19  ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A  1  133  ? 90.919  -10.197 109.258  1.00 47.00  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A  1  133  ? 91.186  -11.639 108.908  1.00 52.56  ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A  1  133  ? 91.212  -11.847 107.408  1.00 57.68  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A  1  133  ? 91.421  -10.859 106.668  1.00 48.23  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A  1  133  ? 91.016  -12.993 106.969  1.00 58.23  ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A  1  134  ? 93.422  -10.483 110.752  1.00 45.08  ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A  1  134  ? 94.857  -10.266 110.844  1.00 47.93  ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A  1  134  ? 95.271  -9.245  109.790  1.00 47.72  ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A  1  134  ? 95.010  -9.431  108.602  1.00 42.84  ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A  1  134  ? 95.606  -11.580 110.613  1.00 57.74  ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A  1  134  ? 96.413  -12.067 111.806  1.00 64.09  ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A  1  134  ? 97.522  -11.107 112.192  1.00 76.08  ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A  1  134  ? 97.764  -10.934 113.406  1.00 78.46  ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A  1  134  ? 98.154  -10.529 111.282  1.00 80.26  ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A  1  135  ? 95.920  -8.171  110.228  1.00 48.67  ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A  1  135  ? 96.347  -7.121  109.321  1.00 42.75  ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A  1  135  ? 95.258  -6.106  109.031  1.00 42.47  ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A  1  135  ? 95.515  -5.063  108.425  1.00 45.86  ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A  1  136  ? 94.035  -6.413  109.456  1.00 43.77  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A  1  136  ? 92.914  -5.511  109.267  1.00 42.29  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A  1  136  ? 93.044  -4.283  110.143  1.00 40.49  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A  1  136  ? 93.330  -4.392  111.334  1.00 42.74  ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A  1  137  ? 92.832  -3.111  109.554  1.00 35.06  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A  1  137  ? 93.023  -1.855  110.269  1.00 39.97  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A  1  137  ? 91.838  -0.905  110.098  1.00 37.09  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A  1  137  ? 91.413  -0.625  108.978  1.00 42.43  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A  1  137  ? 94.318  -1.185  109.804  1.00 47.89  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A  1  137  ? 95.582  -1.933  110.211  1.00 53.82  ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A  1  137  ? 96.799  -1.466  109.423  1.00 65.43  ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A  1  137  ? 96.887  -0.010  109.346  1.00 84.74  ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A  1  137  ? 96.736  0.689   108.224  1.00 85.11  ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A  1  137  ? 96.495  0.066   107.078  1.00 81.52  ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A  1  137  ? 96.832  2.012   108.247  1.00 79.04  ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A  1  138  ? 91.311  -0.406  111.213  1.00 32.22  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A  1  138  ? 90.145  0.471   111.173  1.00 31.40  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A  1  138  ? 90.368  1.768   111.953  1.00 31.68  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A  1  138  ? 90.515  1.748   113.175  1.00 41.70  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A  1  138  ? 88.921  -0.270  111.719  1.00 35.10  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A  1  138  ? 87.548  0.398   111.610  1.00 38.49  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A  1  138  ? 87.167  0.604   110.158  1.00 33.75  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A  1  138  ? 86.489  -0.428  112.325  1.00 36.96  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A  1  139  ? 90.396  2.893   111.243  1.00 24.06  ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A  1  139  ? 90.510  4.199   111.883  0.50 31.89  ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A  1  139  ? 89.335  5.102   111.517  1.00 36.41  ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A  1  139  ? 89.219  5.541   110.375  1.00 47.28  ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A  1  139  ? 91.833  4.865   111.503  0.50 31.18  ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A  1  139  ? 92.026  6.209   112.176  0.50 34.47  ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A  1  139  ? 91.437  6.485   113.220  0.50 36.54  ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A  1  139  ? 92.857  7.054   111.580  0.50 36.49  ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A  1  140  ? 88.479  5.394   112.493  1.00 32.70  ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A  1  140  ? 87.255  6.152   112.251  1.00 32.75  ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A  1  140  ? 87.142  7.403   113.111  1.00 34.46  ? 140  MET A C     1 
ATOM   1065  O  O     . MET A  1  140  ? 87.660  7.455   114.229  1.00 47.05  ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A  1  140  ? 86.022  5.290   112.531  1.00 30.69  ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A  1  140  ? 86.018  3.926   111.881  1.00 33.13  ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A  1  140  ? 84.473  3.061   112.231  1.00 36.56  ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A  1  140  ? 84.425  3.154   114.018  1.00 38.55  ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A  1  141  ? 86.440  8.400   112.580  1.00 28.46  ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A  1  141  ? 86.007  9.552   113.359  1.00 29.61  ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A  1  141  ? 84.506  9.716   113.157  1.00 33.67  ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A  1  141  ? 84.054  10.016  112.051  1.00 42.24  ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A  1  141  ? 86.728  10.819  112.904  1.00 31.52  ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A  1  141  ? 88.241  10.719  112.923  1.00 35.77  ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A  1  141  ? 88.908  11.948  112.332  1.00 49.16  ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A  1  141  ? 88.218  12.975  112.156  1.00 49.55  ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A  1  141  ? 90.121  11.884  112.036  1.00 51.40  ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A  1  142  ? 83.733  9.517   114.221  1.00 32.32  ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A  1  142  ? 82.279  9.595   114.123  1.00 29.16  ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A  1  142  ? 81.708  10.827  114.835  1.00 25.31  ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A  1  142  ? 81.959  11.055  116.019  1.00 31.93  ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A  1  142  ? 81.594  8.284   114.608  1.00 28.70  ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A  1  142  ? 82.075  7.101   113.780  1.00 27.92  ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A  1  142  ? 81.867  8.027   116.075  1.00 31.67  ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A  1  143  ? 80.957  11.633  114.092  1.00 24.19  ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A  1  143  ? 80.348  12.838  114.642  1.00 26.74  ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A  1  143  ? 78.931  12.593  115.156  1.00 28.87  ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A  1  143  ? 78.034  12.192  114.394  1.00 33.92  ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A  1  143  ? 80.348  13.977  113.620  1.00 23.40  ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A  1  143  ? 79.522  15.166  114.068  1.00 27.01  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A  1  143  ? 79.709  16.375  113.176  1.00 26.94  ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A  1  143  ? 78.778  17.441  113.533  1.00 24.37  ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A  1  143  ? 78.888  18.699  113.122  1.00 34.73  ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A  1  143  ? 79.901  19.056  112.342  1.00 37.69  ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A  1  143  ? 77.990  19.602  113.496  1.00 38.30  ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A  1  144  ? 78.757  12.858  116.451  1.00 28.73  ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A  1  144  ? 77.501  12.682  117.172  1.00 25.38  ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A  1  144  ? 76.955  14.033  117.626  1.00 28.55  ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A  1  144  ? 77.662  14.807  118.271  1.00 39.13  ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A  1  144  ? 77.717  11.816  118.427  1.00 27.75  ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A  1  144  ? 76.436  11.712  119.235  1.00 28.31  ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A  1  144  ? 78.238  10.439  118.044  1.00 30.09  ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A  1  145  ? 75.697  14.311  117.300  1.00 30.14  ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A  1  145  ? 75.077  15.585  117.657  1.00 36.14  ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A  1  145  ? 73.804  15.411  118.482  1.00 40.43  ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A  1  145  ? 73.194  14.341  118.488  1.00 36.70  ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A  1  145  ? 74.740  16.389  116.397  1.00 36.09  ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A  1  145  ? 75.971  16.921  115.693  1.00 40.24  ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A  1  145  ? 76.637  16.139  114.984  1.00 38.31  ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A  1  145  ? 76.268  18.126  115.841  1.00 50.52  ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A  1  146  ? 73.416  16.474  119.181  1.00 42.63  ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A  1  146  ? 72.087  16.560  119.769  1.00 38.25  ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A  1  146  ? 71.128  16.991  118.674  1.00 43.07  ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A  1  146  ? 71.479  17.800  117.813  1.00 40.74  ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A  1  146  ? 72.045  17.587  120.900  1.00 44.03  ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A  1  146  ? 72.698  17.147  122.194  1.00 54.20  ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A  1  146  ? 72.660  18.274  123.218  1.00 61.62  ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A  1  146  ? 73.283  17.895  124.483  1.00 58.35  ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A  1  146  ? 72.619  17.396  125.520  1.00 58.65  ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A  1  146  ? 71.307  17.217  125.445  1.00 56.30  ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A  1  146  ? 73.267  17.077  126.633  1.00 52.95  ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A  1  147  ? 69.919  16.448  118.705  1.00 38.82  ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A  1  147  ? 68.913  16.790  117.718  1.00 35.07  ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A  1  147  ? 67.561  16.269  118.145  1.00 29.32  ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A  1  147  ? 67.427  15.680  119.215  1.00 32.78  ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A  1  148  ? 66.554  16.481  117.311  1.00 28.70  ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A  1  148  ? 65.216  16.019  117.639  1.00 33.86  ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A  1  148  ? 64.492  15.462  116.412  1.00 37.13  ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A  1  148  ? 64.470  16.081  115.345  1.00 30.42  ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A  1  148  ? 64.385  17.131  118.330  1.00 32.54  ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A  1  148  ? 64.349  18.395  117.476  1.00 35.02  ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A  1  148  ? 62.981  16.637  118.650  1.00 30.28  ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A  1  149  ? 63.913  14.277  116.573  1.00 36.07  ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A  1  149  ? 63.169  13.642  115.505  1.00 34.11  ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A  1  149  ? 64.042  12.773  114.625  1.00 33.44  ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A  1  149  ? 65.157  12.403  115.001  1.00 29.89  ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A  1  150  ? 63.524  12.446  113.446  1.00 36.46  ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A  1  150  ? 64.238  11.617  112.482  1.00 31.02  ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A  1  150  ? 64.691  12.473  111.308  1.00 27.80  ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A  1  150  ? 63.876  12.919  110.499  1.00 23.64  ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A  1  150  ? 63.333  10.474  112.004  1.00 26.71  ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A  1  150  ? 63.776  9.785   110.730  1.00 22.68  ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A  1  150  ? 64.867  8.928   110.721  1.00 25.83  ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A  1  150  ? 63.085  9.973   109.541  1.00 24.90  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A  1  150  ? 65.268  8.291   109.559  1.00 22.30  ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A  1  150  ? 63.479  9.341   108.376  1.00 22.38  ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A  1  150  ? 64.571  8.503   108.392  1.00 18.44  ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A  1  150  ? 64.966  7.873   107.237  1.00 19.43  ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A  1  151  ? 65.996  12.712  111.231  1.00 27.77  ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A  1  151  ? 66.557  13.498  110.141  1.00 27.56  ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A  1  151  ? 67.486  12.644  109.283  1.00 29.06  ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A  1  151  ? 68.591  12.297  109.708  1.00 23.28  ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A  1  151  ? 67.303  14.737  110.662  1.00 21.56  ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A  1  151  ? 67.912  15.510  109.507  1.00 21.55  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A  1  151  ? 66.354  15.622  111.456  1.00 21.61  ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A  1  152  ? 67.033  12.307  108.064  1.00 29.14  ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A  1  152  ? 67.781  11.454  107.137  1.00 26.86  ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A  1  152  ? 69.053  12.142  106.670  1.00 29.78  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A  1  152  ? 69.176  13.361  106.796  1.00 30.75  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A  1  152  ? 66.816  11.283  105.959  1.00 25.65  ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A  1  152  ? 65.467  11.643  106.499  1.00 24.29  ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A  1  152  ? 65.731  12.708  107.507  1.00 26.97  ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A  1  153  ? 69.985  11.363  106.133  1.00 29.44  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A  1  153  ? 71.266  11.892  105.685  1.00 27.56  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A  1  153  ? 71.108  12.933  104.577  1.00 30.01  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A  1  153  ? 71.874  13.893  104.501  1.00 31.64  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A  1  153  ? 72.174  10.758  105.228  1.00 25.85  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A  1  154  ? 70.107  12.745  103.725  1.00 29.43  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A  1  154  ? 69.892  13.645  102.602  1.00 25.96  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A  1  154  ? 69.540  15.043  103.086  1.00 27.14  ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A  1  154  ? 69.863  16.030  102.430  1.00 32.27  ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A  1  154  ? 68.784  13.122  101.685  1.00 29.69  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A  1  154  ? 68.895  11.641  101.341  1.00 43.80  ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A  1  154  ? 68.222  10.747  102.373  1.00 56.77  ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A  1  154  ? 67.035  10.989  102.686  1.00 48.11  ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A  1  154  ? 68.881  9.807   102.874  1.00 54.74  ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A  1  155  ? 68.869  15.124  104.230  1.00 27.87  ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A  1  155  ? 68.418  16.415  104.737  1.00 31.89  ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A  1  155  ? 69.508  17.268  105.397  1.00 30.83  ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A  1  155  ? 69.669  18.443  105.059  1.00 26.58  ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A  1  155  ? 67.223  16.246  105.680  1.00 26.44  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A  1  155  ? 66.507  17.559  105.958  1.00 54.14  ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A  1  155  ? 66.254  18.312  104.653  1.00 68.27  ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A  1  155  ? 65.843  19.758  104.891  1.00 70.91  ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A  1  155  ? 65.708  20.510  103.607  1.00 64.51  ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A  1  156  ? 70.245  16.685  106.339  1.00 29.56  ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A  1  156  ? 71.275  17.435  107.060  1.00 25.56  ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A  1  156  ? 72.597  17.543  106.305  1.00 31.33  ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A  1  156  ? 73.241  18.592  106.320  1.00 37.14  ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A  1  156  ? 71.484  16.897  108.482  1.00 23.42  ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A  1  156  ? 71.952  15.478  108.543  1.00 23.53  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A  1  156  ? 73.269  15.116  108.344  1.00 27.35  ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A  1  156  ? 71.287  14.329  108.807  1.00 24.92  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A  1  156  ? 73.389  13.809  108.471  1.00 23.71  ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A  1  156  ? 72.200  13.305  108.753  1.00 25.76  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A  1  157  ? 72.994  16.453  105.655  1.00 33.69  ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A  1  157  ? 74.215  16.419  104.867  1.00 37.20  ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A  1  157  ? 75.453  16.862  105.624  1.00 37.83  ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A  1  157  ? 76.287  17.592  105.091  1.00 41.64  ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A  1  158  ? 75.571  16.415  106.869  1.00 41.41  ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A  1  158  ? 76.679  16.817  107.726  1.00 36.43  ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A  1  158  ? 77.966  16.095  107.356  1.00 40.80  ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A  1  158  ? 78.035  14.868  107.384  1.00 44.01  ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A  1  158  ? 76.364  16.542  109.211  1.00 28.90  ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A  1  158  ? 75.260  17.478  109.706  1.00 28.83  ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A  1  158  ? 77.610  16.693  110.065  1.00 29.44  ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A  1  158  ? 74.847  17.226  111.141  1.00 29.76  ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A  1  159  ? 78.984  16.871  107.002  1.00 47.43  ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A  1  159  ? 80.309  16.332  106.718  1.00 46.10  ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A  1  159  ? 81.384  17.231  107.319  1.00 51.67  ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A  1  159  ? 81.431  18.431  107.035  1.00 49.31  ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A  1  159  ? 80.527  16.194  105.209  1.00 38.88  ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A  1  159  ? 79.623  15.172  104.539  1.00 32.78  ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A  1  159  ? 79.647  15.297  103.026  1.00 46.81  ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A  1  159  ? 81.020  14.976  102.458  1.00 46.41  ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A  1  159  ? 81.009  14.988  100.966  1.00 48.36  ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A  1  160  ? 82.237  16.649  108.157  1.00 51.63  ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A  1  160  ? 83.349  17.387  108.747  1.00 52.62  ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A  1  160  ? 84.477  17.567  107.734  1.00 52.22  ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A  1  160  ? 85.121  18.615  107.686  1.00 54.51  ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A  1  160  ? 83.858  16.681  110.005  1.00 55.34  ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A  1  160  ? 83.000  16.972  111.225  1.00 57.66  ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A  1  160  ? 81.889  17.519  111.054  1.00 55.95  ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A  1  160  ? 83.435  16.654  112.353  1.00 55.11  ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A  1  161  ? 84.708  16.546  106.918  1.00 49.10  ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A  1  161  ? 85.712  16.634  105.865  1.00 52.40  ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A  1  161  ? 85.178  16.149  104.516  1.00 49.55  ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A  1  161  ? 83.994  15.835  104.380  1.00 45.14  ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A  1  161  ? 86.980  15.873  106.259  1.00 52.20  ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A  1  161  ? 86.772  14.395  106.511  1.00 42.83  ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A  1  161  ? 88.036  13.774  107.065  1.00 41.75  ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A  1  161  ? 88.293  14.213  108.432  1.00 48.09  ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A  1  161  ? 89.392  13.917  109.119  1.00 57.25  ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A  1  161  ? 90.349  13.185  108.562  1.00 54.77  ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A  1  161  ? 89.537  14.360  110.362  1.00 52.14  ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A  1  162  ? 86.061  16.097  103.524  1.00 46.80  ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A  1  162  ? 85.676  15.765  102.154  1.00 47.98  ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A  1  162  ? 85.129  14.345  102.008  1.00 45.19  ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A  1  162  ? 84.116  14.126  101.342  1.00 49.70  ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A  1  162  ? 86.863  15.950  101.183  1.00 45.44  ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A  1  162  ? 87.447  17.359  101.314  1.00 51.14  ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A  1  162  ? 86.433  15.676  99.750   1.00 34.58  ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A  1  162  ? 86.469  18.464  100.979  1.00 49.21  ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A  1  163  ? 85.800  13.385  102.632  1.00 41.07  ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A  1  163  ? 85.439  11.976  102.489  1.00 38.74  ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A  1  163  ? 84.484  11.445  103.556  1.00 39.06  ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A  1  163  ? 84.236  10.242  103.628  1.00 35.63  ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A  1  163  ? 86.688  11.101  102.394  1.00 39.78  ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A  1  163  ? 87.359  11.200  101.041  1.00 47.10  ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A  1  163  ? 86.690  11.305  100.009  1.00 41.95  ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A  1  163  ? 88.687  11.177  101.035  1.00 54.40  ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A  1  164  ? 83.979  12.339  104.400  1.00 39.30  ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A  1  164  ? 83.014  11.956  105.426  1.00 34.49  ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A  1  164  ? 81.677  11.513  104.824  1.00 31.36  ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A  1  164  ? 81.241  12.029  103.795  1.00 28.48  ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A  1  164  ? 82.807  13.097  106.413  1.00 39.23  ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A  1  165  ? 81.034  10.553  105.481  1.00 31.38  ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A  1  165  ? 79.757  10.015  105.029  1.00 25.25  ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A  1  165  ? 78.615  10.501  105.916  1.00 27.12  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A  1  165  ? 78.572  10.176  107.103  1.00 27.95  ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A  1  165  ? 79.762  8.474   105.067  1.00 22.68  ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A  1  165  ? 80.902  7.918   104.212  1.00 21.36  ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A  1  165  ? 78.424  7.926   104.605  1.00 26.49  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A  1  165  ? 81.074  6.418   104.324  1.00 19.19  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A  1  166  ? 77.688  11.288  105.345  1.00 21.98  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A  1  166  ? 76.500  11.714  106.092  1.00 24.32  ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A  1  166  ? 75.668  10.503  106.500  1.00 29.32  ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A  1  166  ? 75.462  9.597   105.690  1.00 29.11  ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A  1  166  ? 75.738  12.570  105.078  1.00 21.67  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A  1  166  ? 76.765  13.025  104.117  1.00 26.19  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A  1  166  ? 77.736  11.888  104.003  1.00 23.53  ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A  1  167  ? 75.199  10.491  107.744  1.00 27.98  ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A  1  167  ? 74.530  9.323   108.301  1.00 23.47  ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A  1  167  ? 73.136  9.657   108.832  1.00 27.92  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A  1  167  ? 72.950  10.676  109.499  1.00 26.67  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A  1  167  ? 75.383  8.694   109.422  1.00 22.20  ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A  1  167  ? 74.626  7.577   110.123  1.00 29.76  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A  1  167  ? 76.693  8.177   108.854  1.00 22.04  ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A  1  168  ? 72.165  8.797   108.516  1.00 32.25  ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A  1  168  ? 70.792  8.935   109.002  1.00 29.78  ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A  1  168  ? 70.748  9.001   110.524  1.00 29.02  ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A  1  168  ? 71.301  8.140   111.213  1.00 27.18  ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A  1  168  ? 69.928  7.764   108.524  1.00 34.33  ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A  1  168  ? 69.766  7.728   107.017  1.00 37.13  ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A  1  168  ? 69.816  8.803   106.383  1.00 37.83  ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A  1  168  ? 69.579  6.621   106.469  1.00 41.93  ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A  1  169  ? 70.074  10.019  111.046  1.00 25.64  ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A  1  169  ? 70.045  10.235  112.483  1.00 25.57  ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A  1  169  ? 68.645  10.116  113.076  1.00 28.34  ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A  1  169  ? 67.754  10.913  112.771  1.00 24.19  ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A  1  169  ? 70.651  11.587  112.822  1.00 27.16  ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A  1  170  ? 68.465  9.116   113.933  1.00 31.22  ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A  1  170  ? 67.250  9.002   114.721  1.00 29.14  ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A  1  170  ? 67.600  9.551   116.091  1.00 36.63  ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A  1  170  ? 68.306  8.907   116.869  1.00 41.93  ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A  1  170  ? 66.827  7.535   114.896  1.00 23.86  ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A  1  170  ? 65.463  7.453   115.563  1.00 24.60  ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A  1  170  ? 66.821  6.816   113.558  1.00 24.82  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A  1  171  ? 67.095  10.739  116.393  1.00 30.86  ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A  1  171  ? 67.499  11.429  117.607  1.00 31.47  ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A  1  171  ? 66.781  10.945  118.865  1.00 36.68  ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A  1  171  ? 67.367  10.928  119.948  1.00 35.46  ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A  1  171  ? 67.358  12.939  117.431  1.00 27.11  ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A  1  171  ? 68.346  13.520  116.466  1.00 30.63  ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A  1  171  ? 69.704  13.475  116.738  1.00 32.74  ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A  1  171  ? 67.924  14.105  115.287  1.00 35.55  ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A  1  171  ? 70.624  14.005  115.852  1.00 27.74  ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A  1  171  ? 68.839  14.638  114.395  1.00 30.94  ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A  1  171  ? 70.190  14.589  114.680  1.00 25.26  ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A  1  172  ? 65.524  10.538  118.711  1.00 37.40  ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A  1  172  ? 64.689  10.180  119.854  1.00 39.73  ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A  1  172  ? 65.295  9.068   120.704  1.00 36.80  ? 172  SER A C     1 
ATOM   1314  O  O     . SER A  1  172  ? 65.541  7.965   120.217  1.00 34.64  ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A  1  172  ? 63.276  9.790   119.408  1.00 44.19  ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A  1  172  ? 62.429  9.574   120.528  1.00 36.74  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A  1  173  ? 65.560  9.380   121.980  1.00 40.55  ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A  1  173  ? 66.026  8.446   123.007  1.00 36.39  ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A  1  173  ? 64.916  7.482   123.416  1.00 36.96  ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A  1  173  ? 65.187  6.460   124.046  1.00 36.34  ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A  1  173  ? 66.382  9.368   124.172  1.00 39.09  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A  1  173  ? 65.468  10.526  124.009  1.00 34.14  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A  1  173  ? 65.340  10.730  122.530  1.00 39.92  ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A  1  174  ? 63.677  7.816   123.068  1.00 31.65  ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A  1  174  ? 62.538  7.008   123.478  1.00 28.94  ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A  1  174  ? 62.321  5.851   122.514  1.00 28.32  ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A  1  174  ? 62.032  6.061   121.336  1.00 32.46  ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A  1  174  ? 61.255  7.851   123.531  1.00 24.80  ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A  1  174  ? 60.073  6.990   123.934  1.00 19.65  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A  1  174  ? 61.427  9.014   124.492  1.00 32.50  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A  1  175  ? 62.469  4.631   123.020  1.00 23.46  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A  1  175  ? 62.221  3.443   122.215  1.00 19.51  ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A  1  175  ? 60.739  3.103   122.142  1.00 17.85  ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A  1  175  ? 60.220  2.808   121.068  1.00 18.07  ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A  1  175  ? 63.007  2.244   122.750  1.00 24.47  ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A  1  175  ? 64.513  2.410   122.680  1.00 34.18  ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A  1  175  ? 65.230  1.071   122.806  1.00 44.18  ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A  1  175  ? 66.681  1.224   122.713  1.00 63.93  ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A  1  175  ? 67.352  1.336   121.570  1.00 71.16  ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A  1  175  ? 66.707  1.314   120.410  1.00 68.61  ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A  1  175  ? 68.672  1.474   121.585  1.00 63.74  ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A  1  176  ? 60.051  3.154   123.278  1.00 22.05  ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A  1  176  ? 58.647  2.744   123.291  1.00 24.52  ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A  1  176  ? 57.807  3.447   124.356  1.00 23.84  ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A  1  176  ? 58.295  3.767   125.436  1.00 24.61  ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A  1  176  ? 58.545  1.223   123.453  1.00 24.07  ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A  1  176  ? 57.145  0.659   123.275  1.00 23.61  ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A  1  176  ? 57.183  -0.673  122.541  1.00 32.06  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A  1  176  ? 57.919  -1.691  123.285  1.00 37.78  ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A  1  176  ? 57.364  -2.774  123.821  1.00 42.37  ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A  1  176  ? 56.061  -2.993  123.691  1.00 31.61  ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A  1  176  ? 58.116  -3.645  124.482  1.00 46.93  ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A  1  177  ? 56.538  3.687   124.040  1.00 21.75  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A  1  177  ? 55.594  4.239   125.003  1.00 22.18  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A  1  177  ? 54.251  3.523   124.904  1.00 23.85  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A  1  177  ? 53.676  3.414   123.823  1.00 27.58  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A  1  177  ? 55.355  5.748   124.781  1.00 17.32  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A  1  177  ? 54.275  6.253   125.719  1.00 17.57  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A  1  177  ? 56.638  6.532   124.984  1.00 18.10  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A  1  178  ? 53.753  3.034   126.033  1.00 22.24  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A  1  178  ? 52.416  2.453   126.080  1.00 22.82  ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A  1  178  ? 51.722  2.954   127.333  1.00 28.44  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A  1  178  ? 52.379  3.225   128.327  1.00 29.74  ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A  1  178  ? 52.494  0.944   126.090  1.00 23.91  ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A  1  179  ? 50.403  3.100   127.299  1.00 27.02  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A  1  179  ? 49.709  3.499   128.518  1.00 22.20  ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A  1  179  ? 48.421  2.729   128.784  1.00 24.01  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A  1  179  ? 47.606  2.503   127.889  1.00 22.34  ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A  1  179  ? 49.509  5.021   128.605  1.00 21.32  ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A  1  179  ? 48.426  5.555   127.720  1.00 16.16  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A  1  179  ? 48.706  5.957   126.430  1.00 16.97  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A  1  179  ? 47.132  5.682   128.189  1.00 17.08  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A  1  179  ? 47.711  6.457   125.618  1.00 19.79  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A  1  179  ? 46.135  6.181   127.384  1.00 17.58  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A  1  179  ? 46.424  6.570   126.097  1.00 17.91  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A  1  180  ? 48.263  2.333   130.042  1.00 27.12  ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A  1  180  ? 47.167  1.486   130.472  1.00 22.28  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A  1  180  ? 46.162  2.315   131.253  1.00 21.52  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A  1  180  ? 46.535  3.086   132.136  1.00 24.39  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A  1  180  ? 47.714  0.374   131.368  1.00 28.81  ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A  1  180  ? 46.740  -0.755  131.658  1.00 39.88  ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A  1  180  ? 46.919  -1.934  130.721  1.00 44.13  ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A  1  180  ? 47.655  -1.855  129.735  1.00 44.46  ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A  1  180  ? 46.251  -3.041  131.031  1.00 43.58  ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A  1  181  ? 44.886  2.167   130.919  1.00 20.56  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A  1  181  ? 43.830  2.814   131.684  1.00 21.81  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A  1  181  ? 43.013  1.758   132.412  1.00 25.71  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A  1  181  ? 42.269  0.999   131.787  1.00 27.50  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A  1  181  ? 42.911  3.649   130.784  1.00 18.27  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A  1  181  ? 41.732  4.175   131.577  1.00 22.56  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A  1  181  ? 43.690  4.794   130.162  1.00 19.09  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A  1  182  ? 43.153  1.711   133.734  1.00 26.69  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A  1  182  ? 42.485  0.680   134.524  1.00 28.45  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A  1  182  ? 41.376  1.252   135.400  1.00 31.63  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A  1  182  ? 41.478  2.372   135.890  1.00 30.05  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A  1  182  ? 43.502  -0.090  135.370  1.00 30.04  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A  1  182  ? 44.342  -1.074  134.566  1.00 37.33  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A  1  182  ? 45.594  -1.524  135.298  1.00 45.59  ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A  1  182  ? 46.102  -2.623  134.984  1.00 41.13  ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A  1  182  ? 46.079  -0.775  136.175  1.00 47.55  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A  1  183  ? 40.313  0.479   135.589  1.00 33.67  ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A  1  183  ? 39.178  0.941   136.376  1.00 34.05  ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A  1  183  ? 39.548  1.069   137.851  1.00 34.48  ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A  1  183  ? 40.180  0.177   138.419  1.00 30.38  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A  1  183  ? 37.984  0.000   136.200  1.00 32.53  ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A  1  183  ? 36.710  0.553   136.812  1.00 39.95  ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A  1  183  ? 36.689  1.753   137.159  1.00 40.23  ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A  1  183  ? 35.726  -0.208  136.936  1.00 43.69  ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A  1  184  ? 39.169  2.192   138.458  1.00 35.44  ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A  1  184  ? 39.404  2.409   139.887  1.00 28.11  ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A  1  184  ? 38.228  3.125   140.550  1.00 35.11  ? 184  THR A C     1 
ATOM   1412  O  O     . THR A  1  184  ? 37.320  3.607   139.869  1.00 42.18  ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A  1  184  ? 40.701  3.198   140.144  1.00 28.78  ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A  1  184  ? 40.910  3.333   141.555  1.00 26.74  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A  1  184  ? 40.621  4.578   139.515  1.00 32.69  ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A  1  185  ? 38.239  3.177   141.881  1.00 42.56  ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A  1  185  ? 37.190  3.872   142.629  1.00 47.78  ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A  1  185  ? 37.722  4.618   143.854  1.00 43.14  ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A  1  185  ? 38.732  4.230   144.446  1.00 36.27  ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A  1  185  ? 36.085  2.897   143.054  1.00 53.04  ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A  1  185  ? 36.554  1.771   143.969  1.00 51.95  ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A  1  185  ? 35.378  0.976   144.529  1.00 60.03  ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A  1  185  ? 34.570  1.766   145.455  1.00 78.77  ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A  1  185  ? 33.244  1.863   145.401  1.00 79.48  ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A  1  185  ? 32.566  1.215   144.462  1.00 73.04  ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A  1  185  ? 32.595  2.608   146.288  1.00 68.46  ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A  1  186  ? 37.042  5.704   144.211  1.00 45.74  ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A  1  186  ? 37.321  6.426   145.449  1.00 49.62  ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A  1  186  ? 36.024  6.859   146.124  1.00 56.18  ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A  1  186  ? 35.198  7.546   145.520  1.00 50.16  ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A  1  186  ? 38.203  7.646   145.193  1.00 47.89  ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A  1  186  ? 38.552  8.435   146.456  1.00 45.50  ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A  1  186  ? 39.399  7.587   147.389  1.00 49.60  ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A  1  186  ? 39.261  9.734   146.115  1.00 50.31  ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A  1  187  ? 35.856  6.468   147.382  1.00 61.62  ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A  1  187  ? 34.627  6.744   148.100  1.00 62.31  ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A  1  187  ? 33.463  5.994   147.482  1.00 68.22  ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A  1  187  ? 33.527  4.777   147.290  1.00 59.44  ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A  1  188  ? 32.396  6.723   147.168  1.00 71.49  ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A  1  188  ? 31.211  6.123   146.563  1.00 76.52  ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A  1  188  ? 31.213  6.245   145.038  1.00 71.95  ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A  1  188  ? 30.304  5.751   144.369  1.00 65.11  ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A  1  188  ? 29.938  6.744   147.148  1.00 80.48  ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A  1  188  ? 29.728  6.464   148.634  1.00 82.04  ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A  1  188  ? 29.369  5.014   148.915  1.00 83.78  ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A  1  188  ? 28.363  4.502   148.420  1.00 84.31  ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A  1  188  ? 30.194  4.344   149.713  1.00 75.35  ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A  1  189  ? 32.238  6.899   144.496  1.00 69.38  ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A  1  189  ? 32.354  7.087   143.053  1.00 56.41  ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A  1  189  ? 32.847  5.818   142.373  1.00 52.21  ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A  1  189  ? 33.688  5.099   142.912  1.00 52.41  ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A  1  189  ? 33.324  8.222   142.728  1.00 46.96  ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A  1  189  ? 33.148  9.478   143.551  1.00 50.82  ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A  1  189  ? 34.291  10.436  143.271  1.00 56.18  ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A  1  189  ? 34.443  11.451  144.309  1.00 67.66  ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A  1  189  ? 34.100  12.726  144.162  1.00 72.66  ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A  1  189  ? 34.277  13.581  145.161  1.00 69.75  ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A  1  189  ? 33.585  13.147  143.013  1.00 64.04  ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A  1  190  ? 32.330  5.551   141.180  1.00 48.05  ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A  1  190  ? 32.790  4.412   140.397  1.00 52.43  ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A  1  190  ? 33.237  4.845   139.006  1.00 48.35  ? 190  THR A C     1 
ATOM   1462  O  O     . THR A  1  190  ? 33.151  6.024   138.654  1.00 41.74  ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A  1  190  ? 31.699  3.329   140.264  1.00 55.00  ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A  1  190  ? 30.523  3.896   139.671  1.00 49.37  ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A  1  190  ? 31.351  2.751   141.628  1.00 52.43  ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A  1  191  ? 33.709  3.876   138.228  1.00 46.19  ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A  1  191  ? 34.170  4.105   136.863  1.00 42.65  ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A  1  191  ? 35.214  5.217   136.782  1.00 38.34  ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A  1  191  ? 35.103  6.122   135.957  1.00 41.06  ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A  1  191  ? 32.982  4.399   135.936  1.00 50.87  ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A  1  191  ? 33.348  4.308   134.457  1.00 64.52  ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A  1  191  ? 34.485  3.893   134.139  1.00 56.72  ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A  1  191  ? 32.489  4.643   133.613  1.00 62.10  ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A  1  192  ? 36.223  5.160   137.645  1.00 37.93  ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A  1  192  ? 37.289  6.150   137.571  1.00 35.57  ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A  1  192  ? 38.513  5.590   136.856  1.00 31.39  ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A  1  192  ? 38.591  4.390   136.569  1.00 30.32  ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A  1  192  ? 37.673  6.647   138.967  1.00 31.95  ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A  1  192  ? 36.539  7.226   139.814  1.00 32.29  ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A  1  192  ? 37.105  7.854   141.077  1.00 37.86  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A  1  192  ? 35.728  8.235   139.014  1.00 33.17  ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A  1  193  ? 39.492  6.458   136.626  1.00 30.85  ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A  1  193  ? 40.627  6.125   135.776  1.00 30.74  ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A  1  193  ? 41.945  6.062   136.535  1.00 27.87  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A  1  193  ? 42.326  7.002   137.230  1.00 28.83  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A  1  193  ? 40.753  7.131   134.624  1.00 31.63  ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A  1  193  ? 39.753  6.880   133.505  1.00 33.19  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A  1  193  ? 39.230  5.749   133.406  1.00 37.80  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A  1  193  ? 39.500  7.815   132.714  1.00 28.48  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A  1  194  ? 42.637  4.941   136.382  1.00 25.98  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A  1  194  ? 43.991  4.780   136.882  1.00 26.94  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A  1  194  ? 44.918  4.723   135.681  1.00 29.08  ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A  1  194  ? 44.916  3.740   134.927  1.00 30.75  ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A  1  194  ? 44.108  3.491   137.691  1.00 29.21  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A  1  194  ? 45.527  3.119   138.077  1.00 27.50  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A  1  194  ? 45.554  1.801   138.832  1.00 35.73  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A  1  194  ? 46.974  1.377   139.165  1.00 42.73  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A  1  194  ? 47.001  0.092   139.917  1.00 41.22  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A  1  195  ? 45.707  5.779   135.502  1.00 23.92  ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A  1  195  ? 46.559  5.892   134.324  1.00 21.26  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A  1  195  ? 47.966  5.383   134.598  1.00 21.53  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A  1  195  ? 48.578  5.750   135.592  1.00 22.20  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A  1  195  ? 46.613  7.344   133.851  1.00 23.22  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A  1  195  ? 47.672  7.674   132.798  1.00 26.83  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A  1  195  ? 47.467  6.845   131.537  1.00 22.63  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A  1  195  ? 47.660  9.162   132.481  1.00 25.67  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A  1  196  ? 48.482  4.534   133.718  1.00 22.14  ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A  1  196  ? 49.841  4.036   133.883  1.00 22.01  ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A  1  196  ? 50.665  4.205   132.611  1.00 26.14  ? 196  THR A C     1 
ATOM   1510  O  O     . THR A  1  196  ? 50.392  3.567   131.596  1.00 29.78  ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A  1  196  ? 49.849  2.558   134.289  1.00 24.59  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A  1  196  ? 48.717  2.283   135.125  1.00 29.03  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A  1  196  ? 51.132  2.229   135.037  1.00 29.03  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A  1  197  ? 51.681  5.058   132.679  1.00 25.17  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A  1  197  ? 52.558  5.315   131.545  1.00 24.00  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A  1  197  ? 53.811  4.459   131.617  1.00 27.17  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A  1  197  ? 54.649  4.644   132.496  1.00 31.86  ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A  1  197  ? 52.950  6.791   131.499  1.00 22.88  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A  1  197  ? 52.012  7.718   130.731  1.00 22.38  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A  1  197  ? 52.352  9.170   131.016  1.00 23.21  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A  1  197  ? 52.114  7.426   129.247  1.00 21.43  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A  1  198  ? 53.928  3.524   130.682  1.00 24.70  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A  1  198  ? 55.103  2.680   130.557  1.00 21.18  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A  1  198  ? 56.005  3.229   129.466  1.00 25.11  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A  1  198  ? 55.581  3.382   128.315  1.00 26.88  ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A  1  198  ? 54.695  1.252   130.218  1.00 19.71  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A  1  198  ? 53.710  0.662   131.191  1.00 22.53  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A  1  198  ? 53.993  -0.804  131.405  1.00 26.20  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A  1  198  ? 53.678  -1.611  130.234  1.00 32.66  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A  1  198  ? 54.151  -2.836  130.030  1.00 36.20  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A  1  198  ? 53.813  -3.505  128.937  1.00 40.76  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A  1  198  ? 54.970  -3.387  130.915  1.00 33.42  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A  1  199  ? 57.249  3.523   129.834  1.00 27.77  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A  1  199  ? 58.197  4.145   128.916  1.00 25.71  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A  1  199  ? 59.530  3.409   128.871  1.00 26.49  ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A  1  199  ? 60.192  3.238   129.896  1.00 30.94  ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A  1  199  ? 58.474  5.612   129.306  1.00 22.62  ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A  1  199  ? 57.181  6.428   129.290  1.00 23.52  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A  1  199  ? 59.496  6.229   128.370  1.00 19.69  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A  1  199  ? 57.361  7.844   129.777  1.00 27.99  ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A  1  200  ? 59.914  2.975   127.675  1.00 24.14  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A  1  200  ? 61.239  2.421   127.436  1.00 26.21  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A  1  200  ? 62.095  3.439   126.693  1.00 27.63  ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A  1  200  ? 61.705  3.921   125.620  1.00 31.42  ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A  1  200  ? 61.154  1.159   126.579  1.00 24.60  ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A  1  200  ? 60.443  0.007   127.198  1.00 24.89  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A  1  200  ? 61.011  -1.113  127.730  1.00 23.37  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A  1  200  ? 59.028  -0.161  127.323  1.00 29.50  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A  1  200  ? 60.037  -1.966  128.187  1.00 23.17  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A  1  200  ? 58.809  -1.404  127.949  1.00 32.21  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A  1  200  ? 57.923  0.621   126.970  1.00 29.20  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A  1  200  ? 57.530  -1.884  128.232  1.00 36.01  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A  1  200  ? 56.654  0.144   127.252  1.00 29.42  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A  1  200  ? 56.468  -1.096  127.876  1.00 31.99  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A  1  201  ? 63.257  3.759   127.259  1.00 28.74  ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A  1  201  ? 64.248  4.585   126.574  1.00 32.91  ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A  1  201  ? 65.584  3.847   126.441  1.00 39.46  ? 201  THR A C     1 
ATOM   1558  O  O     . THR A  1  201  ? 65.730  2.713   126.901  1.00 34.98  ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A  1  201  ? 64.467  5.943   127.276  1.00 30.83  ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A  1  201  ? 64.905  5.728   128.623  1.00 38.52  ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A  1  201  ? 63.182  6.752   127.287  1.00 27.05  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A  1  202  ? 66.554  4.501   125.811  1.00 43.87  ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A  1  202  ? 67.847  3.886   125.527  1.00 44.61  ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A  1  202  ? 68.843  4.080   126.664  1.00 49.70  ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A  1  202  ? 69.910  3.465   126.678  1.00 49.52  ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A  1  202  ? 68.429  4.464   124.235  1.00 46.53  ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A  1  202  ? 68.550  5.980   124.276  1.00 45.58  ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A  1  202  ? 67.977  6.598   125.198  1.00 46.82  ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A  1  202  ? 69.208  6.557   123.383  1.00 40.59  ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A  1  203  ? 68.492  4.941   127.613  1.00 47.29  ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A  1  203  ? 69.392  5.275   128.699  1.00 46.04  ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A  1  203  ? 70.058  6.624   128.500  1.00 46.79  ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A  1  203  ? 70.647  7.171   129.433  1.00 49.15  ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A  1  204  ? 69.977  7.156   127.282  1.00 40.89  ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A  1  204  ? 70.505  8.484   126.986  1.00 39.20  ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A  1  204  ? 69.819  9.517   127.865  1.00 41.48  ? 204  SER A C     1 
ATOM   1577  O  O     . SER A  1  204  ? 70.471  10.367  128.471  1.00 47.70  ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A  1  204  ? 70.298  8.837   125.514  1.00 44.51  ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A  1  204  ? 70.596  10.202  125.276  1.00 48.85  ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A  1  205  ? 68.494  9.450   127.914  1.00 38.85  ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A  1  205  ? 67.732  10.188  128.910  1.00 42.14  ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A  1  205  ? 66.794  9.215   129.624  1.00 42.42  ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A  1  205  ? 66.330  8.237   129.035  1.00 38.13  ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A  1  205  ? 66.950  11.383  128.304  1.00 38.59  ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A  1  205  ? 67.846  12.197  127.377  1.00 34.50  ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A  1  205  ? 65.712  10.908  127.572  1.00 41.24  ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A  1  206  ? 66.541  9.470   130.903  1.00 49.35  ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A  1  206  ? 65.738  8.564   131.713  1.00 44.67  ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A  1  206  ? 64.255  8.758   131.420  1.00 41.46  ? 206  THR A C     1 
ATOM   1590  O  O     . THR A  1  206  ? 63.842  9.844   131.008  1.00 39.59  ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A  1  206  ? 65.995  8.778   133.220  1.00 50.78  ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A  1  206  ? 65.207  9.877   133.697  1.00 55.42  ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A  1  206  ? 67.468  9.052   133.476  1.00 48.52  ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A  1  207  ? 63.454  7.697   131.618  1.00 38.49  ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A  1  207  ? 62.000  7.762   131.450  1.00 39.85  ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A  1  207  ? 61.373  8.942   132.187  1.00 38.90  ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A  1  207  ? 60.470  9.587   131.649  1.00 37.17  ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A  1  207  ? 61.530  6.444   132.065  1.00 36.32  ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A  1  207  ? 62.649  5.505   131.783  1.00 33.96  ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A  1  207  ? 63.910  6.321   131.890  1.00 36.24  ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A  1  208  ? 61.854  9.228   133.394  1.00 37.57  ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A  1  208  ? 61.323  10.343  134.172  1.00 42.99  ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A  1  208  ? 61.646  11.683  133.517  1.00 39.34  ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A  1  208  ? 60.794  12.572  133.458  1.00 40.24  ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A  1  208  ? 61.843  10.314  135.613  1.00 44.19  ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A  1  208  ? 61.318  11.437  136.514  1.00 37.72  ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A  1  208  ? 59.797  11.483  136.490  1.00 35.13  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A  1  208  ? 61.824  11.276  137.937  1.00 36.48  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A  1  209  ? 62.876  11.820  133.030  1.00 35.86  ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A  1  209  ? 63.298  13.033  132.341  1.00 37.94  ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A  1  209  ? 62.413  13.264  131.123  1.00 39.46  ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A  1  209  ? 61.859  14.356  130.931  1.00 38.11  ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A  1  209  ? 64.766  12.925  131.919  1.00 41.06  ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A  1  209  ? 65.751  12.903  133.083  1.00 49.02  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A  1  209  ? 67.166  12.550  132.653  1.00 48.95  ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A  1  209  ? 68.021  12.318  133.534  1.00 44.23  ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A  1  209  ? 67.423  12.502  131.432  1.00 55.58  ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A  1  210  ? 62.275  12.213  130.321  1.00 37.08  ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A  1  210  ? 61.445  12.241  129.124  1.00 38.00  ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A  1  210  ? 60.020  12.677  129.446  1.00 35.20  ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A  1  210  ? 59.501  13.616  128.843  1.00 31.33  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A  1  210  ? 61.447  10.875  128.451  1.00 34.41  ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A  1  211  ? 59.401  11.991  130.405  1.00 34.97  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A  1  211  ? 58.045  12.310  130.838  1.00 31.06  ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A  1  211  ? 57.925  13.775  131.243  1.00 32.43  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A  1  211  ? 56.990  14.470  130.834  1.00 35.63  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A  1  211  ? 57.638  11.408  132.005  1.00 32.47  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A  1  211  ? 56.306  11.723  132.689  1.00 35.42  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A  1  211  ? 55.145  11.579  131.717  1.00 31.54  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A  1  211  ? 56.109  10.830  133.904  1.00 33.40  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A  1  212  ? 58.886  14.241  132.035  1.00 33.91  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A  1  212  ? 58.894  15.622  132.501  1.00 33.61  ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A  1  212  ? 58.921  16.635  131.362  1.00 35.24  ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A  1  212  ? 58.065  17.523  131.295  1.00 34.87  ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A  1  212  ? 60.060  15.868  133.462  1.00 33.62  ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A  1  212  ? 59.817  15.278  134.839  1.00 41.94  ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A  1  212  ? 58.682  15.233  135.315  1.00 44.33  ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A  1  212  ? 60.884  14.824  135.487  1.00 41.12  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A  1  213  ? 59.890  16.501  130.458  1.00 35.33  ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A  1  213  ? 60.001  17.472  129.371  1.00 35.05  ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A  1  213  ? 58.881  17.335  128.348  1.00 33.95  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A  1  213  ? 58.580  18.280  127.619  1.00 38.02  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A  1  213  ? 61.377  17.431  128.705  1.00 30.44  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A  1  213  ? 61.880  16.055  128.363  1.00 28.91  ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A  1  213  ? 63.353  16.068  128.016  1.00 38.23  ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A  1  213  ? 63.844  17.011  127.393  1.00 35.80  ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A  1  213  ? 64.071  15.028  128.430  1.00 36.53  ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A  1  214  ? 58.259  16.161  128.305  1.00 30.09  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A  1  214  ? 57.080  15.955  127.474  1.00 29.90  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A  1  214  ? 55.928  16.778  128.036  1.00 29.39  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A  1  214  ? 55.241  17.505  127.306  1.00 27.66  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A  1  214  ? 56.713  14.483  127.431  1.00 25.81  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A  1  215  ? 55.729  16.659  129.346  1.00 28.57  ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A  1  215  ? 54.729  17.456  130.044  1.00 30.96  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A  1  215  ? 54.985  18.944  129.818  1.00 32.21  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A  1  215  ? 54.055  19.715  129.560  1.00 28.35  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A  1  215  ? 54.710  17.139  131.554  1.00 28.57  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A  1  215  ? 53.917  18.191  132.318  1.00 32.51  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A  1  215  ? 54.136  15.749  131.795  1.00 26.40  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A  1  216  ? 56.252  19.340  129.893  1.00 30.76  ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A  1  216  ? 56.614  20.731  129.659  1.00 30.89  ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A  1  216  ? 56.275  21.171  128.237  1.00 33.96  ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A  1  216  ? 55.789  22.282  128.030  1.00 41.70  ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A  1  216  ? 58.092  20.982  129.970  1.00 32.83  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A  1  216  ? 58.568  22.406  129.670  1.00 48.60  ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A  1  216  ? 57.782  23.486  130.414  1.00 46.19  ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A  1  216  ? 57.189  23.194  131.476  1.00 37.90  ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A  1  216  ? 57.762  24.638  129.929  1.00 43.45  ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A  1  217  ? 56.524  20.299  127.263  1.00 31.58  ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A  1  217  ? 56.147  20.581  125.878  1.00 33.97  ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A  1  217  ? 54.642  20.809  125.745  1.00 30.15  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A  1  217  ? 54.203  21.774  125.112  1.00 25.88  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A  1  217  ? 56.570  19.447  124.921  1.00 29.51  ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A  1  217  ? 58.084  19.461  124.712  1.00 32.18  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A  1  217  ? 55.861  19.582  123.579  1.00 23.26  ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A  1  217  ? 58.571  18.419  123.723  1.00 35.16  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A  1  218  ? 53.855  19.922  126.348  1.00 24.86  ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A  1  218  ? 52.404  20.035  126.265  1.00 23.62  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A  1  218  ? 51.903  21.325  126.917  1.00 31.25  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A  1  218  ? 51.058  22.025  126.354  1.00 30.41  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A  1  218  ? 51.728  18.810  126.887  1.00 27.00  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A  1  218  ? 50.217  18.667  126.674  1.00 25.99  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A  1  218  ? 49.849  18.877  125.215  1.00 19.58  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A  1  218  ? 49.744  17.302  127.148  1.00 19.13  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A  1  219  ? 52.440  21.635  128.096  1.00 33.01  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A  1  219  ? 52.095  22.857  128.823  1.00 32.74  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A  1  219  ? 52.397  24.077  127.959  1.00 28.20  ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A  1  219  ? 51.537  24.943  127.735  1.00 27.93  ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A  1  219  ? 52.896  22.923  130.131  1.00 33.60  ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A  1  219  ? 52.324  23.844  131.211  1.00 38.73  ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A  1  219  ? 52.860  25.264  131.102  1.00 36.48  ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A  1  219  ? 54.320  25.296  131.067  1.00 38.89  ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A  1  219  ? 55.038  26.382  130.790  1.00 44.42  ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A  1  219  ? 54.433  27.534  130.523  1.00 36.98  ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A  1  219  ? 56.362  26.317  130.777  1.00 40.51  ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A  1  220  ? 53.631  24.121  127.469  1.00 23.67  ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A  1  220  ? 54.096  25.195  126.610  1.00 29.50  ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A  1  220  ? 53.174  25.365  125.411  1.00 35.47  ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A  1  220  ? 52.878  26.485  125.001  1.00 40.27  ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A  1  220  ? 55.524  24.913  126.142  1.00 37.82  ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A  1  220  ? 56.081  25.945  125.174  1.00 54.84  ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A  1  220  ? 57.511  25.648  124.760  1.00 62.92  ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A  1  220  ? 58.195  24.889  125.481  1.00 56.84  ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A  1  220  ? 57.948  26.172  123.713  1.00 72.12  ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A  1  221  ? 52.711  24.252  124.856  1.00 34.48  ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A  1  221  ? 51.796  24.315  123.724  1.00 34.43  ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A  1  221  ? 50.436  24.861  124.138  1.00 35.15  ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A  1  221  ? 49.781  25.558  123.365  1.00 38.15  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A  1  221  ? 51.648  22.949  123.055  1.00 31.85  ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A  1  221  ? 52.563  22.753  121.888  1.00 29.53  ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A  1  221  ? 53.917  22.540  122.032  1.00 29.30  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A  1  221  ? 52.320  22.749  120.556  1.00 30.25  ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A  1  221  ? 54.468  22.408  120.838  1.00 32.80  ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A  1  221  ? 53.521  22.530  119.926  1.00 35.80  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A  1  222  ? 50.018  24.546  125.359  1.00 32.04  ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A  1  222  ? 48.753  25.051  125.874  1.00 31.69  ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A  1  222  ? 48.807  26.557  126.092  1.00 41.47  ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A  1  222  ? 47.778  27.237  126.047  1.00 41.94  ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A  1  222  ? 48.379  24.341  127.170  1.00 26.30  ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A  1  222  ? 47.781  22.954  126.979  1.00 23.88  ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A  1  222  ? 47.576  22.293  128.324  1.00 28.56  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A  1  222  ? 46.471  23.064  126.224  1.00 23.05  ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A  1  223  ? 50.013  27.072  126.330  1.00 39.38  ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A  1  223  ? 50.215  28.512  126.489  1.00 34.20  ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A  1  223  ? 49.706  29.303  125.282  1.00 40.10  ? 223  THR A C     1 
ATOM   1726  O  O     . THR A  1  223  ? 49.221  30.424  125.423  1.00 49.02  ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A  1  223  ? 51.704  28.847  126.694  1.00 33.62  ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A  1  223  ? 52.252  28.003  127.713  1.00 38.38  ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A  1  223  ? 51.884  30.307  127.091  1.00 44.62  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A  1  224  ? 49.800  28.697  124.103  1.00 42.19  ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A  1  224  ? 49.530  29.377  122.836  1.00 42.15  ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A  1  224  ? 48.106  29.909  122.664  1.00 41.60  ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A  1  224  ? 47.843  30.702  121.759  1.00 39.83  ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A  1  224  ? 49.878  28.453  121.668  1.00 39.49  ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A  1  224  ? 51.333  28.042  121.629  1.00 42.87  ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A  1  224  ? 52.328  28.899  122.083  1.00 42.50  ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A  1  224  ? 51.712  26.796  121.142  1.00 40.80  ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A  1  224  ? 53.661  28.529  122.051  1.00 42.61  ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A  1  224  ? 53.044  26.417  121.108  1.00 42.40  ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A  1  224  ? 54.014  27.288  121.564  1.00 41.24  ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A  1  224  ? 55.341  26.920  121.534  1.00 37.82  ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A  1  225  ? 47.190  29.474  123.523  1.00 41.77  ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A  1  225  ? 45.799  29.907  123.431  1.00 48.63  ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A  1  225  ? 45.542  31.194  124.214  1.00 51.70  ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A  1  225  ? 44.430  31.724  124.203  1.00 46.68  ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A  1  225  ? 44.860  28.805  123.932  1.00 44.05  ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A  1  225  ? 44.862  27.567  123.080  1.00 44.38  ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A  1  225  ? 45.757  26.536  123.329  1.00 39.98  ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A  1  225  ? 43.964  27.429  122.032  1.00 40.14  ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A  1  225  ? 45.758  25.392  122.544  1.00 31.36  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A  1  225  ? 43.962  26.288  121.244  1.00 33.29  ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A  1  225  ? 44.860  25.269  121.502  1.00 26.31  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A  1  226  ? 46.578  31.698  124.877  1.00 51.10  ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A  1  226  ? 46.431  32.816  125.810  1.00 59.90  ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A  1  226  ? 46.187  34.175  125.147  1.00 71.19  ? 226  SER A C     1 
ATOM   1756  O  O     . SER A  1  226  ? 45.588  35.065  125.754  1.00 73.99  ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A  1  226  ? 47.641  32.899  126.750  1.00 60.72  ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A  1  226  ? 48.848  33.091  126.029  1.00 55.71  ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A  1  227  ? 46.644  34.334  123.910  1.00 64.43  ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A  1  227  ? 46.543  35.622  123.231  1.00 59.58  ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A  1  227  ? 45.727  35.536  121.950  1.00 51.04  ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A  1  227  ? 46.281  35.310  120.875  1.00 55.69  ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A  1  227  ? 47.938  36.175  122.925  1.00 64.29  ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A  1  227  ? 47.893  37.539  122.259  1.00 71.47  ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A  1  227  ? 47.036  38.367  122.569  1.00 73.68  ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A  1  227  ? 48.816  37.775  121.332  1.00 67.70  ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A  1  228  ? 44.402  35.717  122.060  1.00 46.16  ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A  1  228  ? 43.521  35.607  120.892  1.00 49.94  ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A  1  228  ? 43.771  36.707  119.864  1.00 51.26  ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A  1  228  ? 44.586  37.600  120.090  1.00 55.41  ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A  1  228  ? 42.119  35.769  121.493  1.00 44.54  ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A  1  228  ? 42.278  35.440  122.943  1.00 49.06  ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A  1  228  ? 43.646  35.924  123.305  1.00 47.37  ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A  1  229  ? 43.066  36.629  118.740  1.00 49.59  ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A  1  229  ? 43.149  37.646  117.701  1.00 50.14  ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A  1  229  ? 41.835  37.663  116.934  1.00 45.89  ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A  1  229  ? 41.209  36.622  116.745  1.00 45.56  ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A  1  229  ? 44.304  37.343  116.746  1.00 51.96  ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A  1  229  ? 44.935  38.568  116.102  1.00 63.45  ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A  1  229  ? 46.206  39.009  116.808  1.00 70.35  ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A  1  229  ? 46.545  38.503  117.880  1.00 63.82  ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A  1  229  ? 46.921  39.952  116.203  1.00 73.85  ? 229  GLN A NE2   1 
ATOM   1783  N  N     . ALA A  1  230  ? 41.420  38.840  116.484  1.00 53.76  ? 230  ALA A N     1 
ATOM   1784  C  CA    . ALA A  1  230  ? 40.171  38.954  115.744  1.00 62.65  ? 230  ALA A CA    1 
ATOM   1785  C  C     . ALA A  1  230  ? 40.339  38.375  114.346  1.00 69.60  ? 230  ALA A C     1 
ATOM   1786  O  O     . ALA A  1  230  ? 41.455  38.279  113.837  1.00 70.69  ? 230  ALA A O     1 
ATOM   1787  C  CB    . ALA A  1  230  ? 39.719  40.405  115.676  1.00 65.02  ? 230  ALA A CB    1 
ATOM   1788  N  N     . ALA A  1  231  ? 39.230  37.978  113.734  1.00 78.83  ? 231  ALA A N     1 
ATOM   1789  C  CA    . ALA A  1  231  ? 39.257  37.501  112.358  1.00 94.53  ? 231  ALA A CA    1 
ATOM   1790  C  C     . ALA A  1  231  ? 38.968  38.653  111.402  1.00 112.20 ? 231  ALA A C     1 
ATOM   1791  O  O     . ALA A  1  231  ? 37.877  39.227  111.413  1.00 112.78 ? 231  ALA A O     1 
ATOM   1792  C  CB    . ALA A  1  231  ? 38.257  36.377  112.162  1.00 80.04  ? 231  ALA A CB    1 
ATOM   1793  N  N     . ALA A  1  232  ? 39.953  38.988  110.575  1.00 116.73 ? 232  ALA A N     1 
ATOM   1794  C  CA    . ALA A  1  232  ? 39.836  40.110  109.651  1.00 119.45 ? 232  ALA A CA    1 
ATOM   1795  C  C     . ALA A  1  232  ? 39.243  39.669  108.319  1.00 126.23 ? 232  ALA A C     1 
ATOM   1796  O  O     . ALA A  1  232  ? 39.148  40.461  107.381  1.00 130.50 ? 232  ALA A O     1 
ATOM   1797  C  CB    . ALA A  1  232  ? 41.194  40.765  109.439  1.00 123.13 ? 232  ALA A CB    1 
ATOM   1798  N  N     . VAL A  1  233  ? 38.853  38.398  108.246  1.00 124.83 ? 233  VAL A N     1 
ATOM   1799  C  CA    . VAL A  1  233  ? 38.308  37.815  107.022  1.00 136.64 ? 233  VAL A CA    1 
ATOM   1800  C  C     . VAL A  1  233  ? 37.047  38.544  106.550  1.00 140.20 ? 233  VAL A C     1 
ATOM   1801  O  O     . VAL A  1  233  ? 36.790  38.647  105.349  1.00 135.71 ? 233  VAL A O     1 
ATOM   1802  C  CB    . VAL A  1  233  ? 37.992  36.315  107.209  1.00 129.05 ? 233  VAL A CB    1 
ATOM   1803  C  CG1   . VAL A  1  233  ? 37.858  35.626  105.858  1.00 117.73 ? 233  VAL A CG1   1 
ATOM   1804  C  CG2   . VAL A  1  233  ? 39.075  35.645  108.042  1.00 109.06 ? 233  VAL A CG2   1 
ATOM   1805  N  N     . ALA A  1  234  ? 36.268  39.054  107.500  1.00 135.29 ? 234  ALA A N     1 
ATOM   1806  C  CA    . ALA A  1  234  ? 35.048  39.786  107.178  1.00 125.87 ? 234  ALA A CA    1 
ATOM   1807  C  C     . ALA A  1  234  ? 35.368  41.182  106.651  1.00 114.24 ? 234  ALA A C     1 
ATOM   1808  O  O     . ALA A  1  234  ? 35.958  42.000  107.356  1.00 108.56 ? 234  ALA A O     1 
ATOM   1809  C  CB    . ALA A  1  234  ? 34.143  39.870  108.396  1.00 117.50 ? 234  ALA A CB    1 
ATOM   1810  N  N     . LEU B  1  6    ? 61.153  27.787  116.120  1.00 78.57  ? 6    LEU B N     1 
ATOM   1811  C  CA    . LEU B  1  6    ? 59.920  28.082  115.399  1.00 93.14  ? 6    LEU B CA    1 
ATOM   1812  C  C     . LEU B  1  6    ? 59.087  29.152  116.106  1.00 95.94  ? 6    LEU B C     1 
ATOM   1813  O  O     . LEU B  1  6    ? 58.592  28.932  117.214  1.00 83.42  ? 6    LEU B O     1 
ATOM   1814  C  CB    . LEU B  1  6    ? 59.095  26.804  115.214  1.00 90.80  ? 6    LEU B CB    1 
ATOM   1815  C  CG    . LEU B  1  6    ? 57.746  26.924  114.500  1.00 93.79  ? 6    LEU B CG    1 
ATOM   1816  C  CD1   . LEU B  1  6    ? 57.915  27.483  113.094  1.00 78.82  ? 6    LEU B CD1   1 
ATOM   1817  C  CD2   . LEU B  1  6    ? 57.036  25.577  114.462  1.00 75.08  ? 6    LEU B CD2   1 
ATOM   1818  N  N     . LYS B  1  7    ? 58.931  30.306  115.457  1.00 99.73  ? 7    LYS B N     1 
ATOM   1819  C  CA    . LYS B  1  7    ? 58.088  31.382  115.976  1.00 94.82  ? 7    LYS B CA    1 
ATOM   1820  C  C     . LYS B  1  7    ? 56.634  30.964  115.804  1.00 85.63  ? 7    LYS B C     1 
ATOM   1821  O  O     . LYS B  1  7    ? 56.380  29.836  115.376  1.00 81.33  ? 7    LYS B O     1 
ATOM   1822  C  CB    . LYS B  1  7    ? 58.359  32.693  115.233  1.00 90.21  ? 7    LYS B CB    1 
ATOM   1823  C  CG    . LYS B  1  7    ? 58.201  33.939  116.096  1.00 89.32  ? 7    LYS B CG    1 
ATOM   1824  C  CD    . LYS B  1  7    ? 58.301  35.217  115.276  1.00 81.91  ? 7    LYS B CD    1 
ATOM   1825  C  CE    . LYS B  1  7    ? 57.101  35.385  114.357  1.00 71.69  ? 7    LYS B CE    1 
ATOM   1826  N  NZ    . LYS B  1  7    ? 57.124  36.696  113.650  1.00 59.85  ? 7    LYS B NZ    1 
ATOM   1827  N  N     . ALA B  1  8    ? 55.690  31.841  116.167  1.00 76.88  ? 8    ALA B N     1 
ATOM   1828  C  CA    . ALA B  1  8    ? 54.265  31.529  116.023  1.00 69.23  ? 8    ALA B CA    1 
ATOM   1829  C  C     . ALA B  1  8    ? 53.888  30.491  117.096  1.00 52.70  ? 8    ALA B C     1 
ATOM   1830  O  O     . ALA B  1  8    ? 54.764  30.052  117.841  1.00 52.85  ? 8    ALA B O     1 
ATOM   1831  C  CB    . ALA B  1  8    ? 53.933  31.077  114.587  1.00 73.64  ? 8    ALA B CB    1 
ATOM   1832  N  N     . PRO B  1  9    ? 52.602  30.109  117.227  1.00 43.10  ? 9    PRO B N     1 
ATOM   1833  C  CA    . PRO B  1  9    ? 51.344  30.289  116.486  1.00 43.79  ? 9    PRO B CA    1 
ATOM   1834  C  C     . PRO B  1  9    ? 50.606  31.601  116.696  1.00 38.88  ? 9    PRO B C     1 
ATOM   1835  O  O     . PRO B  1  9    ? 50.820  32.303  117.682  1.00 45.81  ? 9    PRO B O     1 
ATOM   1836  C  CB    . PRO B  1  9    ? 50.489  29.126  116.985  1.00 49.84  ? 9    PRO B CB    1 
ATOM   1837  C  CG    . PRO B  1  9    ? 50.929  28.941  118.369  1.00 46.47  ? 9    PRO B CG    1 
ATOM   1838  C  CD    . PRO B  1  9    ? 52.404  29.228  118.391  1.00 43.06  ? 9    PRO B CD    1 
ATOM   1839  N  N     . VAL B  1  10   ? 49.734  31.914  115.744  1.00 34.89  ? 10   VAL B N     1 
ATOM   1840  C  CA    . VAL B  1  10   ? 48.769  32.989  115.913  1.00 42.86  ? 10   VAL B CA    1 
ATOM   1841  C  C     . VAL B  1  10   ? 47.382  32.393  116.159  1.00 44.05  ? 10   VAL B C     1 
ATOM   1842  O  O     . VAL B  1  10   ? 46.872  31.622  115.344  1.00 46.70  ? 10   VAL B O     1 
ATOM   1843  C  CB    . VAL B  1  10   ? 48.748  33.943  114.691  1.00 46.36  ? 10   VAL B CB    1 
ATOM   1844  C  CG1   . VAL B  1  10   ? 48.795  33.161  113.382  1.00 38.18  ? 10   VAL B CG1   1 
ATOM   1845  C  CG2   . VAL B  1  10   ? 47.533  34.861  114.744  1.00 47.01  ? 10   VAL B CG2   1 
ATOM   1846  N  N     . PHE B  1  11   ? 46.786  32.739  117.295  1.00 38.06  ? 11   PHE B N     1 
ATOM   1847  C  CA    . PHE B  1  11   ? 45.474  32.216  117.672  1.00 42.62  ? 11   PHE B CA    1 
ATOM   1848  C  C     . PHE B  1  11   ? 44.355  33.152  117.204  1.00 40.60  ? 11   PHE B C     1 
ATOM   1849  O  O     . PHE B  1  11   ? 44.264  34.293  117.651  1.00 50.74  ? 11   PHE B O     1 
ATOM   1850  C  CB    . PHE B  1  11   ? 45.420  32.003  119.189  1.00 44.73  ? 11   PHE B CB    1 
ATOM   1851  C  CG    . PHE B  1  11   ? 44.151  31.360  119.676  1.00 49.44  ? 11   PHE B CG    1 
ATOM   1852  C  CD1   . PHE B  1  11   ? 43.552  30.338  118.957  1.00 44.25  ? 11   PHE B CD1   1 
ATOM   1853  C  CD2   . PHE B  1  11   ? 43.573  31.763  120.871  1.00 51.66  ? 11   PHE B CD2   1 
ATOM   1854  C  CE1   . PHE B  1  11   ? 42.387  29.744  119.413  1.00 45.04  ? 11   PHE B CE1   1 
ATOM   1855  C  CE2   . PHE B  1  11   ? 42.410  31.173  121.332  1.00 47.62  ? 11   PHE B CE2   1 
ATOM   1856  C  CZ    . PHE B  1  11   ? 41.817  30.161  120.603  1.00 43.72  ? 11   PHE B CZ    1 
ATOM   1857  N  N     . THR B  1  12   ? 43.505  32.664  116.304  1.00 32.42  ? 12   THR B N     1 
ATOM   1858  C  CA    . THR B  1  12   ? 42.481  33.498  115.677  1.00 30.86  ? 12   THR B CA    1 
ATOM   1859  C  C     . THR B  1  12   ? 41.075  33.078  116.102  1.00 35.40  ? 12   THR B C     1 
ATOM   1860  O  O     . THR B  1  12   ? 40.813  31.895  116.295  1.00 42.53  ? 12   THR B O     1 
ATOM   1861  C  CB    . THR B  1  12   ? 42.583  33.415  114.148  1.00 32.99  ? 12   THR B CB    1 
ATOM   1862  O  OG1   . THR B  1  12   ? 43.964  33.396  113.766  1.00 27.21  ? 12   THR B OG1   1 
ATOM   1863  C  CG2   . THR B  1  12   ? 41.879  34.599  113.491  1.00 46.42  ? 12   THR B CG2   1 
ATOM   1864  N  N     . VAL B  1  13   ? 40.170  34.044  116.242  1.00 36.82  ? 13   VAL B N     1 
ATOM   1865  C  CA    . VAL B  1  13   ? 38.823  33.761  116.740  1.00 34.11  ? 13   VAL B CA    1 
ATOM   1866  C  C     . VAL B  1  13   ? 37.718  34.342  115.846  1.00 39.66  ? 13   VAL B C     1 
ATOM   1867  O  O     . VAL B  1  13   ? 37.851  35.448  115.322  1.00 40.63  ? 13   VAL B O     1 
ATOM   1868  C  CB    . VAL B  1  13   ? 38.645  34.278  118.191  1.00 36.60  ? 13   VAL B CB    1 
ATOM   1869  C  CG1   . VAL B  1  13   ? 37.275  33.906  118.736  1.00 35.16  ? 13   VAL B CG1   1 
ATOM   1870  C  CG2   . VAL B  1  13   ? 39.741  33.728  119.099  1.00 35.76  ? 13   VAL B CG2   1 
ATOM   1871  N  N     . ARG B  1  14   ? 36.640  33.577  115.667  1.00 38.83  ? 14   ARG B N     1 
ATOM   1872  C  CA    . ARG B  1  14   ? 35.463  34.024  114.920  1.00 40.98  ? 14   ARG B CA    1 
ATOM   1873  C  C     . ARG B  1  14   ? 34.193  33.650  115.681  1.00 40.71  ? 14   ARG B C     1 
ATOM   1874  O  O     . ARG B  1  14   ? 33.926  32.471  115.888  1.00 43.86  ? 14   ARG B O     1 
ATOM   1875  C  CB    . ARG B  1  14   ? 35.437  33.356  113.545  1.00 40.43  ? 14   ARG B CB    1 
ATOM   1876  C  CG    . ARG B  1  14   ? 35.329  34.310  112.368  1.00 56.48  ? 14   ARG B CG    1 
ATOM   1877  C  CD    . ARG B  1  14   ? 35.820  33.633  111.098  1.00 62.19  ? 14   ARG B CD    1 
ATOM   1878  N  NE    . ARG B  1  14   ? 36.932  32.727  111.386  1.00 71.36  ? 14   ARG B NE    1 
ATOM   1879  C  CZ    . ARG B  1  14   ? 37.691  32.141  110.465  1.00 62.26  ? 14   ARG B CZ    1 
ATOM   1880  N  NH1   . ARG B  1  14   ? 38.676  31.331  110.836  1.00 36.01  ? 14   ARG B NH1   1 
ATOM   1881  N  NH2   . ARG B  1  14   ? 37.472  32.368  109.177  1.00 65.93  ? 14   ARG B NH2   1 
ATOM   1882  N  N     . THR B  1  15   ? 33.398  34.636  116.089  1.00 43.68  ? 15   THR B N     1 
ATOM   1883  C  CA    . THR B  1  15   ? 32.204  34.335  116.881  1.00 44.44  ? 15   THR B CA    1 
ATOM   1884  C  C     . THR B  1  15   ? 30.904  34.877  116.297  1.00 48.01  ? 15   THR B C     1 
ATOM   1885  O  O     . THR B  1  15   ? 30.847  36.006  115.808  1.00 50.44  ? 15   THR B O     1 
ATOM   1886  C  CB    . THR B  1  15   ? 32.316  34.852  118.337  1.00 37.77  ? 15   THR B CB    1 
ATOM   1887  O  OG1   . THR B  1  15   ? 32.078  36.265  118.370  1.00 42.89  ? 15   THR B OG1   1 
ATOM   1888  C  CG2   . THR B  1  15   ? 33.684  34.544  118.925  1.00 32.00  ? 15   THR B CG2   1 
ATOM   1889  N  N     . GLN B  1  16   ? 29.862  34.054  116.357  1.00 54.71  ? 16   GLN B N     1 
ATOM   1890  C  CA    . GLN B  1  16   ? 28.502  34.516  116.129  1.00 56.51  ? 16   GLN B CA    1 
ATOM   1891  C  C     . GLN B  1  16   ? 27.752  34.385  117.446  1.00 56.32  ? 16   GLN B C     1 
ATOM   1892  O  O     . GLN B  1  16   ? 27.423  33.277  117.875  1.00 49.75  ? 16   GLN B O     1 
ATOM   1893  C  CB    . GLN B  1  16   ? 27.809  33.672  115.060  1.00 54.77  ? 16   GLN B CB    1 
ATOM   1894  C  CG    . GLN B  1  16   ? 28.500  33.674  113.710  1.00 71.94  ? 16   GLN B CG    1 
ATOM   1895  C  CD    . GLN B  1  16   ? 27.810  32.768  112.706  1.00 87.41  ? 16   GLN B CD    1 
ATOM   1896  O  OE1   . GLN B  1  16   ? 26.694  32.301  112.939  1.00 85.67  ? 16   GLN B OE1   1 
ATOM   1897  N  NE2   . GLN B  1  16   ? 28.475  32.512  111.583  1.00 79.22  ? 16   GLN B NE2   1 
ATOM   1898  N  N     . GLY B  1  17   ? 27.477  35.521  118.077  1.00 59.93  ? 17   GLY B N     1 
ATOM   1899  C  CA    . GLY B  1  17   ? 26.814  35.543  119.367  1.00 61.05  ? 17   GLY B CA    1 
ATOM   1900  C  C     . GLY B  1  17   ? 27.559  34.768  120.436  1.00 47.66  ? 17   GLY B C     1 
ATOM   1901  O  O     . GLY B  1  17   ? 28.773  34.575  120.352  1.00 38.97  ? 17   GLY B O     1 
ATOM   1902  N  N     . ARG B  1  18   ? 26.821  34.320  121.445  1.00 51.11  ? 18   ARG B N     1 
ATOM   1903  C  CA    . ARG B  1  18   ? 27.392  33.526  122.524  1.00 52.83  ? 18   ARG B CA    1 
ATOM   1904  C  C     . ARG B  1  18   ? 27.227  32.037  122.242  1.00 50.11  ? 18   ARG B C     1 
ATOM   1905  O  O     . ARG B  1  18   ? 27.693  31.198  123.011  1.00 40.64  ? 18   ARG B O     1 
ATOM   1906  C  CB    . ARG B  1  18   ? 26.701  33.866  123.846  1.00 50.86  ? 18   ARG B CB    1 
ATOM   1907  C  CG    . ARG B  1  18   ? 26.831  35.319  124.274  1.00 50.99  ? 18   ARG B CG    1 
ATOM   1908  C  CD    . ARG B  1  18   ? 25.873  35.646  125.411  1.00 48.16  ? 18   ARG B CD    1 
ATOM   1909  N  NE    . ARG B  1  18   ? 25.929  34.651  126.479  1.00 47.38  ? 18   ARG B NE    1 
ATOM   1910  C  CZ    . ARG B  1  18   ? 26.814  34.666  127.471  1.00 49.82  ? 18   ARG B CZ    1 
ATOM   1911  N  NH1   . ARG B  1  18   ? 26.790  33.719  128.398  1.00 43.82  ? 18   ARG B NH1   1 
ATOM   1912  N  NH2   . ARG B  1  18   ? 27.727  35.626  127.534  1.00 54.27  ? 18   ARG B NH2   1 
ATOM   1913  N  N     . GLU B  1  19   ? 26.544  31.717  121.146  1.00 53.02  ? 19   GLU B N     1 
ATOM   1914  C  CA    . GLU B  1  19   ? 26.179  30.335  120.844  1.00 46.01  ? 19   GLU B CA    1 
ATOM   1915  C  C     . GLU B  1  19   ? 27.218  29.524  120.056  1.00 41.98  ? 19   GLU B C     1 
ATOM   1916  O  O     . GLU B  1  19   ? 27.174  28.293  120.060  1.00 33.22  ? 19   GLU B O     1 
ATOM   1917  C  CB    . GLU B  1  19   ? 24.844  30.314  120.091  1.00 49.97  ? 19   GLU B CB    1 
ATOM   1918  C  CG    . GLU B  1  19   ? 23.722  31.090  120.770  1.00 49.52  ? 19   GLU B CG    1 
ATOM   1919  C  CD    . GLU B  1  19   ? 22.703  30.183  121.436  1.00 63.22  ? 19   GLU B CD    1 
ATOM   1920  O  OE1   . GLU B  1  19   ? 21.660  30.693  121.901  1.00 61.75  ? 19   GLU B OE1   1 
ATOM   1921  O  OE2   . GLU B  1  19   ? 22.946  28.959  121.491  1.00 67.10  ? 19   GLU B OE2   1 
ATOM   1922  N  N     . TYR B  1  20   ? 28.155  30.200  119.396  1.00 42.08  ? 20   TYR B N     1 
ATOM   1923  C  CA    . TYR B  1  20   ? 29.051  29.509  118.467  1.00 37.04  ? 20   TYR B CA    1 
ATOM   1924  C  C     . TYR B  1  20   ? 30.406  30.186  118.283  1.00 33.21  ? 20   TYR B C     1 
ATOM   1925  O  O     . TYR B  1  20   ? 30.508  31.409  118.355  1.00 41.03  ? 20   TYR B O     1 
ATOM   1926  C  CB    . TYR B  1  20   ? 28.369  29.355  117.105  1.00 39.44  ? 20   TYR B CB    1 
ATOM   1927  C  CG    . TYR B  1  20   ? 29.248  28.725  116.051  1.00 33.60  ? 20   TYR B CG    1 
ATOM   1928  C  CD1   . TYR B  1  20   ? 29.598  27.386  116.126  1.00 30.93  ? 20   TYR B CD1   1 
ATOM   1929  C  CD2   . TYR B  1  20   ? 29.731  29.470  114.984  1.00 39.80  ? 20   TYR B CD2   1 
ATOM   1930  C  CE1   . TYR B  1  20   ? 30.404  26.803  115.170  1.00 30.75  ? 20   TYR B CE1   1 
ATOM   1931  C  CE2   . TYR B  1  20   ? 30.538  28.893  114.018  1.00 43.36  ? 20   TYR B CE2   1 
ATOM   1932  C  CZ    . TYR B  1  20   ? 30.870  27.557  114.118  1.00 36.67  ? 20   TYR B CZ    1 
ATOM   1933  O  OH    . TYR B  1  20   ? 31.669  26.965  113.167  1.00 32.50  ? 20   TYR B OH    1 
ATOM   1934  N  N     . GLY B  1  21   ? 31.441  29.388  118.029  1.00 28.26  ? 21   GLY B N     1 
ATOM   1935  C  CA    . GLY B  1  21   ? 32.756  29.938  117.745  1.00 29.99  ? 21   GLY B CA    1 
ATOM   1936  C  C     . GLY B  1  21   ? 33.689  29.061  116.923  1.00 34.44  ? 21   GLY B C     1 
ATOM   1937  O  O     . GLY B  1  21   ? 33.565  27.834  116.907  1.00 36.05  ? 21   GLY B O     1 
ATOM   1938  N  N     . GLU B  1  22   ? 34.635  29.709  116.245  1.00 35.23  ? 22   GLU B N     1 
ATOM   1939  C  CA    . GLU B  1  22   ? 35.687  29.039  115.484  1.00 30.92  ? 22   GLU B CA    1 
ATOM   1940  C  C     . GLU B  1  22   ? 37.040  29.563  115.937  1.00 26.88  ? 22   GLU B C     1 
ATOM   1941  O  O     . GLU B  1  22   ? 37.217  30.764  116.129  1.00 31.79  ? 22   GLU B O     1 
ATOM   1942  C  CB    . GLU B  1  22   ? 35.535  29.291  113.985  1.00 35.62  ? 22   GLU B CB    1 
ATOM   1943  C  CG    . GLU B  1  22   ? 34.267  28.742  113.368  1.00 41.71  ? 22   GLU B CG    1 
ATOM   1944  C  CD    . GLU B  1  22   ? 34.301  28.782  111.850  1.00 54.95  ? 22   GLU B CD    1 
ATOM   1945  O  OE1   . GLU B  1  22   ? 35.414  28.752  111.280  1.00 50.86  ? 22   GLU B OE1   1 
ATOM   1946  O  OE2   . GLU B  1  22   ? 33.219  28.848  111.228  1.00 63.22  ? 22   GLU B OE2   1 
ATOM   1947  N  N     . PHE B  1  23   ? 37.996  28.659  116.094  1.00 22.16  ? 23   PHE B N     1 
ATOM   1948  C  CA    . PHE B  1  23   ? 39.290  29.006  116.658  1.00 26.61  ? 23   PHE B CA    1 
ATOM   1949  C  C     . PHE B  1  23   ? 40.408  28.381  115.832  1.00 29.58  ? 23   PHE B C     1 
ATOM   1950  O  O     . PHE B  1  23   ? 40.455  27.165  115.660  1.00 35.14  ? 23   PHE B O     1 
ATOM   1951  C  CB    . PHE B  1  23   ? 39.372  28.529  118.111  1.00 29.57  ? 23   PHE B CB    1 
ATOM   1952  C  CG    . PHE B  1  23   ? 38.254  29.040  118.986  1.00 33.20  ? 23   PHE B CG    1 
ATOM   1953  C  CD1   . PHE B  1  23   ? 37.025  28.396  119.019  1.00 29.37  ? 23   PHE B CD1   1 
ATOM   1954  C  CD2   . PHE B  1  23   ? 38.435  30.160  119.781  1.00 34.52  ? 23   PHE B CD2   1 
ATOM   1955  C  CE1   . PHE B  1  23   ? 35.998  28.865  119.819  1.00 28.78  ? 23   PHE B CE1   1 
ATOM   1956  C  CE2   . PHE B  1  23   ? 37.412  30.631  120.586  1.00 31.99  ? 23   PHE B CE2   1 
ATOM   1957  C  CZ    . PHE B  1  23   ? 36.193  29.982  120.604  1.00 30.23  ? 23   PHE B CZ    1 
ATOM   1958  N  N     . VAL B  1  24   ? 41.307  29.214  115.320  1.00 28.90  ? 24   VAL B N     1 
ATOM   1959  C  CA    . VAL B  1  24   ? 42.364  28.735  114.437  1.00 27.52  ? 24   VAL B CA    1 
ATOM   1960  C  C     . VAL B  1  24   ? 43.751  28.902  115.044  1.00 30.80  ? 24   VAL B C     1 
ATOM   1961  O  O     . VAL B  1  24   ? 44.196  30.019  115.306  1.00 37.90  ? 24   VAL B O     1 
ATOM   1962  C  CB    . VAL B  1  24   ? 42.334  29.462  113.081  1.00 30.31  ? 24   VAL B CB    1 
ATOM   1963  C  CG1   . VAL B  1  24   ? 43.456  28.958  112.188  1.00 39.09  ? 24   VAL B CG1   1 
ATOM   1964  C  CG2   . VAL B  1  24   ? 40.983  29.278  112.409  1.00 33.77  ? 24   VAL B CG2   1 
ATOM   1965  N  N     . LEU B  1  25   ? 44.434  27.783  115.262  1.00 31.72  ? 25   LEU B N     1 
ATOM   1966  C  CA    . LEU B  1  25   ? 45.804  27.811  115.752  1.00 33.59  ? 25   LEU B CA    1 
ATOM   1967  C  C     . LEU B  1  25   ? 46.755  27.274  114.686  1.00 41.63  ? 25   LEU B C     1 
ATOM   1968  O  O     . LEU B  1  25   ? 46.769  26.072  114.394  1.00 34.27  ? 25   LEU B O     1 
ATOM   1969  C  CB    . LEU B  1  25   ? 45.927  26.986  117.032  1.00 32.22  ? 25   LEU B CB    1 
ATOM   1970  C  CG    . LEU B  1  25   ? 47.166  27.237  117.891  1.00 29.59  ? 25   LEU B CG    1 
ATOM   1971  C  CD1   . LEU B  1  25   ? 47.158  28.661  118.414  1.00 40.08  ? 25   LEU B CD1   1 
ATOM   1972  C  CD2   . LEU B  1  25   ? 47.225  26.243  119.036  1.00 26.08  ? 25   LEU B CD2   1 
ATOM   1973  N  N     . GLU B  1  26   ? 47.536  28.181  114.102  1.00 57.02  ? 26   GLU B N     1 
ATOM   1974  C  CA    . GLU B  1  26   ? 48.517  27.838  113.075  1.00 47.67  ? 26   GLU B CA    1 
ATOM   1975  C  C     . GLU B  1  26   ? 49.724  28.772  113.137  1.00 37.99  ? 26   GLU B C     1 
ATOM   1976  O  O     . GLU B  1  26   ? 49.613  29.903  113.618  1.00 51.68  ? 26   GLU B O     1 
ATOM   1977  C  CB    . GLU B  1  26   ? 47.877  27.922  111.687  1.00 43.26  ? 26   GLU B CB    1 
ATOM   1978  C  CG    . GLU B  1  26   ? 47.292  29.288  111.361  1.00 48.22  ? 26   GLU B CG    1 
ATOM   1979  C  CD    . GLU B  1  26   ? 46.790  29.382  109.932  1.00 65.80  ? 26   GLU B CD    1 
ATOM   1980  O  OE1   . GLU B  1  26   ? 47.231  28.568  109.090  1.00 56.42  ? 26   GLU B OE1   1 
ATOM   1981  O  OE2   . GLU B  1  26   ? 45.953  30.267  109.651  1.00 71.04  ? 26   GLU B OE2   1 
ATOM   1982  N  N     . PRO B  1  27   ? 50.888  28.303  112.661  1.00 30.50  ? 27   PRO B N     1 
ATOM   1983  C  CA    . PRO B  1  27   ? 51.224  26.915  112.340  1.00 34.73  ? 27   PRO B CA    1 
ATOM   1984  C  C     . PRO B  1  27   ? 51.609  26.150  113.594  1.00 36.79  ? 27   PRO B C     1 
ATOM   1985  O  O     . PRO B  1  27   ? 52.015  26.761  114.580  1.00 44.07  ? 27   PRO B O     1 
ATOM   1986  C  CB    . PRO B  1  27   ? 52.449  27.061  111.444  1.00 41.12  ? 27   PRO B CB    1 
ATOM   1987  C  CG    . PRO B  1  27   ? 53.116  28.278  111.955  1.00 50.17  ? 27   PRO B CG    1 
ATOM   1988  C  CD    . PRO B  1  27   ? 51.992  29.215  112.319  1.00 48.69  ? 27   PRO B CD    1 
ATOM   1989  N  N     . LEU B  1  28   ? 51.491  24.829  113.552  1.00 36.54  ? 28   LEU B N     1 
ATOM   1990  C  CA    . LEU B  1  28   ? 51.962  23.983  114.636  1.00 31.39  ? 28   LEU B CA    1 
ATOM   1991  C  C     . LEU B  1  28   ? 52.958  22.984  114.080  1.00 32.04  ? 28   LEU B C     1 
ATOM   1992  O  O     . LEU B  1  28   ? 52.965  22.709  112.884  1.00 36.85  ? 28   LEU B O     1 
ATOM   1993  C  CB    . LEU B  1  28   ? 50.798  23.239  115.293  1.00 33.93  ? 28   LEU B CB    1 
ATOM   1994  C  CG    . LEU B  1  28   ? 49.829  24.047  116.157  1.00 33.08  ? 28   LEU B CG    1 
ATOM   1995  C  CD1   . LEU B  1  28   ? 48.644  23.186  116.562  1.00 29.08  ? 28   LEU B CD1   1 
ATOM   1996  C  CD2   . LEU B  1  28   ? 50.536  24.595  117.387  1.00 36.91  ? 28   LEU B CD2   1 
ATOM   1997  N  N     . GLU B  1  29   ? 53.792  22.432  114.952  1.00 36.75  ? 29   GLU B N     1 
ATOM   1998  C  CA    . GLU B  1  29   ? 54.747  21.417  114.536  1.00 34.31  ? 29   GLU B CA    1 
ATOM   1999  C  C     . GLU B  1  29   ? 53.974  20.176  114.107  1.00 38.58  ? 29   GLU B C     1 
ATOM   2000  O  O     . GLU B  1  29   ? 52.804  20.022  114.460  1.00 39.57  ? 29   GLU B O     1 
ATOM   2001  C  CB    . GLU B  1  29   ? 55.716  21.091  115.673  1.00 40.12  ? 29   GLU B CB    1 
ATOM   2002  C  CG    . GLU B  1  29   ? 56.990  20.400  115.218  1.00 52.94  ? 29   GLU B CG    1 
ATOM   2003  C  CD    . GLU B  1  29   ? 57.687  21.148  114.094  1.00 67.57  ? 29   GLU B CD    1 
ATOM   2004  O  OE1   . GLU B  1  29   ? 57.610  20.688  112.933  1.00 70.15  ? 29   GLU B OE1   1 
ATOM   2005  O  OE2   . GLU B  1  29   ? 58.312  22.194  114.369  1.00 70.34  ? 29   GLU B OE2   1 
ATOM   2006  N  N     . ARG B  1  30   ? 54.617  19.310  113.328  1.00 43.87  ? 30   ARG B N     1 
ATOM   2007  C  CA    . ARG B  1  30   ? 53.943  18.147  112.761  1.00 34.52  ? 30   ARG B CA    1 
ATOM   2008  C  C     . ARG B  1  30   ? 53.312  17.257  113.824  1.00 29.49  ? 30   ARG B C     1 
ATOM   2009  O  O     . ARG B  1  30   ? 53.982  16.815  114.756  1.00 27.29  ? 30   ARG B O     1 
ATOM   2010  C  CB    . ARG B  1  30   ? 54.910  17.322  111.914  1.00 28.68  ? 30   ARG B CB    1 
ATOM   2011  C  CG    . ARG B  1  30   ? 54.225  16.220  111.130  1.00 32.74  ? 30   ARG B CG    1 
ATOM   2012  C  CD    . ARG B  1  30   ? 55.222  15.336  110.404  1.00 38.66  ? 30   ARG B CD    1 
ATOM   2013  N  NE    . ARG B  1  30   ? 55.878  14.390  111.303  1.00 34.53  ? 30   ARG B NE    1 
ATOM   2014  C  CZ    . ARG B  1  30   ? 56.745  13.463  110.907  1.00 30.33  ? 30   ARG B CZ    1 
ATOM   2015  N  NH1   . ARG B  1  30   ? 57.067  13.355  109.626  1.00 28.76  ? 30   ARG B NH1   1 
ATOM   2016  N  NH2   . ARG B  1  30   ? 57.295  12.644  111.793  1.00 34.74  ? 30   ARG B NH2   1 
ATOM   2017  N  N     . GLY B  1  31   ? 52.017  17.003  113.669  1.00 30.11  ? 31   GLY B N     1 
ATOM   2018  C  CA    . GLY B  1  31   ? 51.292  16.099  114.544  1.00 30.48  ? 31   GLY B CA    1 
ATOM   2019  C  C     . GLY B  1  31   ? 50.563  16.758  115.701  1.00 26.20  ? 31   GLY B C     1 
ATOM   2020  O  O     . GLY B  1  31   ? 49.609  16.192  116.239  1.00 21.84  ? 31   GLY B O     1 
ATOM   2021  N  N     . PHE B  1  32   ? 50.994  17.959  116.076  1.00 29.85  ? 32   PHE B N     1 
ATOM   2022  C  CA    . PHE B  1  32   ? 50.452  18.623  117.260  1.00 25.70  ? 32   PHE B CA    1 
ATOM   2023  C  C     . PHE B  1  32   ? 49.021  19.105  117.085  1.00 23.37  ? 32   PHE B C     1 
ATOM   2024  O  O     . PHE B  1  32   ? 48.360  19.472  118.060  1.00 27.30  ? 32   PHE B O     1 
ATOM   2025  C  CB    . PHE B  1  32   ? 51.362  19.765  117.713  1.00 25.22  ? 32   PHE B CB    1 
ATOM   2026  C  CG    . PHE B  1  32   ? 52.563  19.299  118.476  1.00 24.69  ? 32   PHE B CG    1 
ATOM   2027  C  CD1   . PHE B  1  32   ? 53.720  18.932  117.813  1.00 25.30  ? 32   PHE B CD1   1 
ATOM   2028  C  CD2   . PHE B  1  32   ? 52.527  19.204  119.856  1.00 23.96  ? 32   PHE B CD2   1 
ATOM   2029  C  CE1   . PHE B  1  32   ? 54.825  18.492  118.512  1.00 24.89  ? 32   PHE B CE1   1 
ATOM   2030  C  CE2   . PHE B  1  32   ? 53.628  18.764  120.562  1.00 23.11  ? 32   PHE B CE2   1 
ATOM   2031  C  CZ    . PHE B  1  32   ? 54.779  18.408  119.889  1.00 24.72  ? 32   PHE B CZ    1 
ATOM   2032  N  N     . GLY B  1  33   ? 48.545  19.087  115.845  1.00 22.81  ? 33   GLY B N     1 
ATOM   2033  C  CA    . GLY B  1  33   ? 47.162  19.415  115.555  1.00 27.42  ? 33   GLY B CA    1 
ATOM   2034  C  C     . GLY B  1  33   ? 46.187  18.529  116.309  1.00 20.33  ? 33   GLY B C     1 
ATOM   2035  O  O     . GLY B  1  33   ? 45.302  19.023  117.004  1.00 15.90  ? 33   GLY B O     1 
ATOM   2036  N  N     . VAL B  1  34   ? 46.351  17.217  116.177  1.00 19.44  ? 34   VAL B N     1 
ATOM   2037  C  CA    . VAL B  1  34   ? 45.479  16.276  116.869  1.00 19.04  ? 34   VAL B CA    1 
ATOM   2038  C  C     . VAL B  1  34   ? 45.868  16.129  118.336  1.00 19.77  ? 34   VAL B C     1 
ATOM   2039  O  O     . VAL B  1  34   ? 45.031  15.787  119.176  1.00 23.95  ? 34   VAL B O     1 
ATOM   2040  C  CB    . VAL B  1  34   ? 45.485  14.894  116.199  1.00 19.83  ? 34   VAL B CB    1 
ATOM   2041  C  CG1   . VAL B  1  34   ? 45.080  15.022  114.742  1.00 27.24  ? 34   VAL B CG1   1 
ATOM   2042  C  CG2   . VAL B  1  34   ? 46.854  14.251  116.314  1.00 17.92  ? 34   VAL B CG2   1 
ATOM   2043  N  N     . THR B  1  35   ? 47.137  16.394  118.638  1.00 20.31  ? 35   THR B N     1 
ATOM   2044  C  CA    . THR B  1  35   ? 47.634  16.312  120.005  1.00 17.99  ? 35   THR B CA    1 
ATOM   2045  C  C     . THR B  1  35   ? 46.953  17.359  120.876  1.00 15.93  ? 35   THR B C     1 
ATOM   2046  O  O     . THR B  1  35   ? 46.636  17.101  122.031  1.00 13.47  ? 35   THR B O     1 
ATOM   2047  C  CB    . THR B  1  35   ? 49.162  16.505  120.071  1.00 18.55  ? 35   THR B CB    1 
ATOM   2048  O  OG1   . THR B  1  35   ? 49.802  15.572  119.193  1.00 18.08  ? 35   THR B OG1   1 
ATOM   2049  C  CG2   . THR B  1  35   ? 49.671  16.286  121.489  1.00 16.56  ? 35   THR B CG2   1 
ATOM   2050  N  N     . LEU B  1  36   ? 46.749  18.550  120.325  1.00 15.85  ? 36   LEU B N     1 
ATOM   2051  C  CA    . LEU B  1  36   ? 45.965  19.566  121.014  1.00 13.54  ? 36   LEU B CA    1 
ATOM   2052  C  C     . LEU B  1  36   ? 44.471  19.351  120.809  1.00 14.72  ? 36   LEU B C     1 
ATOM   2053  O  O     . LEU B  1  36   ? 43.669  19.613  121.697  1.00 16.71  ? 36   LEU B O     1 
ATOM   2054  C  CB    . LEU B  1  36   ? 46.367  20.965  120.556  1.00 14.50  ? 36   LEU B CB    1 
ATOM   2055  C  CG    . LEU B  1  36   ? 47.832  21.319  120.809  1.00 16.88  ? 36   LEU B CG    1 
ATOM   2056  C  CD1   . LEU B  1  36   ? 48.091  22.771  120.449  1.00 23.19  ? 36   LEU B CD1   1 
ATOM   2057  C  CD2   . LEU B  1  36   ? 48.215  21.035  122.254  1.00 14.85  ? 36   LEU B CD2   1 
ATOM   2058  N  N     . GLY B  1  37   ? 44.105  18.870  119.628  1.00 18.98  ? 37   GLY B N     1 
ATOM   2059  C  CA    . GLY B  1  37   ? 42.708  18.757  119.245  1.00 20.49  ? 37   GLY B CA    1 
ATOM   2060  C  C     . GLY B  1  37   ? 41.891  17.773  120.058  1.00 17.13  ? 37   GLY B C     1 
ATOM   2061  O  O     . GLY B  1  37   ? 40.858  18.135  120.618  1.00 17.67  ? 37   GLY B O     1 
ATOM   2062  N  N     . ASN B  1  38   ? 42.345  16.527  120.123  1.00 18.05  ? 38   ASN B N     1 
ATOM   2063  C  CA    . ASN B  1  38   ? 41.593  15.492  120.831  1.00 16.72  ? 38   ASN B CA    1 
ATOM   2064  C  C     . ASN B  1  38   ? 41.317  15.754  122.315  1.00 20.88  ? 38   ASN B C     1 
ATOM   2065  O  O     . ASN B  1  38   ? 40.167  15.647  122.743  1.00 25.27  ? 38   ASN B O     1 
ATOM   2066  C  CB    . ASN B  1  38   ? 42.207  14.103  120.617  1.00 19.75  ? 38   ASN B CB    1 
ATOM   2067  C  CG    . ASN B  1  38   ? 41.727  13.452  119.335  1.00 26.56  ? 38   ASN B CG    1 
ATOM   2068  O  OD1   . ASN B  1  38   ? 40.533  13.465  119.033  1.00 27.73  ? 38   ASN B OD1   1 
ATOM   2069  N  ND2   . ASN B  1  38   ? 42.656  12.890  118.567  1.00 24.00  ? 38   ASN B ND2   1 
ATOM   2070  N  N     . PRO B  1  39   ? 42.356  16.098  123.104  1.00 19.62  ? 39   PRO B N     1 
ATOM   2071  C  CA    . PRO B  1  39   ? 42.116  16.313  124.537  1.00 19.64  ? 39   PRO B CA    1 
ATOM   2072  C  C     . PRO B  1  39   ? 41.121  17.432  124.793  1.00 17.88  ? 39   PRO B C     1 
ATOM   2073  O  O     . PRO B  1  39   ? 40.215  17.266  125.607  1.00 22.15  ? 39   PRO B O     1 
ATOM   2074  C  CB    . PRO B  1  39   ? 43.488  16.734  125.066  1.00 14.41  ? 39   PRO B CB    1 
ATOM   2075  C  CG    . PRO B  1  39   ? 44.441  16.214  124.091  1.00 13.97  ? 39   PRO B CG    1 
ATOM   2076  C  CD    . PRO B  1  39   ? 43.773  16.298  122.766  1.00 15.04  ? 39   PRO B CD    1 
ATOM   2077  N  N     . LEU B  1  40   ? 41.288  18.552  124.101  1.00 14.83  ? 40   LEU B N     1 
ATOM   2078  C  CA    . LEU B  1  40   ? 40.378  19.672  124.270  1.00 16.40  ? 40   LEU B CA    1 
ATOM   2079  C  C     . LEU B  1  40   ? 38.944  19.256  123.975  1.00 18.44  ? 40   LEU B C     1 
ATOM   2080  O  O     . LEU B  1  40   ? 38.033  19.600  124.725  1.00 19.83  ? 40   LEU B O     1 
ATOM   2081  C  CB    . LEU B  1  40   ? 40.793  20.849  123.390  1.00 16.46  ? 40   LEU B CB    1 
ATOM   2082  C  CG    . LEU B  1  40   ? 42.165  21.429  123.725  1.00 16.93  ? 40   LEU B CG    1 
ATOM   2083  C  CD1   . LEU B  1  40   ? 42.417  22.703  122.933  1.00 20.81  ? 40   LEU B CD1   1 
ATOM   2084  C  CD2   . LEU B  1  40   ? 42.305  21.666  125.223  1.00 16.61  ? 40   LEU B CD2   1 
ATOM   2085  N  N     . ARG B  1  41   ? 38.749  18.497  122.900  1.00 17.37  ? 41   ARG B N     1 
ATOM   2086  C  CA    . ARG B  1  41   ? 37.412  18.042  122.536  1.00 18.99  ? 41   ARG B CA    1 
ATOM   2087  C  C     . ARG B  1  41   ? 36.790  17.226  123.662  1.00 19.15  ? 41   ARG B C     1 
ATOM   2088  O  O     . ARG B  1  41   ? 35.639  17.450  124.041  1.00 19.02  ? 41   ARG B O     1 
ATOM   2089  C  CB    . ARG B  1  41   ? 37.432  17.216  121.249  1.00 17.44  ? 41   ARG B CB    1 
ATOM   2090  C  CG    . ARG B  1  41   ? 36.060  16.674  120.878  1.00 20.21  ? 41   ARG B CG    1 
ATOM   2091  C  CD    . ARG B  1  41   ? 36.091  15.772  119.658  1.00 22.08  ? 41   ARG B CD    1 
ATOM   2092  N  NE    . ARG B  1  41   ? 34.748  15.309  119.311  1.00 22.03  ? 41   ARG B NE    1 
ATOM   2093  C  CZ    . ARG B  1  41   ? 34.188  14.205  119.795  1.00 24.78  ? 41   ARG B CZ    1 
ATOM   2094  N  NH1   . ARG B  1  41   ? 34.857  13.440  120.649  1.00 22.81  ? 41   ARG B NH1   1 
ATOM   2095  N  NH2   . ARG B  1  41   ? 32.960  13.864  119.425  1.00 23.89  ? 41   ARG B NH2   1 
ATOM   2096  N  N     . ARG B  1  42   ? 37.564  16.286  124.196  1.00 17.25  ? 42   ARG B N     1 
ATOM   2097  C  CA    . ARG B  1  42   ? 37.091  15.427  125.275  1.00 17.92  ? 42   ARG B CA    1 
ATOM   2098  C  C     . ARG B  1  42   ? 36.696  16.253  126.493  1.00 21.22  ? 42   ARG B C     1 
ATOM   2099  O  O     . ARG B  1  42   ? 35.561  16.175  126.965  1.00 25.74  ? 42   ARG B O     1 
ATOM   2100  C  CB    . ARG B  1  42   ? 38.159  14.396  125.645  1.00 13.41  ? 42   ARG B CB    1 
ATOM   2101  C  CG    . ARG B  1  42   ? 38.488  13.431  124.520  1.00 14.02  ? 42   ARG B CG    1 
ATOM   2102  C  CD    . ARG B  1  42   ? 39.779  12.672  124.784  1.00 16.69  ? 42   ARG B CD    1 
ATOM   2103  N  NE    . ARG B  1  42   ? 39.629  11.664  125.827  1.00 14.44  ? 42   ARG B NE    1 
ATOM   2104  C  CZ    . ARG B  1  42   ? 39.186  10.431  125.607  1.00 15.53  ? 42   ARG B CZ    1 
ATOM   2105  N  NH1   . ARG B  1  42   ? 38.846  10.061  124.381  1.00 20.40  ? 42   ARG B NH1   1 
ATOM   2106  N  NH2   . ARG B  1  42   ? 39.076  9.572   126.609  1.00 18.17  ? 42   ARG B NH2   1 
ATOM   2107  N  N     . ILE B  1  43   ? 37.635  17.054  126.984  1.00 16.82  ? 43   ILE B N     1 
ATOM   2108  C  CA    . ILE B  1  43   ? 37.388  17.930  128.119  1.00 14.24  ? 43   ILE B CA    1 
ATOM   2109  C  C     . ILE B  1  43   ? 36.176  18.825  127.873  1.00 18.89  ? 43   ILE B C     1 
ATOM   2110  O  O     . ILE B  1  43   ? 35.341  19.005  128.758  1.00 23.63  ? 43   ILE B O     1 
ATOM   2111  C  CB    . ILE B  1  43   ? 38.618  18.799  128.418  1.00 13.16  ? 43   ILE B CB    1 
ATOM   2112  C  CG1   . ILE B  1  43   ? 39.822  17.913  128.730  1.00 16.21  ? 43   ILE B CG1   1 
ATOM   2113  C  CG2   . ILE B  1  43   ? 38.344  19.742  129.573  1.00 15.65  ? 43   ILE B CG2   1 
ATOM   2114  C  CD1   . ILE B  1  43   ? 41.119  18.675  128.858  1.00 18.88  ? 43   ILE B CD1   1 
ATOM   2115  N  N     . LEU B  1  44   ? 36.071  19.365  126.663  1.00 17.26  ? 44   LEU B N     1 
ATOM   2116  C  CA    . LEU B  1  44   ? 34.967  20.258  126.318  1.00 18.53  ? 44   LEU B CA    1 
ATOM   2117  C  C     . LEU B  1  44   ? 33.603  19.585  126.435  1.00 21.14  ? 44   LEU B C     1 
ATOM   2118  O  O     . LEU B  1  44   ? 32.618  20.223  126.810  1.00 22.17  ? 44   LEU B O     1 
ATOM   2119  C  CB    . LEU B  1  44   ? 35.149  20.818  124.908  1.00 16.57  ? 44   LEU B CB    1 
ATOM   2120  C  CG    . LEU B  1  44   ? 36.062  22.036  124.788  1.00 17.92  ? 44   LEU B CG    1 
ATOM   2121  C  CD1   . LEU B  1  44   ? 36.518  22.206  123.353  1.00 19.85  ? 44   LEU B CD1   1 
ATOM   2122  C  CD2   . LEU B  1  44   ? 35.344  23.282  125.277  1.00 22.56  ? 44   LEU B CD2   1 
ATOM   2123  N  N     . LEU B  1  45   ? 33.545  18.304  126.092  1.00 18.54  ? 45   LEU B N     1 
ATOM   2124  C  CA    . LEU B  1  45   ? 32.294  17.562  126.168  1.00 18.77  ? 45   LEU B CA    1 
ATOM   2125  C  C     . LEU B  1  45   ? 31.917  17.123  127.584  1.00 22.14  ? 45   LEU B C     1 
ATOM   2126  O  O     . LEU B  1  45   ? 30.788  17.330  128.026  1.00 26.22  ? 45   LEU B O     1 
ATOM   2127  C  CB    . LEU B  1  45   ? 32.336  16.363  125.224  1.00 18.80  ? 45   LEU B CB    1 
ATOM   2128  C  CG    . LEU B  1  45   ? 32.429  16.766  123.752  1.00 19.01  ? 45   LEU B CG    1 
ATOM   2129  C  CD1   . LEU B  1  45   ? 32.507  15.544  122.852  1.00 21.39  ? 45   LEU B CD1   1 
ATOM   2130  C  CD2   . LEU B  1  45   ? 31.246  17.645  123.375  1.00 15.43  ? 45   LEU B CD2   1 
ATOM   2131  N  N     . SER B  1  46   ? 32.857  16.496  128.282  1.00 20.20  ? 46   SER B N     1 
ATOM   2132  C  CA    . SER B  1  46   ? 32.591  15.983  129.625  1.00 22.59  ? 46   SER B CA    1 
ATOM   2133  C  C     . SER B  1  46   ? 32.728  16.979  130.784  1.00 26.49  ? 46   SER B C     1 
ATOM   2134  O  O     . SER B  1  46   ? 31.879  17.024  131.671  1.00 31.19  ? 46   SER B O     1 
ATOM   2135  C  CB    . SER B  1  46   ? 33.468  14.759  129.900  1.00 24.58  ? 46   SER B CB    1 
ATOM   2136  O  OG    . SER B  1  46   ? 34.844  15.084  129.796  1.00 23.08  ? 46   SER B OG    1 
ATOM   2137  N  N     . SER B  1  47   ? 33.797  17.770  130.773  1.00 26.18  ? 47   SER B N     1 
ATOM   2138  C  CA    . SER B  1  47   ? 34.270  18.432  131.995  1.00 22.66  ? 47   SER B CA    1 
ATOM   2139  C  C     . SER B  1  47   ? 33.887  19.892  132.252  1.00 18.98  ? 47   SER B C     1 
ATOM   2140  O  O     . SER B  1  47   ? 34.278  20.448  133.277  1.00 17.15  ? 47   SER B O     1 
ATOM   2141  C  CB    . SER B  1  47   ? 35.787  18.277  132.113  1.00 21.77  ? 47   SER B CB    1 
ATOM   2142  O  OG    . SER B  1  47   ? 36.147  16.909  132.104  1.00 19.15  ? 47   SER B OG    1 
ATOM   2143  N  N     . ILE B  1  48   ? 33.148  20.520  131.344  1.00 24.21  ? 48   ILE B N     1 
ATOM   2144  C  CA    . ILE B  1  48   ? 32.794  21.928  131.532  1.00 25.97  ? 48   ILE B CA    1 
ATOM   2145  C  C     . ILE B  1  48   ? 31.493  22.090  132.316  1.00 25.85  ? 48   ILE B C     1 
ATOM   2146  O  O     . ILE B  1  48   ? 30.441  21.633  131.871  1.00 26.84  ? 48   ILE B O     1 
ATOM   2147  C  CB    . ILE B  1  48   ? 32.697  22.693  130.198  1.00 29.03  ? 48   ILE B CB    1 
ATOM   2148  C  CG1   . ILE B  1  48   ? 34.041  22.651  129.463  1.00 27.51  ? 48   ILE B CG1   1 
ATOM   2149  C  CG2   . ILE B  1  48   ? 32.263  24.127  130.441  1.00 20.80  ? 48   ILE B CG2   1 
ATOM   2150  C  CD1   . ILE B  1  48   ? 35.228  23.052  130.318  1.00 19.55  ? 48   ILE B CD1   1 
ATOM   2151  N  N     . PRO B  1  49   ? 31.574  22.742  133.490  1.00 25.95  ? 49   PRO B N     1 
ATOM   2152  C  CA    . PRO B  1  49   ? 30.477  22.917  134.451  1.00 20.88  ? 49   PRO B CA    1 
ATOM   2153  C  C     . PRO B  1  49   ? 29.265  23.639  133.872  1.00 21.17  ? 49   PRO B C     1 
ATOM   2154  O  O     . PRO B  1  49   ? 29.406  24.664  133.205  1.00 18.84  ? 49   PRO B O     1 
ATOM   2155  C  CB    . PRO B  1  49   ? 31.115  23.762  135.556  1.00 21.24  ? 49   PRO B CB    1 
ATOM   2156  C  CG    . PRO B  1  49   ? 32.569  23.452  135.469  1.00 19.31  ? 49   PRO B CG    1 
ATOM   2157  C  CD    . PRO B  1  49   ? 32.837  23.304  134.002  1.00 25.02  ? 49   PRO B CD    1 
ATOM   2158  N  N     . GLY B  1  50   ? 28.082  23.101  134.154  1.00 24.35  ? 50   GLY B N     1 
ATOM   2159  C  CA    . GLY B  1  50   ? 26.838  23.603  133.600  1.00 23.90  ? 50   GLY B CA    1 
ATOM   2160  C  C     . GLY B  1  50   ? 25.660  23.182  134.458  1.00 27.84  ? 50   GLY B C     1 
ATOM   2161  O  O     . GLY B  1  50   ? 25.845  22.685  135.568  1.00 30.93  ? 50   GLY B O     1 
ATOM   2162  N  N     . THR B  1  51   ? 24.446  23.399  133.959  1.00 28.95  ? 51   THR B N     1 
ATOM   2163  C  CA    . THR B  1  51   ? 23.243  23.041  134.708  1.00 29.19  ? 51   THR B CA    1 
ATOM   2164  C  C     . THR B  1  51   ? 22.281  22.163  133.906  1.00 28.90  ? 51   THR B C     1 
ATOM   2165  O  O     . THR B  1  51   ? 22.186  22.281  132.683  1.00 35.13  ? 51   THR B O     1 
ATOM   2166  C  CB    . THR B  1  51   ? 22.495  24.292  135.196  1.00 27.82  ? 51   THR B CB    1 
ATOM   2167  O  OG1   . THR B  1  51   ? 22.092  25.077  134.068  1.00 29.52  ? 51   THR B OG1   1 
ATOM   2168  C  CG2   . THR B  1  51   ? 23.391  25.127  136.102  1.00 31.30  ? 51   THR B CG2   1 
ATOM   2169  N  N     . ALA B  1  52   ? 21.562  21.292  134.609  1.00 22.28  ? 52   ALA B N     1 
ATOM   2170  C  CA    . ALA B  1  52   ? 20.631  20.366  133.973  1.00 21.24  ? 52   ALA B CA    1 
ATOM   2171  C  C     . ALA B  1  52   ? 19.405  20.144  134.845  1.00 23.36  ? 52   ALA B C     1 
ATOM   2172  O  O     . ALA B  1  52   ? 19.466  20.306  136.061  1.00 31.83  ? 52   ALA B O     1 
ATOM   2173  C  CB    . ALA B  1  52   ? 21.313  19.044  133.706  1.00 22.93  ? 52   ALA B CB    1 
ATOM   2174  N  N     . VAL B  1  53   ? 18.295  19.758  134.227  1.00 18.60  ? 53   VAL B N     1 
ATOM   2175  C  CA    . VAL B  1  53   ? 17.100  19.429  134.987  1.00 20.62  ? 53   VAL B CA    1 
ATOM   2176  C  C     . VAL B  1  53   ? 17.117  17.935  135.267  1.00 29.02  ? 53   VAL B C     1 
ATOM   2177  O  O     . VAL B  1  53   ? 16.952  17.124  134.354  1.00 32.11  ? 53   VAL B O     1 
ATOM   2178  C  CB    . VAL B  1  53   ? 15.828  19.777  134.202  1.00 19.92  ? 53   VAL B CB    1 
ATOM   2179  C  CG1   . VAL B  1  53   ? 14.592  19.274  134.936  1.00 26.57  ? 53   VAL B CG1   1 
ATOM   2180  C  CG2   . VAL B  1  53   ? 15.747  21.277  133.967  1.00 22.02  ? 53   VAL B CG2   1 
ATOM   2181  N  N     . THR B  1  54   ? 17.338  17.575  136.528  1.00 29.45  ? 54   THR B N     1 
ATOM   2182  C  CA    . THR B  1  54   ? 17.512  16.170  136.891  1.00 31.45  ? 54   THR B CA    1 
ATOM   2183  C  C     . THR B  1  54   ? 16.265  15.424  137.388  1.00 33.71  ? 54   THR B C     1 
ATOM   2184  O  O     . THR B  1  54   ? 16.271  14.196  137.459  1.00 33.59  ? 54   THR B O     1 
ATOM   2185  C  CB    . THR B  1  54   ? 18.627  16.024  137.936  1.00 29.97  ? 54   THR B CB    1 
ATOM   2186  O  OG1   . THR B  1  54   ? 18.319  16.837  139.073  1.00 36.71  ? 54   THR B OG1   1 
ATOM   2187  C  CG2   . THR B  1  54   ? 19.951  16.480  137.355  1.00 29.64  ? 54   THR B CG2   1 
ATOM   2188  N  N     . SER B  1  55   ? 15.200  16.150  137.714  1.00 35.42  ? 55   SER B N     1 
ATOM   2189  C  CA    . SER B  1  55   ? 13.985  15.510  138.222  1.00 35.03  ? 55   SER B CA    1 
ATOM   2190  C  C     . SER B  1  55   ? 12.735  16.350  137.958  1.00 35.66  ? 55   SER B C     1 
ATOM   2191  O  O     . SER B  1  55   ? 12.804  17.575  137.931  1.00 39.24  ? 55   SER B O     1 
ATOM   2192  C  CB    . SER B  1  55   ? 14.125  15.211  139.717  1.00 39.56  ? 55   SER B CB    1 
ATOM   2193  O  OG    . SER B  1  55   ? 13.103  14.340  140.167  1.00 47.56  ? 55   SER B OG    1 
ATOM   2194  N  N     . VAL B  1  56   ? 11.596  15.692  137.761  1.00 34.30  ? 56   VAL B N     1 
ATOM   2195  C  CA    . VAL B  1  56   ? 10.337  16.398  137.526  1.00 37.95  ? 56   VAL B CA    1 
ATOM   2196  C  C     . VAL B  1  56   ? 9.179   15.742  138.272  1.00 48.29  ? 56   VAL B C     1 
ATOM   2197  O  O     . VAL B  1  56   ? 8.970   14.534  138.163  1.00 52.20  ? 56   VAL B O     1 
ATOM   2198  C  CB    . VAL B  1  56   ? 9.982   16.457  136.020  1.00 37.21  ? 56   VAL B CB    1 
ATOM   2199  C  CG1   . VAL B  1  56   ? 8.591   17.035  135.819  1.00 36.98  ? 56   VAL B CG1   1 
ATOM   2200  C  CG2   . VAL B  1  56   ? 11.006  17.277  135.257  1.00 45.09  ? 56   VAL B CG2   1 
ATOM   2201  N  N     . TYR B  1  57   ? 8.431   16.538  139.032  1.00 48.22  ? 57   TYR B N     1 
ATOM   2202  C  CA    . TYR B  1  57   ? 7.207   16.057  139.665  1.00 47.01  ? 57   TYR B CA    1 
ATOM   2203  C  C     . TYR B  1  57   ? 5.995   16.802  139.133  1.00 47.36  ? 57   TYR B C     1 
ATOM   2204  O  O     . TYR B  1  57   ? 5.955   18.028  139.167  1.00 42.98  ? 57   TYR B O     1 
ATOM   2205  C  CB    . TYR B  1  57   ? 7.264   16.208  141.186  1.00 56.63  ? 57   TYR B CB    1 
ATOM   2206  C  CG    . TYR B  1  57   ? 5.908   16.065  141.853  1.00 66.59  ? 57   TYR B CG    1 
ATOM   2207  C  CD1   . TYR B  1  57   ? 5.254   14.836  141.895  1.00 63.69  ? 57   TYR B CD1   1 
ATOM   2208  C  CD2   . TYR B  1  57   ? 5.280   17.159  142.438  1.00 62.66  ? 57   TYR B CD2   1 
ATOM   2209  C  CE1   . TYR B  1  57   ? 4.014   14.702  142.500  1.00 58.78  ? 57   TYR B CE1   1 
ATOM   2210  C  CE2   . TYR B  1  57   ? 4.039   17.035  143.045  1.00 65.73  ? 57   TYR B CE2   1 
ATOM   2211  C  CZ    . TYR B  1  57   ? 3.411   15.806  143.073  1.00 64.84  ? 57   TYR B CZ    1 
ATOM   2212  O  OH    . TYR B  1  57   ? 2.179   15.683  143.677  1.00 57.05  ? 57   TYR B OH    1 
ATOM   2213  N  N     . ILE B  1  58   ? 5.010   16.053  138.645  1.00 50.98  ? 58   ILE B N     1 
ATOM   2214  C  CA    . ILE B  1  58   ? 3.763   16.640  138.163  1.00 59.97  ? 58   ILE B CA    1 
ATOM   2215  C  C     . ILE B  1  58   ? 2.571   16.039  138.904  1.00 67.21  ? 58   ILE B C     1 
ATOM   2216  O  O     . ILE B  1  58   ? 2.456   14.817  139.016  1.00 64.25  ? 58   ILE B O     1 
ATOM   2217  C  CB    . ILE B  1  58   ? 3.570   16.412  136.653  1.00 57.79  ? 58   ILE B CB    1 
ATOM   2218  C  CG1   . ILE B  1  58   ? 4.830   16.804  135.881  1.00 59.46  ? 58   ILE B CG1   1 
ATOM   2219  C  CG2   . ILE B  1  58   ? 2.375   17.201  136.147  1.00 61.72  ? 58   ILE B CG2   1 
ATOM   2220  C  CD1   . ILE B  1  58   ? 4.774   16.454  134.409  1.00 51.67  ? 58   ILE B CD1   1 
ATOM   2221  N  N     . GLU B  1  59   ? 1.692   16.904  139.408  1.00 70.81  ? 59   GLU B N     1 
ATOM   2222  C  CA    . GLU B  1  59   ? 0.503   16.466  140.137  1.00 69.97  ? 59   GLU B CA    1 
ATOM   2223  C  C     . GLU B  1  59   ? -0.357  15.534  139.299  1.00 69.59  ? 59   GLU B C     1 
ATOM   2224  O  O     . GLU B  1  59   ? -0.483  15.717  138.087  1.00 70.41  ? 59   GLU B O     1 
ATOM   2225  C  CB    . GLU B  1  59   ? -0.340  17.663  140.583  1.00 78.60  ? 59   GLU B CB    1 
ATOM   2226  C  CG    . GLU B  1  59   ? 0.190   18.401  141.800  1.00 83.65  ? 59   GLU B CG    1 
ATOM   2227  C  CD    . GLU B  1  59   ? -0.798  19.429  142.324  1.00 82.86  ? 59   GLU B CD    1 
ATOM   2228  O  OE1   . GLU B  1  59   ? -0.386  20.307  143.111  1.00 86.24  ? 59   GLU B OE1   1 
ATOM   2229  O  OE2   . GLU B  1  59   ? -1.988  19.356  141.950  1.00 74.33  ? 59   GLU B OE2   1 
ATOM   2230  N  N     . ASP B  1  60   ? -0.936  14.533  139.957  1.00 71.96  ? 60   ASP B N     1 
ATOM   2231  C  CA    . ASP B  1  60   ? -1.836  13.575  139.317  1.00 75.90  ? 60   ASP B CA    1 
ATOM   2232  C  C     . ASP B  1  60   ? -1.165  12.834  138.161  1.00 71.04  ? 60   ASP B C     1 
ATOM   2233  O  O     . ASP B  1  60   ? -1.830  12.387  137.227  1.00 73.02  ? 60   ASP B O     1 
ATOM   2234  C  CB    . ASP B  1  60   ? -3.118  14.272  138.842  1.00 84.39  ? 60   ASP B CB    1 
ATOM   2235  C  CG    . ASP B  1  60   ? -3.842  14.998  139.966  1.00 87.92  ? 60   ASP B CG    1 
ATOM   2236  O  OD1   . ASP B  1  60   ? -3.995  14.409  141.058  1.00 83.30  ? 60   ASP B OD1   1 
ATOM   2237  O  OD2   . ASP B  1  60   ? -4.255  16.160  139.758  1.00 84.62  ? 60   ASP B OD2   1 
ATOM   2238  N  N     . VAL B  1  61   ? 0.157   12.707  138.233  1.00 65.93  ? 61   VAL B N     1 
ATOM   2239  C  CA    . VAL B  1  61   ? 0.921   12.000  137.214  1.00 59.05  ? 61   VAL B CA    1 
ATOM   2240  C  C     . VAL B  1  61   ? 1.805   10.942  137.859  1.00 62.28  ? 61   VAL B C     1 
ATOM   2241  O  O     . VAL B  1  61   ? 2.683   11.259  138.660  1.00 64.92  ? 61   VAL B O     1 
ATOM   2242  C  CB    . VAL B  1  61   ? 1.804   12.959  136.401  1.00 55.65  ? 61   VAL B CB    1 
ATOM   2243  C  CG1   . VAL B  1  61   ? 2.708   12.176  135.466  1.00 61.24  ? 61   VAL B CG1   1 
ATOM   2244  C  CG2   . VAL B  1  61   ? 0.944   13.935  135.620  1.00 60.91  ? 61   VAL B CG2   1 
ATOM   2245  N  N     . LEU B  1  62   ? 1.574   9.685   137.501  1.00 62.52  ? 62   LEU B N     1 
ATOM   2246  C  CA    . LEU B  1  62   ? 2.285   8.577   138.129  1.00 69.57  ? 62   LEU B CA    1 
ATOM   2247  C  C     . LEU B  1  62   ? 3.682   8.369   137.548  1.00 68.15  ? 62   LEU B C     1 
ATOM   2248  O  O     . LEU B  1  62   ? 4.683   8.609   138.223  1.00 61.88  ? 62   LEU B O     1 
ATOM   2249  C  CB    . LEU B  1  62   ? 1.463   7.292   138.020  1.00 70.02  ? 62   LEU B CB    1 
ATOM   2250  C  CG    . LEU B  1  62   ? 0.051   7.392   138.598  1.00 73.80  ? 62   LEU B CG    1 
ATOM   2251  C  CD1   . LEU B  1  62   ? -0.678  6.063   138.481  1.00 80.51  ? 62   LEU B CD1   1 
ATOM   2252  C  CD2   . LEU B  1  62   ? 0.097   7.863   140.046  1.00 72.43  ? 62   LEU B CD2   1 
ATOM   2253  N  N     . HIS B  1  63   ? 3.744   7.927   136.295  1.00 73.72  ? 63   HIS B N     1 
ATOM   2254  C  CA    . HIS B  1  63   ? 5.019   7.606   135.657  1.00 64.06  ? 63   HIS B CA    1 
ATOM   2255  C  C     . HIS B  1  63   ? 5.326   8.476   134.438  1.00 64.33  ? 63   HIS B C     1 
ATOM   2256  O  O     . HIS B  1  63   ? 4.563   9.378   134.091  1.00 61.57  ? 63   HIS B O     1 
ATOM   2257  C  CB    . HIS B  1  63   ? 5.071   6.123   135.281  1.00 63.06  ? 63   HIS B CB    1 
ATOM   2258  C  CG    . HIS B  1  63   ? 3.869   5.648   134.521  1.00 68.76  ? 63   HIS B CG    1 
ATOM   2259  N  ND1   . HIS B  1  63   ? 3.762   5.757   133.155  1.00 68.55  ? 63   HIS B ND1   1 
ATOM   2260  C  CD2   . HIS B  1  63   ? 2.724   5.060   134.948  1.00 73.99  ? 63   HIS B CD2   1 
ATOM   2261  C  CE1   . HIS B  1  63   ? 2.600   5.254   132.765  1.00 71.81  ? 63   HIS B CE1   1 
ATOM   2262  N  NE2   . HIS B  1  63   ? 1.954   4.828   133.832  1.00 75.87  ? 63   HIS B NE2   1 
ATOM   2263  N  N     . GLU B  1  64   ? 6.452   8.188   133.793  1.00 62.54  ? 64   GLU B N     1 
ATOM   2264  C  CA    . GLU B  1  64   ? 6.948   8.984   132.674  1.00 59.74  ? 64   GLU B CA    1 
ATOM   2265  C  C     . GLU B  1  64   ? 6.104   8.817   131.409  1.00 60.49  ? 64   GLU B C     1 
ATOM   2266  O  O     . GLU B  1  64   ? 5.998   9.735   130.593  1.00 57.20  ? 64   GLU B O     1 
ATOM   2267  C  CB    . GLU B  1  64   ? 8.410   8.615   132.391  1.00 65.80  ? 64   GLU B CB    1 
ATOM   2268  C  CG    . GLU B  1  64   ? 9.117   9.498   131.370  1.00 73.63  ? 64   GLU B CG    1 
ATOM   2269  C  CD    . GLU B  1  64   ? 10.596  9.160   131.225  1.00 71.00  ? 64   GLU B CD    1 
ATOM   2270  O  OE1   . GLU B  1  64   ? 11.316  9.922   130.545  1.00 64.66  ? 64   GLU B OE1   1 
ATOM   2271  O  OE2   . GLU B  1  64   ? 11.040  8.135   131.789  1.00 65.81  ? 64   GLU B OE2   1 
ATOM   2272  N  N     . PHE B  1  65   ? 5.505   7.643   131.253  1.00 61.53  ? 65   PHE B N     1 
ATOM   2273  C  CA    . PHE B  1  65   ? 4.755   7.315   130.044  1.00 58.36  ? 65   PHE B CA    1 
ATOM   2274  C  C     . PHE B  1  65   ? 3.257   7.583   130.156  1.00 64.70  ? 65   PHE B C     1 
ATOM   2275  O  O     . PHE B  1  65   ? 2.492   7.246   129.252  1.00 63.12  ? 65   PHE B O     1 
ATOM   2276  C  CB    . PHE B  1  65   ? 5.029   5.872   129.627  1.00 60.39  ? 65   PHE B CB    1 
ATOM   2277  C  CG    . PHE B  1  65   ? 6.484   5.575   129.447  1.00 63.04  ? 65   PHE B CG    1 
ATOM   2278  C  CD1   . PHE B  1  65   ? 7.162   6.037   128.332  1.00 60.93  ? 65   PHE B CD1   1 
ATOM   2279  C  CD2   . PHE B  1  65   ? 7.183   4.859   130.403  1.00 67.13  ? 65   PHE B CD2   1 
ATOM   2280  C  CE1   . PHE B  1  65   ? 8.509   5.779   128.165  1.00 55.73  ? 65   PHE B CE1   1 
ATOM   2281  C  CE2   . PHE B  1  65   ? 8.531   4.594   130.242  1.00 70.36  ? 65   PHE B CE2   1 
ATOM   2282  C  CZ    . PHE B  1  65   ? 9.195   5.056   129.122  1.00 59.94  ? 65   PHE B CZ    1 
ATOM   2283  N  N     . SER B  1  66   ? 2.841   8.185   131.266  1.00 72.42  ? 66   SER B N     1 
ATOM   2284  C  CA    . SER B  1  66   ? 1.432   8.498   131.478  1.00 72.62  ? 66   SER B CA    1 
ATOM   2285  C  C     . SER B  1  66   ? 0.980   9.630   130.562  1.00 70.01  ? 66   SER B C     1 
ATOM   2286  O  O     . SER B  1  66   ? 1.762   10.162  129.773  1.00 64.50  ? 66   SER B O     1 
ATOM   2287  C  CB    . SER B  1  66   ? 1.181   8.892   132.937  1.00 74.04  ? 66   SER B CB    1 
ATOM   2288  O  OG    . SER B  1  66   ? 1.469   7.824   133.822  1.00 81.16  ? 66   SER B OG    1 
ATOM   2289  N  N     . THR B  1  67   ? -0.292  9.994   130.673  1.00 70.56  ? 67   THR B N     1 
ATOM   2290  C  CA    . THR B  1  67   ? -0.838  11.086  129.880  1.00 69.22  ? 67   THR B CA    1 
ATOM   2291  C  C     . THR B  1  67   ? -1.609  12.061  130.769  1.00 71.09  ? 67   THR B C     1 
ATOM   2292  O  O     . THR B  1  67   ? -2.212  11.666  131.768  1.00 70.74  ? 67   THR B O     1 
ATOM   2293  C  CB    . THR B  1  67   ? -1.734  10.567  128.736  1.00 58.81  ? 67   THR B CB    1 
ATOM   2294  O  OG1   . THR B  1  67   ? -2.250  11.676  127.988  1.00 67.03  ? 67   THR B OG1   1 
ATOM   2295  C  CG2   . THR B  1  67   ? -2.888  9.740   129.286  1.00 56.67  ? 67   THR B CG2   1 
ATOM   2296  N  N     . ILE B  1  68   ? -1.569  13.338  130.407  1.00 67.03  ? 68   ILE B N     1 
ATOM   2297  C  CA    . ILE B  1  68   ? -2.202  14.380  131.204  1.00 59.52  ? 68   ILE B CA    1 
ATOM   2298  C  C     . ILE B  1  68   ? -3.478  14.898  130.549  1.00 70.43  ? 68   ILE B C     1 
ATOM   2299  O  O     . ILE B  1  68   ? -3.464  15.305  129.384  1.00 63.52  ? 68   ILE B O     1 
ATOM   2300  C  CB    . ILE B  1  68   ? -1.244  15.556  131.445  1.00 53.28  ? 68   ILE B CB    1 
ATOM   2301  C  CG1   . ILE B  1  68   ? 0.057   15.055  132.072  1.00 52.35  ? 68   ILE B CG1   1 
ATOM   2302  C  CG2   . ILE B  1  68   ? -1.898  16.604  132.330  1.00 57.32  ? 68   ILE B CG2   1 
ATOM   2303  C  CD1   . ILE B  1  68   ? 1.074   16.146  132.313  1.00 63.28  ? 68   ILE B CD1   1 
ATOM   2304  N  N     . PRO B  1  69   ? -4.593  14.864  131.297  1.00 76.53  ? 69   PRO B N     1 
ATOM   2305  C  CA    . PRO B  1  69   ? -5.876  15.413  130.843  1.00 73.01  ? 69   PRO B CA    1 
ATOM   2306  C  C     . PRO B  1  69   ? -5.825  16.935  130.751  1.00 68.72  ? 69   PRO B C     1 
ATOM   2307  O  O     . PRO B  1  69   ? -5.288  17.586  131.649  1.00 63.89  ? 69   PRO B O     1 
ATOM   2308  C  CB    . PRO B  1  69   ? -6.850  14.990  131.951  1.00 61.90  ? 69   PRO B CB    1 
ATOM   2309  C  CG    . PRO B  1  69   ? -6.165  13.873  132.675  1.00 54.27  ? 69   PRO B CG    1 
ATOM   2310  C  CD    . PRO B  1  69   ? -4.713  14.202  132.607  1.00 58.73  ? 69   PRO B CD    1 
ATOM   2311  N  N     . GLY B  1  70   ? -6.373  17.492  129.676  1.00 65.91  ? 70   GLY B N     1 
ATOM   2312  C  CA    . GLY B  1  70   ? -6.424  18.934  129.511  1.00 74.10  ? 70   GLY B CA    1 
ATOM   2313  C  C     . GLY B  1  70   ? -5.128  19.542  129.007  1.00 74.34  ? 70   GLY B C     1 
ATOM   2314  O  O     . GLY B  1  70   ? -4.989  20.764  128.936  1.00 73.77  ? 70   GLY B O     1 
ATOM   2315  N  N     . VAL B  1  71   ? -4.171  18.686  128.663  1.00 69.94  ? 71   VAL B N     1 
ATOM   2316  C  CA    . VAL B  1  71   ? -2.905  19.138  128.100  1.00 59.78  ? 71   VAL B CA    1 
ATOM   2317  C  C     . VAL B  1  71   ? -2.605  18.374  126.812  1.00 60.25  ? 71   VAL B C     1 
ATOM   2318  O  O     . VAL B  1  71   ? -2.667  17.143  126.784  1.00 61.48  ? 71   VAL B O     1 
ATOM   2319  C  CB    . VAL B  1  71   ? -1.743  18.960  129.099  1.00 54.22  ? 71   VAL B CB    1 
ATOM   2320  C  CG1   . VAL B  1  71   ? -0.436  19.417  128.479  1.00 55.64  ? 71   VAL B CG1   1 
ATOM   2321  C  CG2   . VAL B  1  71   ? -2.020  19.730  130.382  1.00 55.03  ? 71   VAL B CG2   1 
ATOM   2322  N  N     . LYS B  1  72   ? -2.293  19.110  125.749  1.00 56.96  ? 72   LYS B N     1 
ATOM   2323  C  CA    . LYS B  1  72   ? -2.035  18.511  124.441  1.00 51.11  ? 72   LYS B CA    1 
ATOM   2324  C  C     . LYS B  1  72   ? -0.800  17.609  124.443  1.00 52.29  ? 72   LYS B C     1 
ATOM   2325  O  O     . LYS B  1  72   ? -0.845  16.488  123.937  1.00 59.83  ? 72   LYS B O     1 
ATOM   2326  C  CB    . LYS B  1  72   ? -1.927  19.594  123.362  1.00 54.58  ? 72   LYS B CB    1 
ATOM   2327  C  CG    . LYS B  1  72   ? -1.213  19.159  122.088  1.00 67.80  ? 72   LYS B CG    1 
ATOM   2328  C  CD    . LYS B  1  72   ? -1.701  19.938  120.866  1.00 64.71  ? 72   LYS B CD    1 
ATOM   2329  C  CE    . LYS B  1  72   ? -1.578  21.447  121.052  1.00 60.88  ? 72   LYS B CE    1 
ATOM   2330  N  NZ    . LYS B  1  72   ? -0.162  21.912  121.096  1.00 60.95  ? 72   LYS B NZ    1 
ATOM   2331  N  N     . GLU B  1  73   ? 0.298   18.094  125.015  1.00 45.43  ? 73   GLU B N     1 
ATOM   2332  C  CA    . GLU B  1  73   ? 1.515   17.294  125.114  1.00 44.58  ? 73   GLU B CA    1 
ATOM   2333  C  C     . GLU B  1  73   ? 1.388   16.205  126.177  1.00 47.38  ? 73   GLU B C     1 
ATOM   2334  O  O     . GLU B  1  73   ? 0.699   16.384  127.179  1.00 51.72  ? 73   GLU B O     1 
ATOM   2335  C  CB    . GLU B  1  73   ? 2.723   18.178  125.436  1.00 38.59  ? 73   GLU B CB    1 
ATOM   2336  C  CG    . GLU B  1  73   ? 3.063   19.204  124.370  1.00 48.60  ? 73   GLU B CG    1 
ATOM   2337  C  CD    . GLU B  1  73   ? 2.377   20.532  124.603  1.00 54.67  ? 73   GLU B CD    1 
ATOM   2338  O  OE1   . GLU B  1  73   ? 1.510   20.600  125.499  1.00 58.85  ? 73   GLU B OE1   1 
ATOM   2339  O  OE2   . GLU B  1  73   ? 2.709   21.509  123.897  1.00 52.04  ? 73   GLU B OE2   1 
ATOM   2340  N  N     . ASP B  1  74   ? 2.055   15.076  125.956  1.00 49.00  ? 74   ASP B N     1 
ATOM   2341  C  CA    . ASP B  1  74   ? 2.143   14.042  126.981  1.00 49.92  ? 74   ASP B CA    1 
ATOM   2342  C  C     . ASP B  1  74   ? 3.296   14.362  127.928  1.00 47.19  ? 74   ASP B C     1 
ATOM   2343  O  O     . ASP B  1  74   ? 3.990   15.361  127.746  1.00 44.43  ? 74   ASP B O     1 
ATOM   2344  C  CB    . ASP B  1  74   ? 2.306   12.647  126.363  1.00 55.00  ? 74   ASP B CB    1 
ATOM   2345  C  CG    . ASP B  1  74   ? 3.402   12.587  125.310  1.00 53.61  ? 74   ASP B CG    1 
ATOM   2346  O  OD1   . ASP B  1  74   ? 4.365   13.382  125.385  1.00 52.54  ? 74   ASP B OD1   1 
ATOM   2347  O  OD2   . ASP B  1  74   ? 3.300   11.730  124.404  1.00 47.08  ? 74   ASP B OD2   1 
ATOM   2348  N  N     . VAL B  1  75   ? 3.496   13.517  128.933  1.00 48.71  ? 75   VAL B N     1 
ATOM   2349  C  CA    . VAL B  1  75   ? 4.530   13.753  129.935  1.00 48.61  ? 75   VAL B CA    1 
ATOM   2350  C  C     . VAL B  1  75   ? 5.919   13.782  129.299  1.00 42.81  ? 75   VAL B C     1 
ATOM   2351  O  O     . VAL B  1  75   ? 6.746   14.644  129.613  1.00 35.28  ? 75   VAL B O     1 
ATOM   2352  C  CB    . VAL B  1  75   ? 4.494   12.674  131.028  1.00 44.74  ? 75   VAL B CB    1 
ATOM   2353  C  CG1   . VAL B  1  75   ? 5.440   13.035  132.156  1.00 50.89  ? 75   VAL B CG1   1 
ATOM   2354  C  CG2   . VAL B  1  75   ? 3.082   12.508  131.554  1.00 46.32  ? 75   VAL B CG2   1 
ATOM   2355  N  N     . VAL B  1  76   ? 6.151   12.838  128.393  1.00 40.09  ? 76   VAL B N     1 
ATOM   2356  C  CA    . VAL B  1  76   ? 7.435   12.694  127.716  1.00 40.88  ? 76   VAL B CA    1 
ATOM   2357  C  C     . VAL B  1  76   ? 7.874   13.976  127.017  1.00 37.57  ? 76   VAL B C     1 
ATOM   2358  O  O     . VAL B  1  76   ? 8.988   14.466  127.233  1.00 32.88  ? 76   VAL B O     1 
ATOM   2359  C  CB    . VAL B  1  76   ? 7.383   11.562  126.678  1.00 38.91  ? 76   VAL B CB    1 
ATOM   2360  C  CG1   . VAL B  1  76   ? 8.715   11.447  125.955  1.00 36.27  ? 76   VAL B CG1   1 
ATOM   2361  C  CG2   . VAL B  1  76   ? 7.013   10.247  127.350  1.00 43.88  ? 76   VAL B CG2   1 
ATOM   2362  N  N     . GLU B  1  77   ? 6.992   14.513  126.179  1.00 36.14  ? 77   GLU B N     1 
ATOM   2363  C  CA    . GLU B  1  77   ? 7.296   15.724  125.429  1.00 34.44  ? 77   GLU B CA    1 
ATOM   2364  C  C     . GLU B  1  77   ? 7.643   16.870  126.372  1.00 31.02  ? 77   GLU B C     1 
ATOM   2365  O  O     . GLU B  1  77   ? 8.590   17.620  126.121  1.00 35.09  ? 77   GLU B O     1 
ATOM   2366  C  CB    . GLU B  1  77   ? 6.127   16.109  124.515  1.00 36.80  ? 77   GLU B CB    1 
ATOM   2367  C  CG    . GLU B  1  77   ? 6.424   17.271  123.564  1.00 42.54  ? 77   GLU B CG    1 
ATOM   2368  C  CD    . GLU B  1  77   ? 7.205   16.851  122.324  1.00 43.94  ? 77   GLU B CD    1 
ATOM   2369  O  OE1   . GLU B  1  77   ? 7.750   17.739  121.633  1.00 38.22  ? 77   GLU B OE1   1 
ATOM   2370  O  OE2   . GLU B  1  77   ? 7.267   15.637  122.032  1.00 41.60  ? 77   GLU B OE2   1 
ATOM   2371  N  N     . ILE B  1  78   ? 6.886   16.987  127.460  1.00 31.72  ? 78   ILE B N     1 
ATOM   2372  C  CA    . ILE B  1  78   ? 7.126   18.030  128.445  1.00 34.90  ? 78   ILE B CA    1 
ATOM   2373  C  C     . ILE B  1  78   ? 8.513   17.864  129.033  1.00 32.72  ? 78   ILE B C     1 
ATOM   2374  O  O     . ILE B  1  78   ? 9.242   18.837  129.199  1.00 31.62  ? 78   ILE B O     1 
ATOM   2375  C  CB    . ILE B  1  78   ? 6.101   17.989  129.591  1.00 35.93  ? 78   ILE B CB    1 
ATOM   2376  C  CG1   . ILE B  1  78   ? 4.681   18.167  129.053  1.00 40.24  ? 78   ILE B CG1   1 
ATOM   2377  C  CG2   . ILE B  1  78   ? 6.402   19.074  130.605  1.00 32.61  ? 78   ILE B CG2   1 
ATOM   2378  C  CD1   . ILE B  1  78   ? 3.610   18.025  130.111  1.00 43.02  ? 78   ILE B CD1   1 
ATOM   2379  N  N     . ILE B  1  79   ? 8.879   16.625  129.343  1.00 34.31  ? 79   ILE B N     1 
ATOM   2380  C  CA    . ILE B  1  79   ? 10.211  16.343  129.871  1.00 35.66  ? 79   ILE B CA    1 
ATOM   2381  C  C     . ILE B  1  79   ? 11.316  16.752  128.884  1.00 31.92  ? 79   ILE B C     1 
ATOM   2382  O  O     . ILE B  1  79   ? 12.344  17.297  129.277  1.00 29.26  ? 79   ILE B O     1 
ATOM   2383  C  CB    . ILE B  1  79   ? 10.348  14.851  130.262  1.00 37.30  ? 79   ILE B CB    1 
ATOM   2384  C  CG1   . ILE B  1  79   ? 9.429   14.527  131.441  1.00 38.60  ? 79   ILE B CG1   1 
ATOM   2385  C  CG2   . ILE B  1  79   ? 11.779  14.499  130.600  1.00 34.18  ? 79   ILE B CG2   1 
ATOM   2386  C  CD1   . ILE B  1  79   ? 9.579   13.122  131.970  1.00 44.20  ? 79   ILE B CD1   1 
ATOM   2387  N  N     . LEU B  1  80   ? 11.090  16.484  127.602  1.00 32.18  ? 80   LEU B N     1 
ATOM   2388  C  CA    . LEU B  1  80   ? 12.017  16.882  126.547  1.00 25.98  ? 80   LEU B CA    1 
ATOM   2389  C  C     . LEU B  1  80   ? 12.195  18.395  126.488  1.00 28.46  ? 80   LEU B C     1 
ATOM   2390  O  O     . LEU B  1  80   ? 13.316  18.907  126.430  1.00 29.35  ? 80   LEU B O     1 
ATOM   2391  C  CB    . LEU B  1  80   ? 11.506  16.371  125.197  1.00 22.99  ? 80   LEU B CB    1 
ATOM   2392  C  CG    . LEU B  1  80   ? 11.442  14.851  124.999  1.00 23.25  ? 80   LEU B CG    1 
ATOM   2393  C  CD1   . LEU B  1  80   ? 10.924  14.489  123.611  1.00 26.03  ? 80   LEU B CD1   1 
ATOM   2394  C  CD2   . LEU B  1  80   ? 12.810  14.248  125.233  1.00 28.41  ? 80   LEU B CD2   1 
ATOM   2395  N  N     . ASN B  1  81   ? 11.079  19.111  126.496  1.00 29.72  ? 81   ASN B N     1 
ATOM   2396  C  CA    . ASN B  1  81   ? 11.105  20.563  126.480  1.00 28.43  ? 81   ASN B CA    1 
ATOM   2397  C  C     . ASN B  1  81   ? 11.843  21.079  127.705  1.00 29.44  ? 81   ASN B C     1 
ATOM   2398  O  O     . ASN B  1  81   ? 12.555  22.087  127.641  1.00 26.41  ? 81   ASN B O     1 
ATOM   2399  C  CB    . ASN B  1  81   ? 9.677   21.112  126.450  1.00 28.94  ? 81   ASN B CB    1 
ATOM   2400  C  CG    . ASN B  1  81   ? 8.917   20.696  125.200  1.00 34.86  ? 81   ASN B CG    1 
ATOM   2401  O  OD1   . ASN B  1  81   ? 9.511   20.499  124.140  1.00 42.10  ? 81   ASN B OD1   1 
ATOM   2402  N  ND2   . ASN B  1  81   ? 7.598   20.567  125.317  1.00 31.42  ? 81   ASN B ND2   1 
ATOM   2403  N  N     . LEU B  1  82   ? 11.681  20.364  128.816  1.00 31.42  ? 82   LEU B N     1 
ATOM   2404  C  CA    . LEU B  1  82   ? 12.359  20.717  130.055  1.00 32.21  ? 82   LEU B CA    1 
ATOM   2405  C  C     . LEU B  1  82   ? 13.853  20.461  129.955  1.00 28.67  ? 82   LEU B C     1 
ATOM   2406  O  O     . LEU B  1  82   ? 14.647  21.140  130.609  1.00 32.04  ? 82   LEU B O     1 
ATOM   2407  C  CB    . LEU B  1  82   ? 11.760  19.955  131.241  1.00 33.47  ? 82   LEU B CB    1 
ATOM   2408  C  CG    . LEU B  1  82   ? 10.428  20.514  131.757  1.00 38.59  ? 82   LEU B CG    1 
ATOM   2409  C  CD1   . LEU B  1  82   ? 9.775   19.563  132.742  1.00 40.06  ? 82   LEU B CD1   1 
ATOM   2410  C  CD2   . LEU B  1  82   ? 10.656  21.874  132.396  1.00 39.42  ? 82   LEU B CD2   1 
ATOM   2411  N  N     . LYS B  1  83   ? 14.234  19.482  129.140  1.00 26.20  ? 83   LYS B N     1 
ATOM   2412  C  CA    . LYS B  1  83   ? 15.644  19.236  128.866  1.00 30.01  ? 83   LYS B CA    1 
ATOM   2413  C  C     . LYS B  1  83   ? 16.237  20.409  128.103  1.00 32.00  ? 83   LYS B C     1 
ATOM   2414  O  O     . LYS B  1  83   ? 17.374  20.799  128.344  1.00 33.85  ? 83   LYS B O     1 
ATOM   2415  C  CB    . LYS B  1  83   ? 15.835  17.963  128.044  1.00 27.77  ? 83   LYS B CB    1 
ATOM   2416  C  CG    . LYS B  1  83   ? 15.726  16.655  128.814  1.00 27.18  ? 83   LYS B CG    1 
ATOM   2417  C  CD    . LYS B  1  83   ? 15.939  15.474  127.878  1.00 26.34  ? 83   LYS B CD    1 
ATOM   2418  C  CE    . LYS B  1  83   ? 15.788  14.137  128.593  1.00 28.75  ? 83   LYS B CE    1 
ATOM   2419  N  NZ    . LYS B  1  83   ? 15.878  12.990  127.633  1.00 28.69  ? 83   LYS B NZ    1 
ATOM   2420  N  N     . GLU B  1  84   ? 15.455  20.975  127.187  1.00 28.71  ? 84   GLU B N     1 
ATOM   2421  C  CA    . GLU B  1  84   ? 15.934  22.106  126.382  1.00 35.32  ? 84   GLU B CA    1 
ATOM   2422  C  C     . GLU B  1  84   ? 16.033  23.416  127.167  1.00 41.22  ? 84   GLU B C     1 
ATOM   2423  O  O     . GLU B  1  84   ? 16.501  24.426  126.633  1.00 40.22  ? 84   GLU B O     1 
ATOM   2424  C  CB    . GLU B  1  84   ? 15.070  22.287  125.126  1.00 39.91  ? 84   GLU B CB    1 
ATOM   2425  C  CG    . GLU B  1  84   ? 15.300  21.224  124.076  1.00 43.41  ? 84   GLU B CG    1 
ATOM   2426  C  CD    . GLU B  1  84   ? 14.561  21.521  122.790  1.00 61.33  ? 84   GLU B CD    1 
ATOM   2427  O  OE1   . GLU B  1  84   ? 13.940  22.602  122.712  1.00 66.71  ? 84   GLU B OE1   1 
ATOM   2428  O  OE2   . GLU B  1  84   ? 14.595  20.681  121.864  1.00 60.67  ? 84   GLU B OE2   1 
ATOM   2429  N  N     . LEU B  1  85   ? 15.582  23.396  128.420  1.00 42.29  ? 85   LEU B N     1 
ATOM   2430  C  CA    . LEU B  1  85   ? 15.645  24.571  129.286  1.00 40.95  ? 85   LEU B CA    1 
ATOM   2431  C  C     . LEU B  1  85   ? 17.083  24.889  129.704  1.00 38.41  ? 85   LEU B C     1 
ATOM   2432  O  O     . LEU B  1  85   ? 17.789  24.032  130.235  1.00 38.82  ? 85   LEU B O     1 
ATOM   2433  C  CB    . LEU B  1  85   ? 14.779  24.351  130.525  1.00 37.07  ? 85   LEU B CB    1 
ATOM   2434  C  CG    . LEU B  1  85   ? 14.783  25.476  131.551  1.00 32.34  ? 85   LEU B CG    1 
ATOM   2435  C  CD1   . LEU B  1  85   ? 14.252  26.756  130.923  1.00 39.38  ? 85   LEU B CD1   1 
ATOM   2436  C  CD2   . LEU B  1  85   ? 13.960  25.073  132.755  1.00 36.16  ? 85   LEU B CD2   1 
ATOM   2437  N  N     . VAL B  1  86   ? 17.515  26.121  129.454  1.00 36.96  ? 86   VAL B N     1 
ATOM   2438  C  CA    . VAL B  1  86   ? 18.854  26.560  129.830  1.00 36.76  ? 86   VAL B CA    1 
ATOM   2439  C  C     . VAL B  1  86   ? 18.799  27.478  131.052  1.00 38.70  ? 86   VAL B C     1 
ATOM   2440  O  O     . VAL B  1  86   ? 18.287  28.595  130.983  1.00 42.67  ? 86   VAL B O     1 
ATOM   2441  C  CB    . VAL B  1  86   ? 19.535  27.301  128.671  1.00 34.48  ? 86   VAL B CB    1 
ATOM   2442  C  CG1   . VAL B  1  86   ? 20.935  27.720  129.066  1.00 30.75  ? 86   VAL B CG1   1 
ATOM   2443  C  CG2   . VAL B  1  86   ? 19.553  26.418  127.429  1.00 41.27  ? 86   VAL B CG2   1 
ATOM   2444  N  N     . VAL B  1  87   ? 19.321  26.998  132.174  1.00 37.69  ? 87   VAL B N     1 
ATOM   2445  C  CA    . VAL B  1  87   ? 19.306  27.771  133.412  1.00 34.55  ? 87   VAL B CA    1 
ATOM   2446  C  C     . VAL B  1  87   ? 20.721  28.171  133.829  1.00 37.38  ? 87   VAL B C     1 
ATOM   2447  O  O     . VAL B  1  87   ? 21.630  27.343  133.850  1.00 39.60  ? 87   VAL B O     1 
ATOM   2448  C  CB    . VAL B  1  87   ? 18.615  26.991  134.548  1.00 33.52  ? 87   VAL B CB    1 
ATOM   2449  C  CG1   . VAL B  1  87   ? 18.848  27.666  135.889  1.00 35.00  ? 87   VAL B CG1   1 
ATOM   2450  C  CG2   . VAL B  1  87   ? 17.124  26.851  134.262  1.00 33.38  ? 87   VAL B CG2   1 
ATOM   2451  N  N     . ARG B  1  88   ? 20.902  29.448  134.151  1.00 38.21  ? 88   ARG B N     1 
ATOM   2452  C  CA    . ARG B  1  88   ? 22.205  29.965  134.546  1.00 39.76  ? 88   ARG B CA    1 
ATOM   2453  C  C     . ARG B  1  88   ? 22.221  30.394  136.013  1.00 46.69  ? 88   ARG B C     1 
ATOM   2454  O  O     . ARG B  1  88   ? 21.417  31.225  136.437  1.00 51.43  ? 88   ARG B O     1 
ATOM   2455  C  CB    . ARG B  1  88   ? 22.586  31.142  133.650  1.00 46.71  ? 88   ARG B CB    1 
ATOM   2456  C  CG    . ARG B  1  88   ? 23.919  31.791  133.978  1.00 53.21  ? 88   ARG B CG    1 
ATOM   2457  C  CD    . ARG B  1  88   ? 24.172  32.956  133.038  1.00 58.74  ? 88   ARG B CD    1 
ATOM   2458  N  NE    . ARG B  1  88   ? 25.453  33.609  133.278  1.00 60.00  ? 88   ARG B NE    1 
ATOM   2459  C  CZ    . ARG B  1  88   ? 25.911  34.623  132.551  1.00 70.23  ? 88   ARG B CZ    1 
ATOM   2460  N  NH1   . ARG B  1  88   ? 25.191  35.093  131.541  1.00 60.17  ? 88   ARG B NH1   1 
ATOM   2461  N  NH2   . ARG B  1  88   ? 27.089  35.166  132.830  1.00 83.28  ? 88   ARG B NH2   1 
ATOM   2462  N  N     . PHE B  1  89   ? 23.140  29.824  136.785  1.00 40.92  ? 89   PHE B N     1 
ATOM   2463  C  CA    . PHE B  1  89   ? 23.286  30.181  138.191  1.00 41.51  ? 89   PHE B CA    1 
ATOM   2464  C  C     . PHE B  1  89   ? 24.262  31.340  138.342  1.00 47.76  ? 89   PHE B C     1 
ATOM   2465  O  O     . PHE B  1  89   ? 25.436  31.219  137.995  1.00 51.49  ? 89   PHE B O     1 
ATOM   2466  C  CB    . PHE B  1  89   ? 23.792  28.985  139.002  1.00 45.09  ? 89   PHE B CB    1 
ATOM   2467  C  CG    . PHE B  1  89   ? 22.786  27.878  139.158  1.00 40.53  ? 89   PHE B CG    1 
ATOM   2468  C  CD1   . PHE B  1  89   ? 21.464  28.057  138.780  1.00 38.09  ? 89   PHE B CD1   1 
ATOM   2469  C  CD2   . PHE B  1  89   ? 23.164  26.659  139.697  1.00 37.50  ? 89   PHE B CD2   1 
ATOM   2470  C  CE1   . PHE B  1  89   ? 20.540  27.036  138.930  1.00 35.24  ? 89   PHE B CE1   1 
ATOM   2471  C  CE2   . PHE B  1  89   ? 22.244  25.636  139.850  1.00 36.12  ? 89   PHE B CE2   1 
ATOM   2472  C  CZ    . PHE B  1  89   ? 20.932  25.824  139.466  1.00 31.26  ? 89   PHE B CZ    1 
ATOM   2473  N  N     . LEU B  1  90   ? 23.779  32.461  138.864  1.00 49.86  ? 90   LEU B N     1 
ATOM   2474  C  CA    . LEU B  1  90   ? 24.628  33.633  139.050  1.00 53.45  ? 90   LEU B CA    1 
ATOM   2475  C  C     . LEU B  1  90   ? 25.551  33.455  140.251  1.00 61.07  ? 90   LEU B C     1 
ATOM   2476  O  O     . LEU B  1  90   ? 26.750  33.726  140.173  1.00 60.08  ? 90   LEU B O     1 
ATOM   2477  C  CB    . LEU B  1  90   ? 23.785  34.899  139.218  1.00 54.35  ? 90   LEU B CB    1 
ATOM   2478  C  CG    . LEU B  1  90   ? 22.995  35.386  138.001  1.00 59.11  ? 90   LEU B CG    1 
ATOM   2479  C  CD1   . LEU B  1  90   ? 23.831  35.261  136.729  1.00 63.55  ? 90   LEU B CD1   1 
ATOM   2480  C  CD2   . LEU B  1  90   ? 21.666  34.652  137.862  1.00 56.79  ? 90   LEU B CD2   1 
ATOM   2481  N  N     . PRO B  1  92   ? 27.885  31.608  142.495  1.00 55.44  ? 92   PRO B N     1 
ATOM   2482  C  CA    . PRO B  1  92   ? 28.788  30.460  142.354  1.00 57.09  ? 92   PRO B CA    1 
ATOM   2483  C  C     . PRO B  1  92   ? 28.647  29.456  143.497  1.00 61.99  ? 92   PRO B C     1 
ATOM   2484  O  O     . PRO B  1  92   ? 29.013  28.292  143.338  1.00 63.56  ? 92   PRO B O     1 
ATOM   2485  C  CB    . PRO B  1  92   ? 30.177  31.105  142.388  1.00 55.13  ? 92   PRO B CB    1 
ATOM   2486  C  CG    . PRO B  1  92   ? 29.981  32.388  143.116  1.00 58.37  ? 92   PRO B CG    1 
ATOM   2487  C  CD    . PRO B  1  92   ? 28.623  32.865  142.705  1.00 56.62  ? 92   PRO B CD    1 
ATOM   2488  N  N     . SER B  1  93   ? 28.123  29.907  144.632  1.00 62.88  ? 93   SER B N     1 
ATOM   2489  C  CA    . SER B  1  93   ? 27.921  29.035  145.782  1.00 58.02  ? 93   SER B CA    1 
ATOM   2490  C  C     . SER B  1  93   ? 26.790  28.045  145.522  1.00 51.41  ? 93   SER B C     1 
ATOM   2491  O  O     . SER B  1  93   ? 26.844  26.894  145.958  1.00 47.66  ? 93   SER B O     1 
ATOM   2492  C  CB    . SER B  1  93   ? 27.596  29.867  147.027  1.00 68.08  ? 93   SER B CB    1 
ATOM   2493  O  OG    . SER B  1  93   ? 28.602  30.830  147.288  1.00 69.20  ? 93   SER B OG    1 
ATOM   2494  N  N     . LEU B  1  94   ? 25.773  28.508  144.799  1.00 48.67  ? 94   LEU B N     1 
ATOM   2495  C  CA    . LEU B  1  94   ? 24.549  27.744  144.568  1.00 45.16  ? 94   LEU B CA    1 
ATOM   2496  C  C     . LEU B  1  94   ? 24.776  26.430  143.822  1.00 45.31  ? 94   LEU B C     1 
ATOM   2497  O  O     . LEU B  1  94   ? 25.435  26.392  142.785  1.00 47.24  ? 94   LEU B O     1 
ATOM   2498  C  CB    . LEU B  1  94   ? 23.527  28.607  143.825  1.00 44.14  ? 94   LEU B CB    1 
ATOM   2499  C  CG    . LEU B  1  94   ? 22.209  27.970  143.383  1.00 36.49  ? 94   LEU B CG    1 
ATOM   2500  C  CD1   . LEU B  1  94   ? 21.498  27.309  144.548  1.00 39.82  ? 94   LEU B CD1   1 
ATOM   2501  C  CD2   . LEU B  1  94   ? 21.325  29.031  142.753  1.00 40.95  ? 94   LEU B CD2   1 
ATOM   2502  N  N     . GLN B  1  95   ? 24.214  25.355  144.363  1.00 46.35  ? 95   GLN B N     1 
ATOM   2503  C  CA    . GLN B  1  95   ? 24.358  24.027  143.782  1.00 40.68  ? 95   GLN B CA    1 
ATOM   2504  C  C     . GLN B  1  95   ? 23.082  23.587  143.074  1.00 38.87  ? 95   GLN B C     1 
ATOM   2505  O  O     . GLN B  1  95   ? 23.093  23.323  141.876  1.00 46.36  ? 95   GLN B O     1 
ATOM   2506  C  CB    . GLN B  1  95   ? 24.758  23.007  144.849  1.00 46.55  ? 95   GLN B CB    1 
ATOM   2507  C  CG    . GLN B  1  95   ? 26.098  23.293  145.515  1.00 56.92  ? 95   GLN B CG    1 
ATOM   2508  C  CD    . GLN B  1  95   ? 27.288  22.836  144.689  1.00 61.44  ? 95   GLN B CD    1 
ATOM   2509  O  OE1   . GLN B  1  95   ? 27.233  22.801  143.459  1.00 63.03  ? 95   GLN B OE1   1 
ATOM   2510  N  NE2   . GLN B  1  95   ? 28.374  22.477  145.367  1.00 54.84  ? 95   GLN B NE2   1 
ATOM   2511  N  N     . THR B  1  96   ? 21.991  23.482  143.825  1.00 39.28  ? 96   THR B N     1 
ATOM   2512  C  CA    . THR B  1  96   ? 20.719  23.055  143.252  1.00 32.13  ? 96   THR B CA    1 
ATOM   2513  C  C     . THR B  1  96   ? 19.555  23.970  143.616  1.00 28.59  ? 96   THR B C     1 
ATOM   2514  O  O     . THR B  1  96   ? 19.557  24.607  144.665  1.00 33.58  ? 96   THR B O     1 
ATOM   2515  C  CB    . THR B  1  96   ? 20.364  21.620  143.669  1.00 37.06  ? 96   THR B CB    1 
ATOM   2516  O  OG1   . THR B  1  96   ? 19.000  21.351  143.324  1.00 42.86  ? 96   THR B OG1   1 
ATOM   2517  C  CG2   . THR B  1  96   ? 20.545  21.440  145.167  1.00 36.27  ? 96   THR B CG2   1 
ATOM   2518  N  N     . VAL B  1  97   ? 18.565  24.031  142.729  1.00 30.58  ? 97   VAL B N     1 
ATOM   2519  C  CA    . VAL B  1  97   ? 17.351  24.809  142.955  1.00 30.59  ? 97   VAL B CA    1 
ATOM   2520  C  C     . VAL B  1  97   ? 16.141  23.964  142.577  1.00 35.79  ? 97   VAL B C     1 
ATOM   2521  O  O     . VAL B  1  97   ? 16.260  23.012  141.807  1.00 37.99  ? 97   VAL B O     1 
ATOM   2522  C  CB    . VAL B  1  97   ? 17.321  26.096  142.098  1.00 33.07  ? 97   VAL B CB    1 
ATOM   2523  C  CG1   . VAL B  1  97   ? 16.348  27.105  142.685  1.00 40.74  ? 97   VAL B CG1   1 
ATOM   2524  C  CG2   . VAL B  1  97   ? 18.701  26.712  141.997  1.00 37.48  ? 97   VAL B CG2   1 
ATOM   2525  N  N     . THR B  1  98   ? 14.979  24.309  143.126  1.00 42.58  ? 98   THR B N     1 
ATOM   2526  C  CA    . THR B  1  98   ? 13.724  23.675  142.734  1.00 43.33  ? 98   THR B CA    1 
ATOM   2527  C  C     . THR B  1  98   ? 12.744  24.732  142.235  1.00 39.51  ? 98   THR B C     1 
ATOM   2528  O  O     . THR B  1  98   ? 12.296  25.587  142.998  1.00 47.23  ? 98   THR B O     1 
ATOM   2529  C  CB    . THR B  1  98   ? 13.088  22.887  143.900  1.00 48.90  ? 98   THR B CB    1 
ATOM   2530  O  OG1   . THR B  1  98   ? 13.920  21.769  144.242  1.00 45.58  ? 98   THR B OG1   1 
ATOM   2531  C  CG2   . THR B  1  98   ? 11.705  22.384  143.510  1.00 48.94  ? 98   THR B CG2   1 
ATOM   2532  N  N     . LEU B  1  99   ? 12.413  24.666  140.950  1.00 41.09  ? 99   LEU B N     1 
ATOM   2533  C  CA    . LEU B  1  99   ? 11.565  25.673  140.319  1.00 41.48  ? 99   LEU B CA    1 
ATOM   2534  C  C     . LEU B  1  99   ? 10.120  25.196  140.241  1.00 45.41  ? 99   LEU B C     1 
ATOM   2535  O  O     . LEU B  1  99   ? 9.858   24.060  139.848  1.00 50.58  ? 99   LEU B O     1 
ATOM   2536  C  CB    . LEU B  1  99   ? 12.084  25.999  138.917  1.00 36.80  ? 99   LEU B CB    1 
ATOM   2537  C  CG    . LEU B  1  99   ? 13.157  27.081  138.762  1.00 37.45  ? 99   LEU B CG    1 
ATOM   2538  C  CD1   . LEU B  1  99   ? 14.321  26.878  139.717  1.00 32.09  ? 99   LEU B CD1   1 
ATOM   2539  C  CD2   . LEU B  1  99   ? 13.651  27.118  137.322  1.00 38.77  ? 99   LEU B CD2   1 
ATOM   2540  N  N     . LEU B  1  100  ? 9.184   26.064  140.613  1.00 45.47  ? 100  LEU B N     1 
ATOM   2541  C  CA    . LEU B  1  100  ? 7.772   25.692  140.627  1.00 49.64  ? 100  LEU B CA    1 
ATOM   2542  C  C     . LEU B  1  100  ? 6.987   26.352  139.499  1.00 48.97  ? 100  LEU B C     1 
ATOM   2543  O  O     . LEU B  1  100  ? 7.259   27.494  139.124  1.00 52.59  ? 100  LEU B O     1 
ATOM   2544  C  CB    . LEU B  1  100  ? 7.128   26.027  141.977  1.00 54.32  ? 100  LEU B CB    1 
ATOM   2545  C  CG    . LEU B  1  100  ? 7.602   25.257  143.214  1.00 58.87  ? 100  LEU B CG    1 
ATOM   2546  C  CD1   . LEU B  1  100  ? 8.838   25.902  143.838  1.00 52.32  ? 100  LEU B CD1   1 
ATOM   2547  C  CD2   . LEU B  1  100  ? 6.477   25.127  144.235  1.00 60.36  ? 100  LEU B CD2   1 
ATOM   2548  N  N     . LEU B  1  101  ? 6.021   25.620  138.952  1.00 44.79  ? 101  LEU B N     1 
ATOM   2549  C  CA    . LEU B  1  101  ? 5.145   26.159  137.919  1.00 56.91  ? 101  LEU B CA    1 
ATOM   2550  C  C     . LEU B  1  101  ? 3.696   25.723  138.116  1.00 61.98  ? 101  LEU B C     1 
ATOM   2551  O  O     . LEU B  1  101  ? 3.402   24.530  138.191  1.00 62.54  ? 101  LEU B O     1 
ATOM   2552  C  CB    . LEU B  1  101  ? 5.632   25.751  136.529  1.00 64.45  ? 101  LEU B CB    1 
ATOM   2553  C  CG    . LEU B  1  101  ? 4.878   26.375  135.354  1.00 59.72  ? 101  LEU B CG    1 
ATOM   2554  C  CD1   . LEU B  1  101  ? 5.868   26.916  134.339  1.00 61.91  ? 101  LEU B CD1   1 
ATOM   2555  C  CD2   . LEU B  1  101  ? 3.932   25.367  134.707  1.00 51.55  ? 101  LEU B CD2   1 
ATOM   2556  N  N     . LYS B  1  102  ? 2.796   26.699  138.192  1.00 63.13  ? 102  LYS B N     1 
ATOM   2557  C  CA    . LYS B  1  102  ? 1.374   26.426  138.359  1.00 61.91  ? 102  LYS B CA    1 
ATOM   2558  C  C     . LYS B  1  102  ? 0.568   27.266  137.378  1.00 58.55  ? 102  LYS B C     1 
ATOM   2559  O  O     . LYS B  1  102  ? 0.670   28.492  137.376  1.00 63.09  ? 102  LYS B O     1 
ATOM   2560  C  CB    . LYS B  1  102  ? 0.938   26.732  139.793  1.00 68.86  ? 102  LYS B CB    1 
ATOM   2561  C  CG    . LYS B  1  102  ? 1.704   25.956  140.855  1.00 70.03  ? 102  LYS B CG    1 
ATOM   2562  C  CD    . LYS B  1  102  ? 1.373   26.432  142.261  1.00 61.23  ? 102  LYS B CD    1 
ATOM   2563  C  CE    . LYS B  1  102  ? 2.171   25.656  143.298  1.00 64.91  ? 102  LYS B CE    1 
ATOM   2564  N  NZ    . LYS B  1  102  ? 1.872   26.096  144.688  1.00 67.23  ? 102  LYS B NZ    1 
ATOM   2565  N  N     . ALA B  1  103  ? -0.227  26.607  136.542  1.00 54.06  ? 103  ALA B N     1 
ATOM   2566  C  CA    . ALA B  1  103  ? -1.039  27.313  135.555  1.00 61.62  ? 103  ALA B CA    1 
ATOM   2567  C  C     . ALA B  1  103  ? -2.251  26.490  135.137  1.00 72.35  ? 103  ALA B C     1 
ATOM   2568  O  O     . ALA B  1  103  ? -2.298  25.281  135.364  1.00 76.59  ? 103  ALA B O     1 
ATOM   2569  C  CB    . ALA B  1  103  ? -0.198  27.679  134.340  1.00 67.23  ? 103  ALA B CB    1 
ATOM   2570  N  N     . GLU B  1  104  ? -3.231  27.149  134.525  1.00 74.10  ? 104  GLU B N     1 
ATOM   2571  C  CA    . GLU B  1  104  ? -4.432  26.466  134.053  1.00 80.10  ? 104  GLU B CA    1 
ATOM   2572  C  C     . GLU B  1  104  ? -5.147  27.247  132.952  1.00 82.67  ? 104  GLU B C     1 
ATOM   2573  O  O     . GLU B  1  104  ? -4.711  28.332  132.561  1.00 81.03  ? 104  GLU B O     1 
ATOM   2574  C  CB    . GLU B  1  104  ? -5.389  26.204  135.218  1.00 87.30  ? 104  GLU B CB    1 
ATOM   2575  C  CG    . GLU B  1  104  ? -5.750  27.447  136.016  1.00 88.96  ? 104  GLU B CG    1 
ATOM   2576  C  CD    . GLU B  1  104  ? -6.777  27.168  137.095  1.00 89.80  ? 104  GLU B CD    1 
ATOM   2577  O  OE1   . GLU B  1  104  ? -7.130  28.109  137.837  1.00 92.80  ? 104  GLU B OE1   1 
ATOM   2578  O  OE2   . GLU B  1  104  ? -7.232  26.009  137.200  1.00 86.95  ? 104  GLU B OE2   1 
ATOM   2579  N  N     . GLY B  1  105  ? -6.246  26.685  132.454  1.00 79.69  ? 105  GLY B N     1 
ATOM   2580  C  CA    . GLY B  1  105  ? -7.041  27.333  131.425  1.00 83.65  ? 105  GLY B CA    1 
ATOM   2581  C  C     . GLY B  1  105  ? -6.395  27.274  130.055  1.00 88.54  ? 105  GLY B C     1 
ATOM   2582  O  O     . GLY B  1  105  ? -5.400  26.576  129.867  1.00 97.68  ? 105  GLY B O     1 
ATOM   2583  N  N     . PRO B  1  106  ? -6.958  28.012  129.086  1.00 88.17  ? 106  PRO B N     1 
ATOM   2584  C  CA    . PRO B  1  106  ? -6.452  28.045  127.709  1.00 90.77  ? 106  PRO B CA    1 
ATOM   2585  C  C     . PRO B  1  106  ? -5.178  28.882  127.582  1.00 89.40  ? 106  PRO B C     1 
ATOM   2586  O  O     . PRO B  1  106  ? -5.242  30.047  127.187  1.00 88.43  ? 106  PRO B O     1 
ATOM   2587  C  CB    . PRO B  1  106  ? -7.599  28.702  126.938  1.00 90.40  ? 106  PRO B CB    1 
ATOM   2588  C  CG    . PRO B  1  106  ? -8.268  29.572  127.946  1.00 95.83  ? 106  PRO B CG    1 
ATOM   2589  C  CD    . PRO B  1  106  ? -8.163  28.842  129.255  1.00 91.02  ? 106  PRO B CD    1 
ATOM   2590  N  N     . LYS B  1  107  ? -4.032  28.293  127.910  1.00 82.37  ? 107  LYS B N     1 
ATOM   2591  C  CA    . LYS B  1  107  ? -2.782  29.048  127.920  1.00 76.48  ? 107  LYS B CA    1 
ATOM   2592  C  C     . LYS B  1  107  ? -1.585  28.228  127.448  1.00 71.36  ? 107  LYS B C     1 
ATOM   2593  O  O     . LYS B  1  107  ? -1.471  27.042  127.756  1.00 66.39  ? 107  LYS B O     1 
ATOM   2594  C  CB    . LYS B  1  107  ? -2.511  29.602  129.322  1.00 76.62  ? 107  LYS B CB    1 
ATOM   2595  C  CG    . LYS B  1  107  ? -1.243  30.436  129.430  1.00 68.57  ? 107  LYS B CG    1 
ATOM   2596  C  CD    . LYS B  1  107  ? -0.945  30.812  130.870  1.00 66.52  ? 107  LYS B CD    1 
ATOM   2597  C  CE    . LYS B  1  107  ? 0.304   31.671  130.962  1.00 64.10  ? 107  LYS B CE    1 
ATOM   2598  N  NZ    . LYS B  1  107  ? 0.626   32.033  132.369  1.00 68.88  ? 107  LYS B NZ    1 
ATOM   2599  N  N     . GLU B  1  108  ? -0.697  28.872  126.694  1.00 71.03  ? 108  GLU B N     1 
ATOM   2600  C  CA    . GLU B  1  108  ? 0.561   28.256  126.288  1.00 67.64  ? 108  GLU B CA    1 
ATOM   2601  C  C     . GLU B  1  108  ? 1.670   28.639  127.260  1.00 65.03  ? 108  GLU B C     1 
ATOM   2602  O  O     . GLU B  1  108  ? 2.052   29.805  127.356  1.00 61.73  ? 108  GLU B O     1 
ATOM   2603  C  CB    . GLU B  1  108  ? 0.937   28.670  124.864  1.00 66.51  ? 108  GLU B CB    1 
ATOM   2604  C  CG    . GLU B  1  108  ? 0.001   28.128  123.798  1.00 78.32  ? 108  GLU B CG    1 
ATOM   2605  C  CD    . GLU B  1  108  ? 0.481   28.429  122.391  1.00 87.42  ? 108  GLU B CD    1 
ATOM   2606  O  OE1   . GLU B  1  108  ? 1.577   29.012  122.246  1.00 81.35  ? 108  GLU B OE1   1 
ATOM   2607  O  OE2   . GLU B  1  108  ? -0.239  28.080  121.432  1.00 94.06  ? 108  GLU B OE2   1 
ATOM   2608  N  N     . VAL B  1  109  ? 2.184   27.646  127.977  1.00 62.26  ? 109  VAL B N     1 
ATOM   2609  C  CA    . VAL B  1  109  ? 3.172   27.877  129.022  1.00 57.34  ? 109  VAL B CA    1 
ATOM   2610  C  C     . VAL B  1  109  ? 4.592   27.991  128.473  1.00 52.24  ? 109  VAL B C     1 
ATOM   2611  O  O     . VAL B  1  109  ? 5.044   27.139  127.712  1.00 52.54  ? 109  VAL B O     1 
ATOM   2612  C  CB    . VAL B  1  109  ? 3.135   26.748  130.065  1.00 58.61  ? 109  VAL B CB    1 
ATOM   2613  C  CG1   . VAL B  1  109  ? 4.144   27.012  131.166  1.00 58.96  ? 109  VAL B CG1   1 
ATOM   2614  C  CG2   . VAL B  1  109  ? 1.735   26.607  130.640  1.00 65.25  ? 109  VAL B CG2   1 
ATOM   2615  N  N     . LYS B  1  110  ? 5.294   29.046  128.875  1.00 54.71  ? 110  LYS B N     1 
ATOM   2616  C  CA    . LYS B  1  110  ? 6.686   29.239  128.490  1.00 50.59  ? 110  LYS B CA    1 
ATOM   2617  C  C     . LYS B  1  110  ? 7.582   29.093  129.713  1.00 50.31  ? 110  LYS B C     1 
ATOM   2618  O  O     . LYS B  1  110  ? 7.101   28.813  130.809  1.00 52.43  ? 110  LYS B O     1 
ATOM   2619  C  CB    . LYS B  1  110  ? 6.884   30.616  127.851  1.00 51.34  ? 110  LYS B CB    1 
ATOM   2620  C  CG    . LYS B  1  110  ? 6.106   30.814  126.560  1.00 55.73  ? 110  LYS B CG    1 
ATOM   2621  C  CD    . LYS B  1  110  ? 6.591   29.863  125.476  1.00 59.87  ? 110  LYS B CD    1 
ATOM   2622  C  CE    . LYS B  1  110  ? 5.682   29.884  124.255  1.00 55.57  ? 110  LYS B CE    1 
ATOM   2623  N  NZ    . LYS B  1  110  ? 4.330   29.336  124.559  1.00 53.60  ? 110  LYS B NZ    1 
ATOM   2624  N  N     . ALA B  1  111  ? 8.885   29.271  129.524  1.00 54.42  ? 111  ALA B N     1 
ATOM   2625  C  CA    . ALA B  1  111  ? 9.833   29.180  130.631  1.00 54.48  ? 111  ALA B CA    1 
ATOM   2626  C  C     . ALA B  1  111  ? 9.761   30.433  131.495  1.00 61.33  ? 111  ALA B C     1 
ATOM   2627  O  O     . ALA B  1  111  ? 10.303  30.475  132.600  1.00 64.11  ? 111  ALA B O     1 
ATOM   2628  C  CB    . ALA B  1  111  ? 11.243  28.968  130.110  1.00 51.66  ? 111  ALA B CB    1 
ATOM   2629  N  N     . ARG B  1  112  ? 9.090   31.454  130.974  1.00 62.64  ? 112  ARG B N     1 
ATOM   2630  C  CA    . ARG B  1  112  ? 8.875   32.698  131.697  1.00 63.94  ? 112  ARG B CA    1 
ATOM   2631  C  C     . ARG B  1  112  ? 7.964   32.444  132.890  1.00 62.72  ? 112  ARG B C     1 
ATOM   2632  O  O     . ARG B  1  112  ? 8.103   33.068  133.941  1.00 59.60  ? 112  ARG B O     1 
ATOM   2633  C  CB    . ARG B  1  112  ? 8.221   33.720  130.768  1.00 70.81  ? 112  ARG B CB    1 
ATOM   2634  C  CG    . ARG B  1  112  ? 8.595   35.165  131.034  1.00 70.29  ? 112  ARG B CG    1 
ATOM   2635  C  CD    . ARG B  1  112  ? 7.817   36.092  130.114  1.00 73.49  ? 112  ARG B CD    1 
ATOM   2636  N  NE    . ARG B  1  112  ? 7.532   35.469  128.822  1.00 68.26  ? 112  ARG B NE    1 
ATOM   2637  C  CZ    . ARG B  1  112  ? 8.375   35.452  127.795  1.00 67.67  ? 112  ARG B CZ    1 
ATOM   2638  N  NH1   . ARG B  1  112  ? 9.568   36.022  127.907  1.00 65.08  ? 112  ARG B NH1   1 
ATOM   2639  N  NH2   . ARG B  1  112  ? 8.029   34.862  126.657  1.00 61.36  ? 112  ARG B NH2   1 
ATOM   2640  N  N     . ASP B  1  113  ? 7.037   31.506  132.713  1.00 62.47  ? 113  ASP B N     1 
ATOM   2641  C  CA    . ASP B  1  113  ? 5.992   31.227  133.693  1.00 55.64  ? 113  ASP B CA    1 
ATOM   2642  C  C     . ASP B  1  113  ? 6.515   30.638  134.999  1.00 55.20  ? 113  ASP B C     1 
ATOM   2643  O  O     . ASP B  1  113  ? 5.795   30.593  135.995  1.00 61.55  ? 113  ASP B O     1 
ATOM   2644  C  CB    . ASP B  1  113  ? 4.941   30.295  133.086  1.00 59.54  ? 113  ASP B CB    1 
ATOM   2645  C  CG    . ASP B  1  113  ? 4.279   30.888  131.857  1.00 71.38  ? 113  ASP B CG    1 
ATOM   2646  O  OD1   . ASP B  1  113  ? 4.793   31.903  131.335  1.00 73.57  ? 113  ASP B OD1   1 
ATOM   2647  O  OD2   . ASP B  1  113  ? 3.248   30.337  131.410  1.00 71.61  ? 113  ASP B OD2   1 
ATOM   2648  N  N     . PHE B  1  114  ? 7.761   30.177  134.994  1.00 56.16  ? 114  PHE B N     1 
ATOM   2649  C  CA    . PHE B  1  114  ? 8.380   29.677  136.215  1.00 62.12  ? 114  PHE B CA    1 
ATOM   2650  C  C     . PHE B  1  114  ? 8.545   30.806  137.230  1.00 65.33  ? 114  PHE B C     1 
ATOM   2651  O  O     . PHE B  1  114  ? 9.026   31.889  136.889  1.00 65.18  ? 114  PHE B O     1 
ATOM   2652  C  CB    . PHE B  1  114  ? 9.738   29.034  135.917  1.00 57.61  ? 114  PHE B CB    1 
ATOM   2653  C  CG    . PHE B  1  114  ? 9.642   27.663  135.307  1.00 55.02  ? 114  PHE B CG    1 
ATOM   2654  C  CD1   . PHE B  1  114  ? 9.274   26.573  136.079  1.00 52.33  ? 114  PHE B CD1   1 
ATOM   2655  C  CD2   . PHE B  1  114  ? 9.932   27.462  133.969  1.00 53.86  ? 114  PHE B CD2   1 
ATOM   2656  C  CE1   . PHE B  1  114  ? 9.186   25.309  135.525  1.00 47.58  ? 114  PHE B CE1   1 
ATOM   2657  C  CE2   . PHE B  1  114  ? 9.846   26.200  133.410  1.00 53.42  ? 114  PHE B CE2   1 
ATOM   2658  C  CZ    . PHE B  1  114  ? 9.473   25.122  134.192  1.00 46.03  ? 114  PHE B CZ    1 
ATOM   2659  N  N     . LEU B  1  115  ? 8.137   30.554  138.472  1.00 57.70  ? 115  LEU B N     1 
ATOM   2660  C  CA    . LEU B  1  115  ? 8.273   31.542  139.538  1.00 52.02  ? 115  LEU B CA    1 
ATOM   2661  C  C     . LEU B  1  115  ? 9.744   31.798  139.839  1.00 51.37  ? 115  LEU B C     1 
ATOM   2662  O  O     . LEU B  1  115  ? 10.465  30.885  140.243  1.00 52.28  ? 115  LEU B O     1 
ATOM   2663  C  CB    . LEU B  1  115  ? 7.549   31.077  140.800  1.00 50.01  ? 115  LEU B CB    1 
ATOM   2664  C  CG    . LEU B  1  115  ? 6.075   30.718  140.614  1.00 55.23  ? 115  LEU B CG    1 
ATOM   2665  C  CD1   . LEU B  1  115  ? 5.428   30.404  141.958  1.00 49.37  ? 115  LEU B CD1   1 
ATOM   2666  C  CD2   . LEU B  1  115  ? 5.331   31.834  139.890  1.00 53.47  ? 115  LEU B CD2   1 
ATOM   2667  N  N     . PRO B  1  116  ? 10.188  33.050  139.644  1.00 48.26  ? 116  PRO B N     1 
ATOM   2668  C  CA    . PRO B  1  116  ? 11.598  33.454  139.733  1.00 49.98  ? 116  PRO B CA    1 
ATOM   2669  C  C     . PRO B  1  116  ? 12.255  33.072  141.055  1.00 43.65  ? 116  PRO B C     1 
ATOM   2670  O  O     . PRO B  1  116  ? 11.600  33.067  142.097  1.00 46.31  ? 116  PRO B O     1 
ATOM   2671  C  CB    . PRO B  1  116  ? 11.531  34.978  139.596  1.00 47.49  ? 116  PRO B CB    1 
ATOM   2672  C  CG    . PRO B  1  116  ? 10.273  35.229  138.840  1.00 47.65  ? 116  PRO B CG    1 
ATOM   2673  C  CD    . PRO B  1  116  ? 9.311   34.188  139.322  1.00 45.91  ? 116  PRO B CD    1 
ATOM   2674  N  N     . VAL B  1  117  ? 13.541  32.742  140.999  1.00 36.17  ? 117  VAL B N     1 
ATOM   2675  C  CA    . VAL B  1  117  ? 14.302  32.393  142.192  1.00 41.31  ? 117  VAL B CA    1 
ATOM   2676  C  C     . VAL B  1  117  ? 15.581  33.226  142.244  1.00 46.04  ? 117  VAL B C     1 
ATOM   2677  O  O     . VAL B  1  117  ? 16.164  33.538  141.205  1.00 43.62  ? 117  VAL B O     1 
ATOM   2678  C  CB    . VAL B  1  117  ? 14.648  30.886  142.224  1.00 46.16  ? 117  VAL B CB    1 
ATOM   2679  C  CG1   . VAL B  1  117  ? 15.356  30.520  143.519  1.00 44.79  ? 117  VAL B CG1   1 
ATOM   2680  C  CG2   . VAL B  1  117  ? 13.388  30.046  142.059  1.00 48.82  ? 117  VAL B CG2   1 
ATOM   2681  N  N     . ALA B  1  118  ? 15.998  33.593  143.453  1.00 51.02  ? 118  ALA B N     1 
ATOM   2682  C  CA    . ALA B  1  118  ? 17.170  34.440  143.658  1.00 56.58  ? 118  ALA B CA    1 
ATOM   2683  C  C     . ALA B  1  118  ? 18.430  33.862  143.022  1.00 55.65  ? 118  ALA B C     1 
ATOM   2684  O  O     . ALA B  1  118  ? 18.767  32.698  143.243  1.00 59.42  ? 118  ALA B O     1 
ATOM   2685  C  CB    . ALA B  1  118  ? 17.392  34.682  145.148  1.00 62.02  ? 118  ALA B CB    1 
ATOM   2686  N  N     . ASP B  1  119  ? 19.110  34.689  142.231  1.00 52.99  ? 119  ASP B N     1 
ATOM   2687  C  CA    . ASP B  1  119  ? 20.345  34.305  141.545  1.00 60.27  ? 119  ASP B CA    1 
ATOM   2688  C  C     . ASP B  1  119  ? 20.153  33.144  140.567  1.00 53.52  ? 119  ASP B C     1 
ATOM   2689  O  O     . ASP B  1  119  ? 21.084  32.385  140.293  1.00 43.52  ? 119  ASP B O     1 
ATOM   2690  C  CB    . ASP B  1  119  ? 21.462  33.998  142.549  1.00 67.78  ? 119  ASP B CB    1 
ATOM   2691  C  CG    . ASP B  1  119  ? 21.773  35.178  143.450  1.00 72.29  ? 119  ASP B CG    1 
ATOM   2692  O  OD1   . ASP B  1  119  ? 21.583  36.330  143.005  1.00 67.42  ? 119  ASP B OD1   1 
ATOM   2693  O  OD2   . ASP B  1  119  ? 22.206  34.955  144.600  1.00 81.37  ? 119  ASP B OD2   1 
ATOM   2694  N  N     . VAL B  1  120  ? 18.937  33.018  140.043  1.00 56.24  ? 120  VAL B N     1 
ATOM   2695  C  CA    . VAL B  1  120  ? 18.630  32.009  139.037  1.00 52.15  ? 120  VAL B CA    1 
ATOM   2696  C  C     . VAL B  1  120  ? 18.096  32.676  137.776  1.00 51.22  ? 120  VAL B C     1 
ATOM   2697  O  O     . VAL B  1  120  ? 17.018  33.275  137.784  1.00 50.64  ? 120  VAL B O     1 
ATOM   2698  C  CB    . VAL B  1  120  ? 17.600  30.983  139.548  1.00 49.97  ? 120  VAL B CB    1 
ATOM   2699  C  CG1   . VAL B  1  120  ? 17.157  30.065  138.420  1.00 47.84  ? 120  VAL B CG1   1 
ATOM   2700  C  CG2   . VAL B  1  120  ? 18.178  30.178  140.698  1.00 49.38  ? 120  VAL B CG2   1 
ATOM   2701  N  N     . GLU B  1  121  ? 18.857  32.561  136.693  1.00 52.84  ? 121  GLU B N     1 
ATOM   2702  C  CA    . GLU B  1  121  ? 18.530  33.228  135.439  1.00 57.71  ? 121  GLU B CA    1 
ATOM   2703  C  C     . GLU B  1  121  ? 18.032  32.240  134.391  1.00 45.69  ? 121  GLU B C     1 
ATOM   2704  O  O     . GLU B  1  121  ? 18.562  31.138  134.264  1.00 44.61  ? 121  GLU B O     1 
ATOM   2705  C  CB    . GLU B  1  121  ? 19.766  33.964  134.913  1.00 51.85  ? 121  GLU B CB    1 
ATOM   2706  C  CG    . GLU B  1  121  ? 19.567  34.696  133.600  1.00 54.11  ? 121  GLU B CG    1 
ATOM   2707  C  CD    . GLU B  1  121  ? 20.837  35.381  133.128  1.00 63.40  ? 121  GLU B CD    1 
ATOM   2708  O  OE1   . GLU B  1  121  ? 20.805  36.031  132.061  1.00 74.80  ? 121  GLU B OE1   1 
ATOM   2709  O  OE2   . GLU B  1  121  ? 21.868  35.268  133.825  1.00 55.01  ? 121  GLU B OE2   1 
ATOM   2710  N  N     . ILE B  1  122  ? 17.009  32.631  133.642  1.00 34.20  ? 122  ILE B N     1 
ATOM   2711  C  CA    . ILE B  1  122  ? 16.559  31.812  132.529  1.00 37.61  ? 122  ILE B CA    1 
ATOM   2712  C  C     . ILE B  1  122  ? 16.937  32.459  131.200  1.00 40.35  ? 122  ILE B C     1 
ATOM   2713  O  O     . ILE B  1  122  ? 16.377  33.482  130.811  1.00 42.08  ? 122  ILE B O     1 
ATOM   2714  C  CB    . ILE B  1  122  ? 15.049  31.541  132.595  1.00 41.48  ? 122  ILE B CB    1 
ATOM   2715  C  CG1   . ILE B  1  122  ? 14.725  30.714  133.841  1.00 33.36  ? 122  ILE B CG1   1 
ATOM   2716  C  CG2   . ILE B  1  122  ? 14.581  30.815  131.343  1.00 44.31  ? 122  ILE B CG2   1 
ATOM   2717  C  CD1   . ILE B  1  122  ? 13.297  30.222  133.894  1.00 37.95  ? 122  ILE B CD1   1 
ATOM   2718  N  N     . MET B  1  123  ? 17.891  31.842  130.509  1.00 43.58  ? 123  MET B N     1 
ATOM   2719  C  CA    . MET B  1  123  ? 18.427  32.373  129.261  1.00 38.89  ? 123  MET B CA    1 
ATOM   2720  C  C     . MET B  1  123  ? 17.403  32.312  128.136  1.00 43.72  ? 123  MET B C     1 
ATOM   2721  O  O     . MET B  1  123  ? 17.390  33.167  127.253  1.00 45.09  ? 123  MET B O     1 
ATOM   2722  C  CB    . MET B  1  123  ? 19.673  31.588  128.849  1.00 38.76  ? 123  MET B CB    1 
ATOM   2723  C  CG    . MET B  1  123  ? 20.714  31.432  129.944  1.00 42.78  ? 123  MET B CG    1 
ATOM   2724  S  SD    . MET B  1  123  ? 21.658  32.936  130.233  1.00 53.87  ? 123  MET B SD    1 
ATOM   2725  C  CE    . MET B  1  123  ? 22.281  33.255  128.586  1.00 56.61  ? 123  MET B CE    1 
ATOM   2726  N  N     . ASN B  1  124  ? 16.548  31.295  128.169  1.00 44.72  ? 124  ASN B N     1 
ATOM   2727  C  CA    . ASN B  1  124  ? 15.550  31.097  127.121  1.00 50.53  ? 124  ASN B CA    1 
ATOM   2728  C  C     . ASN B  1  124  ? 14.115  31.073  127.647  1.00 55.87  ? 124  ASN B C     1 
ATOM   2729  O  O     . ASN B  1  124  ? 13.474  30.022  127.658  1.00 56.58  ? 124  ASN B O     1 
ATOM   2730  C  CB    . ASN B  1  124  ? 15.845  29.809  126.345  1.00 47.61  ? 124  ASN B CB    1 
ATOM   2731  C  CG    . ASN B  1  124  ? 16.066  28.615  127.257  1.00 43.32  ? 124  ASN B CG    1 
ATOM   2732  O  OD1   . ASN B  1  124  ? 16.584  28.756  128.363  1.00 44.22  ? 124  ASN B OD1   1 
ATOM   2733  N  ND2   . ASN B  1  124  ? 15.671  27.433  126.796  1.00 39.03  ? 124  ASN B ND2   1 
ATOM   2734  N  N     . PRO B  1  125  ? 13.602  32.240  128.073  1.00 55.15  ? 125  PRO B N     1 
ATOM   2735  C  CA    . PRO B  1  125  ? 12.254  32.328  128.649  1.00 58.53  ? 125  PRO B CA    1 
ATOM   2736  C  C     . PRO B  1  125  ? 11.149  32.082  127.622  1.00 58.73  ? 125  PRO B C     1 
ATOM   2737  O  O     . PRO B  1  125  ? 10.009  31.811  128.006  1.00 55.77  ? 125  PRO B O     1 
ATOM   2738  C  CB    . PRO B  1  125  ? 12.192  33.766  129.167  1.00 61.23  ? 125  PRO B CB    1 
ATOM   2739  C  CG    . PRO B  1  125  ? 13.136  34.513  128.296  1.00 61.18  ? 125  PRO B CG    1 
ATOM   2740  C  CD    . PRO B  1  125  ? 14.251  33.560  127.986  1.00 47.43  ? 125  PRO B CD    1 
ATOM   2741  N  N     . ASP B  1  126  ? 11.484  32.174  126.339  1.00 59.95  ? 126  ASP B N     1 
ATOM   2742  C  CA    . ASP B  1  126  ? 10.502  31.969  125.277  1.00 66.58  ? 126  ASP B CA    1 
ATOM   2743  C  C     . ASP B  1  126  ? 10.306  30.493  124.944  1.00 61.37  ? 126  ASP B C     1 
ATOM   2744  O  O     . ASP B  1  126  ? 9.477   30.146  124.101  1.00 55.23  ? 126  ASP B O     1 
ATOM   2745  C  CB    . ASP B  1  126  ? 10.898  32.741  124.014  1.00 72.17  ? 126  ASP B CB    1 
ATOM   2746  C  CG    . ASP B  1  126  ? 10.627  34.229  124.129  1.00 80.80  ? 126  ASP B CG    1 
ATOM   2747  O  OD1   . ASP B  1  126  ? 10.682  34.759  125.258  1.00 83.39  ? 126  ASP B OD1   1 
ATOM   2748  O  OD2   . ASP B  1  126  ? 10.356  34.869  123.089  1.00 79.18  ? 126  ASP B OD2   1 
ATOM   2749  N  N     . LEU B  1  127  ? 11.067  29.628  125.608  1.00 62.12  ? 127  LEU B N     1 
ATOM   2750  C  CA    . LEU B  1  127  ? 10.978  28.191  125.368  1.00 59.68  ? 127  LEU B CA    1 
ATOM   2751  C  C     . LEU B  1  127  ? 9.619   27.630  125.771  1.00 53.50  ? 127  LEU B C     1 
ATOM   2752  O  O     . LEU B  1  127  ? 9.175   27.810  126.904  1.00 55.50  ? 127  LEU B O     1 
ATOM   2753  C  CB    . LEU B  1  127  ? 12.084  27.446  126.117  1.00 49.67  ? 127  LEU B CB    1 
ATOM   2754  C  CG    . LEU B  1  127  ? 11.990  25.923  126.013  1.00 50.60  ? 127  LEU B CG    1 
ATOM   2755  C  CD1   . LEU B  1  127  ? 12.089  25.472  124.560  1.00 51.90  ? 127  LEU B CD1   1 
ATOM   2756  C  CD2   . LEU B  1  127  ? 13.059  25.258  126.860  1.00 47.60  ? 127  LEU B CD2   1 
ATOM   2757  N  N     . HIS B  1  128  ? 8.972   26.938  124.840  1.00 46.78  ? 128  HIS B N     1 
ATOM   2758  C  CA    . HIS B  1  128  ? 7.656   26.362  125.082  1.00 42.20  ? 128  HIS B CA    1 
ATOM   2759  C  C     . HIS B  1  128  ? 7.734   25.122  125.966  1.00 42.74  ? 128  HIS B C     1 
ATOM   2760  O  O     . HIS B  1  128  ? 8.578   24.255  125.750  1.00 47.72  ? 128  HIS B O     1 
ATOM   2761  C  CB    . HIS B  1  128  ? 6.991   26.003  123.756  1.00 46.03  ? 128  HIS B CB    1 
ATOM   2762  C  CG    . HIS B  1  128  ? 5.692   25.278  123.913  1.00 52.79  ? 128  HIS B CG    1 
ATOM   2763  N  ND1   . HIS B  1  128  ? 4.497   25.933  124.115  1.00 56.30  ? 128  HIS B ND1   1 
ATOM   2764  C  CD2   . HIS B  1  128  ? 5.401   23.955  123.905  1.00 53.05  ? 128  HIS B CD2   1 
ATOM   2765  C  CE1   . HIS B  1  128  ? 3.525   25.045  124.223  1.00 56.97  ? 128  HIS B CE1   1 
ATOM   2766  N  NE2   . HIS B  1  128  ? 4.046   23.838  124.097  1.00 50.82  ? 128  HIS B NE2   1 
ATOM   2767  N  N     . ILE B  1  129  ? 6.849   25.038  126.955  1.00 45.96  ? 129  ILE B N     1 
ATOM   2768  C  CA    . ILE B  1  129  ? 6.783   23.864  127.825  1.00 43.79  ? 129  ILE B CA    1 
ATOM   2769  C  C     . ILE B  1  129  ? 5.583   22.984  127.478  1.00 44.55  ? 129  ILE B C     1 
ATOM   2770  O  O     . ILE B  1  129  ? 5.751   21.842  127.054  1.00 52.16  ? 129  ILE B O     1 
ATOM   2771  C  CB    . ILE B  1  129  ? 6.767   24.231  129.330  1.00 40.34  ? 129  ILE B CB    1 
ATOM   2772  C  CG1   . ILE B  1  129  ? 8.181   24.540  129.827  1.00 35.71  ? 129  ILE B CG1   1 
ATOM   2773  C  CG2   . ILE B  1  129  ? 6.225   23.078  130.159  1.00 45.47  ? 129  ILE B CG2   1 
ATOM   2774  C  CD1   . ILE B  1  129  ? 8.719   25.878  129.400  1.00 40.63  ? 129  ILE B CD1   1 
ATOM   2775  N  N     . ALA B  1  130  ? 4.376   23.509  127.658  1.00 45.16  ? 130  ALA B N     1 
ATOM   2776  C  CA    . ALA B  1  130  ? 3.178   22.760  127.300  1.00 51.67  ? 130  ALA B CA    1 
ATOM   2777  C  C     . ALA B  1  130  ? 1.993   23.672  127.000  1.00 59.68  ? 130  ALA B C     1 
ATOM   2778  O  O     . ALA B  1  130  ? 1.926   24.804  127.482  1.00 55.54  ? 130  ALA B O     1 
ATOM   2779  C  CB    . ALA B  1  130  ? 2.824   21.769  128.401  1.00 46.33  ? 130  ALA B CB    1 
ATOM   2780  N  N     . THR B  1  131  ? 1.056   23.163  126.206  1.00 59.49  ? 131  THR B N     1 
ATOM   2781  C  CA    . THR B  1  131  ? -0.176  23.880  125.908  1.00 58.64  ? 131  THR B CA    1 
ATOM   2782  C  C     . THR B  1  131  ? -1.308  23.333  126.760  1.00 59.41  ? 131  THR B C     1 
ATOM   2783  O  O     . THR B  1  131  ? -1.498  22.119  126.850  1.00 52.63  ? 131  THR B O     1 
ATOM   2784  C  CB    . THR B  1  131  ? -0.587  23.735  124.432  1.00 63.94  ? 131  THR B CB    1 
ATOM   2785  O  OG1   . THR B  1  131  ? -0.611  22.348  124.078  1.00 69.31  ? 131  THR B OG1   1 
ATOM   2786  C  CG2   . THR B  1  131  ? 0.378   24.467  123.520  1.00 60.88  ? 131  THR B CG2   1 
ATOM   2787  N  N     . LEU B  1  132  ? -2.060  24.233  127.382  1.00 69.05  ? 132  LEU B N     1 
ATOM   2788  C  CA    . LEU B  1  132  ? -3.208  23.839  128.184  1.00 68.69  ? 132  LEU B CA    1 
ATOM   2789  C  C     . LEU B  1  132  ? -4.497  24.354  127.562  1.00 70.17  ? 132  LEU B C     1 
ATOM   2790  O  O     . LEU B  1  132  ? -4.584  25.515  127.157  1.00 68.62  ? 132  LEU B O     1 
ATOM   2791  C  CB    . LEU B  1  132  ? -3.077  24.347  129.620  1.00 66.93  ? 132  LEU B CB    1 
ATOM   2792  C  CG    . LEU B  1  132  ? -2.248  23.510  130.597  1.00 65.40  ? 132  LEU B CG    1 
ATOM   2793  C  CD1   . LEU B  1  132  ? -0.759  23.598  130.293  1.00 64.77  ? 132  LEU B CD1   1 
ATOM   2794  C  CD2   . LEU B  1  132  ? -2.534  23.943  132.026  1.00 72.81  ? 132  LEU B CD2   1 
ATOM   2795  N  N     . GLU B  1  133  ? -5.489  23.472  127.486  1.00 72.12  ? 133  GLU B N     1 
ATOM   2796  C  CA    . GLU B  1  133  ? -6.799  23.814  126.947  1.00 86.44  ? 133  GLU B CA    1 
ATOM   2797  C  C     . GLU B  1  133  ? -7.734  24.262  128.064  1.00 93.53  ? 133  GLU B C     1 
ATOM   2798  O  O     . GLU B  1  133  ? -7.307  24.460  129.202  1.00 92.03  ? 133  GLU B O     1 
ATOM   2799  C  CB    . GLU B  1  133  ? -7.399  22.612  126.220  1.00 79.75  ? 133  GLU B CB    1 
ATOM   2800  C  CG    . GLU B  1  133  ? -6.472  21.990  125.195  1.00 81.00  ? 133  GLU B CG    1 
ATOM   2801  C  CD    . GLU B  1  133  ? -6.429  20.480  125.298  1.00 84.54  ? 133  GLU B CD    1 
ATOM   2802  O  OE1   . GLU B  1  133  ? -7.177  19.919  126.128  1.00 83.55  ? 133  GLU B OE1   1 
ATOM   2803  O  OE2   . GLU B  1  133  ? -5.645  19.853  124.555  1.00 90.16  ? 133  GLU B OE2   1 
ATOM   2804  N  N     . GLU B  1  134  ? -9.012  24.417  127.735  1.00 91.50  ? 134  GLU B N     1 
ATOM   2805  C  CA    . GLU B  1  134  ? -10.002 24.817  128.724  1.00 90.23  ? 134  GLU B CA    1 
ATOM   2806  C  C     . GLU B  1  134  ? -10.227 23.697  129.736  1.00 85.29  ? 134  GLU B C     1 
ATOM   2807  O  O     . GLU B  1  134  ? -10.542 22.566  129.366  1.00 76.56  ? 134  GLU B O     1 
ATOM   2808  C  CB    . GLU B  1  134  ? -11.320 25.181  128.039  1.00 98.70  ? 134  GLU B CB    1 
ATOM   2809  C  CG    . GLU B  1  134  ? -11.221 26.346  127.060  1.00 104.74 ? 134  GLU B CG    1 
ATOM   2810  C  CD    . GLU B  1  134  ? -11.217 27.703  127.747  1.00 105.11 ? 134  GLU B CD    1 
ATOM   2811  O  OE1   . GLU B  1  134  ? -11.225 28.731  127.034  1.00 90.45  ? 134  GLU B OE1   1 
ATOM   2812  O  OE2   . GLU B  1  134  ? -11.213 27.746  128.996  1.00 106.86 ? 134  GLU B OE2   1 
ATOM   2813  N  N     . GLY B  1  135  ? -10.061 24.020  131.014  1.00 79.59  ? 135  GLY B N     1 
ATOM   2814  C  CA    . GLY B  1  135  ? -10.238 23.046  132.074  1.00 78.16  ? 135  GLY B CA    1 
ATOM   2815  C  C     . GLY B  1  135  ? -8.962  22.297  132.410  1.00 79.03  ? 135  GLY B C     1 
ATOM   2816  O  O     . GLY B  1  135  ? -8.914  21.539  133.378  1.00 77.35  ? 135  GLY B O     1 
ATOM   2817  N  N     . GLY B  1  136  ? -7.924  22.513  131.609  1.00 87.17  ? 136  GLY B N     1 
ATOM   2818  C  CA    . GLY B  1  136  ? -6.646  21.859  131.826  1.00 85.00  ? 136  GLY B CA    1 
ATOM   2819  C  C     . GLY B  1  136  ? -5.875  22.472  132.979  1.00 78.86  ? 136  GLY B C     1 
ATOM   2820  O  O     . GLY B  1  136  ? -5.915  23.687  133.186  1.00 75.09  ? 136  GLY B O     1 
ATOM   2821  N  N     . ARG B  1  137  ? -5.171  21.632  133.732  1.00 68.85  ? 137  ARG B N     1 
ATOM   2822  C  CA    . ARG B  1  137  ? -4.415  22.096  134.890  1.00 76.59  ? 137  ARG B CA    1 
ATOM   2823  C  C     . ARG B  1  137  ? -2.999  21.525  134.915  1.00 65.79  ? 137  ARG B C     1 
ATOM   2824  O  O     . ARG B  1  137  ? -2.801  20.318  134.776  1.00 52.92  ? 137  ARG B O     1 
ATOM   2825  C  CB    . ARG B  1  137  ? -5.150  21.741  136.188  1.00 89.59  ? 137  ARG B CB    1 
ATOM   2826  C  CG    . ARG B  1  137  ? -6.506  22.418  136.344  1.00 100.14 ? 137  ARG B CG    1 
ATOM   2827  C  CD    . ARG B  1  137  ? -7.217  21.969  137.616  1.00 105.70 ? 137  ARG B CD    1 
ATOM   2828  N  NE    . ARG B  1  137  ? -6.522  22.405  138.826  1.00 101.42 ? 137  ARG B NE    1 
ATOM   2829  C  CZ    . ARG B  1  137  ? -6.792  23.531  139.479  1.00 94.15  ? 137  ARG B CZ    1 
ATOM   2830  N  NH1   . ARG B  1  137  ? -7.744  24.344  139.041  1.00 100.25 ? 137  ARG B NH1   1 
ATOM   2831  N  NH2   . ARG B  1  137  ? -6.109  23.846  140.571  1.00 72.84  ? 137  ARG B NH2   1 
ATOM   2832  N  N     . LEU B  1  138  ? -2.018  22.404  135.099  1.00 70.76  ? 138  LEU B N     1 
ATOM   2833  C  CA    . LEU B  1  138  ? -0.620  21.993  135.161  1.00 65.31  ? 138  LEU B CA    1 
ATOM   2834  C  C     . LEU B  1  138  ? 0.068   22.523  136.416  1.00 62.96  ? 138  LEU B C     1 
ATOM   2835  O  O     . LEU B  1  138  ? 0.246   23.734  136.584  1.00 60.98  ? 138  LEU B O     1 
ATOM   2836  C  CB    . LEU B  1  138  ? 0.135   22.466  133.917  1.00 67.52  ? 138  LEU B CB    1 
ATOM   2837  C  CG    . LEU B  1  138  ? 1.568   21.960  133.742  1.00 58.90  ? 138  LEU B CG    1 
ATOM   2838  C  CD1   . LEU B  1  138  ? 1.575   20.460  133.481  1.00 47.37  ? 138  LEU B CD1   1 
ATOM   2839  C  CD2   . LEU B  1  138  ? 2.272   22.713  132.622  1.00 51.56  ? 138  LEU B CD2   1 
ATOM   2840  N  N     . ASN B  1  139  ? 0.453   21.605  137.294  1.00 55.00  ? 139  ASN B N     1 
ATOM   2841  C  CA    . ASN B  1  139  ? 1.202   21.949  138.492  1.00 62.78  ? 139  ASN B CA    1 
ATOM   2842  C  C     . ASN B  1  139  ? 2.432   21.057  138.579  1.00 60.76  ? 139  ASN B C     1 
ATOM   2843  O  O     . ASN B  1  139  ? 2.308   19.839  138.700  1.00 62.74  ? 139  ASN B O     1 
ATOM   2844  C  CB    . ASN B  1  139  ? 0.325   21.770  139.733  1.00 69.87  ? 139  ASN B CB    1 
ATOM   2845  C  CG    . ASN B  1  139  ? 0.897   22.456  140.963  1.00 70.59  ? 139  ASN B CG    1 
ATOM   2846  O  OD1   . ASN B  1  139  ? 2.098   22.715  141.048  1.00 62.88  ? 139  ASN B OD1   1 
ATOM   2847  N  ND2   . ASN B  1  139  ? 0.032   22.750  141.927  1.00 74.49  ? 139  ASN B ND2   1 
ATOM   2848  N  N     . MET B  1  140  ? 3.618   21.656  138.508  1.00 59.84  ? 140  MET B N     1 
ATOM   2849  C  CA    . MET B  1  140  ? 4.850   20.870  138.512  1.00 58.17  ? 140  MET B CA    1 
ATOM   2850  C  C     . MET B  1  140  ? 6.035   21.531  139.218  1.00 49.21  ? 140  MET B C     1 
ATOM   2851  O  O     . MET B  1  140  ? 6.123   22.755  139.311  1.00 43.15  ? 140  MET B O     1 
ATOM   2852  C  CB    . MET B  1  140  ? 5.251   20.485  137.083  1.00 64.15  ? 140  MET B CB    1 
ATOM   2853  C  CG    . MET B  1  140  ? 5.652   21.662  136.203  1.00 69.46  ? 140  MET B CG    1 
ATOM   2854  S  SD    . MET B  1  140  ? 6.439   21.144  134.664  1.00 71.29  ? 140  MET B SD    1 
ATOM   2855  C  CE    . MET B  1  140  ? 5.191   20.043  134.005  1.00 49.47  ? 140  MET B CE    1 
ATOM   2856  N  N     . GLU B  1  141  ? 6.944   20.694  139.712  1.00 44.30  ? 141  GLU B N     1 
ATOM   2857  C  CA    . GLU B  1  141  ? 8.197   21.156  140.293  1.00 49.77  ? 141  GLU B CA    1 
ATOM   2858  C  C     . GLU B  1  141  ? 9.364   20.482  139.582  1.00 50.19  ? 141  GLU B C     1 
ATOM   2859  O  O     . GLU B  1  141  ? 9.374   19.261  139.413  1.00 52.33  ? 141  GLU B O     1 
ATOM   2860  C  CB    . GLU B  1  141  ? 8.255   20.838  141.787  1.00 53.46  ? 141  GLU B CB    1 
ATOM   2861  C  CG    . GLU B  1  141  ? 7.170   21.503  142.613  1.00 65.90  ? 141  GLU B CG    1 
ATOM   2862  C  CD    . GLU B  1  141  ? 7.223   21.096  144.074  1.00 78.98  ? 141  GLU B CD    1 
ATOM   2863  O  OE1   . GLU B  1  141  ? 8.275   20.581  144.513  1.00 69.75  ? 141  GLU B OE1   1 
ATOM   2864  O  OE2   . GLU B  1  141  ? 6.208   21.287  144.780  1.00 85.05  ? 141  GLU B OE2   1 
ATOM   2865  N  N     . VAL B  1  142  ? 10.343  21.278  139.163  1.00 43.12  ? 142  VAL B N     1 
ATOM   2866  C  CA    . VAL B  1  142  ? 11.511  20.743  138.472  1.00 34.77  ? 142  VAL B CA    1 
ATOM   2867  C  C     . VAL B  1  142  ? 12.802  20.983  139.255  1.00 40.02  ? 142  VAL B C     1 
ATOM   2868  O  O     . VAL B  1  142  ? 13.037  22.074  139.778  1.00 45.83  ? 142  VAL B O     1 
ATOM   2869  C  CB    . VAL B  1  142  ? 11.638  21.303  137.036  1.00 35.45  ? 142  VAL B CB    1 
ATOM   2870  C  CG1   . VAL B  1  142  ? 10.469  20.837  136.183  1.00 40.11  ? 142  VAL B CG1   1 
ATOM   2871  C  CG2   . VAL B  1  142  ? 11.714  22.822  137.049  1.00 40.63  ? 142  VAL B CG2   1 
ATOM   2872  N  N     . ARG B  1  143  ? 13.628  19.945  139.336  1.00 40.91  ? 143  ARG B N     1 
ATOM   2873  C  CA    . ARG B  1  143  ? 14.890  19.995  140.064  1.00 38.19  ? 143  ARG B CA    1 
ATOM   2874  C  C     . ARG B  1  143  ? 16.037  20.342  139.124  1.00 33.80  ? 143  ARG B C     1 
ATOM   2875  O  O     . ARG B  1  143  ? 16.261  19.662  138.123  1.00 29.68  ? 143  ARG B O     1 
ATOM   2876  C  CB    . ARG B  1  143  ? 15.159  18.649  140.741  1.00 38.38  ? 143  ARG B CB    1 
ATOM   2877  C  CG    . ARG B  1  143  ? 16.553  18.500  141.333  1.00 41.28  ? 143  ARG B CG    1 
ATOM   2878  C  CD    . ARG B  1  143  ? 16.590  18.857  142.811  1.00 48.77  ? 143  ARG B CD    1 
ATOM   2879  N  NE    . ARG B  1  143  ? 17.906  18.612  143.401  1.00 51.89  ? 143  ARG B NE    1 
ATOM   2880  C  CZ    . ARG B  1  143  ? 18.272  17.474  143.986  1.00 39.94  ? 143  ARG B CZ    1 
ATOM   2881  N  NH1   . ARG B  1  143  ? 17.423  16.461  144.067  1.00 37.83  ? 143  ARG B NH1   1 
ATOM   2882  N  NH2   . ARG B  1  143  ? 19.490  17.350  144.493  1.00 36.65  ? 143  ARG B NH2   1 
ATOM   2883  N  N     . VAL B  1  144  ? 16.760  21.406  139.454  1.00 30.51  ? 144  VAL B N     1 
ATOM   2884  C  CA    . VAL B  1  144  ? 17.872  21.860  138.631  1.00 30.45  ? 144  VAL B CA    1 
ATOM   2885  C  C     . VAL B  1  144  ? 19.181  21.778  139.405  1.00 30.77  ? 144  VAL B C     1 
ATOM   2886  O  O     . VAL B  1  144  ? 19.315  22.365  140.475  1.00 35.90  ? 144  VAL B O     1 
ATOM   2887  C  CB    . VAL B  1  144  ? 17.650  23.301  138.140  1.00 28.55  ? 144  VAL B CB    1 
ATOM   2888  C  CG1   . VAL B  1  144  ? 18.884  23.814  137.419  1.00 26.15  ? 144  VAL B CG1   1 
ATOM   2889  C  CG2   . VAL B  1  144  ? 16.426  23.368  137.238  1.00 24.83  ? 144  VAL B CG2   1 
ATOM   2890  N  N     . ASP B  1  145  ? 20.145  21.049  138.853  1.00 29.42  ? 145  ASP B N     1 
ATOM   2891  C  CA    . ASP B  1  145  ? 21.420  20.816  139.522  1.00 30.73  ? 145  ASP B CA    1 
ATOM   2892  C  C     . ASP B  1  145  ? 22.586  21.319  138.687  1.00 27.14  ? 145  ASP B C     1 
ATOM   2893  O  O     . ASP B  1  145  ? 22.446  21.562  137.490  1.00 29.45  ? 145  ASP B O     1 
ATOM   2894  C  CB    . ASP B  1  145  ? 21.614  19.323  139.808  1.00 38.81  ? 145  ASP B CB    1 
ATOM   2895  C  CG    . ASP B  1  145  ? 20.891  18.863  141.063  1.00 49.25  ? 145  ASP B CG    1 
ATOM   2896  O  OD1   . ASP B  1  145  ? 21.484  18.958  142.161  1.00 55.05  ? 145  ASP B OD1   1 
ATOM   2897  O  OD2   . ASP B  1  145  ? 19.737  18.394  140.951  1.00 42.77  ? 145  ASP B OD2   1 
ATOM   2898  N  N     . ARG B  1  146  ? 23.735  21.483  139.331  1.00 27.70  ? 146  ARG B N     1 
ATOM   2899  C  CA    . ARG B  1  146  ? 24.963  21.837  138.633  1.00 28.00  ? 146  ARG B CA    1 
ATOM   2900  C  C     . ARG B  1  146  ? 25.920  20.651  138.605  1.00 33.63  ? 146  ARG B C     1 
ATOM   2901  O  O     . ARG B  1  146  ? 26.249  20.082  139.646  1.00 42.48  ? 146  ARG B O     1 
ATOM   2902  C  CB    . ARG B  1  146  ? 25.636  23.040  139.293  1.00 30.46  ? 146  ARG B CB    1 
ATOM   2903  C  CG    . ARG B  1  146  ? 27.095  23.210  138.912  1.00 36.59  ? 146  ARG B CG    1 
ATOM   2904  C  CD    . ARG B  1  146  ? 27.486  24.675  138.847  1.00 50.70  ? 146  ARG B CD    1 
ATOM   2905  N  NE    . ARG B  1  146  ? 27.264  25.368  140.112  1.00 59.18  ? 146  ARG B NE    1 
ATOM   2906  C  CZ    . ARG B  1  146  ? 27.423  26.677  140.282  1.00 58.99  ? 146  ARG B CZ    1 
ATOM   2907  N  NH1   . ARG B  1  146  ? 27.803  27.438  139.264  1.00 54.38  ? 146  ARG B NH1   1 
ATOM   2908  N  NH2   . ARG B  1  146  ? 27.200  27.226  141.467  1.00 60.80  ? 146  ARG B NH2   1 
ATOM   2909  N  N     . GLY B  1  147  ? 26.369  20.288  137.407  1.00 32.92  ? 147  GLY B N     1 
ATOM   2910  C  CA    . GLY B  1  147  ? 27.250  19.147  137.228  1.00 33.19  ? 147  GLY B CA    1 
ATOM   2911  C  C     . GLY B  1  147  ? 27.932  19.168  135.873  1.00 33.09  ? 147  GLY B C     1 
ATOM   2912  O  O     . GLY B  1  147  ? 27.911  20.180  135.173  1.00 32.01  ? 147  GLY B O     1 
ATOM   2913  N  N     . VAL B  1  148  ? 28.547  18.053  135.498  1.00 30.14  ? 148  VAL B N     1 
ATOM   2914  C  CA    . VAL B  1  148  ? 29.305  18.000  134.254  1.00 30.10  ? 148  VAL B CA    1 
ATOM   2915  C  C     . VAL B  1  148  ? 28.962  16.781  133.400  1.00 30.63  ? 148  VAL B C     1 
ATOM   2916  O  O     . VAL B  1  148  ? 28.628  15.716  133.922  1.00 34.75  ? 148  VAL B O     1 
ATOM   2917  C  CB    . VAL B  1  148  ? 30.824  18.014  134.524  1.00 26.97  ? 148  VAL B CB    1 
ATOM   2918  C  CG1   . VAL B  1  148  ? 31.251  19.359  135.092  1.00 24.60  ? 148  VAL B CG1   1 
ATOM   2919  C  CG2   . VAL B  1  148  ? 31.208  16.881  135.460  1.00 23.85  ? 148  VAL B CG2   1 
ATOM   2920  N  N     . GLY B  1  149  ? 29.040  16.949  132.083  1.00 25.46  ? 149  GLY B N     1 
ATOM   2921  C  CA    . GLY B  1  149  ? 28.872  15.842  131.160  1.00 24.32  ? 149  GLY B CA    1 
ATOM   2922  C  C     . GLY B  1  149  ? 27.432  15.453  130.896  1.00 24.42  ? 149  GLY B C     1 
ATOM   2923  O  O     . GLY B  1  149  ? 26.544  16.303  130.851  1.00 27.97  ? 149  GLY B O     1 
ATOM   2924  N  N     . TYR B  1  150  ? 27.207  14.157  130.702  1.00 21.68  ? 150  TYR B N     1 
ATOM   2925  C  CA    . TYR B  1  150  ? 25.870  13.637  130.448  1.00 22.96  ? 150  TYR B CA    1 
ATOM   2926  C  C     . TYR B  1  150  ? 25.615  12.425  131.340  1.00 28.40  ? 150  TYR B C     1 
ATOM   2927  O  O     . TYR B  1  150  ? 26.261  11.385  131.199  1.00 27.61  ? 150  TYR B O     1 
ATOM   2928  C  CB    . TYR B  1  150  ? 25.735  13.255  128.971  1.00 21.49  ? 150  TYR B CB    1 
ATOM   2929  C  CG    . TYR B  1  150  ? 24.348  12.837  128.532  1.00 18.39  ? 150  TYR B CG    1 
ATOM   2930  C  CD1   . TYR B  1  150  ? 23.443  13.770  128.041  1.00 19.44  ? 150  TYR B CD1   1 
ATOM   2931  C  CD2   . TYR B  1  150  ? 23.954  11.506  128.580  1.00 18.64  ? 150  TYR B CD2   1 
ATOM   2932  C  CE1   . TYR B  1  150  ? 22.180  13.390  127.625  1.00 19.83  ? 150  TYR B CE1   1 
ATOM   2933  C  CE2   . TYR B  1  150  ? 22.693  11.117  128.169  1.00 19.90  ? 150  TYR B CE2   1 
ATOM   2934  C  CZ    . TYR B  1  150  ? 21.810  12.063  127.692  1.00 22.14  ? 150  TYR B CZ    1 
ATOM   2935  O  OH    . TYR B  1  150  ? 20.551  11.679  127.284  1.00 21.90  ? 150  TYR B OH    1 
ATOM   2936  N  N     . VAL B  1  151  ? 24.673  12.570  132.264  1.00 29.33  ? 151  VAL B N     1 
ATOM   2937  C  CA    . VAL B  1  151  ? 24.309  11.486  133.163  1.00 23.72  ? 151  VAL B CA    1 
ATOM   2938  C  C     . VAL B  1  151  ? 22.850  11.087  132.953  1.00 26.95  ? 151  VAL B C     1 
ATOM   2939  O  O     . VAL B  1  151  ? 21.941  11.850  133.287  1.00 24.04  ? 151  VAL B O     1 
ATOM   2940  C  CB    . VAL B  1  151  ? 24.535  11.883  134.631  1.00 22.28  ? 151  VAL B CB    1 
ATOM   2941  C  CG1   . VAL B  1  151  ? 24.296  10.696  135.545  1.00 26.12  ? 151  VAL B CG1   1 
ATOM   2942  C  CG2   . VAL B  1  151  ? 25.943  12.425  134.817  1.00 20.44  ? 151  VAL B CG2   1 
ATOM   2943  N  N     . PRO B  1  152  ? 22.625  9.890   132.387  1.00 27.44  ? 152  PRO B N     1 
ATOM   2944  C  CA    . PRO B  1  152  ? 21.281  9.352   132.150  1.00 26.94  ? 152  PRO B CA    1 
ATOM   2945  C  C     . PRO B  1  152  ? 20.476  9.249   133.443  1.00 32.08  ? 152  PRO B C     1 
ATOM   2946  O  O     . PRO B  1  152  ? 21.061  9.115   134.517  1.00 32.77  ? 152  PRO B O     1 
ATOM   2947  C  CB    . PRO B  1  152  ? 21.560  7.956   131.592  1.00 24.55  ? 152  PRO B CB    1 
ATOM   2948  C  CG    . PRO B  1  152  ? 22.903  8.066   130.978  1.00 24.10  ? 152  PRO B CG    1 
ATOM   2949  C  CD    . PRO B  1  152  ? 23.672  9.001   131.857  1.00 23.12  ? 152  PRO B CD    1 
ATOM   2950  N  N     . ALA B  1  153  ? 19.152  9.307   133.328  1.00 33.31  ? 153  ALA B N     1 
ATOM   2951  C  CA    . ALA B  1  153  ? 18.261  9.359   134.484  1.00 33.18  ? 153  ALA B CA    1 
ATOM   2952  C  C     . ALA B  1  153  ? 18.458  8.198   135.456  1.00 34.30  ? 153  ALA B C     1 
ATOM   2953  O  O     . ALA B  1  153  ? 18.345  8.367   136.671  1.00 35.64  ? 153  ALA B O     1 
ATOM   2954  C  CB    . ALA B  1  153  ? 16.813  9.418   134.023  1.00 34.88  ? 153  ALA B CB    1 
ATOM   2955  N  N     . GLU B  1  154  ? 18.776  7.027   134.920  1.00 29.22  ? 154  GLU B N     1 
ATOM   2956  C  CA    . GLU B  1  154  ? 18.891  5.827   135.738  1.00 30.74  ? 154  GLU B CA    1 
ATOM   2957  C  C     . GLU B  1  154  ? 20.257  5.704   136.403  1.00 34.24  ? 154  GLU B C     1 
ATOM   2958  O  O     . GLU B  1  154  ? 20.531  4.726   137.099  1.00 37.82  ? 154  GLU B O     1 
ATOM   2959  C  CB    . GLU B  1  154  ? 18.583  4.574   134.914  1.00 30.55  ? 154  GLU B CB    1 
ATOM   2960  C  CG    . GLU B  1  154  ? 19.088  4.623   133.480  1.00 43.01  ? 154  GLU B CG    1 
ATOM   2961  C  CD    . GLU B  1  154  ? 18.097  5.282   132.528  1.00 51.33  ? 154  GLU B CD    1 
ATOM   2962  O  OE1   . GLU B  1  154  ? 18.509  5.671   131.413  1.00 48.74  ? 154  GLU B OE1   1 
ATOM   2963  O  OE2   . GLU B  1  154  ? 16.907  5.408   132.890  1.00 50.07  ? 154  GLU B OE2   1 
ATOM   2964  N  N     . LYS B  1  155  ? 21.112  6.699   136.186  1.00 34.09  ? 155  LYS B N     1 
ATOM   2965  C  CA    . LYS B  1  155  ? 22.428  6.725   136.821  1.00 35.76  ? 155  LYS B CA    1 
ATOM   2966  C  C     . LYS B  1  155  ? 22.449  7.582   138.088  1.00 42.35  ? 155  LYS B C     1 
ATOM   2967  O  O     . LYS B  1  155  ? 22.708  7.070   139.178  1.00 51.89  ? 155  LYS B O     1 
ATOM   2968  C  CB    . LYS B  1  155  ? 23.513  7.161   135.836  1.00 34.17  ? 155  LYS B CB    1 
ATOM   2969  C  CG    . LYS B  1  155  ? 23.695  6.196   134.674  1.00 43.49  ? 155  LYS B CG    1 
ATOM   2970  C  CD    . LYS B  1  155  ? 24.008  4.794   135.173  1.00 53.19  ? 155  LYS B CD    1 
ATOM   2971  C  CE    . LYS B  1  155  ? 23.944  3.773   134.045  1.00 60.24  ? 155  LYS B CE    1 
ATOM   2972  N  NZ    . LYS B  1  155  ? 24.907  4.075   132.948  1.00 57.72  ? 155  LYS B NZ    1 
ATOM   2973  N  N     . HIS B  1  156  ? 22.194  8.880   137.943  1.00 40.24  ? 156  HIS B N     1 
ATOM   2974  C  CA    . HIS B  1  156  ? 22.087  9.759   139.103  1.00 39.24  ? 156  HIS B CA    1 
ATOM   2975  C  C     . HIS B  1  156  ? 20.902  9.334   139.969  1.00 45.27  ? 156  HIS B C     1 
ATOM   2976  O  O     . HIS B  1  156  ? 21.007  9.303   141.198  1.00 40.15  ? 156  HIS B O     1 
ATOM   2977  C  CB    . HIS B  1  156  ? 21.950  11.223  138.673  1.00 35.30  ? 156  HIS B CB    1 
ATOM   2978  C  CG    . HIS B  1  156  ? 20.669  11.529  137.955  1.00 35.00  ? 156  HIS B CG    1 
ATOM   2979  N  ND1   . HIS B  1  156  ? 19.492  11.794  138.619  1.00 39.39  ? 156  HIS B ND1   1 
ATOM   2980  C  CD2   . HIS B  1  156  ? 20.383  11.613  136.634  1.00 38.31  ? 156  HIS B CD2   1 
ATOM   2981  C  CE1   . HIS B  1  156  ? 18.533  12.027  137.739  1.00 38.01  ? 156  HIS B CE1   1 
ATOM   2982  N  NE2   . HIS B  1  156  ? 19.048  11.925  136.528  1.00 37.26  ? 156  HIS B NE2   1 
ATOM   2983  N  N     . GLY B  1  157  ? 19.786  9.002   139.313  1.00 45.04  ? 157  GLY B N     1 
ATOM   2984  C  CA    . GLY B  1  157  ? 18.610  8.433   139.958  1.00 49.23  ? 157  GLY B CA    1 
ATOM   2985  C  C     . GLY B  1  157  ? 18.107  9.137   141.206  1.00 55.68  ? 157  GLY B C     1 
ATOM   2986  O  O     . GLY B  1  157  ? 17.868  8.490   142.231  1.00 64.50  ? 157  GLY B O     1 
ATOM   2987  N  N     . ILE B  1  158  ? 17.944  10.454  141.134  1.00 48.54  ? 158  ILE B N     1 
ATOM   2988  C  CA    . ILE B  1  158  ? 17.531  11.213  142.311  1.00 52.20  ? 158  ILE B CA    1 
ATOM   2989  C  C     . ILE B  1  158  ? 16.023  11.485  142.377  1.00 57.18  ? 158  ILE B C     1 
ATOM   2990  O  O     . ILE B  1  158  ? 15.390  11.826  141.373  1.00 43.73  ? 158  ILE B O     1 
ATOM   2991  C  CB    . ILE B  1  158  ? 18.341  12.522  142.469  1.00 42.77  ? 158  ILE B CB    1 
ATOM   2992  C  CG1   . ILE B  1  158  ? 18.045  13.495  141.328  1.00 38.05  ? 158  ILE B CG1   1 
ATOM   2993  C  CG2   . ILE B  1  158  ? 19.829  12.218  142.537  1.00 39.34  ? 158  ILE B CG2   1 
ATOM   2994  C  CD1   . ILE B  1  158  ? 18.790  14.805  141.455  1.00 39.38  ? 158  ILE B CD1   1 
ATOM   2995  N  N     . LYS B  1  159  ? 15.463  11.315  143.575  1.00 67.34  ? 159  LYS B N     1 
ATOM   2996  C  CA    . LYS B  1  159  ? 14.043  11.539  143.833  1.00 63.07  ? 159  LYS B CA    1 
ATOM   2997  C  C     . LYS B  1  159  ? 13.819  12.399  145.081  1.00 55.63  ? 159  LYS B C     1 
ATOM   2998  O  O     . LYS B  1  159  ? 14.175  12.002  146.190  1.00 52.10  ? 159  LYS B O     1 
ATOM   2999  C  CB    . LYS B  1  159  ? 13.315  10.204  144.013  1.00 54.43  ? 159  LYS B CB    1 
ATOM   3000  C  CG    . LYS B  1  159  ? 12.809  9.563   142.732  1.00 60.32  ? 159  LYS B CG    1 
ATOM   3001  C  CD    . LYS B  1  159  ? 11.896  8.384   143.055  1.00 66.89  ? 159  LYS B CD    1 
ATOM   3002  C  CE    . LYS B  1  159  ? 11.280  7.771   141.806  1.00 63.68  ? 159  LYS B CE    1 
ATOM   3003  N  NZ    . LYS B  1  159  ? 12.288  7.062   140.971  1.00 58.12  ? 159  LYS B NZ    1 
ATOM   3004  N  N     . ASP B  1  160  ? 13.233  13.577  144.895  1.00 58.78  ? 160  ASP B N     1 
ATOM   3005  C  CA    . ASP B  1  160  ? 12.822  14.414  146.018  1.00 62.81  ? 160  ASP B CA    1 
ATOM   3006  C  C     . ASP B  1  160  ? 11.447  13.994  146.540  1.00 53.10  ? 160  ASP B C     1 
ATOM   3007  O  O     . ASP B  1  160  ? 11.088  14.286  147.680  1.00 51.71  ? 160  ASP B O     1 
ATOM   3008  C  CB    . ASP B  1  160  ? 12.792  15.893  145.613  1.00 75.72  ? 160  ASP B CB    1 
ATOM   3009  C  CG    . ASP B  1  160  ? 14.177  16.481  145.414  1.00 64.31  ? 160  ASP B CG    1 
ATOM   3010  O  OD1   . ASP B  1  160  ? 15.163  15.849  145.847  1.00 66.76  ? 160  ASP B OD1   1 
ATOM   3011  O  OD2   . ASP B  1  160  ? 14.272  17.586  144.835  1.00 43.88  ? 160  ASP B OD2   1 
ATOM   3012  N  N     . ARG B  1  161  ? 10.689  13.299  145.696  1.00 54.50  ? 161  ARG B N     1 
ATOM   3013  C  CA    . ARG B  1  161  ? 9.315   12.913  146.011  1.00 53.28  ? 161  ARG B CA    1 
ATOM   3014  C  C     . ARG B  1  161  ? 9.025   11.492  145.547  1.00 51.81  ? 161  ARG B C     1 
ATOM   3015  O  O     . ARG B  1  161  ? 9.817   10.893  144.823  1.00 58.51  ? 161  ARG B O     1 
ATOM   3016  C  CB    . ARG B  1  161  ? 8.317   13.878  145.365  1.00 47.30  ? 161  ARG B CB    1 
ATOM   3017  C  CG    . ARG B  1  161  ? 8.287   15.260  145.986  1.00 41.04  ? 161  ARG B CG    1 
ATOM   3018  C  CD    . ARG B  1  161  ? 7.401   16.204  145.187  1.00 51.17  ? 161  ARG B CD    1 
ATOM   3019  N  NE    . ARG B  1  161  ? 7.293   17.513  145.824  1.00 55.17  ? 161  ARG B NE    1 
ATOM   3020  C  CZ    . ARG B  1  161  ? 6.277   17.886  146.594  1.00 54.06  ? 161  ARG B CZ    1 
ATOM   3021  N  NH1   . ARG B  1  161  ? 5.272   17.049  146.818  1.00 46.77  ? 161  ARG B NH1   1 
ATOM   3022  N  NH2   . ARG B  1  161  ? 6.264   19.096  147.139  1.00 46.69  ? 161  ARG B NH2   1 
ATOM   3023  N  N     . ILE B  1  162  ? 7.888   10.957  145.974  1.00 44.28  ? 162  ILE B N     1 
ATOM   3024  C  CA    . ILE B  1  162  ? 7.496   9.604   145.602  1.00 56.23  ? 162  ILE B CA    1 
ATOM   3025  C  C     . ILE B  1  162  ? 7.189   9.473   144.104  1.00 63.92  ? 162  ILE B C     1 
ATOM   3026  O  O     . ILE B  1  162  ? 7.691   8.568   143.437  1.00 61.37  ? 162  ILE B O     1 
ATOM   3027  C  CB    . ILE B  1  162  ? 6.301   9.118   146.451  1.00 58.54  ? 162  ILE B CB    1 
ATOM   3028  C  CG1   . ILE B  1  162  ? 5.675   7.866   145.834  1.00 55.53  ? 162  ILE B CG1   1 
ATOM   3029  C  CG2   . ILE B  1  162  ? 5.270   10.222  146.609  1.00 54.78  ? 162  ILE B CG2   1 
ATOM   3030  C  CD1   . ILE B  1  162  ? 6.567   6.642   145.895  1.00 45.63  ? 162  ILE B CD1   1 
ATOM   3031  N  N     . ASN B  1  163  ? 6.380   10.386  143.574  1.00 65.38  ? 163  ASN B N     1 
ATOM   3032  C  CA    . ASN B  1  163  ? 6.005   10.341  142.160  1.00 66.21  ? 163  ASN B CA    1 
ATOM   3033  C  C     . ASN B  1  163  ? 7.006   11.030  141.236  1.00 67.44  ? 163  ASN B C     1 
ATOM   3034  O  O     . ASN B  1  163  ? 6.797   11.089  140.024  1.00 63.03  ? 163  ASN B O     1 
ATOM   3035  C  CB    . ASN B  1  163  ? 4.600   10.919  141.946  1.00 70.65  ? 163  ASN B CB    1 
ATOM   3036  C  CG    . ASN B  1  163  ? 3.506   9.906   142.218  1.00 72.40  ? 163  ASN B CG    1 
ATOM   3037  O  OD1   . ASN B  1  163  ? 3.744   8.696   142.198  1.00 72.25  ? 163  ASN B OD1   1 
ATOM   3038  N  ND2   . ASN B  1  163  ? 2.295   10.394  142.464  1.00 68.36  ? 163  ASN B ND2   1 
ATOM   3039  N  N     . ALA B  1  164  ? 8.084   11.553  141.817  1.00 68.73  ? 164  ALA B N     1 
ATOM   3040  C  CA    . ALA B  1  164  ? 9.108   12.276  141.063  1.00 62.37  ? 164  ALA B CA    1 
ATOM   3041  C  C     . ALA B  1  164  ? 9.704   11.459  139.918  1.00 64.49  ? 164  ALA B C     1 
ATOM   3042  O  O     . ALA B  1  164  ? 10.143  10.323  140.109  1.00 59.49  ? 164  ALA B O     1 
ATOM   3043  C  CB    . ALA B  1  164  ? 10.213  12.764  141.994  1.00 58.84  ? 164  ALA B CB    1 
ATOM   3044  N  N     . ILE B  1  165  ? 9.719   12.052  138.728  1.00 60.28  ? 165  ILE B N     1 
ATOM   3045  C  CA    . ILE B  1  165  ? 10.294  11.406  137.555  1.00 49.38  ? 165  ILE B CA    1 
ATOM   3046  C  C     . ILE B  1  165  ? 11.741  11.851  137.351  1.00 44.92  ? 165  ILE B C     1 
ATOM   3047  O  O     . ILE B  1  165  ? 12.008  13.040  137.178  1.00 41.96  ? 165  ILE B O     1 
ATOM   3048  C  CB    . ILE B  1  165  ? 9.473   11.723  136.293  1.00 44.16  ? 165  ILE B CB    1 
ATOM   3049  C  CG1   . ILE B  1  165  ? 8.054   11.170  136.438  1.00 50.08  ? 165  ILE B CG1   1 
ATOM   3050  C  CG2   . ILE B  1  165  ? 10.145  11.148  135.060  1.00 52.17  ? 165  ILE B CG2   1 
ATOM   3051  C  CD1   . ILE B  1  165  ? 7.138   11.493  135.267  1.00 50.26  ? 165  ILE B CD1   1 
ATOM   3052  N  N     . PRO B  1  166  ? 12.684  10.894  137.386  1.00 42.70  ? 166  PRO B N     1 
ATOM   3053  C  CA    . PRO B  1  166  ? 14.084  11.231  137.114  1.00 35.64  ? 166  PRO B CA    1 
ATOM   3054  C  C     . PRO B  1  166  ? 14.263  11.593  135.644  1.00 35.55  ? 166  PRO B C     1 
ATOM   3055  O  O     . PRO B  1  166  ? 13.738  10.901  134.770  1.00 34.30  ? 166  PRO B O     1 
ATOM   3056  C  CB    . PRO B  1  166  ? 14.822  9.931   137.439  1.00 33.39  ? 166  PRO B CB    1 
ATOM   3057  C  CG    . PRO B  1  166  ? 13.808  8.860   137.232  1.00 31.44  ? 166  PRO B CG    1 
ATOM   3058  C  CD    . PRO B  1  166  ? 12.505  9.459   137.669  1.00 44.73  ? 166  PRO B CD    1 
ATOM   3059  N  N     . VAL B  1  167  ? 14.993  12.670  135.376  1.00 33.10  ? 167  VAL B N     1 
ATOM   3060  C  CA    . VAL B  1  167  ? 15.186  13.135  134.008  1.00 33.98  ? 167  VAL B CA    1 
ATOM   3061  C  C     . VAL B  1  167  ? 16.653  13.051  133.607  1.00 35.49  ? 167  VAL B C     1 
ATOM   3062  O  O     . VAL B  1  167  ? 17.540  13.354  134.409  1.00 31.35  ? 167  VAL B O     1 
ATOM   3063  C  CB    . VAL B  1  167  ? 14.673  14.582  133.826  1.00 30.74  ? 167  VAL B CB    1 
ATOM   3064  C  CG1   . VAL B  1  167  ? 14.992  15.106  132.433  1.00 25.93  ? 167  VAL B CG1   1 
ATOM   3065  C  CG2   . VAL B  1  167  ? 13.180  14.640  134.080  1.00 36.38  ? 167  VAL B CG2   1 
ATOM   3066  N  N     . ASP B  1  168  ? 16.898  12.623  132.369  1.00 34.42  ? 168  ASP B N     1 
ATOM   3067  C  CA    . ASP B  1  168  ? 18.250  12.561  131.832  1.00 30.98  ? 168  ASP B CA    1 
ATOM   3068  C  C     . ASP B  1  168  ? 18.910  13.933  131.927  1.00 28.95  ? 168  ASP B C     1 
ATOM   3069  O  O     . ASP B  1  168  ? 18.368  14.936  131.465  1.00 28.45  ? 168  ASP B O     1 
ATOM   3070  C  CB    . ASP B  1  168  ? 18.235  12.070  130.381  1.00 31.42  ? 168  ASP B CB    1 
ATOM   3071  C  CG    . ASP B  1  168  ? 17.562  10.717  130.224  1.00 41.27  ? 168  ASP B CG    1 
ATOM   3072  O  OD1   . ASP B  1  168  ? 18.108  9.732   130.755  1.00 46.33  ? 168  ASP B OD1   1 
ATOM   3073  O  OD2   . ASP B  1  168  ? 16.504  10.632  129.555  1.00 42.69  ? 168  ASP B OD2   1 
ATOM   3074  N  N     . ALA B  1  169  ? 20.082  13.969  132.544  1.00 25.99  ? 169  ALA B N     1 
ATOM   3075  C  CA    . ALA B  1  169  ? 20.732  15.233  132.844  1.00 28.39  ? 169  ALA B CA    1 
ATOM   3076  C  C     . ALA B  1  169  ? 21.721  15.632  131.763  1.00 26.01  ? 169  ALA B C     1 
ATOM   3077  O  O     . ALA B  1  169  ? 22.736  14.965  131.568  1.00 28.02  ? 169  ALA B O     1 
ATOM   3078  C  CB    . ALA B  1  169  ? 21.431  15.156  134.196  1.00 27.96  ? 169  ALA B CB    1 
ATOM   3079  N  N     . VAL B  1  170  ? 21.441  16.728  131.065  1.00 25.31  ? 170  VAL B N     1 
ATOM   3080  C  CA    . VAL B  1  170  ? 22.426  17.254  130.138  1.00 25.46  ? 170  VAL B CA    1 
ATOM   3081  C  C     . VAL B  1  170  ? 23.096  18.419  130.841  1.00 24.11  ? 170  VAL B C     1 
ATOM   3082  O  O     . VAL B  1  170  ? 22.562  19.528  130.886  1.00 24.44  ? 170  VAL B O     1 
ATOM   3083  C  CB    . VAL B  1  170  ? 21.752  17.772  128.851  1.00 19.96  ? 170  VAL B CB    1 
ATOM   3084  C  CG1   . VAL B  1  170  ? 22.785  18.354  127.900  1.00 22.38  ? 170  VAL B CG1   1 
ATOM   3085  C  CG2   . VAL B  1  170  ? 20.968  16.659  128.176  1.00 22.44  ? 170  VAL B CG2   1 
ATOM   3086  N  N     . PHE B  1  171  ? 24.293  18.168  131.354  1.00 22.14  ? 171  PHE B N     1 
ATOM   3087  C  CA    . PHE B  1  171  ? 25.009  19.176  132.119  1.00 26.55  ? 171  PHE B CA    1 
ATOM   3088  C  C     . PHE B  1  171  ? 25.774  20.130  131.223  1.00 29.16  ? 171  PHE B C     1 
ATOM   3089  O  O     . PHE B  1  171  ? 25.764  21.342  131.439  1.00 33.32  ? 171  PHE B O     1 
ATOM   3090  C  CB    . PHE B  1  171  ? 25.950  18.529  133.136  1.00 25.12  ? 171  PHE B CB    1 
ATOM   3091  C  CG    . PHE B  1  171  ? 25.247  17.967  134.340  1.00 31.66  ? 171  PHE B CG    1 
ATOM   3092  C  CD1   . PHE B  1  171  ? 24.526  18.794  135.185  1.00 33.17  ? 171  PHE B CD1   1 
ATOM   3093  C  CD2   . PHE B  1  171  ? 25.315  16.615  134.634  1.00 31.48  ? 171  PHE B CD2   1 
ATOM   3094  C  CE1   . PHE B  1  171  ? 23.881  18.283  136.297  1.00 30.24  ? 171  PHE B CE1   1 
ATOM   3095  C  CE2   . PHE B  1  171  ? 24.671  16.098  135.744  1.00 26.03  ? 171  PHE B CE2   1 
ATOM   3096  C  CZ    . PHE B  1  171  ? 23.954  16.934  136.575  1.00 25.64  ? 171  PHE B CZ    1 
ATOM   3097  N  N     . SER B  1  172  ? 26.426  19.569  130.210  1.00 25.43  ? 172  SER B N     1 
ATOM   3098  C  CA    . SER B  1  172  ? 27.359  20.328  129.390  1.00 27.61  ? 172  SER B CA    1 
ATOM   3099  C  C     . SER B  1  172  ? 26.700  21.527  128.728  1.00 23.27  ? 172  SER B C     1 
ATOM   3100  O  O     . SER B  1  172  ? 25.686  21.391  128.044  1.00 19.48  ? 172  SER B O     1 
ATOM   3101  C  CB    . SER B  1  172  ? 28.013  19.436  128.331  1.00 28.34  ? 172  SER B CB    1 
ATOM   3102  O  OG    . SER B  1  172  ? 29.052  20.127  127.656  1.00 24.09  ? 172  SER B OG    1 
ATOM   3103  N  N     . PRO B  1  173  ? 27.272  22.716  128.957  1.00 24.69  ? 173  PRO B N     1 
ATOM   3104  C  CA    . PRO B  1  173  ? 26.889  23.932  128.242  1.00 25.97  ? 173  PRO B CA    1 
ATOM   3105  C  C     . PRO B  1  173  ? 27.340  23.827  126.793  1.00 26.65  ? 173  PRO B C     1 
ATOM   3106  O  O     . PRO B  1  173  ? 26.860  24.573  125.946  1.00 30.64  ? 173  PRO B O     1 
ATOM   3107  C  CB    . PRO B  1  173  ? 27.680  25.022  128.965  1.00 29.63  ? 173  PRO B CB    1 
ATOM   3108  C  CG    . PRO B  1  173  ? 28.870  24.316  129.505  1.00 24.48  ? 173  PRO B CG    1 
ATOM   3109  C  CD    . PRO B  1  173  ? 28.380  22.956  129.898  1.00 23.45  ? 173  PRO B CD    1 
ATOM   3110  N  N     . VAL B  1  174  ? 28.257  22.902  126.522  1.00 26.04  ? 174  VAL B N     1 
ATOM   3111  C  CA    . VAL B  1  174  ? 28.745  22.666  125.171  1.00 24.89  ? 174  VAL B CA    1 
ATOM   3112  C  C     . VAL B  1  174  ? 27.821  21.701  124.431  1.00 24.50  ? 174  VAL B C     1 
ATOM   3113  O  O     . VAL B  1  174  ? 27.649  20.551  124.839  1.00 21.27  ? 174  VAL B O     1 
ATOM   3114  C  CB    . VAL B  1  174  ? 30.166  22.073  125.187  1.00 19.67  ? 174  VAL B CB    1 
ATOM   3115  C  CG1   . VAL B  1  174  ? 30.656  21.858  123.773  1.00 20.74  ? 174  VAL B CG1   1 
ATOM   3116  C  CG2   . VAL B  1  174  ? 31.117  22.980  125.950  1.00 18.84  ? 174  VAL B CG2   1 
ATOM   3117  N  N     . ARG B  1  175  ? 27.214  22.183  123.352  1.00 22.90  ? 175  ARG B N     1 
ATOM   3118  C  CA    . ARG B  1  175  ? 26.338  21.353  122.533  1.00 21.15  ? 175  ARG B CA    1 
ATOM   3119  C  C     . ARG B  1  175  ? 27.105  20.487  121.531  1.00 26.15  ? 175  ARG B C     1 
ATOM   3120  O  O     . ARG B  1  175  ? 26.767  19.320  121.333  1.00 26.98  ? 175  ARG B O     1 
ATOM   3121  C  CB    . ARG B  1  175  ? 25.282  22.207  121.829  1.00 26.27  ? 175  ARG B CB    1 
ATOM   3122  C  CG    . ARG B  1  175  ? 24.393  22.982  122.788  1.00 28.65  ? 175  ARG B CG    1 
ATOM   3123  C  CD    . ARG B  1  175  ? 23.076  23.379  122.141  1.00 34.92  ? 175  ARG B CD    1 
ATOM   3124  N  NE    . ARG B  1  175  ? 22.122  23.896  123.121  1.00 47.92  ? 175  ARG B NE    1 
ATOM   3125  C  CZ    . ARG B  1  175  ? 21.395  23.134  123.937  1.00 62.04  ? 175  ARG B CZ    1 
ATOM   3126  N  NH1   . ARG B  1  175  ? 21.510  21.810  123.904  1.00 47.58  ? 175  ARG B NH1   1 
ATOM   3127  N  NH2   . ARG B  1  175  ? 20.551  23.696  124.794  1.00 58.70  ? 175  ARG B NH2   1 
ATOM   3128  N  N     . ARG B  1  176  ? 28.119  21.059  120.880  1.00 27.90  ? 176  ARG B N     1 
ATOM   3129  C  CA    . ARG B  1  176  ? 28.960  20.263  119.974  1.00 22.44  ? 176  ARG B CA    1 
ATOM   3130  C  C     . ARG B  1  176  ? 30.397  20.773  119.818  1.00 18.99  ? 176  ARG B C     1 
ATOM   3131  O  O     . ARG B  1  176  ? 30.634  21.975  119.779  1.00 23.38  ? 176  ARG B O     1 
ATOM   3132  C  CB    . ARG B  1  176  ? 28.297  20.119  118.595  1.00 24.57  ? 176  ARG B CB    1 
ATOM   3133  C  CG    . ARG B  1  176  ? 29.193  19.468  117.537  1.00 26.13  ? 176  ARG B CG    1 
ATOM   3134  C  CD    . ARG B  1  176  ? 28.393  18.792  116.439  1.00 26.09  ? 176  ARG B CD    1 
ATOM   3135  N  NE    . ARG B  1  176  ? 27.737  19.743  115.546  1.00 27.62  ? 176  ARG B NE    1 
ATOM   3136  C  CZ    . ARG B  1  176  ? 27.992  19.845  114.245  1.00 24.99  ? 176  ARG B CZ    1 
ATOM   3137  N  NH1   . ARG B  1  176  ? 28.888  19.049  113.675  1.00 19.60  ? 176  ARG B NH1   1 
ATOM   3138  N  NH2   . ARG B  1  176  ? 27.346  20.740  113.512  1.00 26.55  ? 176  ARG B NH2   1 
ATOM   3139  N  N     . VAL B  1  177  ? 31.349  19.852  119.714  1.00 14.70  ? 177  VAL B N     1 
ATOM   3140  C  CA    . VAL B  1  177  ? 32.725  20.203  119.385  1.00 14.70  ? 177  VAL B CA    1 
ATOM   3141  C  C     . VAL B  1  177  ? 33.168  19.443  118.145  1.00 19.05  ? 177  VAL B C     1 
ATOM   3142  O  O     . VAL B  1  177  ? 32.999  18.227  118.065  1.00 21.27  ? 177  VAL B O     1 
ATOM   3143  C  CB    . VAL B  1  177  ? 33.692  19.865  120.530  1.00 17.97  ? 177  VAL B CB    1 
ATOM   3144  C  CG1   . VAL B  1  177  ? 35.133  20.048  120.081  1.00 16.41  ? 177  VAL B CG1   1 
ATOM   3145  C  CG2   . VAL B  1  177  ? 33.400  20.723  121.739  1.00 20.57  ? 177  VAL B CG2   1 
ATOM   3146  N  N     . ALA B  1  178  ? 33.717  20.161  117.170  1.00 22.39  ? 178  ALA B N     1 
ATOM   3147  C  CA    . ALA B  1  178  ? 34.263  19.521  115.976  1.00 21.06  ? 178  ALA B CA    1 
ATOM   3148  C  C     . ALA B  1  178  ? 35.598  20.142  115.571  1.00 18.99  ? 178  ALA B C     1 
ATOM   3149  O  O     . ALA B  1  178  ? 35.672  21.337  115.295  1.00 22.91  ? 178  ALA B O     1 
ATOM   3150  C  CB    . ALA B  1  178  ? 33.266  19.597  114.830  1.00 24.21  ? 178  ALA B CB    1 
ATOM   3151  N  N     . PHE B  1  179  ? 36.653  19.333  115.530  1.00 17.60  ? 179  PHE B N     1 
ATOM   3152  C  CA    . PHE B  1  179  ? 37.969  19.854  115.174  1.00 20.77  ? 179  PHE B CA    1 
ATOM   3153  C  C     . PHE B  1  179  ? 38.572  19.178  113.945  1.00 24.90  ? 179  PHE B C     1 
ATOM   3154  O  O     . PHE B  1  179  ? 38.420  17.973  113.738  1.00 21.15  ? 179  PHE B O     1 
ATOM   3155  C  CB    . PHE B  1  179  ? 38.933  19.782  116.364  1.00 23.97  ? 179  PHE B CB    1 
ATOM   3156  C  CG    . PHE B  1  179  ? 39.656  18.469  116.493  1.00 23.49  ? 179  PHE B CG    1 
ATOM   3157  C  CD1   . PHE B  1  179  ? 39.012  17.353  116.998  1.00 24.98  ? 179  PHE B CD1   1 
ATOM   3158  C  CD2   . PHE B  1  179  ? 40.987  18.359  116.124  1.00 21.77  ? 179  PHE B CD2   1 
ATOM   3159  C  CE1   . PHE B  1  179  ? 39.679  16.148  117.123  1.00 25.89  ? 179  PHE B CE1   1 
ATOM   3160  C  CE2   . PHE B  1  179  ? 41.659  17.159  116.247  1.00 20.92  ? 179  PHE B CE2   1 
ATOM   3161  C  CZ    . PHE B  1  179  ? 41.005  16.052  116.747  1.00 23.91  ? 179  PHE B CZ    1 
ATOM   3162  N  N     . GLN B  1  180  ? 39.259  19.978  113.135  1.00 28.94  ? 180  GLN B N     1 
ATOM   3163  C  CA    . GLN B  1  180  ? 39.867  19.507  111.898  1.00 29.69  ? 180  GLN B CA    1 
ATOM   3164  C  C     . GLN B  1  180  ? 41.313  19.985  111.815  1.00 26.18  ? 180  GLN B C     1 
ATOM   3165  O  O     . GLN B  1  180  ? 41.628  21.111  112.204  1.00 30.40  ? 180  GLN B O     1 
ATOM   3166  C  CB    . GLN B  1  180  ? 39.071  20.021  110.697  1.00 30.69  ? 180  GLN B CB    1 
ATOM   3167  C  CG    . GLN B  1  180  ? 39.327  19.276  109.398  1.00 40.97  ? 180  GLN B CG    1 
ATOM   3168  C  CD    . GLN B  1  180  ? 38.440  19.767  108.264  1.00 59.97  ? 180  GLN B CD    1 
ATOM   3169  O  OE1   . GLN B  1  180  ? 38.081  20.946  108.206  1.00 61.61  ? 180  GLN B OE1   1 
ATOM   3170  N  NE2   . GLN B  1  180  ? 38.074  18.861  107.362  1.00 51.52  ? 180  GLN B NE2   1 
ATOM   3171  N  N     . VAL B  1  181  ? 42.191  19.126  111.312  1.00 23.48  ? 181  VAL B N     1 
ATOM   3172  C  CA    . VAL B  1  181  ? 43.602  19.464  111.196  1.00 26.74  ? 181  VAL B CA    1 
ATOM   3173  C  C     . VAL B  1  181  ? 44.035  19.434  109.739  1.00 32.70  ? 181  VAL B C     1 
ATOM   3174  O  O     . VAL B  1  181  ? 44.085  18.373  109.121  1.00 41.21  ? 181  VAL B O     1 
ATOM   3175  C  CB    . VAL B  1  181  ? 44.481  18.485  111.995  1.00 28.90  ? 181  VAL B CB    1 
ATOM   3176  C  CG1   . VAL B  1  181  ? 45.955  18.825  111.821  1.00 30.41  ? 181  VAL B CG1   1 
ATOM   3177  C  CG2   . VAL B  1  181  ? 44.093  18.504  113.462  1.00 26.25  ? 181  VAL B CG2   1 
ATOM   3178  N  N     . GLU B  1  182  ? 44.363  20.602  109.197  1.00 34.11  ? 182  GLU B N     1 
ATOM   3179  C  CA    . GLU B  1  182  ? 44.736  20.707  107.790  1.00 33.06  ? 182  GLU B CA    1 
ATOM   3180  C  C     . GLU B  1  182  ? 46.238  20.904  107.648  1.00 38.10  ? 182  GLU B C     1 
ATOM   3181  O  O     . GLU B  1  182  ? 46.879  21.472  108.528  1.00 44.40  ? 182  GLU B O     1 
ATOM   3182  C  CB    . GLU B  1  182  ? 43.990  21.863  107.119  1.00 37.11  ? 182  GLU B CB    1 
ATOM   3183  C  CG    . GLU B  1  182  ? 42.476  21.715  107.110  1.00 37.98  ? 182  GLU B CG    1 
ATOM   3184  C  CD    . GLU B  1  182  ? 41.770  22.972  106.628  1.00 63.88  ? 182  GLU B CD    1 
ATOM   3185  O  OE1   . GLU B  1  182  ? 40.520  22.982  106.600  1.00 62.40  ? 182  GLU B OE1   1 
ATOM   3186  O  OE2   . GLU B  1  182  ? 42.465  23.952  106.279  1.00 64.06  ? 182  GLU B OE2   1 
ATOM   3187  N  N     . ASP B  1  183  ? 46.806  20.412  106.553  1.00 39.21  ? 183  ASP B N     1 
ATOM   3188  C  CA    . ASP B  1  183  ? 48.221  20.637  106.285  1.00 41.76  ? 183  ASP B CA    1 
ATOM   3189  C  C     . ASP B  1  183  ? 48.479  22.098  105.947  1.00 47.34  ? 183  ASP B C     1 
ATOM   3190  O  O     . ASP B  1  183  ? 47.648  22.759  105.323  1.00 48.65  ? 183  ASP B O     1 
ATOM   3191  C  CB    . ASP B  1  183  ? 48.719  19.734  105.159  1.00 46.22  ? 183  ASP B CB    1 
ATOM   3192  C  CG    . ASP B  1  183  ? 49.213  18.395  105.669  1.00 73.77  ? 183  ASP B CG    1 
ATOM   3193  O  OD1   . ASP B  1  183  ? 49.910  18.376  106.707  1.00 80.17  ? 183  ASP B OD1   1 
ATOM   3194  O  OD2   . ASP B  1  183  ? 48.905  17.363  105.035  1.00 86.84  ? 183  ASP B OD2   1 
ATOM   3195  N  N     . THR B  1  184  ? 49.632  22.599  106.372  1.00 46.67  ? 184  THR B N     1 
ATOM   3196  C  CA    . THR B  1  184  ? 50.007  23.980  106.111  1.00 44.05  ? 184  THR B CA    1 
ATOM   3197  C  C     . THR B  1  184  ? 51.523  24.134  106.055  1.00 47.61  ? 184  THR B C     1 
ATOM   3198  O  O     . THR B  1  184  ? 52.271  23.289  106.562  1.00 50.56  ? 184  THR B O     1 
ATOM   3199  C  CB    . THR B  1  184  ? 49.423  24.937  107.169  1.00 41.98  ? 184  THR B CB    1 
ATOM   3200  O  OG1   . THR B  1  184  ? 49.589  26.292  106.736  1.00 55.60  ? 184  THR B OG1   1 
ATOM   3201  C  CG2   . THR B  1  184  ? 50.115  24.744  108.508  1.00 40.99  ? 184  THR B CG2   1 
ATOM   3202  N  N     . ARG B  1  185  ? 51.965  25.221  105.433  1.00 55.55  ? 185  ARG B N     1 
ATOM   3203  C  CA    . ARG B  1  185  ? 53.385  25.480  105.256  1.00 62.54  ? 185  ARG B CA    1 
ATOM   3204  C  C     . ARG B  1  185  ? 53.782  26.894  105.680  1.00 77.81  ? 185  ARG B C     1 
ATOM   3205  O  O     . ARG B  1  185  ? 53.092  27.869  105.376  1.00 79.22  ? 185  ARG B O     1 
ATOM   3206  C  CB    . ARG B  1  185  ? 53.802  25.225  103.802  1.00 66.46  ? 185  ARG B CB    1 
ATOM   3207  C  CG    . ARG B  1  185  ? 53.167  26.164  102.783  1.00 68.10  ? 185  ARG B CG    1 
ATOM   3208  C  CD    . ARG B  1  185  ? 53.718  25.927  101.384  1.00 71.77  ? 185  ARG B CD    1 
ATOM   3209  N  NE    . ARG B  1  185  ? 53.280  26.951  100.438  1.00 71.66  ? 185  ARG B NE    1 
ATOM   3210  C  CZ    . ARG B  1  185  ? 53.994  28.026  100.116  1.00 74.70  ? 185  ARG B CZ    1 
ATOM   3211  N  NH1   . ARG B  1  185  ? 55.189  28.218  100.661  1.00 82.79  ? 185  ARG B NH1   1 
ATOM   3212  N  NH2   . ARG B  1  185  ? 53.517  28.907  99.246   1.00 58.50  ? 185  ARG B NH2   1 
ATOM   3213  N  N     . LEU B  1  186  ? 54.895  26.993  106.399  1.00 78.56  ? 186  LEU B N     1 
ATOM   3214  C  CA    . LEU B  1  186  ? 55.494  28.285  106.704  1.00 84.44  ? 186  LEU B CA    1 
ATOM   3215  C  C     . LEU B  1  186  ? 56.871  28.320  106.064  1.00 90.55  ? 186  LEU B C     1 
ATOM   3216  O  O     . LEU B  1  186  ? 57.768  27.577  106.464  1.00 83.24  ? 186  LEU B O     1 
ATOM   3217  C  CB    . LEU B  1  186  ? 55.605  28.504  108.213  1.00 76.34  ? 186  LEU B CB    1 
ATOM   3218  C  CG    . LEU B  1  186  ? 56.284  29.807  108.642  1.00 83.88  ? 186  LEU B CG    1 
ATOM   3219  C  CD1   . LEU B  1  186  ? 55.483  31.018  108.178  1.00 82.82  ? 186  LEU B CD1   1 
ATOM   3220  C  CD2   . LEU B  1  186  ? 56.498  29.841  110.149  1.00 90.73  ? 186  LEU B CD2   1 
ATOM   3221  N  N     . GLY B  1  187  ? 57.033  29.184  105.068  1.00 96.28  ? 187  GLY B N     1 
ATOM   3222  C  CA    . GLY B  1  187  ? 58.255  29.206  104.289  1.00 94.56  ? 187  GLY B CA    1 
ATOM   3223  C  C     . GLY B  1  187  ? 58.419  27.897  103.542  1.00 94.81  ? 187  GLY B C     1 
ATOM   3224  O  O     . GLY B  1  187  ? 57.542  27.493  102.775  1.00 86.78  ? 187  GLY B O     1 
ATOM   3225  N  N     . GLN B  1  188  ? 59.550  27.234  103.759  1.00 90.26  ? 188  GLN B N     1 
ATOM   3226  C  CA    . GLN B  1  188  ? 59.811  25.959  103.103  1.00 88.45  ? 188  GLN B CA    1 
ATOM   3227  C  C     . GLN B  1  188  ? 59.476  24.736  103.967  1.00 90.86  ? 188  GLN B C     1 
ATOM   3228  O  O     . GLN B  1  188  ? 59.700  23.600  103.550  1.00 90.37  ? 188  GLN B O     1 
ATOM   3229  C  CB    . GLN B  1  188  ? 61.251  25.899  102.582  1.00 79.26  ? 188  GLN B CB    1 
ATOM   3230  C  CG    . GLN B  1  188  ? 61.418  25.061  101.315  1.00 84.85  ? 188  GLN B CG    1 
ATOM   3231  C  CD    . GLN B  1  188  ? 60.494  25.497  100.183  1.00 73.73  ? 188  GLN B CD    1 
ATOM   3232  O  OE1   . GLN B  1  188  ? 60.159  26.677  100.050  1.00 69.75  ? 188  GLN B OE1   1 
ATOM   3233  N  NE2   . GLN B  1  188  ? 60.077  24.538  99.362   1.00 51.98  ? 188  GLN B NE2   1 
ATOM   3234  N  N     . ARG B  1  189  ? 58.940  24.961  105.165  1.00 93.68  ? 189  ARG B N     1 
ATOM   3235  C  CA    . ARG B  1  189  ? 58.496  23.846  105.997  1.00 83.40  ? 189  ARG B CA    1 
ATOM   3236  C  C     . ARG B  1  189  ? 57.139  23.400  105.477  1.00 81.96  ? 189  ARG B C     1 
ATOM   3237  O  O     . ARG B  1  189  ? 56.179  24.161  105.532  1.00 75.70  ? 189  ARG B O     1 
ATOM   3238  C  CB    . ARG B  1  189  ? 58.348  24.293  107.451  1.00 81.81  ? 189  ARG B CB    1 
ATOM   3239  C  CG    . ARG B  1  189  ? 59.622  24.803  108.102  1.00 85.50  ? 189  ARG B CG    1 
ATOM   3240  C  CD    . ARG B  1  189  ? 60.473  23.661  108.629  1.00 82.81  ? 189  ARG B CD    1 
ATOM   3241  N  NE    . ARG B  1  189  ? 61.151  24.022  109.872  1.00 85.32  ? 189  ARG B NE    1 
ATOM   3242  C  CZ    . ARG B  1  189  ? 60.629  23.849  111.083  1.00 78.36  ? 189  ARG B CZ    1 
ATOM   3243  N  NH1   . ARG B  1  189  ? 61.314  24.204  112.162  1.00 64.25  ? 189  ARG B NH1   1 
ATOM   3244  N  NH2   . ARG B  1  189  ? 59.421  23.318  111.216  1.00 81.38  ? 189  ARG B NH2   1 
ATOM   3245  N  N     . THR B  1  190  ? 57.061  22.170  104.974  1.00 79.99  ? 190  THR B N     1 
ATOM   3246  C  CA    . THR B  1  190  ? 55.844  21.694  104.313  1.00 80.52  ? 190  THR B CA    1 
ATOM   3247  C  C     . THR B  1  190  ? 54.859  20.876  105.158  1.00 76.82  ? 190  THR B C     1 
ATOM   3248  O  O     . THR B  1  190  ? 53.719  20.654  104.743  1.00 71.54  ? 190  THR B O     1 
ATOM   3249  C  CB    . THR B  1  190  ? 56.203  20.871  103.060  1.00 81.65  ? 190  THR B CB    1 
ATOM   3250  O  OG1   . THR B  1  190  ? 57.220  19.915  103.392  1.00 72.54  ? 190  THR B OG1   1 
ATOM   3251  C  CG2   . THR B  1  190  ? 56.716  21.784  101.960  1.00 79.79  ? 190  THR B CG2   1 
ATOM   3252  N  N     . ASP B  1  191  ? 55.291  20.436  106.334  1.00 71.57  ? 191  ASP B N     1 
ATOM   3253  C  CA    . ASP B  1  191  ? 54.514  19.473  107.118  1.00 58.23  ? 191  ASP B CA    1 
ATOM   3254  C  C     . ASP B  1  191  ? 53.660  20.053  108.249  1.00 56.11  ? 191  ASP B C     1 
ATOM   3255  O  O     . ASP B  1  191  ? 53.051  19.300  109.007  1.00 57.67  ? 191  ASP B O     1 
ATOM   3256  C  CB    . ASP B  1  191  ? 55.419  18.358  107.653  1.00 56.47  ? 191  ASP B CB    1 
ATOM   3257  C  CG    . ASP B  1  191  ? 56.640  18.894  108.373  1.00 81.59  ? 191  ASP B CG    1 
ATOM   3258  O  OD1   . ASP B  1  191  ? 57.134  19.976  107.988  1.00 87.25  ? 191  ASP B OD1   1 
ATOM   3259  O  OD2   . ASP B  1  191  ? 57.108  18.230  109.323  1.00 88.11  ? 191  ASP B OD2   1 
ATOM   3260  N  N     . LEU B  1  192  ? 53.620  21.377  108.369  1.00 58.84  ? 192  LEU B N     1 
ATOM   3261  C  CA    . LEU B  1  192  ? 53.048  22.006  109.561  1.00 51.97  ? 192  LEU B CA    1 
ATOM   3262  C  C     . LEU B  1  192  ? 51.534  21.807  109.705  1.00 49.23  ? 192  LEU B C     1 
ATOM   3263  O  O     . LEU B  1  192  ? 50.847  21.481  108.738  1.00 54.22  ? 192  LEU B O     1 
ATOM   3264  C  CB    . LEU B  1  192  ? 53.423  23.489  109.613  1.00 50.05  ? 192  LEU B CB    1 
ATOM   3265  C  CG    . LEU B  1  192  ? 54.925  23.757  109.460  1.00 53.04  ? 192  LEU B CG    1 
ATOM   3266  C  CD1   . LEU B  1  192  ? 55.244  25.223  109.702  1.00 67.59  ? 192  LEU B CD1   1 
ATOM   3267  C  CD2   . LEU B  1  192  ? 55.751  22.863  110.379  1.00 45.63  ? 192  LEU B CD2   1 
ATOM   3268  N  N     . ASP B  1  193  ? 51.026  21.986  110.922  1.00 40.65  ? 193  ASP B N     1 
ATOM   3269  C  CA    . ASP B  1  193  ? 49.619  21.725  111.218  1.00 33.55  ? 193  ASP B CA    1 
ATOM   3270  C  C     . ASP B  1  193  ? 48.802  22.990  111.460  1.00 31.15  ? 193  ASP B C     1 
ATOM   3271  O  O     . ASP B  1  193  ? 49.198  23.860  112.231  1.00 37.55  ? 193  ASP B O     1 
ATOM   3272  C  CB    . ASP B  1  193  ? 49.499  20.813  112.440  1.00 36.97  ? 193  ASP B CB    1 
ATOM   3273  C  CG    . ASP B  1  193  ? 49.854  19.374  112.131  1.00 41.20  ? 193  ASP B CG    1 
ATOM   3274  O  OD1   . ASP B  1  193  ? 50.396  19.120  111.035  1.00 54.69  ? 193  ASP B OD1   1 
ATOM   3275  O  OD2   . ASP B  1  193  ? 49.596  18.499  112.986  1.00 30.94  ? 193  ASP B OD2   1 
ATOM   3276  N  N     . LYS B  1  194  ? 47.655  23.083  110.799  1.00 32.23  ? 194  LYS B N     1 
ATOM   3277  C  CA    . LYS B  1  194  ? 46.688  24.132  111.088  1.00 33.23  ? 194  LYS B CA    1 
ATOM   3278  C  C     . LYS B  1  194  ? 45.493  23.521  111.804  1.00 35.79  ? 194  LYS B C     1 
ATOM   3279  O  O     . LYS B  1  194  ? 44.778  22.685  111.241  1.00 42.55  ? 194  LYS B O     1 
ATOM   3280  C  CB    . LYS B  1  194  ? 46.217  24.823  109.809  1.00 32.65  ? 194  LYS B CB    1 
ATOM   3281  C  CG    . LYS B  1  194  ? 45.037  25.757  110.032  1.00 35.23  ? 194  LYS B CG    1 
ATOM   3282  C  CD    . LYS B  1  194  ? 44.453  26.253  108.721  1.00 40.68  ? 194  LYS B CD    1 
ATOM   3283  C  CE    . LYS B  1  194  ? 43.243  27.140  108.966  1.00 37.19  ? 194  LYS B CE    1 
ATOM   3284  N  NZ    . LYS B  1  194  ? 42.620  27.596  107.696  1.00 42.91  ? 194  LYS B NZ    1 
ATOM   3285  N  N     . LEU B  1  195  ? 45.278  23.938  113.047  1.00 30.85  ? 195  LEU B N     1 
ATOM   3286  C  CA    . LEU B  1  195  ? 44.194  23.384  113.847  1.00 27.35  ? 195  LEU B CA    1 
ATOM   3287  C  C     . LEU B  1  195  ? 42.968  24.296  113.860  1.00 27.30  ? 195  LEU B C     1 
ATOM   3288  O  O     . LEU B  1  195  ? 43.036  25.438  114.309  1.00 28.87  ? 195  LEU B O     1 
ATOM   3289  C  CB    . LEU B  1  195  ? 44.679  23.109  115.273  1.00 24.96  ? 195  LEU B CB    1 
ATOM   3290  C  CG    . LEU B  1  195  ? 43.651  22.656  116.309  1.00 18.52  ? 195  LEU B CG    1 
ATOM   3291  C  CD1   . LEU B  1  195  ? 42.854  21.470  115.805  1.00 24.50  ? 195  LEU B CD1   1 
ATOM   3292  C  CD2   . LEU B  1  195  ? 44.354  22.308  117.607  1.00 17.43  ? 195  LEU B CD2   1 
ATOM   3293  N  N     . THR B  1  196  ? 41.849  23.784  113.357  1.00 27.29  ? 196  THR B N     1 
ATOM   3294  C  CA    . THR B  1  196  ? 40.592  24.524  113.391  1.00 26.74  ? 196  THR B CA    1 
ATOM   3295  C  C     . THR B  1  196  ? 39.601  23.850  114.331  1.00 28.54  ? 196  THR B C     1 
ATOM   3296  O  O     . THR B  1  196  ? 39.206  22.706  114.114  1.00 31.74  ? 196  THR B O     1 
ATOM   3297  C  CB    . THR B  1  196  ? 39.960  24.648  111.992  1.00 29.54  ? 196  THR B CB    1 
ATOM   3298  O  OG1   . THR B  1  196  ? 40.803  25.448  111.154  1.00 38.88  ? 196  THR B OG1   1 
ATOM   3299  C  CG2   . THR B  1  196  ? 38.588  25.300  112.082  1.00 28.02  ? 196  THR B CG2   1 
ATOM   3300  N  N     . LEU B  1  197  ? 39.203  24.566  115.376  1.00 26.56  ? 197  LEU B N     1 
ATOM   3301  C  CA    . LEU B  1  197  ? 38.291  24.030  116.376  1.00 20.91  ? 197  LEU B CA    1 
ATOM   3302  C  C     . LEU B  1  197  ? 36.959  24.769  116.321  1.00 21.51  ? 197  LEU B C     1 
ATOM   3303  O  O     . LEU B  1  197  ? 36.927  25.991  116.250  1.00 29.75  ? 197  LEU B O     1 
ATOM   3304  C  CB    . LEU B  1  197  ? 38.920  24.152  117.763  1.00 19.47  ? 197  LEU B CB    1 
ATOM   3305  C  CG    . LEU B  1  197  ? 38.113  23.655  118.959  1.00 23.08  ? 197  LEU B CG    1 
ATOM   3306  C  CD1   . LEU B  1  197  ? 37.718  22.211  118.761  1.00 23.35  ? 197  LEU B CD1   1 
ATOM   3307  C  CD2   . LEU B  1  197  ? 38.912  23.819  120.242  1.00 22.28  ? 197  LEU B CD2   1 
ATOM   3308  N  N     . ARG B  1  198  ? 35.858  24.026  116.347  1.00 18.93  ? 198  ARG B N     1 
ATOM   3309  C  CA    . ARG B  1  198  ? 34.533  24.630  116.241  1.00 22.90  ? 198  ARG B CA    1 
ATOM   3310  C  C     . ARG B  1  198  ? 33.662  24.226  117.426  1.00 23.17  ? 198  ARG B C     1 
ATOM   3311  O  O     . ARG B  1  198  ? 33.515  23.035  117.714  1.00 26.64  ? 198  ARG B O     1 
ATOM   3312  C  CB    . ARG B  1  198  ? 33.863  24.205  114.934  1.00 25.91  ? 198  ARG B CB    1 
ATOM   3313  C  CG    . ARG B  1  198  ? 34.675  24.516  113.685  1.00 29.17  ? 198  ARG B CG    1 
ATOM   3314  C  CD    . ARG B  1  198  ? 34.171  23.716  112.493  1.00 28.15  ? 198  ARG B CD    1 
ATOM   3315  N  NE    . ARG B  1  198  ? 32.760  23.973  112.220  1.00 33.72  ? 198  ARG B NE    1 
ATOM   3316  C  CZ    . ARG B  1  198  ? 32.000  23.212  111.439  1.00 35.13  ? 198  ARG B CZ    1 
ATOM   3317  N  NH1   . ARG B  1  198  ? 30.722  23.520  111.246  1.00 26.18  ? 198  ARG B NH1   1 
ATOM   3318  N  NH2   . ARG B  1  198  ? 32.519  22.138  110.855  1.00 32.88  ? 198  ARG B NH2   1 
ATOM   3319  N  N     . ILE B  1  199  ? 33.086  25.214  118.110  1.00 20.35  ? 199  ILE B N     1 
ATOM   3320  C  CA    . ILE B  1  199  ? 32.314  24.946  119.326  1.00 19.34  ? 199  ILE B CA    1 
ATOM   3321  C  C     . ILE B  1  199  ? 30.925  25.596  119.371  1.00 23.81  ? 199  ILE B C     1 
ATOM   3322  O  O     . ILE B  1  199  ? 30.788  26.820  119.277  1.00 27.58  ? 199  ILE B O     1 
ATOM   3323  C  CB    . ILE B  1  199  ? 33.087  25.361  120.594  1.00 16.64  ? 199  ILE B CB    1 
ATOM   3324  C  CG1   . ILE B  1  199  ? 34.459  24.687  120.640  1.00 15.67  ? 199  ILE B CG1   1 
ATOM   3325  C  CG2   . ILE B  1  199  ? 32.288  25.012  121.836  1.00 19.49  ? 199  ILE B CG2   1 
ATOM   3326  C  CD1   . ILE B  1  199  ? 35.336  25.170  121.768  1.00 15.09  ? 199  ILE B CD1   1 
ATOM   3327  N  N     . TRP B  1  200  ? 29.905  24.754  119.521  1.00 22.48  ? 200  TRP B N     1 
ATOM   3328  C  CA    . TRP B  1  200  ? 28.533  25.195  119.738  1.00 25.38  ? 200  TRP B CA    1 
ATOM   3329  C  C     . TRP B  1  200  ? 28.176  25.017  121.210  1.00 28.41  ? 200  TRP B C     1 
ATOM   3330  O  O     . TRP B  1  200  ? 28.299  23.908  121.753  1.00 27.58  ? 200  TRP B O     1 
ATOM   3331  C  CB    . TRP B  1  200  ? 27.552  24.351  118.920  1.00 24.41  ? 200  TRP B CB    1 
ATOM   3332  C  CG    . TRP B  1  200  ? 27.676  24.441  117.427  1.00 27.25  ? 200  TRP B CG    1 
ATOM   3333  C  CD1   . TRP B  1  200  ? 26.830  25.087  116.571  1.00 28.42  ? 200  TRP B CD1   1 
ATOM   3334  C  CD2   . TRP B  1  200  ? 28.683  23.831  116.612  1.00 24.14  ? 200  TRP B CD2   1 
ATOM   3335  N  NE1   . TRP B  1  200  ? 27.257  24.929  115.275  1.00 22.86  ? 200  TRP B NE1   1 
ATOM   3336  C  CE2   . TRP B  1  200  ? 28.389  24.161  115.273  1.00 23.47  ? 200  TRP B CE2   1 
ATOM   3337  C  CE3   . TRP B  1  200  ? 29.806  23.045  116.884  1.00 21.64  ? 200  TRP B CE3   1 
ATOM   3338  C  CZ2   . TRP B  1  200  ? 29.183  23.734  114.213  1.00 26.79  ? 200  TRP B CZ2   1 
ATOM   3339  C  CZ3   . TRP B  1  200  ? 30.591  22.624  115.831  1.00 21.39  ? 200  TRP B CZ3   1 
ATOM   3340  C  CH2   . TRP B  1  200  ? 30.276  22.969  114.511  1.00 26.69  ? 200  TRP B CH2   1 
ATOM   3341  N  N     . THR B  1  201  ? 27.720  26.095  121.845  1.00 28.75  ? 201  THR B N     1 
ATOM   3342  C  CA    . THR B  1  201  ? 27.243  26.037  123.225  1.00 24.50  ? 201  THR B CA    1 
ATOM   3343  C  C     . THR B  1  201  ? 25.790  26.489  123.327  1.00 31.22  ? 201  THR B C     1 
ATOM   3344  O  O     . THR B  1  201  ? 25.176  26.854  122.326  1.00 39.22  ? 201  THR B O     1 
ATOM   3345  C  CB    . THR B  1  201  ? 28.082  26.914  124.164  1.00 27.16  ? 201  THR B CB    1 
ATOM   3346  O  OG1   . THR B  1  201  ? 27.683  28.283  124.029  1.00 35.13  ? 201  THR B OG1   1 
ATOM   3347  C  CG2   . THR B  1  201  ? 29.564  26.776  123.854  1.00 31.34  ? 201  THR B CG2   1 
ATOM   3348  N  N     . ASP B  1  202  ? 25.248  26.471  124.543  1.00 31.63  ? 202  ASP B N     1 
ATOM   3349  C  CA    . ASP B  1  202  ? 23.842  26.811  124.764  1.00 36.55  ? 202  ASP B CA    1 
ATOM   3350  C  C     . ASP B  1  202  ? 23.633  28.301  125.030  1.00 37.11  ? 202  ASP B C     1 
ATOM   3351  O  O     . ASP B  1  202  ? 22.499  28.778  125.101  1.00 36.89  ? 202  ASP B O     1 
ATOM   3352  C  CB    . ASP B  1  202  ? 23.247  25.975  125.906  1.00 35.59  ? 202  ASP B CB    1 
ATOM   3353  C  CG    . ASP B  1  202  ? 24.049  26.078  127.197  1.00 35.65  ? 202  ASP B CG    1 
ATOM   3354  O  OD1   . ASP B  1  202  ? 24.853  27.023  127.334  1.00 43.76  ? 202  ASP B OD1   1 
ATOM   3355  O  OD2   . ASP B  1  202  ? 23.871  25.215  128.085  1.00 31.11  ? 202  ASP B OD2   1 
ATOM   3356  N  N     . GLY B  1  203  ? 24.734  29.029  125.179  1.00 36.06  ? 203  GLY B N     1 
ATOM   3357  C  CA    . GLY B  1  203  ? 24.672  30.454  125.438  1.00 42.23  ? 203  GLY B CA    1 
ATOM   3358  C  C     . GLY B  1  203  ? 24.938  30.810  126.888  1.00 46.66  ? 203  GLY B C     1 
ATOM   3359  O  O     . GLY B  1  203  ? 25.297  31.948  127.194  1.00 50.36  ? 203  GLY B O     1 
ATOM   3360  N  N     . SER B  1  204  ? 24.765  29.840  127.782  1.00 44.22  ? 204  SER B N     1 
ATOM   3361  C  CA    . SER B  1  204  ? 25.042  30.055  129.200  1.00 44.40  ? 204  SER B CA    1 
ATOM   3362  C  C     . SER B  1  204  ? 26.539  30.272  129.416  1.00 48.06  ? 204  SER B C     1 
ATOM   3363  O  O     . SER B  1  204  ? 26.951  31.078  130.249  1.00 55.77  ? 204  SER B O     1 
ATOM   3364  C  CB    . SER B  1  204  ? 24.540  28.877  130.042  1.00 40.34  ? 204  SER B CB    1 
ATOM   3365  O  OG    . SER B  1  204  ? 25.292  27.702  129.793  1.00 37.09  ? 204  SER B OG    1 
ATOM   3366  N  N     . VAL B  1  205  ? 27.347  29.540  128.657  1.00 39.58  ? 205  VAL B N     1 
ATOM   3367  C  CA    . VAL B  1  205  ? 28.787  29.749  128.634  1.00 35.69  ? 205  VAL B CA    1 
ATOM   3368  C  C     . VAL B  1  205  ? 29.227  29.873  127.181  1.00 43.32  ? 205  VAL B C     1 
ATOM   3369  O  O     . VAL B  1  205  ? 28.892  29.025  126.356  1.00 40.98  ? 205  VAL B O     1 
ATOM   3370  C  CB    . VAL B  1  205  ? 29.541  28.581  129.291  1.00 30.70  ? 205  VAL B CB    1 
ATOM   3371  C  CG1   . VAL B  1  205  ? 31.039  28.835  129.266  1.00 28.86  ? 205  VAL B CG1   1 
ATOM   3372  C  CG2   . VAL B  1  205  ? 29.059  28.371  130.714  1.00 39.58  ? 205  VAL B CG2   1 
ATOM   3373  N  N     . THR B  1  206  ? 29.965  30.933  126.863  1.00 47.89  ? 206  THR B N     1 
ATOM   3374  C  CA    . THR B  1  206  ? 30.396  31.175  125.488  1.00 41.06  ? 206  THR B CA    1 
ATOM   3375  C  C     . THR B  1  206  ? 31.507  30.207  125.082  1.00 40.01  ? 206  THR B C     1 
ATOM   3376  O  O     . THR B  1  206  ? 32.275  29.751  125.934  1.00 36.67  ? 206  THR B O     1 
ATOM   3377  C  CB    . THR B  1  206  ? 30.882  32.627  125.293  1.00 41.51  ? 206  THR B CB    1 
ATOM   3378  O  OG1   . THR B  1  206  ? 32.176  32.785  125.885  1.00 42.00  ? 206  THR B OG1   1 
ATOM   3379  C  CG2   . THR B  1  206  ? 29.905  33.610  125.918  1.00 48.98  ? 206  THR B CG2   1 
ATOM   3380  N  N     . PRO B  1  207  ? 31.587  29.884  123.777  1.00 35.33  ? 207  PRO B N     1 
ATOM   3381  C  CA    . PRO B  1  207  ? 32.603  28.972  123.240  1.00 31.40  ? 207  PRO B CA    1 
ATOM   3382  C  C     . PRO B  1  207  ? 34.023  29.358  123.635  1.00 31.60  ? 207  PRO B C     1 
ATOM   3383  O  O     . PRO B  1  207  ? 34.828  28.474  123.925  1.00 34.12  ? 207  PRO B O     1 
ATOM   3384  C  CB    . PRO B  1  207  ? 32.421  29.111  121.729  1.00 29.88  ? 207  PRO B CB    1 
ATOM   3385  C  CG    . PRO B  1  207  ? 30.980  29.411  121.573  1.00 33.08  ? 207  PRO B CG    1 
ATOM   3386  C  CD    . PRO B  1  207  ? 30.630  30.297  122.735  1.00 33.98  ? 207  PRO B CD    1 
ATOM   3387  N  N     . LEU B  1  208  ? 34.325  30.652  123.652  1.00 28.40  ? 208  LEU B N     1 
ATOM   3388  C  CA    . LEU B  1  208  ? 35.647  31.104  124.070  1.00 29.90  ? 208  LEU B CA    1 
ATOM   3389  C  C     . LEU B  1  208  ? 35.874  30.805  125.553  1.00 32.10  ? 208  LEU B C     1 
ATOM   3390  O  O     . LEU B  1  208  ? 36.923  30.271  125.941  1.00 32.20  ? 208  LEU B O     1 
ATOM   3391  C  CB    . LEU B  1  208  ? 35.824  32.594  123.786  1.00 28.65  ? 208  LEU B CB    1 
ATOM   3392  C  CG    . LEU B  1  208  ? 37.161  33.196  124.224  1.00 34.16  ? 208  LEU B CG    1 
ATOM   3393  C  CD1   . LEU B  1  208  ? 38.333  32.416  123.641  1.00 24.62  ? 208  LEU B CD1   1 
ATOM   3394  C  CD2   . LEU B  1  208  ? 37.238  34.664  123.830  1.00 46.11  ? 208  LEU B CD2   1 
ATOM   3395  N  N     . GLU B  1  209  ? 34.882  31.145  126.373  1.00 29.59  ? 209  GLU B N     1 
ATOM   3396  C  CA    . GLU B  1  209  ? 34.925  30.849  127.798  1.00 32.13  ? 209  GLU B CA    1 
ATOM   3397  C  C     . GLU B  1  209  ? 35.131  29.355  128.011  1.00 32.97  ? 209  GLU B C     1 
ATOM   3398  O  O     . GLU B  1  209  ? 35.987  28.940  128.799  1.00 27.98  ? 209  GLU B O     1 
ATOM   3399  C  CB    . GLU B  1  209  ? 33.632  31.306  128.479  1.00 35.07  ? 209  GLU B CB    1 
ATOM   3400  C  CG    . GLU B  1  209  ? 33.518  32.814  128.671  1.00 41.64  ? 209  GLU B CG    1 
ATOM   3401  C  CD    . GLU B  1  209  ? 32.096  33.258  128.977  1.00 49.06  ? 209  GLU B CD    1 
ATOM   3402  O  OE1   . GLU B  1  209  ? 31.870  34.476  129.146  1.00 51.68  ? 209  GLU B OE1   1 
ATOM   3403  O  OE2   . GLU B  1  209  ? 31.201  32.387  129.043  1.00 50.54  ? 209  GLU B OE2   1 
ATOM   3404  N  N     . ALA B  1  210  ? 34.351  28.558  127.284  1.00 30.58  ? 210  ALA B N     1 
ATOM   3405  C  CA    . ALA B  1  210  ? 34.433  27.103  127.355  1.00 26.57  ? 210  ALA B CA    1 
ATOM   3406  C  C     . ALA B  1  210  ? 35.839  26.601  127.043  1.00 26.45  ? 210  ALA B C     1 
ATOM   3407  O  O     . ALA B  1  210  ? 36.407  25.815  127.801  1.00 30.49  ? 210  ALA B O     1 
ATOM   3408  C  CB    . ALA B  1  210  ? 33.424  26.472  126.408  1.00 21.94  ? 210  ALA B CB    1 
ATOM   3409  N  N     . LEU B  1  211  ? 36.395  27.068  125.929  1.00 22.58  ? 211  LEU B N     1 
ATOM   3410  C  CA    . LEU B  1  211  ? 37.731  26.667  125.498  1.00 21.52  ? 211  LEU B CA    1 
ATOM   3411  C  C     . LEU B  1  211  ? 38.783  27.006  126.550  1.00 26.17  ? 211  LEU B C     1 
ATOM   3412  O  O     . LEU B  1  211  ? 39.656  26.186  126.860  1.00 22.84  ? 211  LEU B O     1 
ATOM   3413  C  CB    . LEU B  1  211  ? 38.079  27.331  124.164  1.00 21.22  ? 211  LEU B CB    1 
ATOM   3414  C  CG    . LEU B  1  211  ? 39.448  27.037  123.549  1.00 20.92  ? 211  LEU B CG    1 
ATOM   3415  C  CD1   . LEU B  1  211  ? 39.662  25.544  123.381  1.00 22.25  ? 211  LEU B CD1   1 
ATOM   3416  C  CD2   . LEU B  1  211  ? 39.581  27.746  122.213  1.00 25.51  ? 211  LEU B CD2   1 
ATOM   3417  N  N     . ASN B  1  212  ? 38.689  28.214  127.100  1.00 31.68  ? 212  ASN B N     1 
ATOM   3418  C  CA    . ASN B  1  212  ? 39.628  28.657  128.129  1.00 29.39  ? 212  ASN B CA    1 
ATOM   3419  C  C     . ASN B  1  212  ? 39.546  27.800  129.388  1.00 24.01  ? 212  ASN B C     1 
ATOM   3420  O  O     . ASN B  1  212  ? 40.574  27.394  129.949  1.00 23.08  ? 212  ASN B O     1 
ATOM   3421  C  CB    . ASN B  1  212  ? 39.388  30.128  128.464  1.00 29.73  ? 212  ASN B CB    1 
ATOM   3422  C  CG    . ASN B  1  212  ? 39.572  31.031  127.263  1.00 29.87  ? 212  ASN B CG    1 
ATOM   3423  O  OD1   . ASN B  1  212  ? 40.546  30.904  126.522  1.00 25.55  ? 212  ASN B OD1   1 
ATOM   3424  N  ND2   . ASN B  1  212  ? 38.625  31.937  127.053  1.00 35.59  ? 212  ASN B ND2   1 
ATOM   3425  N  N     . GLN B  1  213  ? 38.320  27.525  129.823  1.00 23.36  ? 213  GLN B N     1 
ATOM   3426  C  CA    . GLN B  1  213  ? 38.101  26.646  130.961  1.00 27.52  ? 213  GLN B CA    1 
ATOM   3427  C  C     . GLN B  1  213  ? 38.759  25.303  130.692  1.00 24.26  ? 213  GLN B C     1 
ATOM   3428  O  O     . GLN B  1  213  ? 39.458  24.760  131.546  1.00 20.51  ? 213  GLN B O     1 
ATOM   3429  C  CB    . GLN B  1  213  ? 36.606  26.437  131.211  1.00 25.93  ? 213  GLN B CB    1 
ATOM   3430  C  CG    . GLN B  1  213  ? 35.858  27.670  131.685  1.00 26.43  ? 213  GLN B CG    1 
ATOM   3431  C  CD    . GLN B  1  213  ? 34.431  27.354  132.095  1.00 27.35  ? 213  GLN B CD    1 
ATOM   3432  O  OE1   . GLN B  1  213  ? 34.145  26.264  132.591  1.00 25.42  ? 213  GLN B OE1   1 
ATOM   3433  N  NE2   . GLN B  1  213  ? 33.527  28.305  131.885  1.00 32.72  ? 213  GLN B NE2   1 
ATOM   3434  N  N     . ALA B  1  214  ? 38.540  24.789  129.486  1.00 23.08  ? 214  ALA B N     1 
ATOM   3435  C  CA    . ALA B  1  214  ? 39.041  23.478  129.096  1.00 22.49  ? 214  ALA B CA    1 
ATOM   3436  C  C     . ALA B  1  214  ? 40.564  23.401  129.153  1.00 24.81  ? 214  ALA B C     1 
ATOM   3437  O  O     . ALA B  1  214  ? 41.122  22.494  129.779  1.00 25.87  ? 214  ALA B O     1 
ATOM   3438  C  CB    . ALA B  1  214  ? 38.536  23.110  127.711  1.00 21.54  ? 214  ALA B CB    1 
ATOM   3439  N  N     . VAL B  1  215  ? 41.238  24.348  128.505  1.00 24.84  ? 215  VAL B N     1 
ATOM   3440  C  CA    . VAL B  1  215  ? 42.699  24.352  128.514  1.00 22.56  ? 215  VAL B CA    1 
ATOM   3441  C  C     . VAL B  1  215  ? 43.238  24.539  129.934  1.00 26.77  ? 215  VAL B C     1 
ATOM   3442  O  O     . VAL B  1  215  ? 44.286  23.987  130.288  1.00 24.72  ? 215  VAL B O     1 
ATOM   3443  C  CB    . VAL B  1  215  ? 43.296  25.404  127.547  1.00 20.74  ? 215  VAL B CB    1 
ATOM   3444  C  CG1   . VAL B  1  215  ? 42.756  25.190  126.147  1.00 27.19  ? 215  VAL B CG1   1 
ATOM   3445  C  CG2   . VAL B  1  215  ? 42.993  26.818  128.013  1.00 30.71  ? 215  VAL B CG2   1 
ATOM   3446  N  N     . GLU B  1  216  ? 42.506  25.296  130.750  1.00 27.91  ? 216  GLU B N     1 
ATOM   3447  C  CA    . GLU B  1  216  ? 42.875  25.455  132.150  1.00 27.19  ? 216  GLU B CA    1 
ATOM   3448  C  C     . GLU B  1  216  ? 42.825  24.109  132.868  1.00 31.28  ? 216  GLU B C     1 
ATOM   3449  O  O     . GLU B  1  216  ? 43.757  23.746  133.593  1.00 32.27  ? 216  GLU B O     1 
ATOM   3450  C  CB    . GLU B  1  216  ? 41.965  26.474  132.840  1.00 31.10  ? 216  GLU B CB    1 
ATOM   3451  C  CG    . GLU B  1  216  ? 42.128  26.547  134.358  1.00 40.30  ? 216  GLU B CG    1 
ATOM   3452  C  CD    . GLU B  1  216  ? 43.497  27.053  134.800  1.00 52.12  ? 216  GLU B CD    1 
ATOM   3453  O  OE1   . GLU B  1  216  ? 43.794  26.965  136.011  1.00 47.86  ? 216  GLU B OE1   1 
ATOM   3454  O  OE2   . GLU B  1  216  ? 44.274  27.543  133.950  1.00 51.60  ? 216  GLU B OE2   1 
ATOM   3455  N  N     . ILE B  1  217  ? 41.736  23.374  132.653  1.00 28.83  ? 217  ILE B N     1 
ATOM   3456  C  CA    . ILE B  1  217  ? 41.580  22.032  133.206  1.00 26.70  ? 217  ILE B CA    1 
ATOM   3457  C  C     . ILE B  1  217  ? 42.752  21.148  132.796  1.00 28.04  ? 217  ILE B C     1 
ATOM   3458  O  O     . ILE B  1  217  ? 43.338  20.451  133.627  1.00 28.97  ? 217  ILE B O     1 
ATOM   3459  C  CB    . ILE B  1  217  ? 40.269  21.369  132.733  1.00 18.43  ? 217  ILE B CB    1 
ATOM   3460  C  CG1   . ILE B  1  217  ? 39.057  22.142  133.248  1.00 17.07  ? 217  ILE B CG1   1 
ATOM   3461  C  CG2   . ILE B  1  217  ? 40.196  19.925  133.197  1.00 17.76  ? 217  ILE B CG2   1 
ATOM   3462  C  CD1   . ILE B  1  217  ? 37.737  21.542  132.829  1.00 19.07  ? 217  ILE B CD1   1 
ATOM   3463  N  N     . LEU B  1  218  ? 43.099  21.195  131.512  1.00 26.51  ? 218  LEU B N     1 
ATOM   3464  C  CA    . LEU B  1  218  ? 44.188  20.376  130.989  1.00 26.56  ? 218  LEU B CA    1 
ATOM   3465  C  C     . LEU B  1  218  ? 45.538  20.710  131.630  1.00 31.57  ? 218  LEU B C     1 
ATOM   3466  O  O     . LEU B  1  218  ? 46.302  19.807  131.978  1.00 27.95  ? 218  LEU B O     1 
ATOM   3467  C  CB    . LEU B  1  218  ? 44.274  20.489  129.463  1.00 26.87  ? 218  LEU B CB    1 
ATOM   3468  C  CG    . LEU B  1  218  ? 45.262  19.540  128.777  1.00 22.38  ? 218  LEU B CG    1 
ATOM   3469  C  CD1   . LEU B  1  218  ? 44.961  18.097  129.146  1.00 22.46  ? 218  LEU B CD1   1 
ATOM   3470  C  CD2   . LEU B  1  218  ? 45.236  19.726  127.269  1.00 16.06  ? 218  LEU B CD2   1 
ATOM   3471  N  N     . ARG B  1  219  ? 45.832  22.000  131.786  1.00 29.79  ? 219  ARG B N     1 
ATOM   3472  C  CA    . ARG B  1  219  ? 47.083  22.409  132.424  1.00 30.73  ? 219  ARG B CA    1 
ATOM   3473  C  C     . ARG B  1  219  ? 47.122  21.949  133.880  1.00 32.95  ? 219  ARG B C     1 
ATOM   3474  O  O     . ARG B  1  219  ? 48.124  21.395  134.353  1.00 30.05  ? 219  ARG B O     1 
ATOM   3475  C  CB    . ARG B  1  219  ? 47.264  23.926  132.358  1.00 34.05  ? 219  ARG B CB    1 
ATOM   3476  C  CG    . ARG B  1  219  ? 48.573  24.407  132.977  1.00 41.18  ? 219  ARG B CG    1 
ATOM   3477  C  CD    . ARG B  1  219  ? 48.594  25.917  133.182  1.00 40.62  ? 219  ARG B CD    1 
ATOM   3478  N  NE    . ARG B  1  219  ? 47.473  26.375  133.998  1.00 37.94  ? 219  ARG B NE    1 
ATOM   3479  C  CZ    . ARG B  1  219  ? 47.403  26.239  135.319  1.00 34.21  ? 219  ARG B CZ    1 
ATOM   3480  N  NH1   . ARG B  1  219  ? 48.389  25.649  135.983  1.00 26.28  ? 219  ARG B NH1   1 
ATOM   3481  N  NH2   . ARG B  1  219  ? 46.344  26.688  135.976  1.00 35.97  ? 219  ARG B NH2   1 
ATOM   3482  N  N     . GLU B  1  220  ? 46.015  22.186  134.579  1.00 32.95  ? 220  GLU B N     1 
ATOM   3483  C  CA    . GLU B  1  220  ? 45.874  21.784  135.971  1.00 34.67  ? 220  GLU B CA    1 
ATOM   3484  C  C     . GLU B  1  220  ? 46.107  20.284  136.126  1.00 36.18  ? 220  GLU B C     1 
ATOM   3485  O  O     . GLU B  1  220  ? 46.728  19.839  137.094  1.00 37.60  ? 220  GLU B O     1 
ATOM   3486  C  CB    . GLU B  1  220  ? 44.489  22.168  136.494  1.00 41.45  ? 220  GLU B CB    1 
ATOM   3487  C  CG    . GLU B  1  220  ? 44.253  21.837  137.960  1.00 48.22  ? 220  GLU B CG    1 
ATOM   3488  C  CD    . GLU B  1  220  ? 42.912  22.341  138.457  1.00 59.95  ? 220  GLU B CD    1 
ATOM   3489  O  OE1   . GLU B  1  220  ? 42.270  23.134  137.735  1.00 53.61  ? 220  GLU B OE1   1 
ATOM   3490  O  OE2   . GLU B  1  220  ? 42.498  21.942  139.567  1.00 70.09  ? 220  GLU B OE2   1 
ATOM   3491  N  N     . HIS B  1  221  ? 45.617  19.507  135.166  1.00 31.86  ? 221  HIS B N     1 
ATOM   3492  C  CA    . HIS B  1  221  ? 45.863  18.071  135.165  1.00 31.02  ? 221  HIS B CA    1 
ATOM   3493  C  C     . HIS B  1  221  ? 47.327  17.757  134.862  1.00 31.81  ? 221  HIS B C     1 
ATOM   3494  O  O     . HIS B  1  221  ? 47.877  16.785  135.376  1.00 30.15  ? 221  HIS B O     1 
ATOM   3495  C  CB    . HIS B  1  221  ? 44.946  17.357  134.171  1.00 27.50  ? 221  HIS B CB    1 
ATOM   3496  C  CG    . HIS B  1  221  ? 43.603  17.002  134.732  1.00 28.23  ? 221  HIS B CG    1 
ATOM   3497  N  ND1   . HIS B  1  221  ? 42.533  17.868  134.706  1.00 32.44  ? 221  HIS B ND1   1 
ATOM   3498  C  CD2   . HIS B  1  221  ? 43.161  15.873  135.335  1.00 30.64  ? 221  HIS B CD2   1 
ATOM   3499  C  CE1   . HIS B  1  221  ? 41.485  17.287  135.267  1.00 32.40  ? 221  HIS B CE1   1 
ATOM   3500  N  NE2   . HIS B  1  221  ? 41.840  16.078  135.658  1.00 38.18  ? 221  HIS B NE2   1 
ATOM   3501  N  N     . LEU B  1  222  ? 47.953  18.581  134.027  1.00 32.89  ? 222  LEU B N     1 
ATOM   3502  C  CA    . LEU B  1  222  ? 49.363  18.399  133.698  1.00 27.65  ? 222  LEU B CA    1 
ATOM   3503  C  C     . LEU B  1  222  ? 50.247  18.608  134.921  1.00 32.19  ? 222  LEU B C     1 
ATOM   3504  O  O     . LEU B  1  222  ? 51.326  18.023  135.024  1.00 28.21  ? 222  LEU B O     1 
ATOM   3505  C  CB    . LEU B  1  222  ? 49.788  19.348  132.577  1.00 25.81  ? 222  LEU B CB    1 
ATOM   3506  C  CG    . LEU B  1  222  ? 49.490  18.894  131.149  1.00 26.27  ? 222  LEU B CG    1 
ATOM   3507  C  CD1   . LEU B  1  222  ? 49.907  19.966  130.156  1.00 25.63  ? 222  LEU B CD1   1 
ATOM   3508  C  CD2   . LEU B  1  222  ? 50.198  17.580  130.853  1.00 23.52  ? 222  LEU B CD2   1 
ATOM   3509  N  N     . THR B  1  223  ? 49.786  19.443  135.849  1.00 41.57  ? 223  THR B N     1 
ATOM   3510  C  CA    . THR B  1  223  ? 50.542  19.704  137.074  1.00 34.89  ? 223  THR B CA    1 
ATOM   3511  C  C     . THR B  1  223  ? 50.598  18.497  138.010  1.00 35.22  ? 223  THR B C     1 
ATOM   3512  O  O     . THR B  1  223  ? 51.418  18.456  138.922  1.00 40.00  ? 223  THR B O     1 
ATOM   3513  C  CB    . THR B  1  223  ? 49.956  20.886  137.864  1.00 27.21  ? 223  THR B CB    1 
ATOM   3514  O  OG1   . THR B  1  223  ? 48.661  20.531  138.362  1.00 32.16  ? 223  THR B OG1   1 
ATOM   3515  C  CG2   . THR B  1  223  ? 49.842  22.114  136.980  1.00 34.55  ? 223  THR B CG2   1 
ATOM   3516  N  N     . TYR B  1  224  ? 49.733  17.514  137.776  1.00 33.46  ? 224  TYR B N     1 
ATOM   3517  C  CA    . TYR B  1  224  ? 49.600  16.366  138.675  1.00 31.18  ? 224  TYR B CA    1 
ATOM   3518  C  C     . TYR B  1  224  ? 50.785  15.395  138.644  1.00 32.79  ? 224  TYR B C     1 
ATOM   3519  O  O     . TYR B  1  224  ? 50.829  14.441  139.417  1.00 34.96  ? 224  TYR B O     1 
ATOM   3520  C  CB    . TYR B  1  224  ? 48.295  15.614  138.399  1.00 30.92  ? 224  TYR B CB    1 
ATOM   3521  C  CG    . TYR B  1  224  ? 47.045  16.403  138.733  1.00 42.25  ? 224  TYR B CG    1 
ATOM   3522  C  CD1   . TYR B  1  224  ? 47.084  17.463  139.633  1.00 44.34  ? 224  TYR B CD1   1 
ATOM   3523  C  CD2   . TYR B  1  224  ? 45.825  16.086  138.148  1.00 46.88  ? 224  TYR B CD2   1 
ATOM   3524  C  CE1   . TYR B  1  224  ? 45.938  18.185  139.941  1.00 49.80  ? 224  TYR B CE1   1 
ATOM   3525  C  CE2   . TYR B  1  224  ? 44.675  16.800  138.450  1.00 42.38  ? 224  TYR B CE2   1 
ATOM   3526  C  CZ    . TYR B  1  224  ? 44.736  17.848  139.345  1.00 48.28  ? 224  TYR B CZ    1 
ATOM   3527  O  OH    . TYR B  1  224  ? 43.593  18.558  139.643  1.00 44.43  ? 224  TYR B OH    1 
ATOM   3528  N  N     . PHE B  1  225  ? 51.736  15.638  137.749  1.00 41.45  ? 225  PHE B N     1 
ATOM   3529  C  CA    . PHE B  1  225  ? 52.925  14.796  137.626  1.00 40.96  ? 225  PHE B CA    1 
ATOM   3530  C  C     . PHE B  1  225  ? 54.059  15.284  138.523  1.00 50.11  ? 225  PHE B C     1 
ATOM   3531  O  O     . PHE B  1  225  ? 55.184  14.792  138.438  1.00 49.66  ? 225  PHE B O     1 
ATOM   3532  C  CB    . PHE B  1  225  ? 53.395  14.727  136.172  1.00 37.02  ? 225  PHE B CB    1 
ATOM   3533  C  CG    . PHE B  1  225  ? 52.471  13.958  135.276  1.00 32.64  ? 225  PHE B CG    1 
ATOM   3534  C  CD1   . PHE B  1  225  ? 52.573  12.582  135.172  1.00 32.23  ? 225  PHE B CD1   1 
ATOM   3535  C  CD2   . PHE B  1  225  ? 51.496  14.609  134.539  1.00 36.20  ? 225  PHE B CD2   1 
ATOM   3536  C  CE1   . PHE B  1  225  ? 51.721  11.871  134.349  1.00 31.68  ? 225  PHE B CE1   1 
ATOM   3537  C  CE2   . PHE B  1  225  ? 50.641  13.901  133.715  1.00 34.48  ? 225  PHE B CE2   1 
ATOM   3538  C  CZ    . PHE B  1  225  ? 50.754  12.532  133.621  1.00 28.66  ? 225  PHE B CZ    1 
ATOM   3539  N  N     . SER B  1  226  ? 53.748  16.260  139.371  1.00 60.08  ? 226  SER B N     1 
ATOM   3540  C  CA    . SER B  1  226  ? 54.746  17.001  140.142  1.00 61.20  ? 226  SER B CA    1 
ATOM   3541  C  C     . SER B  1  226  ? 55.387  16.243  141.306  1.00 61.84  ? 226  SER B C     1 
ATOM   3542  O  O     . SER B  1  226  ? 56.600  16.041  141.325  1.00 67.83  ? 226  SER B O     1 
ATOM   3543  C  CB    . SER B  1  226  ? 54.143  18.310  140.660  1.00 58.32  ? 226  SER B CB    1 
ATOM   3544  O  OG    . SER B  1  226  ? 53.646  19.096  139.590  1.00 71.37  ? 226  SER B OG    1 
ATOM   3545  N  N     . ASN B  1  227  ? 54.579  15.840  142.279  1.00 57.56  ? 227  ASN B N     1 
ATOM   3546  C  CA    . ASN B  1  227  ? 55.110  15.414  143.572  1.00 67.52  ? 227  ASN B CA    1 
ATOM   3547  C  C     . ASN B  1  227  ? 54.765  13.980  143.977  1.00 64.95  ? 227  ASN B C     1 
ATOM   3548  O  O     . ASN B  1  227  ? 53.697  13.729  144.533  1.00 74.03  ? 227  ASN B O     1 
ATOM   3549  C  CB    . ASN B  1  227  ? 54.671  16.390  144.667  1.00 77.18  ? 227  ASN B CB    1 
ATOM   3550  C  CG    . ASN B  1  227  ? 55.253  16.044  146.021  1.00 86.63  ? 227  ASN B CG    1 
ATOM   3551  O  OD1   . ASN B  1  227  ? 54.608  15.382  146.836  1.00 85.26  ? 227  ASN B OD1   1 
ATOM   3552  N  ND2   . ASN B  1  227  ? 56.481  16.486  146.268  1.00 85.96  ? 227  ASN B ND2   1 
ATOM   3553  N  N     . PRO B  1  228  ? 55.675  13.034  143.685  1.00 58.82  ? 228  PRO B N     1 
ATOM   3554  C  CA    . PRO B  1  228  ? 55.529  11.603  143.988  1.00 58.39  ? 228  PRO B CA    1 
ATOM   3555  C  C     . PRO B  1  228  ? 55.281  11.324  145.469  1.00 56.80  ? 228  PRO B C     1 
ATOM   3556  O  O     . PRO B  1  228  ? 55.445  10.176  145.890  1.00 46.69  ? 228  PRO B O     1 
ATOM   3557  C  CB    . PRO B  1  228  ? 56.884  11.018  143.578  1.00 47.72  ? 228  PRO B CB    1 
ATOM   3558  C  CG    . PRO B  1  228  ? 57.430  11.983  142.587  1.00 55.78  ? 228  PRO B CG    1 
ATOM   3559  C  CD    . PRO B  1  228  ? 56.970  13.329  143.049  1.00 52.13  ? 228  PRO B CD    1 
ATOM   3560  N  N     . MET C  2  1    ? 66.829  -18.618 114.260  1.00 54.55  ? 1    MET C N     1 
ATOM   3561  C  CA    . MET C  2  1    ? 65.607  -18.964 114.980  1.00 65.55  ? 1    MET C CA    1 
ATOM   3562  C  C     . MET C  2  1    ? 65.071  -20.326 114.541  1.00 72.92  ? 1    MET C C     1 
ATOM   3563  O  O     . MET C  2  1    ? 65.309  -20.759 113.411  1.00 72.10  ? 1    MET C O     1 
ATOM   3564  C  CB    . MET C  2  1    ? 64.548  -17.873 114.796  1.00 67.67  ? 1    MET C CB    1 
ATOM   3565  C  CG    . MET C  2  1    ? 64.357  -17.418 113.354  1.00 68.28  ? 1    MET C CG    1 
ATOM   3566  S  SD    . MET C  2  1    ? 63.297  -15.961 113.213  1.00 83.00  ? 1    MET C SD    1 
ATOM   3567  C  CE    . MET C  2  1    ? 64.264  -14.742 114.101  1.00 62.45  ? 1    MET C CE    1 
ATOM   3568  N  N     . GLU C  2  2    ? 64.353  -20.996 115.440  1.00 63.90  ? 2    GLU C N     1 
ATOM   3569  C  CA    . GLU C  2  2    ? 63.842  -22.340 115.180  1.00 58.57  ? 2    GLU C CA    1 
ATOM   3570  C  C     . GLU C  2  2    ? 62.821  -22.359 114.044  1.00 55.33  ? 2    GLU C C     1 
ATOM   3571  O  O     . GLU C  2  2    ? 61.923  -21.519 113.996  1.00 51.93  ? 2    GLU C O     1 
ATOM   3572  C  CB    . GLU C  2  2    ? 63.213  -22.926 116.444  1.00 51.00  ? 2    GLU C CB    1 
ATOM   3573  C  CG    . GLU C  2  2    ? 62.748  -24.364 116.283  1.00 56.35  ? 2    GLU C CG    1 
ATOM   3574  C  CD    . GLU C  2  2    ? 61.889  -24.835 117.439  1.00 66.22  ? 2    GLU C CD    1 
ATOM   3575  O  OE1   . GLU C  2  2    ? 61.899  -26.049 117.731  1.00 67.33  ? 2    GLU C OE1   1 
ATOM   3576  O  OE2   . GLU C  2  2    ? 61.200  -23.991 118.051  1.00 66.75  ? 2    GLU C OE2   1 
ATOM   3577  N  N     . ILE C  2  3    ? 62.959  -23.325 113.139  1.00 48.43  ? 3    ILE C N     1 
ATOM   3578  C  CA    . ILE C  2  3    ? 62.059  -23.436 111.992  1.00 39.63  ? 3    ILE C CA    1 
ATOM   3579  C  C     . ILE C  2  3    ? 61.185  -24.686 112.061  1.00 32.90  ? 3    ILE C C     1 
ATOM   3580  O  O     . ILE C  2  3    ? 61.681  -25.805 111.938  1.00 34.16  ? 3    ILE C O     1 
ATOM   3581  C  CB    . ILE C  2  3    ? 62.840  -23.449 110.663  1.00 31.05  ? 3    ILE C CB    1 
ATOM   3582  C  CG1   . ILE C  2  3    ? 63.685  -22.184 110.526  1.00 34.23  ? 3    ILE C CG1   1 
ATOM   3583  C  CG2   . ILE C  2  3    ? 61.888  -23.578 109.485  1.00 23.65  ? 3    ILE C CG2   1 
ATOM   3584  C  CD1   . ILE C  2  3    ? 64.444  -22.106 109.223  1.00 37.59  ? 3    ILE C CD1   1 
ATOM   3585  N  N     . LYS C  2  4    ? 59.882  -24.494 112.251  1.00 27.82  ? 4    LYS C N     1 
ATOM   3586  C  CA    . LYS C  2  4    ? 58.956  -25.625 112.292  1.00 26.21  ? 4    LYS C CA    1 
ATOM   3587  C  C     . LYS C  2  4    ? 58.372  -25.882 110.912  1.00 25.73  ? 4    LYS C C     1 
ATOM   3588  O  O     . LYS C  2  4    ? 57.934  -24.954 110.242  1.00 28.28  ? 4    LYS C O     1 
ATOM   3589  C  CB    . LYS C  2  4    ? 57.825  -25.371 113.290  1.00 28.40  ? 4    LYS C CB    1 
ATOM   3590  C  CG    . LYS C  2  4    ? 56.798  -26.497 113.362  1.00 31.20  ? 4    LYS C CG    1 
ATOM   3591  C  CD    . LYS C  2  4    ? 55.665  -26.163 114.328  1.00 34.24  ? 4    LYS C CD    1 
ATOM   3592  C  CE    . LYS C  2  4    ? 54.845  -27.399 114.700  1.00 40.47  ? 4    LYS C CE    1 
ATOM   3593  N  NZ    . LYS C  2  4    ? 54.174  -28.043 113.532  1.00 35.10  ? 4    LYS C NZ    1 
ATOM   3594  N  N     . ARG C  2  5    ? 58.362  -27.139 110.481  1.00 26.75  ? 5    ARG C N     1 
ATOM   3595  C  CA    . ARG C  2  5    ? 57.832  -27.457 109.159  1.00 30.17  ? 5    ARG C CA    1 
ATOM   3596  C  C     . ARG C  2  5    ? 56.653  -28.416 109.216  1.00 29.71  ? 5    ARG C C     1 
ATOM   3597  O  O     . ARG C  2  5    ? 56.656  -29.378 109.983  1.00 31.22  ? 5    ARG C O     1 
ATOM   3598  C  CB    . ARG C  2  5    ? 58.929  -28.003 108.240  1.00 31.88  ? 5    ARG C CB    1 
ATOM   3599  C  CG    . ARG C  2  5    ? 59.631  -29.243 108.751  1.00 39.26  ? 5    ARG C CG    1 
ATOM   3600  C  CD    . ARG C  2  5    ? 60.796  -29.603 107.843  1.00 43.62  ? 5    ARG C CD    1 
ATOM   3601  N  NE    . ARG C  2  5    ? 60.389  -29.664 106.442  1.00 45.74  ? 5    ARG C NE    1 
ATOM   3602  C  CZ    . ARG C  2  5    ? 61.101  -29.164 105.437  1.00 40.98  ? 5    ARG C CZ    1 
ATOM   3603  N  NH1   . ARG C  2  5    ? 62.260  -28.564 105.680  1.00 31.70  ? 5    ARG C NH1   1 
ATOM   3604  N  NH2   . ARG C  2  5    ? 60.655  -29.264 104.190  1.00 37.60  ? 5    ARG C NH2   1 
ATOM   3605  N  N     . PHE C  2  6    ? 55.645  -28.140 108.394  1.00 25.13  ? 6    PHE C N     1 
ATOM   3606  C  CA    . PHE C  2  6    ? 54.424  -28.931 108.385  1.00 27.46  ? 6    PHE C CA    1 
ATOM   3607  C  C     . PHE C  2  6    ? 54.398  -29.914 107.219  1.00 35.77  ? 6    PHE C C     1 
ATOM   3608  O  O     . PHE C  2  6    ? 55.315  -29.956 106.397  1.00 36.50  ? 6    PHE C O     1 
ATOM   3609  C  CB    . PHE C  2  6    ? 53.195  -28.018 108.289  1.00 25.98  ? 6    PHE C CB    1 
ATOM   3610  C  CG    . PHE C  2  6    ? 53.117  -26.973 109.367  1.00 25.61  ? 6    PHE C CG    1 
ATOM   3611  C  CD1   . PHE C  2  6    ? 53.760  -25.756 109.221  1.00 28.99  ? 6    PHE C CD1   1 
ATOM   3612  C  CD2   . PHE C  2  6    ? 52.383  -27.200 110.516  1.00 32.36  ? 6    PHE C CD2   1 
ATOM   3613  C  CE1   . PHE C  2  6    ? 53.683  -24.790 110.208  1.00 26.99  ? 6    PHE C CE1   1 
ATOM   3614  C  CE2   . PHE C  2  6    ? 52.302  -26.239 111.506  1.00 32.31  ? 6    PHE C CE2   1 
ATOM   3615  C  CZ    . PHE C  2  6    ? 52.954  -25.034 111.351  1.00 27.81  ? 6    PHE C CZ    1 
ATOM   3616  N  N     . GLY C  2  7    ? 53.329  -30.701 107.165  1.00 40.65  ? 7    GLY C N     1 
ATOM   3617  C  CA    . GLY C  2  7    ? 53.036  -31.573 106.042  1.00 46.43  ? 7    GLY C CA    1 
ATOM   3618  C  C     . GLY C  2  7    ? 53.525  -33.000 106.191  1.00 54.78  ? 7    GLY C C     1 
ATOM   3619  O  O     . GLY C  2  7    ? 54.604  -33.254 106.728  1.00 49.84  ? 7    GLY C O     1 
ATOM   3620  N  N     . ARG C  2  8    ? 52.723  -33.935 105.691  1.00 64.17  ? 8    ARG C N     1 
ATOM   3621  C  CA    . ARG C  2  8    ? 53.035  -35.357 105.782  1.00 68.49  ? 8    ARG C CA    1 
ATOM   3622  C  C     . ARG C  2  8    ? 53.619  -35.960 104.503  1.00 61.78  ? 8    ARG C C     1 
ATOM   3623  O  O     . ARG C  2  8    ? 53.983  -37.135 104.477  1.00 70.65  ? 8    ARG C O     1 
ATOM   3624  C  CB    . ARG C  2  8    ? 51.798  -36.136 106.239  1.00 74.97  ? 8    ARG C CB    1 
ATOM   3625  C  CG    . ARG C  2  8    ? 51.237  -35.627 107.559  1.00 87.10  ? 8    ARG C CG    1 
ATOM   3626  C  CD    . ARG C  2  8    ? 50.057  -36.447 108.043  1.00 102.51 ? 8    ARG C CD    1 
ATOM   3627  N  NE    . ARG C  2  8    ? 49.574  -35.965 109.334  1.00 114.67 ? 8    ARG C NE    1 
ATOM   3628  C  CZ    . ARG C  2  8    ? 48.586  -36.526 110.022  1.00 123.99 ? 8    ARG C CZ    1 
ATOM   3629  N  NH1   . ARG C  2  8    ? 47.968  -37.599 109.547  1.00 125.00 ? 8    ARG C NH1   1 
ATOM   3630  N  NH2   . ARG C  2  8    ? 48.215  -36.015 111.189  1.00 125.12 ? 8    ARG C NH2   1 
ATOM   3631  N  N     . ILE C  2  9    ? 53.712  -35.157 103.447  1.00 60.33  ? 9    ILE C N     1 
ATOM   3632  C  CA    . ILE C  2  9    ? 54.214  -35.648 102.166  1.00 56.22  ? 9    ILE C CA    1 
ATOM   3633  C  C     . ILE C  2  9    ? 55.737  -35.695 102.150  1.00 58.36  ? 9    ILE C C     1 
ATOM   3634  O  O     . ILE C  2  9    ? 56.400  -34.686 102.388  1.00 53.16  ? 9    ILE C O     1 
ATOM   3635  C  CB    . ILE C  2  9    ? 53.703  -34.800 100.975  1.00 56.90  ? 9    ILE C CB    1 
ATOM   3636  C  CG1   . ILE C  2  9    ? 52.203  -35.023 100.763  1.00 59.22  ? 9    ILE C CG1   1 
ATOM   3637  C  CG2   . ILE C  2  9    ? 54.464  -35.143 99.703   1.00 44.00  ? 9    ILE C CG2   1 
ATOM   3638  C  CD1   . ILE C  2  9    ? 51.634  -34.306 99.551   1.00 41.54  ? 9    ILE C CD1   1 
ATOM   3639  N  N     . ARG C  2  10   ? 56.283  -36.878 101.881  1.00 62.34  ? 10   ARG C N     1 
ATOM   3640  C  CA    . ARG C  2  10   ? 57.727  -37.054 101.786  1.00 64.95  ? 10   ARG C CA    1 
ATOM   3641  C  C     . ARG C  2  10   ? 58.168  -37.155 100.328  1.00 60.65  ? 10   ARG C C     1 
ATOM   3642  O  O     . ARG C  2  10   ? 57.875  -38.141 99.648   1.00 52.69  ? 10   ARG C O     1 
ATOM   3643  C  CB    . ARG C  2  10   ? 58.169  -38.303 102.551  1.00 57.49  ? 10   ARG C CB    1 
ATOM   3644  C  CG    . ARG C  2  10   ? 59.656  -38.603 102.426  1.00 64.37  ? 10   ARG C CG    1 
ATOM   3645  C  CD    . ARG C  2  10   ? 60.014  -39.940 103.053  1.00 66.69  ? 10   ARG C CD    1 
ATOM   3646  N  NE    . ARG C  2  10   ? 59.343  -41.056 102.391  1.00 78.91  ? 10   ARG C NE    1 
ATOM   3647  C  CZ    . ARG C  2  10   ? 59.853  -41.737 101.369  1.00 78.53  ? 10   ARG C CZ    1 
ATOM   3648  N  NH1   . ARG C  2  10   ? 59.170  -42.739 100.830  1.00 68.18  ? 10   ARG C NH1   1 
ATOM   3649  N  NH2   . ARG C  2  10   ? 61.046  -41.417 100.886  1.00 69.54  ? 10   ARG C NH2   1 
ATOM   3650  N  N     . GLU C  2  11   ? 58.878  -36.135 99.853   1.00 55.30  ? 11   GLU C N     1 
ATOM   3651  C  CA    . GLU C  2  11   ? 59.353  -36.123 98.476   1.00 48.65  ? 11   GLU C CA    1 
ATOM   3652  C  C     . GLU C  2  11   ? 60.452  -37.159 98.274   1.00 47.84  ? 11   GLU C C     1 
ATOM   3653  O  O     . GLU C  2  11   ? 61.483  -37.130 98.947   1.00 51.97  ? 11   GLU C O     1 
ATOM   3654  C  CB    . GLU C  2  11   ? 59.853  -34.728 98.084   1.00 51.34  ? 11   GLU C CB    1 
ATOM   3655  C  CG    . GLU C  2  11   ? 58.763  -33.814 97.536   1.00 49.67  ? 11   GLU C CG    1 
ATOM   3656  C  CD    . GLU C  2  11   ? 58.471  -32.626 98.435   1.00 52.11  ? 11   GLU C CD    1 
ATOM   3657  O  OE1   . GLU C  2  11   ? 59.434  -32.027 98.962   1.00 57.82  ? 11   GLU C OE1   1 
ATOM   3658  O  OE2   . GLU C  2  11   ? 57.277  -32.291 98.612   1.00 43.04  ? 11   GLU C OE2   1 
ATOM   3659  N  N     . VAL C  2  12   ? 60.223  -38.064 97.328   1.00 41.59  ? 12   VAL C N     1 
ATOM   3660  C  CA    . VAL C  2  12   ? 61.138  -39.168 97.070   1.00 35.05  ? 12   VAL C CA    1 
ATOM   3661  C  C     . VAL C  2  12   ? 62.428  -38.696 96.423   1.00 33.07  ? 12   VAL C C     1 
ATOM   3662  O  O     . VAL C  2  12   ? 63.519  -39.096 96.827   1.00 38.87  ? 12   VAL C O     1 
ATOM   3663  C  CB    . VAL C  2  12   ? 60.481  -40.220 96.170   1.00 36.30  ? 12   VAL C CB    1 
ATOM   3664  C  CG1   . VAL C  2  12   ? 61.495  -41.273 95.746   1.00 46.18  ? 12   VAL C CG1   1 
ATOM   3665  C  CG2   . VAL C  2  12   ? 59.314  -40.852 96.898   1.00 47.86  ? 12   VAL C CG2   1 
ATOM   3666  N  N     . ILE C  2  13   ? 62.295  -37.837 95.420   1.00 34.47  ? 13   ILE C N     1 
ATOM   3667  C  CA    . ILE C  2  13   ? 63.444  -37.314 94.696   1.00 32.60  ? 13   ILE C CA    1 
ATOM   3668  C  C     . ILE C  2  13   ? 63.542  -35.800 94.859   1.00 25.83  ? 13   ILE C C     1 
ATOM   3669  O  O     . ILE C  2  13   ? 62.529  -35.126 95.030   1.00 33.12  ? 13   ILE C O     1 
ATOM   3670  C  CB    . ILE C  2  13   ? 63.358  -37.670 93.202   1.00 28.90  ? 13   ILE C CB    1 
ATOM   3671  C  CG1   . ILE C  2  13   ? 61.996  -37.269 92.640   1.00 25.55  ? 13   ILE C CG1   1 
ATOM   3672  C  CG2   . ILE C  2  13   ? 63.563  -39.157 93.003   1.00 37.43  ? 13   ILE C CG2   1 
ATOM   3673  C  CD1   . ILE C  2  13   ? 61.822  -37.620 91.188   1.00 25.91  ? 13   ILE C CD1   1 
ATOM   3674  N  N     . PRO C  2  14   ? 64.767  -35.260 94.826   1.00 19.28  ? 14   PRO C N     1 
ATOM   3675  C  CA    . PRO C  2  14   ? 64.937  -33.808 94.893   1.00 22.35  ? 14   PRO C CA    1 
ATOM   3676  C  C     . PRO C  2  14   ? 64.547  -33.165 93.571   1.00 23.52  ? 14   PRO C C     1 
ATOM   3677  O  O     . PRO C  2  14   ? 64.401  -33.870 92.570   1.00 23.64  ? 14   PRO C O     1 
ATOM   3678  C  CB    . PRO C  2  14   ? 66.440  -33.651 95.120   1.00 22.17  ? 14   PRO C CB    1 
ATOM   3679  C  CG    . PRO C  2  14   ? 67.028  -34.830 94.446   1.00 22.94  ? 14   PRO C CG    1 
ATOM   3680  C  CD    . PRO C  2  14   ? 66.058  -35.956 94.695   1.00 24.46  ? 14   PRO C CD    1 
ATOM   3681  N  N     . LEU C  2  15   ? 64.356  -31.850 93.571   1.00 20.54  ? 15   LEU C N     1 
ATOM   3682  C  CA    . LEU C  2  15   ? 64.200  -31.123 92.321   1.00 18.78  ? 15   LEU C CA    1 
ATOM   3683  C  C     . LEU C  2  15   ? 65.469  -31.277 91.497   1.00 19.79  ? 15   LEU C C     1 
ATOM   3684  O  O     . LEU C  2  15   ? 66.573  -31.100 92.014   1.00 20.81  ? 15   LEU C O     1 
ATOM   3685  C  CB    . LEU C  2  15   ? 63.933  -29.642 92.582   1.00 17.10  ? 15   LEU C CB    1 
ATOM   3686  C  CG    . LEU C  2  15   ? 62.504  -29.288 92.980   1.00 14.67  ? 15   LEU C CG    1 
ATOM   3687  C  CD1   . LEU C  2  15   ? 62.400  -27.808 93.290   1.00 15.09  ? 15   LEU C CD1   1 
ATOM   3688  C  CD2   . LEU C  2  15   ? 61.558  -29.673 91.864   1.00 13.53  ? 15   LEU C CD2   1 
ATOM   3689  N  N     . PRO C  2  16   ? 65.315  -31.601 90.205   1.00 17.97  ? 16   PRO C N     1 
ATOM   3690  C  CA    . PRO C  2  16   ? 66.449  -31.756 89.288   1.00 20.88  ? 16   PRO C CA    1 
ATOM   3691  C  C     . PRO C  2  16   ? 67.180  -30.424 89.132   1.00 20.90  ? 16   PRO C C     1 
ATOM   3692  O  O     . PRO C  2  16   ? 66.623  -29.399 89.528   1.00 23.21  ? 16   PRO C O     1 
ATOM   3693  C  CB    . PRO C  2  16   ? 65.778  -32.166 87.974   1.00 18.66  ? 16   PRO C CB    1 
ATOM   3694  C  CG    . PRO C  2  16   ? 64.376  -31.675 88.090   1.00 16.35  ? 16   PRO C CG    1 
ATOM   3695  C  CD    . PRO C  2  16   ? 64.024  -31.815 89.531   1.00 14.53  ? 16   PRO C CD    1 
ATOM   3696  N  N     . PRO C  2  17   ? 68.418  -30.436 88.605   1.00 19.50  ? 17   PRO C N     1 
ATOM   3697  C  CA    . PRO C  2  17   ? 69.119  -29.157 88.438   1.00 21.09  ? 17   PRO C CA    1 
ATOM   3698  C  C     . PRO C  2  17   ? 68.256  -28.211 87.615   1.00 21.52  ? 17   PRO C C     1 
ATOM   3699  O  O     . PRO C  2  17   ? 67.801  -28.586 86.538   1.00 24.48  ? 17   PRO C O     1 
ATOM   3700  C  CB    . PRO C  2  17   ? 70.375  -29.550 87.658   1.00 24.51  ? 17   PRO C CB    1 
ATOM   3701  C  CG    . PRO C  2  17   ? 70.591  -30.992 87.995   1.00 21.41  ? 17   PRO C CG    1 
ATOM   3702  C  CD    . PRO C  2  17   ? 69.223  -31.579 88.140   1.00 17.82  ? 17   PRO C CD    1 
ATOM   3703  N  N     . LEU C  2  18   ? 68.030  -27.004 88.119   1.00 21.58  ? 18   LEU C N     1 
ATOM   3704  C  CA    . LEU C  2  18   ? 66.990  -26.141 87.564   1.00 19.97  ? 18   LEU C CA    1 
ATOM   3705  C  C     . LEU C  2  18   ? 67.360  -25.511 86.221   1.00 17.80  ? 18   LEU C C     1 
ATOM   3706  O  O     . LEU C  2  18   ? 66.508  -25.354 85.347   1.00 17.64  ? 18   LEU C O     1 
ATOM   3707  C  CB    . LEU C  2  18   ? 66.577  -25.079 88.588   1.00 18.20  ? 18   LEU C CB    1 
ATOM   3708  C  CG    . LEU C  2  18   ? 65.934  -25.667 89.851   1.00 16.05  ? 18   LEU C CG    1 
ATOM   3709  C  CD1   . LEU C  2  18   ? 65.701  -24.605 90.917   1.00 13.51  ? 18   LEU C CD1   1 
ATOM   3710  C  CD2   . LEU C  2  18   ? 64.633  -26.381 89.510   1.00 13.25  ? 18   LEU C CD2   1 
ATOM   3711  N  N     . THR C  2  19   ? 68.633  -25.175 86.050   1.00 17.95  ? 19   THR C N     1 
ATOM   3712  C  CA    . THR C  2  19   ? 69.097  -24.564 84.810   1.00 15.35  ? 19   THR C CA    1 
ATOM   3713  C  C     . THR C  2  19   ? 69.538  -25.609 83.789   1.00 17.91  ? 19   THR C C     1 
ATOM   3714  O  O     . THR C  2  19   ? 70.089  -25.260 82.745   1.00 15.94  ? 19   THR C O     1 
ATOM   3715  C  CB    . THR C  2  19   ? 70.253  -23.576 85.054   1.00 14.26  ? 19   THR C CB    1 
ATOM   3716  O  OG1   . THR C  2  19   ? 71.369  -24.270 85.624   1.00 17.31  ? 19   THR C OG1   1 
ATOM   3717  C  CG2   . THR C  2  19   ? 69.813  -22.467 85.996   1.00 18.03  ? 19   THR C CG2   1 
ATOM   3718  N  N     . GLU C  2  20   ? 69.314  -26.885 84.101   1.00 20.67  ? 20   GLU C N     1 
ATOM   3719  C  CA    . GLU C  2  20   ? 69.775  -27.982 83.244   1.00 19.29  ? 20   GLU C CA    1 
ATOM   3720  C  C     . GLU C  2  20   ? 69.198  -27.930 81.833   1.00 16.83  ? 20   GLU C C     1 
ATOM   3721  O  O     . GLU C  2  20   ? 69.807  -28.440 80.894   1.00 16.98  ? 20   GLU C O     1 
ATOM   3722  C  CB    . GLU C  2  20   ? 69.484  -29.352 83.870   1.00 23.14  ? 20   GLU C CB    1 
ATOM   3723  C  CG    . GLU C  2  20   ? 68.066  -29.876 83.644   1.00 29.11  ? 20   GLU C CG    1 
ATOM   3724  C  CD    . GLU C  2  20   ? 67.934  -31.366 83.933   1.00 30.79  ? 20   GLU C CD    1 
ATOM   3725  O  OE1   . GLU C  2  20   ? 68.952  -32.084 83.842   1.00 38.15  ? 20   GLU C OE1   1 
ATOM   3726  O  OE2   . GLU C  2  20   ? 66.812  -31.820 84.248   1.00 24.11  ? 20   GLU C OE2   1 
ATOM   3727  N  N     . ILE C  2  21   ? 68.027  -27.318 81.686   1.00 19.39  ? 21   ILE C N     1 
ATOM   3728  C  CA    . ILE C  2  21   ? 67.409  -27.180 80.371   1.00 20.32  ? 21   ILE C CA    1 
ATOM   3729  C  C     . ILE C  2  21   ? 68.303  -26.342 79.450   1.00 14.02  ? 21   ILE C C     1 
ATOM   3730  O  O     . ILE C  2  21   ? 68.337  -26.553 78.239   1.00 11.12  ? 21   ILE C O     1 
ATOM   3731  C  CB    . ILE C  2  21   ? 65.969  -26.600 80.467   1.00 18.76  ? 21   ILE C CB    1 
ATOM   3732  C  CG1   . ILE C  2  21   ? 65.306  -26.551 79.087   1.00 13.27  ? 21   ILE C CG1   1 
ATOM   3733  C  CG2   . ILE C  2  21   ? 65.972  -25.232 81.133   1.00 13.37  ? 21   ILE C CG2   1 
ATOM   3734  C  CD1   . ILE C  2  21   ? 63.893  -26.029 79.116   1.00 10.14  ? 21   ILE C CD1   1 
ATOM   3735  N  N     . GLN C  2  22   ? 69.047  -25.414 80.046   1.00 14.86  ? 22   GLN C N     1 
ATOM   3736  C  CA    . GLN C  2  22   ? 70.018  -24.607 79.320   1.00 12.69  ? 22   GLN C CA    1 
ATOM   3737  C  C     . GLN C  2  22   ? 71.355  -25.338 79.215   1.00 14.94  ? 22   GLN C C     1 
ATOM   3738  O  O     . GLN C  2  22   ? 71.771  -25.743 78.125   1.00 17.04  ? 22   GLN C O     1 
ATOM   3739  C  CB    . GLN C  2  22   ? 70.222  -23.269 80.030   1.00 10.04  ? 22   GLN C CB    1 
ATOM   3740  C  CG    . GLN C  2  22   ? 69.022  -22.353 79.993   1.00 6.73   ? 22   GLN C CG    1 
ATOM   3741  C  CD    . GLN C  2  22   ? 68.816  -21.737 78.631   1.00 9.61   ? 22   GLN C CD    1 
ATOM   3742  O  OE1   . GLN C  2  22   ? 69.712  -21.098 78.079   1.00 9.30   ? 22   GLN C OE1   1 
ATOM   3743  N  NE2   . GLN C  2  22   ? 67.630  -21.930 78.074   1.00 16.93  ? 22   GLN C NE2   1 
ATOM   3744  N  N     . VAL C  2  23   ? 72.002  -25.520 80.366   1.00 14.61  ? 23   VAL C N     1 
ATOM   3745  C  CA    . VAL C  2  23   ? 73.344  -26.093 80.458   1.00 11.07  ? 23   VAL C CA    1 
ATOM   3746  C  C     . VAL C  2  23   ? 73.514  -27.349 79.621   1.00 13.74  ? 23   VAL C C     1 
ATOM   3747  O  O     . VAL C  2  23   ? 74.210  -27.342 78.601   1.00 14.11  ? 23   VAL C O     1 
ATOM   3748  C  CB    . VAL C  2  23   ? 73.672  -26.465 81.903   1.00 9.86   ? 23   VAL C CB    1 
ATOM   3749  C  CG1   . VAL C  2  23   ? 75.068  -27.042 81.986   1.00 18.07  ? 23   VAL C CG1   1 
ATOM   3750  C  CG2   . VAL C  2  23   ? 73.534  -25.253 82.803   1.00 16.41  ? 23   VAL C CG2   1 
ATOM   3751  N  N     . GLU C  2  24   ? 72.842  -28.413 80.048   1.00 17.21  ? 24   GLU C N     1 
ATOM   3752  C  CA    . GLU C  2  24   ? 72.912  -29.705 79.377   1.00 18.54  ? 24   GLU C CA    1 
ATOM   3753  C  C     . GLU C  2  24   ? 72.587  -29.627 77.896   1.00 17.72  ? 24   GLU C C     1 
ATOM   3754  O  O     . GLU C  2  24   ? 73.058  -30.453 77.118   1.00 23.87  ? 24   GLU C O     1 
ATOM   3755  C  CB    . GLU C  2  24   ? 71.998  -30.726 80.058   1.00 21.56  ? 24   GLU C CB    1 
ATOM   3756  C  CG    . GLU C  2  24   ? 72.534  -31.228 81.386   1.00 28.84  ? 24   GLU C CG    1 
ATOM   3757  C  CD    . GLU C  2  24   ? 73.884  -31.904 81.243   1.00 35.36  ? 24   GLU C CD    1 
ATOM   3758  O  OE1   . GLU C  2  24   ? 74.759  -31.675 82.107   1.00 34.22  ? 24   GLU C OE1   1 
ATOM   3759  O  OE2   . GLU C  2  24   ? 74.066  -32.662 80.264   1.00 30.86  ? 24   GLU C OE2   1 
ATOM   3760  N  N     . SER C  2  25   ? 71.780  -28.648 77.500   1.00 16.35  ? 25   SER C N     1 
ATOM   3761  C  CA    . SER C  2  25   ? 71.505  -28.483 76.082   1.00 14.69  ? 25   SER C CA    1 
ATOM   3762  C  C     . SER C  2  25   ? 72.775  -28.037 75.367   1.00 16.84  ? 25   SER C C     1 
ATOM   3763  O  O     . SER C  2  25   ? 73.270  -28.730 74.473   1.00 19.94  ? 25   SER C O     1 
ATOM   3764  C  CB    . SER C  2  25   ? 70.373  -27.485 75.851   1.00 13.07  ? 25   SER C CB    1 
ATOM   3765  O  OG    . SER C  2  25   ? 70.164  -27.280 74.465   1.00 13.93  ? 25   SER C OG    1 
ATOM   3766  N  N     . TYR C  2  26   ? 73.335  -26.915 75.812   1.00 17.09  ? 26   TYR C N     1 
ATOM   3767  C  CA    . TYR C  2  26   ? 74.461  -26.308 75.113   1.00 15.77  ? 26   TYR C CA    1 
ATOM   3768  C  C     . TYR C  2  26   ? 75.666  -27.235 75.108   1.00 17.72  ? 26   TYR C C     1 
ATOM   3769  O  O     . TYR C  2  26   ? 76.340  -27.386 74.087   1.00 17.63  ? 26   TYR C O     1 
ATOM   3770  C  CB    . TYR C  2  26   ? 74.824  -24.960 75.726   1.00 12.66  ? 26   TYR C CB    1 
ATOM   3771  C  CG    . TYR C  2  26   ? 75.462  -24.022 74.736   1.00 12.23  ? 26   TYR C CG    1 
ATOM   3772  C  CD1   . TYR C  2  26   ? 74.795  -23.662 73.571   1.00 12.95  ? 26   TYR C CD1   1 
ATOM   3773  C  CD2   . TYR C  2  26   ? 76.727  -23.497 74.956   1.00 12.21  ? 26   TYR C CD2   1 
ATOM   3774  C  CE1   . TYR C  2  26   ? 75.367  -22.807 72.653   1.00 14.27  ? 26   TYR C CE1   1 
ATOM   3775  C  CE2   . TYR C  2  26   ? 77.307  -22.635 74.045   1.00 14.28  ? 26   TYR C CE2   1 
ATOM   3776  C  CZ    . TYR C  2  26   ? 76.622  -22.295 72.893   1.00 16.36  ? 26   TYR C CZ    1 
ATOM   3777  O  OH    . TYR C  2  26   ? 77.190  -21.439 71.976   1.00 18.33  ? 26   TYR C OH    1 
ATOM   3778  N  N     . ARG C  2  27   ? 75.911  -27.867 76.252   1.00 21.93  ? 27   ARG C N     1 
ATOM   3779  C  CA    . ARG C  2  27   ? 76.952  -28.874 76.376   1.00 21.78  ? 27   ARG C CA    1 
ATOM   3780  C  C     . ARG C  2  27   ? 76.759  -29.891 75.268   1.00 19.16  ? 27   ARG C C     1 
ATOM   3781  O  O     . ARG C  2  27   ? 77.652  -30.096 74.439   1.00 21.63  ? 27   ARG C O     1 
ATOM   3782  C  CB    . ARG C  2  27   ? 76.839  -29.567 77.734   1.00 21.35  ? 27   ARG C CB    1 
ATOM   3783  C  CG    . ARG C  2  27   ? 78.141  -30.122 78.274   1.00 27.07  ? 27   ARG C CG    1 
ATOM   3784  C  CD    . ARG C  2  27   ? 77.909  -30.881 79.572   1.00 38.12  ? 27   ARG C CD    1 
ATOM   3785  N  NE    . ARG C  2  27   ? 78.007  -32.328 79.391   1.00 59.72  ? 27   ARG C NE    1 
ATOM   3786  C  CZ    . ARG C  2  27   ? 77.020  -33.101 78.945   1.00 53.81  ? 27   ARG C CZ    1 
ATOM   3787  N  NH1   . ARG C  2  27   ? 77.208  -34.408 78.816   1.00 59.79  ? 27   ARG C NH1   1 
ATOM   3788  N  NH2   . ARG C  2  27   ? 75.847  -32.570 78.625   1.00 42.74  ? 27   ARG C NH2   1 
ATOM   3789  N  N     . ARG C  2  28   ? 75.561  -30.470 75.224   1.00 19.10  ? 28   ARG C N     1 
ATOM   3790  C  CA    . ARG C  2  28   ? 75.237  -31.513 74.256   1.00 22.19  ? 28   ARG C CA    1 
ATOM   3791  C  C     . ARG C  2  28   ? 75.439  -31.026 72.822   1.00 21.64  ? 28   ARG C C     1 
ATOM   3792  O  O     . ARG C  2  28   ? 75.712  -31.819 71.922   1.00 21.40  ? 28   ARG C O     1 
ATOM   3793  C  CB    . ARG C  2  28   ? 73.795  -31.988 74.455   1.00 25.38  ? 28   ARG C CB    1 
ATOM   3794  C  CG    . ARG C  2  28   ? 73.418  -33.250 73.695   1.00 32.09  ? 28   ARG C CG    1 
ATOM   3795  C  CD    . ARG C  2  28   ? 73.606  -34.499 74.546   1.00 40.66  ? 28   ARG C CD    1 
ATOM   3796  N  NE    . ARG C  2  28   ? 72.890  -35.642 73.983   1.00 59.82  ? 28   ARG C NE    1 
ATOM   3797  C  CZ    . ARG C  2  28   ? 73.438  -36.553 73.184   1.00 63.97  ? 28   ARG C CZ    1 
ATOM   3798  N  NH1   . ARG C  2  28   ? 74.719  -36.466 72.852   1.00 64.11  ? 28   ARG C NH1   1 
ATOM   3799  N  NH2   . ARG C  2  28   ? 72.705  -37.556 72.719   1.00 66.76  ? 28   ARG C NH2   1 
ATOM   3800  N  N     . ALA C  2  29   ? 75.314  -29.718 72.616   1.00 24.68  ? 29   ALA C N     1 
ATOM   3801  C  CA    . ALA C  2  29   ? 75.499  -29.147 71.290   1.00 21.47  ? 29   ALA C CA    1 
ATOM   3802  C  C     . ALA C  2  29   ? 76.978  -28.984 70.951   1.00 21.87  ? 29   ALA C C     1 
ATOM   3803  O  O     . ALA C  2  29   ? 77.395  -29.262 69.826   1.00 25.71  ? 29   ALA C O     1 
ATOM   3804  C  CB    . ALA C  2  29   ? 74.764  -27.817 71.173   1.00 19.70  ? 29   ALA C CB    1 
ATOM   3805  N  N     . LEU C  2  30   ? 77.771  -28.539 71.924   1.00 20.32  ? 30   LEU C N     1 
ATOM   3806  C  CA    . LEU C  2  30   ? 79.182  -28.250 71.661   1.00 21.40  ? 30   LEU C CA    1 
ATOM   3807  C  C     . LEU C  2  30   ? 80.080  -29.488 71.656   1.00 26.71  ? 30   LEU C C     1 
ATOM   3808  O  O     . LEU C  2  30   ? 80.932  -29.632 70.778   1.00 29.46  ? 30   LEU C O     1 
ATOM   3809  C  CB    . LEU C  2  30   ? 79.723  -27.204 72.638   1.00 21.09  ? 30   LEU C CB    1 
ATOM   3810  C  CG    . LEU C  2  30   ? 79.160  -25.791 72.473   1.00 18.96  ? 30   LEU C CG    1 
ATOM   3811  C  CD1   . LEU C  2  30   ? 79.930  -24.800 73.333   1.00 13.74  ? 30   LEU C CD1   1 
ATOM   3812  C  CD2   . LEU C  2  30   ? 79.179  -25.375 71.009   1.00 17.28  ? 30   LEU C CD2   1 
ATOM   3813  N  N     . GLN C  2  31   ? 79.878  -30.375 72.628   1.00 26.83  ? 31   GLN C N     1 
ATOM   3814  C  CA    . GLN C  2  31   ? 80.721  -31.558 72.793   1.00 23.45  ? 31   GLN C CA    1 
ATOM   3815  C  C     . GLN C  2  31   ? 82.203  -31.201 72.867   1.00 31.16  ? 31   GLN C C     1 
ATOM   3816  O  O     . GLN C  2  31   ? 83.037  -31.858 72.244   1.00 33.76  ? 31   GLN C O     1 
ATOM   3817  C  CB    . GLN C  2  31   ? 80.486  -32.558 71.661   1.00 20.26  ? 31   GLN C CB    1 
ATOM   3818  C  CG    . GLN C  2  31   ? 79.180  -33.320 71.755   1.00 25.38  ? 31   GLN C CG    1 
ATOM   3819  C  CD    . GLN C  2  31   ? 79.001  -34.291 70.607   1.00 27.74  ? 31   GLN C CD    1 
ATOM   3820  O  OE1   . GLN C  2  31   ? 78.743  -35.477 70.817   1.00 26.24  ? 31   GLN C OE1   1 
ATOM   3821  N  NE2   . GLN C  2  31   ? 79.137  -33.792 69.382   1.00 25.94  ? 31   GLN C NE2   1 
ATOM   3822  N  N     . ALA C  2  32   ? 82.526  -30.157 73.624   1.00 30.93  ? 32   ALA C N     1 
ATOM   3823  C  CA    . ALA C  2  32   ? 83.908  -29.711 73.752   1.00 27.36  ? 32   ALA C CA    1 
ATOM   3824  C  C     . ALA C  2  32   ? 84.690  -30.603 74.710   1.00 42.65  ? 32   ALA C C     1 
ATOM   3825  O  O     . ALA C  2  32   ? 85.920  -30.658 74.654   1.00 46.62  ? 32   ALA C O     1 
ATOM   3826  C  CB    . ALA C  2  32   ? 83.958  -28.267 74.213   1.00 27.01  ? 32   ALA C CB    1 
ATOM   3827  N  N     . ASP C  2  33   ? 83.968  -31.300 75.583   1.00 48.12  ? 33   ASP C N     1 
ATOM   3828  C  CA    . ASP C  2  33   ? 84.576  -32.185 76.576   1.00 51.58  ? 33   ASP C CA    1 
ATOM   3829  C  C     . ASP C  2  33   ? 84.869  -33.575 76.012   1.00 48.17  ? 33   ASP C C     1 
ATOM   3830  O  O     . ASP C  2  33   ? 85.606  -34.361 76.610   1.00 52.88  ? 33   ASP C O     1 
ATOM   3831  C  CB    . ASP C  2  33   ? 83.676  -32.297 77.808   1.00 54.88  ? 33   ASP C CB    1 
ATOM   3832  C  CG    . ASP C  2  33   ? 83.709  -31.049 78.667   1.00 64.18  ? 33   ASP C CG    1 
ATOM   3833  O  OD1   . ASP C  2  33   ? 84.227  -30.015 78.194   1.00 62.43  ? 33   ASP C OD1   1 
ATOM   3834  O  OD2   . ASP C  2  33   ? 83.217  -31.101 79.814   1.00 68.09  ? 33   ASP C OD2   1 
ATOM   3835  N  N     . VAL C  2  34   ? 84.284  -33.870 74.859   1.00 38.15  ? 34   VAL C N     1 
ATOM   3836  C  CA    . VAL C  2  34   ? 84.474  -35.157 74.208   1.00 30.02  ? 34   VAL C CA    1 
ATOM   3837  C  C     . VAL C  2  34   ? 85.617  -35.083 73.202   1.00 34.56  ? 34   VAL C C     1 
ATOM   3838  O  O     . VAL C  2  34   ? 85.692  -34.137 72.415   1.00 36.88  ? 34   VAL C O     1 
ATOM   3839  C  CB    . VAL C  2  34   ? 83.182  -35.597 73.489   1.00 30.05  ? 34   VAL C CB    1 
ATOM   3840  C  CG1   . VAL C  2  34   ? 83.424  -36.835 72.645   1.00 32.45  ? 34   VAL C CG1   1 
ATOM   3841  C  CG2   . VAL C  2  34   ? 82.071  -35.839 74.497   1.00 32.42  ? 34   VAL C CG2   1 
ATOM   3842  N  N     . PRO C  2  35   ? 86.532  -36.066 73.246   1.00 34.57  ? 35   PRO C N     1 
ATOM   3843  C  CA    . PRO C  2  35   ? 87.551  -36.211 72.200   1.00 34.65  ? 35   PRO C CA    1 
ATOM   3844  C  C     . PRO C  2  35   ? 86.909  -36.408 70.827   1.00 31.56  ? 35   PRO C C     1 
ATOM   3845  O  O     . PRO C  2  35   ? 85.979  -37.204 70.702   1.00 30.84  ? 35   PRO C O     1 
ATOM   3846  C  CB    . PRO C  2  35   ? 88.327  -37.464 72.629   1.00 28.99  ? 35   PRO C CB    1 
ATOM   3847  C  CG    . PRO C  2  35   ? 87.502  -38.109 73.697   1.00 27.15  ? 35   PRO C CG    1 
ATOM   3848  C  CD    . PRO C  2  35   ? 86.747  -37.009 74.354   1.00 31.79  ? 35   PRO C CD    1 
ATOM   3849  N  N     . PRO C  2  36   ? 87.414  -35.696 69.806   1.00 28.38  ? 36   PRO C N     1 
ATOM   3850  C  CA    . PRO C  2  36   ? 86.805  -35.575 68.476   1.00 30.93  ? 36   PRO C CA    1 
ATOM   3851  C  C     . PRO C  2  36   ? 86.338  -36.889 67.850   1.00 36.87  ? 36   PRO C C     1 
ATOM   3852  O  O     . PRO C  2  36   ? 85.334  -36.890 67.140   1.00 45.86  ? 36   PRO C O     1 
ATOM   3853  C  CB    . PRO C  2  36   ? 87.934  -34.969 67.640   1.00 31.17  ? 36   PRO C CB    1 
ATOM   3854  C  CG    . PRO C  2  36   ? 88.688  -34.135 68.609   1.00 32.91  ? 36   PRO C CG    1 
ATOM   3855  C  CD    . PRO C  2  36   ? 88.641  -34.886 69.917   1.00 34.57  ? 36   PRO C CD    1 
ATOM   3856  N  N     . GLU C  2  37   ? 87.039  -37.986 68.110   1.00 44.85  ? 37   GLU C N     1 
ATOM   3857  C  CA    . GLU C  2  37   ? 86.684  -39.264 67.498   1.00 49.88  ? 37   GLU C CA    1 
ATOM   3858  C  C     . GLU C  2  37   ? 85.515  -39.950 68.207   1.00 48.35  ? 37   GLU C C     1 
ATOM   3859  O  O     . GLU C  2  37   ? 84.880  -40.841 67.644   1.00 52.62  ? 37   GLU C O     1 
ATOM   3860  C  CB    . GLU C  2  37   ? 87.895  -40.201 67.441   1.00 48.78  ? 37   GLU C CB    1 
ATOM   3861  C  CG    . GLU C  2  37   ? 88.379  -40.687 68.801   1.00 54.76  ? 37   GLU C CG    1 
ATOM   3862  C  CD    . GLU C  2  37   ? 89.284  -39.692 69.502   1.00 54.05  ? 37   GLU C CD    1 
ATOM   3863  O  OE1   . GLU C  2  37   ? 89.789  -38.764 68.833   1.00 49.93  ? 37   GLU C OE1   1 
ATOM   3864  O  OE2   . GLU C  2  37   ? 89.494  -39.841 70.725   1.00 53.76  ? 37   GLU C OE2   1 
ATOM   3865  N  N     . LYS C  2  38   ? 85.239  -39.532 69.441   1.00 46.23  ? 38   LYS C N     1 
ATOM   3866  C  CA    . LYS C  2  38   ? 84.141  -40.098 70.229   1.00 47.60  ? 38   LYS C CA    1 
ATOM   3867  C  C     . LYS C  2  38   ? 82.845  -39.288 70.138   1.00 45.67  ? 38   LYS C C     1 
ATOM   3868  O  O     . LYS C  2  38   ? 81.857  -39.612 70.803   1.00 36.63  ? 38   LYS C O     1 
ATOM   3869  C  CB    . LYS C  2  38   ? 84.539  -40.225 71.701   1.00 34.62  ? 38   LYS C CB    1 
ATOM   3870  C  CG    . LYS C  2  38   ? 85.628  -41.234 72.001   1.00 34.92  ? 38   LYS C CG    1 
ATOM   3871  C  CD    . LYS C  2  38   ? 85.824  -41.327 73.505   1.00 29.47  ? 38   LYS C CD    1 
ATOM   3872  C  CE    . LYS C  2  38   ? 87.013  -42.184 73.884   1.00 30.69  ? 38   LYS C CE    1 
ATOM   3873  N  NZ    . LYS C  2  38   ? 87.243  -42.134 75.355   1.00 23.92  ? 38   LYS C NZ    1 
ATOM   3874  N  N     . ARG C  2  39   ? 82.853  -38.230 69.334   1.00 41.83  ? 39   ARG C N     1 
ATOM   3875  C  CA    . ARG C  2  39   ? 81.694  -37.350 69.233   1.00 37.94  ? 39   ARG C CA    1 
ATOM   3876  C  C     . ARG C  2  39   ? 80.516  -37.986 68.496   1.00 43.07  ? 39   ARG C C     1 
ATOM   3877  O  O     . ARG C  2  39   ? 80.686  -38.614 67.449   1.00 43.37  ? 39   ARG C O     1 
ATOM   3878  C  CB    . ARG C  2  39   ? 82.070  -36.025 68.564   1.00 35.59  ? 39   ARG C CB    1 
ATOM   3879  C  CG    . ARG C  2  39   ? 83.000  -35.152 69.384   1.00 28.98  ? 39   ARG C CG    1 
ATOM   3880  C  CD    . ARG C  2  39   ? 82.849  -33.688 69.003   1.00 26.36  ? 39   ARG C CD    1 
ATOM   3881  N  NE    . ARG C  2  39   ? 83.741  -32.833 69.779   1.00 21.87  ? 39   ARG C NE    1 
ATOM   3882  C  CZ    . ARG C  2  39   ? 84.875  -32.325 69.312   1.00 21.83  ? 39   ARG C CZ    1 
ATOM   3883  N  NH1   . ARG C  2  39   ? 85.249  -32.579 68.065   1.00 24.17  ? 39   ARG C NH1   1 
ATOM   3884  N  NH2   . ARG C  2  39   ? 85.631  -31.561 70.089   1.00 23.80  ? 39   ARG C NH2   1 
ATOM   3885  N  N     . GLU C  2  40   ? 79.324  -37.812 69.059   1.00 40.82  ? 40   GLU C N     1 
ATOM   3886  C  CA    . GLU C  2  40   ? 78.077  -38.230 68.426   1.00 35.34  ? 40   GLU C CA    1 
ATOM   3887  C  C     . GLU C  2  40   ? 77.708  -37.321 67.261   1.00 40.50  ? 40   GLU C C     1 
ATOM   3888  O  O     . GLU C  2  40   ? 78.255  -36.230 67.117   1.00 44.51  ? 40   GLU C O     1 
ATOM   3889  C  CB    . GLU C  2  40   ? 76.935  -38.268 69.435   1.00 29.06  ? 40   GLU C CB    1 
ATOM   3890  C  CG    . GLU C  2  40   ? 77.104  -39.312 70.512   1.00 46.52  ? 40   GLU C CG    1 
ATOM   3891  C  CD    . GLU C  2  40   ? 75.798  -39.638 71.200   1.00 68.81  ? 40   GLU C CD    1 
ATOM   3892  O  OE1   . GLU C  2  40   ? 74.733  -39.430 70.579   1.00 63.98  ? 40   GLU C OE1   1 
ATOM   3893  O  OE2   . GLU C  2  40   ? 75.834  -40.098 72.360   1.00 82.74  ? 40   GLU C OE2   1 
ATOM   3894  N  N     . ASN C  2  41   ? 76.775  -37.778 66.434   1.00 46.00  ? 41   ASN C N     1 
ATOM   3895  C  CA    . ASN C  2  41   ? 76.382  -37.053 65.230   1.00 50.06  ? 41   ASN C CA    1 
ATOM   3896  C  C     . ASN C  2  41   ? 75.403  -35.919 65.539   1.00 51.29  ? 41   ASN C C     1 
ATOM   3897  O  O     . ASN C  2  41   ? 74.909  -35.261 64.636   1.00 50.60  ? 41   ASN C O     1 
ATOM   3898  C  CB    . ASN C  2  41   ? 75.778  -38.015 64.198   1.00 52.68  ? 41   ASN C CB    1 
ATOM   3899  C  CG    . ASN C  2  41   ? 75.650  -37.394 62.811   1.00 58.61  ? 41   ASN C CG    1 
ATOM   3900  O  OD1   . ASN C  2  41   ? 76.335  -36.425 62.482   1.00 54.07  ? 41   ASN C OD1   1 
ATOM   3901  N  ND2   . ASN C  2  41   ? 74.767  -37.955 61.992   1.00 63.22  ? 41   ASN C ND2   1 
ATOM   3902  N  N     . VAL C  2  42   ? 75.117  -35.706 66.820   1.00 52.27  ? 42   VAL C N     1 
ATOM   3903  C  CA    . VAL C  2  42   ? 74.253  -34.605 67.248   1.00 44.43  ? 42   VAL C CA    1 
ATOM   3904  C  C     . VAL C  2  42   ? 75.060  -33.351 67.603   1.00 37.78  ? 42   VAL C C     1 
ATOM   3905  O  O     . VAL C  2  42   ? 76.190  -33.446 68.081   1.00 46.22  ? 42   VAL C O     1 
ATOM   3906  C  CB    . VAL C  2  42   ? 73.367  -35.006 68.445   1.00 37.96  ? 42   VAL C CB    1 
ATOM   3907  C  CG1   . VAL C  2  42   ? 72.429  -36.140 68.056   1.00 47.60  ? 42   VAL C CG1   1 
ATOM   3908  C  CG2   . VAL C  2  42   ? 74.224  -35.401 69.635   1.00 34.66  ? 42   VAL C CG2   1 
ATOM   3909  N  N     . GLY C  2  43   ? 74.486  -32.178 67.350   1.00 27.65  ? 43   GLY C N     1 
ATOM   3910  C  CA    . GLY C  2  43   ? 75.156  -30.923 67.654   1.00 27.88  ? 43   GLY C CA    1 
ATOM   3911  C  C     . GLY C  2  43   ? 75.797  -30.314 66.427   1.00 24.85  ? 43   GLY C C     1 
ATOM   3912  O  O     . GLY C  2  43   ? 75.419  -30.659 65.316   1.00 28.95  ? 43   GLY C O     1 
ATOM   3913  N  N     . ILE C  2  44   ? 76.751  -29.404 66.612   1.00 25.03  ? 44   ILE C N     1 
ATOM   3914  C  CA    . ILE C  2  44   ? 77.420  -28.779 65.468   1.00 24.93  ? 44   ILE C CA    1 
ATOM   3915  C  C     . ILE C  2  44   ? 78.202  -29.813 64.659   1.00 28.09  ? 44   ILE C C     1 
ATOM   3916  O  O     . ILE C  2  44   ? 78.546  -29.586 63.488   1.00 29.68  ? 44   ILE C O     1 
ATOM   3917  C  CB    . ILE C  2  44   ? 78.335  -27.606 65.880   1.00 20.55  ? 44   ILE C CB    1 
ATOM   3918  C  CG1   . ILE C  2  44   ? 79.468  -28.085 66.781   1.00 19.28  ? 44   ILE C CG1   1 
ATOM   3919  C  CG2   . ILE C  2  44   ? 77.531  -26.523 66.577   1.00 23.75  ? 44   ILE C CG2   1 
ATOM   3920  C  CD1   . ILE C  2  44   ? 80.390  -26.966 67.207   1.00 17.59  ? 44   ILE C CD1   1 
ATOM   3921  N  N     . GLN C  2  45   ? 78.478  -30.948 65.295   1.00 28.76  ? 45   GLN C N     1 
ATOM   3922  C  CA    . GLN C  2  45   ? 79.008  -32.109 64.597   1.00 32.48  ? 45   GLN C CA    1 
ATOM   3923  C  C     . GLN C  2  45   ? 78.080  -32.467 63.437   1.00 36.46  ? 45   GLN C C     1 
ATOM   3924  O  O     . GLN C  2  45   ? 78.536  -32.674 62.310   1.00 41.63  ? 45   GLN C O     1 
ATOM   3925  C  CB    . GLN C  2  45   ? 79.148  -33.294 65.555   1.00 32.59  ? 45   GLN C CB    1 
ATOM   3926  C  CG    . GLN C  2  45   ? 79.822  -34.516 64.945   1.00 33.08  ? 45   GLN C CG    1 
ATOM   3927  C  CD    . GLN C  2  45   ? 81.314  -34.328 64.734   1.00 27.58  ? 45   GLN C CD    1 
ATOM   3928  O  OE1   . GLN C  2  45   ? 82.028  -33.876 65.627   1.00 26.77  ? 45   GLN C OE1   1 
ATOM   3929  N  NE2   . GLN C  2  45   ? 81.791  -34.678 63.547   1.00 30.13  ? 45   GLN C NE2   1 
ATOM   3930  N  N     . ALA C  2  46   ? 76.778  -32.519 63.715   1.00 33.53  ? 46   ALA C N     1 
ATOM   3931  C  CA    . ALA C  2  46   ? 75.775  -32.747 62.675   1.00 33.84  ? 46   ALA C CA    1 
ATOM   3932  C  C     . ALA C  2  46   ? 75.874  -31.727 61.551   1.00 32.73  ? 46   ALA C C     1 
ATOM   3933  O  O     . ALA C  2  46   ? 75.666  -32.060 60.392   1.00 37.57  ? 46   ALA C O     1 
ATOM   3934  C  CB    . ALA C  2  46   ? 74.373  -32.718 63.259   1.00 41.56  ? 46   ALA C CB    1 
ATOM   3935  N  N     . ALA C  2  47   ? 76.176  -30.481 61.898   1.00 27.84  ? 47   ALA C N     1 
ATOM   3936  C  CA    . ALA C  2  47   ? 76.251  -29.420 60.903   1.00 30.74  ? 47   ALA C CA    1 
ATOM   3937  C  C     . ALA C  2  47   ? 77.422  -29.657 59.971   1.00 33.46  ? 47   ALA C C     1 
ATOM   3938  O  O     . ALA C  2  47   ? 77.293  -29.524 58.751   1.00 38.35  ? 47   ALA C O     1 
ATOM   3939  C  CB    . ALA C  2  47   ? 76.376  -28.068 61.575   1.00 37.20  ? 47   ALA C CB    1 
ATOM   3940  N  N     . PHE C  2  48   ? 78.567  -30.007 60.548   1.00 34.45  ? 48   PHE C N     1 
ATOM   3941  C  CA    . PHE C  2  48   ? 79.742  -30.305 59.737   1.00 30.74  ? 48   PHE C CA    1 
ATOM   3942  C  C     . PHE C  2  48   ? 79.536  -31.546 58.869   1.00 32.95  ? 48   PHE C C     1 
ATOM   3943  O  O     . PHE C  2  48   ? 79.981  -31.587 57.723   1.00 36.38  ? 48   PHE C O     1 
ATOM   3944  C  CB    . PHE C  2  48   ? 80.982  -30.469 60.610   1.00 25.94  ? 48   PHE C CB    1 
ATOM   3945  C  CG    . PHE C  2  48   ? 81.539  -29.172 61.119   1.00 20.90  ? 48   PHE C CG    1 
ATOM   3946  C  CD1   . PHE C  2  48   ? 82.057  -28.236 60.243   1.00 19.83  ? 48   PHE C CD1   1 
ATOM   3947  C  CD2   . PHE C  2  48   ? 81.553  -28.894 62.474   1.00 23.12  ? 48   PHE C CD2   1 
ATOM   3948  C  CE1   . PHE C  2  48   ? 82.574  -27.046 60.707   1.00 20.77  ? 48   PHE C CE1   1 
ATOM   3949  C  CE2   . PHE C  2  48   ? 82.071  -27.706 62.946   1.00 23.36  ? 48   PHE C CE2   1 
ATOM   3950  C  CZ    . PHE C  2  48   ? 82.582  -26.779 62.060   1.00 23.31  ? 48   PHE C CZ    1 
ATOM   3951  N  N     . ARG C  2  49   ? 78.853  -32.548 59.416   1.00 27.88  ? 49   ARG C N     1 
ATOM   3952  C  CA    . ARG C  2  49   ? 78.576  -33.779 58.680   1.00 33.51  ? 49   ARG C CA    1 
ATOM   3953  C  C     . ARG C  2  49   ? 77.547  -33.582 57.565   1.00 46.78  ? 49   ARG C C     1 
ATOM   3954  O  O     . ARG C  2  49   ? 77.565  -34.296 56.561   1.00 58.90  ? 49   ARG C O     1 
ATOM   3955  C  CB    . ARG C  2  49   ? 78.108  -34.881 59.632   1.00 36.17  ? 49   ARG C CB    1 
ATOM   3956  C  CG    . ARG C  2  49   ? 79.164  -35.323 60.630   1.00 44.22  ? 49   ARG C CG    1 
ATOM   3957  C  CD    . ARG C  2  49   ? 80.301  -36.074 59.960   1.00 51.54  ? 49   ARG C CD    1 
ATOM   3958  N  NE    . ARG C  2  49   ? 79.944  -37.461 59.683   1.00 71.67  ? 49   ARG C NE    1 
ATOM   3959  C  CZ    . ARG C  2  49   ? 79.466  -37.895 58.521   1.00 87.74  ? 49   ARG C CZ    1 
ATOM   3960  N  NH1   . ARG C  2  49   ? 79.290  -37.050 57.512   1.00 74.74  ? 49   ARG C NH1   1 
ATOM   3961  N  NH2   . ARG C  2  49   ? 79.167  -39.178 58.366   1.00 99.99  ? 49   ARG C NH2   1 
ATOM   3962  N  N     . GLU C  2  50   ? 76.641  -32.627 57.753   1.00 45.51  ? 50   GLU C N     1 
ATOM   3963  C  CA    . GLU C  2  50   ? 75.619  -32.326 56.755   1.00 48.11  ? 50   GLU C CA    1 
ATOM   3964  C  C     . GLU C  2  50   ? 76.159  -31.448 55.631   1.00 43.35  ? 50   GLU C C     1 
ATOM   3965  O  O     . GLU C  2  50   ? 75.870  -31.679 54.458   1.00 52.43  ? 50   GLU C O     1 
ATOM   3966  C  CB    . GLU C  2  50   ? 74.401  -31.657 57.403   1.00 46.50  ? 50   GLU C CB    1 
ATOM   3967  C  CG    . GLU C  2  50   ? 73.501  -32.609 58.177   1.00 51.19  ? 50   GLU C CG    1 
ATOM   3968  C  CD    . GLU C  2  50   ? 72.314  -31.907 58.814   1.00 72.23  ? 50   GLU C CD    1 
ATOM   3969  O  OE1   . GLU C  2  50   ? 71.875  -32.344 59.900   1.00 67.92  ? 50   GLU C OE1   1 
ATOM   3970  O  OE2   . GLU C  2  50   ? 71.820  -30.919 58.229   1.00 83.92  ? 50   GLU C OE2   1 
ATOM   3971  N  N     . THR C  2  51   ? 76.944  -30.442 55.994   1.00 35.24  ? 51   THR C N     1 
ATOM   3972  C  CA    . THR C  2  51   ? 77.485  -29.522 55.004   1.00 39.89  ? 51   THR C CA    1 
ATOM   3973  C  C     . THR C  2  51   ? 78.553  -30.194 54.137   1.00 49.12  ? 51   THR C C     1 
ATOM   3974  O  O     . THR C  2  51   ? 78.515  -30.102 52.908   1.00 46.50  ? 51   THR C O     1 
ATOM   3975  C  CB    . THR C  2  51   ? 78.054  -28.259 55.674   1.00 42.36  ? 51   THR C CB    1 
ATOM   3976  O  OG1   . THR C  2  51   ? 77.002  -27.568 56.359   1.00 44.81  ? 51   THR C OG1   1 
ATOM   3977  C  CG2   . THR C  2  51   ? 78.662  -27.333 54.640   1.00 41.34  ? 51   THR C CG2   1 
ATOM   3978  N  N     . PHE C  2  52   ? 79.500  -30.869 54.785   1.00 49.37  ? 52   PHE C N     1 
ATOM   3979  C  CA    . PHE C  2  52   ? 80.577  -31.575 54.088   1.00 47.06  ? 52   PHE C CA    1 
ATOM   3980  C  C     . PHE C  2  52   ? 80.195  -33.027 53.771   1.00 49.81  ? 52   PHE C C     1 
ATOM   3981  O  O     . PHE C  2  52   ? 79.364  -33.613 54.467   1.00 44.71  ? 52   PHE C O     1 
ATOM   3982  C  CB    . PHE C  2  52   ? 81.854  -31.542 54.931   1.00 40.73  ? 52   PHE C CB    1 
ATOM   3983  C  CG    . PHE C  2  52   ? 82.442  -30.168 55.098   1.00 39.65  ? 52   PHE C CG    1 
ATOM   3984  C  CD1   . PHE C  2  52   ? 83.299  -29.646 54.143   1.00 39.96  ? 52   PHE C CD1   1 
ATOM   3985  C  CD2   . PHE C  2  52   ? 82.146  -29.403 56.213   1.00 36.50  ? 52   PHE C CD2   1 
ATOM   3986  C  CE1   . PHE C  2  52   ? 83.848  -28.385 54.296   1.00 32.26  ? 52   PHE C CE1   1 
ATOM   3987  C  CE2   . PHE C  2  52   ? 82.692  -28.141 56.368   1.00 33.44  ? 52   PHE C CE2   1 
ATOM   3988  C  CZ    . PHE C  2  52   ? 83.543  -27.632 55.407   1.00 26.44  ? 52   PHE C CZ    1 
ATOM   3989  N  N     . PRO C  2  53   ? 80.812  -33.624 52.733   1.00 51.23  ? 53   PRO C N     1 
ATOM   3990  C  CA    . PRO C  2  53   ? 81.838  -33.083 51.829   1.00 52.17  ? 53   PRO C CA    1 
ATOM   3991  C  C     . PRO C  2  53   ? 81.297  -32.155 50.738   1.00 51.30  ? 53   PRO C C     1 
ATOM   3992  O  O     . PRO C  2  53   ? 80.164  -32.313 50.281   1.00 49.73  ? 53   PRO C O     1 
ATOM   3993  C  CB    . PRO C  2  53   ? 82.428  -34.341 51.195   1.00 47.03  ? 53   PRO C CB    1 
ATOM   3994  C  CG    . PRO C  2  53   ? 81.299  -35.295 51.176   1.00 44.31  ? 53   PRO C CG    1 
ATOM   3995  C  CD    . PRO C  2  53   ? 80.527  -35.040 52.439   1.00 42.66  ? 53   PRO C CD    1 
ATOM   3996  N  N     . ILE C  2  54   ? 82.133  -31.209 50.320   1.00 52.31  ? 54   ILE C N     1 
ATOM   3997  C  CA    . ILE C  2  54   ? 81.782  -30.240 49.289   1.00 54.88  ? 54   ILE C CA    1 
ATOM   3998  C  C     . ILE C  2  54   ? 82.442  -30.623 47.968   1.00 64.34  ? 54   ILE C C     1 
ATOM   3999  O  O     . ILE C  2  54   ? 83.668  -30.706 47.885   1.00 65.31  ? 54   ILE C O     1 
ATOM   4000  C  CB    . ILE C  2  54   ? 82.251  -28.827 49.683   1.00 47.95  ? 54   ILE C CB    1 
ATOM   4001  C  CG1   . ILE C  2  54   ? 81.712  -28.452 51.065   1.00 44.80  ? 54   ILE C CG1   1 
ATOM   4002  C  CG2   . ILE C  2  54   ? 81.828  -27.808 48.637   1.00 62.16  ? 54   ILE C CG2   1 
ATOM   4003  C  CD1   . ILE C  2  54   ? 82.124  -27.071 51.523   1.00 50.50  ? 54   ILE C CD1   1 
ATOM   4004  N  N     . GLU C  2  55   ? 81.635  -30.844 46.934   1.00 71.10  ? 55   GLU C N     1 
ATOM   4005  C  CA    . GLU C  2  55   ? 82.160  -31.354 45.670   1.00 72.59  ? 55   GLU C CA    1 
ATOM   4006  C  C     . GLU C  2  55   ? 82.037  -30.369 44.508   1.00 78.43  ? 55   GLU C C     1 
ATOM   4007  O  O     . GLU C  2  55   ? 81.482  -29.279 44.661   1.00 81.95  ? 55   GLU C O     1 
ATOM   4008  C  CB    . GLU C  2  55   ? 81.477  -32.676 45.317   1.00 68.43  ? 55   GLU C CB    1 
ATOM   4009  C  CG    . GLU C  2  55   ? 81.380  -33.637 46.490   1.00 63.92  ? 55   GLU C CG    1 
ATOM   4010  C  CD    . GLU C  2  55   ? 81.078  -35.057 46.062   1.00 80.29  ? 55   GLU C CD    1 
ATOM   4011  O  OE1   . GLU C  2  55   ? 80.768  -35.889 46.942   1.00 71.48  ? 55   GLU C OE1   1 
ATOM   4012  O  OE2   . GLU C  2  55   ? 81.157  -35.342 44.847   1.00 81.52  ? 55   GLU C OE2   1 
ATOM   4013  N  N     . GLU C  2  56   ? 82.552  -30.776 43.349   1.00 78.38  ? 56   GLU C N     1 
ATOM   4014  C  CA    . GLU C  2  56   ? 82.575  -29.943 42.147   1.00 78.14  ? 56   GLU C CA    1 
ATOM   4015  C  C     . GLU C  2  56   ? 83.232  -28.585 42.385   1.00 86.61  ? 56   GLU C C     1 
ATOM   4016  O  O     . GLU C  2  56   ? 83.045  -27.647 41.608   1.00 101.61 ? 56   GLU C O     1 
ATOM   4017  C  CB    . GLU C  2  56   ? 81.164  -29.766 41.581   1.00 85.85  ? 56   GLU C CB    1 
ATOM   4018  C  CG    . GLU C  2  56   ? 80.560  -31.045 41.030   1.00 91.52  ? 56   GLU C CG    1 
ATOM   4019  C  CD    . GLU C  2  56   ? 79.119  -30.865 40.602   1.00 109.06 ? 56   GLU C CD    1 
ATOM   4020  O  OE1   . GLU C  2  56   ? 78.706  -31.509 39.615   1.00 114.66 ? 56   GLU C OE1   1 
ATOM   4021  O  OE2   . GLU C  2  56   ? 78.400  -30.081 41.258   1.00 108.87 ? 56   GLU C OE2   1 
ATOM   4022  N  N     . GLY C  2  63   ? 90.547  -27.424 43.121   1.00 86.22  ? 63   GLY C N     1 
ATOM   4023  C  CA    . GLY C  2  63   ? 90.367  -28.765 43.645   1.00 86.13  ? 63   GLY C CA    1 
ATOM   4024  C  C     . GLY C  2  63   ? 88.921  -29.218 43.605   1.00 80.78  ? 63   GLY C C     1 
ATOM   4025  O  O     . GLY C  2  63   ? 88.005  -28.405 43.723   1.00 91.54  ? 63   GLY C O     1 
ATOM   4026  N  N     . LEU C  2  64   ? 88.715  -30.519 43.430   1.00 74.57  ? 64   LEU C N     1 
ATOM   4027  C  CA    . LEU C  2  64   ? 87.368  -31.070 43.301   1.00 82.83  ? 64   LEU C CA    1 
ATOM   4028  C  C     . LEU C  2  64   ? 86.628  -31.308 44.626   1.00 80.30  ? 64   LEU C C     1 
ATOM   4029  O  O     . LEU C  2  64   ? 85.438  -31.011 44.734   1.00 86.67  ? 64   LEU C O     1 
ATOM   4030  C  CB    . LEU C  2  64   ? 87.387  -32.347 42.452   1.00 81.67  ? 64   LEU C CB    1 
ATOM   4031  C  CG    . LEU C  2  64   ? 87.853  -32.149 41.006   1.00 85.05  ? 64   LEU C CG    1 
ATOM   4032  C  CD1   . LEU C  2  64   ? 87.655  -33.414 40.184   1.00 83.65  ? 64   LEU C CD1   1 
ATOM   4033  C  CD2   . LEU C  2  64   ? 87.137  -30.967 40.362   1.00 78.94  ? 64   LEU C CD2   1 
ATOM   4034  N  N     . VAL C  2  65   ? 87.323  -31.837 45.631   1.00 70.73  ? 65   VAL C N     1 
ATOM   4035  C  CA    . VAL C  2  65   ? 86.658  -32.245 46.871   1.00 60.32  ? 65   VAL C CA    1 
ATOM   4036  C  C     . VAL C  2  65   ? 87.286  -31.683 48.151   1.00 65.16  ? 65   VAL C C     1 
ATOM   4037  O  O     . VAL C  2  65   ? 88.480  -31.855 48.402   1.00 66.28  ? 65   VAL C O     1 
ATOM   4038  C  CB    . VAL C  2  65   ? 86.574  -33.786 46.983   1.00 49.47  ? 65   VAL C CB    1 
ATOM   4039  C  CG1   . VAL C  2  65   ? 86.117  -34.203 48.371   1.00 45.34  ? 65   VAL C CG1   1 
ATOM   4040  C  CG2   . VAL C  2  65   ? 85.642  -34.344 45.923   1.00 52.45  ? 65   VAL C CG2   1 
ATOM   4041  N  N     . LEU C  2  66   ? 86.463  -31.014 48.955   1.00 65.07  ? 66   LEU C N     1 
ATOM   4042  C  CA    . LEU C  2  66   ? 86.859  -30.539 50.277   1.00 52.17  ? 66   LEU C CA    1 
ATOM   4043  C  C     . LEU C  2  66   ? 86.055  -31.297 51.329   1.00 42.70  ? 66   LEU C C     1 
ATOM   4044  O  O     . LEU C  2  66   ? 84.827  -31.305 51.288   1.00 47.23  ? 66   LEU C O     1 
ATOM   4045  C  CB    . LEU C  2  66   ? 86.604  -29.036 50.398   1.00 45.76  ? 66   LEU C CB    1 
ATOM   4046  C  CG    . LEU C  2  66   ? 86.939  -28.367 51.731   1.00 38.90  ? 66   LEU C CG    1 
ATOM   4047  C  CD1   . LEU C  2  66   ? 88.425  -28.469 52.017   1.00 49.72  ? 66   LEU C CD1   1 
ATOM   4048  C  CD2   . LEU C  2  66   ? 86.489  -26.915 51.728   1.00 38.77  ? 66   LEU C CD2   1 
ATOM   4049  N  N     . ASP C  2  67   ? 86.739  -31.934 52.272   1.00 42.75  ? 67   ASP C N     1 
ATOM   4050  C  CA    . ASP C  2  67   ? 86.061  -32.826 53.209   1.00 45.64  ? 67   ASP C CA    1 
ATOM   4051  C  C     . ASP C  2  67   ? 86.327  -32.489 54.677   1.00 44.60  ? 67   ASP C C     1 
ATOM   4052  O  O     . ASP C  2  67   ? 87.349  -31.897 55.015   1.00 52.64  ? 67   ASP C O     1 
ATOM   4053  C  CB    . ASP C  2  67   ? 86.446  -34.279 52.921   1.00 53.79  ? 67   ASP C CB    1 
ATOM   4054  C  CG    . ASP C  2  67   ? 85.596  -35.268 53.690   1.00 65.17  ? 67   ASP C CG    1 
ATOM   4055  O  OD1   . ASP C  2  67   ? 84.439  -34.926 54.022   1.00 58.97  ? 67   ASP C OD1   1 
ATOM   4056  O  OD2   . ASP C  2  67   ? 86.085  -36.385 53.963   1.00 77.51  ? 67   ASP C OD2   1 
ATOM   4057  N  N     . PHE C  2  68   ? 85.397  -32.881 55.542   1.00 39.28  ? 68   PHE C N     1 
ATOM   4058  C  CA    . PHE C  2  68   ? 85.484  -32.589 56.970   1.00 39.88  ? 68   PHE C CA    1 
ATOM   4059  C  C     . PHE C  2  68   ? 86.081  -33.748 57.760   1.00 37.89  ? 68   PHE C C     1 
ATOM   4060  O  O     . PHE C  2  68   ? 85.646  -34.891 57.623   1.00 39.15  ? 68   PHE C O     1 
ATOM   4061  C  CB    . PHE C  2  68   ? 84.095  -32.249 57.514   1.00 35.50  ? 68   PHE C CB    1 
ATOM   4062  C  CG    . PHE C  2  68   ? 84.013  -32.221 59.012   1.00 32.31  ? 68   PHE C CG    1 
ATOM   4063  C  CD1   . PHE C  2  68   ? 84.516  -31.146 59.728   1.00 27.05  ? 68   PHE C CD1   1 
ATOM   4064  C  CD2   . PHE C  2  68   ? 83.411  -33.260 59.705   1.00 29.59  ? 68   PHE C CD2   1 
ATOM   4065  C  CE1   . PHE C  2  68   ? 84.434  -31.116 61.106   1.00 22.61  ? 68   PHE C CE1   1 
ATOM   4066  C  CE2   . PHE C  2  68   ? 83.325  -33.234 61.083   1.00 26.84  ? 68   PHE C CE2   1 
ATOM   4067  C  CZ    . PHE C  2  68   ? 83.836  -32.162 61.785   1.00 24.78  ? 68   PHE C CZ    1 
ATOM   4068  N  N     . LEU C  2  69   ? 87.076  -33.448 58.590   1.00 30.63  ? 69   LEU C N     1 
ATOM   4069  C  CA    . LEU C  2  69   ? 87.706  -34.468 59.423   1.00 32.14  ? 69   LEU C CA    1 
ATOM   4070  C  C     . LEU C  2  69   ? 87.197  -34.399 60.859   1.00 29.55  ? 69   LEU C C     1 
ATOM   4071  O  O     . LEU C  2  69   ? 86.527  -35.315 61.339   1.00 29.06  ? 69   LEU C O     1 
ATOM   4072  C  CB    . LEU C  2  69   ? 89.229  -34.326 59.400   1.00 37.22  ? 69   LEU C CB    1 
ATOM   4073  C  CG    . LEU C  2  69   ? 89.943  -34.646 58.085   1.00 40.27  ? 69   LEU C CG    1 
ATOM   4074  C  CD1   . LEU C  2  69   ? 91.450  -34.559 58.264   1.00 43.18  ? 69   LEU C CD1   1 
ATOM   4075  C  CD2   . LEU C  2  69   ? 89.539  -36.018 57.571   1.00 40.40  ? 69   LEU C CD2   1 
ATOM   4076  N  N     . GLU C  2  70   ? 87.526  -33.308 61.539   1.00 28.74  ? 70   GLU C N     1 
ATOM   4077  C  CA    . GLU C  2  70   ? 87.069  -33.083 62.903   1.00 29.41  ? 70   GLU C CA    1 
ATOM   4078  C  C     . GLU C  2  70   ? 87.132  -31.594 63.210   1.00 25.95  ? 70   GLU C C     1 
ATOM   4079  O  O     . GLU C  2  70   ? 87.598  -30.809 62.389   1.00 29.10  ? 70   GLU C O     1 
ATOM   4080  C  CB    . GLU C  2  70   ? 87.950  -33.851 63.886   1.00 32.84  ? 70   GLU C CB    1 
ATOM   4081  C  CG    . GLU C  2  70   ? 89.404  -33.406 63.874   1.00 37.23  ? 70   GLU C CG    1 
ATOM   4082  C  CD    . GLU C  2  70   ? 90.278  -34.223 64.804   1.00 50.95  ? 70   GLU C CD    1 
ATOM   4083  O  OE1   . GLU C  2  70   ? 91.252  -33.664 65.351   1.00 68.60  ? 70   GLU C OE1   1 
ATOM   4084  O  OE2   . GLU C  2  70   ? 89.996  -35.426 64.985   1.00 53.23  ? 70   GLU C OE2   1 
ATOM   4085  N  N     . TYR C  2  71   ? 86.676  -31.204 64.394   1.00 21.84  ? 71   TYR C N     1 
ATOM   4086  C  CA    . TYR C  2  71   ? 86.762  -29.807 64.802   1.00 21.49  ? 71   TYR C CA    1 
ATOM   4087  C  C     . TYR C  2  71   ? 87.260  -29.719 66.230   1.00 17.09  ? 71   TYR C C     1 
ATOM   4088  O  O     . TYR C  2  71   ? 87.312  -30.723 66.936   1.00 21.87  ? 71   TYR C O     1 
ATOM   4089  C  CB    . TYR C  2  71   ? 85.412  -29.090 64.656   1.00 22.55  ? 71   TYR C CB    1 
ATOM   4090  C  CG    . TYR C  2  71   ? 84.359  -29.489 65.672   1.00 21.65  ? 71   TYR C CG    1 
ATOM   4091  C  CD1   . TYR C  2  71   ? 84.292  -28.871 66.918   1.00 18.74  ? 71   TYR C CD1   1 
ATOM   4092  C  CD2   . TYR C  2  71   ? 83.421  -30.471 65.379   1.00 21.56  ? 71   TYR C CD2   1 
ATOM   4093  C  CE1   . TYR C  2  71   ? 83.333  -29.232 67.847   1.00 17.28  ? 71   TYR C CE1   1 
ATOM   4094  C  CE2   . TYR C  2  71   ? 82.455  -30.835 66.301   1.00 24.00  ? 71   TYR C CE2   1 
ATOM   4095  C  CZ    . TYR C  2  71   ? 82.416  -30.213 67.534   1.00 19.94  ? 71   TYR C CZ    1 
ATOM   4096  O  OH    . TYR C  2  71   ? 81.456  -30.573 68.453   1.00 20.21  ? 71   TYR C OH    1 
ATOM   4097  N  N     . ARG C  2  72   ? 87.633  -28.520 66.654   1.00 13.72  ? 72   ARG C N     1 
ATOM   4098  C  CA    . ARG C  2  72   ? 88.000  -28.323 68.046   1.00 21.46  ? 72   ARG C CA    1 
ATOM   4099  C  C     . ARG C  2  72   ? 87.692  -26.916 68.533   1.00 21.72  ? 72   ARG C C     1 
ATOM   4100  O  O     . ARG C  2  72   ? 87.649  -25.964 67.748   1.00 20.90  ? 72   ARG C O     1 
ATOM   4101  C  CB    . ARG C  2  72   ? 89.474  -28.667 68.288   1.00 28.03  ? 72   ARG C CB    1 
ATOM   4102  C  CG    . ARG C  2  72   ? 90.473  -27.714 67.654   1.00 21.15  ? 72   ARG C CG    1 
ATOM   4103  C  CD    . ARG C  2  72   ? 91.889  -28.042 68.112   1.00 17.83  ? 72   ARG C CD    1 
ATOM   4104  N  NE    . ARG C  2  72   ? 92.884  -27.173 67.494   1.00 20.76  ? 72   ARG C NE    1 
ATOM   4105  C  CZ    . ARG C  2  72   ? 93.317  -26.036 68.029   1.00 23.13  ? 72   ARG C CZ    1 
ATOM   4106  N  NH1   . ARG C  2  72   ? 92.844  -25.629 69.199   1.00 20.25  ? 72   ARG C NH1   1 
ATOM   4107  N  NH2   . ARG C  2  72   ? 94.224  -25.306 67.392   1.00 24.69  ? 72   ARG C NH2   1 
ATOM   4108  N  N     . LEU C  2  73   ? 87.469  -26.804 69.837   1.00 18.72  ? 73   LEU C N     1 
ATOM   4109  C  CA    . LEU C  2  73   ? 87.224  -25.523 70.476   1.00 21.44  ? 73   LEU C CA    1 
ATOM   4110  C  C     . LEU C  2  73   ? 88.383  -25.181 71.403   1.00 20.30  ? 73   LEU C C     1 
ATOM   4111  O  O     . LEU C  2  73   ? 88.775  -25.991 72.244   1.00 26.27  ? 73   LEU C O     1 
ATOM   4112  C  CB    . LEU C  2  73   ? 85.912  -25.566 71.261   1.00 21.87  ? 73   LEU C CB    1 
ATOM   4113  C  CG    . LEU C  2  73   ? 84.644  -25.733 70.424   1.00 18.27  ? 73   LEU C CG    1 
ATOM   4114  C  CD1   . LEU C  2  73   ? 83.442  -26.032 71.310   1.00 19.76  ? 73   LEU C CD1   1 
ATOM   4115  C  CD2   . LEU C  2  73   ? 84.401  -24.487 69.593   1.00 16.38  ? 73   LEU C CD2   1 
ATOM   4116  N  N     . GLY C  2  74   ? 88.934  -23.983 71.244   1.00 17.32  ? 74   GLY C N     1 
ATOM   4117  C  CA    . GLY C  2  74   ? 90.038  -23.544 72.075   1.00 25.43  ? 74   GLY C CA    1 
ATOM   4118  C  C     . GLY C  2  74   ? 89.577  -22.928 73.382   1.00 28.72  ? 74   GLY C C     1 
ATOM   4119  O  O     . GLY C  2  74   ? 88.399  -22.999 73.735   1.00 26.68  ? 74   GLY C O     1 
ATOM   4120  N  N     . GLU C  2  75   ? 90.514  -22.325 74.105   1.00 26.68  ? 75   GLU C N     1 
ATOM   4121  C  CA    . GLU C  2  75   ? 90.195  -21.641 75.349   1.00 29.57  ? 75   GLU C CA    1 
ATOM   4122  C  C     . GLU C  2  75   ? 89.770  -20.205 75.054   1.00 32.10  ? 75   GLU C C     1 
ATOM   4123  O  O     . GLU C  2  75   ? 90.215  -19.614 74.069   1.00 30.67  ? 75   GLU C O     1 
ATOM   4124  C  CB    . GLU C  2  75   ? 91.404  -21.655 76.287   1.00 34.21  ? 75   GLU C CB    1 
ATOM   4125  C  CG    . GLU C  2  75   ? 91.847  -23.044 76.719   1.00 42.88  ? 75   GLU C CG    1 
ATOM   4126  C  CD    . GLU C  2  75   ? 90.894  -23.684 77.713   1.00 59.15  ? 75   GLU C CD    1 
ATOM   4127  O  OE1   . GLU C  2  75   ? 90.761  -24.927 77.693   1.00 60.84  ? 75   GLU C OE1   1 
ATOM   4128  O  OE2   . GLU C  2  75   ? 90.288  -22.944 78.520   1.00 61.11  ? 75   GLU C OE2   1 
ATOM   4129  N  N     . PRO C  2  76   ? 88.893  -19.644 75.902   1.00 26.80  ? 76   PRO C N     1 
ATOM   4130  C  CA    . PRO C  2  76   ? 88.449  -18.254 75.751   1.00 26.45  ? 76   PRO C CA    1 
ATOM   4131  C  C     . PRO C  2  76   ? 89.615  -17.281 75.866   1.00 27.58  ? 76   PRO C C     1 
ATOM   4132  O  O     . PRO C  2  76   ? 90.389  -17.376 76.816   1.00 28.56  ? 76   PRO C O     1 
ATOM   4133  C  CB    . PRO C  2  76   ? 87.505  -18.059 76.940   1.00 28.11  ? 76   PRO C CB    1 
ATOM   4134  C  CG    . PRO C  2  76   ? 87.060  -19.426 77.304   1.00 26.62  ? 76   PRO C CG    1 
ATOM   4135  C  CD    . PRO C  2  76   ? 88.217  -20.322 77.021   1.00 24.32  ? 76   PRO C CD    1 
ATOM   4136  N  N     . PRO C  2  77   ? 89.735  -16.349 74.909   1.00 26.75  ? 77   PRO C N     1 
ATOM   4137  C  CA    . PRO C  2  77   ? 90.816  -15.357 74.929   1.00 33.41  ? 77   PRO C CA    1 
ATOM   4138  C  C     . PRO C  2  77   ? 90.716  -14.414 76.126   1.00 35.17  ? 77   PRO C C     1 
ATOM   4139  O  O     . PRO C  2  77   ? 91.720  -13.824 76.531   1.00 31.59  ? 77   PRO C O     1 
ATOM   4140  C  CB    . PRO C  2  77   ? 90.613  -14.589 73.616   1.00 32.45  ? 77   PRO C CB    1 
ATOM   4141  C  CG    . PRO C  2  77   ? 89.192  -14.826 73.244   1.00 34.69  ? 77   PRO C CG    1 
ATOM   4142  C  CD    . PRO C  2  77   ? 88.878  -16.209 73.721   1.00 29.27  ? 77   PRO C CD    1 
ATOM   4143  N  N     . PHE C  2  78   ? 89.515  -14.272 76.679   1.00 37.32  ? 78   PHE C N     1 
ATOM   4144  C  CA    . PHE C  2  78   ? 89.304  -13.424 77.848   1.00 34.60  ? 78   PHE C CA    1 
ATOM   4145  C  C     . PHE C  2  78   ? 88.280  -14.044 78.794   1.00 35.83  ? 78   PHE C C     1 
ATOM   4146  O  O     . PHE C  2  78   ? 87.323  -14.676 78.347   1.00 37.59  ? 78   PHE C O     1 
ATOM   4147  C  CB    . PHE C  2  78   ? 88.848  -12.028 77.418   1.00 35.83  ? 78   PHE C CB    1 
ATOM   4148  C  CG    . PHE C  2  78   ? 89.752  -11.382 76.410   1.00 35.52  ? 78   PHE C CG    1 
ATOM   4149  C  CD1   . PHE C  2  78   ? 90.906  -10.734 76.812   1.00 33.56  ? 78   PHE C CD1   1 
ATOM   4150  C  CD2   . PHE C  2  78   ? 89.452  -11.431 75.060   1.00 32.80  ? 78   PHE C CD2   1 
ATOM   4151  C  CE1   . PHE C  2  78   ? 91.740  -10.142 75.889   1.00 35.89  ? 78   PHE C CE1   1 
ATOM   4152  C  CE2   . PHE C  2  78   ? 90.283  -10.841 74.131   1.00 38.12  ? 78   PHE C CE2   1 
ATOM   4153  C  CZ    . PHE C  2  78   ? 91.429  -10.195 74.547   1.00 38.36  ? 78   PHE C CZ    1 
ATOM   4154  N  N     . PRO C  2  79   ? 88.480  -13.861 80.110   1.00 40.24  ? 79   PRO C N     1 
ATOM   4155  C  CA    . PRO C  2  79   ? 87.561  -14.355 81.144   1.00 38.16  ? 79   PRO C CA    1 
ATOM   4156  C  C     . PRO C  2  79   ? 86.239  -13.589 81.149   1.00 38.42  ? 79   PRO C C     1 
ATOM   4157  O  O     . PRO C  2  79   ? 86.145  -12.532 80.522   1.00 38.64  ? 79   PRO C O     1 
ATOM   4158  C  CB    . PRO C  2  79   ? 88.330  -14.107 82.443   1.00 36.55  ? 79   PRO C CB    1 
ATOM   4159  C  CG    . PRO C  2  79   ? 89.255  -12.989 82.124   1.00 36.94  ? 79   PRO C CG    1 
ATOM   4160  C  CD    . PRO C  2  79   ? 89.659  -13.200 80.697   1.00 39.25  ? 79   PRO C CD    1 
ATOM   4161  N  N     . GLN C  2  80   ? 85.233  -14.132 81.832   1.00 33.71  ? 80   GLN C N     1 
ATOM   4162  C  CA    . GLN C  2  80   ? 83.896  -13.540 81.857   1.00 36.52  ? 80   GLN C CA    1 
ATOM   4163  C  C     . GLN C  2  80   ? 83.885  -12.074 82.302   1.00 44.75  ? 80   GLN C C     1 
ATOM   4164  O  O     . GLN C  2  80   ? 83.369  -11.203 81.594   1.00 40.93  ? 80   GLN C O     1 
ATOM   4165  C  CB    . GLN C  2  80   ? 82.967  -14.355 82.762   1.00 34.32  ? 80   GLN C CB    1 
ATOM   4166  C  CG    . GLN C  2  80   ? 82.825  -15.819 82.377   1.00 34.09  ? 80   GLN C CG    1 
ATOM   4167  C  CD    . GLN C  2  80   ? 81.761  -16.537 83.196   1.00 43.80  ? 80   GLN C CD    1 
ATOM   4168  O  OE1   . GLN C  2  80   ? 80.886  -15.903 83.792   1.00 41.04  ? 80   GLN C OE1   1 
ATOM   4169  N  NE2   . GLN C  2  80   ? 81.834  -17.865 83.231   1.00 36.27  ? 80   GLN C NE2   1 
ATOM   4170  N  N     . ASP C  2  81   ? 84.453  -11.807 83.474   1.00 49.22  ? 81   ASP C N     1 
ATOM   4171  C  CA    . ASP C  2  81   ? 84.432  -10.465 84.050   1.00 50.91  ? 81   ASP C CA    1 
ATOM   4172  C  C     . ASP C  2  81   ? 85.091  -9.446  83.126   1.00 44.83  ? 81   ASP C C     1 
ATOM   4173  O  O     . ASP C  2  81   ? 84.581  -8.336  82.934   1.00 47.10  ? 81   ASP C O     1 
ATOM   4174  C  CB    . ASP C  2  81   ? 85.101  -10.463 85.427   1.00 57.27  ? 81   ASP C CB    1 
ATOM   4175  C  CG    . ASP C  2  81   ? 84.317  -11.262 86.458   1.00 76.76  ? 81   ASP C CG    1 
ATOM   4176  O  OD1   . ASP C  2  81   ? 83.068  -11.264 86.395   1.00 69.83  ? 81   ASP C OD1   1 
ATOM   4177  O  OD2   . ASP C  2  81   ? 84.950  -11.888 87.335   1.00 91.62  ? 81   ASP C OD2   1 
ATOM   4178  N  N     . GLU C  2  82   ? 86.219  -9.834  82.544   1.00 39.19  ? 82   GLU C N     1 
ATOM   4179  C  CA    . GLU C  2  82   ? 86.900  -8.982  81.585   1.00 40.10  ? 82   GLU C CA    1 
ATOM   4180  C  C     . GLU C  2  82   ? 86.024  -8.745  80.359   1.00 42.30  ? 82   GLU C C     1 
ATOM   4181  O  O     . GLU C  2  82   ? 86.018  -7.652  79.794   1.00 46.86  ? 82   GLU C O     1 
ATOM   4182  C  CB    . GLU C  2  82   ? 88.238  -9.593  81.175   1.00 37.64  ? 82   GLU C CB    1 
ATOM   4183  C  CG    . GLU C  2  82   ? 89.013  -8.745  80.183   1.00 47.62  ? 82   GLU C CG    1 
ATOM   4184  C  CD    . GLU C  2  82   ? 90.461  -9.167  80.065   1.00 61.42  ? 82   GLU C CD    1 
ATOM   4185  O  OE1   . GLU C  2  82   ? 90.910  -9.988  80.895   1.00 61.45  ? 82   GLU C OE1   1 
ATOM   4186  O  OE2   . GLU C  2  82   ? 91.150  -8.676  79.145   1.00 66.65  ? 82   GLU C OE2   1 
ATOM   4187  N  N     . CYS C  2  83   ? 85.278  -9.769  79.956   1.00 41.69  ? 83   CYS C N     1 
ATOM   4188  C  CA    . CYS C  2  83   ? 84.372  -9.636  78.821   1.00 40.57  ? 83   CYS C CA    1 
ATOM   4189  C  C     . CYS C  2  83   ? 83.266  -8.632  79.108   1.00 42.75  ? 83   CYS C C     1 
ATOM   4190  O  O     . CYS C  2  83   ? 82.876  -7.867  78.228   1.00 44.60  ? 83   CYS C O     1 
ATOM   4191  C  CB    . CYS C  2  83   ? 83.773  -10.986 78.429   1.00 34.40  ? 83   CYS C CB    1 
ATOM   4192  S  SG    . CYS C  2  83   ? 84.724  -11.870 77.181   1.00 45.84  ? 83   CYS C SG    1 
ATOM   4193  N  N     . ARG C  2  84   ? 82.764  -8.635  80.339   1.00 49.29  ? 84   ARG C N     1 
ATOM   4194  C  CA    . ARG C  2  84   ? 81.754  -7.657  80.735   1.00 51.33  ? 84   ARG C CA    1 
ATOM   4195  C  C     . ARG C  2  84   ? 82.349  -6.251  80.790   1.00 43.49  ? 84   ARG C C     1 
ATOM   4196  O  O     . ARG C  2  84   ? 81.690  -5.273  80.430   1.00 34.01  ? 84   ARG C O     1 
ATOM   4197  C  CB    . ARG C  2  84   ? 81.119  -8.031  82.077   1.00 46.11  ? 84   ARG C CB    1 
ATOM   4198  C  CG    . ARG C  2  84   ? 80.306  -9.316  82.037   1.00 39.20  ? 84   ARG C CG    1 
ATOM   4199  C  CD    . ARG C  2  84   ? 79.542  -9.527  83.333   1.00 44.89  ? 84   ARG C CD    1 
ATOM   4200  N  NE    . ARG C  2  84   ? 78.792  -10.781 83.334   1.00 40.34  ? 84   ARG C NE    1 
ATOM   4201  C  CZ    . ARG C  2  84   ? 79.215  -11.905 83.904   1.00 42.22  ? 84   ARG C CZ    1 
ATOM   4202  N  NH1   . ARG C  2  84   ? 80.387  -11.937 84.526   1.00 39.05  ? 84   ARG C NH1   1 
ATOM   4203  N  NH2   . ARG C  2  84   ? 78.463  -12.999 83.855   1.00 39.94  ? 84   ARG C NH2   1 
ATOM   4204  N  N     . GLU C  2  85   ? 83.602  -6.157  81.227   1.00 42.59  ? 85   GLU C N     1 
ATOM   4205  C  CA    . GLU C  2  85   ? 84.285  -4.868  81.309   1.00 43.61  ? 85   GLU C CA    1 
ATOM   4206  C  C     . GLU C  2  85   ? 84.490  -4.198  79.952   1.00 45.86  ? 85   GLU C C     1 
ATOM   4207  O  O     . GLU C  2  85   ? 84.105  -3.046  79.756   1.00 47.00  ? 85   GLU C O     1 
ATOM   4208  C  CB    . GLU C  2  85   ? 85.634  -5.016  82.017   1.00 44.00  ? 85   GLU C CB    1 
ATOM   4209  C  CG    . GLU C  2  85   ? 85.586  -4.717  83.505   1.00 60.77  ? 85   GLU C CG    1 
ATOM   4210  C  CD    . GLU C  2  85   ? 85.213  -3.271  83.799   1.00 71.51  ? 85   GLU C CD    1 
ATOM   4211  O  OE1   . GLU C  2  85   ? 84.725  -2.998  84.918   1.00 60.28  ? 85   GLU C OE1   1 
ATOM   4212  O  OE2   . GLU C  2  85   ? 85.411  -2.407  82.916   1.00 66.23  ? 85   GLU C OE2   1 
ATOM   4213  N  N     . LYS C  2  86   ? 85.093  -4.929  79.021   1.00 45.66  ? 86   LYS C N     1 
ATOM   4214  C  CA    . LYS C  2  86   ? 85.506  -4.369  77.737   1.00 39.70  ? 86   LYS C CA    1 
ATOM   4215  C  C     . LYS C  2  86   ? 84.444  -4.484  76.645   1.00 38.80  ? 86   LYS C C     1 
ATOM   4216  O  O     . LYS C  2  86   ? 84.713  -4.175  75.482   1.00 38.34  ? 86   LYS C O     1 
ATOM   4217  C  CB    . LYS C  2  86   ? 86.806  -5.022  77.262   1.00 44.54  ? 86   LYS C CB    1 
ATOM   4218  C  CG    . LYS C  2  86   ? 87.986  -4.847  78.209   1.00 43.21  ? 86   LYS C CG    1 
ATOM   4219  C  CD    . LYS C  2  86   ? 89.229  -5.514  77.642   1.00 50.42  ? 86   LYS C CD    1 
ATOM   4220  C  CE    . LYS C  2  86   ? 90.418  -5.385  78.578   1.00 57.41  ? 86   LYS C CE    1 
ATOM   4221  N  NZ    . LYS C  2  86   ? 91.649  -5.976  77.978   1.00 57.73  ? 86   LYS C NZ    1 
ATOM   4222  N  N     . ASP C  2  87   ? 83.254  -4.946  77.020   1.00 39.15  ? 87   ASP C N     1 
ATOM   4223  C  CA    . ASP C  2  87   ? 82.160  -5.163  76.069   1.00 42.97  ? 87   ASP C CA    1 
ATOM   4224  C  C     . ASP C  2  87   ? 82.541  -6.161  74.976   1.00 36.74  ? 87   ASP C C     1 
ATOM   4225  O  O     . ASP C  2  87   ? 82.371  -5.899  73.785   1.00 34.69  ? 87   ASP C O     1 
ATOM   4226  C  CB    . ASP C  2  87   ? 81.672  -3.839  75.460   1.00 48.05  ? 87   ASP C CB    1 
ATOM   4227  C  CG    . ASP C  2  87   ? 80.800  -3.036  76.418   1.00 61.38  ? 87   ASP C CG    1 
ATOM   4228  O  OD1   . ASP C  2  87   ? 80.862  -3.284  77.644   1.00 58.38  ? 87   ASP C OD1   1 
ATOM   4229  O  OD2   . ASP C  2  87   ? 80.052  -2.154  75.943   1.00 60.34  ? 87   ASP C OD2   1 
ATOM   4230  N  N     . LEU C  2  88   ? 83.058  -7.308  75.403   1.00 40.90  ? 88   LEU C N     1 
ATOM   4231  C  CA    . LEU C  2  88   ? 83.445  -8.381  74.498   1.00 34.21  ? 88   LEU C CA    1 
ATOM   4232  C  C     . LEU C  2  88   ? 82.517  -9.572  74.680   1.00 30.14  ? 88   LEU C C     1 
ATOM   4233  O  O     . LEU C  2  88   ? 81.972  -9.783  75.761   1.00 36.46  ? 88   LEU C O     1 
ATOM   4234  C  CB    . LEU C  2  88   ? 84.883  -8.818  74.777   1.00 30.60  ? 88   LEU C CB    1 
ATOM   4235  C  CG    . LEU C  2  88   ? 85.947  -7.723  74.746   1.00 41.36  ? 88   LEU C CG    1 
ATOM   4236  C  CD1   . LEU C  2  88   ? 87.312  -8.303  75.084   1.00 42.09  ? 88   LEU C CD1   1 
ATOM   4237  C  CD2   . LEU C  2  88   ? 85.966  -7.032  73.390   1.00 43.42  ? 88   LEU C CD2   1 
ATOM   4238  N  N     . THR C  2  89   ? 82.336  -10.347 73.618   1.00 23.37  ? 89   THR C N     1 
ATOM   4239  C  CA    . THR C  2  89   ? 81.542  -11.564 73.691   1.00 20.35  ? 89   THR C CA    1 
ATOM   4240  C  C     . THR C  2  89   ? 82.364  -12.689 74.306   1.00 18.29  ? 89   THR C C     1 
ATOM   4241  O  O     . THR C  2  89   ? 83.504  -12.915 73.908   1.00 16.52  ? 89   THR C O     1 
ATOM   4242  C  CB    . THR C  2  89   ? 81.055  -11.991 72.296   1.00 22.42  ? 89   THR C CB    1 
ATOM   4243  O  OG1   . THR C  2  89   ? 80.147  -11.007 71.787   1.00 24.70  ? 89   THR C OG1   1 
ATOM   4244  C  CG2   . THR C  2  89   ? 80.355  -13.341 72.355   1.00 18.74  ? 89   THR C CG2   1 
ATOM   4245  N  N     . TYR C  2  90   ? 81.787  -13.390 75.278   1.00 20.38  ? 90   TYR C N     1 
ATOM   4246  C  CA    . TYR C  2  90   ? 82.475  -14.515 75.896   1.00 20.88  ? 90   TYR C CA    1 
ATOM   4247  C  C     . TYR C  2  90   ? 82.348  -15.696 74.951   1.00 18.40  ? 90   TYR C C     1 
ATOM   4248  O  O     . TYR C  2  90   ? 81.247  -16.185 74.695   1.00 15.07  ? 90   TYR C O     1 
ATOM   4249  C  CB    . TYR C  2  90   ? 81.850  -14.842 77.252   1.00 19.22  ? 90   TYR C CB    1 
ATOM   4250  C  CG    . TYR C  2  90   ? 82.559  -15.933 78.029   1.00 20.18  ? 90   TYR C CG    1 
ATOM   4251  C  CD1   . TYR C  2  90   ? 83.871  -15.771 78.453   1.00 21.97  ? 90   TYR C CD1   1 
ATOM   4252  C  CD2   . TYR C  2  90   ? 81.906  -17.115 78.357   1.00 18.69  ? 90   TYR C CD2   1 
ATOM   4253  C  CE1   . TYR C  2  90   ? 84.517  -16.761 79.169   1.00 22.02  ? 90   TYR C CE1   1 
ATOM   4254  C  CE2   . TYR C  2  90   ? 82.543  -18.108 79.075   1.00 16.95  ? 90   TYR C CE2   1 
ATOM   4255  C  CZ    . TYR C  2  90   ? 83.848  -17.925 79.478   1.00 21.46  ? 90   TYR C CZ    1 
ATOM   4256  O  OH    . TYR C  2  90   ? 84.490  -18.911 80.193   1.00 25.96  ? 90   TYR C OH    1 
ATOM   4257  N  N     . GLN C  2  91   ? 83.489  -16.159 74.450   1.00 17.32  ? 91   GLN C N     1 
ATOM   4258  C  CA    . GLN C  2  91   ? 83.504  -17.083 73.325   1.00 16.68  ? 91   GLN C CA    1 
ATOM   4259  C  C     . GLN C  2  91   ? 84.808  -17.863 73.218   1.00 18.94  ? 91   GLN C C     1 
ATOM   4260  O  O     . GLN C  2  91   ? 85.826  -17.467 73.785   1.00 24.17  ? 91   GLN C O     1 
ATOM   4261  C  CB    . GLN C  2  91   ? 83.273  -16.306 72.032   1.00 20.64  ? 91   GLN C CB    1 
ATOM   4262  C  CG    . GLN C  2  91   ? 84.278  -15.187 71.819   1.00 24.01  ? 91   GLN C CG    1 
ATOM   4263  C  CD    . GLN C  2  91   ? 83.937  -14.321 70.629   1.00 22.55  ? 91   GLN C CD    1 
ATOM   4264  O  OE1   . GLN C  2  91   ? 82.808  -14.343 70.135   1.00 19.81  ? 91   GLN C OE1   1 
ATOM   4265  N  NE2   . GLN C  2  91   ? 84.917  -13.561 70.150   1.00 24.11  ? 91   GLN C NE2   1 
ATOM   4266  N  N     . ALA C  2  92   ? 84.771  -18.965 72.472   1.00 21.10  ? 92   ALA C N     1 
ATOM   4267  C  CA    . ALA C  2  92   ? 85.959  -19.784 72.238   1.00 22.79  ? 92   ALA C CA    1 
ATOM   4268  C  C     . ALA C  2  92   ? 86.199  -19.979 70.744   1.00 20.52  ? 92   ALA C C     1 
ATOM   4269  O  O     . ALA C  2  92   ? 85.248  -20.103 69.974   1.00 20.03  ? 92   ALA C O     1 
ATOM   4270  C  CB    . ALA C  2  92   ? 85.817  -21.131 72.930   1.00 24.79  ? 92   ALA C CB    1 
ATOM   4271  N  N     . PRO C  2  93   ? 87.475  -20.011 70.330   1.00 21.73  ? 93   PRO C N     1 
ATOM   4272  C  CA    . PRO C  2  93   ? 87.812  -20.175 68.912   1.00 22.11  ? 93   PRO C CA    1 
ATOM   4273  C  C     . PRO C  2  93   ? 87.423  -21.553 68.388   1.00 19.90  ? 93   PRO C C     1 
ATOM   4274  O  O     . PRO C  2  93   ? 87.600  -22.543 69.095   1.00 23.08  ? 93   PRO C O     1 
ATOM   4275  C  CB    . PRO C  2  93   ? 89.336  -20.013 68.896   1.00 20.70  ? 93   PRO C CB    1 
ATOM   4276  C  CG    . PRO C  2  93   ? 89.769  -20.372 70.270   1.00 20.11  ? 93   PRO C CG    1 
ATOM   4277  C  CD    . PRO C  2  93   ? 88.676  -19.892 71.173   1.00 21.74  ? 93   PRO C CD    1 
ATOM   4278  N  N     . LEU C  2  94   ? 86.893  -21.609 67.169   1.00 20.25  ? 94   LEU C N     1 
ATOM   4279  C  CA    . LEU C  2  94   ? 86.496  -22.874 66.554   1.00 20.83  ? 94   LEU C CA    1 
ATOM   4280  C  C     . LEU C  2  94   ? 87.348  -23.198 65.332   1.00 25.60  ? 94   LEU C C     1 
ATOM   4281  O  O     . LEU C  2  94   ? 87.270  -22.511 64.312   1.00 27.89  ? 94   LEU C O     1 
ATOM   4282  C  CB    . LEU C  2  94   ? 85.020  -22.842 66.151   1.00 19.19  ? 94   LEU C CB    1 
ATOM   4283  C  CG    . LEU C  2  94   ? 84.540  -24.022 65.300   1.00 18.51  ? 94   LEU C CG    1 
ATOM   4284  C  CD1   . LEU C  2  94   ? 84.548  -25.317 66.096   1.00 20.60  ? 94   LEU C CD1   1 
ATOM   4285  C  CD2   . LEU C  2  94   ? 83.161  -23.753 64.734   1.00 19.10  ? 94   LEU C CD2   1 
ATOM   4286  N  N     . TYR C  2  95   ? 88.151  -24.252 65.438   1.00 24.01  ? 95   TYR C N     1 
ATOM   4287  C  CA    . TYR C  2  95   ? 89.005  -24.676 64.335   1.00 20.54  ? 95   TYR C CA    1 
ATOM   4288  C  C     . TYR C  2  95   ? 88.411  -25.918 63.684   1.00 20.90  ? 95   TYR C C     1 
ATOM   4289  O  O     . TYR C  2  95   ? 87.796  -26.742 64.359   1.00 24.98  ? 95   TYR C O     1 
ATOM   4290  C  CB    . TYR C  2  95   ? 90.416  -24.991 64.832   1.00 21.24  ? 95   TYR C CB    1 
ATOM   4291  C  CG    . TYR C  2  95   ? 91.121  -23.852 65.534   1.00 19.05  ? 95   TYR C CG    1 
ATOM   4292  C  CD1   . TYR C  2  95   ? 90.932  -23.621 66.890   1.00 18.10  ? 95   TYR C CD1   1 
ATOM   4293  C  CD2   . TYR C  2  95   ? 91.996  -23.024 64.846   1.00 25.89  ? 95   TYR C CD2   1 
ATOM   4294  C  CE1   . TYR C  2  95   ? 91.584  -22.587 67.539   1.00 24.02  ? 95   TYR C CE1   1 
ATOM   4295  C  CE2   . TYR C  2  95   ? 92.655  -21.985 65.485   1.00 31.75  ? 95   TYR C CE2   1 
ATOM   4296  C  CZ    . TYR C  2  95   ? 92.446  -21.771 66.832   1.00 29.09  ? 95   TYR C CZ    1 
ATOM   4297  O  OH    . TYR C  2  95   ? 93.099  -20.739 67.471   1.00 22.95  ? 95   TYR C OH    1 
ATOM   4298  N  N     . ALA C  2  96   ? 88.591  -26.050 62.374   1.00 21.82  ? 96   ALA C N     1 
ATOM   4299  C  CA    . ALA C  2  96   ? 88.075  -27.206 61.649   1.00 21.77  ? 96   ALA C CA    1 
ATOM   4300  C  C     . ALA C  2  96   ? 89.128  -27.816 60.728   1.00 31.61  ? 96   ALA C C     1 
ATOM   4301  O  O     . ALA C  2  96   ? 89.675  -27.139 59.854   1.00 35.63  ? 96   ALA C O     1 
ATOM   4302  C  CB    . ALA C  2  96   ? 86.833  -26.827 60.857   1.00 20.99  ? 96   ALA C CB    1 
ATOM   4303  N  N     . ARG C  2  97   ? 89.408  -29.099 60.932   1.00 32.52  ? 97   ARG C N     1 
ATOM   4304  C  CA    . ARG C  2  97   ? 90.368  -29.816 60.103   1.00 31.83  ? 97   ARG C CA    1 
ATOM   4305  C  C     . ARG C  2  97   ? 89.718  -30.306 58.819   1.00 28.86  ? 97   ARG C C     1 
ATOM   4306  O  O     . ARG C  2  97   ? 88.772  -31.094 58.841   1.00 24.96  ? 97   ARG C O     1 
ATOM   4307  C  CB    . ARG C  2  97   ? 90.978  -30.989 60.871   1.00 31.32  ? 97   ARG C CB    1 
ATOM   4308  C  CG    . ARG C  2  97   ? 91.803  -30.561 62.075   1.00 48.26  ? 97   ARG C CG    1 
ATOM   4309  C  CD    . ARG C  2  97   ? 92.518  -31.737 62.710   1.00 57.35  ? 97   ARG C CD    1 
ATOM   4310  N  NE    . ARG C  2  97   ? 93.242  -32.525 61.717   1.00 68.06  ? 97   ARG C NE    1 
ATOM   4311  C  CZ    . ARG C  2  97   ? 94.086  -33.507 62.014   1.00 77.65  ? 97   ARG C CZ    1 
ATOM   4312  N  NH1   . ARG C  2  97   ? 94.697  -34.174 61.043   1.00 72.03  ? 97   ARG C NH1   1 
ATOM   4313  N  NH2   . ARG C  2  97   ? 94.322  -33.822 63.282   1.00 73.07  ? 97   ARG C NH2   1 
ATOM   4314  N  N     . LEU C  2  98   ? 90.246  -29.835 57.698   1.00 31.75  ? 98   LEU C N     1 
ATOM   4315  C  CA    . LEU C  2  98   ? 89.704  -30.170 56.395   1.00 35.50  ? 98   LEU C CA    1 
ATOM   4316  C  C     . LEU C  2  98   ? 90.814  -30.683 55.485   1.00 48.55  ? 98   LEU C C     1 
ATOM   4317  O  O     . LEU C  2  98   ? 91.986  -30.352 55.678   1.00 58.42  ? 98   LEU C O     1 
ATOM   4318  C  CB    . LEU C  2  98   ? 89.061  -28.933 55.770   1.00 36.94  ? 98   LEU C CB    1 
ATOM   4319  C  CG    . LEU C  2  98   ? 88.126  -28.118 56.665   1.00 32.91  ? 98   LEU C CG    1 
ATOM   4320  C  CD1   . LEU C  2  98   ? 87.630  -26.892 55.921   1.00 34.51  ? 98   LEU C CD1   1 
ATOM   4321  C  CD2   . LEU C  2  98   ? 86.960  -28.968 57.144   1.00 32.57  ? 98   LEU C CD2   1 
ATOM   4322  N  N     . GLN C  2  99   ? 90.448  -31.492 54.497   1.00 48.27  ? 99   GLN C N     1 
ATOM   4323  C  CA    . GLN C  2  99   ? 91.415  -31.949 53.504   1.00 50.89  ? 99   GLN C CA    1 
ATOM   4324  C  C     . GLN C  2  99   ? 90.889  -31.833 52.074   1.00 56.68  ? 99   GLN C C     1 
ATOM   4325  O  O     . GLN C  2  99   ? 89.819  -32.345 51.739   1.00 56.42  ? 99   GLN C O     1 
ATOM   4326  C  CB    . GLN C  2  99   ? 91.897  -33.372 53.805   1.00 54.44  ? 99   GLN C CB    1 
ATOM   4327  C  CG    . GLN C  2  99   ? 90.819  -34.442 53.777   1.00 53.24  ? 99   GLN C CG    1 
ATOM   4328  C  CD    . GLN C  2  99   ? 91.388  -35.836 53.961   1.00 53.53  ? 99   GLN C CD    1 
ATOM   4329  O  OE1   . GLN C  2  99   ? 91.076  -36.753 53.200   1.00 51.45  ? 99   GLN C OE1   1 
ATOM   4330  N  NE2   . GLN C  2  99   ? 92.232  -36.001 54.974   1.00 43.22  ? 99   GLN C NE2   1 
ATOM   4331  N  N     . LEU C  2  100  ? 91.655  -31.138 51.241   1.00 63.83  ? 100  LEU C N     1 
ATOM   4332  C  CA    . LEU C  2  100  ? 91.325  -30.953 49.836   1.00 62.22  ? 100  LEU C CA    1 
ATOM   4333  C  C     . LEU C  2  100  ? 91.847  -32.145 49.041   1.00 63.38  ? 100  LEU C C     1 
ATOM   4334  O  O     . LEU C  2  100  ? 93.004  -32.550 49.197   1.00 69.09  ? 100  LEU C O     1 
ATOM   4335  C  CB    . LEU C  2  100  ? 91.948  -29.650 49.323   1.00 61.39  ? 100  LEU C CB    1 
ATOM   4336  C  CG    . LEU C  2  100  ? 91.365  -28.947 48.092   1.00 59.27  ? 100  LEU C CG    1 
ATOM   4337  C  CD1   . LEU C  2  100  ? 91.907  -27.531 47.998   1.00 67.38  ? 100  LEU C CD1   1 
ATOM   4338  C  CD2   . LEU C  2  100  ? 91.675  -29.706 46.817   1.00 70.94  ? 100  LEU C CD2   1 
ATOM   4339  N  N     . ILE C  2  101  ? 90.984  -32.705 48.198   1.00 64.28  ? 101  ILE C N     1 
ATOM   4340  C  CA    . ILE C  2  101  ? 91.339  -33.848 47.365   1.00 68.79  ? 101  ILE C CA    1 
ATOM   4341  C  C     . ILE C  2  101  ? 90.929  -33.635 45.912   1.00 78.61  ? 101  ILE C C     1 
ATOM   4342  O  O     . ILE C  2  101  ? 89.744  -33.487 45.612   1.00 81.54  ? 101  ILE C O     1 
ATOM   4343  C  CB    . ILE C  2  101  ? 90.658  -35.140 47.859   1.00 62.73  ? 101  ILE C CB    1 
ATOM   4344  C  CG1   . ILE C  2  101  ? 91.067  -35.455 49.299   1.00 67.58  ? 101  ILE C CG1   1 
ATOM   4345  C  CG2   . ILE C  2  101  ? 90.998  -36.304 46.940   1.00 73.12  ? 101  ILE C CG2   1 
ATOM   4346  C  CD1   . ILE C  2  101  ? 90.460  -36.734 49.837   1.00 64.91  ? 101  ILE C CD1   1 
ATOM   4347  N  N     . HIS C  2  102  ? 91.906  -33.622 45.011   1.00 82.64  ? 102  HIS C N     1 
ATOM   4348  C  CA    . HIS C  2  102  ? 91.609  -33.594 43.584   0.50 87.29  ? 102  HIS C CA    1 
ATOM   4349  C  C     . HIS C  2  102  ? 91.416  -35.031 43.114   1.00 94.19  ? 102  HIS C C     1 
ATOM   4350  O  O     . HIS C  2  102  ? 92.273  -35.883 43.347   1.00 96.64  ? 102  HIS C O     1 
ATOM   4351  C  CB    . HIS C  2  102  ? 92.738  -32.914 42.805   0.50 84.21  ? 102  HIS C CB    1 
ATOM   4352  C  CG    . HIS C  2  102  ? 92.362  -32.527 41.410   0.50 87.22  ? 102  HIS C CG    1 
ATOM   4353  N  ND1   . HIS C  2  102  ? 92.542  -33.365 40.327   0.50 92.88  ? 102  HIS C ND1   1 
ATOM   4354  C  CD2   . HIS C  2  102  ? 91.814  -31.393 40.914   0.50 86.16  ? 102  HIS C CD2   1 
ATOM   4355  C  CE1   . HIS C  2  102  ? 92.124  -32.764 39.232   0.50 91.29  ? 102  HIS C CE1   1 
ATOM   4356  N  NE2   . HIS C  2  102  ? 91.675  -31.563 39.560   0.50 86.37  ? 102  HIS C NE2   1 
ATOM   4357  N  N     . LYS C  2  103  ? 90.284  -35.300 42.470   1.00 97.17  ? 103  LYS C N     1 
ATOM   4358  C  CA    . LYS C  2  103  ? 89.929  -36.660 42.068   1.00 102.03 ? 103  LYS C CA    1 
ATOM   4359  C  C     . LYS C  2  103  ? 90.938  -37.271 41.097   1.00 109.00 ? 103  LYS C C     1 
ATOM   4360  O  O     . LYS C  2  103  ? 91.405  -38.394 41.297   1.00 100.44 ? 103  LYS C O     1 
ATOM   4361  C  CB    . LYS C  2  103  ? 88.534  -36.689 41.442   1.00 103.21 ? 103  LYS C CB    1 
ATOM   4362  C  CG    . LYS C  2  103  ? 87.406  -36.296 42.382   1.00 83.80  ? 103  LYS C CG    1 
ATOM   4363  C  CD    . LYS C  2  103  ? 86.063  -36.382 41.673   1.00 69.05  ? 103  LYS C CD    1 
ATOM   4364  C  CE    . LYS C  2  103  ? 84.913  -36.094 42.621   1.00 78.51  ? 103  LYS C CE    1 
ATOM   4365  N  NZ    . LYS C  2  103  ? 83.590  -36.287 41.963   1.00 82.22  ? 103  LYS C NZ    1 
ATOM   4366  N  N     . ASP C  2  104  ? 91.265  -36.526 40.045   1.00 112.93 ? 104  ASP C N     1 
ATOM   4367  C  CA    . ASP C  2  104  ? 92.198  -36.999 39.027   1.00 115.04 ? 104  ASP C CA    1 
ATOM   4368  C  C     . ASP C  2  104  ? 93.625  -37.083 39.563   1.00 117.14 ? 104  ASP C C     1 
ATOM   4369  O  O     . ASP C  2  104  ? 94.272  -38.129 39.478   1.00 120.58 ? 104  ASP C O     1 
ATOM   4370  C  CB    . ASP C  2  104  ? 92.160  -36.081 37.802   1.00 103.63 ? 104  ASP C CB    1 
ATOM   4371  C  CG    . ASP C  2  104  ? 90.789  -36.022 37.157   1.00 107.99 ? 104  ASP C CG    1 
ATOM   4372  O  OD1   . ASP C  2  104  ? 90.096  -37.061 37.133   1.00 116.78 ? 104  ASP C OD1   1 
ATOM   4373  O  OD2   . ASP C  2  104  ? 90.405  -34.936 36.674   1.00 110.88 ? 104  ASP C OD2   1 
ATOM   4374  N  N     . THR C  2  105  ? 94.103  -35.975 40.122   1.00 112.54 ? 105  THR C N     1 
ATOM   4375  C  CA    . THR C  2  105  ? 95.480  -35.868 40.593   1.00 104.21 ? 105  THR C CA    1 
ATOM   4376  C  C     . THR C  2  105  ? 95.779  -36.843 41.729   1.00 103.68 ? 105  THR C C     1 
ATOM   4377  O  O     . THR C  2  105  ? 96.804  -37.526 41.722   1.00 102.94 ? 105  THR C O     1 
ATOM   4378  C  CB    . THR C  2  105  ? 95.796  -34.434 41.071   1.00 93.92  ? 105  THR C CB    1 
ATOM   4379  O  OG1   . THR C  2  105  ? 95.382  -33.489 40.076   1.00 97.42  ? 105  THR C OG1   1 
ATOM   4380  C  CG2   . THR C  2  105  ? 97.282  -34.273 41.328   1.00 85.68  ? 105  THR C CG2   1 
ATOM   4381  N  N     . GLY C  2  106  ? 94.875  -36.906 42.700   1.00 108.46 ? 106  GLY C N     1 
ATOM   4382  C  CA    . GLY C  2  106  ? 95.090  -37.705 43.892   1.00 104.76 ? 106  GLY C CA    1 
ATOM   4383  C  C     . GLY C  2  106  ? 95.750  -36.874 44.976   1.00 98.61  ? 106  GLY C C     1 
ATOM   4384  O  O     . GLY C  2  106  ? 95.925  -37.333 46.106   1.00 84.34  ? 106  GLY C O     1 
ATOM   4385  N  N     . LEU C  2  107  ? 96.113  -35.644 44.621   1.00 101.59 ? 107  LEU C N     1 
ATOM   4386  C  CA    . LEU C  2  107  ? 96.758  -34.716 45.544   1.00 93.49  ? 107  LEU C CA    1 
ATOM   4387  C  C     . LEU C  2  107  ? 95.896  -34.460 46.773   1.00 84.07  ? 107  LEU C C     1 
ATOM   4388  O  O     . LEU C  2  107  ? 94.720  -34.113 46.660   1.00 79.88  ? 107  LEU C O     1 
ATOM   4389  C  CB    . LEU C  2  107  ? 97.067  -33.390 44.843   1.00 89.57  ? 107  LEU C CB    1 
ATOM   4390  C  CG    . LEU C  2  107  ? 97.637  -32.272 45.720   1.00 88.45  ? 107  LEU C CG    1 
ATOM   4391  C  CD1   . LEU C  2  107  ? 98.969  -32.688 46.331   1.00 81.42  ? 107  LEU C CD1   1 
ATOM   4392  C  CD2   . LEU C  2  107  ? 97.780  -30.980 44.926   1.00 92.38  ? 107  LEU C CD2   1 
ATOM   4393  N  N     . ILE C  2  108  ? 96.491  -34.638 47.947   1.00 76.08  ? 108  ILE C N     1 
ATOM   4394  C  CA    . ILE C  2  108  ? 95.783  -34.446 49.204   1.00 69.91  ? 108  ILE C CA    1 
ATOM   4395  C  C     . ILE C  2  108  ? 96.446  -33.357 50.038   1.00 70.44  ? 108  ILE C C     1 
ATOM   4396  O  O     . ILE C  2  108  ? 97.569  -33.526 50.511   1.00 76.27  ? 108  ILE C O     1 
ATOM   4397  C  CB    . ILE C  2  108  ? 95.742  -35.749 50.017   1.00 57.68  ? 108  ILE C CB    1 
ATOM   4398  C  CG1   . ILE C  2  108  ? 95.127  -36.873 49.180   1.00 64.27  ? 108  ILE C CG1   1 
ATOM   4399  C  CG2   . ILE C  2  108  ? 94.971  -35.546 51.311   1.00 55.06  ? 108  ILE C CG2   1 
ATOM   4400  C  CD1   . ILE C  2  108  ? 95.103  -38.213 49.872   1.00 68.53  ? 108  ILE C CD1   1 
ATOM   4401  N  N     . LYS C  2  109  ? 95.749  -32.238 50.214   1.00 67.72  ? 109  LYS C N     1 
ATOM   4402  C  CA    . LYS C  2  109  ? 96.276  -31.137 51.016   1.00 63.26  ? 109  LYS C CA    1 
ATOM   4403  C  C     . LYS C  2  109  ? 95.429  -30.924 52.273   1.00 61.68  ? 109  LYS C C     1 
ATOM   4404  O  O     . LYS C  2  109  ? 94.282  -30.496 52.195   1.00 63.89  ? 109  LYS C O     1 
ATOM   4405  C  CB    . LYS C  2  109  ? 96.370  -29.856 50.177   1.00 60.57  ? 109  LYS C CB    1 
ATOM   4406  C  CG    . LYS C  2  109  ? 96.531  -28.564 50.978   1.00 71.03  ? 109  LYS C CG    1 
ATOM   4407  C  CD    . LYS C  2  109  ? 97.790  -28.558 51.835   1.00 67.15  ? 109  LYS C CD    1 
ATOM   4408  C  CE    . LYS C  2  109  ? 97.791  -27.370 52.788   1.00 53.36  ? 109  LYS C CE    1 
ATOM   4409  N  NZ    . LYS C  2  109  ? 98.860  -27.481 53.817   1.00 50.10  ? 109  LYS C NZ    1 
ATOM   4410  N  N     . GLU C  2  110  ? 96.009  -31.222 53.431   1.00 58.96  ? 110  GLU C N     1 
ATOM   4411  C  CA    . GLU C  2  110  ? 95.279  -31.173 54.695   1.00 53.94  ? 110  GLU C CA    1 
ATOM   4412  C  C     . GLU C  2  110  ? 95.662  -29.951 55.529   1.00 50.95  ? 110  GLU C C     1 
ATOM   4413  O  O     . GLU C  2  110  ? 96.842  -29.619 55.652   1.00 51.27  ? 110  GLU C O     1 
ATOM   4414  C  CB    . GLU C  2  110  ? 95.530  -32.458 55.484   1.00 53.28  ? 110  GLU C CB    1 
ATOM   4415  C  CG    . GLU C  2  110  ? 94.762  -32.571 56.785   1.00 54.62  ? 110  GLU C CG    1 
ATOM   4416  C  CD    . GLU C  2  110  ? 94.953  -33.925 57.445   1.00 64.34  ? 110  GLU C CD    1 
ATOM   4417  O  OE1   . GLU C  2  110  ? 94.693  -34.041 58.662   1.00 61.45  ? 110  GLU C OE1   1 
ATOM   4418  O  OE2   . GLU C  2  110  ? 95.364  -34.876 56.745   1.00 60.87  ? 110  GLU C OE2   1 
ATOM   4419  N  N     . ASP C  2  111  ? 94.662  -29.280 56.094   1.00 50.16  ? 111  ASP C N     1 
ATOM   4420  C  CA    . ASP C  2  111  ? 94.908  -28.078 56.888   1.00 58.86  ? 111  ASP C CA    1 
ATOM   4421  C  C     . ASP C  2  111  ? 93.815  -27.842 57.937   1.00 51.43  ? 111  ASP C C     1 
ATOM   4422  O  O     . ASP C  2  111  ? 92.666  -28.247 57.757   1.00 44.62  ? 111  ASP C O     1 
ATOM   4423  C  CB    . ASP C  2  111  ? 95.043  -26.858 55.964   1.00 62.40  ? 111  ASP C CB    1 
ATOM   4424  C  CG    . ASP C  2  111  ? 95.538  -25.614 56.692   1.00 63.85  ? 111  ASP C CG    1 
ATOM   4425  O  OD1   . ASP C  2  111  ? 96.165  -25.749 57.766   1.00 62.75  ? 111  ASP C OD1   1 
ATOM   4426  O  OD2   . ASP C  2  111  ? 95.302  -24.497 56.182   1.00 58.20  ? 111  ASP C OD2   1 
ATOM   4427  N  N     . GLU C  2  112  ? 94.186  -27.183 59.031   1.00 48.93  ? 112  GLU C N     1 
ATOM   4428  C  CA    . GLU C  2  112  ? 93.234  -26.793 60.065   1.00 34.36  ? 112  GLU C CA    1 
ATOM   4429  C  C     . GLU C  2  112  ? 92.909  -25.314 59.909   1.00 42.22  ? 112  GLU C C     1 
ATOM   4430  O  O     . GLU C  2  112  ? 93.786  -24.462 60.056   1.00 46.10  ? 112  GLU C O     1 
ATOM   4431  C  CB    . GLU C  2  112  ? 93.820  -27.056 61.452   1.00 33.18  ? 112  GLU C CB    1 
ATOM   4432  C  CG    . GLU C  2  112  ? 92.936  -26.602 62.604   1.00 34.18  ? 112  GLU C CG    1 
ATOM   4433  C  CD    . GLU C  2  112  ? 93.585  -26.814 63.964   1.00 37.42  ? 112  GLU C CD    1 
ATOM   4434  O  OE1   . GLU C  2  112  ? 94.392  -25.954 64.382   1.00 33.34  ? 112  GLU C OE1   1 
ATOM   4435  O  OE2   . GLU C  2  112  ? 93.286  -27.840 64.615   1.00 31.41  ? 112  GLU C OE2   1 
ATOM   4436  N  N     . VAL C  2  113  ? 91.647  -25.009 59.618   1.00 37.12  ? 113  VAL C N     1 
ATOM   4437  C  CA    . VAL C  2  113  ? 91.242  -23.635 59.329   1.00 30.15  ? 113  VAL C CA    1 
ATOM   4438  C  C     . VAL C  2  113  ? 90.479  -22.987 60.480   1.00 30.23  ? 113  VAL C C     1 
ATOM   4439  O  O     . VAL C  2  113  ? 89.785  -23.661 61.240   1.00 28.91  ? 113  VAL C O     1 
ATOM   4440  C  CB    . VAL C  2  113  ? 90.392  -23.551 58.052   1.00 30.17  ? 113  VAL C CB    1 
ATOM   4441  C  CG1   . VAL C  2  113  ? 91.214  -23.961 56.845   1.00 41.30  ? 113  VAL C CG1   1 
ATOM   4442  C  CG2   . VAL C  2  113  ? 89.162  -24.426 58.183   1.00 33.80  ? 113  VAL C CG2   1 
ATOM   4443  N  N     . PHE C  2  114  ? 90.626  -21.672 60.605   1.00 36.44  ? 114  PHE C N     1 
ATOM   4444  C  CA    . PHE C  2  114  ? 89.972  -20.917 61.668   1.00 33.40  ? 114  PHE C CA    1 
ATOM   4445  C  C     . PHE C  2  114  ? 88.603  -20.409 61.226   1.00 34.85  ? 114  PHE C C     1 
ATOM   4446  O  O     . PHE C  2  114  ? 88.497  -19.580 60.322   1.00 35.41  ? 114  PHE C O     1 
ATOM   4447  C  CB    . PHE C  2  114  ? 90.853  -19.747 62.104   1.00 34.97  ? 114  PHE C CB    1 
ATOM   4448  C  CG    . PHE C  2  114  ? 90.228  -18.872 63.148   1.00 34.02  ? 114  PHE C CG    1 
ATOM   4449  C  CD1   . PHE C  2  114  ? 90.020  -19.345 64.431   1.00 31.31  ? 114  PHE C CD1   1 
ATOM   4450  C  CD2   . PHE C  2  114  ? 89.859  -17.571 62.849   1.00 38.94  ? 114  PHE C CD2   1 
ATOM   4451  C  CE1   . PHE C  2  114  ? 89.446  -18.541 65.396   1.00 32.81  ? 114  PHE C CE1   1 
ATOM   4452  C  CE2   . PHE C  2  114  ? 89.288  -16.760 63.810   1.00 39.18  ? 114  PHE C CE2   1 
ATOM   4453  C  CZ    . PHE C  2  114  ? 89.084  -17.245 65.086   1.00 36.04  ? 114  PHE C CZ    1 
ATOM   4454  N  N     . LEU C  2  115  ? 87.560  -20.912 61.880   1.00 33.57  ? 115  LEU C N     1 
ATOM   4455  C  CA    . LEU C  2  115  ? 86.185  -20.591 61.513   1.00 30.25  ? 115  LEU C CA    1 
ATOM   4456  C  C     . LEU C  2  115  ? 85.594  -19.440 62.317   1.00 32.04  ? 115  LEU C C     1 
ATOM   4457  O  O     . LEU C  2  115  ? 84.416  -19.127 62.170   1.00 42.27  ? 115  LEU C O     1 
ATOM   4458  C  CB    . LEU C  2  115  ? 85.288  -21.822 61.655   1.00 24.20  ? 115  LEU C CB    1 
ATOM   4459  C  CG    . LEU C  2  115  ? 85.571  -22.991 60.715   1.00 19.85  ? 115  LEU C CG    1 
ATOM   4460  C  CD1   . LEU C  2  115  ? 84.442  -23.999 60.794   1.00 18.75  ? 115  LEU C CD1   1 
ATOM   4461  C  CD2   . LEU C  2  115  ? 85.760  -22.497 59.295   1.00 24.26  ? 115  LEU C CD2   1 
ATOM   4462  N  N     . GLY C  2  116  ? 86.400  -18.815 63.168   1.00 28.59  ? 116  GLY C N     1 
ATOM   4463  C  CA    . GLY C  2  116  ? 85.892  -17.762 64.029   1.00 33.14  ? 116  GLY C CA    1 
ATOM   4464  C  C     . GLY C  2  116  ? 85.622  -18.273 65.430   1.00 31.07  ? 116  GLY C C     1 
ATOM   4465  O  O     . GLY C  2  116  ? 86.110  -19.339 65.807   1.00 30.78  ? 116  GLY C O     1 
ATOM   4466  N  N     . HIS C  2  117  ? 84.847  -17.515 66.202   1.00 27.89  ? 117  HIS C N     1 
ATOM   4467  C  CA    . HIS C  2  117  ? 84.558  -17.871 67.591   1.00 22.86  ? 117  HIS C CA    1 
ATOM   4468  C  C     . HIS C  2  117  ? 83.085  -18.220 67.805   1.00 19.74  ? 117  HIS C C     1 
ATOM   4469  O  O     . HIS C  2  117  ? 82.213  -17.780 67.055   1.00 22.37  ? 117  HIS C O     1 
ATOM   4470  C  CB    . HIS C  2  117  ? 84.927  -16.722 68.529   1.00 25.20  ? 117  HIS C CB    1 
ATOM   4471  C  CG    . HIS C  2  117  ? 86.376  -16.346 68.503   1.00 26.56  ? 117  HIS C CG    1 
ATOM   4472  N  ND1   . HIS C  2  117  ? 87.245  -16.667 69.523   1.00 24.62  ? 117  HIS C ND1   1 
ATOM   4473  C  CD2   . HIS C  2  117  ? 87.101  -15.652 67.594   1.00 29.36  ? 117  HIS C CD2   1 
ATOM   4474  C  CE1   . HIS C  2  117  ? 88.447  -16.199 69.239   1.00 28.67  ? 117  HIS C CE1   1 
ATOM   4475  N  NE2   . HIS C  2  117  ? 88.387  -15.579 68.074   1.00 36.33  ? 117  HIS C NE2   1 
ATOM   4476  N  N     . ILE C  2  118  ? 82.813  -19.012 68.837   1.00 17.21  ? 118  ILE C N     1 
ATOM   4477  C  CA    . ILE C  2  118  ? 81.443  -19.349 69.197   1.00 16.69  ? 118  ILE C CA    1 
ATOM   4478  C  C     . ILE C  2  118  ? 81.193  -18.947 70.642   1.00 16.75  ? 118  ILE C C     1 
ATOM   4479  O  O     . ILE C  2  118  ? 82.029  -19.198 71.510   1.00 18.33  ? 118  ILE C O     1 
ATOM   4480  C  CB    . ILE C  2  118  ? 81.200  -20.868 69.060   1.00 16.31  ? 118  ILE C CB    1 
ATOM   4481  C  CG1   . ILE C  2  118  ? 81.079  -21.263 67.591   1.00 18.19  ? 118  ILE C CG1   1 
ATOM   4482  C  CG2   . ILE C  2  118  ? 79.950  -21.304 69.816   1.00 17.98  ? 118  ILE C CG2   1 
ATOM   4483  C  CD1   . ILE C  2  118  ? 80.645  -22.696 67.395   1.00 21.78  ? 118  ILE C CD1   1 
ATOM   4484  N  N     . PRO C  2  119  ? 80.024  -18.348 70.910   1.00 13.52  ? 119  PRO C N     1 
ATOM   4485  C  CA    . PRO C  2  119  ? 79.648  -17.921 72.258   1.00 13.94  ? 119  PRO C CA    1 
ATOM   4486  C  C     . PRO C  2  119  ? 79.574  -19.097 73.213   1.00 14.48  ? 119  PRO C C     1 
ATOM   4487  O  O     . PRO C  2  119  ? 78.940  -20.102 72.903   1.00 14.51  ? 119  PRO C O     1 
ATOM   4488  C  CB    . PRO C  2  119  ? 78.254  -17.330 72.052   1.00 13.79  ? 119  PRO C CB    1 
ATOM   4489  C  CG    . PRO C  2  119  ? 78.261  -16.858 70.654   1.00 13.12  ? 119  PRO C CG    1 
ATOM   4490  C  CD    . PRO C  2  119  ? 79.068  -17.867 69.901   1.00 14.55  ? 119  PRO C CD    1 
ATOM   4491  N  N     . LEU C  2  120  ? 80.223  -18.965 74.364   1.00 16.18  ? 120  LEU C N     1 
ATOM   4492  C  CA    . LEU C  2  120  ? 80.192  -20.004 75.382   1.00 14.98  ? 120  LEU C CA    1 
ATOM   4493  C  C     . LEU C  2  120  ? 79.138  -19.665 76.417   1.00 14.22  ? 120  LEU C C     1 
ATOM   4494  O  O     . LEU C  2  120  ? 78.939  -18.496 76.748   1.00 17.26  ? 120  LEU C O     1 
ATOM   4495  C  CB    . LEU C  2  120  ? 81.557  -20.138 76.059   1.00 14.44  ? 120  LEU C CB    1 
ATOM   4496  C  CG    . LEU C  2  120  ? 82.732  -20.562 75.177   1.00 11.61  ? 120  LEU C CG    1 
ATOM   4497  C  CD1   . LEU C  2  120  ? 83.989  -20.673 76.010   1.00 10.23  ? 120  LEU C CD1   1 
ATOM   4498  C  CD2   . LEU C  2  120  ? 82.434  -21.875 74.481   1.00 11.60  ? 120  LEU C CD2   1 
ATOM   4499  N  N     . MET C  2  121  ? 78.454  -20.689 76.913   1.00 13.09  ? 121  MET C N     1 
ATOM   4500  C  CA    . MET C  2  121  ? 77.480  -20.504 77.978   1.00 12.85  ? 121  MET C CA    1 
ATOM   4501  C  C     . MET C  2  121  ? 78.217  -20.418 79.308   1.00 13.72  ? 121  MET C C     1 
ATOM   4502  O  O     . MET C  2  121  ? 79.181  -21.147 79.535   1.00 15.28  ? 121  MET C O     1 
ATOM   4503  C  CB    . MET C  2  121  ? 76.471  -21.654 77.992   1.00 11.17  ? 121  MET C CB    1 
ATOM   4504  C  CG    . MET C  2  121  ? 75.431  -21.554 79.093   1.00 13.54  ? 121  MET C CG    1 
ATOM   4505  S  SD    . MET C  2  121  ? 74.221  -22.893 79.073   1.00 10.23  ? 121  MET C SD    1 
ATOM   4506  C  CE    . MET C  2  121  ? 73.225  -22.439 77.657   1.00 11.88  ? 121  MET C CE    1 
ATOM   4507  N  N     . THR C  2  122  ? 77.778  -19.511 80.176   1.00 16.00  ? 122  THR C N     1 
ATOM   4508  C  CA    . THR C  2  122  ? 78.394  -19.363 81.490   1.00 18.88  ? 122  THR C CA    1 
ATOM   4509  C  C     . THR C  2  122  ? 77.911  -20.470 82.415   1.00 16.83  ? 122  THR C C     1 
ATOM   4510  O  O     . THR C  2  122  ? 77.100  -21.306 82.024   1.00 15.83  ? 122  THR C O     1 
ATOM   4511  C  CB    . THR C  2  122  ? 78.085  -17.994 82.125   1.00 19.58  ? 122  THR C CB    1 
ATOM   4512  O  OG1   . THR C  2  122  ? 76.692  -17.919 82.453   1.00 22.59  ? 122  THR C OG1   1 
ATOM   4513  C  CG2   . THR C  2  122  ? 78.453  -16.862 81.171   1.00 14.65  ? 122  THR C CG2   1 
ATOM   4514  N  N     . GLU C  2  123  ? 78.403  -20.471 83.647   1.00 16.92  ? 123  GLU C N     1 
ATOM   4515  C  CA    . GLU C  2  123  ? 78.102  -21.558 84.564   1.00 20.89  ? 123  GLU C CA    1 
ATOM   4516  C  C     . GLU C  2  123  ? 76.626  -21.592 84.957   1.00 21.29  ? 123  GLU C C     1 
ATOM   4517  O  O     . GLU C  2  123  ? 76.090  -22.649 85.284   1.00 21.52  ? 123  GLU C O     1 
ATOM   4518  C  CB    . GLU C  2  123  ? 78.987  -21.465 85.806   1.00 31.14  ? 123  GLU C CB    1 
ATOM   4519  C  CG    . GLU C  2  123  ? 78.999  -22.733 86.645   1.00 44.51  ? 123  GLU C CG    1 
ATOM   4520  C  CD    . GLU C  2  123  ? 79.825  -22.591 87.909   1.00 59.62  ? 123  GLU C CD    1 
ATOM   4521  O  OE1   . GLU C  2  123  ? 79.959  -23.590 88.648   1.00 68.94  ? 123  GLU C OE1   1 
ATOM   4522  O  OE2   . GLU C  2  123  ? 80.336  -21.478 88.164   1.00 54.94  ? 123  GLU C OE2   1 
ATOM   4523  N  N     . ASP C  2  124  ? 75.968  -20.438 84.910   1.00 21.19  ? 124  ASP C N     1 
ATOM   4524  C  CA    . ASP C  2  124  ? 74.584  -20.331 85.365   1.00 23.23  ? 124  ASP C CA    1 
ATOM   4525  C  C     . ASP C  2  124  ? 73.547  -20.503 84.252   1.00 23.50  ? 124  ASP C C     1 
ATOM   4526  O  O     . ASP C  2  124  ? 72.343  -20.458 84.503   1.00 21.68  ? 124  ASP C O     1 
ATOM   4527  C  CB    . ASP C  2  124  ? 74.368  -19.002 86.093   1.00 23.13  ? 124  ASP C CB    1 
ATOM   4528  C  CG    . ASP C  2  124  ? 74.719  -17.805 85.234   1.00 25.72  ? 124  ASP C CG    1 
ATOM   4529  O  OD1   . ASP C  2  124  ? 75.920  -17.466 85.147   1.00 27.23  ? 124  ASP C OD1   1 
ATOM   4530  O  OD2   . ASP C  2  124  ? 73.795  -17.206 84.644   1.00 26.24  ? 124  ASP C OD2   1 
ATOM   4531  N  N     . GLY C  2  125  ? 74.014  -20.699 83.024   1.00 21.66  ? 125  GLY C N     1 
ATOM   4532  C  CA    . GLY C  2  125  ? 73.115  -20.934 81.910   1.00 17.58  ? 125  GLY C CA    1 
ATOM   4533  C  C     . GLY C  2  125  ? 72.860  -19.730 81.020   1.00 16.33  ? 125  GLY C C     1 
ATOM   4534  O  O     . GLY C  2  125  ? 71.969  -19.759 80.170   1.00 14.53  ? 125  GLY C O     1 
ATOM   4535  N  N     . SER C  2  126  ? 73.646  -18.673 81.197   1.00 16.08  ? 126  SER C N     1 
ATOM   4536  C  CA    . SER C  2  126  ? 73.480  -17.472 80.387   1.00 14.25  ? 126  SER C CA    1 
ATOM   4537  C  C     . SER C  2  126  ? 74.661  -17.256 79.447   1.00 16.36  ? 126  SER C C     1 
ATOM   4538  O  O     . SER C  2  126  ? 75.600  -18.050 79.415   1.00 17.68  ? 126  SER C O     1 
ATOM   4539  C  CB    . SER C  2  126  ? 73.294  -16.242 81.277   1.00 15.16  ? 126  SER C CB    1 
ATOM   4540  O  OG    . SER C  2  126  ? 74.488  -15.933 81.972   1.00 17.61  ? 126  SER C OG    1 
ATOM   4541  N  N     . PHE C  2  127  ? 74.595  -16.180 78.672   1.00 17.66  ? 127  PHE C N     1 
ATOM   4542  C  CA    . PHE C  2  127  ? 75.664  -15.811 77.755   1.00 17.04  ? 127  PHE C CA    1 
ATOM   4543  C  C     . PHE C  2  127  ? 76.103  -14.384 78.023   1.00 21.10  ? 127  PHE C C     1 
ATOM   4544  O  O     . PHE C  2  127  ? 75.385  -13.610 78.659   1.00 22.73  ? 127  PHE C O     1 
ATOM   4545  C  CB    . PHE C  2  127  ? 75.198  -15.919 76.302   1.00 13.45  ? 127  PHE C CB    1 
ATOM   4546  C  CG    . PHE C  2  127  ? 75.006  -17.326 75.828   1.00 14.78  ? 127  PHE C CG    1 
ATOM   4547  C  CD1   . PHE C  2  127  ? 76.071  -18.049 75.318   1.00 16.23  ? 127  PHE C CD1   1 
ATOM   4548  C  CD2   . PHE C  2  127  ? 73.760  -17.926 75.884   1.00 14.98  ? 127  PHE C CD2   1 
ATOM   4549  C  CE1   . PHE C  2  127  ? 75.898  -19.346 74.876   1.00 13.92  ? 127  PHE C CE1   1 
ATOM   4550  C  CE2   . PHE C  2  127  ? 73.579  -19.223 75.444   1.00 12.89  ? 127  PHE C CE2   1 
ATOM   4551  C  CZ    . PHE C  2  127  ? 74.649  -19.934 74.940   1.00 13.27  ? 127  PHE C CZ    1 
ATOM   4552  N  N     . ILE C  2  128  ? 77.290  -14.044 77.537   1.00 21.27  ? 128  ILE C N     1 
ATOM   4553  C  CA    . ILE C  2  128  ? 77.748  -12.669 77.560   1.00 16.20  ? 128  ILE C CA    1 
ATOM   4554  C  C     . ILE C  2  128  ? 77.998  -12.246 76.125   1.00 18.05  ? 128  ILE C C     1 
ATOM   4555  O  O     . ILE C  2  128  ? 78.926  -12.731 75.483   1.00 22.07  ? 128  ILE C O     1 
ATOM   4556  C  CB    . ILE C  2  128  ? 79.036  -12.526 78.380   1.00 17.49  ? 128  ILE C CB    1 
ATOM   4557  C  CG1   . ILE C  2  128  ? 78.832  -13.102 79.784   1.00 20.57  ? 128  ILE C CG1   1 
ATOM   4558  C  CG2   . ILE C  2  128  ? 79.462  -11.068 78.449   1.00 26.69  ? 128  ILE C CG2   1 
ATOM   4559  C  CD1   . ILE C  2  128  ? 80.104  -13.242 80.590   1.00 22.31  ? 128  ILE C CD1   1 
ATOM   4560  N  N     . ILE C  2  129  ? 77.159  -11.349 75.622   1.00 21.16  ? 129  ILE C N     1 
ATOM   4561  C  CA    . ILE C  2  129  ? 77.252  -10.893 74.241   1.00 21.45  ? 129  ILE C CA    1 
ATOM   4562  C  C     . ILE C  2  129  ? 77.496  -9.394  74.210   1.00 25.92  ? 129  ILE C C     1 
ATOM   4563  O  O     . ILE C  2  129  ? 76.610  -8.609  74.551   1.00 25.82  ? 129  ILE C O     1 
ATOM   4564  C  CB    . ILE C  2  129  ? 75.957  -11.197 73.468   1.00 22.26  ? 129  ILE C CB    1 
ATOM   4565  C  CG1   . ILE C  2  129  ? 75.649  -12.699 73.498   1.00 19.08  ? 129  ILE C CG1   1 
ATOM   4566  C  CG2   . ILE C  2  129  ? 76.050  -10.679 72.042   1.00 25.66  ? 129  ILE C CG2   1 
ATOM   4567  C  CD1   . ILE C  2  129  ? 76.698  -13.558 72.842   1.00 15.81  ? 129  ILE C CD1   1 
ATOM   4568  N  N     . ASN C  2  130  ? 78.696  -9.009  73.783   1.00 30.49  ? 130  ASN C N     1 
ATOM   4569  C  CA    . ASN C  2  130  ? 79.135  -7.616  73.808   1.00 31.85  ? 130  ASN C CA    1 
ATOM   4570  C  C     . ASN C  2  130  ? 79.053  -6.984  75.195   1.00 31.53  ? 130  ASN C C     1 
ATOM   4571  O  O     . ASN C  2  130  ? 78.737  -5.802  75.330   1.00 33.18  ? 130  ASN C O     1 
ATOM   4572  C  CB    . ASN C  2  130  ? 78.365  -6.780  72.785   1.00 26.52  ? 130  ASN C CB    1 
ATOM   4573  C  CG    . ASN C  2  130  ? 78.675  -7.185  71.362   1.00 34.60  ? 130  ASN C CG    1 
ATOM   4574  O  OD1   . ASN C  2  130  ? 79.837  -7.375  70.998   1.00 32.85  ? 130  ASN C OD1   1 
ATOM   4575  N  ND2   . ASN C  2  130  ? 77.635  -7.333  70.550   1.00 43.47  ? 130  ASN C ND2   1 
ATOM   4576  N  N     . GLY C  2  131  ? 79.336  -7.783  76.219   1.00 26.94  ? 131  GLY C N     1 
ATOM   4577  C  CA    . GLY C  2  131  ? 79.386  -7.294  77.585   1.00 34.30  ? 131  GLY C CA    1 
ATOM   4578  C  C     . GLY C  2  131  ? 78.038  -7.252  78.276   1.00 34.87  ? 131  GLY C C     1 
ATOM   4579  O  O     . GLY C  2  131  ? 77.943  -6.883  79.447   1.00 41.89  ? 131  GLY C O     1 
ATOM   4580  N  N     . ALA C  2  132  ? 76.992  -7.630  77.551   1.00 25.56  ? 132  ALA C N     1 
ATOM   4581  C  CA    . ALA C  2  132  ? 75.648  -7.652  78.112   1.00 25.33  ? 132  ALA C CA    1 
ATOM   4582  C  C     . ALA C  2  132  ? 75.186  -9.086  78.281   1.00 22.45  ? 132  ALA C C     1 
ATOM   4583  O  O     . ALA C  2  132  ? 75.227  -9.865  77.333   1.00 25.58  ? 132  ALA C O     1 
ATOM   4584  C  CB    . ALA C  2  132  ? 74.690  -6.895  77.215   1.00 29.07  ? 132  ALA C CB    1 
ATOM   4585  N  N     . ASP C  2  133  ? 74.746  -9.436  79.485   1.00 20.96  ? 133  ASP C N     1 
ATOM   4586  C  CA    . ASP C  2  133  ? 74.275  -10.793 79.743   1.00 21.17  ? 133  ASP C CA    1 
ATOM   4587  C  C     . ASP C  2  133  ? 72.944  -11.057 79.050   1.00 16.20  ? 133  ASP C C     1 
ATOM   4588  O  O     . ASP C  2  133  ? 72.010  -10.262 79.152   1.00 15.79  ? 133  ASP C O     1 
ATOM   4589  C  CB    . ASP C  2  133  ? 74.152  -11.057 81.244   1.00 29.77  ? 133  ASP C CB    1 
ATOM   4590  C  CG    . ASP C  2  133  ? 75.477  -10.928 81.969   1.00 45.20  ? 133  ASP C CG    1 
ATOM   4591  O  OD1   . ASP C  2  133  ? 76.138  -9.875  81.816   1.00 43.73  ? 133  ASP C OD1   1 
ATOM   4592  O  OD2   . ASP C  2  133  ? 75.859  -11.882 82.684   1.00 45.82  ? 133  ASP C OD2   1 
ATOM   4593  N  N     . ARG C  2  134  ? 72.866  -12.172 78.334   1.00 15.87  ? 134  ARG C N     1 
ATOM   4594  C  CA    . ARG C  2  134  ? 71.651  -12.526 77.608   1.00 15.18  ? 134  ARG C CA    1 
ATOM   4595  C  C     . ARG C  2  134  ? 71.268  -13.989 77.830   1.00 13.07  ? 134  ARG C C     1 
ATOM   4596  O  O     . ARG C  2  134  ? 72.113  -14.827 78.123   1.00 16.58  ? 134  ARG C O     1 
ATOM   4597  C  CB    . ARG C  2  134  ? 71.818  -12.238 76.113   1.00 13.98  ? 134  ARG C CB    1 
ATOM   4598  C  CG    . ARG C  2  134  ? 72.285  -10.823 75.801   1.00 17.18  ? 134  ARG C CG    1 
ATOM   4599  C  CD    . ARG C  2  134  ? 72.428  -10.583 74.306   1.00 17.28  ? 134  ARG C CD    1 
ATOM   4600  N  NE    . ARG C  2  134  ? 71.450  -9.616  73.816   1.00 17.96  ? 134  ARG C NE    1 
ATOM   4601  C  CZ    . ARG C  2  134  ? 70.237  -9.940  73.383   1.00 20.60  ? 134  ARG C CZ    1 
ATOM   4602  N  NH1   . ARG C  2  134  ? 69.854  -11.209 73.377   1.00 22.00  ? 134  ARG C NH1   1 
ATOM   4603  N  NH2   . ARG C  2  134  ? 69.405  -9.000  72.954   1.00 24.17  ? 134  ARG C NH2   1 
ATOM   4604  N  N     . VAL C  2  135  ? 69.984  -14.286 77.692   1.00 9.45   ? 135  VAL C N     1 
ATOM   4605  C  CA    . VAL C  2  135  ? 69.480  -15.638 77.851   1.00 10.37  ? 135  VAL C CA    1 
ATOM   4606  C  C     . VAL C  2  135  ? 68.808  -16.066 76.557   1.00 13.34  ? 135  VAL C C     1 
ATOM   4607  O  O     . VAL C  2  135  ? 68.088  -15.282 75.939   1.00 18.99  ? 135  VAL C O     1 
ATOM   4608  C  CB    . VAL C  2  135  ? 68.468  -15.714 79.014   1.00 10.86  ? 135  VAL C CB    1 
ATOM   4609  C  CG1   . VAL C  2  135  ? 67.619  -16.970 78.926   1.00 10.08  ? 135  VAL C CG1   1 
ATOM   4610  C  CG2   . VAL C  2  135  ? 69.190  -15.643 80.349   1.00 13.07  ? 135  VAL C CG2   1 
ATOM   4611  N  N     . ILE C  2  136  ? 69.058  -17.298 76.130   1.00 11.90  ? 136  ILE C N     1 
ATOM   4612  C  CA    . ILE C  2  136  ? 68.355  -17.840 74.978   1.00 11.01  ? 136  ILE C CA    1 
ATOM   4613  C  C     . ILE C  2  136  ? 67.130  -18.604 75.467   1.00 13.48  ? 136  ILE C C     1 
ATOM   4614  O  O     . ILE C  2  136  ? 67.253  -19.641 76.116   1.00 15.80  ? 136  ILE C O     1 
ATOM   4615  C  CB    . ILE C  2  136  ? 69.250  -18.774 74.152   1.00 11.65  ? 136  ILE C CB    1 
ATOM   4616  C  CG1   . ILE C  2  136  ? 70.482  -18.025 73.644   1.00 11.65  ? 136  ILE C CG1   1 
ATOM   4617  C  CG2   . ILE C  2  136  ? 68.469  -19.364 72.988   1.00 12.18  ? 136  ILE C CG2   1 
ATOM   4618  C  CD1   . ILE C  2  136  ? 70.169  -16.953 72.636   1.00 10.08  ? 136  ILE C CD1   1 
ATOM   4619  N  N     . VAL C  2  137  ? 65.949  -18.083 75.155   1.00 13.09  ? 137  VAL C N     1 
ATOM   4620  C  CA    . VAL C  2  137  ? 64.701  -18.671 75.624   1.00 9.78   ? 137  VAL C CA    1 
ATOM   4621  C  C     . VAL C  2  137  ? 64.263  -19.837 74.748   1.00 10.29  ? 137  VAL C C     1 
ATOM   4622  O  O     . VAL C  2  137  ? 64.236  -19.724 73.524   1.00 11.13  ? 137  VAL C O     1 
ATOM   4623  C  CB    . VAL C  2  137  ? 63.581  -17.622 75.673   1.00 8.83   ? 137  VAL C CB    1 
ATOM   4624  C  CG1   . VAL C  2  137  ? 62.251  -18.277 75.995   1.00 10.89  ? 137  VAL C CG1   1 
ATOM   4625  C  CG2   . VAL C  2  137  ? 63.911  -16.553 76.697   1.00 10.31  ? 137  VAL C CG2   1 
ATOM   4626  N  N     . SER C  2  138  ? 63.923  -20.954 75.386   1.00 13.22  ? 138  SER C N     1 
ATOM   4627  C  CA    . SER C  2  138  ? 63.483  -22.156 74.681   1.00 12.87  ? 138  SER C CA    1 
ATOM   4628  C  C     . SER C  2  138  ? 62.205  -21.891 73.895   1.00 9.90   ? 138  SER C C     1 
ATOM   4629  O  O     . SER C  2  138  ? 61.404  -21.038 74.272   1.00 11.74  ? 138  SER C O     1 
ATOM   4630  C  CB    . SER C  2  138  ? 63.258  -23.299 75.671   1.00 11.45  ? 138  SER C CB    1 
ATOM   4631  O  OG    . SER C  2  138  ? 64.321  -23.378 76.605   1.00 14.12  ? 138  SER C OG    1 
ATOM   4632  N  N     . GLN C  2  139  ? 62.016  -22.621 72.803   1.00 8.75   ? 139  GLN C N     1 
ATOM   4633  C  CA    . GLN C  2  139  ? 60.873  -22.382 71.933   1.00 12.00  ? 139  GLN C CA    1 
ATOM   4634  C  C     . GLN C  2  139  ? 60.023  -23.629 71.707   1.00 12.86  ? 139  GLN C C     1 
ATOM   4635  O  O     . GLN C  2  139  ? 60.494  -24.608 71.144   1.00 13.54  ? 139  GLN C O     1 
ATOM   4636  C  CB    . GLN C  2  139  ? 61.344  -21.829 70.588   1.00 11.34  ? 139  GLN C CB    1 
ATOM   4637  C  CG    . GLN C  2  139  ? 60.236  -21.670 69.567   1.00 11.94  ? 139  GLN C CG    1 
ATOM   4638  C  CD    . GLN C  2  139  ? 60.751  -21.217 68.220   1.00 19.27  ? 139  GLN C CD    1 
ATOM   4639  O  OE1   . GLN C  2  139  ? 61.733  -21.751 67.708   1.00 22.83  ? 139  GLN C OE1   1 
ATOM   4640  N  NE2   . GLN C  2  139  ? 60.093  -20.222 67.640   1.00 32.34  ? 139  GLN C NE2   1 
ATOM   4641  N  N     . ILE C  2  140  ? 58.764  -23.588 72.130   1.00 12.75  ? 140  ILE C N     1 
ATOM   4642  C  CA    . ILE C  2  140  ? 57.853  -24.702 71.882   1.00 13.10  ? 140  ILE C CA    1 
ATOM   4643  C  C     . ILE C  2  140  ? 57.252  -24.621 70.476   1.00 13.97  ? 140  ILE C C     1 
ATOM   4644  O  O     . ILE C  2  140  ? 56.844  -23.550 70.023   1.00 16.19  ? 140  ILE C O     1 
ATOM   4645  C  CB    . ILE C  2  140  ? 56.734  -24.782 72.955   1.00 12.99  ? 140  ILE C CB    1 
ATOM   4646  C  CG1   . ILE C  2  140  ? 55.885  -26.043 72.765   1.00 10.85  ? 140  ILE C CG1   1 
ATOM   4647  C  CG2   . ILE C  2  140  ? 55.872  -23.525 72.946   1.00 13.87  ? 140  ILE C CG2   1 
ATOM   4648  C  CD1   . ILE C  2  140  ? 54.932  -26.315 73.911   1.00 8.06   ? 140  ILE C CD1   1 
ATOM   4649  N  N     . HIS C  2  141  ? 57.237  -25.747 69.770   1.00 12.25  ? 141  HIS C N     1 
ATOM   4650  C  CA    . HIS C  2  141  ? 56.632  -25.789 68.442   1.00 12.58  ? 141  HIS C CA    1 
ATOM   4651  C  C     . HIS C  2  141  ? 55.997  -27.142 68.141   1.00 14.03  ? 141  HIS C C     1 
ATOM   4652  O  O     . HIS C  2  141  ? 56.192  -28.102 68.886   1.00 15.52  ? 141  HIS C O     1 
ATOM   4653  C  CB    . HIS C  2  141  ? 57.651  -25.429 67.367   1.00 16.49  ? 141  HIS C CB    1 
ATOM   4654  C  CG    . HIS C  2  141  ? 58.651  -26.508 67.097   1.00 16.33  ? 141  HIS C CG    1 
ATOM   4655  N  ND1   . HIS C  2  141  ? 59.155  -26.753 65.843   1.00 18.75  ? 141  HIS C ND1   1 
ATOM   4656  C  CD2   . HIS C  2  141  ? 59.236  -27.405 67.927   1.00 15.21  ? 141  HIS C CD2   1 
ATOM   4657  C  CE1   . HIS C  2  141  ? 60.012  -27.761 65.904   1.00 20.30  ? 141  HIS C CE1   1 
ATOM   4658  N  NE2   . HIS C  2  141  ? 60.078  -28.171 67.156   1.00 19.47  ? 141  HIS C NE2   1 
ATOM   4659  N  N     . ARG C  2  142  ? 55.217  -27.202 67.064   1.00 16.50  ? 142  ARG C N     1 
ATOM   4660  C  CA    . ARG C  2  142  ? 54.657  -28.465 66.591   1.00 19.24  ? 142  ARG C CA    1 
ATOM   4661  C  C     . ARG C  2  142  ? 55.762  -29.443 66.217   1.00 22.74  ? 142  ARG C C     1 
ATOM   4662  O  O     . ARG C  2  142  ? 56.633  -29.130 65.402   1.00 25.15  ? 142  ARG C O     1 
ATOM   4663  C  CB    . ARG C  2  142  ? 53.756  -28.244 65.375   1.00 24.06  ? 142  ARG C CB    1 
ATOM   4664  C  CG    . ARG C  2  142  ? 52.504  -27.434 65.647   1.00 43.11  ? 142  ARG C CG    1 
ATOM   4665  C  CD    . ARG C  2  142  ? 51.564  -27.496 64.456   1.00 50.61  ? 142  ARG C CD    1 
ATOM   4666  N  NE    . ARG C  2  142  ? 51.062  -28.850 64.237   1.00 55.99  ? 142  ARG C NE    1 
ATOM   4667  C  CZ    . ARG C  2  142  ? 50.366  -29.227 63.170   1.00 49.29  ? 142  ARG C CZ    1 
ATOM   4668  N  NH1   . ARG C  2  142  ? 50.092  -28.350 62.213   1.00 48.37  ? 142  ARG C NH1   1 
ATOM   4669  N  NH2   . ARG C  2  142  ? 49.947  -30.481 63.058   1.00 32.99  ? 142  ARG C NH2   1 
ATOM   4670  N  N     . SER C  2  143  ? 55.714  -30.632 66.805   1.00 24.75  ? 143  SER C N     1 
ATOM   4671  C  CA    . SER C  2  143  ? 56.713  -31.657 66.541   1.00 22.79  ? 143  SER C CA    1 
ATOM   4672  C  C     . SER C  2  143  ? 56.598  -32.166 65.117   1.00 23.63  ? 143  SER C C     1 
ATOM   4673  O  O     . SER C  2  143  ? 55.497  -32.283 64.585   1.00 25.50  ? 143  SER C O     1 
ATOM   4674  C  CB    . SER C  2  143  ? 56.555  -32.825 67.514   1.00 23.57  ? 143  SER C CB    1 
ATOM   4675  O  OG    . SER C  2  143  ? 57.218  -33.980 67.027   1.00 24.11  ? 143  SER C OG    1 
ATOM   4676  N  N     . PRO C  2  144  ? 57.744  -32.459 64.490   1.00 26.93  ? 144  PRO C N     1 
ATOM   4677  C  CA    . PRO C  2  144  ? 57.745  -33.106 63.178   1.00 26.72  ? 144  PRO C CA    1 
ATOM   4678  C  C     . PRO C  2  144  ? 57.064  -34.463 63.264   1.00 28.57  ? 144  PRO C C     1 
ATOM   4679  O  O     . PRO C  2  144  ? 56.993  -35.041 64.348   1.00 34.03  ? 144  PRO C O     1 
ATOM   4680  C  CB    . PRO C  2  144  ? 59.235  -33.282 62.881   1.00 28.59  ? 144  PRO C CB    1 
ATOM   4681  C  CG    . PRO C  2  144  ? 59.901  -32.213 63.667   1.00 31.72  ? 144  PRO C CG    1 
ATOM   4682  C  CD    . PRO C  2  144  ? 59.099  -32.085 64.925   1.00 28.11  ? 144  PRO C CD    1 
ATOM   4683  N  N     . GLY C  2  145  ? 56.551  -34.952 62.142   1.00 27.80  ? 145  GLY C N     1 
ATOM   4684  C  CA    . GLY C  2  145  ? 55.904  -36.248 62.099   1.00 28.30  ? 145  GLY C CA    1 
ATOM   4685  C  C     . GLY C  2  145  ? 54.781  -36.256 61.086   1.00 27.66  ? 145  GLY C C     1 
ATOM   4686  O  O     . GLY C  2  145  ? 54.681  -35.357 60.249   1.00 26.27  ? 145  GLY C O     1 
ATOM   4687  N  N     . VAL C  2  146  ? 53.937  -37.280 61.160   1.00 29.07  ? 146  VAL C N     1 
ATOM   4688  C  CA    . VAL C  2  146  ? 52.751  -37.357 60.318   1.00 29.33  ? 146  VAL C CA    1 
ATOM   4689  C  C     . VAL C  2  146  ? 51.503  -37.294 61.188   1.00 29.46  ? 146  VAL C C     1 
ATOM   4690  O  O     . VAL C  2  146  ? 51.356  -38.067 62.135   1.00 27.03  ? 146  VAL C O     1 
ATOM   4691  C  CB    . VAL C  2  146  ? 52.733  -38.639 59.463   1.00 30.08  ? 146  VAL C CB    1 
ATOM   4692  C  CG1   . VAL C  2  146  ? 51.377  -38.820 58.807   1.00 32.29  ? 146  VAL C CG1   1 
ATOM   4693  C  CG2   . VAL C  2  146  ? 53.832  -38.590 58.413   1.00 28.41  ? 146  VAL C CG2   1 
ATOM   4694  N  N     . TYR C  2  147  ? 50.614  -36.360 60.863   1.00 30.75  ? 147  TYR C N     1 
ATOM   4695  C  CA    . TYR C  2  147  ? 49.414  -36.123 61.651   1.00 30.76  ? 147  TYR C CA    1 
ATOM   4696  C  C     . TYR C  2  147  ? 48.180  -36.301 60.789   1.00 27.50  ? 147  TYR C C     1 
ATOM   4697  O  O     . TYR C  2  147  ? 48.259  -36.242 59.566   1.00 27.29  ? 147  TYR C O     1 
ATOM   4698  C  CB    . TYR C  2  147  ? 49.428  -34.707 62.229   1.00 34.23  ? 147  TYR C CB    1 
ATOM   4699  C  CG    . TYR C  2  147  ? 50.569  -34.434 63.181   1.00 30.42  ? 147  TYR C CG    1 
ATOM   4700  C  CD1   . TYR C  2  147  ? 51.833  -34.107 62.706   1.00 24.76  ? 147  TYR C CD1   1 
ATOM   4701  C  CD2   . TYR C  2  147  ? 50.380  -34.495 64.554   1.00 29.96  ? 147  TYR C CD2   1 
ATOM   4702  C  CE1   . TYR C  2  147  ? 52.875  -33.858 63.571   1.00 26.13  ? 147  TYR C CE1   1 
ATOM   4703  C  CE2   . TYR C  2  147  ? 51.416  -34.246 65.427   1.00 28.43  ? 147  TYR C CE2   1 
ATOM   4704  C  CZ    . TYR C  2  147  ? 52.661  -33.928 64.932   1.00 29.38  ? 147  TYR C CZ    1 
ATOM   4705  O  OH    . TYR C  2  147  ? 53.695  -33.677 65.804   1.00 35.31  ? 147  TYR C OH    1 
ATOM   4706  N  N     . PHE C  2  148  ? 47.040  -36.527 61.432   1.00 27.22  ? 148  PHE C N     1 
ATOM   4707  C  CA    . PHE C  2  148  ? 45.773  -36.623 60.719   1.00 32.64  ? 148  PHE C CA    1 
ATOM   4708  C  C     . PHE C  2  148  ? 44.726  -35.779 61.429   1.00 35.75  ? 148  PHE C C     1 
ATOM   4709  O  O     . PHE C  2  148  ? 44.396  -36.030 62.588   1.00 36.52  ? 148  PHE C O     1 
ATOM   4710  C  CB    . PHE C  2  148  ? 45.316  -38.080 60.611   1.00 36.17  ? 148  PHE C CB    1 
ATOM   4711  C  CG    . PHE C  2  148  ? 46.266  -38.956 59.843   1.00 35.36  ? 148  PHE C CG    1 
ATOM   4712  C  CD1   . PHE C  2  148  ? 47.340  -39.561 60.479   1.00 35.30  ? 148  PHE C CD1   1 
ATOM   4713  C  CD2   . PHE C  2  148  ? 46.089  -39.172 58.486   1.00 33.42  ? 148  PHE C CD2   1 
ATOM   4714  C  CE1   . PHE C  2  148  ? 48.220  -40.362 59.777   1.00 34.20  ? 148  PHE C CE1   1 
ATOM   4715  C  CE2   . PHE C  2  148  ? 46.964  -39.976 57.780   1.00 36.84  ? 148  PHE C CE2   1 
ATOM   4716  C  CZ    . PHE C  2  148  ? 48.031  -40.570 58.426   1.00 39.13  ? 148  PHE C CZ    1 
ATOM   4717  N  N     . THR C  2  149  ? 44.212  -34.771 60.733   1.00 39.80  ? 149  THR C N     1 
ATOM   4718  C  CA    . THR C  2  149  ? 43.271  -33.837 61.344   1.00 44.83  ? 149  THR C CA    1 
ATOM   4719  C  C     . THR C  2  149  ? 41.961  -33.779 60.569   1.00 45.45  ? 149  THR C C     1 
ATOM   4720  O  O     . THR C  2  149  ? 41.951  -33.972 59.360   1.00 47.73  ? 149  THR C O     1 
ATOM   4721  C  CB    . THR C  2  149  ? 43.874  -32.426 61.434   1.00 41.88  ? 149  THR C CB    1 
ATOM   4722  O  OG1   . THR C  2  149  ? 44.552  -32.123 60.209   1.00 42.00  ? 149  THR C OG1   1 
ATOM   4723  C  CG2   . THR C  2  149  ? 44.866  -32.349 62.583   1.00 35.23  ? 149  THR C CG2   1 
ATOM   4724  N  N     . PRO C  2  150  ? 40.845  -33.520 61.267   1.00 50.91  ? 150  PRO C N     1 
ATOM   4725  C  CA    . PRO C  2  150  ? 39.556  -33.439 60.572   1.00 51.72  ? 150  PRO C CA    1 
ATOM   4726  C  C     . PRO C  2  150  ? 39.510  -32.269 59.595   1.00 54.29  ? 150  PRO C C     1 
ATOM   4727  O  O     . PRO C  2  150  ? 39.882  -31.153 59.958   1.00 51.47  ? 150  PRO C O     1 
ATOM   4728  C  CB    . PRO C  2  150  ? 38.558  -33.199 61.710   1.00 51.67  ? 150  PRO C CB    1 
ATOM   4729  C  CG    . PRO C  2  150  ? 39.243  -33.701 62.937   1.00 61.10  ? 150  PRO C CG    1 
ATOM   4730  C  CD    . PRO C  2  150  ? 40.695  -33.405 62.728   1.00 54.77  ? 150  PRO C CD    1 
ATOM   4731  N  N     . ASP C  2  151  ? 39.062  -32.531 58.369   1.00 58.41  ? 151  ASP C N     1 
ATOM   4732  C  CA    . ASP C  2  151  ? 38.829  -31.479 57.388   1.00 59.41  ? 151  ASP C CA    1 
ATOM   4733  C  C     . ASP C  2  151  ? 37.675  -30.622 57.897   1.00 69.44  ? 151  ASP C C     1 
ATOM   4734  O  O     . ASP C  2  151  ? 36.560  -31.117 58.066   1.00 73.76  ? 151  ASP C O     1 
ATOM   4735  C  CB    . ASP C  2  151  ? 38.480  -32.096 56.027   1.00 61.20  ? 151  ASP C CB    1 
ATOM   4736  C  CG    . ASP C  2  151  ? 38.445  -31.071 54.894   1.00 66.72  ? 151  ASP C CG    1 
ATOM   4737  O  OD1   . ASP C  2  151  ? 38.256  -29.866 55.162   1.00 71.85  ? 151  ASP C OD1   1 
ATOM   4738  O  OD2   . ASP C  2  151  ? 38.599  -31.479 53.721   1.00 60.94  ? 151  ASP C OD2   1 
ATOM   4739  N  N     . PRO C  2  152  ? 37.942  -29.332 58.151   1.00 64.62  ? 152  PRO C N     1 
ATOM   4740  C  CA    . PRO C  2  152  ? 36.921  -28.437 58.707   1.00 62.51  ? 152  PRO C CA    1 
ATOM   4741  C  C     . PRO C  2  152  ? 35.740  -28.250 57.760   1.00 66.00  ? 152  PRO C C     1 
ATOM   4742  O  O     . PRO C  2  152  ? 34.613  -28.053 58.213   1.00 68.24  ? 152  PRO C O     1 
ATOM   4743  C  CB    . PRO C  2  152  ? 37.677  -27.117 58.887   1.00 59.03  ? 152  PRO C CB    1 
ATOM   4744  C  CG    . PRO C  2  152  ? 38.815  -27.195 57.922   1.00 58.74  ? 152  PRO C CG    1 
ATOM   4745  C  CD    . PRO C  2  152  ? 39.215  -28.635 57.904   1.00 55.71  ? 152  PRO C CD    1 
ATOM   4746  N  N     . ALA C  2  153  ? 36.003  -28.319 56.459   1.00 65.56  ? 153  ALA C N     1 
ATOM   4747  C  CA    . ALA C  2  153  ? 34.965  -28.116 55.454   1.00 71.48  ? 153  ALA C CA    1 
ATOM   4748  C  C     . ALA C  2  153  ? 34.056  -29.332 55.275   1.00 72.51  ? 153  ALA C C     1 
ATOM   4749  O  O     . ALA C  2  153  ? 32.832  -29.202 55.246   1.00 78.08  ? 153  ALA C O     1 
ATOM   4750  C  CB    . ALA C  2  153  ? 35.592  -27.720 54.122   1.00 68.10  ? 153  ALA C CB    1 
ATOM   4751  N  N     . ARG C  2  154  ? 34.655  -30.512 55.155   1.00 71.17  ? 154  ARG C N     1 
ATOM   4752  C  CA    . ARG C  2  154  ? 33.893  -31.721 54.865   1.00 69.14  ? 154  ARG C CA    1 
ATOM   4753  C  C     . ARG C  2  154  ? 33.915  -32.701 56.032   1.00 66.80  ? 154  ARG C C     1 
ATOM   4754  O  O     . ARG C  2  154  ? 34.929  -33.354 56.276   1.00 76.71  ? 154  ARG C O     1 
ATOM   4755  C  CB    . ARG C  2  154  ? 34.464  -32.404 53.620   1.00 74.66  ? 154  ARG C CB    1 
ATOM   4756  C  CG    . ARG C  2  154  ? 34.522  -31.513 52.388   1.00 73.43  ? 154  ARG C CG    1 
ATOM   4757  C  CD    . ARG C  2  154  ? 35.539  -32.022 51.375   1.00 71.73  ? 154  ARG C CD    1 
ATOM   4758  N  NE    . ARG C  2  154  ? 35.397  -33.452 51.112   1.00 83.48  ? 154  ARG C NE    1 
ATOM   4759  C  CZ    . ARG C  2  154  ? 34.532  -33.975 50.247   1.00 77.86  ? 154  ARG C CZ    1 
ATOM   4760  N  NH1   . ARG C  2  154  ? 33.717  -33.187 49.559   1.00 69.56  ? 154  ARG C NH1   1 
ATOM   4761  N  NH2   . ARG C  2  154  ? 34.477  -35.289 50.074   1.00 75.84  ? 154  ARG C NH2   1 
ATOM   4762  N  N     . PRO C  2  155  ? 32.790  -32.814 56.754   1.00 62.00  ? 155  PRO C N     1 
ATOM   4763  C  CA    . PRO C  2  155  ? 32.678  -33.814 57.821   1.00 75.29  ? 155  PRO C CA    1 
ATOM   4764  C  C     . PRO C  2  155  ? 32.723  -35.232 57.259   1.00 69.93  ? 155  PRO C C     1 
ATOM   4765  O  O     . PRO C  2  155  ? 32.025  -35.534 56.290   1.00 62.35  ? 155  PRO C O     1 
ATOM   4766  C  CB    . PRO C  2  155  ? 31.301  -33.523 58.425   1.00 57.94  ? 155  PRO C CB    1 
ATOM   4767  C  CG    . PRO C  2  155  ? 31.064  -32.084 58.125   1.00 54.99  ? 155  PRO C CG    1 
ATOM   4768  C  CD    . PRO C  2  155  ? 31.663  -31.869 56.767   1.00 60.32  ? 155  PRO C CD    1 
ATOM   4769  N  N     . GLY C  2  156  ? 33.538  -36.090 57.864   1.00 64.04  ? 156  GLY C N     1 
ATOM   4770  C  CA    . GLY C  2  156  ? 33.717  -37.442 57.371   1.00 71.90  ? 156  GLY C CA    1 
ATOM   4771  C  C     . GLY C  2  156  ? 34.985  -37.596 56.550   1.00 75.17  ? 156  GLY C C     1 
ATOM   4772  O  O     . GLY C  2  156  ? 35.401  -38.714 56.242   1.00 78.50  ? 156  GLY C O     1 
ATOM   4773  N  N     . ARG C  2  157  ? 35.595  -36.470 56.190   1.00 62.09  ? 157  ARG C N     1 
ATOM   4774  C  CA    . ARG C  2  157  ? 36.851  -36.477 55.444   1.00 57.29  ? 157  ARG C CA    1 
ATOM   4775  C  C     . ARG C  2  157  ? 37.989  -35.913 56.284   1.00 56.11  ? 157  ARG C C     1 
ATOM   4776  O  O     . ARG C  2  157  ? 37.764  -35.093 57.173   1.00 57.33  ? 157  ARG C O     1 
ATOM   4777  C  CB    . ARG C  2  157  ? 36.714  -35.702 54.133   1.00 57.91  ? 157  ARG C CB    1 
ATOM   4778  C  CG    . ARG C  2  157  ? 35.717  -36.319 53.175   1.00 64.04  ? 157  ARG C CG    1 
ATOM   4779  C  CD    . ARG C  2  157  ? 35.990  -37.803 53.001   1.00 67.01  ? 157  ARG C CD    1 
ATOM   4780  N  NE    . ARG C  2  157  ? 34.940  -38.471 52.241   1.00 62.91  ? 157  ARG C NE    1 
ATOM   4781  C  CZ    . ARG C  2  157  ? 34.927  -38.571 50.917   1.00 73.70  ? 157  ARG C CZ    1 
ATOM   4782  N  NH1   . ARG C  2  157  ? 35.909  -38.041 50.200   1.00 68.32  ? 157  ARG C NH1   1 
ATOM   4783  N  NH2   . ARG C  2  157  ? 33.931  -39.198 50.307   1.00 93.80  ? 157  ARG C NH2   1 
ATOM   4784  N  N     . TYR C  2  158  ? 39.210  -36.362 56.006   1.00 57.04  ? 158  TYR C N     1 
ATOM   4785  C  CA    . TYR C  2  158  ? 40.356  -35.997 56.832   1.00 53.06  ? 158  TYR C CA    1 
ATOM   4786  C  C     . TYR C  2  158  ? 41.570  -35.555 56.020   1.00 51.92  ? 158  TYR C C     1 
ATOM   4787  O  O     . TYR C  2  158  ? 41.783  -36.008 54.896   1.00 61.35  ? 158  TYR C O     1 
ATOM   4788  C  CB    . TYR C  2  158  ? 40.725  -37.157 57.765   1.00 48.94  ? 158  TYR C CB    1 
ATOM   4789  C  CG    . TYR C  2  158  ? 39.571  -37.608 58.632   1.00 51.18  ? 158  TYR C CG    1 
ATOM   4790  C  CD1   . TYR C  2  158  ? 39.278  -36.959 59.824   1.00 52.79  ? 158  TYR C CD1   1 
ATOM   4791  C  CD2   . TYR C  2  158  ? 38.766  -38.674 58.252   1.00 51.75  ? 158  TYR C CD2   1 
ATOM   4792  C  CE1   . TYR C  2  158  ? 38.218  -37.363 60.616   1.00 58.55  ? 158  TYR C CE1   1 
ATOM   4793  C  CE2   . TYR C  2  158  ? 37.703  -39.084 59.039   1.00 52.01  ? 158  TYR C CE2   1 
ATOM   4794  C  CZ    . TYR C  2  158  ? 37.435  -38.425 60.219   1.00 54.07  ? 158  TYR C CZ    1 
ATOM   4795  O  OH    . TYR C  2  158  ? 36.380  -38.827 61.007   1.00 57.93  ? 158  TYR C OH    1 
ATOM   4796  N  N     . ILE C  2  159  ? 42.357  -34.660 56.606   1.00 47.11  ? 159  ILE C N     1 
ATOM   4797  C  CA    . ILE C  2  159  ? 43.584  -34.172 55.996   1.00 35.75  ? 159  ILE C CA    1 
ATOM   4798  C  C     . ILE C  2  159  ? 44.792  -34.807 56.665   1.00 38.15  ? 159  ILE C C     1 
ATOM   4799  O  O     . ILE C  2  159  ? 44.961  -34.713 57.887   1.00 40.05  ? 159  ILE C O     1 
ATOM   4800  C  CB    . ILE C  2  159  ? 43.720  -32.651 56.149   1.00 37.84  ? 159  ILE C CB    1 
ATOM   4801  C  CG1   . ILE C  2  159  ? 42.425  -31.951 55.739   1.00 51.92  ? 159  ILE C CG1   1 
ATOM   4802  C  CG2   . ILE C  2  159  ? 44.904  -32.140 55.347   1.00 39.87  ? 159  ILE C CG2   1 
ATOM   4803  C  CD1   . ILE C  2  159  ? 42.037  -32.188 54.306   1.00 61.87  ? 159  ILE C CD1   1 
ATOM   4804  N  N     . ALA C  2  160  ? 45.625  -35.458 55.861   1.00 37.97  ? 160  ALA C N     1 
ATOM   4805  C  CA    . ALA C  2  160  ? 46.883  -36.007 56.346   1.00 32.75  ? 160  ALA C CA    1 
ATOM   4806  C  C     . ALA C  2  160  ? 47.973  -34.967 56.147   1.00 35.75  ? 160  ALA C C     1 
ATOM   4807  O  O     . ALA C  2  160  ? 48.043  -34.328 55.101   1.00 38.93  ? 160  ALA C O     1 
ATOM   4808  C  CB    . ALA C  2  160  ? 47.227  -37.283 55.605   1.00 32.76  ? 160  ALA C CB    1 
ATOM   4809  N  N     . SER C  2  161  ? 48.819  -34.792 57.152   1.00 33.69  ? 161  SER C N     1 
ATOM   4810  C  CA    . SER C  2  161  ? 49.851  -33.770 57.094   1.00 32.11  ? 161  SER C CA    1 
ATOM   4811  C  C     . SER C  2  161  ? 51.215  -34.367 57.404   1.00 31.36  ? 161  SER C C     1 
ATOM   4812  O  O     . SER C  2  161  ? 51.367  -35.122 58.362   1.00 32.57  ? 161  SER C O     1 
ATOM   4813  C  CB    . SER C  2  161  ? 49.531  -32.642 58.076   1.00 34.76  ? 161  SER C CB    1 
ATOM   4814  O  OG    . SER C  2  161  ? 48.220  -32.142 57.869   1.00 33.03  ? 161  SER C OG    1 
ATOM   4815  N  N     . ILE C  2  162  ? 52.203  -34.037 56.579   1.00 33.31  ? 162  ILE C N     1 
ATOM   4816  C  CA    . ILE C  2  162  ? 53.571  -34.477 56.819   1.00 33.21  ? 162  ILE C CA    1 
ATOM   4817  C  C     . ILE C  2  162  ? 54.467  -33.279 57.115   1.00 34.33  ? 162  ILE C C     1 
ATOM   4818  O  O     . ILE C  2  162  ? 54.792  -32.495 56.222   1.00 37.33  ? 162  ILE C O     1 
ATOM   4819  C  CB    . ILE C  2  162  ? 54.123  -35.250 55.616   1.00 29.00  ? 162  ILE C CB    1 
ATOM   4820  C  CG1   . ILE C  2  162  ? 53.286  -36.509 55.375   1.00 30.26  ? 162  ILE C CG1   1 
ATOM   4821  C  CG2   . ILE C  2  162  ? 55.577  -35.601 55.843   1.00 31.01  ? 162  ILE C CG2   1 
ATOM   4822  C  CD1   . ILE C  2  162  ? 53.650  -37.264 54.117   1.00 29.39  ? 162  ILE C CD1   1 
ATOM   4823  N  N     . ILE C  2  163  ? 54.873  -33.153 58.372   1.00 34.40  ? 163  ILE C N     1 
ATOM   4824  C  CA    . ILE C  2  163  ? 55.622  -31.986 58.822   1.00 36.79  ? 163  ILE C CA    1 
ATOM   4825  C  C     . ILE C  2  163  ? 57.063  -32.322 59.190   1.00 33.88  ? 163  ILE C C     1 
ATOM   4826  O  O     . ILE C  2  163  ? 57.303  -33.179 60.031   1.00 33.53  ? 163  ILE C O     1 
ATOM   4827  C  CB    . ILE C  2  163  ? 54.942  -31.323 60.033   1.00 38.37  ? 163  ILE C CB    1 
ATOM   4828  C  CG1   . ILE C  2  163  ? 53.480  -31.003 59.717   1.00 38.47  ? 163  ILE C CG1   1 
ATOM   4829  C  CG2   . ILE C  2  163  ? 55.692  -30.065 60.443   1.00 45.15  ? 163  ILE C CG2   1 
ATOM   4830  C  CD1   . ILE C  2  163  ? 52.721  -30.411 60.884   1.00 37.48  ? 163  ILE C CD1   1 
ATOM   4831  N  N     . PRO C  2  164  ? 58.030  -31.667 58.533   1.00 28.09  ? 164  PRO C N     1 
ATOM   4832  C  CA    . PRO C  2  164  ? 59.440  -31.764 58.917   1.00 32.76  ? 164  PRO C CA    1 
ATOM   4833  C  C     . PRO C  2  164  ? 59.829  -30.655 59.895   1.00 38.69  ? 164  PRO C C     1 
ATOM   4834  O  O     . PRO C  2  164  ? 58.969  -29.875 60.306   1.00 42.97  ? 164  PRO C O     1 
ATOM   4835  C  CB    . PRO C  2  164  ? 60.161  -31.566 57.588   1.00 38.36  ? 164  PRO C CB    1 
ATOM   4836  C  CG    . PRO C  2  164  ? 59.278  -30.635 56.848   1.00 37.23  ? 164  PRO C CG    1 
ATOM   4837  C  CD    . PRO C  2  164  ? 57.859  -30.941 57.264   1.00 33.60  ? 164  PRO C CD    1 
ATOM   4838  N  N     . LEU C  2  165  ? 61.106  -30.595 60.265   1.00 37.07  ? 165  LEU C N     1 
ATOM   4839  C  CA    . LEU C  2  165  ? 61.627  -29.512 61.097   1.00 37.75  ? 165  LEU C CA    1 
ATOM   4840  C  C     . LEU C  2  165  ? 61.480  -28.163 60.381   1.00 41.25  ? 165  LEU C C     1 
ATOM   4841  O  O     . LEU C  2  165  ? 61.350  -28.122 59.156   1.00 39.69  ? 165  LEU C O     1 
ATOM   4842  C  CB    . LEU C  2  165  ? 63.097  -29.769 61.437   1.00 36.76  ? 165  LEU C CB    1 
ATOM   4843  C  CG    . LEU C  2  165  ? 63.455  -30.947 62.340   1.00 34.25  ? 165  LEU C CG    1 
ATOM   4844  C  CD1   . LEU C  2  165  ? 64.934  -31.260 62.217   1.00 37.11  ? 165  LEU C CD1   1 
ATOM   4845  C  CD2   . LEU C  2  165  ? 63.102  -30.634 63.782   1.00 32.29  ? 165  LEU C CD2   1 
ATOM   4846  N  N     . PRO C  2  166  ? 61.483  -27.055 61.145   1.00 39.97  ? 166  PRO C N     1 
ATOM   4847  C  CA    . PRO C  2  166  ? 61.370  -25.717 60.548   1.00 46.13  ? 166  PRO C CA    1 
ATOM   4848  C  C     . PRO C  2  166  ? 62.491  -25.396 59.559   1.00 46.24  ? 166  PRO C C     1 
ATOM   4849  O  O     . PRO C  2  166  ? 63.670  -25.582 59.868   1.00 45.13  ? 166  PRO C O     1 
ATOM   4850  C  CB    . PRO C  2  166  ? 61.448  -24.790 61.762   1.00 39.75  ? 166  PRO C CB    1 
ATOM   4851  C  CG    . PRO C  2  166  ? 60.901  -25.605 62.873   1.00 38.10  ? 166  PRO C CG    1 
ATOM   4852  C  CD    . PRO C  2  166  ? 61.392  -27.002 62.615   1.00 36.83  ? 166  PRO C CD    1 
ATOM   4853  N  N     . LYS C  2  167  ? 62.098  -24.926 58.377   1.00 46.00  ? 167  LYS C N     1 
ATOM   4854  C  CA    . LYS C  2  167  ? 63.012  -24.607 57.279   1.00 49.71  ? 167  LYS C CA    1 
ATOM   4855  C  C     . LYS C  2  167  ? 63.847  -25.816 56.847   1.00 49.59  ? 167  LYS C C     1 
ATOM   4856  O  O     . LYS C  2  167  ? 64.905  -25.679 56.232   1.00 52.53  ? 167  LYS C O     1 
ATOM   4857  C  CB    . LYS C  2  167  ? 63.889  -23.397 57.623   1.00 49.45  ? 167  LYS C CB    1 
ATOM   4858  C  CG    . LYS C  2  167  ? 63.084  -22.121 57.847   1.00 49.73  ? 167  LYS C CG    1 
ATOM   4859  C  CD    . LYS C  2  167  ? 63.929  -20.870 57.672   1.00 57.49  ? 167  LYS C CD    1 
ATOM   4860  C  CE    . LYS C  2  167  ? 63.061  -19.618 57.659   1.00 56.12  ? 167  LYS C CE    1 
ATOM   4861  N  NZ    . LYS C  2  167  ? 63.843  -18.394 57.319   1.00 54.45  ? 167  LYS C NZ    1 
ATOM   4862  N  N     . ARG C  2  168  ? 63.340  -26.998 57.179   1.00 48.88  ? 168  ARG C N     1 
ATOM   4863  C  CA    . ARG C  2  168  ? 63.883  -28.276 56.726   1.00 48.55  ? 168  ARG C CA    1 
ATOM   4864  C  C     . ARG C  2  168  ? 63.149  -28.838 55.511   1.00 49.81  ? 168  ARG C C     1 
ATOM   4865  O  O     . ARG C  2  168  ? 63.285  -30.015 55.189   1.00 44.70  ? 168  ARG C O     1 
ATOM   4866  C  CB    . ARG C  2  168  ? 64.007  -29.294 57.859   1.00 49.44  ? 168  ARG C CB    1 
ATOM   4867  C  CG    . ARG C  2  168  ? 65.192  -29.029 58.790   1.00 58.03  ? 168  ARG C CG    1 
ATOM   4868  C  CD    . ARG C  2  168  ? 66.533  -29.474 58.205   1.00 61.36  ? 168  ARG C CD    1 
ATOM   4869  N  NE    . ARG C  2  168  ? 67.029  -28.592 57.150   1.00 67.53  ? 168  ARG C NE    1 
ATOM   4870  C  CZ    . ARG C  2  168  ? 68.232  -28.694 56.594   1.00 73.02  ? 168  ARG C CZ    1 
ATOM   4871  N  NH1   . ARG C  2  168  ? 69.074  -29.639 56.995   1.00 70.49  ? 168  ARG C NH1   1 
ATOM   4872  N  NH2   . ARG C  2  168  ? 68.599  -27.850 55.638   1.00 67.13  ? 168  ARG C NH2   1 
ATOM   4873  N  N     . GLY C  2  169  ? 62.335  -28.003 54.871   1.00 51.91  ? 169  GLY C N     1 
ATOM   4874  C  CA    . GLY C  2  169  ? 61.524  -28.440 53.749   1.00 44.22  ? 169  GLY C CA    1 
ATOM   4875  C  C     . GLY C  2  169  ? 60.026  -28.403 53.971   1.00 35.59  ? 169  GLY C C     1 
ATOM   4876  O  O     . GLY C  2  169  ? 59.563  -28.155 55.081   1.00 39.87  ? 169  GLY C O     1 
ATOM   4877  N  N     . PRO C  2  170  ? 59.263  -28.617 52.889   1.00 33.81  ? 170  PRO C N     1 
ATOM   4878  C  CA    . PRO C  2  170  ? 57.837  -28.301 52.740   1.00 40.60  ? 170  PRO C CA    1 
ATOM   4879  C  C     . PRO C  2  170  ? 56.867  -29.166 53.540   1.00 41.58  ? 170  PRO C C     1 
ATOM   4880  O  O     . PRO C  2  170  ? 57.053  -30.379 53.671   1.00 34.65  ? 170  PRO C O     1 
ATOM   4881  C  CB    . PRO C  2  170  ? 57.596  -28.541 51.250   1.00 41.23  ? 170  PRO C CB    1 
ATOM   4882  C  CG    . PRO C  2  170  ? 58.545  -29.631 50.911   1.00 38.23  ? 170  PRO C CG    1 
ATOM   4883  C  CD    . PRO C  2  170  ? 59.783  -29.339 51.713   1.00 37.98  ? 170  PRO C CD    1 
ATOM   4884  N  N     . TRP C  2  171  ? 55.826  -28.521 54.060   1.00 43.04  ? 171  TRP C N     1 
ATOM   4885  C  CA    . TRP C  2  171  ? 54.674  -29.235 54.584   1.00 41.53  ? 171  TRP C CA    1 
ATOM   4886  C  C     . TRP C  2  171  ? 53.947  -29.832 53.392   1.00 39.94  ? 171  TRP C C     1 
ATOM   4887  O  O     . TRP C  2  171  ? 53.773  -29.171 52.368   1.00 40.70  ? 171  TRP C O     1 
ATOM   4888  C  CB    . TRP C  2  171  ? 53.731  -28.292 55.334   1.00 43.30  ? 171  TRP C CB    1 
ATOM   4889  C  CG    . TRP C  2  171  ? 54.232  -27.836 56.671   1.00 52.21  ? 171  TRP C CG    1 
ATOM   4890  C  CD1   . TRP C  2  171  ? 55.528  -27.589 57.025   1.00 55.32  ? 171  TRP C CD1   1 
ATOM   4891  C  CD2   . TRP C  2  171  ? 53.442  -27.581 57.838   1.00 57.19  ? 171  TRP C CD2   1 
ATOM   4892  N  NE1   . TRP C  2  171  ? 55.592  -27.190 58.340   1.00 55.85  ? 171  TRP C NE1   1 
ATOM   4893  C  CE2   . TRP C  2  171  ? 54.324  -27.178 58.863   1.00 60.44  ? 171  TRP C CE2   1 
ATOM   4894  C  CE3   . TRP C  2  171  ? 52.072  -27.654 58.117   1.00 50.67  ? 171  TRP C CE3   1 
ATOM   4895  C  CZ2   . TRP C  2  171  ? 53.883  -26.848 60.144   1.00 61.08  ? 171  TRP C CZ2   1 
ATOM   4896  C  CZ3   . TRP C  2  171  ? 51.635  -27.326 59.390   1.00 62.60  ? 171  TRP C CZ3   1 
ATOM   4897  C  CH2   . TRP C  2  171  ? 52.538  -26.928 60.388   1.00 64.91  ? 171  TRP C CH2   1 
ATOM   4898  N  N     . ILE C  2  172  ? 53.530  -31.085 53.521   1.00 39.03  ? 172  ILE C N     1 
ATOM   4899  C  CA    . ILE C  2  172  ? 52.837  -31.772 52.441   1.00 36.55  ? 172  ILE C CA    1 
ATOM   4900  C  C     . ILE C  2  172  ? 51.470  -32.237 52.910   1.00 33.76  ? 172  ILE C C     1 
ATOM   4901  O  O     . ILE C  2  172  ? 51.353  -32.865 53.960   1.00 33.97  ? 172  ILE C O     1 
ATOM   4902  C  CB    . ILE C  2  172  ? 53.644  -32.981 51.945   1.00 35.33  ? 172  ILE C CB    1 
ATOM   4903  C  CG1   . ILE C  2  172  ? 54.943  -32.511 51.287   1.00 36.07  ? 172  ILE C CG1   1 
ATOM   4904  C  CG2   . ILE C  2  172  ? 52.815  -33.816 50.986   1.00 33.64  ? 172  ILE C CG2   1 
ATOM   4905  C  CD1   . ILE C  2  172  ? 55.796  -33.630 50.748   1.00 35.97  ? 172  ILE C CD1   1 
ATOM   4906  N  N     . ASP C  2  173  ? 50.430  -31.924 52.144   1.00 36.16  ? 173  ASP C N     1 
ATOM   4907  C  CA    . ASP C  2  173  ? 49.084  -32.316 52.560   1.00 37.55  ? 173  ASP C CA    1 
ATOM   4908  C  C     . ASP C  2  173  ? 48.418  -33.334 51.635   1.00 45.11  ? 173  ASP C C     1 
ATOM   4909  O  O     . ASP C  2  173  ? 48.365  -33.153 50.423   1.00 48.79  ? 173  ASP C O     1 
ATOM   4910  C  CB    . ASP C  2  173  ? 48.188  -31.089 52.757   1.00 43.51  ? 173  ASP C CB    1 
ATOM   4911  C  CG    . ASP C  2  173  ? 48.285  -30.514 54.161   1.00 47.26  ? 173  ASP C CG    1 
ATOM   4912  O  OD1   . ASP C  2  173  ? 49.307  -30.756 54.840   1.00 45.11  ? 173  ASP C OD1   1 
ATOM   4913  O  OD2   . ASP C  2  173  ? 47.336  -29.821 54.587   1.00 54.02  ? 173  ASP C OD2   1 
ATOM   4914  N  N     . LEU C  2  174  ? 47.914  -34.410 52.230   1.00 42.46  ? 174  LEU C N     1 
ATOM   4915  C  CA    . LEU C  2  174  ? 47.192  -35.443 51.499   1.00 42.20  ? 174  LEU C CA    1 
ATOM   4916  C  C     . LEU C  2  174  ? 45.702  -35.321 51.798   1.00 48.93  ? 174  LEU C C     1 
ATOM   4917  O  O     . LEU C  2  174  ? 45.291  -35.312 52.962   1.00 53.21  ? 174  LEU C O     1 
ATOM   4918  C  CB    . LEU C  2  174  ? 47.703  -36.832 51.888   1.00 32.19  ? 174  LEU C CB    1 
ATOM   4919  C  CG    . LEU C  2  174  ? 48.883  -37.424 51.111   1.00 31.87  ? 174  LEU C CG    1 
ATOM   4920  C  CD1   . LEU C  2  174  ? 49.996  -36.411 50.887   1.00 31.43  ? 174  LEU C CD1   1 
ATOM   4921  C  CD2   . LEU C  2  174  ? 49.420  -38.645 51.837   1.00 34.86  ? 174  LEU C CD2   1 
ATOM   4922  N  N     . GLU C  2  175  ? 44.895  -35.220 50.747   1.00 51.26  ? 175  GLU C N     1 
ATOM   4923  C  CA    . GLU C  2  175  ? 43.467  -34.980 50.906   1.00 55.52  ? 175  GLU C CA    1 
ATOM   4924  C  C     . GLU C  2  175  ? 42.663  -35.850 49.946   1.00 58.67  ? 175  GLU C C     1 
ATOM   4925  O  O     . GLU C  2  175  ? 43.160  -36.233 48.892   1.00 59.01  ? 175  GLU C O     1 
ATOM   4926  C  CB    . GLU C  2  175  ? 43.168  -33.496 50.661   1.00 63.95  ? 175  GLU C CB    1 
ATOM   4927  C  CG    . GLU C  2  175  ? 41.721  -33.080 50.882   1.00 71.02  ? 175  GLU C CG    1 
ATOM   4928  C  CD    . GLU C  2  175  ? 41.528  -31.576 50.814   1.00 73.75  ? 175  GLU C CD    1 
ATOM   4929  O  OE1   . GLU C  2  175  ? 42.483  -30.869 50.426   1.00 69.01  ? 175  GLU C OE1   1 
ATOM   4930  O  OE2   . GLU C  2  175  ? 40.421  -31.102 51.150   1.00 81.64  ? 175  GLU C OE2   1 
ATOM   4931  N  N     . VAL C  2  176  ? 41.427  -36.174 50.314   1.00 65.09  ? 176  VAL C N     1 
ATOM   4932  C  CA    . VAL C  2  176  ? 40.526  -36.857 49.393   1.00 65.67  ? 176  VAL C CA    1 
ATOM   4933  C  C     . VAL C  2  176  ? 39.534  -35.846 48.817   1.00 72.92  ? 176  VAL C C     1 
ATOM   4934  O  O     . VAL C  2  176  ? 38.647  -35.358 49.518   1.00 75.71  ? 176  VAL C O     1 
ATOM   4935  C  CB    . VAL C  2  176  ? 39.769  -38.009 50.079   1.00 65.76  ? 176  VAL C CB    1 
ATOM   4936  C  CG1   . VAL C  2  176  ? 38.970  -38.795 49.055   1.00 64.78  ? 176  VAL C CG1   1 
ATOM   4937  C  CG2   . VAL C  2  176  ? 40.742  -38.923 50.806   1.00 62.28  ? 176  VAL C CG2   1 
ATOM   4938  N  N     . GLU C  2  177  ? 39.695  -35.544 47.532   1.00 70.77  ? 177  GLU C N     1 
ATOM   4939  C  CA    . GLU C  2  177  ? 38.926  -34.495 46.866   1.00 67.54  ? 177  GLU C CA    1 
ATOM   4940  C  C     . GLU C  2  177  ? 37.463  -34.904 46.685   1.00 74.02  ? 177  GLU C C     1 
ATOM   4941  O  O     . GLU C  2  177  ? 37.158  -36.095 46.616   1.00 81.86  ? 177  GLU C O     1 
ATOM   4942  C  CB    . GLU C  2  177  ? 39.567  -34.173 45.510   1.00 63.15  ? 177  GLU C CB    1 
ATOM   4943  C  CG    . GLU C  2  177  ? 39.739  -32.685 45.220   1.00 72.70  ? 177  GLU C CG    1 
ATOM   4944  C  CD    . GLU C  2  177  ? 40.462  -31.945 46.333   1.00 77.42  ? 177  GLU C CD    1 
ATOM   4945  O  OE1   . GLU C  2  177  ? 39.973  -30.874 46.755   1.00 72.24  ? 177  GLU C OE1   1 
ATOM   4946  O  OE2   . GLU C  2  177  ? 41.523  -32.429 46.781   1.00 73.08  ? 177  GLU C OE2   1 
ATOM   4947  N  N     . PRO C  2  178  ? 36.549  -33.916 46.625   1.00 73.17  ? 178  PRO C N     1 
ATOM   4948  C  CA    . PRO C  2  178  ? 35.123  -34.162 46.376   1.00 73.66  ? 178  PRO C CA    1 
ATOM   4949  C  C     . PRO C  2  178  ? 34.838  -34.978 45.112   1.00 77.02  ? 178  PRO C C     1 
ATOM   4950  O  O     . PRO C  2  178  ? 33.783  -35.608 45.028   1.00 78.32  ? 178  PRO C O     1 
ATOM   4951  C  CB    . PRO C  2  178  ? 34.555  -32.751 46.221   1.00 61.30  ? 178  PRO C CB    1 
ATOM   4952  C  CG    . PRO C  2  178  ? 35.418  -31.920 47.084   1.00 66.48  ? 178  PRO C CG    1 
ATOM   4953  C  CD    . PRO C  2  178  ? 36.799  -32.511 46.997   1.00 68.42  ? 178  PRO C CD    1 
ATOM   4954  N  N     . ASN C  2  179  ? 35.753  -34.965 44.146   1.00 72.70  ? 179  ASN C N     1 
ATOM   4955  C  CA    . ASN C  2  179  ? 35.574  -35.748 42.927   1.00 72.43  ? 179  ASN C CA    1 
ATOM   4956  C  C     . ASN C  2  179  ? 36.091  -37.182 43.057   1.00 78.68  ? 179  ASN C C     1 
ATOM   4957  O  O     . ASN C  2  179  ? 35.956  -37.986 42.135   1.00 85.39  ? 179  ASN C O     1 
ATOM   4958  C  CB    . ASN C  2  179  ? 36.214  -35.050 41.724   1.00 72.12  ? 179  ASN C CB    1 
ATOM   4959  C  CG    . ASN C  2  179  ? 37.714  -34.905 41.862   1.00 71.96  ? 179  ASN C CG    1 
ATOM   4960  O  OD1   . ASN C  2  179  ? 38.462  -35.857 41.645   1.00 72.02  ? 179  ASN C OD1   1 
ATOM   4961  N  ND2   . ASN C  2  179  ? 38.165  -33.707 42.213   1.00 71.23  ? 179  ASN C ND2   1 
ATOM   4962  N  N     . GLY C  2  180  ? 36.683  -37.495 44.206   1.00 76.93  ? 180  GLY C N     1 
ATOM   4963  C  CA    . GLY C  2  180  ? 37.108  -38.851 44.502   1.00 77.83  ? 180  GLY C CA    1 
ATOM   4964  C  C     . GLY C  2  180  ? 38.602  -39.113 44.416   1.00 84.02  ? 180  GLY C C     1 
ATOM   4965  O  O     . GLY C  2  180  ? 39.088  -40.095 44.978   1.00 85.41  ? 180  GLY C O     1 
ATOM   4966  N  N     . VAL C  2  181  ? 39.332  -38.242 43.722   1.00 77.62  ? 181  VAL C N     1 
ATOM   4967  C  CA    . VAL C  2  181  ? 40.778  -38.412 43.564   1.00 78.62  ? 181  VAL C CA    1 
ATOM   4968  C  C     . VAL C  2  181  ? 41.541  -37.955 44.812   1.00 76.13  ? 181  VAL C C     1 
ATOM   4969  O  O     . VAL C  2  181  ? 41.057  -37.118 45.577   1.00 70.39  ? 181  VAL C O     1 
ATOM   4970  C  CB    . VAL C  2  181  ? 41.314  -37.673 42.307   1.00 73.75  ? 181  VAL C CB    1 
ATOM   4971  C  CG1   . VAL C  2  181  ? 41.473  -36.186 42.580   1.00 76.30  ? 181  VAL C CG1   1 
ATOM   4972  C  CG2   . VAL C  2  181  ? 42.639  -38.276 41.845   1.00 64.82  ? 181  VAL C CG2   1 
ATOM   4973  N  N     . VAL C  2  182  ? 42.726  -38.522 45.020   1.00 76.78  ? 182  VAL C N     1 
ATOM   4974  C  CA    . VAL C  2  182  ? 43.571  -38.141 46.146   1.00 65.03  ? 182  VAL C CA    1 
ATOM   4975  C  C     . VAL C  2  182  ? 44.585  -37.070 45.740   1.00 59.76  ? 182  VAL C C     1 
ATOM   4976  O  O     . VAL C  2  182  ? 45.446  -37.296 44.887   1.00 61.15  ? 182  VAL C O     1 
ATOM   4977  C  CB    . VAL C  2  182  ? 44.280  -39.364 46.773   1.00 55.69  ? 182  VAL C CB    1 
ATOM   4978  C  CG1   . VAL C  2  182  ? 44.848  -40.277 45.693   1.00 68.75  ? 182  VAL C CG1   1 
ATOM   4979  C  CG2   . VAL C  2  182  ? 45.360  -38.916 47.739   1.00 53.25  ? 182  VAL C CG2   1 
ATOM   4980  N  N     . SER C  2  183  ? 44.466  -35.899 46.357   1.00 58.61  ? 183  SER C N     1 
ATOM   4981  C  CA    . SER C  2  183  ? 45.293  -34.751 46.012   1.00 57.67  ? 183  SER C CA    1 
ATOM   4982  C  C     . SER C  2  183  ? 46.424  -34.518 47.006   1.00 58.87  ? 183  SER C C     1 
ATOM   4983  O  O     . SER C  2  183  ? 46.242  -34.623 48.223   1.00 60.31  ? 183  SER C O     1 
ATOM   4984  C  CB    . SER C  2  183  ? 44.434  -33.488 45.914   1.00 63.15  ? 183  SER C CB    1 
ATOM   4985  O  OG    . SER C  2  183  ? 43.879  -33.148 47.174   1.00 60.73  ? 183  SER C OG    1 
ATOM   4986  N  N     . MET C  2  184  ? 47.592  -34.192 46.465   1.00 56.27  ? 184  MET C N     1 
ATOM   4987  C  CA    . MET C  2  184  ? 48.758  -33.833 47.255   1.00 53.84  ? 184  MET C CA    1 
ATOM   4988  C  C     . MET C  2  184  ? 49.060  -32.355 47.059   1.00 58.87  ? 184  MET C C     1 
ATOM   4989  O  O     . MET C  2  184  ? 49.031  -31.847 45.932   1.00 62.60  ? 184  MET C O     1 
ATOM   4990  C  CB    . MET C  2  184  ? 49.959  -34.678 46.835   1.00 46.09  ? 184  MET C CB    1 
ATOM   4991  C  CG    . MET C  2  184  ? 51.274  -34.311 47.499   1.00 40.05  ? 184  MET C CG    1 
ATOM   4992  S  SD    . MET C  2  184  ? 52.510  -35.561 47.100   1.00 62.08  ? 184  MET C SD    1 
ATOM   4993  C  CE    . MET C  2  184  ? 53.998  -34.897 47.837   1.00 32.78  ? 184  MET C CE    1 
ATOM   4994  N  N     . LYS C  2  185  ? 49.335  -31.670 48.166   1.00 54.22  ? 185  LYS C N     1 
ATOM   4995  C  CA    . LYS C  2  185  ? 49.656  -30.250 48.148   1.00 50.03  ? 185  LYS C CA    1 
ATOM   4996  C  C     . LYS C  2  185  ? 51.077  -30.028 48.645   1.00 48.03  ? 185  LYS C C     1 
ATOM   4997  O  O     . LYS C  2  185  ? 51.426  -30.422 49.767   1.00 48.41  ? 185  LYS C O     1 
ATOM   4998  C  CB    . LYS C  2  185  ? 48.673  -29.459 49.014   1.00 48.90  ? 185  LYS C CB    1 
ATOM   4999  C  CG    . LYS C  2  185  ? 48.889  -27.951 48.978   1.00 50.11  ? 185  LYS C CG    1 
ATOM   5000  C  CD    . LYS C  2  185  ? 48.171  -27.255 50.129   1.00 51.46  ? 185  LYS C CD    1 
ATOM   5001  C  CE    . LYS C  2  185  ? 46.669  -27.512 50.101   1.00 47.49  ? 185  LYS C CE    1 
ATOM   5002  N  NZ    . LYS C  2  185  ? 46.007  -26.891 48.919   1.00 45.21  ? 185  LYS C NZ    1 
ATOM   5003  N  N     . VAL C  2  186  ? 51.886  -29.414 47.783   1.00 51.76  ? 186  VAL C N     1 
ATOM   5004  C  CA    . VAL C  2  186  ? 53.264  -29.045 48.082   1.00 53.70  ? 186  VAL C CA    1 
ATOM   5005  C  C     . VAL C  2  186  ? 53.526  -27.638 47.560   1.00 66.25  ? 186  VAL C C     1 
ATOM   5006  O  O     . VAL C  2  186  ? 53.315  -27.370 46.376   1.00 71.43  ? 186  VAL C O     1 
ATOM   5007  C  CB    . VAL C  2  186  ? 54.258  -29.988 47.389   1.00 41.15  ? 186  VAL C CB    1 
ATOM   5008  C  CG1   . VAL C  2  186  ? 55.686  -29.522 47.627   1.00 49.12  ? 186  VAL C CG1   1 
ATOM   5009  C  CG2   . VAL C  2  186  ? 54.073  -31.399 47.879   1.00 45.74  ? 186  VAL C CG2   1 
ATOM   5010  N  N     . ASN C  2  187  ? 53.989  -26.749 48.437   1.00 64.17  ? 187  ASN C N     1 
ATOM   5011  C  CA    . ASN C  2  187  ? 54.239  -25.351 48.078   1.00 72.77  ? 187  ASN C CA    1 
ATOM   5012  C  C     . ASN C  2  187  ? 53.017  -24.698 47.438   1.00 70.52  ? 187  ASN C C     1 
ATOM   5013  O  O     . ASN C  2  187  ? 53.137  -23.952 46.462   1.00 59.83  ? 187  ASN C O     1 
ATOM   5014  C  CB    . ASN C  2  187  ? 55.448  -25.227 47.144   1.00 73.44  ? 187  ASN C CB    1 
ATOM   5015  C  CG    . ASN C  2  187  ? 56.719  -25.786 47.754   1.00 69.04  ? 187  ASN C CG    1 
ATOM   5016  O  OD1   . ASN C  2  187  ? 57.398  -26.615 47.149   1.00 62.01  ? 187  ASN C OD1   1 
ATOM   5017  N  ND2   . ASN C  2  187  ? 57.048  -25.331 48.959   1.00 65.94  ? 187  ASN C ND2   1 
ATOM   5018  N  N     . LYS C  2  188  ? 51.848  -24.997 47.997   1.00 73.79  ? 188  LYS C N     1 
ATOM   5019  C  CA    . LYS C  2  188  ? 50.573  -24.520 47.469   1.00 79.08  ? 188  LYS C CA    1 
ATOM   5020  C  C     . LYS C  2  188  ? 50.357  -24.926 46.010   1.00 75.42  ? 188  LYS C C     1 
ATOM   5021  O  O     . LYS C  2  188  ? 50.000  -24.101 45.169   1.00 77.92  ? 188  LYS C O     1 
ATOM   5022  C  CB    . LYS C  2  188  ? 50.439  -23.003 47.647   1.00 79.58  ? 188  LYS C CB    1 
ATOM   5023  C  CG    . LYS C  2  188  ? 50.309  -22.563 49.098   1.00 77.07  ? 188  LYS C CG    1 
ATOM   5024  C  CD    . LYS C  2  188  ? 50.299  -21.047 49.227   1.00 78.96  ? 188  LYS C CD    1 
ATOM   5025  C  CE    . LYS C  2  188  ? 51.652  -20.449 48.873   1.00 79.03  ? 188  LYS C CE    1 
ATOM   5026  N  NZ    . LYS C  2  188  ? 52.729  -20.943 49.776   1.00 79.33  ? 188  LYS C NZ    1 
ATOM   5027  N  N     . ARG C  2  189  ? 50.589  -26.203 45.718   1.00 66.42  ? 189  ARG C N     1 
ATOM   5028  C  CA    . ARG C  2  189  ? 50.284  -26.762 44.407   1.00 58.40  ? 189  ARG C CA    1 
ATOM   5029  C  C     . ARG C  2  189  ? 49.562  -28.097 44.546   1.00 59.01  ? 189  ARG C C     1 
ATOM   5030  O  O     . ARG C  2  189  ? 50.119  -29.058 45.073   1.00 65.29  ? 189  ARG C O     1 
ATOM   5031  C  CB    . ARG C  2  189  ? 51.556  -26.940 43.581   1.00 58.22  ? 189  ARG C CB    1 
ATOM   5032  C  CG    . ARG C  2  189  ? 52.178  -25.640 43.107   1.00 67.00  ? 189  ARG C CG    1 
ATOM   5033  C  CD    . ARG C  2  189  ? 53.361  -25.907 42.192   1.00 73.15  ? 189  ARG C CD    1 
ATOM   5034  N  NE    . ARG C  2  189  ? 53.953  -24.675 41.681   1.00 77.43  ? 189  ARG C NE    1 
ATOM   5035  C  CZ    . ARG C  2  189  ? 53.629  -24.114 40.520   1.00 80.29  ? 189  ARG C CZ    1 
ATOM   5036  N  NH1   . ARG C  2  189  ? 52.712  -24.676 39.743   1.00 74.60  ? 189  ARG C NH1   1 
ATOM   5037  N  NH2   . ARG C  2  189  ? 54.222  -22.991 40.136   1.00 83.23  ? 189  ARG C NH2   1 
ATOM   5038  N  N     . LYS C  2  190  ? 48.323  -28.151 44.067   1.00 61.69  ? 190  LYS C N     1 
ATOM   5039  C  CA    . LYS C  2  190  ? 47.516  -29.366 44.132   1.00 63.50  ? 190  LYS C CA    1 
ATOM   5040  C  C     . LYS C  2  190  ? 47.748  -30.248 42.909   1.00 67.24  ? 190  LYS C C     1 
ATOM   5041  O  O     . LYS C  2  190  ? 47.496  -29.827 41.780   1.00 81.48  ? 190  LYS C O     1 
ATOM   5042  C  CB    . LYS C  2  190  ? 46.028  -29.009 44.218   1.00 58.76  ? 190  LYS C CB    1 
ATOM   5043  C  CG    . LYS C  2  190  ? 45.522  -28.666 45.609   1.00 47.97  ? 190  LYS C CG    1 
ATOM   5044  C  CD    . LYS C  2  190  ? 45.118  -29.919 46.370   1.00 53.48  ? 190  LYS C CD    1 
ATOM   5045  C  CE    . LYS C  2  190  ? 44.357  -29.576 47.643   1.00 66.59  ? 190  LYS C CE    1 
ATOM   5046  N  NZ    . LYS C  2  190  ? 43.077  -28.865 47.362   1.00 59.64  ? 190  LYS C NZ    1 
ATOM   5047  N  N     . PHE C  2  191  ? 48.219  -31.471 43.127   1.00 57.13  ? 191  PHE C N     1 
ATOM   5048  C  CA    . PHE C  2  191  ? 48.379  -32.410 42.018   1.00 58.21  ? 191  PHE C CA    1 
ATOM   5049  C  C     . PHE C  2  191  ? 48.017  -33.827 42.458   1.00 62.03  ? 191  PHE C C     1 
ATOM   5050  O  O     . PHE C  2  191  ? 48.120  -34.147 43.639   1.00 66.97  ? 191  PHE C O     1 
ATOM   5051  C  CB    . PHE C  2  191  ? 49.802  -32.348 41.451   1.00 56.86  ? 191  PHE C CB    1 
ATOM   5052  C  CG    . PHE C  2  191  ? 50.840  -32.974 42.335   1.00 59.74  ? 191  PHE C CG    1 
ATOM   5053  C  CD1   . PHE C  2  191  ? 51.423  -32.249 43.361   1.00 64.61  ? 191  PHE C CD1   1 
ATOM   5054  C  CD2   . PHE C  2  191  ? 51.244  -34.284 42.130   1.00 64.42  ? 191  PHE C CD2   1 
ATOM   5055  C  CE1   . PHE C  2  191  ? 52.384  -32.823 44.174   1.00 65.64  ? 191  PHE C CE1   1 
ATOM   5056  C  CE2   . PHE C  2  191  ? 52.201  -34.864 42.940   1.00 66.66  ? 191  PHE C CE2   1 
ATOM   5057  C  CZ    . PHE C  2  191  ? 52.774  -34.131 43.961   1.00 67.08  ? 191  PHE C CZ    1 
ATOM   5058  N  N     . PRO C  2  192  ? 47.580  -34.678 41.513   1.00 61.01  ? 192  PRO C N     1 
ATOM   5059  C  CA    . PRO C  2  192  ? 47.186  -36.048 41.872   1.00 64.55  ? 192  PRO C CA    1 
ATOM   5060  C  C     . PRO C  2  192  ? 48.335  -36.859 42.472   1.00 62.37  ? 192  PRO C C     1 
ATOM   5061  O  O     . PRO C  2  192  ? 49.427  -36.907 41.906   1.00 60.97  ? 192  PRO C O     1 
ATOM   5062  C  CB    . PRO C  2  192  ? 46.752  -36.652 40.531   1.00 58.92  ? 192  PRO C CB    1 
ATOM   5063  C  CG    . PRO C  2  192  ? 47.415  -35.802 39.495   1.00 52.61  ? 192  PRO C CG    1 
ATOM   5064  C  CD    . PRO C  2  192  ? 47.425  -34.425 40.071   1.00 49.29  ? 192  PRO C CD    1 
ATOM   5065  N  N     . LEU C  2  193  ? 48.072  -37.495 43.609   1.00 57.87  ? 193  LEU C N     1 
ATOM   5066  C  CA    . LEU C  2  193  ? 49.090  -38.257 44.325   1.00 63.06  ? 193  LEU C CA    1 
ATOM   5067  C  C     . LEU C  2  193  ? 49.556  -39.462 43.510   1.00 68.67  ? 193  LEU C C     1 
ATOM   5068  O  O     . LEU C  2  193  ? 50.690  -39.931 43.659   1.00 68.78  ? 193  LEU C O     1 
ATOM   5069  C  CB    . LEU C  2  193  ? 48.549  -38.703 45.688   1.00 55.56  ? 193  LEU C CB    1 
ATOM   5070  C  CG    . LEU C  2  193  ? 49.502  -39.470 46.605   1.00 54.77  ? 193  LEU C CG    1 
ATOM   5071  C  CD1   . LEU C  2  193  ? 50.779  -38.678 46.840   1.00 50.33  ? 193  LEU C CD1   1 
ATOM   5072  C  CD2   . LEU C  2  193  ? 48.828  -39.805 47.925   1.00 44.94  ? 193  LEU C CD2   1 
ATOM   5073  N  N     . VAL C  2  194  ? 48.672  -39.947 42.642   1.00 69.53  ? 194  VAL C N     1 
ATOM   5074  C  CA    . VAL C  2  194  ? 48.946  -41.105 41.800   1.00 63.64  ? 194  VAL C CA    1 
ATOM   5075  C  C     . VAL C  2  194  ? 50.214  -40.906 40.980   1.00 67.32  ? 194  VAL C C     1 
ATOM   5076  O  O     . VAL C  2  194  ? 50.983  -41.845 40.769   1.00 70.91  ? 194  VAL C O     1 
ATOM   5077  C  CB    . VAL C  2  194  ? 47.782  -41.369 40.832   1.00 68.37  ? 194  VAL C CB    1 
ATOM   5078  C  CG1   . VAL C  2  194  ? 47.902  -42.760 40.229   1.00 70.21  ? 194  VAL C CG1   1 
ATOM   5079  C  CG2   . VAL C  2  194  ? 46.449  -41.199 41.546   1.00 79.16  ? 194  VAL C CG2   1 
ATOM   5080  N  N     . LEU C  2  195  ? 50.421  -39.674 40.526   1.00 67.04  ? 195  LEU C N     1 
ATOM   5081  C  CA    . LEU C  2  195  ? 51.579  -39.325 39.713   1.00 65.58  ? 195  LEU C CA    1 
ATOM   5082  C  C     . LEU C  2  195  ? 52.877  -39.572 40.473   1.00 65.06  ? 195  LEU C C     1 
ATOM   5083  O  O     . LEU C  2  195  ? 53.771  -40.281 39.994   1.00 62.93  ? 195  LEU C O     1 
ATOM   5084  C  CB    . LEU C  2  195  ? 51.492  -37.859 39.288   1.00 61.69  ? 195  LEU C CB    1 
ATOM   5085  C  CG    . LEU C  2  195  ? 52.531  -37.377 38.279   1.00 69.13  ? 195  LEU C CG    1 
ATOM   5086  C  CD1   . LEU C  2  195  ? 52.435  -38.179 36.995   1.00 73.26  ? 195  LEU C CD1   1 
ATOM   5087  C  CD2   . LEU C  2  195  ? 52.340  -35.900 38.002   1.00 68.66  ? 195  LEU C CD2   1 
ATOM   5088  N  N     . LEU C  2  196  ? 52.968  -38.986 41.663   1.00 67.06  ? 196  LEU C N     1 
ATOM   5089  C  CA    . LEU C  2  196  ? 54.126  -39.172 42.527   1.00 64.07  ? 196  LEU C CA    1 
ATOM   5090  C  C     . LEU C  2  196  ? 54.313  -40.643 42.871   1.00 60.69  ? 196  LEU C C     1 
ATOM   5091  O  O     . LEU C  2  196  ? 55.436  -41.146 42.881   1.00 62.46  ? 196  LEU C O     1 
ATOM   5092  C  CB    . LEU C  2  196  ? 53.979  -38.362 43.813   1.00 56.96  ? 196  LEU C CB    1 
ATOM   5093  C  CG    . LEU C  2  196  ? 55.141  -38.554 44.788   1.00 50.85  ? 196  LEU C CG    1 
ATOM   5094  C  CD1   . LEU C  2  196  ? 56.387  -37.829 44.294   1.00 42.93  ? 196  LEU C CD1   1 
ATOM   5095  C  CD2   . LEU C  2  196  ? 54.762  -38.111 46.187   1.00 48.89  ? 196  LEU C CD2   1 
ATOM   5096  N  N     . LEU C  2  197  ? 53.209  -41.328 43.153   1.00 57.17  ? 197  LEU C N     1 
ATOM   5097  C  CA    . LEU C  2  197  ? 53.259  -42.758 43.438   1.00 60.07  ? 197  LEU C CA    1 
ATOM   5098  C  C     . LEU C  2  197  ? 53.895  -43.531 42.286   1.00 64.66  ? 197  LEU C C     1 
ATOM   5099  O  O     . LEU C  2  197  ? 54.675  -44.456 42.508   1.00 66.04  ? 197  LEU C O     1 
ATOM   5100  C  CB    . LEU C  2  197  ? 51.862  -43.303 43.740   1.00 61.26  ? 197  LEU C CB    1 
ATOM   5101  C  CG    . LEU C  2  197  ? 51.254  -42.873 45.075   1.00 53.71  ? 197  LEU C CG    1 
ATOM   5102  C  CD1   . LEU C  2  197  ? 49.900  -43.529 45.283   1.00 60.59  ? 197  LEU C CD1   1 
ATOM   5103  C  CD2   . LEU C  2  197  ? 52.196  -43.210 46.215   1.00 54.00  ? 197  LEU C CD2   1 
ATOM   5104  N  N     . ARG C  2  198  ? 53.569  -43.139 41.057   1.00 64.03  ? 198  ARG C N     1 
ATOM   5105  C  CA    . ARG C  2  198  ? 54.150  -43.778 39.881   1.00 67.39  ? 198  ARG C CA    1 
ATOM   5106  C  C     . ARG C  2  198  ? 55.631  -43.438 39.758   1.00 66.04  ? 198  ARG C C     1 
ATOM   5107  O  O     . ARG C  2  198  ? 56.434  -44.273 39.343   1.00 68.31  ? 198  ARG C O     1 
ATOM   5108  C  CB    . ARG C  2  198  ? 53.409  -43.366 38.609   1.00 73.19  ? 198  ARG C CB    1 
ATOM   5109  C  CG    . ARG C  2  198  ? 53.779  -44.190 37.378   1.00 87.01  ? 198  ARG C CG    1 
ATOM   5110  C  CD    . ARG C  2  198  ? 53.285  -45.629 37.497   1.00 90.61  ? 198  ARG C CD    1 
ATOM   5111  N  NE    . ARG C  2  198  ? 53.539  -46.410 36.286   1.00 100.65 ? 198  ARG C NE    1 
ATOM   5112  C  CZ    . ARG C  2  198  ? 54.491  -47.331 36.170   1.00 99.48  ? 198  ARG C CZ    1 
ATOM   5113  N  NH1   . ARG C  2  198  ? 54.645  -47.990 35.029   1.00 89.23  ? 198  ARG C NH1   1 
ATOM   5114  N  NH2   . ARG C  2  198  ? 55.288  -47.600 37.195   1.00 95.71  ? 198  ARG C NH2   1 
ATOM   5115  N  N     . VAL C  2  199  ? 55.989  -42.208 40.118   1.00 65.65  ? 199  VAL C N     1 
ATOM   5116  C  CA    . VAL C  2  199  ? 57.393  -41.809 40.136   1.00 61.70  ? 199  VAL C CA    1 
ATOM   5117  C  C     . VAL C  2  199  ? 58.160  -42.648 41.157   1.00 59.72  ? 199  VAL C C     1 
ATOM   5118  O  O     . VAL C  2  199  ? 59.319  -43.005 40.942   1.00 60.46  ? 199  VAL C O     1 
ATOM   5119  C  CB    . VAL C  2  199  ? 57.557  -40.309 40.461   1.00 58.95  ? 199  VAL C CB    1 
ATOM   5120  C  CG1   . VAL C  2  199  ? 59.029  -39.932 40.542   1.00 51.61  ? 199  VAL C CG1   1 
ATOM   5121  C  CG2   . VAL C  2  199  ? 56.849  -39.462 39.420   1.00 58.60  ? 199  VAL C CG2   1 
ATOM   5122  N  N     . LEU C  2  200  ? 57.491  -42.980 42.258   1.00 64.19  ? 200  LEU C N     1 
ATOM   5123  C  CA    . LEU C  2  200  ? 58.088  -43.795 43.315   1.00 69.01  ? 200  LEU C CA    1 
ATOM   5124  C  C     . LEU C  2  200  ? 58.369  -45.225 42.855   1.00 70.38  ? 200  LEU C C     1 
ATOM   5125  O  O     . LEU C  2  200  ? 59.120  -45.958 43.501   1.00 74.46  ? 200  LEU C O     1 
ATOM   5126  C  CB    . LEU C  2  200  ? 57.190  -43.812 44.556   1.00 65.40  ? 200  LEU C CB    1 
ATOM   5127  C  CG    . LEU C  2  200  ? 57.593  -42.906 45.723   1.00 60.00  ? 200  LEU C CG    1 
ATOM   5128  C  CD1   . LEU C  2  200  ? 59.042  -43.153 46.106   1.00 71.54  ? 200  LEU C CD1   1 
ATOM   5129  C  CD2   . LEU C  2  200  ? 57.368  -41.441 45.395   1.00 47.14  ? 200  LEU C CD2   1 
ATOM   5130  N  N     . GLY C  2  201  ? 57.760  -45.618 41.741   1.00 69.35  ? 201  GLY C N     1 
ATOM   5131  C  CA    . GLY C  2  201  ? 57.957  -46.947 41.194   1.00 71.80  ? 201  GLY C CA    1 
ATOM   5132  C  C     . GLY C  2  201  ? 56.800  -47.886 41.473   1.00 72.70  ? 201  GLY C C     1 
ATOM   5133  O  O     . GLY C  2  201  ? 56.864  -49.073 41.154   1.00 71.02  ? 201  GLY C O     1 
ATOM   5134  N  N     . TYR C  2  202  ? 55.738  -47.357 42.074   1.00 76.72  ? 202  TYR C N     1 
ATOM   5135  C  CA    . TYR C  2  202  ? 54.551  -48.157 42.355   1.00 77.72  ? 202  TYR C CA    1 
ATOM   5136  C  C     . TYR C  2  202  ? 53.798  -48.488 41.075   1.00 78.95  ? 202  TYR C C     1 
ATOM   5137  O  O     . TYR C  2  202  ? 53.836  -47.732 40.103   1.00 70.07  ? 202  TYR C O     1 
ATOM   5138  C  CB    . TYR C  2  202  ? 53.617  -47.445 43.339   1.00 78.48  ? 202  TYR C CB    1 
ATOM   5139  C  CG    . TYR C  2  202  ? 54.075  -47.501 44.779   1.00 75.00  ? 202  TYR C CG    1 
ATOM   5140  C  CD1   . TYR C  2  202  ? 54.125  -48.707 45.464   1.00 74.96  ? 202  TYR C CD1   1 
ATOM   5141  C  CD2   . TYR C  2  202  ? 54.446  -46.346 45.456   1.00 71.21  ? 202  TYR C CD2   1 
ATOM   5142  C  CE1   . TYR C  2  202  ? 54.542  -48.765 46.779   1.00 77.23  ? 202  TYR C CE1   1 
ATOM   5143  C  CE2   . TYR C  2  202  ? 54.863  -46.394 46.772   1.00 71.73  ? 202  TYR C CE2   1 
ATOM   5144  C  CZ    . TYR C  2  202  ? 54.909  -47.606 47.428   1.00 75.95  ? 202  TYR C CZ    1 
ATOM   5145  O  OH    . TYR C  2  202  ? 55.325  -47.658 48.739   1.00 75.80  ? 202  TYR C OH    1 
ATOM   5146  N  N     . ASP C  2  203  ? 53.113  -49.624 41.086   1.00 89.35  ? 203  ASP C N     1 
ATOM   5147  C  CA    . ASP C  2  203  ? 52.317  -50.049 39.946   1.00 91.12  ? 203  ASP C CA    1 
ATOM   5148  C  C     . ASP C  2  203  ? 50.884  -50.285 40.397   1.00 88.79  ? 203  ASP C C     1 
ATOM   5149  O  O     . ASP C  2  203  ? 50.616  -50.387 41.593   1.00 92.63  ? 203  ASP C O     1 
ATOM   5150  C  CB    . ASP C  2  203  ? 52.901  -51.318 39.324   1.00 91.22  ? 203  ASP C CB    1 
ATOM   5151  C  CG    . ASP C  2  203  ? 52.519  -51.479 37.867   1.00 102.72 ? 203  ASP C CG    1 
ATOM   5152  O  OD1   . ASP C  2  203  ? 51.334  -51.267 37.534   1.00 104.56 ? 203  ASP C OD1   1 
ATOM   5153  O  OD2   . ASP C  2  203  ? 53.407  -51.810 37.053   1.00 108.80 ? 203  ASP C OD2   1 
ATOM   5154  N  N     . GLN C  2  204  ? 49.968  -50.357 39.437   1.00 86.11  ? 204  GLN C N     1 
ATOM   5155  C  CA    . GLN C  2  204  ? 48.548  -50.525 39.732   1.00 83.71  ? 204  GLN C CA    1 
ATOM   5156  C  C     . GLN C  2  204  ? 48.267  -51.803 40.520   1.00 86.87  ? 204  GLN C C     1 
ATOM   5157  O  O     . GLN C  2  204  ? 47.359  -51.843 41.349   1.00 80.37  ? 204  GLN C O     1 
ATOM   5158  C  CB    . GLN C  2  204  ? 47.735  -50.503 38.438   1.00 82.02  ? 204  GLN C CB    1 
ATOM   5159  C  CG    . GLN C  2  204  ? 46.236  -50.548 38.648   1.00 78.91  ? 204  GLN C CG    1 
ATOM   5160  C  CD    . GLN C  2  204  ? 45.466  -50.094 37.425   1.00 81.85  ? 204  GLN C CD    1 
ATOM   5161  O  OE1   . GLN C  2  204  ? 46.051  -49.814 36.377   1.00 72.09  ? 204  GLN C OE1   1 
ATOM   5162  N  NE2   . GLN C  2  204  ? 44.147  -50.012 37.553   1.00 85.40  ? 204  GLN C NE2   1 
ATOM   5163  N  N     . GLU C  2  205  ? 49.060  -52.838 40.260   1.00 89.39  ? 205  GLU C N     1 
ATOM   5164  C  CA    . GLU C  2  205  ? 48.938  -54.109 40.962   1.00 86.94  ? 205  GLU C CA    1 
ATOM   5165  C  C     . GLU C  2  205  ? 49.177  -53.930 42.458   1.00 85.16  ? 205  GLU C C     1 
ATOM   5166  O  O     . GLU C  2  205  ? 48.321  -54.267 43.282   1.00 84.83  ? 205  GLU C O     1 
ATOM   5167  C  CB    . GLU C  2  205  ? 49.952  -55.109 40.403   1.00 100.60 ? 205  GLU C CB    1 
ATOM   5168  C  CG    . GLU C  2  205  ? 49.722  -56.548 40.830   1.00 113.48 ? 205  GLU C CG    1 
ATOM   5169  C  CD    . GLU C  2  205  ? 48.960  -57.346 39.790   1.00 120.48 ? 205  GLU C CD    1 
ATOM   5170  O  OE1   . GLU C  2  205  ? 48.674  -56.792 38.707   1.00 115.65 ? 205  GLU C OE1   1 
ATOM   5171  O  OE2   . GLU C  2  205  ? 48.650  -58.527 40.052   1.00 133.86 ? 205  GLU C OE2   1 
ATOM   5172  N  N     . THR C  2  206  ? 50.345  -53.387 42.791   1.00 86.12  ? 206  THR C N     1 
ATOM   5173  C  CA    . THR C  2  206  ? 50.775  -53.205 44.175   1.00 87.15  ? 206  THR C CA    1 
ATOM   5174  C  C     . THR C  2  206  ? 49.813  -52.326 44.977   1.00 84.28  ? 206  THR C C     1 
ATOM   5175  O  O     . THR C  2  206  ? 49.505  -52.618 46.135   1.00 77.20  ? 206  THR C O     1 
ATOM   5176  C  CB    . THR C  2  206  ? 52.185  -52.585 44.237   1.00 80.72  ? 206  THR C CB    1 
ATOM   5177  O  OG1   . THR C  2  206  ? 52.989  -53.106 43.172   1.00 66.71  ? 206  THR C OG1   1 
ATOM   5178  C  CG2   . THR C  2  206  ? 52.848  -52.888 45.575   1.00 82.58  ? 206  THR C CG2   1 
ATOM   5179  N  N     . LEU C  2  207  ? 49.336  -51.254 44.352   1.00 87.24  ? 207  LEU C N     1 
ATOM   5180  C  CA    . LEU C  2  207  ? 48.401  -50.342 45.001   1.00 86.13  ? 207  LEU C CA    1 
ATOM   5181  C  C     . LEU C  2  207  ? 47.015  -50.972 45.127   1.00 86.59  ? 207  LEU C C     1 
ATOM   5182  O  O     . LEU C  2  207  ? 46.271  -50.672 46.064   1.00 89.47  ? 207  LEU C O     1 
ATOM   5183  C  CB    . LEU C  2  207  ? 48.329  -49.012 44.244   1.00 78.74  ? 207  LEU C CB    1 
ATOM   5184  C  CG    . LEU C  2  207  ? 49.607  -48.168 44.256   1.00 74.54  ? 207  LEU C CG    1 
ATOM   5185  C  CD1   . LEU C  2  207  ? 49.491  -46.976 43.320   1.00 70.11  ? 207  LEU C CD1   1 
ATOM   5186  C  CD2   . LEU C  2  207  ? 49.935  -47.706 45.669   1.00 75.80  ? 207  LEU C CD2   1 
ATOM   5187  N  N     . ALA C  2  208  ? 46.675  -51.852 44.187   1.00 86.26  ? 208  ALA C N     1 
ATOM   5188  C  CA    . ALA C  2  208  ? 45.398  -52.560 44.235   1.00 90.34  ? 208  ALA C CA    1 
ATOM   5189  C  C     . ALA C  2  208  ? 45.362  -53.594 45.357   1.00 89.83  ? 208  ALA C C     1 
ATOM   5190  O  O     . ALA C  2  208  ? 44.342  -53.747 46.030   1.00 85.13  ? 208  ALA C O     1 
ATOM   5191  C  CB    . ALA C  2  208  ? 45.090  -53.218 42.897   1.00 91.04  ? 208  ALA C CB    1 
ATOM   5192  N  N     . ARG C  2  209  ? 46.466  -54.311 45.553   1.00 88.71  ? 209  ARG C N     1 
ATOM   5193  C  CA    . ARG C  2  209  ? 46.530  -55.290 46.637   1.00 82.76  ? 209  ARG C CA    1 
ATOM   5194  C  C     . ARG C  2  209  ? 46.710  -54.624 48.001   1.00 90.70  ? 209  ARG C C     1 
ATOM   5195  O  O     . ARG C  2  209  ? 46.132  -55.065 48.995   1.00 95.20  ? 209  ARG C O     1 
ATOM   5196  C  CB    . ARG C  2  209  ? 47.629  -56.333 46.393   1.00 79.88  ? 209  ARG C CB    1 
ATOM   5197  C  CG    . ARG C  2  209  ? 48.978  -55.757 46.006   1.00 87.15  ? 209  ARG C CG    1 
ATOM   5198  C  CD    . ARG C  2  209  ? 50.076  -56.806 46.064   1.00 85.57  ? 209  ARG C CD    1 
ATOM   5199  N  NE    . ARG C  2  209  ? 50.467  -57.103 47.439   1.00 102.87 ? 209  ARG C NE    1 
ATOM   5200  C  CZ    . ARG C  2  209  ? 51.461  -56.496 48.080   1.00 101.41 ? 209  ARG C CZ    1 
ATOM   5201  N  NH1   . ARG C  2  209  ? 52.170  -55.555 47.471   1.00 85.21  ? 209  ARG C NH1   1 
ATOM   5202  N  NH2   . ARG C  2  209  ? 51.746  -56.827 49.333   1.00 101.13 ? 209  ARG C NH2   1 
ATOM   5203  N  N     . GLU C  2  210  ? 47.504  -53.557 48.046   1.00 90.78  ? 210  GLU C N     1 
ATOM   5204  C  CA    . GLU C  2  210  ? 47.772  -52.869 49.305   1.00 80.93  ? 210  GLU C CA    1 
ATOM   5205  C  C     . GLU C  2  210  ? 46.578  -52.054 49.802   1.00 82.91  ? 210  GLU C C     1 
ATOM   5206  O  O     . GLU C  2  210  ? 46.152  -52.198 50.947   1.00 83.84  ? 210  GLU C O     1 
ATOM   5207  C  CB    . GLU C  2  210  ? 48.992  -51.956 49.169   1.00 76.77  ? 210  GLU C CB    1 
ATOM   5208  C  CG    . GLU C  2  210  ? 49.936  -52.014 50.353   1.00 87.21  ? 210  GLU C CG    1 
ATOM   5209  C  CD    . GLU C  2  210  ? 50.731  -53.302 50.390   1.00 94.60  ? 210  GLU C CD    1 
ATOM   5210  O  OE1   . GLU C  2  210  ? 51.197  -53.739 49.316   1.00 87.39  ? 210  GLU C OE1   1 
ATOM   5211  O  OE2   . GLU C  2  210  ? 50.887  -53.879 51.487   1.00 100.25 ? 210  GLU C OE2   1 
ATOM   5212  N  N     . LEU C  2  211  ? 46.045  -51.198 48.934   1.00 83.28  ? 211  LEU C N     1 
ATOM   5213  C  CA    . LEU C  2  211  ? 44.994  -50.259 49.329   1.00 83.68  ? 211  LEU C CA    1 
ATOM   5214  C  C     . LEU C  2  211  ? 43.579  -50.733 48.997   1.00 84.10  ? 211  LEU C C     1 
ATOM   5215  O  O     . LEU C  2  211  ? 42.604  -50.024 49.255   1.00 78.43  ? 211  LEU C O     1 
ATOM   5216  C  CB    . LEU C  2  211  ? 45.250  -48.882 48.706   1.00 82.95  ? 211  LEU C CB    1 
ATOM   5217  C  CG    . LEU C  2  211  ? 46.097  -47.887 49.506   1.00 79.07  ? 211  LEU C CG    1 
ATOM   5218  C  CD1   . LEU C  2  211  ? 47.400  -48.504 49.996   1.00 77.93  ? 211  LEU C CD1   1 
ATOM   5219  C  CD2   . LEU C  2  211  ? 46.379  -46.657 48.666   1.00 72.46  ? 211  LEU C CD2   1 
ATOM   5220  N  N     . GLY C  2  212  ? 43.473  -51.928 48.428   1.00 88.74  ? 212  GLY C N     1 
ATOM   5221  C  CA    . GLY C  2  212  ? 42.194  -52.448 47.982   1.00 85.97  ? 212  GLY C CA    1 
ATOM   5222  C  C     . GLY C  2  212  ? 41.222  -52.763 49.102   1.00 82.06  ? 212  GLY C C     1 
ATOM   5223  O  O     . GLY C  2  212  ? 40.008  -52.672 48.917   1.00 79.49  ? 212  GLY C O     1 
ATOM   5224  N  N     . ALA C  2  213  ? 41.756  -53.123 50.265   1.00 79.06  ? 213  ALA C N     1 
ATOM   5225  C  CA    . ALA C  2  213  ? 40.936  -53.520 51.407   1.00 83.69  ? 213  ALA C CA    1 
ATOM   5226  C  C     . ALA C  2  213  ? 39.921  -52.449 51.817   1.00 89.00  ? 213  ALA C C     1 
ATOM   5227  O  O     . ALA C  2  213  ? 38.867  -52.760 52.375   1.00 87.06  ? 213  ALA C O     1 
ATOM   5228  C  CB    . ALA C  2  213  ? 41.824  -53.901 52.589   1.00 72.62  ? 213  ALA C CB    1 
ATOM   5229  N  N     . TYR C  2  214  ? 40.242  -51.190 51.532   1.00 90.92  ? 214  TYR C N     1 
ATOM   5230  C  CA    . TYR C  2  214  ? 39.368  -50.074 51.880   1.00 88.26  ? 214  TYR C CA    1 
ATOM   5231  C  C     . TYR C  2  214  ? 38.471  -49.718 50.701   1.00 91.23  ? 214  TYR C C     1 
ATOM   5232  O  O     . TYR C  2  214  ? 38.950  -49.317 49.639   1.00 87.43  ? 214  TYR C O     1 
ATOM   5233  C  CB    . TYR C  2  214  ? 40.199  -48.878 52.343   1.00 65.53  ? 214  TYR C CB    1 
ATOM   5234  C  CG    . TYR C  2  214  ? 41.253  -49.277 53.351   1.00 68.00  ? 214  TYR C CG    1 
ATOM   5235  C  CD1   . TYR C  2  214  ? 40.929  -49.450 54.692   1.00 60.96  ? 214  TYR C CD1   1 
ATOM   5236  C  CD2   . TYR C  2  214  ? 42.566  -49.509 52.959   1.00 71.99  ? 214  TYR C CD2   1 
ATOM   5237  C  CE1   . TYR C  2  214  ? 41.888  -49.829 55.617   1.00 58.78  ? 214  TYR C CE1   1 
ATOM   5238  C  CE2   . TYR C  2  214  ? 43.532  -49.889 53.877   1.00 67.60  ? 214  TYR C CE2   1 
ATOM   5239  C  CZ    . TYR C  2  214  ? 43.187  -50.047 55.204   1.00 64.93  ? 214  TYR C CZ    1 
ATOM   5240  O  OH    . TYR C  2  214  ? 44.143  -50.423 56.122   1.00 61.26  ? 214  TYR C OH    1 
ATOM   5241  N  N     . GLY C  2  215  ? 37.166  -49.871 50.905   1.00 91.09  ? 215  GLY C N     1 
ATOM   5242  C  CA    . GLY C  2  215  ? 36.202  -49.838 49.821   1.00 96.59  ? 215  GLY C CA    1 
ATOM   5243  C  C     . GLY C  2  215  ? 36.099  -48.542 49.044   1.00 96.47  ? 215  GLY C C     1 
ATOM   5244  O  O     . GLY C  2  215  ? 35.879  -47.477 49.616   1.00 97.28  ? 215  GLY C O     1 
ATOM   5245  N  N     . GLU C  2  216  ? 36.287  -48.653 47.730   1.00 100.84 ? 216  GLU C N     1 
ATOM   5246  C  CA    . GLU C  2  216  ? 36.036  -47.579 46.760   1.00 102.44 ? 216  GLU C CA    1 
ATOM   5247  C  C     . GLU C  2  216  ? 36.925  -46.332 46.879   1.00 99.59  ? 216  GLU C C     1 
ATOM   5248  O  O     . GLU C  2  216  ? 36.902  -45.469 45.999   1.00 97.87  ? 216  GLU C O     1 
ATOM   5249  C  CB    . GLU C  2  216  ? 34.544  -47.208 46.703   1.00 94.47  ? 216  GLU C CB    1 
ATOM   5250  C  CG    . GLU C  2  216  ? 34.129  -46.025 47.564   1.00 89.96  ? 216  GLU C CG    1 
ATOM   5251  C  CD    . GLU C  2  216  ? 32.641  -45.746 47.486   1.00 91.94  ? 216  GLU C CD    1 
ATOM   5252  O  OE1   . GLU C  2  216  ? 31.999  -46.207 46.518   1.00 93.12  ? 216  GLU C OE1   1 
ATOM   5253  O  OE2   . GLU C  2  216  ? 32.111  -45.071 48.394   1.00 85.41  ? 216  GLU C OE2   1 
ATOM   5254  N  N     . LEU C  2  217  ? 37.714  -46.243 47.948   1.00 93.84  ? 217  LEU C N     1 
ATOM   5255  C  CA    . LEU C  2  217  ? 38.664  -45.145 48.088   1.00 86.40  ? 217  LEU C CA    1 
ATOM   5256  C  C     . LEU C  2  217  ? 39.763  -45.290 47.045   1.00 83.53  ? 217  LEU C C     1 
ATOM   5257  O  O     . LEU C  2  217  ? 40.107  -44.333 46.352   1.00 82.73  ? 217  LEU C O     1 
ATOM   5258  C  CB    . LEU C  2  217  ? 39.287  -45.117 49.489   1.00 84.92  ? 217  LEU C CB    1 
ATOM   5259  C  CG    . LEU C  2  217  ? 38.565  -44.369 50.615   1.00 74.50  ? 217  LEU C CG    1 
ATOM   5260  C  CD1   . LEU C  2  217  ? 37.988  -43.049 50.116   1.00 66.28  ? 217  LEU C CD1   1 
ATOM   5261  C  CD2   . LEU C  2  217  ? 37.488  -45.231 51.256   1.00 84.96  ? 217  LEU C CD2   1 
ATOM   5262  N  N     . VAL C  2  218  ? 40.295  -46.504 46.935   1.00 85.70  ? 218  VAL C N     1 
ATOM   5263  C  CA    . VAL C  2  218  ? 41.408  -46.798 46.036   1.00 85.95  ? 218  VAL C CA    1 
ATOM   5264  C  C     . VAL C  2  218  ? 41.046  -46.541 44.570   1.00 84.64  ? 218  VAL C C     1 
ATOM   5265  O  O     . VAL C  2  218  ? 41.924  -46.345 43.731   1.00 84.36  ? 218  VAL C O     1 
ATOM   5266  C  CB    . VAL C  2  218  ? 41.913  -48.252 46.234   1.00 82.34  ? 218  VAL C CB    1 
ATOM   5267  C  CG1   . VAL C  2  218  ? 40.858  -49.253 45.787   1.00 88.58  ? 218  VAL C CG1   1 
ATOM   5268  C  CG2   . VAL C  2  218  ? 43.236  -48.482 45.506   1.00 76.06  ? 218  VAL C CG2   1 
ATOM   5269  N  N     . GLN C  2  219  ? 39.751  -46.522 44.267   1.00 89.63  ? 219  GLN C N     1 
ATOM   5270  C  CA    . GLN C  2  219  ? 39.292  -46.257 42.906   1.00 98.14  ? 219  GLN C CA    1 
ATOM   5271  C  C     . GLN C  2  219  ? 39.590  -44.822 42.474   1.00 90.46  ? 219  GLN C C     1 
ATOM   5272  O  O     . GLN C  2  219  ? 39.759  -44.545 41.286   1.00 82.60  ? 219  GLN C O     1 
ATOM   5273  C  CB    . GLN C  2  219  ? 37.799  -46.567 42.760   1.00 99.66  ? 219  GLN C CB    1 
ATOM   5274  C  CG    . GLN C  2  219  ? 37.453  -48.047 42.870   1.00 105.87 ? 219  GLN C CG    1 
ATOM   5275  C  CD    . GLN C  2  219  ? 38.055  -48.885 41.749   1.00 106.52 ? 219  GLN C CD    1 
ATOM   5276  O  OE1   . GLN C  2  219  ? 38.350  -50.067 41.934   1.00 103.82 ? 219  GLN C OE1   1 
ATOM   5277  N  NE2   . GLN C  2  219  ? 38.229  -48.278 40.579   1.00 90.01  ? 219  GLN C NE2   1 
ATOM   5278  N  N     . GLY C  2  220  ? 39.655  -43.915 43.444   1.00 86.47  ? 220  GLY C N     1 
ATOM   5279  C  CA    . GLY C  2  220  ? 40.037  -42.542 43.175   1.00 84.43  ? 220  GLY C CA    1 
ATOM   5280  C  C     . GLY C  2  220  ? 41.534  -42.432 42.953   1.00 85.83  ? 220  GLY C C     1 
ATOM   5281  O  O     . GLY C  2  220  ? 42.039  -41.418 42.470   1.00 80.75  ? 220  GLY C O     1 
ATOM   5282  N  N     . LEU C  2  221  ? 42.246  -43.491 43.323   1.00 88.96  ? 221  LEU C N     1 
ATOM   5283  C  CA    . LEU C  2  221  ? 43.687  -43.561 43.142   1.00 82.13  ? 221  LEU C CA    1 
ATOM   5284  C  C     . LEU C  2  221  ? 44.037  -44.203 41.795   1.00 87.44  ? 221  LEU C C     1 
ATOM   5285  O  O     . LEU C  2  221  ? 45.188  -44.175 41.360   1.00 86.93  ? 221  LEU C O     1 
ATOM   5286  C  CB    . LEU C  2  221  ? 44.307  -44.334 44.312   1.00 75.42  ? 221  LEU C CB    1 
ATOM   5287  C  CG    . LEU C  2  221  ? 45.782  -44.729 44.325   1.00 77.56  ? 221  LEU C CG    1 
ATOM   5288  C  CD1   . LEU C  2  221  ? 46.331  -44.571 45.717   1.00 69.55  ? 221  LEU C CD1   1 
ATOM   5289  C  CD2   . LEU C  2  221  ? 45.947  -46.167 43.857   1.00 87.78  ? 221  LEU C CD2   1 
ATOM   5290  N  N     . MET C  2  222  ? 43.033  -44.754 41.118   1.00 91.44  ? 222  MET C N     1 
ATOM   5291  C  CA    . MET C  2  222  ? 43.270  -45.454 39.859   1.00 86.77  ? 222  MET C CA    1 
ATOM   5292  C  C     . MET C  2  222  ? 43.111  -44.534 38.654   1.00 86.37  ? 222  MET C C     1 
ATOM   5293  O  O     . MET C  2  222  ? 42.005  -44.104 38.327   1.00 80.45  ? 222  MET C O     1 
ATOM   5294  C  CB    . MET C  2  222  ? 42.329  -46.654 39.721   1.00 84.86  ? 222  MET C CB    1 
ATOM   5295  C  CG    . MET C  2  222  ? 42.566  -47.755 40.745   1.00 93.53  ? 222  MET C CG    1 
ATOM   5296  S  SD    . MET C  2  222  ? 44.204  -48.501 40.612   1.00 93.29  ? 222  MET C SD    1 
ATOM   5297  C  CE    . MET C  2  222  ? 44.173  -49.652 41.985   1.00 83.91  ? 222  MET C CE    1 
ATOM   5298  N  N     . ASP C  2  223  ? 44.229  -44.248 37.996   1.00 90.95  ? 223  ASP C N     1 
ATOM   5299  C  CA    . ASP C  2  223  ? 44.229  -43.446 36.779   1.00 100.52 ? 223  ASP C CA    1 
ATOM   5300  C  C     . ASP C  2  223  ? 45.096  -44.127 35.724   1.00 102.75 ? 223  ASP C C     1 
ATOM   5301  O  O     . ASP C  2  223  ? 46.307  -44.270 35.899   1.00 95.56  ? 223  ASP C O     1 
ATOM   5302  C  CB    . ASP C  2  223  ? 44.742  -42.032 37.067   1.00 97.80  ? 223  ASP C CB    1 
ATOM   5303  C  CG    . ASP C  2  223  ? 44.485  -41.073 35.920   1.00 99.91  ? 223  ASP C CG    1 
ATOM   5304  O  OD1   . ASP C  2  223  ? 43.396  -40.461 35.889   1.00 98.00  ? 223  ASP C OD1   1 
ATOM   5305  O  OD2   . ASP C  2  223  ? 45.371  -40.929 35.051   1.00 96.90  ? 223  ASP C OD2   1 
ATOM   5306  N  N     . GLU C  2  224  ? 44.469  -44.535 34.626   1.00 107.18 ? 224  GLU C N     1 
ATOM   5307  C  CA    . GLU C  2  224  ? 45.136  -45.326 33.594   1.00 108.54 ? 224  GLU C CA    1 
ATOM   5308  C  C     . GLU C  2  224  ? 46.269  -44.580 32.890   1.00 101.10 ? 224  GLU C C     1 
ATOM   5309  O  O     . GLU C  2  224  ? 47.298  -45.173 32.562   1.00 96.79  ? 224  GLU C O     1 
ATOM   5310  C  CB    . GLU C  2  224  ? 44.121  -45.845 32.567   1.00 110.63 ? 224  GLU C CB    1 
ATOM   5311  C  CG    . GLU C  2  224  ? 43.247  -44.768 31.928   1.00 115.90 ? 224  GLU C CG    1 
ATOM   5312  C  CD    . GLU C  2  224  ? 42.127  -44.297 32.840   1.00 118.32 ? 224  GLU C CD    1 
ATOM   5313  O  OE1   . GLU C  2  224  ? 41.183  -45.079 33.078   1.00 126.68 ? 224  GLU C OE1   1 
ATOM   5314  O  OE2   . GLU C  2  224  ? 42.198  -43.148 33.328   1.00 105.01 ? 224  GLU C OE2   1 
ATOM   5315  N  N     . SER C  2  225  ? 46.078  -43.284 32.665   1.00 95.45  ? 225  SER C N     1 
ATOM   5316  C  CA    . SER C  2  225  ? 47.073  -42.472 31.971   1.00 92.78  ? 225  SER C CA    1 
ATOM   5317  C  C     . SER C  2  225  ? 48.382  -42.391 32.752   1.00 93.63  ? 225  SER C C     1 
ATOM   5318  O  O     . SER C  2  225  ? 49.452  -42.208 32.173   1.00 88.73  ? 225  SER C O     1 
ATOM   5319  C  CB    . SER C  2  225  ? 46.527  -41.066 31.710   1.00 88.60  ? 225  SER C CB    1 
ATOM   5320  O  OG    . SER C  2  225  ? 46.145  -40.433 32.918   1.00 89.86  ? 225  SER C OG    1 
ATOM   5321  N  N     . VAL C  2  226  ? 48.288  -42.536 34.069   1.00 98.95  ? 226  VAL C N     1 
ATOM   5322  C  CA    . VAL C  2  226  ? 49.460  -42.465 34.932   1.00 97.86  ? 226  VAL C CA    1 
ATOM   5323  C  C     . VAL C  2  226  ? 50.268  -43.762 34.896   1.00 94.22  ? 226  VAL C C     1 
ATOM   5324  O  O     . VAL C  2  226  ? 51.496  -43.735 34.828   1.00 95.75  ? 226  VAL C O     1 
ATOM   5325  C  CB    . VAL C  2  226  ? 49.066  -42.139 36.386   1.00 92.64  ? 226  VAL C CB    1 
ATOM   5326  C  CG1   . VAL C  2  226  ? 50.299  -42.072 37.271   1.00 83.39  ? 226  VAL C CG1   1 
ATOM   5327  C  CG2   . VAL C  2  226  ? 48.296  -40.828 36.442   1.00 83.61  ? 226  VAL C CG2   1 
ATOM   5328  N  N     . PHE C  2  227  ? 49.575  -44.896 34.933   1.00 92.10  ? 227  PHE C N     1 
ATOM   5329  C  CA    . PHE C  2  227  ? 50.246  -46.192 34.917   1.00 94.87  ? 227  PHE C CA    1 
ATOM   5330  C  C     . PHE C  2  227  ? 50.697  -46.577 33.513   1.00 94.95  ? 227  PHE C C     1 
ATOM   5331  O  O     . PHE C  2  227  ? 51.414  -47.562 33.331   1.00 88.27  ? 227  PHE C O     1 
ATOM   5332  C  CB    . PHE C  2  227  ? 49.340  -47.280 35.500   1.00 92.91  ? 227  PHE C CB    1 
ATOM   5333  C  CG    . PHE C  2  227  ? 48.984  -47.060 36.940   1.00 89.49  ? 227  PHE C CG    1 
ATOM   5334  C  CD1   . PHE C  2  227  ? 49.894  -47.347 37.943   1.00 89.72  ? 227  PHE C CD1   1 
ATOM   5335  C  CD2   . PHE C  2  227  ? 47.740  -46.566 37.291   1.00 84.66  ? 227  PHE C CD2   1 
ATOM   5336  C  CE1   . PHE C  2  227  ? 49.571  -47.142 39.270   1.00 89.39  ? 227  PHE C CE1   1 
ATOM   5337  C  CE2   . PHE C  2  227  ? 47.408  -46.359 38.616   1.00 83.27  ? 227  PHE C CE2   1 
ATOM   5338  C  CZ    . PHE C  2  227  ? 48.325  -46.649 39.607   1.00 91.31  ? 227  PHE C CZ    1 
ATOM   5339  N  N     . ALA C  2  228  ? 50.282  -45.788 32.527   1.00 94.33  ? 228  ALA C N     1 
ATOM   5340  C  CA    . ALA C  2  228  ? 50.617  -46.056 31.133   1.00 93.22  ? 228  ALA C CA    1 
ATOM   5341  C  C     . ALA C  2  228  ? 52.005  -45.530 30.780   1.00 96.52  ? 228  ALA C C     1 
ATOM   5342  O  O     . ALA C  2  228  ? 52.471  -45.691 29.652   1.00 97.29  ? 228  ALA C O     1 
ATOM   5343  C  CB    . ALA C  2  228  ? 49.570  -45.449 30.211   1.00 84.44  ? 228  ALA C CB    1 
ATOM   5344  N  N     . MET C  2  229  ? 52.661  -44.901 31.749   1.00 97.41  ? 229  MET C N     1 
ATOM   5345  C  CA    . MET C  2  229  ? 53.989  -44.340 31.531   1.00 96.91  ? 229  MET C CA    1 
ATOM   5346  C  C     . MET C  2  229  ? 54.984  -44.783 32.599   1.00 101.89 ? 229  MET C C     1 
ATOM   5347  O  O     . MET C  2  229  ? 54.621  -44.971 33.761   1.00 98.03  ? 229  MET C O     1 
ATOM   5348  C  CB    . MET C  2  229  ? 53.921  -42.814 31.470   1.00 95.55  ? 229  MET C CB    1 
ATOM   5349  C  CG    . MET C  2  229  ? 53.200  -42.177 32.645   1.00 89.38  ? 229  MET C CG    1 
ATOM   5350  S  SD    . MET C  2  229  ? 52.999  -40.397 32.450   1.00 94.18  ? 229  MET C SD    1 
ATOM   5351  C  CE    . MET C  2  229  ? 52.008  -40.011 33.888   1.00 90.95  ? 229  MET C CE    1 
ATOM   5352  N  N     . ARG C  2  230  ? 56.237  -44.953 32.189   1.00 105.37 ? 230  ARG C N     1 
ATOM   5353  C  CA    . ARG C  2  230  ? 57.310  -45.352 33.093   1.00 104.85 ? 230  ARG C CA    1 
ATOM   5354  C  C     . ARG C  2  230  ? 57.572  -44.253 34.121   1.00 100.53 ? 230  ARG C C     1 
ATOM   5355  O  O     . ARG C  2  230  ? 57.156  -43.113 33.917   1.00 99.31  ? 230  ARG C O     1 
ATOM   5356  C  CB    . ARG C  2  230  ? 58.587  -45.647 32.298   1.00 102.05 ? 230  ARG C CB    1 
ATOM   5357  C  CG    . ARG C  2  230  ? 58.411  -45.652 30.792   1.00 95.87  ? 230  ARG C CG    1 
ATOM   5358  C  CD    . ARG C  2  230  ? 59.722  -45.994 30.102   1.00 98.42  ? 230  ARG C CD    1 
ATOM   5359  N  NE    . ARG C  2  230  ? 59.628  -45.873 28.650   1.00 112.01 ? 230  ARG C NE    1 
ATOM   5360  C  CZ    . ARG C  2  230  ? 59.911  -44.764 27.975   1.00 113.90 ? 230  ARG C CZ    1 
ATOM   5361  N  NH1   . ARG C  2  230  ? 59.800  -44.743 26.653   1.00 103.60 ? 230  ARG C NH1   1 
ATOM   5362  N  NH2   . ARG C  2  230  ? 60.306  -43.675 28.622   1.00 111.86 ? 230  ARG C NH2   1 
ATOM   5363  N  N     . PRO C  2  231  ? 58.246  -44.596 35.236   1.00 94.03  ? 231  PRO C N     1 
ATOM   5364  C  CA    . PRO C  2  231  ? 58.606  -43.607 36.260   1.00 91.56  ? 231  PRO C CA    1 
ATOM   5365  C  C     . PRO C  2  231  ? 59.275  -42.346 35.707   1.00 91.71  ? 231  PRO C C     1 
ATOM   5366  O  O     . PRO C  2  231  ? 59.082  -41.269 36.267   1.00 88.81  ? 231  PRO C O     1 
ATOM   5367  C  CB    . PRO C  2  231  ? 59.587  -44.378 37.144   1.00 85.35  ? 231  PRO C CB    1 
ATOM   5368  C  CG    . PRO C  2  231  ? 59.103  -45.776 37.072   1.00 81.89  ? 231  PRO C CG    1 
ATOM   5369  C  CD    . PRO C  2  231  ? 58.573  -45.967 35.672   1.00 89.26  ? 231  PRO C CD    1 
ATOM   5370  N  N     . GLU C  2  232  ? 60.038  -42.477 34.626   1.00 92.31  ? 232  GLU C N     1 
ATOM   5371  C  CA    . GLU C  2  232  ? 60.717  -41.331 34.024   1.00 89.33  ? 232  GLU C CA    1 
ATOM   5372  C  C     . GLU C  2  232  ? 59.734  -40.302 33.473   1.00 84.81  ? 232  GLU C C     1 
ATOM   5373  O  O     . GLU C  2  232  ? 59.851  -39.106 33.752   1.00 88.35  ? 232  GLU C O     1 
ATOM   5374  C  CB    . GLU C  2  232  ? 61.674  -41.786 32.919   1.00 99.09  ? 232  GLU C CB    1 
ATOM   5375  C  CG    . GLU C  2  232  ? 62.984  -42.385 33.420   1.00 103.46 ? 232  GLU C CG    1 
ATOM   5376  C  CD    . GLU C  2  232  ? 62.805  -43.739 34.084   1.00 103.82 ? 232  GLU C CD    1 
ATOM   5377  O  OE1   . GLU C  2  232  ? 61.741  -44.367 33.895   1.00 93.80  ? 232  GLU C OE1   1 
ATOM   5378  O  OE2   . GLU C  2  232  ? 63.734  -44.175 34.797   1.00 104.99 ? 232  GLU C OE2   1 
ATOM   5379  N  N     . GLU C  2  233  ? 58.766  -40.772 32.692   1.00 82.43  ? 233  GLU C N     1 
ATOM   5380  C  CA    . GLU C  2  233  ? 57.778  -39.892 32.074   1.00 87.65  ? 233  GLU C CA    1 
ATOM   5381  C  C     . GLU C  2  233  ? 56.889  -39.216 33.117   1.00 90.90  ? 233  GLU C C     1 
ATOM   5382  O  O     . GLU C  2  233  ? 56.537  -38.042 32.981   1.00 87.76  ? 233  GLU C O     1 
ATOM   5383  C  CB    . GLU C  2  233  ? 56.924  -40.667 31.069   1.00 94.49  ? 233  GLU C CB    1 
ATOM   5384  C  CG    . GLU C  2  233  ? 57.729  -41.342 29.970   1.00 102.05 ? 233  GLU C CG    1 
ATOM   5385  C  CD    . GLU C  2  233  ? 56.853  -42.005 28.925   1.00 106.54 ? 233  GLU C CD    1 
ATOM   5386  O  OE1   . GLU C  2  233  ? 55.627  -41.764 28.931   1.00 108.54 ? 233  GLU C OE1   1 
ATOM   5387  O  OE2   . GLU C  2  233  ? 57.391  -42.768 28.096   1.00 104.84 ? 233  GLU C OE2   1 
ATOM   5388  N  N     . ALA C  2  234  ? 56.531  -39.962 34.157   1.00 94.20  ? 234  ALA C N     1 
ATOM   5389  C  CA    . ALA C  2  234  ? 55.737  -39.417 35.251   1.00 85.38  ? 234  ALA C CA    1 
ATOM   5390  C  C     . ALA C  2  234  ? 56.561  -38.419 36.061   1.00 80.21  ? 234  ALA C C     1 
ATOM   5391  O  O     . ALA C  2  234  ? 56.021  -37.476 36.637   1.00 76.13  ? 234  ALA C O     1 
ATOM   5392  C  CB    . ALA C  2  234  ? 55.220  -40.536 36.143   1.00 79.48  ? 234  ALA C CB    1 
ATOM   5393  N  N     . LEU C  2  235  ? 57.872  -38.637 36.098   1.00 82.12  ? 235  LEU C N     1 
ATOM   5394  C  CA    . LEU C  2  235  ? 58.784  -37.731 36.787   1.00 76.54  ? 235  LEU C CA    1 
ATOM   5395  C  C     . LEU C  2  235  ? 58.880  -36.402 36.049   1.00 77.08  ? 235  LEU C C     1 
ATOM   5396  O  O     . LEU C  2  235  ? 58.813  -35.336 36.661   1.00 78.45  ? 235  LEU C O     1 
ATOM   5397  C  CB    . LEU C  2  235  ? 60.172  -38.359 36.913   1.00 76.19  ? 235  LEU C CB    1 
ATOM   5398  C  CG    . LEU C  2  235  ? 61.236  -37.503 37.600   1.00 72.91  ? 235  LEU C CG    1 
ATOM   5399  C  CD1   . LEU C  2  235  ? 60.782  -37.134 38.996   1.00 73.24  ? 235  LEU C CD1   1 
ATOM   5400  C  CD2   . LEU C  2  235  ? 62.566  -38.233 37.646   1.00 73.72  ? 235  LEU C CD2   1 
ATOM   5401  N  N     . ILE C  2  236  ? 59.044  -36.473 34.731   1.00 75.66  ? 236  ILE C N     1 
ATOM   5402  C  CA    . ILE C  2  236  ? 59.102  -35.270 33.906   1.00 74.80  ? 236  ILE C CA    1 
ATOM   5403  C  C     . ILE C  2  236  ? 57.767  -34.523 33.941   1.00 75.49  ? 236  ILE C C     1 
ATOM   5404  O  O     . ILE C  2  236  ? 57.736  -33.294 34.018   1.00 72.40  ? 236  ILE C O     1 
ATOM   5405  C  CB    . ILE C  2  236  ? 59.505  -35.600 32.451   1.00 70.66  ? 236  ILE C CB    1 
ATOM   5406  C  CG1   . ILE C  2  236  ? 60.910  -36.209 32.417   1.00 73.30  ? 236  ILE C CG1   1 
ATOM   5407  C  CG2   . ILE C  2  236  ? 59.451  -34.356 31.582   1.00 68.99  ? 236  ILE C CG2   1 
ATOM   5408  C  CD1   . ILE C  2  236  ? 61.412  -36.525 31.024   1.00 76.87  ? 236  ILE C CD1   1 
ATOM   5409  N  N     . ARG C  2  237  ? 56.670  -35.276 33.900   1.00 79.58  ? 237  ARG C N     1 
ATOM   5410  C  CA    . ARG C  2  237  ? 55.328  -34.705 34.008   1.00 76.67  ? 237  ARG C CA    1 
ATOM   5411  C  C     . ARG C  2  237  ? 55.135  -33.981 35.341   1.00 73.74  ? 237  ARG C C     1 
ATOM   5412  O  O     . ARG C  2  237  ? 54.599  -32.868 35.389   1.00 73.54  ? 237  ARG C O     1 
ATOM   5413  C  CB    . ARG C  2  237  ? 54.276  -35.806 33.846   1.00 81.91  ? 237  ARG C CB    1 
ATOM   5414  C  CG    . ARG C  2  237  ? 52.864  -35.413 34.256   1.00 84.09  ? 237  ARG C CG    1 
ATOM   5415  C  CD    . ARG C  2  237  ? 52.256  -34.388 33.311   1.00 90.86  ? 237  ARG C CD    1 
ATOM   5416  N  NE    . ARG C  2  237  ? 50.845  -34.153 33.611   1.00 98.24  ? 237  ARG C NE    1 
ATOM   5417  C  CZ    . ARG C  2  237  ? 50.070  -33.294 32.957   1.00 95.09  ? 237  ARG C CZ    1 
ATOM   5418  N  NH1   . ARG C  2  237  ? 48.799  -33.151 33.304   1.00 87.93  ? 237  ARG C NH1   1 
ATOM   5419  N  NH2   . ARG C  2  237  ? 50.565  -32.576 31.957   1.00 95.61  ? 237  ARG C NH2   1 
ATOM   5420  N  N     . LEU C  2  238  ? 55.579  -34.620 36.420   1.00 71.93  ? 238  LEU C N     1 
ATOM   5421  C  CA    . LEU C  2  238  ? 55.499  -34.034 37.753   1.00 70.20  ? 238  LEU C CA    1 
ATOM   5422  C  C     . LEU C  2  238  ? 56.341  -32.767 37.835   1.00 69.82  ? 238  LEU C C     1 
ATOM   5423  O  O     . LEU C  2  238  ? 55.943  -31.780 38.457   1.00 67.48  ? 238  LEU C O     1 
ATOM   5424  C  CB    . LEU C  2  238  ? 55.951  -35.047 38.809   1.00 71.15  ? 238  LEU C CB    1 
ATOM   5425  C  CG    . LEU C  2  238  ? 55.976  -34.591 40.270   1.00 66.92  ? 238  LEU C CG    1 
ATOM   5426  C  CD1   . LEU C  2  238  ? 54.654  -33.949 40.657   1.00 63.40  ? 238  LEU C CD1   1 
ATOM   5427  C  CD2   . LEU C  2  238  ? 56.289  -35.764 41.187   1.00 51.94  ? 238  LEU C CD2   1 
ATOM   5428  N  N     . PHE C  2  239  ? 57.505  -32.799 37.195   1.00 68.50  ? 239  PHE C N     1 
ATOM   5429  C  CA    . PHE C  2  239  ? 58.390  -31.643 37.176   1.00 65.49  ? 239  PHE C CA    1 
ATOM   5430  C  C     . PHE C  2  239  ? 57.759  -30.478 36.424   1.00 69.39  ? 239  PHE C C     1 
ATOM   5431  O  O     . PHE C  2  239  ? 57.889  -29.327 36.835   1.00 72.96  ? 239  PHE C O     1 
ATOM   5432  C  CB    . PHE C  2  239  ? 59.739  -32.002 36.557   1.00 64.45  ? 239  PHE C CB    1 
ATOM   5433  C  CG    . PHE C  2  239  ? 60.713  -30.862 36.539   1.00 62.09  ? 239  PHE C CG    1 
ATOM   5434  C  CD1   . PHE C  2  239  ? 61.346  -30.458 37.702   1.00 61.01  ? 239  PHE C CD1   1 
ATOM   5435  C  CD2   . PHE C  2  239  ? 60.994  -30.191 35.362   1.00 69.20  ? 239  PHE C CD2   1 
ATOM   5436  C  CE1   . PHE C  2  239  ? 62.243  -29.410 37.691   1.00 64.72  ? 239  PHE C CE1   1 
ATOM   5437  C  CE2   . PHE C  2  239  ? 61.890  -29.142 35.344   1.00 73.87  ? 239  PHE C CE2   1 
ATOM   5438  C  CZ    . PHE C  2  239  ? 62.515  -28.751 36.510   1.00 72.93  ? 239  PHE C CZ    1 
ATOM   5439  N  N     . THR C  2  240  ? 57.076  -30.779 35.323   1.00 73.86  ? 240  THR C N     1 
ATOM   5440  C  CA    . THR C  2  240  ? 56.383  -29.748 34.555   1.00 71.17  ? 240  THR C CA    1 
ATOM   5441  C  C     . THR C  2  240  ? 55.175  -29.208 35.319   1.00 73.08  ? 240  THR C C     1 
ATOM   5442  O  O     . THR C  2  240  ? 54.770  -28.061 35.125   1.00 72.00  ? 240  THR C O     1 
ATOM   5443  C  CB    . THR C  2  240  ? 55.925  -30.262 33.177   1.00 68.28  ? 240  THR C CB    1 
ATOM   5444  O  OG1   . THR C  2  240  ? 55.073  -31.400 33.347   1.00 83.15  ? 240  THR C OG1   1 
ATOM   5445  C  CG2   . THR C  2  240  ? 57.123  -30.654 32.330   1.00 63.21  ? 240  THR C CG2   1 
ATOM   5446  N  N     . LEU C  2  241  ? 54.600  -30.043 36.180   1.00 75.59  ? 241  LEU C N     1 
ATOM   5447  C  CA    . LEU C  2  241  ? 53.471  -29.623 37.006   1.00 74.08  ? 241  LEU C CA    1 
ATOM   5448  C  C     . LEU C  2  241  ? 53.902  -28.706 38.150   1.00 74.29  ? 241  LEU C C     1 
ATOM   5449  O  O     . LEU C  2  241  ? 53.214  -27.735 38.475   1.00 72.78  ? 241  LEU C O     1 
ATOM   5450  C  CB    . LEU C  2  241  ? 52.715  -30.835 37.556   1.00 71.88  ? 241  LEU C CB    1 
ATOM   5451  C  CG    . LEU C  2  241  ? 51.723  -31.508 36.607   1.00 75.75  ? 241  LEU C CG    1 
ATOM   5452  C  CD1   . LEU C  2  241  ? 50.993  -32.632 37.318   1.00 75.25  ? 241  LEU C CD1   1 
ATOM   5453  C  CD2   . LEU C  2  241  ? 50.735  -30.488 36.064   1.00 84.25  ? 241  LEU C CD2   1 
ATOM   5454  N  N     . LEU C  2  242  ? 55.035  -29.031 38.765   1.00 75.32  ? 242  LEU C N     1 
ATOM   5455  C  CA    . LEU C  2  242  ? 55.553  -28.252 39.886   1.00 75.97  ? 242  LEU C CA    1 
ATOM   5456  C  C     . LEU C  2  242  ? 56.371  -27.036 39.439   1.00 71.25  ? 242  LEU C C     1 
ATOM   5457  O  O     . LEU C  2  242  ? 56.592  -26.112 40.220   1.00 71.05  ? 242  LEU C O     1 
ATOM   5458  C  CB    . LEU C  2  242  ? 56.413  -29.137 40.795   1.00 76.34  ? 242  LEU C CB    1 
ATOM   5459  C  CG    . LEU C  2  242  ? 55.777  -30.381 41.431   1.00 70.01  ? 242  LEU C CG    1 
ATOM   5460  C  CD1   . LEU C  2  242  ? 56.809  -31.134 42.262   1.00 57.09  ? 242  LEU C CD1   1 
ATOM   5461  C  CD2   . LEU C  2  242  ? 54.567  -30.015 42.278   1.00 65.29  ? 242  LEU C CD2   1 
ATOM   5462  N  N     . ARG C  2  243  ? 56.825  -27.040 38.187   1.00 76.43  ? 243  ARG C N     1 
ATOM   5463  C  CA    . ARG C  2  243  ? 57.719  -25.989 37.695   1.00 80.55  ? 243  ARG C CA    1 
ATOM   5464  C  C     . ARG C  2  243  ? 57.334  -25.492 36.294   1.00 81.87  ? 243  ARG C C     1 
ATOM   5465  O  O     . ARG C  2  243  ? 57.959  -25.873 35.303   1.00 81.43  ? 243  ARG C O     1 
ATOM   5466  C  CB    . ARG C  2  243  ? 59.171  -26.487 37.669   1.00 80.10  ? 243  ARG C CB    1 
ATOM   5467  C  CG    . ARG C  2  243  ? 59.732  -26.972 38.993   1.00 74.72  ? 243  ARG C CG    1 
ATOM   5468  C  CD    . ARG C  2  243  ? 60.192  -25.827 39.867   1.00 75.28  ? 243  ARG C CD    1 
ATOM   5469  N  NE    . ARG C  2  243  ? 61.310  -25.088 39.286   1.00 89.31  ? 243  ARG C NE    1 
ATOM   5470  C  CZ    . ARG C  2  243  ? 61.938  -24.087 39.896   1.00 82.87  ? 243  ARG C CZ    1 
ATOM   5471  N  NH1   . ARG C  2  243  ? 62.939  -23.467 39.294   1.00 73.08  ? 243  ARG C NH1   1 
ATOM   5472  N  NH2   . ARG C  2  243  ? 61.564  -23.698 41.106   1.00 74.72  ? 243  ARG C NH2   1 
ATOM   5473  N  N     . PRO C  2  244  ? 56.303  -24.640 36.207   1.00 79.26  ? 244  PRO C N     1 
ATOM   5474  C  CA    . PRO C  2  244  ? 55.903  -24.075 34.911   1.00 83.15  ? 244  PRO C CA    1 
ATOM   5475  C  C     . PRO C  2  244  ? 56.968  -23.137 34.348   1.00 83.99  ? 244  PRO C C     1 
ATOM   5476  O  O     . PRO C  2  244  ? 57.532  -22.337 35.093   1.00 83.88  ? 244  PRO C O     1 
ATOM   5477  C  CB    . PRO C  2  244  ? 54.637  -23.279 35.249   1.00 89.28  ? 244  PRO C CB    1 
ATOM   5478  C  CG    . PRO C  2  244  ? 54.175  -23.810 36.568   1.00 82.65  ? 244  PRO C CG    1 
ATOM   5479  C  CD    . PRO C  2  244  ? 55.414  -24.210 37.296   1.00 79.51  ? 244  PRO C CD    1 
ATOM   5480  N  N     . GLY C  2  245  ? 57.240  -23.244 33.051   1.00 87.14  ? 245  GLY C N     1 
ATOM   5481  C  CA    . GLY C  2  245  ? 58.186  -22.358 32.395   1.00 96.91  ? 245  GLY C CA    1 
ATOM   5482  C  C     . GLY C  2  245  ? 59.610  -22.880 32.398   1.00 90.20  ? 245  GLY C C     1 
ATOM   5483  O  O     . GLY C  2  245  ? 60.437  -22.465 31.584   1.00 84.89  ? 245  GLY C O     1 
ATOM   5484  N  N     . ASP C  2  246  ? 59.895  -23.793 33.319   1.00 89.17  ? 246  ASP C N     1 
ATOM   5485  C  CA    . ASP C  2  246  ? 61.214  -24.404 33.419   1.00 94.88  ? 246  ASP C CA    1 
ATOM   5486  C  C     . ASP C  2  246  ? 61.290  -25.584 32.451   1.00 92.63  ? 246  ASP C C     1 
ATOM   5487  O  O     . ASP C  2  246  ? 60.464  -26.496 32.523   1.00 87.65  ? 246  ASP C O     1 
ATOM   5488  C  CB    . ASP C  2  246  ? 61.462  -24.870 34.858   1.00 93.16  ? 246  ASP C CB    1 
ATOM   5489  C  CG    . ASP C  2  246  ? 62.933  -24.853 35.239   1.00 92.19  ? 246  ASP C CG    1 
ATOM   5490  O  OD1   . ASP C  2  246  ? 63.775  -25.278 34.420   1.00 92.62  ? 246  ASP C OD1   1 
ATOM   5491  O  OD2   . ASP C  2  246  ? 63.247  -24.411 36.366   1.00 85.93  ? 246  ASP C OD2   1 
ATOM   5492  N  N     . PRO C  2  247  ? 62.271  -25.560 31.529   1.00 92.70  ? 247  PRO C N     1 
ATOM   5493  C  CA    . PRO C  2  247  ? 62.431  -26.635 30.540   1.00 87.62  ? 247  PRO C CA    1 
ATOM   5494  C  C     . PRO C  2  247  ? 62.615  -28.004 31.195   1.00 83.47  ? 247  PRO C C     1 
ATOM   5495  O  O     . PRO C  2  247  ? 63.481  -28.164 32.055   1.00 85.04  ? 247  PRO C O     1 
ATOM   5496  C  CB    . PRO C  2  247  ? 63.697  -26.226 29.771   1.00 80.40  ? 247  PRO C CB    1 
ATOM   5497  C  CG    . PRO C  2  247  ? 64.380  -25.213 30.638   1.00 76.40  ? 247  PRO C CG    1 
ATOM   5498  C  CD    . PRO C  2  247  ? 63.279  -24.502 31.356   1.00 84.98  ? 247  PRO C CD    1 
ATOM   5499  N  N     . PRO C  2  248  ? 61.809  -28.989 30.772   1.00 84.67  ? 248  PRO C N     1 
ATOM   5500  C  CA    . PRO C  2  248  ? 61.704  -30.306 31.412   1.00 81.99  ? 248  PRO C CA    1 
ATOM   5501  C  C     . PRO C  2  248  ? 62.874  -31.239 31.110   1.00 77.05  ? 248  PRO C C     1 
ATOM   5502  O  O     . PRO C  2  248  ? 62.658  -32.315 30.551   1.00 76.17  ? 248  PRO C O     1 
ATOM   5503  C  CB    . PRO C  2  248  ? 60.415  -30.888 30.810   1.00 84.65  ? 248  PRO C CB    1 
ATOM   5504  C  CG    . PRO C  2  248  ? 59.736  -29.742 30.105   1.00 87.02  ? 248  PRO C CG    1 
ATOM   5505  C  CD    . PRO C  2  248  ? 60.835  -28.835 29.681   1.00 90.91  ? 248  PRO C CD    1 
ATOM   5506  N  N     . LYS C  2  249  ? 64.087  -30.845 31.479   1.00 74.37  ? 249  LYS C N     1 
ATOM   5507  C  CA    . LYS C  2  249  ? 65.237  -31.727 31.320   1.00 80.73  ? 249  LYS C CA    1 
ATOM   5508  C  C     . LYS C  2  249  ? 65.179  -32.824 32.381   1.00 85.88  ? 249  LYS C C     1 
ATOM   5509  O  O     . LYS C  2  249  ? 64.708  -32.590 33.493   1.00 90.88  ? 249  LYS C O     1 
ATOM   5510  C  CB    . LYS C  2  249  ? 66.545  -30.940 31.419   1.00 84.58  ? 249  LYS C CB    1 
ATOM   5511  C  CG    . LYS C  2  249  ? 67.762  -31.693 30.899   1.00 85.66  ? 249  LYS C CG    1 
ATOM   5512  C  CD    . LYS C  2  249  ? 69.001  -30.811 30.876   1.00 85.55  ? 249  LYS C CD    1 
ATOM   5513  C  CE    . LYS C  2  249  ? 70.188  -31.538 30.261   1.00 75.79  ? 249  LYS C CE    1 
ATOM   5514  N  NZ    . LYS C  2  249  ? 69.927  -31.954 28.852   1.00 56.79  ? 249  LYS C NZ    1 
ATOM   5515  N  N     . ARG C  2  250  ? 65.649  -34.018 32.029   1.00 86.60  ? 250  ARG C N     1 
ATOM   5516  C  CA    . ARG C  2  250  ? 65.554  -35.184 32.909   1.00 87.36  ? 250  ARG C CA    1 
ATOM   5517  C  C     . ARG C  2  250  ? 66.335  -35.023 34.218   1.00 93.33  ? 250  ARG C C     1 
ATOM   5518  O  O     . ARG C  2  250  ? 65.767  -35.143 35.309   1.00 99.10  ? 250  ARG C O     1 
ATOM   5519  C  CB    . ARG C  2  250  ? 66.002  -36.449 32.165   1.00 89.87  ? 250  ARG C CB    1 
ATOM   5520  C  CG    . ARG C  2  250  ? 65.764  -37.755 32.915   1.00 81.59  ? 250  ARG C CG    1 
ATOM   5521  C  CD    . ARG C  2  250  ? 67.018  -38.228 33.640   1.00 78.90  ? 250  ARG C CD    1 
ATOM   5522  N  NE    . ARG C  2  250  ? 66.807  -39.501 34.323   1.00 89.52  ? 250  ARG C NE    1 
ATOM   5523  C  CZ    . ARG C  2  250  ? 67.720  -40.104 35.078   1.00 93.71  ? 250  ARG C CZ    1 
ATOM   5524  N  NH1   . ARG C  2  250  ? 68.911  -39.547 35.252   1.00 93.68  ? 250  ARG C NH1   1 
ATOM   5525  N  NH2   . ARG C  2  250  ? 67.442  -41.262 35.662   1.00 83.23  ? 250  ARG C NH2   1 
ATOM   5526  N  N     . ASP C  2  251  ? 67.633  -34.755 34.105   1.00 87.35  ? 251  ASP C N     1 
ATOM   5527  C  CA    . ASP C  2  251  ? 68.498  -34.612 35.274   1.00 82.04  ? 251  ASP C CA    1 
ATOM   5528  C  C     . ASP C  2  251  ? 68.078  -33.456 36.188   1.00 83.78  ? 251  ASP C C     1 
ATOM   5529  O  O     . ASP C  2  251  ? 68.301  -33.499 37.401   1.00 76.72  ? 251  ASP C O     1 
ATOM   5530  C  CB    . ASP C  2  251  ? 69.958  -34.454 34.841   1.00 84.68  ? 251  ASP C CB    1 
ATOM   5531  C  CG    . ASP C  2  251  ? 70.115  -33.529 33.648   1.00 88.81  ? 251  ASP C CG    1 
ATOM   5532  O  OD1   . ASP C  2  251  ? 70.005  -34.016 32.503   1.00 85.98  ? 251  ASP C OD1   1 
ATOM   5533  O  OD2   . ASP C  2  251  ? 70.349  -32.318 33.853   1.00 89.36  ? 251  ASP C OD2   1 
ATOM   5534  N  N     . LYS C  2  252  ? 67.468  -32.429 35.600   1.00 89.74  ? 252  LYS C N     1 
ATOM   5535  C  CA    . LYS C  2  252  ? 66.971  -31.288 36.362   1.00 82.49  ? 252  LYS C CA    1 
ATOM   5536  C  C     . LYS C  2  252  ? 65.751  -31.701 37.186   1.00 72.50  ? 252  LYS C C     1 
ATOM   5537  O  O     . LYS C  2  252  ? 65.590  -31.285 38.338   1.00 71.26  ? 252  LYS C O     1 
ATOM   5538  C  CB    . LYS C  2  252  ? 66.626  -30.130 35.421   1.00 73.54  ? 252  LYS C CB    1 
ATOM   5539  C  CG    . LYS C  2  252  ? 66.654  -28.758 36.080   1.00 87.51  ? 252  LYS C CG    1 
ATOM   5540  C  CD    . LYS C  2  252  ? 66.631  -27.639 35.043   1.00 84.59  ? 252  LYS C CD    1 
ATOM   5541  C  CE    . LYS C  2  252  ? 66.815  -26.274 35.697   1.00 80.68  ? 252  LYS C CE    1 
ATOM   5542  N  NZ    . LYS C  2  252  ? 66.899  -25.172 34.697   1.00 69.11  ? 252  LYS C NZ    1 
ATOM   5543  N  N     . ALA C  2  253  ? 64.906  -32.535 36.585   1.00 70.16  ? 253  ALA C N     1 
ATOM   5544  C  CA    . ALA C  2  253  ? 63.737  -33.085 37.262   1.00 68.74  ? 253  ALA C CA    1 
ATOM   5545  C  C     . ALA C  2  253  ? 64.161  -33.983 38.417   1.00 72.81  ? 253  ALA C C     1 
ATOM   5546  O  O     . ALA C  2  253  ? 63.621  -33.886 39.525   1.00 75.07  ? 253  ALA C O     1 
ATOM   5547  C  CB    . ALA C  2  253  ? 62.872  -33.860 36.282   1.00 63.71  ? 253  ALA C CB    1 
ATOM   5548  N  N     . VAL C  2  254  ? 65.127  -34.858 38.148   1.00 77.10  ? 254  VAL C N     1 
ATOM   5549  C  CA    . VAL C  2  254  ? 65.669  -35.741 39.177   1.00 79.66  ? 254  VAL C CA    1 
ATOM   5550  C  C     . VAL C  2  254  ? 66.268  -34.940 40.333   1.00 75.98  ? 254  VAL C C     1 
ATOM   5551  O  O     . VAL C  2  254  ? 66.022  -35.247 41.499   1.00 72.51  ? 254  VAL C O     1 
ATOM   5552  C  CB    . VAL C  2  254  ? 66.741  -36.694 38.609   1.00 72.26  ? 254  VAL C CB    1 
ATOM   5553  C  CG1   . VAL C  2  254  ? 67.315  -37.567 39.716   1.00 64.26  ? 254  VAL C CG1   1 
ATOM   5554  C  CG2   . VAL C  2  254  ? 66.157  -37.551 37.500   1.00 68.70  ? 254  VAL C CG2   1 
ATOM   5555  N  N     . ALA C  2  255  ? 67.043  -33.910 40.002   1.00 73.31  ? 255  ALA C N     1 
ATOM   5556  C  CA    . ALA C  2  255  ? 67.655  -33.058 41.017   1.00 66.54  ? 255  ALA C CA    1 
ATOM   5557  C  C     . ALA C  2  255  ? 66.608  -32.357 41.880   1.00 64.66  ? 255  ALA C C     1 
ATOM   5558  O  O     . ALA C  2  255  ? 66.706  -32.361 43.110   1.00 62.27  ? 255  ALA C O     1 
ATOM   5559  C  CB    . ALA C  2  255  ? 68.584  -32.038 40.371   1.00 69.10  ? 255  ALA C CB    1 
ATOM   5560  N  N     . TYR C  2  256  ? 65.605  -31.763 41.237   1.00 67.01  ? 256  TYR C N     1 
ATOM   5561  C  CA    . TYR C  2  256  ? 64.567  -31.043 41.974   1.00 65.30  ? 256  TYR C CA    1 
ATOM   5562  C  C     . TYR C  2  256  ? 63.735  -31.959 42.867   1.00 60.66  ? 256  TYR C C     1 
ATOM   5563  O  O     . TYR C  2  256  ? 63.490  -31.640 44.029   1.00 62.50  ? 256  TYR C O     1 
ATOM   5564  C  CB    . TYR C  2  256  ? 63.652  -30.254 41.033   1.00 64.80  ? 256  TYR C CB    1 
ATOM   5565  C  CG    . TYR C  2  256  ? 62.536  -29.524 41.753   1.00 63.80  ? 256  TYR C CG    1 
ATOM   5566  C  CD1   . TYR C  2  256  ? 62.782  -28.339 42.436   1.00 65.10  ? 256  TYR C CD1   1 
ATOM   5567  C  CD2   . TYR C  2  256  ? 61.238  -30.023 41.755   1.00 66.71  ? 256  TYR C CD2   1 
ATOM   5568  C  CE1   . TYR C  2  256  ? 61.768  -27.670 43.099   1.00 70.19  ? 256  TYR C CE1   1 
ATOM   5569  C  CE2   . TYR C  2  256  ? 60.217  -29.360 42.415   1.00 66.84  ? 256  TYR C CE2   1 
ATOM   5570  C  CZ    . TYR C  2  256  ? 60.488  -28.184 43.085   1.00 74.86  ? 256  TYR C CZ    1 
ATOM   5571  O  OH    . TYR C  2  256  ? 59.475  -27.522 43.743   1.00 75.22  ? 256  TYR C OH    1 
ATOM   5572  N  N     . VAL C  2  257  ? 63.299  -33.092 42.326   1.00 58.93  ? 257  VAL C N     1 
ATOM   5573  C  CA    . VAL C  2  257  ? 62.487  -34.027 43.103   1.00 61.06  ? 257  VAL C CA    1 
ATOM   5574  C  C     . VAL C  2  257  ? 63.279  -34.654 44.252   1.00 62.95  ? 257  VAL C C     1 
ATOM   5575  O  O     . VAL C  2  257  ? 62.769  -34.787 45.366   1.00 62.75  ? 257  VAL C O     1 
ATOM   5576  C  CB    . VAL C  2  257  ? 61.850  -35.113 42.208   1.00 58.11  ? 257  VAL C CB    1 
ATOM   5577  C  CG1   . VAL C  2  257  ? 61.441  -36.325 43.027   1.00 51.94  ? 257  VAL C CG1   1 
ATOM   5578  C  CG2   . VAL C  2  257  ? 60.654  -34.535 41.468   1.00 62.81  ? 257  VAL C CG2   1 
ATOM   5579  N  N     . TYR C  2  258  ? 64.529  -35.020 43.982   1.00 66.46  ? 258  TYR C N     1 
ATOM   5580  C  CA    . TYR C  2  258  ? 65.417  -35.534 45.020   1.00 61.24  ? 258  TYR C CA    1 
ATOM   5581  C  C     . TYR C  2  258  ? 65.587  -34.508 46.136   1.00 63.01  ? 258  TYR C C     1 
ATOM   5582  O  O     . TYR C  2  258  ? 65.484  -34.840 47.317   1.00 58.80  ? 258  TYR C O     1 
ATOM   5583  C  CB    . TYR C  2  258  ? 66.781  -35.901 44.428   1.00 61.39  ? 258  TYR C CB    1 
ATOM   5584  C  CG    . TYR C  2  258  ? 67.830  -36.280 45.450   1.00 60.52  ? 258  TYR C CG    1 
ATOM   5585  C  CD1   . TYR C  2  258  ? 67.834  -37.540 46.038   1.00 61.13  ? 258  TYR C CD1   1 
ATOM   5586  C  CD2   . TYR C  2  258  ? 68.824  -35.382 45.817   1.00 54.95  ? 258  TYR C CD2   1 
ATOM   5587  C  CE1   . TYR C  2  258  ? 68.794  -37.892 46.970   1.00 58.09  ? 258  TYR C CE1   1 
ATOM   5588  C  CE2   . TYR C  2  258  ? 69.789  -35.724 46.747   1.00 60.64  ? 258  TYR C CE2   1 
ATOM   5589  C  CZ    . TYR C  2  258  ? 69.770  -36.980 47.320   1.00 64.80  ? 258  TYR C CZ    1 
ATOM   5590  O  OH    . TYR C  2  258  ? 70.729  -37.323 48.246   1.00 65.01  ? 258  TYR C OH    1 
ATOM   5591  N  N     . GLY C  2  259  ? 65.834  -33.259 45.751   1.00 71.21  ? 259  GLY C N     1 
ATOM   5592  C  CA    . GLY C  2  259  ? 66.011  -32.184 46.711   1.00 70.81  ? 259  GLY C CA    1 
ATOM   5593  C  C     . GLY C  2  259  ? 64.749  -31.868 47.492   1.00 67.40  ? 259  GLY C C     1 
ATOM   5594  O  O     . GLY C  2  259  ? 64.808  -31.391 48.625   1.00 68.97  ? 259  GLY C O     1 
ATOM   5595  N  N     . LEU C  2  260  ? 63.602  -32.137 46.879   1.00 63.58  ? 260  LEU C N     1 
ATOM   5596  C  CA    . LEU C  2  260  ? 62.313  -31.853 47.493   1.00 56.80  ? 260  LEU C CA    1 
ATOM   5597  C  C     . LEU C  2  260  ? 61.921  -32.920 48.516   1.00 50.65  ? 260  LEU C C     1 
ATOM   5598  O  O     . LEU C  2  260  ? 61.248  -32.627 49.504   1.00 47.57  ? 260  LEU C O     1 
ATOM   5599  C  CB    . LEU C  2  260  ? 61.236  -31.741 46.414   1.00 57.97  ? 260  LEU C CB    1 
ATOM   5600  C  CG    . LEU C  2  260  ? 59.916  -31.083 46.813   1.00 58.93  ? 260  LEU C CG    1 
ATOM   5601  C  CD1   . LEU C  2  260  ? 60.136  -29.612 47.139   1.00 63.69  ? 260  LEU C CD1   1 
ATOM   5602  C  CD2   . LEU C  2  260  ? 58.877  -31.249 45.713   1.00 50.44  ? 260  LEU C CD2   1 
ATOM   5603  N  N     . ILE C  2  261  ? 62.342  -34.158 48.270   1.00 50.94  ? 261  ILE C N     1 
ATOM   5604  C  CA    . ILE C  2  261  ? 61.949  -35.289 49.112   1.00 48.59  ? 261  ILE C CA    1 
ATOM   5605  C  C     . ILE C  2  261  ? 63.123  -36.076 49.709   1.00 52.48  ? 261  ILE C C     1 
ATOM   5606  O  O     . ILE C  2  261  ? 63.245  -36.179 50.928   1.00 57.19  ? 261  ILE C O     1 
ATOM   5607  C  CB    . ILE C  2  261  ? 60.974  -36.252 48.388   1.00 41.82  ? 261  ILE C CB    1 
ATOM   5608  C  CG1   . ILE C  2  261  ? 59.551  -35.692 48.414   1.00 38.27  ? 261  ILE C CG1   1 
ATOM   5609  C  CG2   . ILE C  2  261  ? 60.964  -37.609 49.057   1.00 47.94  ? 261  ILE C CG2   1 
ATOM   5610  C  CD1   . ILE C  2  261  ? 59.260  -34.684 47.333   1.00 41.59  ? 261  ILE C CD1   1 
ATOM   5611  N  N     . ALA C  2  262  ? 63.967  -36.646 48.853   1.00 53.80  ? 262  ALA C N     1 
ATOM   5612  C  CA    . ALA C  2  262  ? 64.970  -37.616 49.296   1.00 55.60  ? 262  ALA C CA    1 
ATOM   5613  C  C     . ALA C  2  262  ? 66.303  -37.036 49.788   1.00 56.33  ? 262  ALA C C     1 
ATOM   5614  O  O     . ALA C  2  262  ? 67.123  -37.767 50.344   1.00 48.80  ? 262  ALA C O     1 
ATOM   5615  C  CB    . ALA C  2  262  ? 65.220  -38.647 48.202   1.00 60.26  ? 262  ALA C CB    1 
ATOM   5616  N  N     . ASP C  2  263  ? 66.519  -35.738 49.594   1.00 58.87  ? 263  ASP C N     1 
ATOM   5617  C  CA    . ASP C  2  263  ? 67.800  -35.125 49.947   1.00 60.47  ? 263  ASP C CA    1 
ATOM   5618  C  C     . ASP C  2  263  ? 67.883  -34.802 51.437   1.00 59.88  ? 263  ASP C C     1 
ATOM   5619  O  O     . ASP C  2  263  ? 67.198  -33.900 51.918   1.00 59.43  ? 263  ASP C O     1 
ATOM   5620  C  CB    . ASP C  2  263  ? 68.024  -33.851 49.124   1.00 60.66  ? 263  ASP C CB    1 
ATOM   5621  C  CG    . ASP C  2  263  ? 69.408  -33.253 49.324   1.00 60.25  ? 263  ASP C CG    1 
ATOM   5622  O  OD1   . ASP C  2  263  ? 70.330  -33.991 49.733   1.00 61.08  ? 263  ASP C OD1   1 
ATOM   5623  O  OD2   . ASP C  2  263  ? 69.578  -32.044 49.059   1.00 59.61  ? 263  ASP C OD2   1 
ATOM   5624  N  N     . PRO C  2  264  ? 68.746  -35.528 52.169   1.00 59.51  ? 264  PRO C N     1 
ATOM   5625  C  CA    . PRO C  2  264  ? 68.887  -35.327 53.615   1.00 58.66  ? 264  PRO C CA    1 
ATOM   5626  C  C     . PRO C  2  264  ? 69.526  -33.981 53.938   1.00 52.32  ? 264  PRO C C     1 
ATOM   5627  O  O     . PRO C  2  264  ? 69.403  -33.489 55.059   1.00 54.36  ? 264  PRO C O     1 
ATOM   5628  C  CB    . PRO C  2  264  ? 69.813  -36.472 54.036   1.00 48.48  ? 264  PRO C CB    1 
ATOM   5629  C  CG    . PRO C  2  264  ? 70.604  -36.776 52.818   1.00 50.58  ? 264  PRO C CG    1 
ATOM   5630  C  CD    . PRO C  2  264  ? 69.672  -36.556 51.663   1.00 52.51  ? 264  PRO C CD    1 
ATOM   5631  N  N     . ARG C  2  265  ? 70.197  -33.395 52.953   1.00 50.41  ? 265  ARG C N     1 
ATOM   5632  C  CA    . ARG C  2  265  ? 70.850  -32.107 53.132   1.00 58.72  ? 265  ARG C CA    1 
ATOM   5633  C  C     . ARG C  2  265  ? 69.846  -30.968 52.985   1.00 58.89  ? 265  ARG C C     1 
ATOM   5634  O  O     . ARG C  2  265  ? 70.113  -29.835 53.388   1.00 57.80  ? 265  ARG C O     1 
ATOM   5635  C  CB    . ARG C  2  265  ? 71.997  -31.958 52.131   1.00 67.27  ? 265  ARG C CB    1 
ATOM   5636  C  CG    . ARG C  2  265  ? 72.977  -33.125 52.157   1.00 62.59  ? 265  ARG C CG    1 
ATOM   5637  C  CD    . ARG C  2  265  ? 73.873  -33.142 50.927   1.00 73.92  ? 265  ARG C CD    1 
ATOM   5638  N  NE    . ARG C  2  265  ? 74.915  -32.119 50.976   1.00 74.66  ? 265  ARG C NE    1 
ATOM   5639  C  CZ    . ARG C  2  265  ? 76.159  -32.342 51.388   1.00 58.73  ? 265  ARG C CZ    1 
ATOM   5640  N  NH1   . ARG C  2  265  ? 76.521  -33.554 51.789   1.00 48.88  ? 265  ARG C NH1   1 
ATOM   5641  N  NH2   . ARG C  2  265  ? 77.042  -31.352 51.397   1.00 53.34  ? 265  ARG C NH2   1 
ATOM   5642  N  N     . ARG C  2  266  ? 68.687  -31.279 52.410   1.00 56.50  ? 266  ARG C N     1 
ATOM   5643  C  CA    . ARG C  2  266  ? 67.599  -30.312 52.283   1.00 61.30  ? 266  ARG C CA    1 
ATOM   5644  C  C     . ARG C  2  266  ? 66.411  -30.703 53.157   1.00 59.37  ? 266  ARG C C     1 
ATOM   5645  O  O     . ARG C  2  266  ? 66.035  -29.967 54.069   1.00 58.16  ? 266  ARG C O     1 
ATOM   5646  C  CB    . ARG C  2  266  ? 67.150  -30.165 50.828   1.00 66.57  ? 266  ARG C CB    1 
ATOM   5647  C  CG    . ARG C  2  266  ? 68.076  -29.326 49.960   1.00 70.83  ? 266  ARG C CG    1 
ATOM   5648  C  CD    . ARG C  2  266  ? 67.433  -29.021 48.612   1.00 76.71  ? 266  ARG C CD    1 
ATOM   5649  N  NE    . ARG C  2  266  ? 66.295  -28.113 48.740   1.00 85.14  ? 266  ARG C NE    1 
ATOM   5650  C  CZ    . ARG C  2  266  ? 65.419  -27.865 47.770   1.00 86.33  ? 266  ARG C CZ    1 
ATOM   5651  N  NH1   . ARG C  2  266  ? 64.417  -27.022 47.980   1.00 93.73  ? 266  ARG C NH1   1 
ATOM   5652  N  NH2   . ARG C  2  266  ? 65.540  -28.461 46.590   1.00 71.71  ? 266  ARG C NH2   1 
ATOM   5653  N  N     . TYR C  2  267  ? 65.814  -31.855 52.862   1.00 61.50  ? 267  TYR C N     1 
ATOM   5654  C  CA    . TYR C  2  267  ? 64.669  -32.346 53.627   1.00 57.89  ? 267  TYR C CA    1 
ATOM   5655  C  C     . TYR C  2  267  ? 65.083  -33.209 54.815   1.00 52.00  ? 267  TYR C C     1 
ATOM   5656  O  O     . TYR C  2  267  ? 65.742  -34.235 54.653   1.00 52.94  ? 267  TYR C O     1 
ATOM   5657  C  CB    . TYR C  2  267  ? 63.708  -33.132 52.731   1.00 51.75  ? 267  TYR C CB    1 
ATOM   5658  C  CG    . TYR C  2  267  ? 62.398  -33.479 53.406   1.00 46.35  ? 267  TYR C CG    1 
ATOM   5659  C  CD1   . TYR C  2  267  ? 62.277  -34.618 54.195   1.00 43.96  ? 267  TYR C CD1   1 
ATOM   5660  C  CD2   . TYR C  2  267  ? 61.282  -32.666 53.253   1.00 43.18  ? 267  TYR C CD2   1 
ATOM   5661  C  CE1   . TYR C  2  267  ? 61.085  -34.933 54.815   1.00 41.87  ? 267  TYR C CE1   1 
ATOM   5662  C  CE2   . TYR C  2  267  ? 60.084  -32.976 53.867   1.00 43.37  ? 267  TYR C CE2   1 
ATOM   5663  C  CZ    . TYR C  2  267  ? 59.991  -34.111 54.646   1.00 39.68  ? 267  TYR C CZ    1 
ATOM   5664  O  OH    . TYR C  2  267  ? 58.800  -34.422 55.258   1.00 37.01  ? 267  TYR C OH    1 
ATOM   5665  N  N     . ASP C  2  268  ? 64.679  -32.793 56.008   1.00 48.01  ? 268  ASP C N     1 
ATOM   5666  C  CA    . ASP C  2  268  ? 64.978  -33.556 57.206   1.00 49.71  ? 268  ASP C CA    1 
ATOM   5667  C  C     . ASP C  2  268  ? 63.789  -33.551 58.167   1.00 50.11  ? 268  ASP C C     1 
ATOM   5668  O  O     . ASP C  2  268  ? 63.277  -32.488 58.521   1.00 49.04  ? 268  ASP C O     1 
ATOM   5669  C  CB    . ASP C  2  268  ? 66.218  -32.966 57.889   1.00 54.64  ? 268  ASP C CB    1 
ATOM   5670  C  CG    . ASP C  2  268  ? 66.845  -33.912 58.896   1.00 60.80  ? 268  ASP C CG    1 
ATOM   5671  O  OD1   . ASP C  2  268  ? 66.720  -35.140 58.716   1.00 60.19  ? 268  ASP C OD1   1 
ATOM   5672  O  OD2   . ASP C  2  268  ? 67.472  -33.425 59.863   1.00 52.84  ? 268  ASP C OD2   1 
ATOM   5673  N  N     . LEU C  2  269  ? 63.350  -34.734 58.590   1.00 46.83  ? 269  LEU C N     1 
ATOM   5674  C  CA    . LEU C  2  269  ? 62.431  -34.826 59.716   1.00 37.33  ? 269  LEU C CA    1 
ATOM   5675  C  C     . LEU C  2  269  ? 63.287  -34.671 60.958   1.00 44.17  ? 269  LEU C C     1 
ATOM   5676  O  O     . LEU C  2  269  ? 64.512  -34.585 60.869   1.00 48.57  ? 269  LEU C O     1 
ATOM   5677  C  CB    . LEU C  2  269  ? 61.722  -36.182 59.764   1.00 35.90  ? 269  LEU C CB    1 
ATOM   5678  C  CG    . LEU C  2  269  ? 60.629  -36.554 58.764   1.00 32.79  ? 269  LEU C CG    1 
ATOM   5679  C  CD1   . LEU C  2  269  ? 60.080  -37.939 59.071   1.00 19.40  ? 269  LEU C CD1   1 
ATOM   5680  C  CD2   . LEU C  2  269  ? 59.510  -35.529 58.772   1.00 37.47  ? 269  LEU C CD2   1 
ATOM   5681  N  N     . GLY C  2  270  ? 62.656  -34.657 62.123   1.00 48.05  ? 270  GLY C N     1 
ATOM   5682  C  CA    . GLY C  2  270  ? 63.413  -34.664 63.357   1.00 52.66  ? 270  GLY C CA    1 
ATOM   5683  C  C     . GLY C  2  270  ? 63.768  -36.101 63.669   1.00 49.69  ? 270  GLY C C     1 
ATOM   5684  O  O     . GLY C  2  270  ? 63.274  -37.018 63.010   1.00 43.82  ? 270  GLY C O     1 
ATOM   5685  N  N     . GLU C  2  271  ? 64.632  -36.313 64.655   1.00 46.51  ? 271  GLU C N     1 
ATOM   5686  C  CA    . GLU C  2  271  ? 64.788  -37.650 65.194   1.00 49.13  ? 271  GLU C CA    1 
ATOM   5687  C  C     . GLU C  2  271  ? 63.456  -37.925 65.879   1.00 46.95  ? 271  GLU C C     1 
ATOM   5688  O  O     . GLU C  2  271  ? 62.923  -39.044 65.854   1.00 40.17  ? 271  GLU C O     1 
ATOM   5689  C  CB    . GLU C  2  271  ? 65.950  -37.712 66.184   1.00 50.97  ? 271  GLU C CB    1 
ATOM   5690  C  CG    . GLU C  2  271  ? 66.570  -39.101 66.320   1.00 67.56  ? 271  GLU C CG    1 
ATOM   5691  C  CD    . GLU C  2  271  ? 67.175  -39.611 65.016   1.00 80.98  ? 271  GLU C CD    1 
ATOM   5692  O  OE1   . GLU C  2  271  ? 67.732  -38.794 64.250   1.00 77.35  ? 271  GLU C OE1   1 
ATOM   5693  O  OE2   . GLU C  2  271  ? 67.090  -40.831 64.755   1.00 72.47  ? 271  GLU C OE2   1 
ATOM   5694  N  N     . ALA C  2  272  ? 62.915  -36.861 66.464   1.00 41.88  ? 272  ALA C N     1 
ATOM   5695  C  CA    . ALA C  2  272  ? 61.572  -36.871 67.013   1.00 39.40  ? 272  ALA C CA    1 
ATOM   5696  C  C     . ALA C  2  272  ? 60.554  -37.171 65.923   1.00 32.73  ? 272  ALA C C     1 
ATOM   5697  O  O     . ALA C  2  272  ? 59.683  -38.011 66.103   1.00 36.45  ? 272  ALA C O     1 
ATOM   5698  C  CB    . ALA C  2  272  ? 61.265  -35.539 67.674   1.00 42.37  ? 272  ALA C CB    1 
ATOM   5699  N  N     . GLY C  2  273  ? 60.668  -36.480 64.794   1.00 34.98  ? 273  GLY C N     1 
ATOM   5700  C  CA    . GLY C  2  273  ? 59.756  -36.687 63.681   1.00 43.04  ? 273  GLY C CA    1 
ATOM   5701  C  C     . GLY C  2  273  ? 59.781  -38.108 63.150   1.00 42.82  ? 273  GLY C C     1 
ATOM   5702  O  O     . GLY C  2  273  ? 58.737  -38.711 62.889   1.00 34.84  ? 273  GLY C O     1 
ATOM   5703  N  N     . ARG C  2  274  ? 60.989  -38.637 62.989   1.00 46.46  ? 274  ARG C N     1 
ATOM   5704  C  CA    . ARG C  2  274  ? 61.186  -40.015 62.570   1.00 41.89  ? 274  ARG C CA    1 
ATOM   5705  C  C     . ARG C  2  274  ? 60.494  -40.968 63.537   1.00 42.09  ? 274  ARG C C     1 
ATOM   5706  O  O     . ARG C  2  274  ? 59.661  -41.784 63.131   1.00 42.25  ? 274  ARG C O     1 
ATOM   5707  C  CB    . ARG C  2  274  ? 62.681  -40.326 62.512   1.00 46.49  ? 274  ARG C CB    1 
ATOM   5708  C  CG    . ARG C  2  274  ? 63.012  -41.753 62.128   1.00 52.07  ? 274  ARG C CG    1 
ATOM   5709  C  CD    . ARG C  2  274  ? 63.991  -42.357 63.115   1.00 59.89  ? 274  ARG C CD    1 
ATOM   5710  N  NE    . ARG C  2  274  ? 64.731  -43.470 62.533   1.00 67.96  ? 274  ARG C NE    1 
ATOM   5711  C  CZ    . ARG C  2  274  ? 65.915  -43.344 61.942   1.00 73.80  ? 274  ARG C CZ    1 
ATOM   5712  N  NH1   . ARG C  2  274  ? 66.491  -42.152 61.861   1.00 72.96  ? 274  ARG C NH1   1 
ATOM   5713  N  NH2   . ARG C  2  274  ? 66.524  -44.408 61.436   1.00 76.66  ? 274  ARG C NH2   1 
ATOM   5714  N  N     . TYR C  2  275  ? 60.838  -40.851 64.817   1.00 42.44  ? 275  TYR C N     1 
ATOM   5715  C  CA    . TYR C  2  275  ? 60.250  -41.700 65.848   1.00 47.70  ? 275  TYR C CA    1 
ATOM   5716  C  C     . TYR C  2  275  ? 58.714  -41.640 65.864   1.00 50.70  ? 275  TYR C C     1 
ATOM   5717  O  O     . TYR C  2  275  ? 58.043  -42.672 65.937   1.00 53.89  ? 275  TYR C O     1 
ATOM   5718  C  CB    . TYR C  2  275  ? 60.824  -41.334 67.220   1.00 51.71  ? 275  TYR C CB    1 
ATOM   5719  C  CG    . TYR C  2  275  ? 60.057  -41.916 68.387   1.00 73.42  ? 275  TYR C CG    1 
ATOM   5720  C  CD1   . TYR C  2  275  ? 60.236  -43.239 68.773   1.00 83.25  ? 275  TYR C CD1   1 
ATOM   5721  C  CD2   . TYR C  2  275  ? 59.156  -41.139 69.108   1.00 77.69  ? 275  TYR C CD2   1 
ATOM   5722  C  CE1   . TYR C  2  275  ? 59.534  -43.775 69.841   1.00 87.24  ? 275  TYR C CE1   1 
ATOM   5723  C  CE2   . TYR C  2  275  ? 58.450  -41.665 70.175   1.00 90.35  ? 275  TYR C CE2   1 
ATOM   5724  C  CZ    . TYR C  2  275  ? 58.643  -42.983 70.537   1.00 89.34  ? 275  TYR C CZ    1 
ATOM   5725  O  OH    . TYR C  2  275  ? 57.943  -43.509 71.599   1.00 89.29  ? 275  TYR C OH    1 
ATOM   5726  N  N     . LYS C  2  276  ? 58.171  -40.429 65.777   1.00 46.13  ? 276  LYS C N     1 
ATOM   5727  C  CA    . LYS C  2  276  ? 56.728  -40.204 65.831   1.00 39.24  ? 276  LYS C CA    1 
ATOM   5728  C  C     . LYS C  2  276  ? 55.999  -40.765 64.615   1.00 41.20  ? 276  LYS C C     1 
ATOM   5729  O  O     . LYS C  2  276  ? 54.910  -41.326 64.740   1.00 42.30  ? 276  LYS C O     1 
ATOM   5730  C  CB    . LYS C  2  276  ? 56.430  -38.710 65.966   1.00 36.42  ? 276  LYS C CB    1 
ATOM   5731  C  CG    . LYS C  2  276  ? 56.724  -38.135 67.344   1.00 37.84  ? 276  LYS C CG    1 
ATOM   5732  C  CD    . LYS C  2  276  ? 55.476  -38.070 68.211   1.00 32.50  ? 276  LYS C CD    1 
ATOM   5733  C  CE    . LYS C  2  276  ? 54.601  -36.878 67.846   1.00 27.03  ? 276  LYS C CE    1 
ATOM   5734  N  NZ    . LYS C  2  276  ? 53.821  -37.074 66.591   1.00 35.27  ? 276  LYS C NZ    1 
ATOM   5735  N  N     . ALA C  2  277  ? 56.595  -40.602 63.438   1.00 45.91  ? 277  ALA C N     1 
ATOM   5736  C  CA    . ALA C  2  277  ? 56.014  -41.143 62.214   1.00 43.31  ? 277  ALA C CA    1 
ATOM   5737  C  C     . ALA C  2  277  ? 56.040  -42.670 62.242   1.00 45.18  ? 277  ALA C C     1 
ATOM   5738  O  O     . ALA C  2  277  ? 55.085  -43.325 61.813   1.00 42.09  ? 277  ALA C O     1 
ATOM   5739  C  CB    . ALA C  2  277  ? 56.749  -40.614 60.995   1.00 33.62  ? 277  ALA C CB    1 
ATOM   5740  N  N     . GLU C  2  278  ? 57.136  -43.227 62.756   1.00 44.20  ? 278  GLU C N     1 
ATOM   5741  C  CA    . GLU C  2  278  ? 57.258  -44.673 62.910   1.00 40.15  ? 278  GLU C CA    1 
ATOM   5742  C  C     . GLU C  2  278  ? 56.201  -45.211 63.865   1.00 45.40  ? 278  GLU C C     1 
ATOM   5743  O  O     . GLU C  2  278  ? 55.591  -46.248 63.609   1.00 46.69  ? 278  GLU C O     1 
ATOM   5744  C  CB    . GLU C  2  278  ? 58.650  -45.049 63.422   1.00 38.44  ? 278  GLU C CB    1 
ATOM   5745  C  CG    . GLU C  2  278  ? 59.737  -45.004 62.366   1.00 50.73  ? 278  GLU C CG    1 
ATOM   5746  C  CD    . GLU C  2  278  ? 61.110  -45.320 62.930   1.00 58.62  ? 278  GLU C CD    1 
ATOM   5747  O  OE1   . GLU C  2  278  ? 61.215  -45.538 64.156   1.00 60.06  ? 278  GLU C OE1   1 
ATOM   5748  O  OE2   . GLU C  2  278  ? 62.084  -45.348 62.147   1.00 58.38  ? 278  GLU C OE2   1 
ATOM   5749  N  N     . GLU C  2  279  ? 55.988  -44.500 64.968   1.00 47.45  ? 279  GLU C N     1 
ATOM   5750  C  CA    . GLU C  2  279  ? 55.027  -44.923 65.980   1.00 52.05  ? 279  GLU C CA    1 
ATOM   5751  C  C     . GLU C  2  279  ? 53.593  -44.826 65.456   1.00 49.66  ? 279  GLU C C     1 
ATOM   5752  O  O     . GLU C  2  279  ? 52.760  -45.689 65.727   1.00 41.75  ? 279  GLU C O     1 
ATOM   5753  C  CB    . GLU C  2  279  ? 55.184  -44.072 67.245   1.00 53.00  ? 279  GLU C CB    1 
ATOM   5754  C  CG    . GLU C  2  279  ? 54.729  -44.754 68.528   1.00 70.34  ? 279  GLU C CG    1 
ATOM   5755  C  CD    . GLU C  2  279  ? 55.744  -45.760 69.051   1.00 88.43  ? 279  GLU C CD    1 
ATOM   5756  O  OE1   . GLU C  2  279  ? 55.395  -46.546 69.960   1.00 92.72  ? 279  GLU C OE1   1 
ATOM   5757  O  OE2   . GLU C  2  279  ? 56.892  -45.762 68.557   1.00 83.06  ? 279  GLU C OE2   1 
ATOM   5758  N  N     . LYS C  2  280  ? 53.315  -43.766 64.705   1.00 51.71  ? 280  LYS C N     1 
ATOM   5759  C  CA    . LYS C  2  280  ? 51.972  -43.510 64.196   1.00 47.56  ? 280  LYS C CA    1 
ATOM   5760  C  C     . LYS C  2  280  ? 51.576  -44.449 63.058   1.00 50.25  ? 280  LYS C C     1 
ATOM   5761  O  O     . LYS C  2  280  ? 50.506  -45.055 63.086   1.00 45.53  ? 280  LYS C O     1 
ATOM   5762  C  CB    . LYS C  2  280  ? 51.852  -42.048 63.745   1.00 41.25  ? 280  LYS C CB    1 
ATOM   5763  C  CG    . LYS C  2  280  ? 50.509  -41.683 63.132   1.00 39.78  ? 280  LYS C CG    1 
ATOM   5764  C  CD    . LYS C  2  280  ? 49.381  -41.755 64.148   1.00 41.37  ? 280  LYS C CD    1 
ATOM   5765  C  CE    . LYS C  2  280  ? 48.104  -41.143 63.596   1.00 41.50  ? 280  LYS C CE    1 
ATOM   5766  N  NZ    . LYS C  2  280  ? 46.971  -41.230 64.560   1.00 49.77  ? 280  LYS C NZ    1 
ATOM   5767  N  N     . LEU C  2  281  ? 52.442  -44.564 62.057   1.00 54.36  ? 281  LEU C N     1 
ATOM   5768  C  CA    . LEU C  2  281  ? 52.124  -45.352 60.870   1.00 48.64  ? 281  LEU C CA    1 
ATOM   5769  C  C     . LEU C  2  281  ? 52.467  -46.827 61.049   1.00 53.36  ? 281  LEU C C     1 
ATOM   5770  O  O     . LEU C  2  281  ? 52.093  -47.662 60.224   1.00 52.63  ? 281  LEU C O     1 
ATOM   5771  C  CB    . LEU C  2  281  ? 52.849  -44.790 59.648   1.00 42.61  ? 281  LEU C CB    1 
ATOM   5772  C  CG    . LEU C  2  281  ? 52.534  -43.336 59.301   1.00 36.58  ? 281  LEU C CG    1 
ATOM   5773  C  CD1   . LEU C  2  281  ? 53.433  -42.853 58.179   1.00 42.05  ? 281  LEU C CD1   1 
ATOM   5774  C  CD2   . LEU C  2  281  ? 51.070  -43.186 58.924   1.00 40.34  ? 281  LEU C CD2   1 
ATOM   5775  N  N     . GLY C  2  282  ? 53.185  -47.138 62.126   1.00 55.57  ? 282  GLY C N     1 
ATOM   5776  C  CA    . GLY C  2  282  ? 53.587  -48.502 62.420   1.00 50.37  ? 282  GLY C CA    1 
ATOM   5777  C  C     . GLY C  2  282  ? 54.574  -49.056 61.411   1.00 47.95  ? 282  GLY C C     1 
ATOM   5778  O  O     . GLY C  2  282  ? 54.387  -50.154 60.887   1.00 51.97  ? 282  GLY C O     1 
ATOM   5779  N  N     . ILE C  2  283  ? 55.623  -48.290 61.127   1.00 43.43  ? 283  ILE C N     1 
ATOM   5780  C  CA    . ILE C  2  283  ? 56.640  -48.704 60.166   1.00 48.06  ? 283  ILE C CA    1 
ATOM   5781  C  C     . ILE C  2  283  ? 58.042  -48.388 60.681   1.00 55.48  ? 283  ILE C C     1 
ATOM   5782  O  O     . ILE C  2  283  ? 58.211  -47.960 61.825   1.00 56.28  ? 283  ILE C O     1 
ATOM   5783  C  CB    . ILE C  2  283  ? 56.446  -48.023 58.791   1.00 51.91  ? 283  ILE C CB    1 
ATOM   5784  C  CG1   . ILE C  2  283  ? 56.664  -46.511 58.898   1.00 52.36  ? 283  ILE C CG1   1 
ATOM   5785  C  CG2   . ILE C  2  283  ? 55.067  -48.333 58.219   1.00 48.74  ? 283  ILE C CG2   1 
ATOM   5786  C  CD1   . ILE C  2  283  ? 56.497  -45.775 57.582   1.00 49.40  ? 283  ILE C CD1   1 
ATOM   5787  N  N     . ARG C  2  284  ? 59.044  -48.609 59.835   1.00 53.16  ? 284  ARG C N     1 
ATOM   5788  C  CA    . ARG C  2  284  ? 60.421  -48.274 60.177   1.00 55.96  ? 284  ARG C CA    1 
ATOM   5789  C  C     . ARG C  2  284  ? 61.043  -47.406 59.084   1.00 60.15  ? 284  ARG C C     1 
ATOM   5790  O  O     . ARG C  2  284  ? 60.938  -47.712 57.895   1.00 51.21  ? 284  ARG C O     1 
ATOM   5791  C  CB    . ARG C  2  284  ? 61.248  -49.545 60.399   1.00 50.86  ? 284  ARG C CB    1 
ATOM   5792  C  CG    . ARG C  2  284  ? 62.230  -49.467 61.565   1.00 55.65  ? 284  ARG C CG    1 
ATOM   5793  C  CD    . ARG C  2  284  ? 63.429  -48.575 61.253   1.00 68.30  ? 284  ARG C CD    1 
ATOM   5794  N  NE    . ARG C  2  284  ? 63.622  -47.531 62.260   1.00 84.23  ? 284  ARG C NE    1 
ATOM   5795  C  CZ    . ARG C  2  284  ? 64.327  -47.684 63.378   1.00 83.91  ? 284  ARG C CZ    1 
ATOM   5796  N  NH1   . ARG C  2  284  ? 64.445  -46.675 64.234   1.00 67.46  ? 284  ARG C NH1   1 
ATOM   5797  N  NH2   . ARG C  2  284  ? 64.911  -48.844 63.644   1.00 86.01  ? 284  ARG C NH2   1 
ATOM   5798  N  N     . LEU C  2  285  ? 61.682  -46.316 59.499   1.00 68.23  ? 285  LEU C N     1 
ATOM   5799  C  CA    . LEU C  2  285  ? 62.331  -45.393 58.574   1.00 68.78  ? 285  LEU C CA    1 
ATOM   5800  C  C     . LEU C  2  285  ? 63.842  -45.594 58.584   1.00 64.55  ? 285  LEU C C     1 
ATOM   5801  O  O     . LEU C  2  285  ? 64.473  -45.558 59.641   1.00 61.71  ? 285  LEU C O     1 
ATOM   5802  C  CB    . LEU C  2  285  ? 62.000  -43.946 58.952   1.00 70.97  ? 285  LEU C CB    1 
ATOM   5803  C  CG    . LEU C  2  285  ? 60.884  -43.219 58.194   1.00 62.40  ? 285  LEU C CG    1 
ATOM   5804  C  CD1   . LEU C  2  285  ? 61.344  -42.844 56.793   1.00 65.46  ? 285  LEU C CD1   1 
ATOM   5805  C  CD2   . LEU C  2  285  ? 59.619  -44.060 58.139   1.00 54.33  ? 285  LEU C CD2   1 
ATOM   5806  N  N     . SER C  2  286  ? 64.419  -45.816 57.407   1.00 62.38  ? 286  SER C N     1 
ATOM   5807  C  CA    . SER C  2  286  ? 65.866  -45.960 57.292   1.00 70.68  ? 286  SER C CA    1 
ATOM   5808  C  C     . SER C  2  286  ? 66.547  -44.615 57.512   1.00 71.97  ? 286  SER C C     1 
ATOM   5809  O  O     . SER C  2  286  ? 67.419  -44.476 58.370   1.00 67.92  ? 286  SER C O     1 
ATOM   5810  C  CB    . SER C  2  286  ? 66.243  -46.518 55.918   1.00 73.47  ? 286  SER C CB    1 
ATOM   5811  O  OG    . SER C  2  286  ? 65.857  -45.630 54.883   1.00 73.55  ? 286  SER C OG    1 
ATOM   5812  N  N     . GLY C  2  287  ? 66.133  -43.624 56.732   1.00 77.13  ? 287  GLY C N     1 
ATOM   5813  C  CA    . GLY C  2  287  ? 66.638  -42.273 56.879   1.00 70.35  ? 287  GLY C CA    1 
ATOM   5814  C  C     . GLY C  2  287  ? 65.604  -41.363 57.507   1.00 62.62  ? 287  GLY C C     1 
ATOM   5815  O  O     . GLY C  2  287  ? 64.530  -41.806 57.909   1.00 63.09  ? 287  GLY C O     1 
ATOM   5816  N  N     . ARG C  2  288  ? 65.932  -40.081 57.591   1.00 62.32  ? 288  ARG C N     1 
ATOM   5817  C  CA    . ARG C  2  288  ? 65.002  -39.083 58.101   1.00 56.81  ? 288  ARG C CA    1 
ATOM   5818  C  C     . ARG C  2  288  ? 64.206  -38.410 56.981   1.00 56.77  ? 288  ARG C C     1 
ATOM   5819  O  O     . ARG C  2  288  ? 63.502  -37.427 57.214   1.00 50.37  ? 288  ARG C O     1 
ATOM   5820  C  CB    . ARG C  2  288  ? 65.728  -38.049 58.960   1.00 54.17  ? 288  ARG C CB    1 
ATOM   5821  C  CG    . ARG C  2  288  ? 66.174  -38.581 60.313   1.00 55.66  ? 288  ARG C CG    1 
ATOM   5822  C  CD    . ARG C  2  288  ? 66.509  -37.448 61.275   1.00 59.07  ? 288  ARG C CD    1 
ATOM   5823  N  NE    . ARG C  2  288  ? 67.694  -36.700 60.865   1.00 60.06  ? 288  ARG C NE    1 
ATOM   5824  C  CZ    . ARG C  2  288  ? 68.920  -36.940 61.320   1.00 69.47  ? 288  ARG C CZ    1 
ATOM   5825  N  NH1   . ARG C  2  288  ? 69.123  -37.909 62.204   1.00 63.24  ? 288  ARG C NH1   1 
ATOM   5826  N  NH2   . ARG C  2  288  ? 69.943  -36.210 60.893   1.00 68.92  ? 288  ARG C NH2   1 
ATOM   5827  N  N     . THR C  2  289  ? 64.349  -38.923 55.762   1.00 61.17  ? 289  THR C N     1 
ATOM   5828  C  CA    . THR C  2  289  ? 63.638  -38.375 54.611   1.00 58.29  ? 289  THR C CA    1 
ATOM   5829  C  C     . THR C  2  289  ? 62.347  -39.140 54.293   1.00 56.78  ? 289  THR C C     1 
ATOM   5830  O  O     . THR C  2  289  ? 62.054  -40.163 54.915   1.00 51.55  ? 289  THR C O     1 
ATOM   5831  C  CB    . THR C  2  289  ? 64.535  -38.388 53.364   1.00 60.56  ? 289  THR C CB    1 
ATOM   5832  O  OG1   . THR C  2  289  ? 64.891  -39.739 53.047   1.00 62.58  ? 289  THR C OG1   1 
ATOM   5833  C  CG2   . THR C  2  289  ? 65.801  -37.586 53.617   1.00 62.05  ? 289  THR C CG2   1 
ATOM   5834  N  N     . LEU C  2  290  ? 61.592  -38.642 53.313   1.00 52.17  ? 290  LEU C N     1 
ATOM   5835  C  CA    . LEU C  2  290  ? 60.319  -39.248 52.917   1.00 50.44  ? 290  LEU C CA    1 
ATOM   5836  C  C     . LEU C  2  290  ? 60.510  -40.411 51.956   1.00 55.53  ? 290  LEU C C     1 
ATOM   5837  O  O     . LEU C  2  290  ? 59.637  -41.271 51.816   1.00 51.96  ? 290  LEU C O     1 
ATOM   5838  C  CB    . LEU C  2  290  ? 59.409  -38.212 52.258   1.00 48.61  ? 290  LEU C CB    1 
ATOM   5839  C  CG    . LEU C  2  290  ? 58.933  -37.032 53.099   1.00 44.41  ? 290  LEU C CG    1 
ATOM   5840  C  CD1   . LEU C  2  290  ? 57.952  -36.182 52.309   1.00 42.36  ? 290  LEU C CD1   1 
ATOM   5841  C  CD2   . LEU C  2  290  ? 58.307  -37.520 54.390   1.00 45.10  ? 290  LEU C CD2   1 
ATOM   5842  N  N     . ALA C  2  291  ? 61.655  -40.418 51.287   1.00 62.30  ? 291  ALA C N     1 
ATOM   5843  C  CA    . ALA C  2  291  ? 61.983  -41.448 50.316   1.00 64.98  ? 291  ALA C CA    1 
ATOM   5844  C  C     . ALA C  2  291  ? 63.484  -41.415 50.073   1.00 71.38  ? 291  ALA C C     1 
ATOM   5845  O  O     . ALA C  2  291  ? 64.191  -40.583 50.643   1.00 64.14  ? 291  ALA C O     1 
ATOM   5846  C  CB    . ALA C  2  291  ? 61.225  -41.216 49.020   1.00 55.83  ? 291  ALA C CB    1 
ATOM   5847  N  N     . ARG C  2  292  ? 63.972  -42.315 49.227   1.00 83.31  ? 292  ARG C N     1 
ATOM   5848  C  CA    . ARG C  2  292  ? 65.403  -42.377 48.949   1.00 82.80  ? 292  ARG C CA    1 
ATOM   5849  C  C     . ARG C  2  292  ? 65.698  -42.435 47.459   1.00 82.71  ? 292  ARG C C     1 
ATOM   5850  O  O     . ARG C  2  292  ? 64.818  -42.718 46.647   1.00 75.77  ? 292  ARG C O     1 
ATOM   5851  C  CB    . ARG C  2  292  ? 66.027  -43.598 49.624   1.00 82.43  ? 292  ARG C CB    1 
ATOM   5852  C  CG    . ARG C  2  292  ? 65.911  -43.622 51.133   1.00 87.49  ? 292  ARG C CG    1 
ATOM   5853  C  CD    . ARG C  2  292  ? 66.252  -45.004 51.648   1.00 91.71  ? 292  ARG C CD    1 
ATOM   5854  N  NE    . ARG C  2  292  ? 65.526  -46.027 50.901   1.00 90.94  ? 292  ARG C NE    1 
ATOM   5855  C  CZ    . ARG C  2  292  ? 65.649  -47.333 51.105   1.00 92.23  ? 292  ARG C CZ    1 
ATOM   5856  N  NH1   . ARG C  2  292  ? 66.475  -47.784 52.040   1.00 93.64  ? 292  ARG C NH1   1 
ATOM   5857  N  NH2   . ARG C  2  292  ? 64.946  -48.187 50.373   1.00 97.53  ? 292  ARG C NH2   1 
ATOM   5858  N  N     . PHE C  2  293  ? 66.948  -42.157 47.108   1.00 85.20  ? 293  PHE C N     1 
ATOM   5859  C  CA    . PHE C  2  293  ? 67.430  -42.408 45.761   1.00 86.22  ? 293  PHE C CA    1 
ATOM   5860  C  C     . PHE C  2  293  ? 68.423  -43.556 45.848   1.00 88.17  ? 293  PHE C C     1 
ATOM   5861  O  O     . PHE C  2  293  ? 69.529  -43.398 46.366   1.00 81.98  ? 293  PHE C O     1 
ATOM   5862  C  CB    . PHE C  2  293  ? 68.100  -41.161 45.182   1.00 87.95  ? 293  PHE C CB    1 
ATOM   5863  C  CG    . PHE C  2  293  ? 68.460  -41.285 43.728   1.00 88.40  ? 293  PHE C CG    1 
ATOM   5864  C  CD1   . PHE C  2  293  ? 67.523  -41.015 42.743   1.00 84.11  ? 293  PHE C CD1   1 
ATOM   5865  C  CD2   . PHE C  2  293  ? 69.738  -41.664 43.345   1.00 85.53  ? 293  PHE C CD2   1 
ATOM   5866  C  CE1   . PHE C  2  293  ? 67.851  -41.125 41.405   1.00 83.86  ? 293  PHE C CE1   1 
ATOM   5867  C  CE2   . PHE C  2  293  ? 70.072  -41.775 42.008   1.00 79.16  ? 293  PHE C CE2   1 
ATOM   5868  C  CZ    . PHE C  2  293  ? 69.128  -41.504 41.038   1.00 84.99  ? 293  PHE C CZ    1 
ATOM   5869  N  N     . GLU C  2  294  ? 68.018  -44.715 45.344   1.00 98.42  ? 294  GLU C N     1 
ATOM   5870  C  CA    . GLU C  2  294  ? 68.835  -45.915 45.445   1.00 104.40 ? 294  GLU C CA    1 
ATOM   5871  C  C     . GLU C  2  294  ? 68.913  -46.648 44.111   1.00 112.62 ? 294  GLU C C     1 
ATOM   5872  O  O     . GLU C  2  294  ? 67.891  -47.067 43.562   1.00 112.92 ? 294  GLU C O     1 
ATOM   5873  C  CB    . GLU C  2  294  ? 68.283  -46.843 46.532   1.00 96.20  ? 294  GLU C CB    1 
ATOM   5874  C  CG    . GLU C  2  294  ? 69.039  -48.153 46.679   1.00 101.91 ? 294  GLU C CG    1 
ATOM   5875  C  CD    . GLU C  2  294  ? 68.504  -49.010 47.810   1.00 98.67  ? 294  GLU C CD    1 
ATOM   5876  O  OE1   . GLU C  2  294  ? 68.789  -50.226 47.824   1.00 91.47  ? 294  GLU C OE1   1 
ATOM   5877  O  OE2   . GLU C  2  294  ? 67.800  -48.466 48.687   1.00 96.30  ? 294  GLU C OE2   1 
ATOM   5878  N  N     . ASP C  2  295  ? 70.133  -46.786 43.598   1.00 107.34 ? 295  ASP C N     1 
ATOM   5879  C  CA    . ASP C  2  295  ? 70.397  -47.507 42.354   1.00 98.97  ? 295  ASP C CA    1 
ATOM   5880  C  C     . ASP C  2  295  ? 69.688  -46.897 41.140   1.00 95.69  ? 295  ASP C C     1 
ATOM   5881  O  O     . ASP C  2  295  ? 69.231  -47.616 40.252   1.00 95.89  ? 295  ASP C O     1 
ATOM   5882  C  CB    . ASP C  2  295  ? 70.045  -48.991 42.502   1.00 105.53 ? 295  ASP C CB    1 
ATOM   5883  C  CG    . ASP C  2  295  ? 70.704  -49.627 43.715   1.00 108.48 ? 295  ASP C CG    1 
ATOM   5884  O  OD1   . ASP C  2  295  ? 71.874  -49.296 44.002   1.00 105.88 ? 295  ASP C OD1   1 
ATOM   5885  O  OD2   . ASP C  2  295  ? 70.049  -50.455 44.384   1.00 101.49 ? 295  ASP C OD2   1 
ATOM   5886  N  N     . GLY C  2  296  ? 69.604  -45.570 41.112   1.00 94.96  ? 296  GLY C N     1 
ATOM   5887  C  CA    . GLY C  2  296  ? 69.088  -44.858 39.956   1.00 91.01  ? 296  GLY C CA    1 
ATOM   5888  C  C     . GLY C  2  296  ? 67.631  -44.438 40.034   1.00 87.48  ? 296  GLY C C     1 
ATOM   5889  O  O     . GLY C  2  296  ? 67.173  -43.623 39.233   1.00 87.65  ? 296  GLY C O     1 
ATOM   5890  N  N     . GLU C  2  297  ? 66.900  -44.984 41.000   1.00 90.05  ? 297  GLU C N     1 
ATOM   5891  C  CA    . GLU C  2  297  ? 65.465  -44.736 41.096   1.00 98.52  ? 297  GLU C CA    1 
ATOM   5892  C  C     . GLU C  2  297  ? 65.034  -44.282 42.490   1.00 98.35  ? 297  GLU C C     1 
ATOM   5893  O  O     . GLU C  2  297  ? 65.787  -44.404 43.457   1.00 96.50  ? 297  GLU C O     1 
ATOM   5894  C  CB    . GLU C  2  297  ? 64.689  -45.993 40.697   1.00 98.90  ? 297  GLU C CB    1 
ATOM   5895  C  CG    . GLU C  2  297  ? 65.080  -47.226 41.494   1.00 99.57  ? 297  GLU C CG    1 
ATOM   5896  C  CD    . GLU C  2  297  ? 64.245  -48.438 41.143   1.00 98.06  ? 297  GLU C CD    1 
ATOM   5897  O  OE1   . GLU C  2  297  ? 64.523  -49.528 41.686   1.00 102.97 ? 297  GLU C OE1   1 
ATOM   5898  O  OE2   . GLU C  2  297  ? 63.311  -48.301 40.324   1.00 96.64  ? 297  GLU C OE2   1 
ATOM   5899  N  N     . PHE C  2  298  ? 63.816  -43.755 42.583   1.00 88.28  ? 298  PHE C N     1 
ATOM   5900  C  CA    . PHE C  2  298  ? 63.259  -43.331 43.863   1.00 83.21  ? 298  PHE C CA    1 
ATOM   5901  C  C     . PHE C  2  298  ? 62.549  -44.484 44.567   1.00 82.71  ? 298  PHE C C     1 
ATOM   5902  O  O     . PHE C  2  298  ? 61.845  -45.269 43.934   1.00 81.65  ? 298  PHE C O     1 
ATOM   5903  C  CB    . PHE C  2  298  ? 62.305  -42.149 43.674   1.00 80.62  ? 298  PHE C CB    1 
ATOM   5904  C  CG    . PHE C  2  298  ? 62.989  -40.879 43.246   1.00 79.44  ? 298  PHE C CG    1 
ATOM   5905  C  CD1   . PHE C  2  298  ? 63.685  -40.108 44.164   1.00 77.53  ? 298  PHE C CD1   1 
ATOM   5906  C  CD2   . PHE C  2  298  ? 62.935  -40.455 41.930   1.00 77.46  ? 298  PHE C CD2   1 
ATOM   5907  C  CE1   . PHE C  2  298  ? 64.316  -38.940 43.777   1.00 68.92  ? 298  PHE C CE1   1 
ATOM   5908  C  CE2   . PHE C  2  298  ? 63.563  -39.287 41.536   1.00 79.83  ? 298  PHE C CE2   1 
ATOM   5909  C  CZ    . PHE C  2  298  ? 64.255  -38.529 42.462   1.00 69.96  ? 298  PHE C CZ    1 
ATOM   5910  N  N     . LYS C  2  299  ? 62.739  -44.575 45.880   1.00 88.02  ? 299  LYS C N     1 
ATOM   5911  C  CA    . LYS C  2  299  ? 62.191  -45.675 46.665   1.00 88.86  ? 299  LYS C CA    1 
ATOM   5912  C  C     . LYS C  2  299  ? 61.424  -45.154 47.878   1.00 87.96  ? 299  LYS C C     1 
ATOM   5913  O  O     . LYS C  2  299  ? 61.921  -44.305 48.621   1.00 89.49  ? 299  LYS C O     1 
ATOM   5914  C  CB    . LYS C  2  299  ? 63.315  -46.616 47.103   1.00 96.09  ? 299  LYS C CB    1 
ATOM   5915  C  CG    . LYS C  2  299  ? 62.934  -48.086 47.102   1.00 106.66 ? 299  LYS C CG    1 
ATOM   5916  C  CD    . LYS C  2  299  ? 64.149  -48.959 46.822   1.00 113.59 ? 299  LYS C CD    1 
ATOM   5917  C  CE    . LYS C  2  299  ? 64.781  -48.603 45.482   1.00 98.77  ? 299  LYS C CE    1 
ATOM   5918  N  NZ    . LYS C  2  299  ? 65.957  -49.459 45.166   1.00 89.78  ? 299  LYS C NZ    1 
ATOM   5919  N  N     . ASP C  2  300  ? 60.217  -45.680 48.075   1.00 84.76  ? 300  ASP C N     1 
ATOM   5920  C  CA    . ASP C  2  300  ? 59.290  -45.163 49.082   1.00 79.66  ? 300  ASP C CA    1 
ATOM   5921  C  C     . ASP C  2  300  ? 59.655  -45.535 50.519   1.00 81.61  ? 300  ASP C C     1 
ATOM   5922  O  O     . ASP C  2  300  ? 60.169  -46.620 50.794   1.00 81.94  ? 300  ASP C O     1 
ATOM   5923  C  CB    . ASP C  2  300  ? 57.859  -45.620 48.766   1.00 76.04  ? 300  ASP C CB    1 
ATOM   5924  C  CG    . ASP C  2  300  ? 56.801  -44.847 49.547   1.00 71.84  ? 300  ASP C CG    1 
ATOM   5925  O  OD1   . ASP C  2  300  ? 56.871  -44.798 50.793   1.00 70.61  ? 300  ASP C OD1   1 
ATOM   5926  O  OD2   . ASP C  2  300  ? 55.888  -44.286 48.907   1.00 73.30  ? 300  ASP C OD2   1 
ATOM   5927  N  N     . GLU C  2  301  ? 59.376  -44.606 51.427   1.00 75.81  ? 301  GLU C N     1 
ATOM   5928  C  CA    . GLU C  2  301  ? 59.544  -44.811 52.860   1.00 67.49  ? 301  GLU C CA    1 
ATOM   5929  C  C     . GLU C  2  301  ? 58.266  -44.418 53.593   1.00 65.85  ? 301  GLU C C     1 
ATOM   5930  O  O     . GLU C  2  301  ? 57.623  -45.239 54.246   1.00 67.40  ? 301  GLU C O     1 
ATOM   5931  C  CB    . GLU C  2  301  ? 60.716  -43.982 53.383   1.00 66.64  ? 301  GLU C CB    1 
ATOM   5932  C  CG    . GLU C  2  301  ? 62.089  -44.490 52.973   1.00 75.04  ? 301  GLU C CG    1 
ATOM   5933  C  CD    . GLU C  2  301  ? 62.570  -45.644 53.836   1.00 84.44  ? 301  GLU C CD    1 
ATOM   5934  O  OE1   . GLU C  2  301  ? 61.846  -46.031 54.779   1.00 81.29  ? 301  GLU C OE1   1 
ATOM   5935  O  OE2   . GLU C  2  301  ? 63.677  -46.162 53.575   1.00 89.83  ? 301  GLU C OE2   1 
ATOM   5936  N  N     . VAL C  2  302  ? 57.913  -43.143 53.466   1.00 65.80  ? 302  VAL C N     1 
ATOM   5937  C  CA    . VAL C  2  302  ? 56.789  -42.535 54.174   1.00 55.68  ? 302  VAL C CA    1 
ATOM   5938  C  C     . VAL C  2  302  ? 55.432  -42.686 53.478   1.00 51.82  ? 302  VAL C C     1 
ATOM   5939  O  O     . VAL C  2  302  ? 54.487  -43.203 54.070   1.00 48.89  ? 302  VAL C O     1 
ATOM   5940  C  CB    . VAL C  2  302  ? 57.060  -41.051 54.496   1.00 53.48  ? 302  VAL C CB    1 
ATOM   5941  C  CG1   . VAL C  2  302  ? 55.817  -40.394 55.080   1.00 45.00  ? 302  VAL C CG1   1 
ATOM   5942  C  CG2   . VAL C  2  302  ? 58.231  -40.932 55.458   1.00 58.41  ? 302  VAL C CG2   1 
ATOM   5943  N  N     . PHE C  2  303  ? 55.343  -42.195 52.242   1.00 51.05  ? 303  PHE C N     1 
ATOM   5944  C  CA    . PHE C  2  303  ? 54.070  -41.954 51.548   1.00 49.74  ? 303  PHE C CA    1 
ATOM   5945  C  C     . PHE C  2  303  ? 52.995  -43.047 51.606   1.00 53.70  ? 303  PHE C C     1 
ATOM   5946  O  O     . PHE C  2  303  ? 51.835  -42.755 51.915   1.00 51.86  ? 303  PHE C O     1 
ATOM   5947  C  CB    . PHE C  2  303  ? 54.330  -41.596 50.080   1.00 43.36  ? 303  PHE C CB    1 
ATOM   5948  C  CG    . PHE C  2  303  ? 54.960  -40.250 49.886   1.00 44.02  ? 303  PHE C CG    1 
ATOM   5949  C  CD1   . PHE C  2  303  ? 54.182  -39.104 49.874   1.00 40.73  ? 303  PHE C CD1   1 
ATOM   5950  C  CD2   . PHE C  2  303  ? 56.328  -40.130 49.714   1.00 44.10  ? 303  PHE C CD2   1 
ATOM   5951  C  CE1   . PHE C  2  303  ? 54.757  -37.863 49.697   1.00 37.84  ? 303  PHE C CE1   1 
ATOM   5952  C  CE2   . PHE C  2  303  ? 56.909  -38.890 49.535   1.00 41.94  ? 303  PHE C CE2   1 
ATOM   5953  C  CZ    . PHE C  2  303  ? 56.123  -37.755 49.526   1.00 40.13  ? 303  PHE C CZ    1 
ATOM   5954  N  N     . LEU C  2  304  ? 53.359  -44.290 51.306   1.00 54.85  ? 304  LEU C N     1 
ATOM   5955  C  CA    . LEU C  2  304  ? 52.349  -45.350 51.223   1.00 56.40  ? 304  LEU C CA    1 
ATOM   5956  C  C     . LEU C  2  304  ? 51.654  -45.699 52.551   1.00 53.38  ? 304  LEU C C     1 
ATOM   5957  O  O     . LEU C  2  304  ? 50.428  -45.783 52.584   1.00 51.00  ? 304  LEU C O     1 
ATOM   5958  C  CB    . LEU C  2  304  ? 52.883  -46.606 50.519   1.00 65.19  ? 304  LEU C CB    1 
ATOM   5959  C  CG    . LEU C  2  304  ? 51.833  -47.686 50.239   1.00 64.50  ? 304  LEU C CG    1 
ATOM   5960  C  CD1   . LEU C  2  304  ? 50.772  -47.174 49.274   1.00 54.62  ? 304  LEU C CD1   1 
ATOM   5961  C  CD2   . LEU C  2  304  ? 52.479  -48.956 49.708   1.00 75.58  ? 304  LEU C CD2   1 
ATOM   5962  N  N     . PRO C  2  305  ? 52.423  -45.911 53.642   1.00 53.19  ? 305  PRO C N     1 
ATOM   5963  C  CA    . PRO C  2  305  ? 51.756  -46.120 54.936   1.00 51.76  ? 305  PRO C CA    1 
ATOM   5964  C  C     . PRO C  2  305  ? 50.929  -44.914 55.379   1.00 48.25  ? 305  PRO C C     1 
ATOM   5965  O  O     . PRO C  2  305  ? 49.937  -45.073 56.093   1.00 46.41  ? 305  PRO C O     1 
ATOM   5966  C  CB    . PRO C  2  305  ? 52.926  -46.326 55.901   1.00 47.04  ? 305  PRO C CB    1 
ATOM   5967  C  CG    . PRO C  2  305  ? 54.010  -46.869 55.056   1.00 50.18  ? 305  PRO C CG    1 
ATOM   5968  C  CD    . PRO C  2  305  ? 53.870  -46.182 53.732   1.00 50.79  ? 305  PRO C CD    1 
ATOM   5969  N  N     . THR C  2  306  ? 51.343  -43.722 54.959   1.00 46.49  ? 306  THR C N     1 
ATOM   5970  C  CA    . THR C  2  306  ? 50.615  -42.500 55.273   1.00 42.38  ? 306  THR C CA    1 
ATOM   5971  C  C     . THR C  2  306  ? 49.254  -42.501 54.588   1.00 47.15  ? 306  THR C C     1 
ATOM   5972  O  O     . THR C  2  306  ? 48.224  -42.270 55.226   1.00 49.66  ? 306  THR C O     1 
ATOM   5973  C  CB    . THR C  2  306  ? 51.399  -41.253 54.833   1.00 39.24  ? 306  THR C CB    1 
ATOM   5974  O  OG1   . THR C  2  306  ? 52.672  -41.231 55.490   1.00 37.50  ? 306  THR C OG1   1 
ATOM   5975  C  CG2   . THR C  2  306  ? 50.631  -39.989 55.183   1.00 40.01  ? 306  THR C CG2   1 
ATOM   5976  N  N     . LEU C  2  307  ? 49.258  -42.766 53.285   1.00 48.30  ? 307  LEU C N     1 
ATOM   5977  C  CA    . LEU C  2  307  ? 48.023  -42.841 52.512   1.00 50.79  ? 307  LEU C CA    1 
ATOM   5978  C  C     . LEU C  2  307  ? 47.133  -43.970 53.021   1.00 49.89  ? 307  LEU C C     1 
ATOM   5979  O  O     . LEU C  2  307  ? 45.905  -43.852 53.048   1.00 49.17  ? 307  LEU C O     1 
ATOM   5980  C  CB    . LEU C  2  307  ? 48.341  -43.051 51.033   1.00 53.65  ? 307  LEU C CB    1 
ATOM   5981  C  CG    . LEU C  2  307  ? 47.158  -43.203 50.077   1.00 56.84  ? 307  LEU C CG    1 
ATOM   5982  C  CD1   . LEU C  2  307  ? 46.144  -42.087 50.274   1.00 51.44  ? 307  LEU C CD1   1 
ATOM   5983  C  CD2   . LEU C  2  307  ? 47.668  -43.210 48.654   1.00 58.66  ? 307  LEU C CD2   1 
ATOM   5984  N  N     . ARG C  2  308  ? 47.771  -45.061 53.425   1.00 49.97  ? 308  ARG C N     1 
ATOM   5985  C  CA    . ARG C  2  308  ? 47.078  -46.214 53.975   1.00 48.83  ? 308  ARG C CA    1 
ATOM   5986  C  C     . ARG C  2  308  ? 46.340  -45.817 55.251   1.00 45.07  ? 308  ARG C C     1 
ATOM   5987  O  O     . ARG C  2  308  ? 45.167  -46.143 55.421   1.00 43.39  ? 308  ARG C O     1 
ATOM   5988  C  CB    . ARG C  2  308  ? 48.080  -47.342 54.244   1.00 51.90  ? 308  ARG C CB    1 
ATOM   5989  C  CG    . ARG C  2  308  ? 47.480  -48.738 54.383   1.00 58.63  ? 308  ARG C CG    1 
ATOM   5990  C  CD    . ARG C  2  308  ? 47.019  -49.004 55.806   1.00 59.55  ? 308  ARG C CD    1 
ATOM   5991  N  NE    . ARG C  2  308  ? 47.988  -48.511 56.782   1.00 68.53  ? 308  ARG C NE    1 
ATOM   5992  C  CZ    . ARG C  2  308  ? 47.752  -48.414 58.086   1.00 64.56  ? 308  ARG C CZ    1 
ATOM   5993  N  NH1   . ARG C  2  308  ? 46.573  -48.776 58.573   1.00 62.51  ? 308  ARG C NH1   1 
ATOM   5994  N  NH2   . ARG C  2  308  ? 48.692  -47.950 58.901   1.00 56.76  ? 308  ARG C NH2   1 
ATOM   5995  N  N     . TYR C  2  309  ? 47.027  -45.105 56.141   1.00 44.73  ? 309  TYR C N     1 
ATOM   5996  C  CA    . TYR C  2  309  ? 46.417  -44.659 57.390   1.00 42.91  ? 309  TYR C CA    1 
ATOM   5997  C  C     . TYR C  2  309  ? 45.306  -43.649 57.114   1.00 38.36  ? 309  TYR C C     1 
ATOM   5998  O  O     . TYR C  2  309  ? 44.299  -43.617 57.819   1.00 38.18  ? 309  TYR C O     1 
ATOM   5999  C  CB    . TYR C  2  309  ? 47.469  -44.053 58.327   1.00 45.61  ? 309  TYR C CB    1 
ATOM   6000  C  CG    . TYR C  2  309  ? 47.040  -43.953 59.782   1.00 48.33  ? 309  TYR C CG    1 
ATOM   6001  C  CD1   . TYR C  2  309  ? 46.143  -42.976 60.204   1.00 46.84  ? 309  TYR C CD1   1 
ATOM   6002  C  CD2   . TYR C  2  309  ? 47.545  -44.829 60.735   1.00 50.68  ? 309  TYR C CD2   1 
ATOM   6003  C  CE1   . TYR C  2  309  ? 45.753  -42.881 61.532   1.00 45.31  ? 309  TYR C CE1   1 
ATOM   6004  C  CE2   . TYR C  2  309  ? 47.162  -44.741 62.067   1.00 56.47  ? 309  TYR C CE2   1 
ATOM   6005  C  CZ    . TYR C  2  309  ? 46.265  -43.767 62.458   1.00 52.95  ? 309  TYR C CZ    1 
ATOM   6006  O  OH    . TYR C  2  309  ? 45.884  -43.676 63.778   1.00 49.00  ? 309  TYR C OH    1 
ATOM   6007  N  N     . LEU C  2  310  ? 45.493  -42.827 56.086   1.00 38.14  ? 310  LEU C N     1 
ATOM   6008  C  CA    . LEU C  2  310  ? 44.479  -41.850 55.704   1.00 40.31  ? 310  LEU C CA    1 
ATOM   6009  C  C     . LEU C  2  310  ? 43.192  -42.536 55.256   1.00 43.84  ? 310  LEU C C     1 
ATOM   6010  O  O     . LEU C  2  310  ? 42.094  -42.164 55.680   1.00 38.66  ? 310  LEU C O     1 
ATOM   6011  C  CB    . LEU C  2  310  ? 44.997  -40.938 54.591   1.00 43.13  ? 310  LEU C CB    1 
ATOM   6012  C  CG    . LEU C  2  310  ? 43.978  -39.952 54.011   1.00 43.18  ? 310  LEU C CG    1 
ATOM   6013  C  CD1   . LEU C  2  310  ? 43.437  -39.032 55.096   1.00 43.94  ? 310  LEU C CD1   1 
ATOM   6014  C  CD2   . LEU C  2  310  ? 44.587  -39.146 52.873   1.00 40.97  ? 310  LEU C CD2   1 
ATOM   6015  N  N     . PHE C  2  311  ? 43.336  -43.541 54.396   1.00 52.28  ? 311  PHE C N     1 
ATOM   6016  C  CA    . PHE C  2  311  ? 42.189  -44.311 53.919   1.00 58.19  ? 311  PHE C CA    1 
ATOM   6017  C  C     . PHE C  2  311  ? 41.534  -45.104 55.049   1.00 59.12  ? 311  PHE C C     1 
ATOM   6018  O  O     . PHE C  2  311  ? 40.308  -45.213 55.113   1.00 59.43  ? 311  PHE C O     1 
ATOM   6019  C  CB    . PHE C  2  311  ? 42.596  -45.254 52.782   1.00 62.38  ? 311  PHE C CB    1 
ATOM   6020  C  CG    . PHE C  2  311  ? 42.746  -44.575 51.449   1.00 63.00  ? 311  PHE C CG    1 
ATOM   6021  C  CD1   . PHE C  2  311  ? 42.207  -43.317 51.231   1.00 67.01  ? 311  PHE C CD1   1 
ATOM   6022  C  CD2   . PHE C  2  311  ? 43.420  -45.199 50.412   1.00 62.06  ? 311  PHE C CD2   1 
ATOM   6023  C  CE1   . PHE C  2  311  ? 42.343  -42.692 50.007   1.00 69.87  ? 311  PHE C CE1   1 
ATOM   6024  C  CE2   . PHE C  2  311  ? 43.559  -44.579 49.185   1.00 65.07  ? 311  PHE C CE2   1 
ATOM   6025  C  CZ    . PHE C  2  311  ? 43.020  -43.325 48.983   1.00 72.65  ? 311  PHE C CZ    1 
ATOM   6026  N  N     . ALA C  2  312  ? 42.360  -45.658 55.932   1.00 49.93  ? 312  ALA C N     1 
ATOM   6027  C  CA    . ALA C  2  312  ? 41.865  -46.438 57.060   1.00 46.67  ? 312  ALA C CA    1 
ATOM   6028  C  C     . ALA C  2  312  ? 41.042  -45.563 57.996   1.00 48.09  ? 312  ALA C C     1 
ATOM   6029  O  O     . ALA C  2  312  ? 39.999  -45.982 58.497   1.00 49.03  ? 312  ALA C O     1 
ATOM   6030  C  CB    . ALA C  2  312  ? 43.020  -47.081 57.807   1.00 47.87  ? 312  ALA C CB    1 
ATOM   6031  N  N     . LEU C  2  313  ? 41.516  -44.343 58.223   1.00 51.23  ? 313  LEU C N     1 
ATOM   6032  C  CA    . LEU C  2  313  ? 40.800  -43.380 59.050   1.00 50.42  ? 313  LEU C CA    1 
ATOM   6033  C  C     . LEU C  2  313  ? 39.498  -42.962 58.380   1.00 48.23  ? 313  LEU C C     1 
ATOM   6034  O  O     . LEU C  2  313  ? 38.443  -42.929 59.016   1.00 45.88  ? 313  LEU C O     1 
ATOM   6035  C  CB    . LEU C  2  313  ? 41.667  -42.147 59.312   1.00 49.59  ? 313  LEU C CB    1 
ATOM   6036  C  CG    . LEU C  2  313  ? 41.007  -40.987 60.062   1.00 43.34  ? 313  LEU C CG    1 
ATOM   6037  C  CD1   . LEU C  2  313  ? 40.633  -41.392 61.480   1.00 44.87  ? 313  LEU C CD1   1 
ATOM   6038  C  CD2   . LEU C  2  313  ? 41.917  -39.771 60.069   1.00 43.86  ? 313  LEU C CD2   1 
ATOM   6039  N  N     . THR C  2  314  ? 39.580  -42.647 57.091   1.00 47.93  ? 314  THR C N     1 
ATOM   6040  C  CA    . THR C  2  314  ? 38.415  -42.192 56.340   1.00 54.27  ? 314  THR C CA    1 
ATOM   6041  C  C     . THR C  2  314  ? 37.331  -43.266 56.288   1.00 57.17  ? 314  THR C C     1 
ATOM   6042  O  O     . THR C  2  314  ? 36.139  -42.961 56.247   1.00 56.18  ? 314  THR C O     1 
ATOM   6043  C  CB    . THR C  2  314  ? 38.795  -41.782 54.904   1.00 54.50  ? 314  THR C CB    1 
ATOM   6044  O  OG1   . THR C  2  314  ? 39.983  -40.981 54.933   1.00 56.22  ? 314  THR C OG1   1 
ATOM   6045  C  CG2   . THR C  2  314  ? 37.667  -40.992 54.256   1.00 50.05  ? 314  THR C CG2   1 
ATOM   6046  N  N     . ALA C  2  315  ? 37.756  -44.526 56.299   1.00 60.53  ? 315  ALA C N     1 
ATOM   6047  C  CA    . ALA C  2  315  ? 36.831  -45.651 56.226   1.00 61.10  ? 315  ALA C CA    1 
ATOM   6048  C  C     . ALA C  2  315  ? 36.097  -45.878 57.546   1.00 55.31  ? 315  ALA C C     1 
ATOM   6049  O  O     . ALA C  2  315  ? 34.923  -46.244 57.559   1.00 54.01  ? 315  ALA C O     1 
ATOM   6050  C  CB    . ALA C  2  315  ? 37.568  -46.915 55.800   1.00 52.80  ? 315  ALA C CB    1 
ATOM   6051  N  N     . GLY C  2  316  ? 36.789  -45.641 58.655   1.00 50.69  ? 316  GLY C N     1 
ATOM   6052  C  CA    . GLY C  2  316  ? 36.246  -45.950 59.965   1.00 49.00  ? 316  GLY C CA    1 
ATOM   6053  C  C     . GLY C  2  316  ? 36.844  -47.225 60.530   1.00 47.17  ? 316  GLY C C     1 
ATOM   6054  O  O     . GLY C  2  316  ? 36.337  -47.782 61.504   1.00 48.69  ? 316  GLY C O     1 
ATOM   6055  N  N     . VAL C  2  317  ? 37.922  -47.689 59.904   1.00 45.50  ? 317  VAL C N     1 
ATOM   6056  C  CA    . VAL C  2  317  ? 38.649  -48.867 60.365   1.00 45.24  ? 317  VAL C CA    1 
ATOM   6057  C  C     . VAL C  2  317  ? 39.252  -48.616 61.746   1.00 50.64  ? 317  VAL C C     1 
ATOM   6058  O  O     . VAL C  2  317  ? 40.073  -47.713 61.910   1.00 54.72  ? 317  VAL C O     1 
ATOM   6059  C  CB    . VAL C  2  317  ? 39.775  -49.245 59.384   1.00 45.38  ? 317  VAL C CB    1 
ATOM   6060  C  CG1   . VAL C  2  317  ? 40.494  -50.498 59.855   1.00 52.74  ? 317  VAL C CG1   1 
ATOM   6061  C  CG2   . VAL C  2  317  ? 39.217  -49.441 57.985   1.00 42.82  ? 317  VAL C CG2   1 
ATOM   6062  N  N     . PRO C  2  318  ? 38.844  -49.421 62.742   1.00 48.62  ? 318  PRO C N     1 
ATOM   6063  C  CA    . PRO C  2  318  ? 39.237  -49.249 64.147   1.00 52.85  ? 318  PRO C CA    1 
ATOM   6064  C  C     . PRO C  2  318  ? 40.749  -49.290 64.354   1.00 52.34  ? 318  PRO C C     1 
ATOM   6065  O  O     . PRO C  2  318  ? 41.437  -50.079 63.707   1.00 57.26  ? 318  PRO C O     1 
ATOM   6066  C  CB    . PRO C  2  318  ? 38.582  -50.447 64.841   1.00 52.52  ? 318  PRO C CB    1 
ATOM   6067  C  CG    . PRO C  2  318  ? 37.453  -50.827 63.955   1.00 53.55  ? 318  PRO C CG    1 
ATOM   6068  C  CD    . PRO C  2  318  ? 37.936  -50.566 62.565   1.00 47.94  ? 318  PRO C CD    1 
ATOM   6069  N  N     . GLY C  2  319  ? 41.251  -48.444 65.249   1.00 50.76  ? 319  GLY C N     1 
ATOM   6070  C  CA    . GLY C  2  319  ? 42.673  -48.384 65.531   1.00 59.51  ? 319  GLY C CA    1 
ATOM   6071  C  C     . GLY C  2  319  ? 43.322  -47.176 64.886   1.00 62.55  ? 319  GLY C C     1 
ATOM   6072  O  O     . GLY C  2  319  ? 44.534  -46.971 64.990   1.00 61.85  ? 319  GLY C O     1 
ATOM   6073  N  N     . HIS C  2  320  ? 42.503  -46.373 64.214   1.00 63.67  ? 320  HIS C N     1 
ATOM   6074  C  CA    . HIS C  2  320  ? 42.973  -45.162 63.554   1.00 64.69  ? 320  HIS C CA    1 
ATOM   6075  C  C     . HIS C  2  320  ? 42.215  -43.948 64.082   1.00 64.62  ? 320  HIS C C     1 
ATOM   6076  O  O     . HIS C  2  320  ? 40.985  -43.909 64.039   1.00 66.31  ? 320  HIS C O     1 
ATOM   6077  C  CB    . HIS C  2  320  ? 42.794  -45.280 62.039   1.00 57.55  ? 320  HIS C CB    1 
ATOM   6078  C  CG    . HIS C  2  320  ? 43.313  -46.562 61.468   1.00 55.58  ? 320  HIS C CG    1 
ATOM   6079  N  ND1   . HIS C  2  320  ? 42.557  -47.715 61.416   1.00 54.88  ? 320  HIS C ND1   1 
ATOM   6080  C  CD2   . HIS C  2  320  ? 44.513  -46.879 60.929   1.00 57.68  ? 320  HIS C CD2   1 
ATOM   6081  C  CE1   . HIS C  2  320  ? 43.267  -48.681 60.868   1.00 57.33  ? 320  HIS C CE1   1 
ATOM   6082  N  NE2   . HIS C  2  320  ? 44.461  -48.201 60.562   1.00 56.88  ? 320  HIS C NE2   1 
ATOM   6083  N  N     . GLU C  2  321  ? 42.952  -42.959 64.577   1.00 63.94  ? 321  GLU C N     1 
ATOM   6084  C  CA    . GLU C  2  321  ? 42.335  -41.794 65.202   1.00 68.06  ? 321  GLU C CA    1 
ATOM   6085  C  C     . GLU C  2  321  ? 42.993  -40.493 64.764   1.00 57.66  ? 321  GLU C C     1 
ATOM   6086  O  O     . GLU C  2  321  ? 44.140  -40.483 64.316   1.00 50.93  ? 321  GLU C O     1 
ATOM   6087  C  CB    . GLU C  2  321  ? 42.406  -41.911 66.727   1.00 72.44  ? 321  GLU C CB    1 
ATOM   6088  C  CG    . GLU C  2  321  ? 43.827  -41.931 67.275   1.00 74.93  ? 321  GLU C CG    1 
ATOM   6089  C  CD    . GLU C  2  321  ? 43.877  -42.198 68.767   1.00 82.89  ? 321  GLU C CD    1 
ATOM   6090  O  OE1   . GLU C  2  321  ? 42.801  -42.320 69.389   1.00 83.93  ? 321  GLU C OE1   1 
ATOM   6091  O  OE2   . GLU C  2  321  ? 44.995  -42.288 69.318   1.00 85.72  ? 321  GLU C OE2   1 
ATOM   6092  N  N     . VAL C  2  322  ? 42.257  -39.395 64.901   1.00 56.32  ? 322  VAL C N     1 
ATOM   6093  C  CA    . VAL C  2  322  ? 42.800  -38.072 64.621   1.00 55.73  ? 322  VAL C CA    1 
ATOM   6094  C  C     . VAL C  2  322  ? 43.782  -37.687 65.718   1.00 51.98  ? 322  VAL C C     1 
ATOM   6095  O  O     . VAL C  2  322  ? 43.770  -38.273 66.802   1.00 53.13  ? 322  VAL C O     1 
ATOM   6096  C  CB    . VAL C  2  322  ? 41.695  -37.003 64.518   1.00 47.49  ? 322  VAL C CB    1 
ATOM   6097  C  CG1   . VAL C  2  322  ? 40.890  -37.192 63.243   1.00 45.96  ? 322  VAL C CG1   1 
ATOM   6098  C  CG2   . VAL C  2  322  ? 40.792  -37.049 65.742   1.00 53.87  ? 322  VAL C CG2   1 
ATOM   6099  N  N     . ASP C  2  323  ? 44.643  -36.718 65.428   1.00 38.34  ? 323  ASP C N     1 
ATOM   6100  C  CA    . ASP C  2  323  ? 45.646  -36.288 66.392   1.00 34.26  ? 323  ASP C CA    1 
ATOM   6101  C  C     . ASP C  2  323  ? 45.322  -34.939 67.016   1.00 34.41  ? 323  ASP C C     1 
ATOM   6102  O  O     . ASP C  2  323  ? 44.946  -33.993 66.326   1.00 39.08  ? 323  ASP C O     1 
ATOM   6103  C  CB    . ASP C  2  323  ? 47.027  -36.234 65.743   1.00 37.42  ? 323  ASP C CB    1 
ATOM   6104  C  CG    . ASP C  2  323  ? 47.555  -37.604 65.388   1.00 43.72  ? 323  ASP C CG    1 
ATOM   6105  O  OD1   . ASP C  2  323  ? 48.001  -38.321 66.309   1.00 50.48  ? 323  ASP C OD1   1 
ATOM   6106  O  OD2   . ASP C  2  323  ? 47.529  -37.959 64.191   1.00 39.46  ? 323  ASP C OD2   1 
ATOM   6107  N  N     . ASP C  2  324  ? 45.475  -34.860 68.332   1.00 34.56  ? 324  ASP C N     1 
ATOM   6108  C  CA    . ASP C  2  324  ? 45.371  -33.596 69.034   1.00 26.27  ? 324  ASP C CA    1 
ATOM   6109  C  C     . ASP C  2  324  ? 46.698  -32.888 68.810   1.00 27.24  ? 324  ASP C C     1 
ATOM   6110  O  O     . ASP C  2  324  ? 47.748  -33.394 69.198   1.00 28.95  ? 324  ASP C O     1 
ATOM   6111  C  CB    . ASP C  2  324  ? 45.154  -33.856 70.525   1.00 24.63  ? 324  ASP C CB    1 
ATOM   6112  C  CG    . ASP C  2  324  ? 44.763  -32.607 71.294   1.00 30.98  ? 324  ASP C CG    1 
ATOM   6113  O  OD1   . ASP C  2  324  ? 45.050  -31.488 70.819   1.00 36.85  ? 324  ASP C OD1   1 
ATOM   6114  O  OD2   . ASP C  2  324  ? 44.170  -32.750 72.385   1.00 30.04  ? 324  ASP C OD2   1 
ATOM   6115  N  N     . ILE C  2  325  ? 46.655  -31.719 68.181   1.00 25.58  ? 325  ILE C N     1 
ATOM   6116  C  CA    . ILE C  2  325  ? 47.879  -30.998 67.858   1.00 25.10  ? 325  ILE C CA    1 
ATOM   6117  C  C     . ILE C  2  325  ? 48.393  -30.192 69.045   1.00 24.07  ? 325  ILE C C     1 
ATOM   6118  O  O     . ILE C  2  325  ? 49.500  -29.660 69.008   1.00 23.95  ? 325  ILE C O     1 
ATOM   6119  C  CB    . ILE C  2  325  ? 47.682  -30.065 66.653   1.00 22.78  ? 325  ILE C CB    1 
ATOM   6120  C  CG1   . ILE C  2  325  ? 46.549  -29.082 66.929   1.00 25.55  ? 325  ILE C CG1   1 
ATOM   6121  C  CG2   . ILE C  2  325  ? 47.382  -30.871 65.403   1.00 26.29  ? 325  ILE C CG2   1 
ATOM   6122  C  CD1   . ILE C  2  325  ? 46.244  -28.173 65.767   1.00 38.84  ? 325  ILE C CD1   1 
ATOM   6123  N  N     . ASP C  2  326  ? 47.576  -30.094 70.090   1.00 22.96  ? 326  ASP C N     1 
ATOM   6124  C  CA    . ASP C  2  326  ? 47.960  -29.386 71.308   1.00 26.18  ? 326  ASP C CA    1 
ATOM   6125  C  C     . ASP C  2  326  ? 48.476  -30.325 72.398   1.00 25.11  ? 326  ASP C C     1 
ATOM   6126  O  O     . ASP C  2  326  ? 48.879  -29.881 73.476   1.00 21.49  ? 326  ASP C O     1 
ATOM   6127  C  CB    . ASP C  2  326  ? 46.787  -28.563 71.836   1.00 34.23  ? 326  ASP C CB    1 
ATOM   6128  C  CG    . ASP C  2  326  ? 46.350  -27.489 70.867   1.00 43.73  ? 326  ASP C CG    1 
ATOM   6129  O  OD1   . ASP C  2  326  ? 47.220  -26.953 70.144   1.00 46.09  ? 326  ASP C OD1   1 
ATOM   6130  O  OD2   . ASP C  2  326  ? 45.138  -27.183 70.829   1.00 53.53  ? 326  ASP C OD2   1 
ATOM   6131  N  N     . HIS C  2  327  ? 48.450  -31.623 72.112   1.00 25.43  ? 327  HIS C N     1 
ATOM   6132  C  CA    . HIS C  2  327  ? 48.980  -32.629 73.023   1.00 20.64  ? 327  HIS C CA    1 
ATOM   6133  C  C     . HIS C  2  327  ? 50.469  -32.369 73.200   1.00 18.44  ? 327  HIS C C     1 
ATOM   6134  O  O     . HIS C  2  327  ? 51.162  -32.055 72.234   1.00 20.56  ? 327  HIS C O     1 
ATOM   6135  C  CB    . HIS C  2  327  ? 48.760  -34.028 72.440   1.00 18.90  ? 327  HIS C CB    1 
ATOM   6136  C  CG    . HIS C  2  327  ? 48.654  -35.108 73.469   1.00 16.49  ? 327  HIS C CG    1 
ATOM   6137  N  ND1   . HIS C  2  327  ? 49.758  -35.674 74.075   1.00 18.73  ? 327  HIS C ND1   1 
ATOM   6138  C  CD2   . HIS C  2  327  ? 47.576  -35.735 73.997   1.00 15.63  ? 327  HIS C CD2   1 
ATOM   6139  C  CE1   . HIS C  2  327  ? 49.363  -36.596 74.932   1.00 19.00  ? 327  HIS C CE1   1 
ATOM   6140  N  NE2   . HIS C  2  327  ? 48.042  -36.653 74.905   1.00 17.84  ? 327  HIS C NE2   1 
ATOM   6141  N  N     . LEU C  2  328  ? 50.974  -32.519 74.419   1.00 18.47  ? 328  LEU C N     1 
ATOM   6142  C  CA    . LEU C  2  328  ? 52.378  -32.207 74.681   1.00 19.93  ? 328  LEU C CA    1 
ATOM   6143  C  C     . LEU C  2  328  ? 53.277  -33.345 74.219   1.00 17.42  ? 328  LEU C C     1 
ATOM   6144  O  O     . LEU C  2  328  ? 54.501  -33.293 74.368   1.00 14.58  ? 328  LEU C O     1 
ATOM   6145  C  CB    . LEU C  2  328  ? 52.621  -31.863 76.153   1.00 14.33  ? 328  LEU C CB    1 
ATOM   6146  C  CG    . LEU C  2  328  ? 52.376  -30.392 76.505   1.00 13.02  ? 328  LEU C CG    1 
ATOM   6147  C  CD1   . LEU C  2  328  ? 52.929  -30.059 77.881   1.00 14.68  ? 328  LEU C CD1   1 
ATOM   6148  C  CD2   . LEU C  2  328  ? 52.973  -29.470 75.449   1.00 11.62  ? 328  LEU C CD2   1 
ATOM   6149  N  N     . GLY C  2  329  ? 52.649  -34.378 73.668   1.00 14.87  ? 329  GLY C N     1 
ATOM   6150  C  CA    . GLY C  2  329  ? 53.361  -35.407 72.945   1.00 15.30  ? 329  GLY C CA    1 
ATOM   6151  C  C     . GLY C  2  329  ? 53.556  -34.976 71.504   1.00 18.78  ? 329  GLY C C     1 
ATOM   6152  O  O     . GLY C  2  329  ? 54.476  -35.437 70.835   1.00 26.38  ? 329  GLY C O     1 
ATOM   6153  N  N     . ASN C  2  330  ? 52.682  -34.099 71.017   1.00 16.34  ? 330  ASN C N     1 
ATOM   6154  C  CA    . ASN C  2  330  ? 52.805  -33.580 69.655   1.00 17.42  ? 330  ASN C CA    1 
ATOM   6155  C  C     . ASN C  2  330  ? 53.493  -32.219 69.563   1.00 15.53  ? 330  ASN C C     1 
ATOM   6156  O  O     . ASN C  2  330  ? 53.715  -31.708 68.468   1.00 14.22  ? 330  ASN C O     1 
ATOM   6157  C  CB    . ASN C  2  330  ? 51.437  -33.519 68.972   1.00 20.73  ? 330  ASN C CB    1 
ATOM   6158  C  CG    . ASN C  2  330  ? 50.876  -34.894 68.669   1.00 22.17  ? 330  ASN C CG    1 
ATOM   6159  O  OD1   . ASN C  2  330  ? 51.624  -35.845 68.447   1.00 23.55  ? 330  ASN C OD1   1 
ATOM   6160  N  ND2   . ASN C  2  330  ? 49.553  -35.005 68.654   1.00 24.85  ? 330  ASN C ND2   1 
ATOM   6161  N  N     . ARG C  2  331  ? 53.822  -31.642 70.716   1.00 16.84  ? 331  ARG C N     1 
ATOM   6162  C  CA    . ARG C  2  331  ? 54.520  -30.360 70.785   1.00 13.37  ? 331  ARG C CA    1 
ATOM   6163  C  C     . ARG C  2  331  ? 55.849  -30.559 71.491   1.00 11.69  ? 331  ARG C C     1 
ATOM   6164  O  O     . ARG C  2  331  ? 55.896  -31.116 72.585   1.00 13.74  ? 331  ARG C O     1 
ATOM   6165  C  CB    . ARG C  2  331  ? 53.692  -29.318 71.548   1.00 13.53  ? 331  ARG C CB    1 
ATOM   6166  C  CG    . ARG C  2  331  ? 52.412  -28.869 70.851   1.00 17.33  ? 331  ARG C CG    1 
ATOM   6167  C  CD    . ARG C  2  331  ? 51.622  -27.864 71.697   1.00 19.70  ? 331  ARG C CD    1 
ATOM   6168  N  NE    . ARG C  2  331  ? 52.251  -26.543 71.740   1.00 24.84  ? 331  ARG C NE    1 
ATOM   6169  C  CZ    . ARG C  2  331  ? 51.804  -25.520 72.466   1.00 17.46  ? 331  ARG C CZ    1 
ATOM   6170  N  NH1   . ARG C  2  331  ? 50.723  -25.662 73.219   1.00 26.34  ? 331  ARG C NH1   1 
ATOM   6171  N  NH2   . ARG C  2  331  ? 52.439  -24.356 72.447   1.00 10.32  ? 331  ARG C NH2   1 
ATOM   6172  N  N     . ARG C  2  332  ? 56.930  -30.093 70.877   1.00 11.88  ? 332  ARG C N     1 
ATOM   6173  C  CA    . ARG C  2  332  ? 58.255  -30.298 71.447   1.00 11.64  ? 332  ARG C CA    1 
ATOM   6174  C  C     . ARG C  2  332  ? 58.974  -28.985 71.706   1.00 11.95  ? 332  ARG C C     1 
ATOM   6175  O  O     . ARG C  2  332  ? 58.601  -27.941 71.165   1.00 16.44  ? 332  ARG C O     1 
ATOM   6176  C  CB    . ARG C  2  332  ? 59.103  -31.183 70.537   1.00 13.75  ? 332  ARG C CB    1 
ATOM   6177  C  CG    . ARG C  2  332  ? 59.318  -30.613 69.154   1.00 15.07  ? 332  ARG C CG    1 
ATOM   6178  C  CD    . ARG C  2  332  ? 60.252  -31.489 68.347   1.00 15.81  ? 332  ARG C CD    1 
ATOM   6179  N  NE    . ARG C  2  332  ? 61.551  -31.623 68.997   1.00 15.04  ? 332  ARG C NE    1 
ATOM   6180  C  CZ    . ARG C  2  332  ? 62.625  -30.913 68.672   1.00 17.03  ? 332  ARG C CZ    1 
ATOM   6181  N  NH1   . ARG C  2  332  ? 62.561  -30.020 67.695   1.00 15.66  ? 332  ARG C NH1   1 
ATOM   6182  N  NH2   . ARG C  2  332  ? 63.767  -31.100 69.320   1.00 22.98  ? 332  ARG C NH2   1 
ATOM   6183  N  N     . ILE C  2  333  ? 60.009  -29.053 72.537   1.00 11.47  ? 333  ILE C N     1 
ATOM   6184  C  CA    . ILE C  2  333  ? 60.766  -27.876 72.941   1.00 11.39  ? 333  ILE C CA    1 
ATOM   6185  C  C     . ILE C  2  333  ? 62.120  -27.810 72.252   1.00 11.79  ? 333  ILE C C     1 
ATOM   6186  O  O     . ILE C  2  333  ? 62.913  -28.746 72.323   1.00 13.66  ? 333  ILE C O     1 
ATOM   6187  C  CB    . ILE C  2  333  ? 61.021  -27.870 74.456   1.00 10.74  ? 333  ILE C CB    1 
ATOM   6188  C  CG1   . ILE C  2  333  ? 59.734  -28.176 75.218   1.00 11.22  ? 333  ILE C CG1   1 
ATOM   6189  C  CG2   . ILE C  2  333  ? 61.608  -26.538 74.891   1.00 13.58  ? 333  ILE C CG2   1 
ATOM   6190  C  CD1   . ILE C  2  333  ? 58.647  -27.157 75.013   1.00 13.13  ? 333  ILE C CD1   1 
ATOM   6191  N  N     . ARG C  2  334  ? 62.384  -26.695 71.585   1.00 10.44  ? 334  ARG C N     1 
ATOM   6192  C  CA    . ARG C  2  334  ? 63.694  -26.451 71.012   1.00 13.15  ? 334  ARG C CA    1 
ATOM   6193  C  C     . ARG C  2  334  ? 64.501  -25.613 71.992   1.00 14.11  ? 334  ARG C C     1 
ATOM   6194  O  O     . ARG C  2  334  ? 64.209  -24.437 72.210   1.00 14.34  ? 334  ARG C O     1 
ATOM   6195  C  CB    . ARG C  2  334  ? 63.563  -25.727 69.675   1.00 11.73  ? 334  ARG C CB    1 
ATOM   6196  C  CG    . ARG C  2  334  ? 62.545  -26.354 68.742   1.00 12.56  ? 334  ARG C CG    1 
ATOM   6197  C  CD    . ARG C  2  334  ? 62.410  -25.565 67.458   1.00 13.70  ? 334  ARG C CD    1 
ATOM   6198  N  NE    . ARG C  2  334  ? 63.476  -25.872 66.515   1.00 15.80  ? 334  ARG C NE    1 
ATOM   6199  C  CZ    . ARG C  2  334  ? 63.955  -25.008 65.629   1.00 25.38  ? 334  ARG C CZ    1 
ATOM   6200  N  NH1   . ARG C  2  334  ? 63.470  -23.775 65.574   1.00 26.60  ? 334  ARG C NH1   1 
ATOM   6201  N  NH2   . ARG C  2  334  ? 64.925  -25.374 64.802   1.00 32.11  ? 334  ARG C NH2   1 
ATOM   6202  N  N     . THR C  2  335  ? 65.519  -26.231 72.582   1.00 15.44  ? 335  THR C N     1 
ATOM   6203  C  CA    . THR C  2  335  ? 66.352  -25.563 73.573   1.00 15.67  ? 335  THR C CA    1 
ATOM   6204  C  C     . THR C  2  335  ? 67.458  -24.769 72.889   1.00 15.45  ? 335  THR C C     1 
ATOM   6205  O  O     . THR C  2  335  ? 67.557  -24.774 71.664   1.00 15.64  ? 335  THR C O     1 
ATOM   6206  C  CB    . THR C  2  335  ? 66.965  -26.575 74.556   1.00 17.30  ? 335  THR C CB    1 
ATOM   6207  O  OG1   . THR C  2  335  ? 67.556  -27.656 73.823   1.00 13.18  ? 335  THR C OG1   1 
ATOM   6208  C  CG2   . THR C  2  335  ? 65.893  -27.133 75.478   1.00 16.34  ? 335  THR C CG2   1 
ATOM   6209  N  N     . VAL C  2  336  ? 68.285  -24.097 73.686   1.00 12.41  ? 336  VAL C N     1 
ATOM   6210  C  CA    . VAL C  2  336  ? 69.326  -23.209 73.168   1.00 11.82  ? 336  VAL C CA    1 
ATOM   6211  C  C     . VAL C  2  336  ? 70.297  -23.908 72.207   1.00 14.29  ? 336  VAL C C     1 
ATOM   6212  O  O     . VAL C  2  336  ? 70.659  -23.359 71.153   1.00 17.02  ? 336  VAL C O     1 
ATOM   6213  C  CB    . VAL C  2  336  ? 70.089  -22.528 74.326   1.00 10.74  ? 336  VAL C CB    1 
ATOM   6214  C  CG1   . VAL C  2  336  ? 70.368  -23.522 75.438   1.00 11.67  ? 336  VAL C CG1   1 
ATOM   6215  C  CG2   . VAL C  2  336  ? 71.370  -21.880 73.828   1.00 11.86  ? 336  VAL C CG2   1 
ATOM   6216  N  N     . GLY C  2  337  ? 70.693  -25.127 72.563   1.00 13.99  ? 337  GLY C N     1 
ATOM   6217  C  CA    . GLY C  2  337  ? 71.583  -25.923 71.738   1.00 15.07  ? 337  GLY C CA    1 
ATOM   6218  C  C     . GLY C  2  337  ? 71.062  -26.161 70.333   1.00 17.91  ? 337  GLY C C     1 
ATOM   6219  O  O     . GLY C  2  337  ? 71.812  -26.042 69.366   1.00 18.67  ? 337  GLY C O     1 
ATOM   6220  N  N     . GLU C  2  338  ? 69.775  -26.482 70.218   1.00 17.29  ? 338  GLU C N     1 
ATOM   6221  C  CA    . GLU C  2  338  ? 69.158  -26.768 68.923   1.00 15.79  ? 338  GLU C CA    1 
ATOM   6222  C  C     . GLU C  2  338  ? 69.029  -25.528 68.033   1.00 19.59  ? 338  GLU C C     1 
ATOM   6223  O  O     . GLU C  2  338  ? 69.215  -25.603 66.816   1.00 24.34  ? 338  GLU C O     1 
ATOM   6224  C  CB    . GLU C  2  338  ? 67.788  -27.422 69.114   1.00 12.40  ? 338  GLU C CB    1 
ATOM   6225  C  CG    . GLU C  2  338  ? 67.075  -27.753 67.811   1.00 19.04  ? 338  GLU C CG    1 
ATOM   6226  C  CD    . GLU C  2  338  ? 65.746  -28.457 68.031   1.00 25.24  ? 338  GLU C CD    1 
ATOM   6227  O  OE1   . GLU C  2  338  ? 65.519  -28.961 69.155   1.00 20.88  ? 338  GLU C OE1   1 
ATOM   6228  O  OE2   . GLU C  2  338  ? 64.930  -28.504 67.081   1.00 21.46  ? 338  GLU C OE2   1 
ATOM   6229  N  N     . LEU C  2  339  ? 68.710  -24.392 68.645   1.00 18.29  ? 339  LEU C N     1 
ATOM   6230  C  CA    . LEU C  2  339  ? 68.563  -23.136 67.916   1.00 17.20  ? 339  LEU C CA    1 
ATOM   6231  C  C     . LEU C  2  339  ? 69.919  -22.680 67.392   1.00 21.26  ? 339  LEU C C     1 
ATOM   6232  O  O     . LEU C  2  339  ? 70.086  -22.391 66.187   1.00 30.86  ? 339  LEU C O     1 
ATOM   6233  C  CB    . LEU C  2  339  ? 67.965  -22.064 68.828   1.00 16.28  ? 339  LEU C CB    1 
ATOM   6234  C  CG    . LEU C  2  339  ? 66.731  -22.497 69.629   1.00 15.45  ? 339  LEU C CG    1 
ATOM   6235  C  CD1   . LEU C  2  339  ? 66.321  -21.429 70.637   1.00 11.61  ? 339  LEU C CD1   1 
ATOM   6236  C  CD2   . LEU C  2  339  ? 65.571  -22.855 68.707   1.00 12.68  ? 339  LEU C CD2   1 
ATOM   6237  N  N     . MET C  2  340  ? 70.892  -22.627 68.299   1.00 18.46  ? 340  MET C N     1 
ATOM   6238  C  CA    . MET C  2  340  ? 72.256  -22.286 67.914   1.00 23.70  ? 340  MET C CA    1 
ATOM   6239  C  C     . MET C  2  340  ? 72.754  -23.232 66.819   1.00 21.65  ? 340  MET C C     1 
ATOM   6240  O  O     . MET C  2  340  ? 73.392  -22.798 65.861   1.00 19.26  ? 340  MET C O     1 
ATOM   6241  C  CB    . MET C  2  340  ? 73.190  -22.315 69.126   1.00 19.76  ? 340  MET C CB    1 
ATOM   6242  C  CG    . MET C  2  340  ? 74.578  -21.760 68.851   1.00 19.27  ? 340  MET C CG    1 
ATOM   6243  S  SD    . MET C  2  340  ? 75.679  -22.917 68.007   1.00 25.05  ? 340  MET C SD    1 
ATOM   6244  C  CE    . MET C  2  340  ? 75.878  -24.165 69.277   1.00 25.73  ? 340  MET C CE    1 
ATOM   6245  N  N     . THR C  2  341  ? 72.456  -24.520 66.970   1.00 22.21  ? 341  THR C N     1 
ATOM   6246  C  CA    . THR C  2  341  ? 72.838  -25.518 65.976   1.00 19.97  ? 341  THR C CA    1 
ATOM   6247  C  C     . THR C  2  341  ? 72.219  -25.207 64.620   1.00 23.83  ? 341  THR C C     1 
ATOM   6248  O  O     . THR C  2  341  ? 72.880  -25.335 63.594   1.00 29.28  ? 341  THR C O     1 
ATOM   6249  C  CB    . THR C  2  341  ? 72.436  -26.945 66.408   1.00 19.67  ? 341  THR C CB    1 
ATOM   6250  O  OG1   . THR C  2  341  ? 73.197  -27.326 67.559   1.00 21.22  ? 341  THR C OG1   1 
ATOM   6251  C  CG2   . THR C  2  341  ? 72.695  -27.947 65.291   1.00 20.43  ? 341  THR C CG2   1 
ATOM   6252  N  N     . ASP C  2  342  ? 70.955  -24.795 64.615   1.00 23.47  ? 342  ASP C N     1 
ATOM   6253  C  CA    . ASP C  2  342  ? 70.284  -24.451 63.364   1.00 27.31  ? 342  ASP C CA    1 
ATOM   6254  C  C     . ASP C  2  342  ? 70.964  -23.288 62.652   1.00 27.99  ? 342  ASP C C     1 
ATOM   6255  O  O     . ASP C  2  342  ? 71.258  -23.365 61.448   1.00 29.28  ? 342  ASP C O     1 
ATOM   6256  C  CB    . ASP C  2  342  ? 68.807  -24.132 63.598   1.00 31.38  ? 342  ASP C CB    1 
ATOM   6257  C  CG    . ASP C  2  342  ? 67.916  -25.338 63.399   1.00 42.62  ? 342  ASP C CG    1 
ATOM   6258  O  OD1   . ASP C  2  342  ? 68.310  -26.441 63.834   1.00 50.60  ? 342  ASP C OD1   1 
ATOM   6259  O  OD2   . ASP C  2  342  ? 66.829  -25.184 62.798   1.00 47.14  ? 342  ASP C OD2   1 
ATOM   6260  N  N     . GLN C  2  343  ? 71.220  -22.211 63.392   1.00 23.86  ? 343  GLN C N     1 
ATOM   6261  C  CA    . GLN C  2  343  ? 71.872  -21.057 62.774   1.00 24.13  ? 343  GLN C CA    1 
ATOM   6262  C  C     . GLN C  2  343  ? 73.285  -21.401 62.322   1.00 25.44  ? 343  GLN C C     1 
ATOM   6263  O  O     . GLN C  2  343  ? 73.783  -20.867 61.323   1.00 32.33  ? 343  GLN C O     1 
ATOM   6264  C  CB    . GLN C  2  343  ? 71.868  -19.853 63.709   1.00 22.93  ? 343  GLN C CB    1 
ATOM   6265  C  CG    . GLN C  2  343  ? 70.479  -19.304 63.925   1.00 28.57  ? 343  GLN C CG    1 
ATOM   6266  C  CD    . GLN C  2  343  ? 69.745  -19.082 62.620   1.00 29.73  ? 343  GLN C CD    1 
ATOM   6267  O  OE1   . GLN C  2  343  ? 68.848  -19.846 62.260   1.00 28.15  ? 343  GLN C OE1   1 
ATOM   6268  N  NE2   . GLN C  2  343  ? 70.127  -18.034 61.900   1.00 28.50  ? 343  GLN C NE2   1 
ATOM   6269  N  N     . PHE C  2  344  ? 73.911  -22.313 63.055   1.00 22.31  ? 344  PHE C N     1 
ATOM   6270  C  CA    . PHE C  2  344  ? 75.227  -22.818 62.703   1.00 21.27  ? 344  PHE C CA    1 
ATOM   6271  C  C     . PHE C  2  344  ? 75.144  -23.533 61.362   1.00 24.51  ? 344  PHE C C     1 
ATOM   6272  O  O     . PHE C  2  344  ? 75.987  -23.331 60.491   1.00 31.64  ? 344  PHE C O     1 
ATOM   6273  C  CB    . PHE C  2  344  ? 75.734  -23.772 63.786   1.00 25.22  ? 344  PHE C CB    1 
ATOM   6274  C  CG    . PHE C  2  344  ? 77.208  -24.054 63.709   1.00 26.38  ? 344  PHE C CG    1 
ATOM   6275  C  CD1   . PHE C  2  344  ? 78.122  -23.197 64.297   1.00 26.81  ? 344  PHE C CD1   1 
ATOM   6276  C  CD2   . PHE C  2  344  ? 77.678  -25.180 63.055   1.00 26.55  ? 344  PHE C CD2   1 
ATOM   6277  C  CE1   . PHE C  2  344  ? 79.477  -23.453 64.227   1.00 24.12  ? 344  PHE C CE1   1 
ATOM   6278  C  CE2   . PHE C  2  344  ? 79.032  -25.443 62.984   1.00 25.61  ? 344  PHE C CE2   1 
ATOM   6279  C  CZ    . PHE C  2  344  ? 79.932  -24.578 63.572   1.00 25.77  ? 344  PHE C CZ    1 
ATOM   6280  N  N     . ARG C  2  345  ? 74.112  -24.357 61.199   1.00 23.81  ? 345  ARG C N     1 
ATOM   6281  C  CA    . ARG C  2  345  ? 73.904  -25.112 59.971   1.00 27.27  ? 345  ARG C CA    1 
ATOM   6282  C  C     . ARG C  2  345  ? 73.730  -24.155 58.800   1.00 30.33  ? 345  ARG C C     1 
ATOM   6283  O  O     . ARG C  2  345  ? 74.317  -24.347 57.731   1.00 36.85  ? 345  ARG C O     1 
ATOM   6284  C  CB    . ARG C  2  345  ? 72.674  -26.010 60.099   1.00 28.21  ? 345  ARG C CB    1 
ATOM   6285  C  CG    . ARG C  2  345  ? 72.672  -27.201 59.157   1.00 37.73  ? 345  ARG C CG    1 
ATOM   6286  C  CD    . ARG C  2  345  ? 71.263  -27.737 58.932   1.00 57.05  ? 345  ARG C CD    1 
ATOM   6287  N  NE    . ARG C  2  345  ? 70.534  -26.954 57.935   1.00 73.11  ? 345  ARG C NE    1 
ATOM   6288  C  CZ    . ARG C  2  345  ? 69.665  -25.987 58.219   1.00 73.64  ? 345  ARG C CZ    1 
ATOM   6289  N  NH1   . ARG C  2  345  ? 69.398  -25.676 59.482   1.00 66.94  ? 345  ARG C NH1   1 
ATOM   6290  N  NH2   . ARG C  2  345  ? 69.056  -25.332 57.237   1.00 66.90  ? 345  ARG C NH2   1 
ATOM   6291  N  N     . VAL C  2  346  ? 72.930  -23.115 59.017   1.00 30.73  ? 346  VAL C N     1 
ATOM   6292  C  CA    . VAL C  2  346  ? 72.732  -22.078 58.007   1.00 31.74  ? 346  VAL C CA    1 
ATOM   6293  C  C     . VAL C  2  346  ? 74.049  -21.423 57.572   1.00 32.48  ? 346  VAL C C     1 
ATOM   6294  O  O     . VAL C  2  346  ? 74.408  -21.445 56.382   1.00 34.64  ? 346  VAL C O     1 
ATOM   6295  C  CB    . VAL C  2  346  ? 71.769  -20.990 58.517   1.00 32.36  ? 346  VAL C CB    1 
ATOM   6296  C  CG1   . VAL C  2  346  ? 71.757  -19.798 57.574   1.00 35.12  ? 346  VAL C CG1   1 
ATOM   6297  C  CG2   . VAL C  2  346  ? 70.371  -21.563 58.689   1.00 35.51  ? 346  VAL C CG2   1 
ATOM   6298  N  N     . GLY C  2  347  ? 74.769  -20.853 58.538   1.00 29.73  ? 347  GLY C N     1 
ATOM   6299  C  CA    . GLY C  2  347  ? 76.028  -20.180 58.257   1.00 31.15  ? 347  GLY C CA    1 
ATOM   6300  C  C     . GLY C  2  347  ? 77.050  -21.080 57.587   1.00 31.38  ? 347  GLY C C     1 
ATOM   6301  O  O     . GLY C  2  347  ? 77.837  -20.638 56.742   1.00 34.17  ? 347  GLY C O     1 
ATOM   6302  N  N     . LEU C  2  348  ? 77.025  -22.355 57.963   1.00 30.07  ? 348  LEU C N     1 
ATOM   6303  C  CA    . LEU C  2  348  ? 77.931  -23.353 57.406   1.00 32.35  ? 348  LEU C CA    1 
ATOM   6304  C  C     . LEU C  2  348  ? 77.595  -23.644 55.947   1.00 34.75  ? 348  LEU C C     1 
ATOM   6305  O  O     . LEU C  2  348  ? 78.490  -23.793 55.110   1.00 33.61  ? 348  LEU C O     1 
ATOM   6306  C  CB    . LEU C  2  348  ? 77.860  -24.641 58.226   1.00 29.08  ? 348  LEU C CB    1 
ATOM   6307  C  CG    . LEU C  2  348  ? 79.146  -25.454 58.346   1.00 27.99  ? 348  LEU C CG    1 
ATOM   6308  C  CD1   . LEU C  2  348  ? 80.259  -24.592 58.925   1.00 27.87  ? 348  LEU C CD1   1 
ATOM   6309  C  CD2   . LEU C  2  348  ? 78.907  -26.677 59.207   1.00 23.68  ? 348  LEU C CD2   1 
ATOM   6310  N  N     . ALA C  2  349  ? 76.303  -23.732 55.645   1.00 36.03  ? 349  ALA C N     1 
ATOM   6311  C  CA    . ALA C  2  349  ? 75.865  -23.928 54.268   1.00 32.45  ? 349  ALA C CA    1 
ATOM   6312  C  C     . ALA C  2  349  ? 76.261  -22.738 53.394   1.00 36.88  ? 349  ALA C C     1 
ATOM   6313  O  O     . ALA C  2  349  ? 76.714  -22.918 52.258   1.00 42.47  ? 349  ALA C O     1 
ATOM   6314  C  CB    . ALA C  2  349  ? 74.366  -24.163 54.210   1.00 33.12  ? 349  ALA C CB    1 
ATOM   6315  N  N     . ARG C  2  350  ? 76.093  -21.527 53.925   1.00 39.11  ? 350  ARG C N     1 
ATOM   6316  C  CA    . ARG C  2  350  ? 76.534  -20.325 53.211   1.00 40.70  ? 350  ARG C CA    1 
ATOM   6317  C  C     . ARG C  2  350  ? 78.037  -20.389 52.935   1.00 45.96  ? 350  ARG C C     1 
ATOM   6318  O  O     . ARG C  2  350  ? 78.505  -20.080 51.825   1.00 52.58  ? 350  ARG C O     1 
ATOM   6319  C  CB    . ARG C  2  350  ? 76.199  -19.064 54.010   1.00 36.85  ? 350  ARG C CB    1 
ATOM   6320  C  CG    . ARG C  2  350  ? 74.711  -18.831 54.215   1.00 39.11  ? 350  ARG C CG    1 
ATOM   6321  C  CD    . ARG C  2  350  ? 74.467  -17.679 55.179   1.00 44.23  ? 350  ARG C CD    1 
ATOM   6322  N  NE    . ARG C  2  350  ? 73.048  -17.490 55.467   1.00 38.29  ? 350  ARG C NE    1 
ATOM   6323  C  CZ    . ARG C  2  350  ? 72.575  -16.612 56.345   1.00 42.43  ? 350  ARG C CZ    1 
ATOM   6324  N  NH1   . ARG C  2  350  ? 73.409  -15.838 57.029   1.00 41.87  ? 350  ARG C NH1   1 
ATOM   6325  N  NH2   . ARG C  2  350  ? 71.268  -16.507 56.543   1.00 44.96  ? 350  ARG C NH2   1 
ATOM   6326  N  N     . LEU C  2  351  ? 78.786  -20.799 53.955   1.00 44.71  ? 351  LEU C N     1 
ATOM   6327  C  CA    . LEU C  2  351  ? 80.221  -21.010 53.816   1.00 43.85  ? 351  LEU C CA    1 
ATOM   6328  C  C     . LEU C  2  351  ? 80.523  -22.001 52.696   1.00 46.21  ? 351  LEU C C     1 
ATOM   6329  O  O     . LEU C  2  351  ? 81.484  -21.825 51.952   1.00 51.17  ? 351  LEU C O     1 
ATOM   6330  C  CB    . LEU C  2  351  ? 80.818  -21.500 55.137   1.00 44.92  ? 351  LEU C CB    1 
ATOM   6331  C  CG    . LEU C  2  351  ? 82.301  -21.871 55.154   1.00 46.91  ? 351  LEU C CG    1 
ATOM   6332  C  CD1   . LEU C  2  351  ? 82.966  -21.320 56.403   1.00 50.70  ? 351  LEU C CD1   1 
ATOM   6333  C  CD2   . LEU C  2  351  ? 82.478  -23.383 55.083   1.00 41.35  ? 351  LEU C CD2   1 
ATOM   6334  N  N     . ALA C  2  352  ? 79.693  -23.035 52.580   1.00 43.52  ? 352  ALA C N     1 
ATOM   6335  C  CA    . ALA C  2  352  ? 79.861  -24.052 51.541   1.00 49.52  ? 352  ALA C CA    1 
ATOM   6336  C  C     . ALA C  2  352  ? 79.614  -23.505 50.133   1.00 66.56  ? 352  ALA C C     1 
ATOM   6337  O  O     . ALA C  2  352  ? 80.359  -23.821 49.197   1.00 77.61  ? 352  ALA C O     1 
ATOM   6338  C  CB    . ALA C  2  352  ? 78.960  -25.241 51.808   1.00 43.84  ? 352  ALA C CB    1 
ATOM   6339  N  N     . ARG C  2  353  ? 78.562  -22.702 49.979   1.00 64.47  ? 353  ARG C N     1 
ATOM   6340  C  CA    . ARG C  2  353  ? 78.301  -22.049 48.698   1.00 59.44  ? 353  ARG C CA    1 
ATOM   6341  C  C     . ARG C  2  353  ? 79.503  -21.188 48.309   1.00 63.32  ? 353  ARG C C     1 
ATOM   6342  O  O     . ARG C  2  353  ? 79.962  -21.217 47.157   1.00 69.34  ? 353  ARG C O     1 
ATOM   6343  C  CB    . ARG C  2  353  ? 77.020  -21.210 48.760   1.00 58.28  ? 353  ARG C CB    1 
ATOM   6344  C  CG    . ARG C  2  353  ? 76.646  -20.532 47.447   1.00 69.45  ? 353  ARG C CG    1 
ATOM   6345  C  CD    . ARG C  2  353  ? 76.873  -19.026 47.510   1.00 81.13  ? 353  ARG C CD    1 
ATOM   6346  N  NE    . ARG C  2  353  ? 76.679  -18.380 46.213   1.00 79.93  ? 353  ARG C NE    1 
ATOM   6347  C  CZ    . ARG C  2  353  ? 76.770  -17.069 46.007   1.00 79.83  ? 353  ARG C CZ    1 
ATOM   6348  N  NH1   . ARG C  2  353  ? 77.052  -16.254 47.015   1.00 80.50  ? 353  ARG C NH1   1 
ATOM   6349  N  NH2   . ARG C  2  353  ? 76.579  -16.572 44.792   1.00 69.01  ? 353  ARG C NH2   1 
ATOM   6350  N  N     . GLY C  2  354  ? 80.024  -20.441 49.283   1.00 62.27  ? 354  GLY C N     1 
ATOM   6351  C  CA    . GLY C  2  354  ? 81.246  -19.680 49.077   1.00 63.03  ? 354  GLY C CA    1 
ATOM   6352  C  C     . GLY C  2  354  ? 82.413  -20.564 48.658   1.00 65.88  ? 354  GLY C C     1 
ATOM   6353  O  O     . GLY C  2  354  ? 83.243  -20.172 47.831   1.00 63.45  ? 354  GLY C O     1 
ATOM   6354  N  N     . VAL C  2  355  ? 82.468  -21.767 49.225   1.00 68.04  ? 355  VAL C N     1 
ATOM   6355  C  CA    . VAL C  2  355  ? 83.517  -22.731 48.900   1.00 64.02  ? 355  VAL C CA    1 
ATOM   6356  C  C     . VAL C  2  355  ? 83.451  -23.182 47.445   1.00 66.83  ? 355  VAL C C     1 
ATOM   6357  O  O     . VAL C  2  355  ? 84.468  -23.189 46.758   1.00 77.45  ? 355  VAL C O     1 
ATOM   6358  C  CB    . VAL C  2  355  ? 83.482  -23.967 49.834   1.00 58.16  ? 355  VAL C CB    1 
ATOM   6359  C  CG1   . VAL C  2  355  ? 84.236  -25.136 49.215   1.00 49.87  ? 355  VAL C CG1   1 
ATOM   6360  C  CG2   . VAL C  2  355  ? 84.057  -23.619 51.197   1.00 56.88  ? 355  VAL C CG2   1 
ATOM   6361  N  N     . ARG C  2  356  ? 82.263  -23.556 46.975   1.00 60.89  ? 356  ARG C N     1 
ATOM   6362  C  CA    . ARG C  2  356  ? 82.095  -23.955 45.574   1.00 66.36  ? 356  ARG C CA    1 
ATOM   6363  C  C     . ARG C  2  356  ? 82.408  -22.806 44.613   1.00 72.71  ? 356  ARG C C     1 
ATOM   6364  O  O     . ARG C  2  356  ? 83.110  -22.985 43.601   1.00 71.89  ? 356  ARG C O     1 
ATOM   6365  C  CB    . ARG C  2  356  ? 80.681  -24.482 45.326   1.00 61.56  ? 356  ARG C CB    1 
ATOM   6366  C  CG    . ARG C  2  356  ? 80.530  -25.979 45.534   1.00 64.13  ? 356  ARG C CG    1 
ATOM   6367  C  CD    . ARG C  2  356  ? 79.085  -26.417 45.369   1.00 72.03  ? 356  ARG C CD    1 
ATOM   6368  N  NE    . ARG C  2  356  ? 78.267  -26.028 46.514   1.00 82.90  ? 356  ARG C NE    1 
ATOM   6369  C  CZ    . ARG C  2  356  ? 77.929  -26.850 47.503   1.00 80.33  ? 356  ARG C CZ    1 
ATOM   6370  N  NH1   . ARG C  2  356  ? 77.183  -26.410 48.511   1.00 67.29  ? 356  ARG C NH1   1 
ATOM   6371  N  NH2   . ARG C  2  356  ? 78.334  -28.114 47.482   1.00 62.38  ? 356  ARG C NH2   1 
ATOM   6372  N  N     . GLU C  2  357  ? 81.886  -21.627 44.945   1.00 75.09  ? 357  GLU C N     1 
ATOM   6373  C  CA    . GLU C  2  357  ? 82.132  -20.421 44.160   1.00 76.44  ? 357  GLU C CA    1 
ATOM   6374  C  C     . GLU C  2  357  ? 83.626  -20.095 44.091   1.00 81.95  ? 357  GLU C C     1 
ATOM   6375  O  O     . GLU C  2  357  ? 84.102  -19.518 43.111   1.00 82.19  ? 357  GLU C O     1 
ATOM   6376  C  CB    . GLU C  2  357  ? 81.353  -19.244 44.748   1.00 80.78  ? 357  GLU C CB    1 
ATOM   6377  C  CG    . GLU C  2  357  ? 81.368  -17.984 43.899   1.00 90.05  ? 357  GLU C CG    1 
ATOM   6378  C  CD    . GLU C  2  357  ? 80.379  -16.946 44.395   1.00 98.90  ? 357  GLU C CD    1 
ATOM   6379  O  OE1   . GLU C  2  357  ? 80.699  -16.230 45.369   1.00 100.26 ? 357  GLU C OE1   1 
ATOM   6380  O  OE2   . GLU C  2  357  ? 79.277  -16.853 43.813   1.00 93.84  ? 357  GLU C OE2   1 
ATOM   6381  N  N     . ARG C  2  358  ? 84.358  -20.467 45.139   1.00 81.53  ? 358  ARG C N     1 
ATOM   6382  C  CA    . ARG C  2  358  ? 85.809  -20.317 45.153   1.00 73.31  ? 358  ARG C CA    1 
ATOM   6383  C  C     . ARG C  2  358  ? 86.489  -21.434 44.360   1.00 72.55  ? 358  ARG C C     1 
ATOM   6384  O  O     . ARG C  2  358  ? 87.577  -21.246 43.817   1.00 73.59  ? 358  ARG C O     1 
ATOM   6385  C  CB    . ARG C  2  358  ? 86.333  -20.317 46.590   1.00 68.78  ? 358  ARG C CB    1 
ATOM   6386  C  CG    . ARG C  2  358  ? 87.243  -19.148 46.931   1.00 72.15  ? 358  ARG C CG    1 
ATOM   6387  C  CD    . ARG C  2  358  ? 86.442  -17.941 47.387   1.00 72.46  ? 358  ARG C CD    1 
ATOM   6388  N  NE    . ARG C  2  358  ? 85.539  -18.279 48.484   1.00 69.44  ? 358  ARG C NE    1 
ATOM   6389  C  CZ    . ARG C  2  358  ? 84.781  -17.397 49.128   1.00 74.08  ? 358  ARG C CZ    1 
ATOM   6390  N  NH1   . ARG C  2  358  ? 84.819  -16.115 48.789   1.00 78.55  ? 358  ARG C NH1   1 
ATOM   6391  N  NH2   . ARG C  2  358  ? 83.986  -17.797 50.112   1.00 64.56  ? 358  ARG C NH2   1 
ATOM   6392  N  N     . MET C  2  359  ? 85.842  -22.596 44.302   1.00 74.66  ? 359  MET C N     1 
ATOM   6393  C  CA    . MET C  2  359  ? 86.404  -23.768 43.633   1.00 77.51  ? 359  MET C CA    1 
ATOM   6394  C  C     . MET C  2  359  ? 86.333  -23.659 42.119   1.00 83.72  ? 359  MET C C     1 
ATOM   6395  O  O     . MET C  2  359  ? 87.159  -24.235 41.411   1.00 91.05  ? 359  MET C O     1 
ATOM   6396  C  CB    . MET C  2  359  ? 85.711  -25.056 44.090   1.00 73.50  ? 359  MET C CB    1 
ATOM   6397  C  CG    . MET C  2  359  ? 86.188  -25.577 45.437   1.00 76.00  ? 359  MET C CG    1 
ATOM   6398  S  SD    . MET C  2  359  ? 85.718  -27.294 45.731   1.00 70.86  ? 359  MET C SD    1 
ATOM   6399  C  CE    . MET C  2  359  ? 83.946  -27.205 45.504   1.00 78.40  ? 359  MET C CE    1 
ATOM   6400  N  N     . LEU C  2  360  ? 85.342  -22.931 41.618   1.00 88.52  ? 360  LEU C N     1 
ATOM   6401  C  CA    . LEU C  2  360  ? 85.271  -22.691 40.178   1.00 87.05  ? 360  LEU C CA    1 
ATOM   6402  C  C     . LEU C  2  360  ? 86.356  -21.717 39.700   1.00 83.71  ? 360  LEU C C     1 
ATOM   6403  O  O     . LEU C  2  360  ? 86.947  -21.905 38.636   1.00 68.18  ? 360  LEU C O     1 
ATOM   6404  C  CB    . LEU C  2  360  ? 83.881  -22.192 39.780   1.00 91.97  ? 360  LEU C CB    1 
ATOM   6405  C  CG    . LEU C  2  360  ? 82.911  -23.251 39.251   1.00 84.62  ? 360  LEU C CG    1 
ATOM   6406  C  CD1   . LEU C  2  360  ? 83.019  -24.552 40.038   1.00 73.94  ? 360  LEU C CD1   1 
ATOM   6407  C  CD2   . LEU C  2  360  ? 81.487  -22.718 39.283   1.00 94.24  ? 360  LEU C CD2   1 
ATOM   6408  N  N     . MET C  2  361  ? 86.620  -20.689 40.502   1.00 94.04  ? 361  MET C N     1 
ATOM   6409  C  CA    . MET C  2  361  ? 87.585  -19.649 40.150   1.00 96.32  ? 361  MET C CA    1 
ATOM   6410  C  C     . MET C  2  361  ? 89.023  -20.053 40.469   1.00 108.61 ? 361  MET C C     1 
ATOM   6411  O  O     . MET C  2  361  ? 89.298  -21.200 40.824   1.00 104.46 ? 361  MET C O     1 
ATOM   6412  C  CB    . MET C  2  361  ? 87.263  -18.355 40.906   1.00 86.65  ? 361  MET C CB    1 
ATOM   6413  C  CG    . MET C  2  361  ? 85.835  -17.869 40.762   1.00 85.15  ? 361  MET C CG    1 
ATOM   6414  S  SD    . MET C  2  361  ? 85.457  -17.324 39.090   1.00 97.69  ? 361  MET C SD    1 
ATOM   6415  C  CE    . MET C  2  361  ? 83.861  -16.552 39.349   1.00 84.90  ? 361  MET C CE    1 
ATOM   6416  N  N     . GLY C  2  362  ? 89.935  -19.093 40.321   1.00 115.90 ? 362  GLY C N     1 
ATOM   6417  C  CA    . GLY C  2  362  ? 91.301  -19.221 40.801   1.00 111.38 ? 362  GLY C CA    1 
ATOM   6418  C  C     . GLY C  2  362  ? 92.151  -20.278 40.123   1.00 113.26 ? 362  GLY C C     1 
ATOM   6419  O  O     . GLY C  2  362  ? 91.706  -20.949 39.191   1.00 118.76 ? 362  GLY C O     1 
ATOM   6420  N  N     . SER C  2  363  ? 93.385  -20.420 40.599   1.00 106.73 ? 363  SER C N     1 
ATOM   6421  C  CA    . SER C  2  363  ? 94.274  -21.471 40.126   1.00 100.50 ? 363  SER C CA    1 
ATOM   6422  C  C     . SER C  2  363  ? 93.689  -22.822 40.511   1.00 105.85 ? 363  SER C C     1 
ATOM   6423  O  O     . SER C  2  363  ? 93.340  -23.043 41.669   1.00 107.97 ? 363  SER C O     1 
ATOM   6424  C  CB    . SER C  2  363  ? 95.667  -21.314 40.738   1.00 86.45  ? 363  SER C CB    1 
ATOM   6425  O  OG    . SER C  2  363  ? 96.222  -20.047 40.430   1.00 84.16  ? 363  SER C OG    1 
ATOM   6426  N  N     . GLU C  2  364  ? 93.572  -23.719 39.538   1.00 114.26 ? 364  GLU C N     1 
ATOM   6427  C  CA    . GLU C  2  364  ? 93.003  -25.041 39.787   1.00 122.74 ? 364  GLU C CA    1 
ATOM   6428  C  C     . GLU C  2  364  ? 93.994  -25.977 40.471   1.00 116.64 ? 364  GLU C C     1 
ATOM   6429  O  O     . GLU C  2  364  ? 93.603  -26.840 41.259   1.00 111.42 ? 364  GLU C O     1 
ATOM   6430  C  CB    . GLU C  2  364  ? 92.496  -25.669 38.485   1.00 130.19 ? 364  GLU C CB    1 
ATOM   6431  C  CG    . GLU C  2  364  ? 91.135  -25.158 38.037   1.00 127.05 ? 364  GLU C CG    1 
ATOM   6432  C  CD    . GLU C  2  364  ? 90.018  -25.583 38.971   1.00 117.13 ? 364  GLU C CD    1 
ATOM   6433  O  OE1   . GLU C  2  364  ? 89.191  -24.721 39.338   1.00 108.48 ? 364  GLU C OE1   1 
ATOM   6434  O  OE2   . GLU C  2  364  ? 89.964  -26.779 39.333   1.00 108.88 ? 364  GLU C OE2   1 
ATOM   6435  N  N     . ASP C  2  365  ? 95.277  -25.806 40.167   1.00 117.67 ? 365  ASP C N     1 
ATOM   6436  C  CA    . ASP C  2  365  ? 96.310  -26.669 40.730   1.00 120.47 ? 365  ASP C CA    1 
ATOM   6437  C  C     . ASP C  2  365  ? 96.698  -26.300 42.161   1.00 117.92 ? 365  ASP C C     1 
ATOM   6438  O  O     . ASP C  2  365  ? 96.857  -27.182 43.009   1.00 115.85 ? 365  ASP C O     1 
ATOM   6439  C  CB    . ASP C  2  365  ? 97.555  -26.677 39.847   1.00 121.09 ? 365  ASP C CB    1 
ATOM   6440  C  CG    . ASP C  2  365  ? 98.671  -27.510 40.437   1.00 117.94 ? 365  ASP C CG    1 
ATOM   6441  O  OD1   . ASP C  2  365  ? 98.427  -28.693 40.758   1.00 104.22 ? 365  ASP C OD1   1 
ATOM   6442  O  OD2   . ASP C  2  365  ? 99.785  -26.972 40.601   1.00 117.78 ? 365  ASP C OD2   1 
ATOM   6443  N  N     . SER C  2  366  ? 96.855  -25.007 42.434   1.00 110.45 ? 366  SER C N     1 
ATOM   6444  C  CA    . SER C  2  366  ? 97.233  -24.584 43.777   1.00 100.02 ? 366  SER C CA    1 
ATOM   6445  C  C     . SER C  2  366  ? 96.027  -24.049 44.537   1.00 103.20 ? 366  SER C C     1 
ATOM   6446  O  O     . SER C  2  366  ? 95.579  -22.923 44.310   1.00 106.27 ? 366  SER C O     1 
ATOM   6447  C  CB    . SER C  2  366  ? 98.319  -23.508 43.710   1.00 92.13  ? 366  SER C CB    1 
ATOM   6448  O  OG    . SER C  2  366  ? 97.842  -22.337 43.064   1.00 85.30  ? 366  SER C OG    1 
ATOM   6449  N  N     . LEU C  2  367  ? 95.525  -24.866 45.458   1.00 96.49  ? 367  LEU C N     1 
ATOM   6450  C  CA    . LEU C  2  367  ? 94.441  -24.480 46.350   1.00 85.94  ? 367  LEU C CA    1 
ATOM   6451  C  C     . LEU C  2  367  ? 94.617  -25.163 47.698   1.00 82.41  ? 367  LEU C C     1 
ATOM   6452  O  O     . LEU C  2  367  ? 94.907  -26.356 47.766   1.00 80.05  ? 367  LEU C O     1 
ATOM   6453  C  CB    . LEU C  2  367  ? 93.078  -24.839 45.755   1.00 80.04  ? 367  LEU C CB    1 
ATOM   6454  C  CG    . LEU C  2  367  ? 92.480  -23.879 44.725   1.00 81.93  ? 367  LEU C CG    1 
ATOM   6455  C  CD1   . LEU C  2  367  ? 91.095  -24.343 44.300   1.00 78.24  ? 367  LEU C CD1   1 
ATOM   6456  C  CD2   . LEU C  2  367  ? 92.431  -22.457 45.268   1.00 69.90  ? 367  LEU C CD2   1 
ATOM   6457  N  N     . THR C  2  368  ? 94.437  -24.399 48.768   1.00 79.81  ? 368  THR C N     1 
ATOM   6458  C  CA    . THR C  2  368  ? 94.472  -24.951 50.113   1.00 73.76  ? 368  THR C CA    1 
ATOM   6459  C  C     . THR C  2  368  ? 93.109  -24.730 50.749   1.00 70.01  ? 368  THR C C     1 
ATOM   6460  O  O     . THR C  2  368  ? 92.363  -23.852 50.317   1.00 72.27  ? 368  THR C O     1 
ATOM   6461  C  CB    . THR C  2  368  ? 95.566  -24.282 50.975   1.00 74.43  ? 368  THR C CB    1 
ATOM   6462  O  OG1   . THR C  2  368  ? 95.338  -22.869 51.034   1.00 71.64  ? 368  THR C OG1   1 
ATOM   6463  C  CG2   . THR C  2  368  ? 96.944  -24.545 50.387   1.00 74.84  ? 368  THR C CG2   1 
ATOM   6464  N  N     . PRO C  2  369  ? 92.762  -25.545 51.757   1.00 62.87  ? 369  PRO C N     1 
ATOM   6465  C  CA    . PRO C  2  369  ? 91.537  -25.308 52.528   1.00 56.15  ? 369  PRO C CA    1 
ATOM   6466  C  C     . PRO C  2  369  ? 91.453  -23.878 53.066   1.00 56.12  ? 369  PRO C C     1 
ATOM   6467  O  O     . PRO C  2  369  ? 90.351  -23.372 53.266   1.00 65.68  ? 369  PRO C O     1 
ATOM   6468  C  CB    . PRO C  2  369  ? 91.662  -26.308 53.675   1.00 56.37  ? 369  PRO C CB    1 
ATOM   6469  C  CG    . PRO C  2  369  ? 92.411  -27.445 53.073   1.00 55.06  ? 369  PRO C CG    1 
ATOM   6470  C  CD    . PRO C  2  369  ? 93.401  -26.823 52.123   1.00 59.16  ? 369  PRO C CD    1 
ATOM   6471  N  N     . ALA C  2  370  ? 92.599  -23.238 53.286   1.00 54.85  ? 370  ALA C N     1 
ATOM   6472  C  CA    . ALA C  2  370  ? 92.634  -21.850 53.737   1.00 61.68  ? 370  ALA C CA    1 
ATOM   6473  C  C     . ALA C  2  370  ? 92.205  -20.871 52.639   1.00 60.84  ? 370  ALA C C     1 
ATOM   6474  O  O     . ALA C  2  370  ? 91.658  -19.804 52.924   1.00 54.04  ? 370  ALA C O     1 
ATOM   6475  C  CB    . ALA C  2  370  ? 94.023  -21.496 54.253   1.00 64.91  ? 370  ALA C CB    1 
ATOM   6476  N  N     . LYS C  2  371  ? 92.468  -21.234 51.387   1.00 62.96  ? 371  LYS C N     1 
ATOM   6477  C  CA    . LYS C  2  371  ? 92.079  -20.404 50.250   1.00 62.40  ? 371  LYS C CA    1 
ATOM   6478  C  C     . LYS C  2  371  ? 90.604  -20.582 49.897   1.00 57.07  ? 371  LYS C C     1 
ATOM   6479  O  O     . LYS C  2  371  ? 89.957  -19.652 49.419   1.00 58.20  ? 371  LYS C O     1 
ATOM   6480  C  CB    . LYS C  2  371  ? 92.944  -20.721 49.027   1.00 68.49  ? 371  LYS C CB    1 
ATOM   6481  C  CG    . LYS C  2  371  ? 94.415  -20.360 49.174   1.00 68.90  ? 371  LYS C CG    1 
ATOM   6482  C  CD    . LYS C  2  371  ? 95.185  -20.719 47.911   1.00 78.77  ? 371  LYS C CD    1 
ATOM   6483  C  CE    . LYS C  2  371  ? 96.656  -20.359 48.025   1.00 82.25  ? 371  LYS C CE    1 
ATOM   6484  N  NZ    . LYS C  2  371  ? 97.399  -20.710 46.783   1.00 77.17  ? 371  LYS C NZ    1 
ATOM   6485  N  N     . LEU C  2  372  ? 90.085  -21.784 50.127   1.00 53.76  ? 372  LEU C N     1 
ATOM   6486  C  CA    . LEU C  2  372  ? 88.699  -22.107 49.797   1.00 54.50  ? 372  LEU C CA    1 
ATOM   6487  C  C     . LEU C  2  372  ? 87.692  -21.598 50.827   1.00 62.73  ? 372  LEU C C     1 
ATOM   6488  O  O     . LEU C  2  372  ? 86.572  -21.219 50.479   1.00 70.13  ? 372  LEU C O     1 
ATOM   6489  C  CB    . LEU C  2  372  ? 88.526  -23.617 49.621   1.00 52.26  ? 372  LEU C CB    1 
ATOM   6490  C  CG    . LEU C  2  372  ? 89.173  -24.257 48.394   1.00 60.91  ? 372  LEU C CG    1 
ATOM   6491  C  CD1   . LEU C  2  372  ? 88.732  -25.709 48.251   1.00 45.54  ? 372  LEU C CD1   1 
ATOM   6492  C  CD2   . LEU C  2  372  ? 88.834  -23.462 47.144   1.00 73.67  ? 372  LEU C CD2   1 
ATOM   6493  N  N     . VAL C  2  373  ? 88.089  -21.600 52.095   1.00 53.98  ? 373  VAL C N     1 
ATOM   6494  C  CA    . VAL C  2  373  ? 87.160  -21.293 53.176   1.00 45.94  ? 373  VAL C CA    1 
ATOM   6495  C  C     . VAL C  2  373  ? 87.149  -19.822 53.595   1.00 47.75  ? 373  VAL C C     1 
ATOM   6496  O  O     . VAL C  2  373  ? 88.169  -19.266 54.008   1.00 42.94  ? 373  VAL C O     1 
ATOM   6497  C  CB    . VAL C  2  373  ? 87.417  -22.188 54.410   1.00 39.14  ? 373  VAL C CB    1 
ATOM   6498  C  CG1   . VAL C  2  373  ? 86.681  -21.654 55.628   1.00 44.33  ? 373  VAL C CG1   1 
ATOM   6499  C  CG2   . VAL C  2  373  ? 87.001  -23.619 54.116   1.00 33.20  ? 373  VAL C CG2   1 
ATOM   6500  N  N     . ASN C  2  374  ? 85.981  -19.201 53.467   1.00 50.52  ? 374  ASN C N     1 
ATOM   6501  C  CA    . ASN C  2  374  ? 85.730  -17.892 54.051   1.00 51.96  ? 374  ASN C CA    1 
ATOM   6502  C  C     . ASN C  2  374  ? 84.750  -18.051 55.210   1.00 48.92  ? 374  ASN C C     1 
ATOM   6503  O  O     . ASN C  2  374  ? 83.631  -18.530 55.028   1.00 43.64  ? 374  ASN C O     1 
ATOM   6504  C  CB    . ASN C  2  374  ? 85.183  -16.923 53.001   1.00 51.03  ? 374  ASN C CB    1 
ATOM   6505  C  CG    . ASN C  2  374  ? 85.065  -15.502 53.521   1.00 52.78  ? 374  ASN C CG    1 
ATOM   6506  O  OD1   . ASN C  2  374  ? 85.480  -15.203 54.640   1.00 53.32  ? 374  ASN C OD1   1 
ATOM   6507  N  ND2   . ASN C  2  374  ? 84.505  -14.617 52.705   1.00 51.98  ? 374  ASN C ND2   1 
ATOM   6508  N  N     . SER C  2  375  ? 85.178  -17.652 56.402   1.00 47.97  ? 375  SER C N     1 
ATOM   6509  C  CA    . SER C  2  375  ? 84.405  -17.900 57.614   1.00 46.91  ? 375  SER C CA    1 
ATOM   6510  C  C     . SER C  2  375  ? 83.371  -16.816 57.925   1.00 52.21  ? 375  SER C C     1 
ATOM   6511  O  O     . SER C  2  375  ? 82.530  -16.997 58.806   1.00 52.91  ? 375  SER C O     1 
ATOM   6512  C  CB    . SER C  2  375  ? 85.345  -18.084 58.809   1.00 48.14  ? 375  SER C CB    1 
ATOM   6513  O  OG    . SER C  2  375  ? 86.187  -16.956 58.976   1.00 53.00  ? 375  SER C OG    1 
ATOM   6514  N  N     . ARG C  2  376  ? 83.433  -15.699 57.202   1.00 49.58  ? 376  ARG C N     1 
ATOM   6515  C  CA    . ARG C  2  376  ? 82.535  -14.561 57.441   1.00 44.81  ? 376  ARG C CA    1 
ATOM   6516  C  C     . ARG C  2  376  ? 81.022  -14.860 57.503   1.00 43.31  ? 376  ARG C C     1 
ATOM   6517  O  O     . ARG C  2  376  ? 80.334  -14.308 58.363   1.00 42.88  ? 376  ARG C O     1 
ATOM   6518  C  CB    . ARG C  2  376  ? 82.820  -13.411 56.464   1.00 50.23  ? 376  ARG C CB    1 
ATOM   6519  C  CG    . ARG C  2  376  ? 83.680  -12.284 57.043   1.00 55.13  ? 376  ARG C CG    1 
ATOM   6520  C  CD    . ARG C  2  376  ? 85.087  -12.758 57.396   1.00 55.14  ? 376  ARG C CD    1 
ATOM   6521  N  NE    . ARG C  2  376  ? 85.994  -11.646 57.678   1.00 57.80  ? 376  ARG C NE    1 
ATOM   6522  C  CZ    . ARG C  2  376  ? 86.435  -11.321 58.891   1.00 57.76  ? 376  ARG C CZ    1 
ATOM   6523  N  NH1   . ARG C  2  376  ? 86.060  -12.029 59.948   1.00 57.65  ? 376  ARG C NH1   1 
ATOM   6524  N  NH2   . ARG C  2  376  ? 87.258  -10.291 59.048   1.00 50.13  ? 376  ARG C NH2   1 
ATOM   6525  N  N     . PRO C  2  377  ? 80.494  -15.714 56.598   1.00 40.53  ? 377  PRO C N     1 
ATOM   6526  C  CA    . PRO C  2  377  ? 79.060  -16.026 56.701   1.00 39.66  ? 377  PRO C CA    1 
ATOM   6527  C  C     . PRO C  2  377  ? 78.676  -16.806 57.963   1.00 38.13  ? 377  PRO C C     1 
ATOM   6528  O  O     . PRO C  2  377  ? 77.593  -16.584 58.510   1.00 47.36  ? 377  PRO C O     1 
ATOM   6529  C  CB    . PRO C  2  377  ? 78.788  -16.870 55.448   1.00 33.73  ? 377  PRO C CB    1 
ATOM   6530  C  CG    . PRO C  2  377  ? 80.115  -17.379 55.028   1.00 34.70  ? 377  PRO C CG    1 
ATOM   6531  C  CD    . PRO C  2  377  ? 81.080  -16.292 55.376   1.00 37.45  ? 377  PRO C CD    1 
ATOM   6532  N  N     . LEU C  2  378  ? 79.546  -17.704 58.413   1.00 35.58  ? 378  LEU C N     1 
ATOM   6533  C  CA    . LEU C  2  378  ? 79.295  -18.467 59.632   1.00 33.49  ? 378  LEU C CA    1 
ATOM   6534  C  C     . LEU C  2  378  ? 79.284  -17.546 60.850   1.00 30.62  ? 378  LEU C C     1 
ATOM   6535  O  O     . LEU C  2  378  ? 78.346  -17.566 61.657   1.00 31.12  ? 378  LEU C O     1 
ATOM   6536  C  CB    . LEU C  2  378  ? 80.353  -19.558 59.802   1.00 34.65  ? 378  LEU C CB    1 
ATOM   6537  C  CG    . LEU C  2  378  ? 80.222  -20.478 61.017   1.00 33.21  ? 378  LEU C CG    1 
ATOM   6538  C  CD1   . LEU C  2  378  ? 78.838  -21.097 61.077   1.00 26.47  ? 378  LEU C CD1   1 
ATOM   6539  C  CD2   . LEU C  2  378  ? 81.286  -21.560 60.972   1.00 33.58  ? 378  LEU C CD2   1 
ATOM   6540  N  N     . GLU C  2  379  ? 80.333  -16.736 60.967   1.00 32.06  ? 379  GLU C N     1 
ATOM   6541  C  CA    . GLU C  2  379  ? 80.436  -15.747 62.032   1.00 32.75  ? 379  GLU C CA    1 
ATOM   6542  C  C     . GLU C  2  379  ? 79.221  -14.833 62.014   1.00 33.83  ? 379  GLU C C     1 
ATOM   6543  O  O     . GLU C  2  379  ? 78.685  -14.485 63.064   1.00 36.87  ? 379  GLU C O     1 
ATOM   6544  C  CB    . GLU C  2  379  ? 81.715  -14.919 61.878   1.00 40.69  ? 379  GLU C CB    1 
ATOM   6545  C  CG    . GLU C  2  379  ? 82.988  -15.750 61.769   1.00 48.64  ? 379  GLU C CG    1 
ATOM   6546  C  CD    . GLU C  2  379  ? 84.247  -14.904 61.673   1.00 55.01  ? 379  GLU C CD    1 
ATOM   6547  O  OE1   . GLU C  2  379  ? 85.071  -15.159 60.767   1.00 44.45  ? 379  GLU C OE1   1 
ATOM   6548  O  OE2   . GLU C  2  379  ? 84.419  -13.991 62.509   1.00 75.15  ? 379  GLU C OE2   1 
ATOM   6549  N  N     . ALA C  2  380  ? 78.786  -14.459 60.814   1.00 34.90  ? 380  ALA C N     1 
ATOM   6550  C  CA    . ALA C  2  380  ? 77.613  -13.604 60.649   1.00 36.69  ? 380  ALA C CA    1 
ATOM   6551  C  C     . ALA C  2  380  ? 76.331  -14.262 61.161   1.00 35.28  ? 380  ALA C C     1 
ATOM   6552  O  O     . ALA C  2  380  ? 75.543  -13.625 61.855   1.00 33.73  ? 380  ALA C O     1 
ATOM   6553  C  CB    . ALA C  2  380  ? 77.452  -13.192 59.191   1.00 37.03  ? 380  ALA C CB    1 
ATOM   6554  N  N     . ALA C  2  381  ? 76.125  -15.530 60.814   1.00 35.92  ? 381  ALA C N     1 
ATOM   6555  C  CA    . ALA C  2  381  ? 74.931  -16.257 61.249   1.00 29.88  ? 381  ALA C CA    1 
ATOM   6556  C  C     . ALA C  2  381  ? 74.894  -16.443 62.766   1.00 28.08  ? 381  ALA C C     1 
ATOM   6557  O  O     . ALA C  2  381  ? 73.843  -16.289 63.401   1.00 28.72  ? 381  ALA C O     1 
ATOM   6558  C  CB    . ALA C  2  381  ? 74.842  -17.602 60.548   1.00 27.51  ? 381  ALA C CB    1 
ATOM   6559  N  N     . ILE C  2  382  ? 76.045  -16.771 63.345   1.00 29.95  ? 382  ILE C N     1 
ATOM   6560  C  CA    . ILE C  2  382  ? 76.128  -16.953 64.790   1.00 25.36  ? 382  ILE C CA    1 
ATOM   6561  C  C     . ILE C  2  382  ? 75.906  -15.631 65.519   1.00 20.90  ? 382  ILE C C     1 
ATOM   6562  O  O     . ILE C  2  382  ? 75.123  -15.557 66.473   1.00 22.07  ? 382  ILE C O     1 
ATOM   6563  C  CB    . ILE C  2  382  ? 77.487  -17.542 65.214   1.00 29.17  ? 382  ILE C CB    1 
ATOM   6564  C  CG1   . ILE C  2  382  ? 77.718  -18.900 64.552   1.00 28.32  ? 382  ILE C CG1   1 
ATOM   6565  C  CG2   . ILE C  2  382  ? 77.549  -17.695 66.717   1.00 24.90  ? 382  ILE C CG2   1 
ATOM   6566  C  CD1   . ILE C  2  382  ? 79.050  -19.528 64.909   1.00 26.28  ? 382  ILE C CD1   1 
ATOM   6567  N  N     . ARG C  2  383  ? 76.594  -14.591 65.058   1.00 20.25  ? 383  ARG C N     1 
ATOM   6568  C  CA    . ARG C  2  383  ? 76.493  -13.268 65.662   1.00 27.55  ? 383  ARG C CA    1 
ATOM   6569  C  C     . ARG C  2  383  ? 75.070  -12.725 65.571   1.00 30.91  ? 383  ARG C C     1 
ATOM   6570  O  O     . ARG C  2  383  ? 74.556  -12.139 66.525   1.00 28.71  ? 383  ARG C O     1 
ATOM   6571  C  CB    . ARG C  2  383  ? 77.476  -12.298 65.003   1.00 28.04  ? 383  ARG C CB    1 
ATOM   6572  C  CG    . ARG C  2  383  ? 77.407  -10.875 65.532   1.00 32.18  ? 383  ARG C CG    1 
ATOM   6573  C  CD    . ARG C  2  383  ? 78.517  -10.009 64.952   1.00 41.00  ? 383  ARG C CD    1 
ATOM   6574  N  NE    . ARG C  2  383  ? 78.567  -10.072 63.492   1.00 61.92  ? 383  ARG C NE    1 
ATOM   6575  C  CZ    . ARG C  2  383  ? 79.520  -10.691 62.800   1.00 59.86  ? 383  ARG C CZ    1 
ATOM   6576  N  NH1   . ARG C  2  383  ? 80.514  -11.301 63.436   1.00 51.65  ? 383  ARG C NH1   1 
ATOM   6577  N  NH2   . ARG C  2  383  ? 79.483  -10.699 61.472   1.00 44.42  ? 383  ARG C NH2   1 
ATOM   6578  N  N     . GLU C  2  384  ? 74.435  -12.935 64.423   1.00 31.54  ? 384  GLU C N     1 
ATOM   6579  C  CA    . GLU C  2  384  ? 73.061  -12.492 64.210   1.00 30.03  ? 384  GLU C CA    1 
ATOM   6580  C  C     . GLU C  2  384  ? 72.063  -13.259 65.085   1.00 27.87  ? 384  GLU C C     1 
ATOM   6581  O  O     . GLU C  2  384  ? 71.130  -12.665 65.628   1.00 31.24  ? 384  GLU C O     1 
ATOM   6582  C  CB    . GLU C  2  384  ? 72.689  -12.567 62.723   1.00 27.98  ? 384  GLU C CB    1 
ATOM   6583  C  CG    . GLU C  2  384  ? 71.306  -13.124 62.432   1.00 45.12  ? 384  GLU C CG    1 
ATOM   6584  C  CD    . GLU C  2  384  ? 71.356  -14.470 61.722   1.00 56.90  ? 384  GLU C CD    1 
ATOM   6585  O  OE1   . GLU C  2  384  ? 71.791  -14.509 60.548   1.00 51.82  ? 384  GLU C OE1   1 
ATOM   6586  O  OE2   . GLU C  2  384  ? 70.966  -15.488 62.341   1.00 47.77  ? 384  GLU C OE2   1 
ATOM   6587  N  N     . PHE C  2  385  ? 72.261  -14.568 65.233   1.00 28.58  ? 385  PHE C N     1 
ATOM   6588  C  CA    . PHE C  2  385  ? 71.408  -15.338 66.135   1.00 20.06  ? 385  PHE C CA    1 
ATOM   6589  C  C     . PHE C  2  385  ? 71.549  -14.875 67.573   1.00 18.73  ? 385  PHE C C     1 
ATOM   6590  O  O     . PHE C  2  385  ? 70.559  -14.721 68.278   1.00 20.01  ? 385  PHE C O     1 
ATOM   6591  C  CB    . PHE C  2  385  ? 71.720  -16.827 66.072   1.00 20.13  ? 385  PHE C CB    1 
ATOM   6592  C  CG    . PHE C  2  385  ? 71.073  -17.624 67.173   1.00 16.93  ? 385  PHE C CG    1 
ATOM   6593  C  CD1   . PHE C  2  385  ? 69.702  -17.805 67.202   1.00 19.37  ? 385  PHE C CD1   1 
ATOM   6594  C  CD2   . PHE C  2  385  ? 71.835  -18.195 68.178   1.00 21.51  ? 385  PHE C CD2   1 
ATOM   6595  C  CE1   . PHE C  2  385  ? 69.104  -18.540 68.213   1.00 19.89  ? 385  PHE C CE1   1 
ATOM   6596  C  CE2   . PHE C  2  385  ? 71.242  -18.932 69.192   1.00 18.61  ? 385  PHE C CE2   1 
ATOM   6597  C  CZ    . PHE C  2  385  ? 69.877  -19.103 69.208   1.00 15.97  ? 385  PHE C CZ    1 
ATOM   6598  N  N     . PHE C  2  386  ? 72.781  -14.665 68.017   1.00 20.26  ? 386  PHE C N     1 
ATOM   6599  C  CA    . PHE C  2  386  ? 73.001  -14.298 69.411   1.00 20.24  ? 386  PHE C CA    1 
ATOM   6600  C  C     . PHE C  2  386  ? 72.721  -12.832 69.722   1.00 24.85  ? 386  PHE C C     1 
ATOM   6601  O  O     . PHE C  2  386  ? 72.605  -12.459 70.891   1.00 22.68  ? 386  PHE C O     1 
ATOM   6602  C  CB    . PHE C  2  386  ? 74.411  -14.672 69.860   1.00 16.95  ? 386  PHE C CB    1 
ATOM   6603  C  CG    . PHE C  2  386  ? 74.534  -16.087 70.317   1.00 13.54  ? 386  PHE C CG    1 
ATOM   6604  C  CD1   . PHE C  2  386  ? 74.237  -16.430 71.623   1.00 13.88  ? 386  PHE C CD1   1 
ATOM   6605  C  CD2   . PHE C  2  386  ? 74.939  -17.078 69.443   1.00 15.88  ? 386  PHE C CD2   1 
ATOM   6606  C  CE1   . PHE C  2  386  ? 74.346  -17.737 72.050   1.00 18.52  ? 386  PHE C CE1   1 
ATOM   6607  C  CE2   . PHE C  2  386  ? 75.051  -18.389 69.864   1.00 17.73  ? 386  PHE C CE2   1 
ATOM   6608  C  CZ    . PHE C  2  386  ? 74.754  -18.720 71.169   1.00 17.31  ? 386  PHE C CZ    1 
ATOM   6609  N  N     . SER C  2  387  ? 72.608  -12.003 68.687   1.00 27.48  ? 387  SER C N     1 
ATOM   6610  C  CA    . SER C  2  387  ? 72.390  -10.574 68.899   1.00 31.14  ? 387  SER C CA    1 
ATOM   6611  C  C     . SER C  2  387  ? 70.950  -10.128 68.653   1.00 35.97  ? 387  SER C C     1 
ATOM   6612  O  O     . SER C  2  387  ? 70.252  -9.726  69.585   1.00 38.35  ? 387  SER C O     1 
ATOM   6613  C  CB    . SER C  2  387  ? 73.351  -9.737  68.050   1.00 33.14  ? 387  SER C CB    1 
ATOM   6614  O  OG    . SER C  2  387  ? 74.694  -9.930  68.463   1.00 32.05  ? 387  SER C OG    1 
ATOM   6615  N  N     . ARG C  2  388  ? 70.510  -10.193 67.402   1.00 32.31  ? 388  ARG C N     1 
ATOM   6616  C  CA    . ARG C  2  388  ? 69.230  -9.595  67.030   1.00 34.71  ? 388  ARG C CA    1 
ATOM   6617  C  C     . ARG C  2  388  ? 68.025  -10.538 67.005   1.00 38.14  ? 388  ARG C C     1 
ATOM   6618  O  O     . ARG C  2  388  ? 66.922  -10.113 66.664   1.00 54.44  ? 388  ARG C O     1 
ATOM   6619  C  CB    . ARG C  2  388  ? 69.355  -8.844  65.703   1.00 45.95  ? 388  ARG C CB    1 
ATOM   6620  C  CG    . ARG C  2  388  ? 69.546  -7.343  65.872   1.00 58.80  ? 388  ARG C CG    1 
ATOM   6621  C  CD    . ARG C  2  388  ? 70.353  -6.744  64.729   1.00 76.72  ? 388  ARG C CD    1 
ATOM   6622  N  NE    . ARG C  2  388  ? 71.711  -7.279  64.694   1.00 82.37  ? 388  ARG C NE    1 
ATOM   6623  C  CZ    . ARG C  2  388  ? 72.705  -6.849  65.466   1.00 81.66  ? 388  ARG C CZ    1 
ATOM   6624  N  NH1   . ARG C  2  388  ? 72.497  -5.873  66.341   1.00 73.96  ? 388  ARG C NH1   1 
ATOM   6625  N  NH2   . ARG C  2  388  ? 73.909  -7.398  65.366   1.00 74.46  ? 388  ARG C NH2   1 
ATOM   6626  N  N     . SER C  2  389  ? 68.222  -11.802 67.370   1.00 27.41  ? 389  SER C N     1 
ATOM   6627  C  CA    . SER C  2  389  ? 67.118  -12.764 67.354   1.00 24.08  ? 389  SER C CA    1 
ATOM   6628  C  C     . SER C  2  389  ? 66.063  -12.508 68.429   1.00 21.70  ? 389  SER C C     1 
ATOM   6629  O  O     . SER C  2  389  ? 66.335  -11.899 69.463   1.00 20.67  ? 389  SER C O     1 
ATOM   6630  C  CB    . SER C  2  389  ? 67.628  -14.199 67.473   1.00 25.55  ? 389  SER C CB    1 
ATOM   6631  O  OG    . SER C  2  389  ? 66.545  -15.115 67.507   1.00 23.88  ? 389  SER C OG    1 
ATOM   6632  N  N     . GLN C  2  390  ? 64.855  -12.992 68.168   1.00 23.34  ? 390  GLN C N     1 
ATOM   6633  C  CA    . GLN C  2  390  ? 63.738  -12.822 69.085   1.00 26.21  ? 390  GLN C CA    1 
ATOM   6634  C  C     . GLN C  2  390  ? 63.915  -13.675 70.331   1.00 24.18  ? 390  GLN C C     1 
ATOM   6635  O  O     . GLN C  2  390  ? 63.665  -13.222 71.448   1.00 26.88  ? 390  GLN C O     1 
ATOM   6636  C  CB    . GLN C  2  390  ? 62.422  -13.177 68.389   1.00 37.83  ? 390  GLN C CB    1 
ATOM   6637  C  CG    . GLN C  2  390  ? 61.238  -13.315 69.332   1.00 45.22  ? 390  GLN C CG    1 
ATOM   6638  C  CD    . GLN C  2  390  ? 59.976  -12.683 68.780   1.00 59.82  ? 390  GLN C CD    1 
ATOM   6639  O  OE1   . GLN C  2  390  ? 58.887  -13.245 68.888   1.00 63.86  ? 390  GLN C OE1   1 
ATOM   6640  N  NE2   . GLN C  2  390  ? 60.116  -11.501 68.192   1.00 68.01  ? 390  GLN C NE2   1 
ATOM   6641  N  N     . LEU C  2  391  ? 64.351  -14.913 70.134   1.00 21.74  ? 391  LEU C N     1 
ATOM   6642  C  CA    . LEU C  2  391  ? 64.534  -15.838 71.243   1.00 14.12  ? 391  LEU C CA    1 
ATOM   6643  C  C     . LEU C  2  391  ? 65.743  -15.462 72.090   1.00 17.19  ? 391  LEU C C     1 
ATOM   6644  O  O     . LEU C  2  391  ? 65.887  -15.938 73.214   1.00 18.73  ? 391  LEU C O     1 
ATOM   6645  C  CB    . LEU C  2  391  ? 64.651  -17.274 70.733   1.00 11.56  ? 391  LEU C CB    1 
ATOM   6646  C  CG    . LEU C  2  391  ? 63.330  -17.858 70.228   1.00 16.85  ? 391  LEU C CG    1 
ATOM   6647  C  CD1   . LEU C  2  391  ? 63.544  -19.178 69.514   1.00 18.92  ? 391  LEU C CD1   1 
ATOM   6648  C  CD2   . LEU C  2  391  ? 62.353  -18.030 71.379   1.00 16.65  ? 391  LEU C CD2   1 
ATOM   6649  N  N     . SER C  2  392  ? 66.597  -14.591 71.559   1.00 19.12  ? 392  SER C N     1 
ATOM   6650  C  CA    . SER C  2  392  ? 67.741  -14.110 72.319   1.00 14.81  ? 392  SER C CA    1 
ATOM   6651  C  C     . SER C  2  392  ? 67.304  -12.866 73.052   1.00 14.07  ? 392  SER C C     1 
ATOM   6652  O  O     . SER C  2  392  ? 67.063  -11.824 72.442   1.00 14.79  ? 392  SER C O     1 
ATOM   6653  C  CB    . SER C  2  392  ? 68.910  -13.773 71.396   1.00 18.50  ? 392  SER C CB    1 
ATOM   6654  O  OG    . SER C  2  392  ? 69.990  -13.210 72.125   1.00 13.87  ? 392  SER C OG    1 
ATOM   6655  N  N     . GLN C  2  393  ? 67.213  -12.977 74.371   1.00 15.02  ? 393  GLN C N     1 
ATOM   6656  C  CA    . GLN C  2  393  ? 66.658  -11.903 75.174   1.00 16.69  ? 393  GLN C CA    1 
ATOM   6657  C  C     . GLN C  2  393  ? 67.694  -11.328 76.122   1.00 17.05  ? 393  GLN C C     1 
ATOM   6658  O  O     . GLN C  2  393  ? 68.540  -12.048 76.640   1.00 18.19  ? 393  GLN C O     1 
ATOM   6659  C  CB    . GLN C  2  393  ? 65.437  -12.398 75.955   1.00 10.72  ? 393  GLN C CB    1 
ATOM   6660  C  CG    . GLN C  2  393  ? 64.348  -12.990 75.072   1.00 12.49  ? 393  GLN C CG    1 
ATOM   6661  C  CD    . GLN C  2  393  ? 63.043  -13.213 75.813   1.00 19.04  ? 393  GLN C CD    1 
ATOM   6662  O  OE1   . GLN C  2  393  ? 62.982  -13.104 77.038   1.00 19.44  ? 393  GLN C OE1   1 
ATOM   6663  N  NE2   . GLN C  2  393  ? 61.988  -13.524 75.070   1.00 25.10  ? 393  GLN C NE2   1 
ATOM   6664  N  N     . PHE C  2  394  ? 67.634  -10.018 76.324   1.00 19.15  ? 394  PHE C N     1 
ATOM   6665  C  CA    . PHE C  2  394  ? 68.422  -9.365  77.354   1.00 16.92  ? 394  PHE C CA    1 
ATOM   6666  C  C     . PHE C  2  394  ? 68.061  -10.019 78.696   1.00 16.34  ? 394  PHE C C     1 
ATOM   6667  O  O     . PHE C  2  394  ? 66.890  -10.078 79.074   1.00 18.95  ? 394  PHE C O     1 
ATOM   6668  C  CB    . PHE C  2  394  ? 68.085  -7.875  77.345   1.00 16.51  ? 394  PHE C CB    1 
ATOM   6669  C  CG    . PHE C  2  394  ? 69.024  -7.029  78.140   1.00 16.03  ? 394  PHE C CG    1 
ATOM   6670  C  CD1   . PHE C  2  394  ? 70.365  -6.966  77.813   1.00 18.22  ? 394  PHE C CD1   1 
ATOM   6671  C  CD2   . PHE C  2  394  ? 68.555  -6.265  79.196   1.00 16.59  ? 394  PHE C CD2   1 
ATOM   6672  C  CE1   . PHE C  2  394  ? 71.228  -6.174  78.544   1.00 29.63  ? 394  PHE C CE1   1 
ATOM   6673  C  CE2   . PHE C  2  394  ? 69.408  -5.468  79.927   1.00 16.71  ? 394  PHE C CE2   1 
ATOM   6674  C  CZ    . PHE C  2  394  ? 70.747  -5.421  79.604   1.00 24.96  ? 394  PHE C CZ    1 
ATOM   6675  N  N     . LYS C  2  395  ? 69.063  -10.523 79.407   1.00 13.60  ? 395  LYS C N     1 
ATOM   6676  C  CA    . LYS C  2  395  ? 68.821  -11.320 80.608   1.00 12.91  ? 395  LYS C CA    1 
ATOM   6677  C  C     . LYS C  2  395  ? 68.218  -10.502 81.740   1.00 14.53  ? 395  LYS C C     1 
ATOM   6678  O  O     . LYS C  2  395  ? 68.626  -9.363  81.973   1.00 17.41  ? 395  LYS C O     1 
ATOM   6679  C  CB    . LYS C  2  395  ? 70.125  -11.962 81.081   1.00 16.37  ? 395  LYS C CB    1 
ATOM   6680  C  CG    . LYS C  2  395  ? 70.034  -12.675 82.420   1.00 14.17  ? 395  LYS C CG    1 
ATOM   6681  C  CD    . LYS C  2  395  ? 71.410  -13.074 82.908   1.00 13.84  ? 395  LYS C CD    1 
ATOM   6682  C  CE    . LYS C  2  395  ? 71.332  -13.791 84.229   1.00 12.48  ? 395  LYS C CE    1 
ATOM   6683  N  NZ    . LYS C  2  395  ? 72.685  -14.113 84.738   1.00 23.39  ? 395  LYS C NZ    1 
ATOM   6684  N  N     . ASP C  2  396  ? 67.257  -11.081 82.455   1.00 11.65  ? 396  ASP C N     1 
ATOM   6685  C  CA    . ASP C  2  396  ? 66.705  -10.397 83.613   1.00 14.02  ? 396  ASP C CA    1 
ATOM   6686  C  C     . ASP C  2  396  ? 67.435  -10.847 84.881   1.00 15.32  ? 396  ASP C C     1 
ATOM   6687  O  O     . ASP C  2  396  ? 67.177  -11.921 85.421   1.00 14.03  ? 396  ASP C O     1 
ATOM   6688  C  CB    . ASP C  2  396  ? 65.212  -10.715 83.714   1.00 11.52  ? 396  ASP C CB    1 
ATOM   6689  C  CG    . ASP C  2  396  ? 64.560  -10.116 84.948   1.00 18.54  ? 396  ASP C CG    1 
ATOM   6690  O  OD1   . ASP C  2  396  ? 65.145  -9.197  85.563   1.00 19.03  ? 396  ASP C OD1   1 
ATOM   6691  O  OD2   . ASP C  2  396  ? 63.446  -10.562 85.296   1.00 24.45  ? 396  ASP C OD2   1 
ATOM   6692  N  N     . GLU C  2  397  ? 68.330  -9.989  85.360   1.00 15.61  ? 397  GLU C N     1 
ATOM   6693  C  CA    . GLU C  2  397  ? 69.079  -10.217 86.598   1.00 15.72  ? 397  GLU C CA    1 
ATOM   6694  C  C     . GLU C  2  397  ? 68.625  -9.466  87.861   1.00 19.62  ? 397  GLU C C     1 
ATOM   6695  O  O     . GLU C  2  397  ? 69.372  -9.415  88.841   1.00 29.68  ? 397  GLU C O     1 
ATOM   6696  C  CB    . GLU C  2  397  ? 70.606  -10.199 86.402   1.00 18.10  ? 397  GLU C CB    1 
ATOM   6697  C  CG    . GLU C  2  397  ? 71.157  -9.195  85.419   1.00 23.54  ? 397  GLU C CG    1 
ATOM   6698  C  CD    . GLU C  2  397  ? 72.661  -9.361  85.241   1.00 31.95  ? 397  GLU C CD    1 
ATOM   6699  O  OE1   . GLU C  2  397  ? 73.168  -10.466 85.541   1.00 27.68  ? 397  GLU C OE1   1 
ATOM   6700  O  OE2   . GLU C  2  397  ? 73.335  -8.396  84.812   1.00 28.53  ? 397  GLU C OE2   1 
ATOM   6701  N  N     . THR C  2  398  ? 67.447  -8.843  87.813   1.00 14.27  ? 398  THR C N     1 
ATOM   6702  C  CA    . THR C  2  398  ? 66.960  -7.992  88.902   1.00 10.89  ? 398  THR C CA    1 
ATOM   6703  C  C     . THR C  2  398  ? 67.202  -8.615  90.273   1.00 10.41  ? 398  THR C C     1 
ATOM   6704  O  O     . THR C  2  398  ? 67.679  -7.948  91.186   1.00 11.28  ? 398  THR C O     1 
ATOM   6705  C  CB    . THR C  2  398  ? 65.448  -7.744  88.768   1.00 9.42   ? 398  THR C CB    1 
ATOM   6706  O  OG1   . THR C  2  398  ? 65.168  -7.149  87.496   1.00 10.70  ? 398  THR C OG1   1 
ATOM   6707  C  CG2   . THR C  2  398  ? 64.958  -6.829  89.871   1.00 9.68   ? 398  THR C CG2   1 
ATOM   6708  N  N     . ASN C  2  399  ? 66.889  -9.899  90.400   1.00 11.13  ? 399  ASN C N     1 
ATOM   6709  C  CA    . ASN C  2  399  ? 67.324  -10.699 91.539   1.00 9.79   ? 399  ASN C CA    1 
ATOM   6710  C  C     . ASN C  2  399  ? 67.678  -12.102 91.025   1.00 11.35  ? 399  ASN C C     1 
ATOM   6711  O  O     . ASN C  2  399  ? 67.495  -12.371 89.841   1.00 11.37  ? 399  ASN C O     1 
ATOM   6712  C  CB    . ASN C  2  399  ? 66.239  -10.721 92.623   1.00 7.01   ? 399  ASN C CB    1 
ATOM   6713  C  CG    . ASN C  2  399  ? 64.932  -11.283 92.129   1.00 8.30   ? 399  ASN C CG    1 
ATOM   6714  O  OD1   . ASN C  2  399  ? 64.827  -12.473 91.834   1.00 10.96  ? 399  ASN C OD1   1 
ATOM   6715  N  ND2   . ASN C  2  399  ? 63.917  -10.434 92.049   1.00 7.87   ? 399  ASN C ND2   1 
ATOM   6716  N  N     . PRO C  2  400  ? 68.195  -12.997 91.892   1.00 13.27  ? 400  PRO C N     1 
ATOM   6717  C  CA    . PRO C  2  400  ? 68.551  -14.330 91.380   1.00 16.70  ? 400  PRO C CA    1 
ATOM   6718  C  C     . PRO C  2  400  ? 67.376  -15.118 90.790   1.00 12.87  ? 400  PRO C C     1 
ATOM   6719  O  O     . PRO C  2  400  ? 67.531  -15.811 89.769   1.00 11.68  ? 400  PRO C O     1 
ATOM   6720  C  CB    . PRO C  2  400  ? 69.084  -15.042 92.627   1.00 18.86  ? 400  PRO C CB    1 
ATOM   6721  C  CG    . PRO C  2  400  ? 69.649  -13.953 93.451   1.00 13.64  ? 400  PRO C CG    1 
ATOM   6722  C  CD    . PRO C  2  400  ? 68.739  -12.778 93.247   1.00 12.86  ? 400  PRO C CD    1 
ATOM   6723  N  N     . LEU C  2  401  ? 66.216  -15.009 91.431   1.00 9.88   ? 401  LEU C N     1 
ATOM   6724  C  CA    . LEU C  2  401  ? 65.026  -15.709 90.975   1.00 8.78   ? 401  LEU C CA    1 
ATOM   6725  C  C     . LEU C  2  401  ? 64.624  -15.253 89.576   1.00 11.04  ? 401  LEU C C     1 
ATOM   6726  O  O     . LEU C  2  401  ? 64.125  -16.046 88.776   1.00 12.44  ? 401  LEU C O     1 
ATOM   6727  C  CB    . LEU C  2  401  ? 63.874  -15.504 91.954   1.00 7.64   ? 401  LEU C CB    1 
ATOM   6728  C  CG    . LEU C  2  401  ? 62.578  -16.219 91.577   1.00 10.95  ? 401  LEU C CG    1 
ATOM   6729  C  CD1   . LEU C  2  401  ? 62.806  -17.719 91.445   1.00 8.47   ? 401  LEU C CD1   1 
ATOM   6730  C  CD2   . LEU C  2  401  ? 61.490  -15.919 92.592   1.00 11.92  ? 401  LEU C CD2   1 
ATOM   6731  N  N     . SER C  2  402  ? 64.855  -13.975 89.286   1.00 11.04  ? 402  SER C N     1 
ATOM   6732  C  CA    . SER C  2  402  ? 64.566  -13.414 87.970   1.00 11.90  ? 402  SER C CA    1 
ATOM   6733  C  C     . SER C  2  402  ? 65.292  -14.201 86.889   1.00 12.51  ? 402  SER C C     1 
ATOM   6734  O  O     . SER C  2  402  ? 64.689  -14.654 85.914   1.00 11.40  ? 402  SER C O     1 
ATOM   6735  C  CB    . SER C  2  402  ? 65.016  -11.955 87.906   1.00 11.92  ? 402  SER C CB    1 
ATOM   6736  O  OG    . SER C  2  402  ? 64.690  -11.263 89.095   1.00 11.67  ? 402  SER C OG    1 
ATOM   6737  N  N     . SER C  2  403  ? 66.598  -14.352 87.081   1.00 12.52  ? 403  SER C N     1 
ATOM   6738  C  CA    . SER C  2  403  ? 67.449  -15.060 86.141   1.00 11.00  ? 403  SER C CA    1 
ATOM   6739  C  C     . SER C  2  403  ? 67.039  -16.518 86.045   1.00 12.76  ? 403  SER C C     1 
ATOM   6740  O  O     . SER C  2  403  ? 66.864  -17.051 84.938   1.00 17.57  ? 403  SER C O     1 
ATOM   6741  C  CB    . SER C  2  403  ? 68.909  -14.951 86.575   1.00 14.86  ? 403  SER C CB    1 
ATOM   6742  O  OG    . SER C  2  403  ? 69.292  -13.591 86.711   1.00 17.26  ? 403  SER C OG    1 
ATOM   6743  N  N     . LEU C  2  404  ? 66.873  -17.156 87.203   1.00 11.11  ? 404  LEU C N     1 
ATOM   6744  C  CA    . LEU C  2  404  ? 66.464  -18.559 87.235   1.00 10.95  ? 404  LEU C CA    1 
ATOM   6745  C  C     . LEU C  2  404  ? 65.207  -18.806 86.400   1.00 11.45  ? 404  LEU C C     1 
ATOM   6746  O  O     . LEU C  2  404  ? 65.204  -19.663 85.517   1.00 12.63  ? 404  LEU C O     1 
ATOM   6747  C  CB    . LEU C  2  404  ? 66.243  -19.035 88.669   1.00 9.73   ? 404  LEU C CB    1 
ATOM   6748  C  CG    . LEU C  2  404  ? 65.943  -20.527 88.825   1.00 7.00   ? 404  LEU C CG    1 
ATOM   6749  C  CD1   . LEU C  2  404  ? 67.118  -21.364 88.354   1.00 11.14  ? 404  LEU C CD1   1 
ATOM   6750  C  CD2   . LEU C  2  404  ? 65.606  -20.850 90.266   1.00 11.40  ? 404  LEU C CD2   1 
ATOM   6751  N  N     . ARG C  2  405  ? 64.154  -18.040 86.668   1.00 12.31  ? 405  ARG C N     1 
ATOM   6752  C  CA    . ARG C  2  405  ? 62.902  -18.173 85.927   1.00 12.00  ? 405  ARG C CA    1 
ATOM   6753  C  C     . ARG C  2  405  ? 63.063  -17.837 84.447   1.00 14.49  ? 405  ARG C C     1 
ATOM   6754  O  O     . ARG C  2  405  ? 62.433  -18.457 83.588   1.00 16.15  ? 405  ARG C O     1 
ATOM   6755  C  CB    . ARG C  2  405  ? 61.820  -17.275 86.521   1.00 12.98  ? 405  ARG C CB    1 
ATOM   6756  C  CG    . ARG C  2  405  ? 60.453  -17.513 85.907   1.00 20.21  ? 405  ARG C CG    1 
ATOM   6757  C  CD    . ARG C  2  405  ? 59.527  -16.332 86.105   1.00 18.08  ? 405  ARG C CD    1 
ATOM   6758  N  NE    . ARG C  2  405  ? 59.681  -15.335 85.052   1.00 16.06  ? 405  ARG C NE    1 
ATOM   6759  C  CZ    . ARG C  2  405  ? 58.756  -14.432 84.747   1.00 17.67  ? 405  ARG C CZ    1 
ATOM   6760  N  NH1   . ARG C  2  405  ? 57.611  -14.406 85.415   1.00 13.26  ? 405  ARG C NH1   1 
ATOM   6761  N  NH2   . ARG C  2  405  ? 58.973  -13.560 83.773   1.00 27.63  ? 405  ARG C NH2   1 
ATOM   6762  N  N     . HIS C  2  406  ? 63.895  -16.841 84.158   1.00 13.07  ? 406  HIS C N     1 
ATOM   6763  C  CA    . HIS C  2  406  ? 64.115  -16.417 82.786   1.00 10.46  ? 406  HIS C CA    1 
ATOM   6764  C  C     . HIS C  2  406  ? 64.649  -17.577 81.972   1.00 10.06  ? 406  HIS C C     1 
ATOM   6765  O  O     . HIS C  2  406  ? 64.160  -17.856 80.881   1.00 8.98   ? 406  HIS C O     1 
ATOM   6766  C  CB    . HIS C  2  406  ? 65.098  -15.251 82.731   1.00 11.43  ? 406  HIS C CB    1 
ATOM   6767  C  CG    . HIS C  2  406  ? 65.115  -14.539 81.414   1.00 10.73  ? 406  HIS C CG    1 
ATOM   6768  N  ND1   . HIS C  2  406  ? 65.697  -13.301 81.246   1.00 12.82  ? 406  HIS C ND1   1 
ATOM   6769  C  CD2   . HIS C  2  406  ? 64.612  -14.887 80.207   1.00 8.87   ? 406  HIS C CD2   1 
ATOM   6770  C  CE1   . HIS C  2  406  ? 65.556  -12.919 79.989   1.00 12.23  ? 406  HIS C CE1   1 
ATOM   6771  N  NE2   . HIS C  2  406  ? 64.901  -13.862 79.338   1.00 10.78  ? 406  HIS C NE2   1 
ATOM   6772  N  N     . LYS C  2  407  ? 65.647  -18.265 82.518   1.00 11.84  ? 407  LYS C N     1 
ATOM   6773  C  CA    . LYS C  2  407  ? 66.248  -19.395 81.815   1.00 12.14  ? 407  LYS C CA    1 
ATOM   6774  C  C     . LYS C  2  407  ? 65.252  -20.537 81.613   1.00 11.79  ? 407  LYS C C     1 
ATOM   6775  O  O     . LYS C  2  407  ? 65.436  -21.380 80.735   1.00 13.10  ? 407  LYS C O     1 
ATOM   6776  C  CB    . LYS C  2  407  ? 67.495  -19.886 82.553   1.00 11.94  ? 407  LYS C CB    1 
ATOM   6777  C  CG    . LYS C  2  407  ? 68.639  -18.880 82.561   1.00 12.28  ? 407  LYS C CG    1 
ATOM   6778  C  CD    . LYS C  2  407  ? 69.507  -19.037 83.799   1.00 14.93  ? 407  LYS C CD    1 
ATOM   6779  C  CE    . LYS C  2  407  ? 70.387  -17.814 84.017   1.00 16.80  ? 407  LYS C CE    1 
ATOM   6780  N  NZ    . LYS C  2  407  ? 70.841  -17.702 85.435   1.00 19.49  ? 407  LYS C NZ    1 
ATOM   6781  N  N     . ARG C  2  408  ? 64.198  -20.550 82.423   1.00 10.62  ? 408  ARG C N     1 
ATOM   6782  C  CA    . ARG C  2  408  ? 63.171  -21.590 82.356   1.00 9.43   ? 408  ARG C CA    1 
ATOM   6783  C  C     . ARG C  2  408  ? 61.947  -21.228 81.504   1.00 11.70  ? 408  ARG C C     1 
ATOM   6784  O  O     . ARG C  2  408  ? 60.960  -21.963 81.502   1.00 10.52  ? 408  ARG C O     1 
ATOM   6785  C  CB    . ARG C  2  408  ? 62.736  -22.014 83.760   1.00 10.28  ? 408  ARG C CB    1 
ATOM   6786  C  CG    . ARG C  2  408  ? 63.865  -22.587 84.601   1.00 10.16  ? 408  ARG C CG    1 
ATOM   6787  C  CD    . ARG C  2  408  ? 63.413  -22.863 86.026   1.00 8.65   ? 408  ARG C CD    1 
ATOM   6788  N  NE    . ARG C  2  408  ? 62.367  -23.875 86.072   1.00 8.20   ? 408  ARG C NE    1 
ATOM   6789  C  CZ    . ARG C  2  408  ? 62.603  -25.182 86.057   1.00 12.43  ? 408  ARG C CZ    1 
ATOM   6790  N  NH1   . ARG C  2  408  ? 61.595  -26.040 86.100   1.00 16.40  ? 408  ARG C NH1   1 
ATOM   6791  N  NH2   . ARG C  2  408  ? 63.850  -25.631 85.999   1.00 12.98  ? 408  ARG C NH2   1 
ATOM   6792  N  N     . ARG C  2  409  ? 61.997  -20.091 80.812   1.00 15.30  ? 409  ARG C N     1 
ATOM   6793  C  CA    . ARG C  2  409  ? 60.884  -19.651 79.961   1.00 13.68  ? 409  ARG C CA    1 
ATOM   6794  C  C     . ARG C  2  409  ? 60.693  -20.499 78.704   1.00 9.46   ? 409  ARG C C     1 
ATOM   6795  O  O     . ARG C  2  409  ? 61.644  -21.063 78.167   1.00 9.29   ? 409  ARG C O     1 
ATOM   6796  C  CB    . ARG C  2  409  ? 61.066  -18.193 79.541   1.00 14.07  ? 409  ARG C CB    1 
ATOM   6797  C  CG    . ARG C  2  409  ? 61.012  -17.194 80.675   1.00 24.11  ? 409  ARG C CG    1 
ATOM   6798  C  CD    . ARG C  2  409  ? 59.766  -16.329 80.592   1.00 29.08  ? 409  ARG C CD    1 
ATOM   6799  N  NE    . ARG C  2  409  ? 58.606  -16.984 81.188   1.00 31.13  ? 409  ARG C NE    1 
ATOM   6800  C  CZ    . ARG C  2  409  ? 57.495  -16.344 81.542   1.00 35.29  ? 409  ARG C CZ    1 
ATOM   6801  N  NH1   . ARG C  2  409  ? 57.397  -15.031 81.357   1.00 32.74  ? 409  ARG C NH1   1 
ATOM   6802  N  NH2   . ARG C  2  409  ? 56.484  -17.015 82.082   1.00 25.83  ? 409  ARG C NH2   1 
ATOM   6803  N  N     . ILE C  2  410  ? 59.452  -20.563 78.237   1.00 9.22   ? 410  ILE C N     1 
ATOM   6804  C  CA    . ILE C  2  410  ? 59.107  -21.273 77.015   1.00 8.61   ? 410  ILE C CA    1 
ATOM   6805  C  C     . ILE C  2  410  ? 58.262  -20.377 76.115   1.00 11.81  ? 410  ILE C C     1 
ATOM   6806  O  O     . ILE C  2  410  ? 57.142  -20.014 76.467   1.00 15.76  ? 410  ILE C O     1 
ATOM   6807  C  CB    . ILE C  2  410  ? 58.304  -22.542 77.324   1.00 8.36   ? 410  ILE C CB    1 
ATOM   6808  C  CG1   . ILE C  2  410  ? 59.142  -23.512 78.157   1.00 11.68  ? 410  ILE C CG1   1 
ATOM   6809  C  CG2   . ILE C  2  410  ? 57.847  -23.202 76.041   1.00 8.82   ? 410  ILE C CG2   1 
ATOM   6810  C  CD1   . ILE C  2  410  ? 58.456  -24.833 78.441   1.00 14.22  ? 410  ILE C CD1   1 
ATOM   6811  N  N     . SER C  2  411  ? 58.794  -20.030 74.948   1.00 9.67   ? 411  SER C N     1 
ATOM   6812  C  CA    . SER C  2  411  ? 58.124  -19.098 74.049   1.00 9.67   ? 411  SER C CA    1 
ATOM   6813  C  C     . SER C  2  411  ? 57.535  -19.807 72.840   1.00 12.48  ? 411  SER C C     1 
ATOM   6814  O  O     . SER C  2  411  ? 58.219  -20.581 72.179   1.00 13.49  ? 411  SER C O     1 
ATOM   6815  C  CB    . SER C  2  411  ? 59.103  -18.014 73.587   1.00 12.98  ? 411  SER C CB    1 
ATOM   6816  O  OG    . SER C  2  411  ? 58.538  -17.194 72.576   1.00 15.39  ? 411  SER C OG    1 
ATOM   6817  N  N     . ALA C  2  412  ? 56.264  -19.541 72.554   1.00 17.27  ? 412  ALA C N     1 
ATOM   6818  C  CA    . ALA C  2  412  ? 55.623  -20.071 71.353   1.00 18.86  ? 412  ALA C CA    1 
ATOM   6819  C  C     . ALA C  2  412  ? 55.869  -19.121 70.186   1.00 25.32  ? 412  ALA C C     1 
ATOM   6820  O  O     . ALA C  2  412  ? 55.524  -19.416 69.039   1.00 22.98  ? 412  ALA C O     1 
ATOM   6821  C  CB    . ALA C  2  412  ? 54.135  -20.262 71.581   1.00 13.13  ? 412  ALA C CB    1 
ATOM   6822  N  N     . LEU C  2  413  ? 56.472  -17.978 70.504   1.00 28.17  ? 413  LEU C N     1 
ATOM   6823  C  CA    . LEU C  2  413  ? 56.785  -16.939 69.530   1.00 29.20  ? 413  LEU C CA    1 
ATOM   6824  C  C     . LEU C  2  413  ? 58.141  -17.182 68.882   1.00 30.64  ? 413  LEU C C     1 
ATOM   6825  O  O     . LEU C  2  413  ? 58.729  -18.251 69.038   1.00 31.39  ? 413  LEU C O     1 
ATOM   6826  C  CB    . LEU C  2  413  ? 56.787  -15.575 70.216   1.00 24.32  ? 413  LEU C CB    1 
ATOM   6827  C  CG    . LEU C  2  413  ? 55.498  -15.197 70.940   1.00 21.38  ? 413  LEU C CG    1 
ATOM   6828  C  CD1   . LEU C  2  413  ? 55.683  -13.900 71.704   1.00 29.30  ? 413  LEU C CD1   1 
ATOM   6829  C  CD2   . LEU C  2  413  ? 54.359  -15.079 69.945   1.00 28.54  ? 413  LEU C CD2   1 
ATOM   6830  N  N     . GLY C  2  414  ? 58.629  -16.188 68.145   1.00 36.12  ? 414  GLY C N     1 
ATOM   6831  C  CA    . GLY C  2  414  ? 59.958  -16.252 67.564   1.00 42.45  ? 414  GLY C CA    1 
ATOM   6832  C  C     . GLY C  2  414  ? 59.985  -16.812 66.155   1.00 51.51  ? 414  GLY C C     1 
ATOM   6833  O  O     . GLY C  2  414  ? 58.943  -17.192 65.617   1.00 51.08  ? 414  GLY C O     1 
ATOM   6834  N  N     . PRO C  2  415  ? 61.182  -16.860 65.546   1.00 50.46  ? 415  PRO C N     1 
ATOM   6835  C  CA    . PRO C  2  415  ? 61.373  -17.379 64.186   1.00 42.95  ? 415  PRO C CA    1 
ATOM   6836  C  C     . PRO C  2  415  ? 60.931  -18.833 64.069   1.00 41.80  ? 415  PRO C C     1 
ATOM   6837  O  O     . PRO C  2  415  ? 61.343  -19.667 64.877   1.00 49.08  ? 415  PRO C O     1 
ATOM   6838  C  CB    . PRO C  2  415  ? 62.888  -17.271 63.983   1.00 36.02  ? 415  PRO C CB    1 
ATOM   6839  C  CG    . PRO C  2  415  ? 63.316  -16.188 64.914   1.00 43.27  ? 415  PRO C CG    1 
ATOM   6840  C  CD    . PRO C  2  415  ? 62.437  -16.341 66.118   1.00 41.87  ? 415  PRO C CD    1 
ATOM   6841  N  N     . GLY C  2  416  ? 60.105  -19.131 63.070   1.00 39.36  ? 416  GLY C N     1 
ATOM   6842  C  CA    . GLY C  2  416  ? 59.570  -20.470 62.895   1.00 44.61  ? 416  GLY C CA    1 
ATOM   6843  C  C     . GLY C  2  416  ? 58.462  -20.771 63.888   1.00 45.57  ? 416  GLY C C     1 
ATOM   6844  O  O     . GLY C  2  416  ? 57.901  -21.869 63.909   1.00 30.71  ? 416  GLY C O     1 
ATOM   6845  N  N     . GLY C  2  417  ? 58.157  -19.786 64.726   1.00 50.27  ? 417  GLY C N     1 
ATOM   6846  C  CA    . GLY C  2  417  ? 57.100  -19.913 65.709   1.00 49.79  ? 417  GLY C CA    1 
ATOM   6847  C  C     . GLY C  2  417  ? 55.873  -19.110 65.333   1.00 45.03  ? 417  GLY C C     1 
ATOM   6848  O  O     . GLY C  2  417  ? 55.849  -18.438 64.300   1.00 46.12  ? 417  GLY C O     1 
ATOM   6849  N  N     . LEU C  2  418  ? 54.853  -19.181 66.179   1.00 43.27  ? 418  LEU C N     1 
ATOM   6850  C  CA    . LEU C  2  418  ? 53.621  -18.438 65.963   1.00 48.21  ? 418  LEU C CA    1 
ATOM   6851  C  C     . LEU C  2  418  ? 53.867  -16.936 65.989   1.00 53.86  ? 418  LEU C C     1 
ATOM   6852  O  O     . LEU C  2  418  ? 54.525  -16.419 66.892   1.00 48.51  ? 418  LEU C O     1 
ATOM   6853  C  CB    . LEU C  2  418  ? 52.585  -18.798 67.031   1.00 49.35  ? 418  LEU C CB    1 
ATOM   6854  C  CG    . LEU C  2  418  ? 51.912  -20.167 66.954   1.00 43.29  ? 418  LEU C CG    1 
ATOM   6855  C  CD1   . LEU C  2  418  ? 51.141  -20.446 68.231   1.00 31.98  ? 418  LEU C CD1   1 
ATOM   6856  C  CD2   . LEU C  2  418  ? 50.989  -20.236 65.750   1.00 46.93  ? 418  LEU C CD2   1 
ATOM   6857  N  N     . THR C  2  419  ? 53.348  -16.241 64.984   1.00 68.06  ? 419  THR C N     1 
ATOM   6858  C  CA    . THR C  2  419  ? 53.283  -14.788 65.022   1.00 69.74  ? 419  THR C CA    1 
ATOM   6859  C  C     . THR C  2  419  ? 52.001  -14.396 65.759   1.00 78.06  ? 419  THR C C     1 
ATOM   6860  O  O     . THR C  2  419  ? 50.979  -15.076 65.643   1.00 81.37  ? 419  THR C O     1 
ATOM   6861  C  CB    . THR C  2  419  ? 53.350  -14.167 63.606   1.00 66.95  ? 419  THR C CB    1 
ATOM   6862  O  OG1   . THR C  2  419  ? 52.728  -12.876 63.612   1.00 71.39  ? 419  THR C OG1   1 
ATOM   6863  C  CG2   . THR C  2  419  ? 52.658  -15.065 62.586   1.00 65.21  ? 419  THR C CG2   1 
ATOM   6864  N  N     . ARG C  2  420  ? 52.065  -13.316 66.532   1.00 71.82  ? 420  ARG C N     1 
ATOM   6865  C  CA    . ARG C  2  420  ? 50.966  -12.933 67.416   1.00 62.33  ? 420  ARG C CA    1 
ATOM   6866  C  C     . ARG C  2  420  ? 49.716  -12.530 66.641   1.00 79.85  ? 420  ARG C C     1 
ATOM   6867  O  O     . ARG C  2  420  ? 49.794  -12.194 65.458   1.00 91.57  ? 420  ARG C O     1 
ATOM   6868  C  CB    . ARG C  2  420  ? 51.404  -11.795 68.333   1.00 56.67  ? 420  ARG C CB    1 
ATOM   6869  C  CG    . ARG C  2  420  ? 50.671  -11.745 69.660   1.00 55.67  ? 420  ARG C CG    1 
ATOM   6870  C  CD    . ARG C  2  420  ? 51.349  -10.755 70.583   1.00 43.87  ? 420  ARG C CD    1 
ATOM   6871  N  NE    . ARG C  2  420  ? 52.802  -10.878 70.497   1.00 41.63  ? 420  ARG C NE    1 
ATOM   6872  C  CZ    . ARG C  2  420  ? 53.661  -10.091 71.135   1.00 48.67  ? 420  ARG C CZ    1 
ATOM   6873  N  NH1   . ARG C  2  420  ? 54.965  -10.279 70.993   1.00 48.12  ? 420  ARG C NH1   1 
ATOM   6874  N  NH2   . ARG C  2  420  ? 53.218  -9.116  71.916   1.00 60.30  ? 420  ARG C NH2   1 
ATOM   6875  N  N     . GLU C  2  421  ? 48.569  -12.592 67.320   1.00 72.92  ? 421  GLU C N     1 
ATOM   6876  C  CA    . GLU C  2  421  ? 47.249  -12.299 66.744   1.00 88.30  ? 421  GLU C CA    1 
ATOM   6877  C  C     . GLU C  2  421  ? 46.787  -13.373 65.758   1.00 89.90  ? 421  GLU C C     1 
ATOM   6878  O  O     . GLU C  2  421  ? 45.624  -13.399 65.352   1.00 89.36  ? 421  GLU C O     1 
ATOM   6879  C  CB    . GLU C  2  421  ? 47.209  -10.912 66.090   1.00 91.73  ? 421  GLU C CB    1 
ATOM   6880  C  CG    . GLU C  2  421  ? 47.700  -9.789  66.985   1.00 95.00  ? 421  GLU C CG    1 
ATOM   6881  C  CD    . GLU C  2  421  ? 48.169  -8.583  66.197   1.00 107.52 ? 421  GLU C CD    1 
ATOM   6882  O  OE1   . GLU C  2  421  ? 48.829  -7.704  66.792   1.00 108.13 ? 421  GLU C OE1   1 
ATOM   6883  O  OE2   . GLU C  2  421  ? 47.881  -8.516  64.982   1.00 97.24  ? 421  GLU C OE2   1 
ATOM   6884  N  N     . ARG C  2  422  ? 47.710  -14.247 65.370   1.00 88.48  ? 422  ARG C N     1 
ATOM   6885  C  CA    . ARG C  2  422  ? 47.387  -15.405 64.551   1.00 87.48  ? 422  ARG C CA    1 
ATOM   6886  C  C     . ARG C  2  422  ? 47.241  -16.609 65.469   1.00 81.89  ? 422  ARG C C     1 
ATOM   6887  O  O     . ARG C  2  422  ? 46.952  -17.721 65.024   1.00 83.18  ? 422  ARG C O     1 
ATOM   6888  C  CB    . ARG C  2  422  ? 48.485  -15.652 63.517   1.00 85.42  ? 422  ARG C CB    1 
ATOM   6889  C  CG    . ARG C  2  422  ? 49.160  -14.382 63.015   1.00 85.25  ? 422  ARG C CG    1 
ATOM   6890  C  CD    . ARG C  2  422  ? 48.192  -13.441 62.311   1.00 82.00  ? 422  ARG C CD    1 
ATOM   6891  N  NE    . ARG C  2  422  ? 48.829  -12.171 61.974   1.00 76.55  ? 422  ARG C NE    1 
ATOM   6892  C  CZ    . ARG C  2  422  ? 49.528  -11.957 60.863   1.00 81.37  ? 422  ARG C CZ    1 
ATOM   6893  N  NH1   . ARG C  2  422  ? 49.680  -12.932 59.975   1.00 86.07  ? 422  ARG C NH1   1 
ATOM   6894  N  NH2   . ARG C  2  422  ? 50.075  -10.770 60.638   1.00 72.65  ? 422  ARG C NH2   1 
ATOM   6895  N  N     . ALA C  2  423  ? 47.456  -16.372 66.759   1.00 62.87  ? 423  ALA C N     1 
ATOM   6896  C  CA    . ALA C  2  423  ? 47.347  -17.418 67.762   1.00 57.26  ? 423  ALA C CA    1 
ATOM   6897  C  C     . ALA C  2  423  ? 45.964  -17.408 68.405   1.00 60.81  ? 423  ALA C C     1 
ATOM   6898  O  O     . ALA C  2  423  ? 45.616  -16.478 69.136   1.00 56.60  ? 423  ALA C O     1 
ATOM   6899  C  CB    . ALA C  2  423  ? 48.420  -17.240 68.816   1.00 50.23  ? 423  ALA C CB    1 
ATOM   6900  N  N     . GLY C  2  424  ? 45.185  -18.453 68.137   1.00 61.32  ? 424  GLY C N     1 
ATOM   6901  C  CA    . GLY C  2  424  ? 43.837  -18.562 68.667   1.00 54.33  ? 424  GLY C CA    1 
ATOM   6902  C  C     . GLY C  2  424  ? 43.829  -19.099 70.083   1.00 44.25  ? 424  GLY C C     1 
ATOM   6903  O  O     . GLY C  2  424  ? 44.883  -19.253 70.698   1.00 41.85  ? 424  GLY C O     1 
ATOM   6904  N  N     . PHE C  2  425  ? 42.639  -19.389 70.601   1.00 41.21  ? 425  PHE C N     1 
ATOM   6905  C  CA    . PHE C  2  425  ? 42.500  -19.912 71.957   1.00 42.84  ? 425  PHE C CA    1 
ATOM   6906  C  C     . PHE C  2  425  ? 43.158  -21.282 72.118   1.00 43.73  ? 425  PHE C C     1 
ATOM   6907  O  O     . PHE C  2  425  ? 43.490  -21.691 73.231   1.00 43.09  ? 425  PHE C O     1 
ATOM   6908  C  CB    . PHE C  2  425  ? 41.023  -20.004 72.350   1.00 46.96  ? 425  PHE C CB    1 
ATOM   6909  C  CG    . PHE C  2  425  ? 40.328  -18.675 72.420   1.00 46.45  ? 425  PHE C CG    1 
ATOM   6910  C  CD1   . PHE C  2  425  ? 39.817  -18.084 71.275   1.00 42.66  ? 425  PHE C CD1   1 
ATOM   6911  C  CD2   . PHE C  2  425  ? 40.177  -18.021 73.631   1.00 46.76  ? 425  PHE C CD2   1 
ATOM   6912  C  CE1   . PHE C  2  425  ? 39.176  -16.864 71.336   1.00 39.71  ? 425  PHE C CE1   1 
ATOM   6913  C  CE2   . PHE C  2  425  ? 39.537  -16.798 73.699   1.00 42.88  ? 425  PHE C CE2   1 
ATOM   6914  C  CZ    . PHE C  2  425  ? 39.035  -16.220 72.550   1.00 43.29  ? 425  PHE C CZ    1 
ATOM   6915  N  N     . ASP C  2  426  ? 43.344  -21.980 71.002   1.00 47.13  ? 426  ASP C N     1 
ATOM   6916  C  CA    . ASP C  2  426  ? 43.876  -23.341 71.013   1.00 41.93  ? 426  ASP C CA    1 
ATOM   6917  C  C     . ASP C  2  426  ? 45.272  -23.437 71.618   1.00 29.30  ? 426  ASP C C     1 
ATOM   6918  O  O     . ASP C  2  426  ? 45.520  -24.257 72.500   1.00 28.59  ? 426  ASP C O     1 
ATOM   6919  C  CB    . ASP C  2  426  ? 43.882  -23.924 69.595   1.00 52.73  ? 426  ASP C CB    1 
ATOM   6920  C  CG    . ASP C  2  426  ? 42.482  -24.186 69.063   1.00 74.04  ? 426  ASP C CG    1 
ATOM   6921  O  OD1   . ASP C  2  426  ? 41.582  -24.497 69.875   1.00 78.97  ? 426  ASP C OD1   1 
ATOM   6922  O  OD2   . ASP C  2  426  ? 42.281  -24.086 67.833   1.00 77.30  ? 426  ASP C OD2   1 
ATOM   6923  N  N     . VAL C  2  427  ? 46.183  -22.601 71.138   1.00 26.44  ? 427  VAL C N     1 
ATOM   6924  C  CA    . VAL C  2  427  ? 47.573  -22.672 71.565   1.00 25.51  ? 427  VAL C CA    1 
ATOM   6925  C  C     . VAL C  2  427  ? 47.823  -22.014 72.922   1.00 30.07  ? 427  VAL C C     1 
ATOM   6926  O  O     . VAL C  2  427  ? 48.773  -22.364 73.623   1.00 32.23  ? 427  VAL C O     1 
ATOM   6927  C  CB    . VAL C  2  427  ? 48.506  -22.053 70.513   1.00 24.10  ? 427  VAL C CB    1 
ATOM   6928  C  CG1   . VAL C  2  427  ? 48.432  -22.847 69.220   1.00 42.97  ? 427  VAL C CG1   1 
ATOM   6929  C  CG2   . VAL C  2  427  ? 48.133  -20.604 70.267   1.00 28.75  ? 427  VAL C CG2   1 
ATOM   6930  N  N     . ARG C  2  428  ? 46.970  -21.064 73.290   1.00 27.51  ? 428  ARG C N     1 
ATOM   6931  C  CA    . ARG C  2  428  ? 47.163  -20.306 74.520   1.00 19.27  ? 428  ARG C CA    1 
ATOM   6932  C  C     . ARG C  2  428  ? 46.522  -21.019 75.701   1.00 21.26  ? 428  ARG C C     1 
ATOM   6933  O  O     . ARG C  2  428  ? 46.766  -20.673 76.855   1.00 25.18  ? 428  ARG C O     1 
ATOM   6934  C  CB    . ARG C  2  428  ? 46.580  -18.902 74.369   1.00 17.52  ? 428  ARG C CB    1 
ATOM   6935  C  CG    . ARG C  2  428  ? 46.873  -18.267 73.020   1.00 25.33  ? 428  ARG C CG    1 
ATOM   6936  C  CD    . ARG C  2  428  ? 46.166  -16.935 72.862   1.00 22.39  ? 428  ARG C CD    1 
ATOM   6937  N  NE    . ARG C  2  428  ? 46.999  -15.822 73.299   1.00 17.96  ? 428  ARG C NE    1 
ATOM   6938  C  CZ    . ARG C  2  428  ? 47.388  -14.829 72.507   1.00 20.36  ? 428  ARG C CZ    1 
ATOM   6939  N  NH1   . ARG C  2  428  ? 47.012  -14.805 71.235   1.00 24.67  ? 428  ARG C NH1   1 
ATOM   6940  N  NH2   . ARG C  2  428  ? 48.147  -13.856 72.989   1.00 20.96  ? 428  ARG C NH2   1 
ATOM   6941  N  N     . ASP C  2  429  ? 45.712  -22.026 75.400   1.00 19.47  ? 429  ASP C N     1 
ATOM   6942  C  CA    . ASP C  2  429  ? 44.996  -22.785 76.418   1.00 17.74  ? 429  ASP C CA    1 
ATOM   6943  C  C     . ASP C  2  429  ? 45.929  -23.623 77.282   1.00 17.59  ? 429  ASP C C     1 
ATOM   6944  O  O     . ASP C  2  429  ? 47.079  -23.869 76.918   1.00 18.66  ? 429  ASP C O     1 
ATOM   6945  C  CB    . ASP C  2  429  ? 43.965  -23.702 75.761   1.00 25.18  ? 429  ASP C CB    1 
ATOM   6946  C  CG    . ASP C  2  429  ? 42.541  -23.256 76.015   1.00 36.44  ? 429  ASP C CG    1 
ATOM   6947  O  OD1   . ASP C  2  429  ? 42.249  -22.820 77.148   1.00 40.00  ? 429  ASP C OD1   1 
ATOM   6948  O  OD2   . ASP C  2  429  ? 41.715  -23.344 75.080   1.00 41.06  ? 429  ASP C OD2   1 
ATOM   6949  N  N     . VAL C  2  430  ? 45.428  -24.037 78.442   1.00 15.67  ? 430  VAL C N     1 
ATOM   6950  C  CA    . VAL C  2  430  ? 46.116  -25.019 79.270   1.00 13.54  ? 430  VAL C CA    1 
ATOM   6951  C  C     . VAL C  2  430  ? 45.625  -26.398 78.864   1.00 16.25  ? 430  VAL C C     1 
ATOM   6952  O  O     . VAL C  2  430  ? 44.455  -26.720 79.056   1.00 22.75  ? 430  VAL C O     1 
ATOM   6953  C  CB    . VAL C  2  430  ? 45.783  -24.821 80.757   1.00 12.68  ? 430  VAL C CB    1 
ATOM   6954  C  CG1   . VAL C  2  430  ? 46.359  -25.952 81.587   1.00 11.57  ? 430  VAL C CG1   1 
ATOM   6955  C  CG2   . VAL C  2  430  ? 46.295  -23.482 81.242   1.00 17.01  ? 430  VAL C CG2   1 
ATOM   6956  N  N     . HIS C  2  431  ? 46.510  -27.208 78.291   1.00 15.03  ? 431  HIS C N     1 
ATOM   6957  C  CA    . HIS C  2  431  ? 46.148  -28.564 77.884   1.00 15.41  ? 431  HIS C CA    1 
ATOM   6958  C  C     . HIS C  2  431  ? 46.212  -29.521 79.074   1.00 18.72  ? 431  HIS C C     1 
ATOM   6959  O  O     . HIS C  2  431  ? 46.972  -29.293 80.018   1.00 20.30  ? 431  HIS C O     1 
ATOM   6960  C  CB    . HIS C  2  431  ? 47.062  -29.051 76.758   1.00 17.44  ? 431  HIS C CB    1 
ATOM   6961  C  CG    . HIS C  2  431  ? 46.471  -30.148 75.929   1.00 15.51  ? 431  HIS C CG    1 
ATOM   6962  N  ND1   . HIS C  2  431  ? 46.431  -31.459 76.348   1.00 15.76  ? 431  HIS C ND1   1 
ATOM   6963  C  CD2   . HIS C  2  431  ? 45.903  -30.128 74.701   1.00 17.35  ? 431  HIS C CD2   1 
ATOM   6964  C  CE1   . HIS C  2  431  ? 45.860  -32.200 75.415   1.00 18.03  ? 431  HIS C CE1   1 
ATOM   6965  N  NE2   . HIS C  2  431  ? 45.531  -31.416 74.405   1.00 17.81  ? 431  HIS C NE2   1 
ATOM   6966  N  N     . ARG C  2  432  ? 45.427  -30.594 79.025   1.00 16.65  ? 432  ARG C N     1 
ATOM   6967  C  CA    . ARG C  2  432  ? 45.419  -31.585 80.097   1.00 13.15  ? 432  ARG C CA    1 
ATOM   6968  C  C     . ARG C  2  432  ? 46.799  -32.205 80.286   1.00 15.62  ? 432  ARG C C     1 
ATOM   6969  O  O     . ARG C  2  432  ? 47.111  -32.742 81.351   1.00 18.75  ? 432  ARG C O     1 
ATOM   6970  C  CB    . ARG C  2  432  ? 44.398  -32.686 79.808   1.00 12.06  ? 432  ARG C CB    1 
ATOM   6971  C  CG    . ARG C  2  432  ? 44.731  -33.536 78.590   1.00 15.69  ? 432  ARG C CG    1 
ATOM   6972  C  CD    . ARG C  2  432  ? 43.736  -34.675 78.420   1.00 18.17  ? 432  ARG C CD    1 
ATOM   6973  N  NE    . ARG C  2  432  ? 43.938  -35.409 77.173   1.00 16.75  ? 432  ARG C NE    1 
ATOM   6974  C  CZ    . ARG C  2  432  ? 44.748  -36.455 77.044   1.00 16.48  ? 432  ARG C CZ    1 
ATOM   6975  N  NH1   . ARG C  2  432  ? 45.438  -36.892 78.087   1.00 16.73  ? 432  ARG C NH1   1 
ATOM   6976  N  NH2   . ARG C  2  432  ? 44.869  -37.061 75.871   1.00 16.66  ? 432  ARG C NH2   1 
ATOM   6977  N  N     . THR C  2  433  ? 47.620  -32.124 79.244   1.00 14.18  ? 433  THR C N     1 
ATOM   6978  C  CA    . THR C  2  433  ? 48.945  -32.720 79.259   1.00 12.31  ? 433  THR C CA    1 
ATOM   6979  C  C     . THR C  2  433  ? 50.002  -31.740 79.752   1.00 11.15  ? 433  THR C C     1 
ATOM   6980  O  O     . THR C  2  433  ? 51.189  -32.058 79.775   1.00 12.42  ? 433  THR C O     1 
ATOM   6981  C  CB    . THR C  2  433  ? 49.339  -33.250 77.867   1.00 13.90  ? 433  THR C CB    1 
ATOM   6982  O  OG1   . THR C  2  433  ? 49.449  -32.156 76.950   1.00 18.12  ? 433  THR C OG1   1 
ATOM   6983  C  CG2   . THR C  2  433  ? 48.293  -34.229 77.358   1.00 13.24  ? 433  THR C CG2   1 
ATOM   6984  N  N     . HIS C  2  434  ? 49.574  -30.548 80.149   1.00 10.89  ? 434  HIS C N     1 
ATOM   6985  C  CA    . HIS C  2  434  ? 50.495  -29.595 80.756   1.00 12.36  ? 434  HIS C CA    1 
ATOM   6986  C  C     . HIS C  2  434  ? 50.791  -29.996 82.195   1.00 14.15  ? 434  HIS C C     1 
ATOM   6987  O  O     . HIS C  2  434  ? 51.738  -29.497 82.805   1.00 15.35  ? 434  HIS C O     1 
ATOM   6988  C  CB    . HIS C  2  434  ? 49.926  -28.177 80.722   1.00 12.28  ? 434  HIS C CB    1 
ATOM   6989  C  CG    . HIS C  2  434  ? 49.904  -27.571 79.363   1.00 11.38  ? 434  HIS C CG    1 
ATOM   6990  N  ND1   . HIS C  2  434  ? 49.776  -26.211 79.152   1.00 13.48  ? 434  HIS C ND1   1 
ATOM   6991  C  CD2   . HIS C  2  434  ? 49.993  -28.125 78.129   1.00 12.60  ? 434  HIS C CD2   1 
ATOM   6992  C  CE1   . HIS C  2  434  ? 49.789  -25.960 77.861   1.00 16.69  ? 434  HIS C CE1   1 
ATOM   6993  N  NE2   . HIS C  2  434  ? 49.918  -27.112 77.214   1.00 14.58  ? 434  HIS C NE2   1 
ATOM   6994  N  N     . TYR C  2  435  ? 49.972  -30.897 82.729   1.00 13.43  ? 435  TYR C N     1 
ATOM   6995  C  CA    . TYR C  2  435  ? 50.121  -31.360 84.101   1.00 10.97  ? 435  TYR C CA    1 
ATOM   6996  C  C     . TYR C  2  435  ? 51.518  -31.920 84.314   1.00 12.46  ? 435  TYR C C     1 
ATOM   6997  O  O     . TYR C  2  435  ? 51.939  -32.842 83.620   1.00 15.34  ? 435  TYR C O     1 
ATOM   6998  C  CB    . TYR C  2  435  ? 49.084  -32.445 84.393   1.00 10.35  ? 435  TYR C CB    1 
ATOM   6999  C  CG    . TYR C  2  435  ? 48.982  -32.826 85.848   1.00 10.35  ? 435  TYR C CG    1 
ATOM   7000  C  CD1   . TYR C  2  435  ? 49.904  -33.684 86.428   1.00 13.19  ? 435  TYR C CD1   1 
ATOM   7001  C  CD2   . TYR C  2  435  ? 47.958  -32.333 86.640   1.00 10.23  ? 435  TYR C CD2   1 
ATOM   7002  C  CE1   . TYR C  2  435  ? 49.814  -34.034 87.756   1.00 15.58  ? 435  TYR C CE1   1 
ATOM   7003  C  CE2   . TYR C  2  435  ? 47.857  -32.678 87.970   1.00 11.37  ? 435  TYR C CE2   1 
ATOM   7004  C  CZ    . TYR C  2  435  ? 48.788  -33.529 88.524   1.00 16.11  ? 435  TYR C CZ    1 
ATOM   7005  O  OH    . TYR C  2  435  ? 48.694  -33.880 89.852   1.00 22.53  ? 435  TYR C OH    1 
ATOM   7006  N  N     . GLY C  2  436  ? 52.229  -31.369 85.292   1.00 15.01  ? 436  GLY C N     1 
ATOM   7007  C  CA    . GLY C  2  436  ? 53.584  -31.802 85.585   1.00 16.65  ? 436  GLY C CA    1 
ATOM   7008  C  C     . GLY C  2  436  ? 54.637  -31.369 84.574   1.00 14.52  ? 436  GLY C C     1 
ATOM   7009  O  O     . GLY C  2  436  ? 55.815  -31.691 84.732   1.00 14.81  ? 436  GLY C O     1 
ATOM   7010  N  N     . ARG C  2  437  ? 54.221  -30.633 83.547   1.00 12.03  ? 437  ARG C N     1 
ATOM   7011  C  CA    . ARG C  2  437  ? 55.121  -30.250 82.461   1.00 12.36  ? 437  ARG C CA    1 
ATOM   7012  C  C     . ARG C  2  437  ? 55.281  -28.741 82.310   1.00 13.15  ? 437  ARG C C     1 
ATOM   7013  O  O     . ARG C  2  437  ? 56.378  -28.208 82.461   1.00 14.94  ? 437  ARG C O     1 
ATOM   7014  C  CB    . ARG C  2  437  ? 54.659  -30.876 81.145   1.00 13.10  ? 437  ARG C CB    1 
ATOM   7015  C  CG    . ARG C  2  437  ? 54.775  -32.383 81.148   1.00 12.56  ? 437  ARG C CG    1 
ATOM   7016  C  CD    . ARG C  2  437  ? 54.221  -33.025 79.895   1.00 11.23  ? 437  ARG C CD    1 
ATOM   7017  N  NE    . ARG C  2  437  ? 54.413  -34.471 79.946   1.00 14.12  ? 437  ARG C NE    1 
ATOM   7018  C  CZ    . ARG C  2  437  ? 53.609  -35.307 80.595   1.00 14.64  ? 437  ARG C CZ    1 
ATOM   7019  N  NH1   . ARG C  2  437  ? 52.549  -34.844 81.243   1.00 13.72  ? 437  ARG C NH1   1 
ATOM   7020  N  NH2   . ARG C  2  437  ? 53.864  -36.606 80.600   1.00 17.40  ? 437  ARG C NH2   1 
ATOM   7021  N  N     . ILE C  2  438  ? 54.188  -28.062 81.985   1.00 13.33  ? 438  ILE C N     1 
ATOM   7022  C  CA    . ILE C  2  438  ? 54.192  -26.611 81.863   1.00 12.03  ? 438  ILE C CA    1 
ATOM   7023  C  C     . ILE C  2  438  ? 53.291  -26.018 82.940   1.00 10.28  ? 438  ILE C C     1 
ATOM   7024  O  O     . ILE C  2  438  ? 52.223  -26.553 83.221   1.00 15.32  ? 438  ILE C O     1 
ATOM   7025  C  CB    . ILE C  2  438  ? 53.707  -26.173 80.470   1.00 14.04  ? 438  ILE C CB    1 
ATOM   7026  C  CG1   . ILE C  2  438  ? 54.618  -26.744 79.385   1.00 14.32  ? 438  ILE C CG1   1 
ATOM   7027  C  CG2   . ILE C  2  438  ? 53.673  -24.668 80.361   1.00 16.13  ? 438  ILE C CG2   1 
ATOM   7028  C  CD1   . ILE C  2  438  ? 54.276  -26.261 77.998   1.00 14.88  ? 438  ILE C CD1   1 
ATOM   7029  N  N     . CYS C  2  439  ? 53.719  -24.921 83.552   1.00 9.24   ? 439  CYS C N     1 
ATOM   7030  C  CA    . CYS C  2  439  ? 52.964  -24.343 84.659   1.00 9.79   ? 439  CYS C CA    1 
ATOM   7031  C  C     . CYS C  2  439  ? 51.691  -23.630 84.216   1.00 11.19  ? 439  CYS C C     1 
ATOM   7032  O  O     . CYS C  2  439  ? 51.747  -22.657 83.462   1.00 14.32  ? 439  CYS C O     1 
ATOM   7033  C  CB    . CYS C  2  439  ? 53.831  -23.386 85.465   1.00 9.59   ? 439  CYS C CB    1 
ATOM   7034  S  SG    . CYS C  2  439  ? 52.969  -22.710 86.881   1.00 8.99   ? 439  CYS C SG    1 
ATOM   7035  N  N     . PRO C  2  440  ? 50.536  -24.111 84.699   1.00 10.74  ? 440  PRO C N     1 
ATOM   7036  C  CA    . PRO C  2  440  ? 49.219  -23.564 84.365   1.00 9.99   ? 440  PRO C CA    1 
ATOM   7037  C  C     . PRO C  2  440  ? 49.011  -22.196 84.995   1.00 10.75  ? 440  PRO C C     1 
ATOM   7038  O  O     . PRO C  2  440  ? 48.127  -21.450 84.580   1.00 15.92  ? 440  PRO C O     1 
ATOM   7039  C  CB    . PRO C  2  440  ? 48.262  -24.575 84.989   1.00 8.94   ? 440  PRO C CB    1 
ATOM   7040  C  CG    . PRO C  2  440  ? 49.004  -25.102 86.155   1.00 11.59  ? 440  PRO C CG    1 
ATOM   7041  C  CD    . PRO C  2  440  ? 50.442  -25.176 85.713   1.00 12.95  ? 440  PRO C CD    1 
ATOM   7042  N  N     . VAL C  2  441  ? 49.822  -21.878 85.996   1.00 10.53  ? 441  VAL C N     1 
ATOM   7043  C  CA    . VAL C  2  441  ? 49.721  -20.603 86.695   1.00 9.94   ? 441  VAL C CA    1 
ATOM   7044  C  C     . VAL C  2  441  ? 50.482  -19.470 86.011   1.00 10.38  ? 441  VAL C C     1 
ATOM   7045  O  O     . VAL C  2  441  ? 49.886  -18.471 85.619   1.00 10.41  ? 441  VAL C O     1 
ATOM   7046  C  CB    . VAL C  2  441  ? 50.143  -20.708 88.170   1.00 8.08   ? 441  VAL C CB    1 
ATOM   7047  C  CG1   . VAL C  2  441  ? 50.296  -19.324 88.772   1.00 8.46   ? 441  VAL C CG1   1 
ATOM   7048  C  CG2   . VAL C  2  441  ? 49.121  -21.514 88.945   1.00 9.78   ? 441  VAL C CG2   1 
ATOM   7049  N  N     . GLU C  2  442  ? 51.794  -19.622 85.855   1.00 12.41  ? 442  GLU C N     1 
ATOM   7050  C  CA    . GLU C  2  442  ? 52.625  -18.469 85.538   1.00 13.93  ? 442  GLU C CA    1 
ATOM   7051  C  C     . GLU C  2  442  ? 52.716  -18.244 84.035   1.00 17.89  ? 442  GLU C C     1 
ATOM   7052  O  O     . GLU C  2  442  ? 53.377  -18.984 83.307   1.00 20.81  ? 442  GLU C O     1 
ATOM   7053  C  CB    . GLU C  2  442  ? 54.032  -18.679 86.104   1.00 12.86  ? 442  GLU C CB    1 
ATOM   7054  C  CG    . GLU C  2  442  ? 55.018  -17.586 85.732   1.00 19.83  ? 442  GLU C CG    1 
ATOM   7055  C  CD    . GLU C  2  442  ? 56.466  -18.035 85.842   1.00 20.52  ? 442  GLU C CD    1 
ATOM   7056  O  OE1   . GLU C  2  442  ? 56.887  -18.453 86.943   1.00 16.07  ? 442  GLU C OE1   1 
ATOM   7057  O  OE2   . GLU C  2  442  ? 57.183  -17.970 84.819   1.00 24.57  ? 442  GLU C OE2   1 
ATOM   7058  N  N     . THR C  2  443  ? 52.036  -17.189 83.600   1.00 16.85  ? 443  THR C N     1 
ATOM   7059  C  CA    . THR C  2  443  ? 52.024  -16.739 82.218   1.00 14.93  ? 443  THR C CA    1 
ATOM   7060  C  C     . THR C  2  443  ? 51.812  -15.231 82.270   1.00 15.92  ? 443  THR C C     1 
ATOM   7061  O  O     . THR C  2  443  ? 51.236  -14.729 83.230   1.00 18.83  ? 443  THR C O     1 
ATOM   7062  C  CB    . THR C  2  443  ? 50.903  -17.444 81.402   1.00 11.12  ? 443  THR C CB    1 
ATOM   7063  O  OG1   . THR C  2  443  ? 50.863  -16.922 80.070   1.00 13.58  ? 443  THR C OG1   1 
ATOM   7064  C  CG2   . THR C  2  443  ? 49.546  -17.253 82.052   1.00 11.25  ? 443  THR C CG2   1 
ATOM   7065  N  N     . PRO C  2  444  ? 52.299  -14.495 81.265   1.00 13.17  ? 444  PRO C N     1 
ATOM   7066  C  CA    . PRO C  2  444  ? 52.062  -13.048 81.289   1.00 14.09  ? 444  PRO C CA    1 
ATOM   7067  C  C     . PRO C  2  444  ? 50.591  -12.703 81.067   1.00 18.37  ? 444  PRO C C     1 
ATOM   7068  O  O     . PRO C  2  444  ? 49.903  -13.418 80.343   1.00 19.68  ? 444  PRO C O     1 
ATOM   7069  C  CB    . PRO C  2  444  ? 52.890  -12.543 80.107   1.00 20.71  ? 444  PRO C CB    1 
ATOM   7070  C  CG    . PRO C  2  444  ? 53.903  -13.614 79.858   1.00 19.99  ? 444  PRO C CG    1 
ATOM   7071  C  CD    . PRO C  2  444  ? 53.221  -14.889 80.190   1.00 13.94  ? 444  PRO C CD    1 
ATOM   7072  N  N     . GLU C  2  445  ? 50.116  -11.630 81.693   1.00 27.75  ? 445  GLU C N     1 
ATOM   7073  C  CA    . GLU C  2  445  ? 48.781  -11.108 81.408   1.00 23.04  ? 445  GLU C CA    1 
ATOM   7074  C  C     . GLU C  2  445  ? 48.829  -10.287 80.126   1.00 28.68  ? 445  GLU C C     1 
ATOM   7075  O  O     . GLU C  2  445  ? 49.874  -9.733  79.774   1.00 34.90  ? 445  GLU C O     1 
ATOM   7076  C  CB    . GLU C  2  445  ? 48.292  -10.208 82.541   1.00 27.03  ? 445  GLU C CB    1 
ATOM   7077  C  CG    . GLU C  2  445  ? 48.810  -10.569 83.914   1.00 34.71  ? 445  GLU C CG    1 
ATOM   7078  C  CD    . GLU C  2  445  ? 48.392  -9.567  84.976   1.00 59.76  ? 445  GLU C CD    1 
ATOM   7079  O  OE1   . GLU C  2  445  ? 47.358  -8.890  84.786   1.00 71.45  ? 445  GLU C OE1   1 
ATOM   7080  O  OE2   . GLU C  2  445  ? 49.102  -9.452  85.998   1.00 59.48  ? 445  GLU C OE2   1 
ATOM   7081  N  N     . GLY C  2  446  ? 47.698  -10.189 79.437   1.00 22.42  ? 446  GLY C N     1 
ATOM   7082  C  CA    . GLY C  2  446  ? 47.632  -9.377  78.236   1.00 27.77  ? 446  GLY C CA    1 
ATOM   7083  C  C     . GLY C  2  446  ? 47.922  -10.129 76.952   1.00 25.29  ? 446  GLY C C     1 
ATOM   7084  O  O     . GLY C  2  446  ? 47.692  -11.333 76.864   1.00 26.88  ? 446  GLY C O     1 
ATOM   7085  N  N     . ALA C  2  447  ? 48.431  -9.414  75.953   1.00 22.81  ? 447  ALA C N     1 
ATOM   7086  C  CA    . ALA C  2  447  ? 48.574  -9.956  74.603   1.00 20.74  ? 447  ALA C CA    1 
ATOM   7087  C  C     . ALA C  2  447  ? 49.447  -11.203 74.510   1.00 17.88  ? 447  ALA C C     1 
ATOM   7088  O  O     . ALA C  2  447  ? 49.344  -11.964 73.552   1.00 22.23  ? 447  ALA C O     1 
ATOM   7089  C  CB    . ALA C  2  447  ? 49.087  -8.883  73.654   1.00 23.88  ? 447  ALA C CB    1 
ATOM   7090  N  N     . ASN C  2  448  ? 50.307  -11.410 75.497   1.00 15.02  ? 448  ASN C N     1 
ATOM   7091  C  CA    . ASN C  2  448  ? 51.213  -12.551 75.469   1.00 16.67  ? 448  ASN C CA    1 
ATOM   7092  C  C     . ASN C  2  448  ? 50.704  -13.780 76.215   1.00 17.64  ? 448  ASN C C     1 
ATOM   7093  O  O     . ASN C  2  448  ? 51.426  -14.769 76.350   1.00 16.60  ? 448  ASN C O     1 
ATOM   7094  C  CB    . ASN C  2  448  ? 52.595  -12.153 75.985   1.00 17.50  ? 448  ASN C CB    1 
ATOM   7095  C  CG    . ASN C  2  448  ? 53.442  -11.499 74.919   1.00 19.49  ? 448  ASN C CG    1 
ATOM   7096  O  OD1   . ASN C  2  448  ? 53.405  -11.891 73.752   1.00 17.20  ? 448  ASN C OD1   1 
ATOM   7097  N  ND2   . ASN C  2  448  ? 54.211  -10.493 75.314   1.00 26.58  ? 448  ASN C ND2   1 
ATOM   7098  N  N     . ILE C  2  449  ? 49.470  -13.715 76.706   1.00 19.44  ? 449  ILE C N     1 
ATOM   7099  C  CA    . ILE C  2  449  ? 48.934  -14.780 77.552   1.00 16.80  ? 449  ILE C CA    1 
ATOM   7100  C  C     . ILE C  2  449  ? 48.887  -16.142 76.856   1.00 14.69  ? 449  ILE C C     1 
ATOM   7101  O  O     . ILE C  2  449  ? 48.363  -16.279 75.749   1.00 15.78  ? 449  ILE C O     1 
ATOM   7102  C  CB    . ILE C  2  449  ? 47.548  -14.413 78.145   1.00 14.24  ? 449  ILE C CB    1 
ATOM   7103  C  CG1   . ILE C  2  449  ? 47.121  -15.445 79.186   1.00 9.63   ? 449  ILE C CG1   1 
ATOM   7104  C  CG2   . ILE C  2  449  ? 46.496  -14.267 77.052   1.00 14.07  ? 449  ILE C CG2   1 
ATOM   7105  C  CD1   . ILE C  2  449  ? 45.777  -15.158 79.792   1.00 10.27  ? 449  ILE C CD1   1 
ATOM   7106  N  N     . GLY C  2  450  ? 49.475  -17.138 77.510   1.00 13.47  ? 450  GLY C N     1 
ATOM   7107  C  CA    . GLY C  2  450  ? 49.484  -18.499 77.007   1.00 16.65  ? 450  GLY C CA    1 
ATOM   7108  C  C     . GLY C  2  450  ? 50.582  -18.786 75.998   1.00 19.17  ? 450  GLY C C     1 
ATOM   7109  O  O     . GLY C  2  450  ? 50.917  -19.945 75.757   1.00 23.22  ? 450  GLY C O     1 
ATOM   7110  N  N     . LEU C  2  451  ? 51.136  -17.736 75.400   1.00 20.73  ? 451  LEU C N     1 
ATOM   7111  C  CA    . LEU C  2  451  ? 52.225  -17.880 74.436   1.00 16.68  ? 451  LEU C CA    1 
ATOM   7112  C  C     . LEU C  2  451  ? 53.572  -18.027 75.128   1.00 16.81  ? 451  LEU C C     1 
ATOM   7113  O  O     . LEU C  2  451  ? 54.429  -18.790 74.685   1.00 17.65  ? 451  LEU C O     1 
ATOM   7114  C  CB    . LEU C  2  451  ? 52.251  -16.697 73.470   1.00 15.90  ? 451  LEU C CB    1 
ATOM   7115  C  CG    . LEU C  2  451  ? 50.961  -16.496 72.678   1.00 14.19  ? 451  LEU C CG    1 
ATOM   7116  C  CD1   . LEU C  2  451  ? 51.140  -15.390 71.661   1.00 19.75  ? 451  LEU C CD1   1 
ATOM   7117  C  CD2   . LEU C  2  451  ? 50.532  -17.791 72.007   1.00 13.38  ? 451  LEU C CD2   1 
ATOM   7118  N  N     . ILE C  2  452  ? 53.755  -17.272 76.208   1.00 19.05  ? 452  ILE C N     1 
ATOM   7119  C  CA    . ILE C  2  452  ? 54.950  -17.373 77.035   1.00 16.50  ? 452  ILE C CA    1 
ATOM   7120  C  C     . ILE C  2  452  ? 54.599  -18.136 78.296   1.00 14.68  ? 452  ILE C C     1 
ATOM   7121  O  O     . ILE C  2  452  ? 53.687  -17.750 79.019   1.00 20.32  ? 452  ILE C O     1 
ATOM   7122  C  CB    . ILE C  2  452  ? 55.466  -15.988 77.453   1.00 14.44  ? 452  ILE C CB    1 
ATOM   7123  C  CG1   . ILE C  2  452  ? 55.609  -15.076 76.234   1.00 13.95  ? 452  ILE C CG1   1 
ATOM   7124  C  CG2   . ILE C  2  452  ? 56.781  -16.117 78.197   1.00 14.99  ? 452  ILE C CG2   1 
ATOM   7125  C  CD1   . ILE C  2  452  ? 56.539  -15.614 75.179   1.00 16.88  ? 452  ILE C CD1   1 
ATOM   7126  N  N     . THR C  2  453  ? 55.313  -19.222 78.564   1.00 13.45  ? 453  THR C N     1 
ATOM   7127  C  CA    . THR C  2  453  ? 55.028  -20.034 79.743   1.00 19.10  ? 453  THR C CA    1 
ATOM   7128  C  C     . THR C  2  453  ? 56.297  -20.406 80.493   1.00 16.36  ? 453  THR C C     1 
ATOM   7129  O  O     . THR C  2  453  ? 57.387  -19.960 80.145   1.00 18.55  ? 453  THR C O     1 
ATOM   7130  C  CB    . THR C  2  453  ? 54.276  -21.315 79.373   1.00 23.90  ? 453  THR C CB    1 
ATOM   7131  O  OG1   . THR C  2  453  ? 54.928  -21.944 78.262   1.00 25.17  ? 453  THR C OG1   1 
ATOM   7132  C  CG2   . THR C  2  453  ? 52.829  -21.001 79.004   1.00 22.99  ? 453  THR C CG2   1 
ATOM   7133  N  N     . SER C  2  454  ? 56.157  -21.217 81.533   1.00 11.90  ? 454  SER C N     1 
ATOM   7134  C  CA    . SER C  2  454  ? 57.326  -21.633 82.292   1.00 15.00  ? 454  SER C CA    1 
ATOM   7135  C  C     . SER C  2  454  ? 57.333  -23.135 82.558   1.00 15.21  ? 454  SER C C     1 
ATOM   7136  O  O     . SER C  2  454  ? 56.294  -23.742 82.817   1.00 16.13  ? 454  SER C O     1 
ATOM   7137  C  CB    . SER C  2  454  ? 57.437  -20.848 83.600   1.00 17.22  ? 454  SER C CB    1 
ATOM   7138  O  OG    . SER C  2  454  ? 58.795  -20.685 83.983   1.00 17.10  ? 454  SER C OG    1 
ATOM   7139  N  N     . LEU C  2  455  ? 58.522  -23.722 82.482   1.00 13.05  ? 455  LEU C N     1 
ATOM   7140  C  CA    . LEU C  2  455  ? 58.709  -25.144 82.706   1.00 9.66   ? 455  LEU C CA    1 
ATOM   7141  C  C     . LEU C  2  455  ? 58.365  -25.491 84.145   1.00 9.07   ? 455  LEU C C     1 
ATOM   7142  O  O     . LEU C  2  455  ? 58.667  -24.726 85.059   1.00 10.79  ? 455  LEU C O     1 
ATOM   7143  C  CB    . LEU C  2  455  ? 60.163  -25.509 82.428   1.00 11.04  ? 455  LEU C CB    1 
ATOM   7144  C  CG    . LEU C  2  455  ? 60.518  -26.986 82.310   1.00 12.04  ? 455  LEU C CG    1 
ATOM   7145  C  CD1   . LEU C  2  455  ? 59.853  -27.589 81.084   1.00 14.75  ? 455  LEU C CD1   1 
ATOM   7146  C  CD2   . LEU C  2  455  ? 62.026  -27.153 82.246   1.00 13.14  ? 455  LEU C CD2   1 
ATOM   7147  N  N     . ALA C  2  456  ? 57.734  -26.643 84.344   1.00 8.61   ? 456  ALA C N     1 
ATOM   7148  C  CA    . ALA C  2  456  ? 57.384  -27.103 85.686   1.00 10.51  ? 456  ALA C CA    1 
ATOM   7149  C  C     . ALA C  2  456  ? 58.623  -27.518 86.482   1.00 11.45  ? 456  ALA C C     1 
ATOM   7150  O  O     . ALA C  2  456  ? 59.674  -27.805 85.910   1.00 13.22  ? 456  ALA C O     1 
ATOM   7151  C  CB    . ALA C  2  456  ? 56.382  -28.243 85.618   1.00 12.29  ? 456  ALA C CB    1 
ATOM   7152  N  N     . ALA C  2  457  ? 58.484  -27.550 87.803   1.00 8.63   ? 457  ALA C N     1 
ATOM   7153  C  CA    . ALA C  2  457  ? 59.613  -27.762 88.702   1.00 8.86   ? 457  ALA C CA    1 
ATOM   7154  C  C     . ALA C  2  457  ? 60.363  -29.079 88.482   1.00 13.62  ? 457  ALA C C     1 
ATOM   7155  O  O     . ALA C  2  457  ? 61.570  -29.072 88.242   1.00 14.61  ? 457  ALA C O     1 
ATOM   7156  C  CB    . ALA C  2  457  ? 59.155  -27.646 90.143   1.00 11.36  ? 457  ALA C CB    1 
ATOM   7157  N  N     . TYR C  2  458  ? 59.652  -30.201 88.566   1.00 16.26  ? 458  TYR C N     1 
ATOM   7158  C  CA    . TYR C  2  458  ? 60.279  -31.516 88.425   1.00 14.82  ? 458  TYR C CA    1 
ATOM   7159  C  C     . TYR C  2  458  ? 60.463  -31.927 86.966   1.00 16.26  ? 458  TYR C C     1 
ATOM   7160  O  O     . TYR C  2  458  ? 61.109  -32.935 86.678   1.00 17.74  ? 458  TYR C O     1 
ATOM   7161  C  CB    . TYR C  2  458  ? 59.466  -32.595 89.151   1.00 15.23  ? 458  TYR C CB    1 
ATOM   7162  C  CG    . TYR C  2  458  ? 59.721  -32.687 90.639   1.00 17.49  ? 458  TYR C CG    1 
ATOM   7163  C  CD1   . TYR C  2  458  ? 60.918  -33.193 91.131   1.00 19.94  ? 458  TYR C CD1   1 
ATOM   7164  C  CD2   . TYR C  2  458  ? 58.758  -32.281 91.555   1.00 18.35  ? 458  TYR C CD2   1 
ATOM   7165  C  CE1   . TYR C  2  458  ? 61.151  -33.281 92.493   1.00 20.09  ? 458  TYR C CE1   1 
ATOM   7166  C  CE2   . TYR C  2  458  ? 58.979  -32.368 92.917   1.00 17.66  ? 458  TYR C CE2   1 
ATOM   7167  C  CZ    . TYR C  2  458  ? 60.177  -32.867 93.380   1.00 20.61  ? 458  TYR C CZ    1 
ATOM   7168  O  OH    . TYR C  2  458  ? 60.398  -32.951 94.735   1.00 25.89  ? 458  TYR C OH    1 
ATOM   7169  N  N     . ALA C  2  459  ? 59.892  -31.145 86.053   1.00 14.94  ? 459  ALA C N     1 
ATOM   7170  C  CA    . ALA C  2  459  ? 59.872  -31.496 84.633   1.00 14.78  ? 459  ALA C CA    1 
ATOM   7171  C  C     . ALA C  2  459  ? 61.250  -31.534 83.967   1.00 14.70  ? 459  ALA C C     1 
ATOM   7172  O  O     . ALA C  2  459  ? 62.175  -30.823 84.366   1.00 12.34  ? 459  ALA C O     1 
ATOM   7173  C  CB    . ALA C  2  459  ? 58.941  -30.563 83.870   1.00 13.55  ? 459  ALA C CB    1 
ATOM   7174  N  N     . ARG C  2  460  ? 61.367  -32.373 82.943   1.00 13.96  ? 460  ARG C N     1 
ATOM   7175  C  CA    . ARG C  2  460  ? 62.602  -32.497 82.183   1.00 13.45  ? 460  ARG C CA    1 
ATOM   7176  C  C     . ARG C  2  460  ? 62.322  -32.576 80.690   1.00 14.90  ? 460  ARG C C     1 
ATOM   7177  O  O     . ARG C  2  460  ? 61.314  -33.143 80.267   1.00 14.35  ? 460  ARG C O     1 
ATOM   7178  C  CB    . ARG C  2  460  ? 63.380  -33.736 82.619   1.00 14.76  ? 460  ARG C CB    1 
ATOM   7179  C  CG    . ARG C  2  460  ? 64.033  -33.616 83.979   1.00 19.22  ? 460  ARG C CG    1 
ATOM   7180  C  CD    . ARG C  2  460  ? 65.031  -34.738 84.187   1.00 25.14  ? 460  ARG C CD    1 
ATOM   7181  N  NE    . ARG C  2  460  ? 65.739  -34.618 85.456   1.00 35.55  ? 460  ARG C NE    1 
ATOM   7182  C  CZ    . ARG C  2  460  ? 66.700  -35.447 85.850   1.00 49.62  ? 460  ARG C CZ    1 
ATOM   7183  N  NH1   . ARG C  2  460  ? 67.066  -36.455 85.069   1.00 52.58  ? 460  ARG C NH1   1 
ATOM   7184  N  NH2   . ARG C  2  460  ? 67.296  -35.269 87.024   1.00 52.33  ? 460  ARG C NH2   1 
ATOM   7185  N  N     . VAL C  2  461  ? 63.220  -32.003 79.897   1.00 15.56  ? 461  VAL C N     1 
ATOM   7186  C  CA    . VAL C  2  461  ? 63.126  -32.093 78.450   1.00 16.43  ? 461  VAL C CA    1 
ATOM   7187  C  C     . VAL C  2  461  ? 64.107  -33.149 77.969   1.00 20.37  ? 461  VAL C C     1 
ATOM   7188  O  O     . VAL C  2  461  ? 65.313  -33.014 78.168   1.00 22.21  ? 461  VAL C O     1 
ATOM   7189  C  CB    . VAL C  2  461  ? 63.471  -30.759 77.780   1.00 18.91  ? 461  VAL C CB    1 
ATOM   7190  C  CG1   . VAL C  2  461  ? 63.088  -30.799 76.310   1.00 18.31  ? 461  VAL C CG1   1 
ATOM   7191  C  CG2   . VAL C  2  461  ? 62.761  -29.615 78.485   1.00 19.21  ? 461  VAL C CG2   1 
ATOM   7192  N  N     . ASP C  2  462  ? 63.590  -34.199 77.337   1.00 21.90  ? 462  ASP C N     1 
ATOM   7193  C  CA    . ASP C  2  462  ? 64.423  -35.329 76.928   1.00 24.06  ? 462  ASP C CA    1 
ATOM   7194  C  C     . ASP C  2  462  ? 65.235  -35.069 75.658   1.00 27.93  ? 462  ASP C C     1 
ATOM   7195  O  O     . ASP C  2  462  ? 65.274  -33.950 75.146   1.00 31.41  ? 462  ASP C O     1 
ATOM   7196  C  CB    . ASP C  2  462  ? 63.591  -36.611 76.791   1.00 23.20  ? 462  ASP C CB    1 
ATOM   7197  C  CG    . ASP C  2  462  ? 62.500  -36.507 75.732   1.00 30.57  ? 462  ASP C CG    1 
ATOM   7198  O  OD1   . ASP C  2  462  ? 62.680  -35.780 74.730   1.00 29.26  ? 462  ASP C OD1   1 
ATOM   7199  O  OD2   . ASP C  2  462  ? 61.454  -37.172 75.899   1.00 35.64  ? 462  ASP C OD2   1 
ATOM   7200  N  N     . GLU C  2  463  ? 65.877  -36.118 75.155   1.00 27.03  ? 463  GLU C N     1 
ATOM   7201  C  CA    . GLU C  2  463  ? 66.740  -36.003 73.988   1.00 30.33  ? 463  GLU C CA    1 
ATOM   7202  C  C     . GLU C  2  463  ? 65.938  -35.696 72.730   1.00 23.11  ? 463  GLU C C     1 
ATOM   7203  O  O     . GLU C  2  463  ? 66.466  -35.155 71.762   1.00 26.10  ? 463  GLU C O     1 
ATOM   7204  C  CB    . GLU C  2  463  ? 67.551  -37.287 73.799   1.00 45.14  ? 463  GLU C CB    1 
ATOM   7205  C  CG    . GLU C  2  463  ? 68.299  -37.733 75.051   1.00 58.38  ? 463  GLU C CG    1 
ATOM   7206  C  CD    . GLU C  2  463  ? 69.221  -38.913 74.800   1.00 68.63  ? 463  GLU C CD    1 
ATOM   7207  O  OE1   . GLU C  2  463  ? 69.585  -39.604 75.777   1.00 66.75  ? 463  GLU C OE1   1 
ATOM   7208  O  OE2   . GLU C  2  463  ? 69.586  -39.147 73.627   1.00 67.60  ? 463  GLU C OE2   1 
ATOM   7209  N  N     . LEU C  2  464  ? 64.658  -36.043 72.750   1.00 21.14  ? 464  LEU C N     1 
ATOM   7210  C  CA    . LEU C  2  464  ? 63.800  -35.828 71.592   1.00 28.18  ? 464  LEU C CA    1 
ATOM   7211  C  C     . LEU C  2  464  ? 63.107  -34.463 71.611   1.00 24.65  ? 464  LEU C C     1 
ATOM   7212  O  O     . LEU C  2  464  ? 62.512  -34.044 70.616   1.00 17.93  ? 464  LEU C O     1 
ATOM   7213  C  CB    . LEU C  2  464  ? 62.772  -36.955 71.488   1.00 27.57  ? 464  LEU C CB    1 
ATOM   7214  C  CG    . LEU C  2  464  ? 62.892  -37.846 70.254   1.00 22.21  ? 464  LEU C CG    1 
ATOM   7215  C  CD1   . LEU C  2  464  ? 64.338  -38.253 70.028   1.00 23.33  ? 464  LEU C CD1   1 
ATOM   7216  C  CD2   . LEU C  2  464  ? 61.994  -39.065 70.395   1.00 24.10  ? 464  LEU C CD2   1 
ATOM   7217  N  N     . GLY C  2  465  ? 63.187  -33.775 72.745   1.00 25.54  ? 465  GLY C N     1 
ATOM   7218  C  CA    . GLY C  2  465  ? 62.615  -32.447 72.870   1.00 21.03  ? 465  GLY C CA    1 
ATOM   7219  C  C     . GLY C  2  465  ? 61.270  -32.383 73.571   1.00 15.31  ? 465  GLY C C     1 
ATOM   7220  O  O     . GLY C  2  465  ? 60.736  -31.299 73.792   1.00 16.96  ? 465  GLY C O     1 
ATOM   7221  N  N     . PHE C  2  466  ? 60.710  -33.539 73.906   1.00 14.90  ? 466  PHE C N     1 
ATOM   7222  C  CA    . PHE C  2  466  ? 59.446  -33.588 74.634   1.00 16.54  ? 466  PHE C CA    1 
ATOM   7223  C  C     . PHE C  2  466  ? 59.665  -33.392 76.137   1.00 19.28  ? 466  PHE C C     1 
ATOM   7224  O  O     . PHE C  2  466  ? 60.717  -33.748 76.667   1.00 20.05  ? 466  PHE C O     1 
ATOM   7225  C  CB    . PHE C  2  466  ? 58.721  -34.906 74.353   1.00 16.10  ? 466  PHE C CB    1 
ATOM   7226  C  CG    . PHE C  2  466  ? 58.589  -35.218 72.890   1.00 16.21  ? 466  PHE C CG    1 
ATOM   7227  C  CD1   . PHE C  2  466  ? 57.580  -34.652 72.134   1.00 15.64  ? 466  PHE C CD1   1 
ATOM   7228  C  CD2   . PHE C  2  466  ? 59.482  -36.072 72.268   1.00 23.40  ? 466  PHE C CD2   1 
ATOM   7229  C  CE1   . PHE C  2  466  ? 57.464  -34.934 70.785   1.00 19.41  ? 466  PHE C CE1   1 
ATOM   7230  C  CE2   . PHE C  2  466  ? 59.368  -36.359 70.917   1.00 23.07  ? 466  PHE C CE2   1 
ATOM   7231  C  CZ    . PHE C  2  466  ? 58.358  -35.790 70.177   1.00 19.78  ? 466  PHE C CZ    1 
ATOM   7232  N  N     . ILE C  2  467  ? 58.682  -32.806 76.816   1.00 18.01  ? 467  ILE C N     1 
ATOM   7233  C  CA    . ILE C  2  467  ? 58.787  -32.573 78.256   1.00 15.58  ? 467  ILE C CA    1 
ATOM   7234  C  C     . ILE C  2  467  ? 58.270  -33.772 79.043   1.00 15.34  ? 467  ILE C C     1 
ATOM   7235  O  O     . ILE C  2  467  ? 57.161  -34.252 78.802   1.00 15.25  ? 467  ILE C O     1 
ATOM   7236  C  CB    . ILE C  2  467  ? 58.012  -31.311 78.694   1.00 16.13  ? 467  ILE C CB    1 
ATOM   7237  C  CG1   . ILE C  2  467  ? 58.477  -30.093 77.901   1.00 14.94  ? 467  ILE C CG1   1 
ATOM   7238  C  CG2   . ILE C  2  467  ? 58.187  -31.059 80.185   1.00 13.71  ? 467  ILE C CG2   1 
ATOM   7239  C  CD1   . ILE C  2  467  ? 57.774  -28.814 78.292   1.00 16.97  ? 467  ILE C CD1   1 
ATOM   7240  N  N     . ARG C  2  468  ? 59.076  -34.253 79.985   1.00 14.38  ? 468  ARG C N     1 
ATOM   7241  C  CA    . ARG C  2  468  ? 58.692  -35.402 80.792   1.00 12.60  ? 468  ARG C CA    1 
ATOM   7242  C  C     . ARG C  2  468  ? 58.519  -35.038 82.261   1.00 14.34  ? 468  ARG C C     1 
ATOM   7243  O  O     . ARG C  2  468  ? 59.186  -34.141 82.776   1.00 14.89  ? 468  ARG C O     1 
ATOM   7244  C  CB    . ARG C  2  468  ? 59.721  -36.521 80.655   1.00 12.07  ? 468  ARG C CB    1 
ATOM   7245  C  CG    . ARG C  2  468  ? 60.035  -36.891 79.223   1.00 18.35  ? 468  ARG C CG    1 
ATOM   7246  C  CD    . ARG C  2  468  ? 61.187  -37.881 79.155   1.00 26.17  ? 468  ARG C CD    1 
ATOM   7247  N  NE    . ARG C  2  468  ? 60.729  -39.265 79.206   1.00 23.75  ? 468  ARG C NE    1 
ATOM   7248  C  CZ    . ARG C  2  468  ? 60.991  -40.170 78.269   1.00 24.19  ? 468  ARG C CZ    1 
ATOM   7249  N  NH1   . ARG C  2  468  ? 61.719  -39.840 77.209   1.00 17.42  ? 468  ARG C NH1   1 
ATOM   7250  N  NH2   . ARG C  2  468  ? 60.530  -41.407 78.397   1.00 33.72  ? 468  ARG C NH2   1 
ATOM   7251  N  N     . THR C  2  469  ? 57.620  -35.749 82.930   1.00 14.40  ? 469  THR C N     1 
ATOM   7252  C  CA    . THR C  2  469  ? 57.355  -35.528 84.344   1.00 14.77  ? 469  THR C CA    1 
ATOM   7253  C  C     . THR C  2  469  ? 57.571  -36.827 85.112   1.00 14.83  ? 469  THR C C     1 
ATOM   7254  O  O     . THR C  2  469  ? 57.251  -37.903 84.613   1.00 17.55  ? 469  THR C O     1 
ATOM   7255  C  CB    . THR C  2  469  ? 55.911  -35.019 84.564   1.00 17.80  ? 469  THR C CB    1 
ATOM   7256  O  OG1   . THR C  2  469  ? 55.586  -35.058 85.959   1.00 19.22  ? 469  THR C OG1   1 
ATOM   7257  C  CG2   . THR C  2  469  ? 54.914  -35.876 83.796   1.00 17.45  ? 469  THR C CG2   1 
ATOM   7258  N  N     . PRO C  2  470  ? 58.125  -36.734 86.328   1.00 14.31  ? 470  PRO C N     1 
ATOM   7259  C  CA    . PRO C  2  470  ? 58.398  -37.947 87.104   1.00 15.50  ? 470  PRO C CA    1 
ATOM   7260  C  C     . PRO C  2  470  ? 57.140  -38.559 87.722   1.00 15.17  ? 470  PRO C C     1 
ATOM   7261  O  O     . PRO C  2  470  ? 56.215  -37.841 88.091   1.00 17.37  ? 470  PRO C O     1 
ATOM   7262  C  CB    . PRO C  2  470  ? 59.339  -37.445 88.199   1.00 15.88  ? 470  PRO C CB    1 
ATOM   7263  C  CG    . PRO C  2  470  ? 58.951  -36.029 88.394   1.00 16.18  ? 470  PRO C CG    1 
ATOM   7264  C  CD    . PRO C  2  470  ? 58.561  -35.517 87.036   1.00 18.19  ? 470  PRO C CD    1 
ATOM   7265  N  N     . TYR C  2  471  ? 57.114  -39.884 87.817   1.00 18.87  ? 471  TYR C N     1 
ATOM   7266  C  CA    . TYR C  2  471  ? 56.051  -40.587 88.525   1.00 19.27  ? 471  TYR C CA    1 
ATOM   7267  C  C     . TYR C  2  471  ? 56.627  -41.756 89.312   1.00 23.31  ? 471  TYR C C     1 
ATOM   7268  O  O     . TYR C  2  471  ? 57.726  -42.221 89.036   1.00 24.74  ? 471  TYR C O     1 
ATOM   7269  C  CB    . TYR C  2  471  ? 54.983  -41.094 87.555   1.00 18.94  ? 471  TYR C CB    1 
ATOM   7270  C  CG    . TYR C  2  471  ? 54.098  -40.010 86.994   1.00 20.34  ? 471  TYR C CG    1 
ATOM   7271  C  CD1   . TYR C  2  471  ? 53.260  -39.274 87.822   1.00 20.58  ? 471  TYR C CD1   1 
ATOM   7272  C  CD2   . TYR C  2  471  ? 54.092  -39.728 85.634   1.00 19.29  ? 471  TYR C CD2   1 
ATOM   7273  C  CE1   . TYR C  2  471  ? 52.446  -38.280 87.314   1.00 21.29  ? 471  TYR C CE1   1 
ATOM   7274  C  CE2   . TYR C  2  471  ? 53.279  -38.738 85.115   1.00 22.22  ? 471  TYR C CE2   1 
ATOM   7275  C  CZ    . TYR C  2  471  ? 52.459  -38.015 85.959   1.00 25.98  ? 471  TYR C CZ    1 
ATOM   7276  O  OH    . TYR C  2  471  ? 51.648  -37.027 85.446   1.00 24.46  ? 471  TYR C OH    1 
ATOM   7277  N  N     . ARG C  2  472  ? 55.879  -42.229 90.299   1.00 25.08  ? 472  ARG C N     1 
ATOM   7278  C  CA    . ARG C  2  472  ? 56.310  -43.367 91.091   1.00 26.91  ? 472  ARG C CA    1 
ATOM   7279  C  C     . ARG C  2  472  ? 55.567  -44.622 90.674   1.00 32.42  ? 472  ARG C C     1 
ATOM   7280  O  O     . ARG C  2  472  ? 54.368  -44.580 90.410   1.00 29.36  ? 472  ARG C O     1 
ATOM   7281  C  CB    . ARG C  2  472  ? 56.089  -43.104 92.575   1.00 26.33  ? 472  ARG C CB    1 
ATOM   7282  C  CG    . ARG C  2  472  ? 57.197  -42.308 93.216   1.00 32.96  ? 472  ARG C CG    1 
ATOM   7283  C  CD    . ARG C  2  472  ? 57.187  -42.508 94.713   1.00 41.38  ? 472  ARG C CD    1 
ATOM   7284  N  NE    . ARG C  2  472  ? 56.080  -41.807 95.353   1.00 44.16  ? 472  ARG C NE    1 
ATOM   7285  C  CZ    . ARG C  2  472  ? 55.804  -41.882 96.649   1.00 46.48  ? 472  ARG C CZ    1 
ATOM   7286  N  NH1   . ARG C  2  472  ? 56.551  -42.637 97.444   1.00 43.66  ? 472  ARG C NH1   1 
ATOM   7287  N  NH2   . ARG C  2  472  ? 54.777  -41.207 97.149   1.00 49.96  ? 472  ARG C NH2   1 
ATOM   7288  N  N     . ARG C  2  473  ? 56.290  -45.735 90.613   1.00 35.12  ? 473  ARG C N     1 
ATOM   7289  C  CA    . ARG C  2  473  ? 55.692  -47.010 90.247   1.00 33.36  ? 473  ARG C CA    1 
ATOM   7290  C  C     . ARG C  2  473  ? 54.905  -47.572 91.417   1.00 32.82  ? 473  ARG C C     1 
ATOM   7291  O  O     . ARG C  2  473  ? 55.410  -47.652 92.538   1.00 32.57  ? 473  ARG C O     1 
ATOM   7292  C  CB    . ARG C  2  473  ? 56.770  -48.008 89.824   1.00 35.65  ? 473  ARG C CB    1 
ATOM   7293  C  CG    . ARG C  2  473  ? 56.239  -49.401 89.521   1.00 39.47  ? 473  ARG C CG    1 
ATOM   7294  C  CD    . ARG C  2  473  ? 56.079  -49.622 88.029   1.00 34.65  ? 473  ARG C CD    1 
ATOM   7295  N  NE    . ARG C  2  473  ? 57.360  -49.514 87.338   1.00 31.20  ? 473  ARG C NE    1 
ATOM   7296  C  CZ    . ARG C  2  473  ? 57.508  -49.597 86.020   1.00 38.03  ? 473  ARG C CZ    1 
ATOM   7297  N  NH1   . ARG C  2  473  ? 56.449  -49.791 85.243   1.00 35.34  ? 473  ARG C NH1   1 
ATOM   7298  N  NH2   . ARG C  2  473  ? 58.715  -49.485 85.479   1.00 39.85  ? 473  ARG C NH2   1 
ATOM   7299  N  N     . VAL C  2  474  ? 53.661  -47.953 91.155   1.00 31.87  ? 474  VAL C N     1 
ATOM   7300  C  CA    . VAL C  2  474  ? 52.834  -48.585 92.171   1.00 35.82  ? 474  VAL C CA    1 
ATOM   7301  C  C     . VAL C  2  474  ? 52.518  -50.005 91.725   1.00 47.48  ? 474  VAL C C     1 
ATOM   7302  O  O     . VAL C  2  474  ? 51.910  -50.210 90.673   1.00 49.66  ? 474  VAL C O     1 
ATOM   7303  C  CB    . VAL C  2  474  ? 51.518  -47.817 92.398   1.00 33.64  ? 474  VAL C CB    1 
ATOM   7304  C  CG1   . VAL C  2  474  ? 50.778  -48.381 93.600   1.00 35.90  ? 474  VAL C CG1   1 
ATOM   7305  C  CG2   . VAL C  2  474  ? 51.792  -46.340 92.599   1.00 37.60  ? 474  VAL C CG2   1 
ATOM   7306  N  N     . VAL C  2  475  ? 52.947  -50.986 92.515   1.00 47.33  ? 475  VAL C N     1 
ATOM   7307  C  CA    . VAL C  2  475  ? 52.673  -52.382 92.193   1.00 47.20  ? 475  VAL C CA    1 
ATOM   7308  C  C     . VAL C  2  475  ? 51.860  -53.057 93.293   1.00 39.53  ? 475  VAL C C     1 
ATOM   7309  O  O     . VAL C  2  475  ? 52.353  -53.265 94.403   1.00 37.80  ? 475  VAL C O     1 
ATOM   7310  C  CB    . VAL C  2  475  ? 53.969  -53.179 91.943   1.00 44.79  ? 475  VAL C CB    1 
ATOM   7311  C  CG1   . VAL C  2  475  ? 53.653  -54.651 91.733   1.00 52.10  ? 475  VAL C CG1   1 
ATOM   7312  C  CG2   . VAL C  2  475  ? 54.713  -52.617 90.741   1.00 37.35  ? 475  VAL C CG2   1 
ATOM   7313  N  N     . GLY C  2  476  ? 50.615  -53.397 92.969   1.00 31.12  ? 476  GLY C N     1 
ATOM   7314  C  CA    . GLY C  2  476  ? 49.732  -54.084 93.892   1.00 31.61  ? 476  GLY C CA    1 
ATOM   7315  C  C     . GLY C  2  476  ? 49.498  -53.343 95.193   1.00 38.71  ? 476  GLY C C     1 
ATOM   7316  O  O     . GLY C  2  476  ? 49.606  -53.924 96.273   1.00 44.15  ? 476  GLY C O     1 
ATOM   7317  N  N     . GLY C  2  477  ? 49.182  -52.057 95.092   1.00 38.66  ? 477  GLY C N     1 
ATOM   7318  C  CA    . GLY C  2  477  ? 48.892  -51.252 96.265   1.00 38.95  ? 477  GLY C CA    1 
ATOM   7319  C  C     . GLY C  2  477  ? 50.109  -50.916 97.108   1.00 38.98  ? 477  GLY C C     1 
ATOM   7320  O  O     . GLY C  2  477  ? 49.976  -50.516 98.264   1.00 42.10  ? 477  GLY C O     1 
ATOM   7321  N  N     . VAL C  2  478  ? 51.297  -51.082 96.536   1.00 37.69  ? 478  VAL C N     1 
ATOM   7322  C  CA    . VAL C  2  478  ? 52.534  -50.717 97.218   1.00 36.38  ? 478  VAL C CA    1 
ATOM   7323  C  C     . VAL C  2  478  ? 53.291  -49.693 96.386   1.00 39.69  ? 478  VAL C C     1 
ATOM   7324  O  O     . VAL C  2  478  ? 53.533  -49.906 95.198   1.00 39.10  ? 478  VAL C O     1 
ATOM   7325  C  CB    . VAL C  2  478  ? 53.446  -51.935 97.444   1.00 38.91  ? 478  VAL C CB    1 
ATOM   7326  C  CG1   . VAL C  2  478  ? 54.704  -51.519 98.188   1.00 36.36  ? 478  VAL C CG1   1 
ATOM   7327  C  CG2   . VAL C  2  478  ? 52.708  -53.021 98.206   1.00 42.43  ? 478  VAL C CG2   1 
ATOM   7328  N  N     . VAL C  2  479  ? 53.670  -48.584 97.011   1.00 37.94  ? 479  VAL C N     1 
ATOM   7329  C  CA    . VAL C  2  479  ? 54.332  -47.510 96.284   1.00 35.61  ? 479  VAL C CA    1 
ATOM   7330  C  C     . VAL C  2  479  ? 55.849  -47.634 96.365   1.00 32.45  ? 479  VAL C C     1 
ATOM   7331  O  O     . VAL C  2  479  ? 56.450  -47.423 97.416   1.00 37.86  ? 479  VAL C O     1 
ATOM   7332  C  CB    . VAL C  2  479  ? 53.907  -46.128 96.811   1.00 34.55  ? 479  VAL C CB    1 
ATOM   7333  C  CG1   . VAL C  2  479  ? 54.511  -45.030 95.953   1.00 35.93  ? 479  VAL C CG1   1 
ATOM   7334  C  CG2   . VAL C  2  479  ? 52.390  -46.016 96.837   1.00 29.65  ? 479  VAL C CG2   1 
ATOM   7335  N  N     . THR C  2  480  ? 56.458  -47.968 95.235   1.00 29.70  ? 480  THR C N     1 
ATOM   7336  C  CA    . THR C  2  480  ? 57.904  -48.094 95.137   1.00 36.80  ? 480  THR C CA    1 
ATOM   7337  C  C     . THR C  2  480  ? 58.566  -46.724 95.136   1.00 38.57  ? 480  THR C C     1 
ATOM   7338  O  O     . THR C  2  480  ? 57.908  -45.709 94.921   1.00 45.18  ? 480  THR C O     1 
ATOM   7339  C  CB    . THR C  2  480  ? 58.316  -48.828 93.854   1.00 43.23  ? 480  THR C CB    1 
ATOM   7340  O  OG1   . THR C  2  480  ? 58.079  -47.981 92.723   1.00 46.64  ? 480  THR C OG1   1 
ATOM   7341  C  CG2   . THR C  2  480  ? 57.525  -50.122 93.700   1.00 37.98  ? 480  THR C CG2   1 
ATOM   7342  N  N     . ASP C  2  481  ? 59.865  -46.694 95.403   1.00 36.56  ? 481  ASP C N     1 
ATOM   7343  C  CA    . ASP C  2  481  ? 60.627  -45.461 95.267   1.00 37.25  ? 481  ASP C CA    1 
ATOM   7344  C  C     . ASP C  2  481  ? 61.200  -45.338 93.859   1.00 38.45  ? 481  ASP C C     1 
ATOM   7345  O  O     . ASP C  2  481  ? 61.948  -44.404 93.568   1.00 41.48  ? 481  ASP C O     1 
ATOM   7346  C  CB    . ASP C  2  481  ? 61.736  -45.379 96.317   1.00 49.71  ? 481  ASP C CB    1 
ATOM   7347  C  CG    . ASP C  2  481  ? 61.192  -45.181 97.722   1.00 65.08  ? 481  ASP C CG    1 
ATOM   7348  O  OD1   . ASP C  2  481  ? 60.059  -44.672 97.856   1.00 66.42  ? 481  ASP C OD1   1 
ATOM   7349  O  OD2   . ASP C  2  481  ? 61.898  -45.530 98.693   1.00 65.44  ? 481  ASP C OD2   1 
ATOM   7350  N  N     . GLU C  2  482  ? 60.848  -46.287 92.991   1.00 34.03  ? 482  GLU C N     1 
ATOM   7351  C  CA    . GLU C  2  482  ? 61.270  -46.245 91.592   1.00 38.52  ? 482  GLU C CA    1 
ATOM   7352  C  C     . GLU C  2  482  ? 60.565  -45.122 90.843   1.00 41.37  ? 482  GLU C C     1 
ATOM   7353  O  O     . GLU C  2  482  ? 59.335  -45.089 90.773   1.00 39.35  ? 482  GLU C O     1 
ATOM   7354  C  CB    . GLU C  2  482  ? 60.968  -47.569 90.886   1.00 40.21  ? 482  GLU C CB    1 
ATOM   7355  C  CG    . GLU C  2  482  ? 61.204  -47.514 89.376   1.00 41.10  ? 482  GLU C CG    1 
ATOM   7356  C  CD    . GLU C  2  482  ? 60.552  -48.662 88.621   1.00 46.63  ? 482  GLU C CD    1 
ATOM   7357  O  OE1   . GLU C  2  482  ? 60.761  -48.762 87.391   1.00 40.44  ? 482  GLU C OE1   1 
ATOM   7358  O  OE2   . GLU C  2  482  ? 59.828  -49.460 89.252   1.00 50.24  ? 482  GLU C OE2   1 
ATOM   7359  N  N     . VAL C  2  483  ? 61.348  -44.223 90.254   1.00 38.91  ? 483  VAL C N     1 
ATOM   7360  C  CA    . VAL C  2  483  ? 60.790  -43.062 89.572   1.00 29.74  ? 483  VAL C CA    1 
ATOM   7361  C  C     . VAL C  2  483  ? 60.970  -43.131 88.059   1.00 27.12  ? 483  VAL C C     1 
ATOM   7362  O  O     . VAL C  2  483  ? 62.091  -43.162 87.552   1.00 29.88  ? 483  VAL C O     1 
ATOM   7363  C  CB    . VAL C  2  483  ? 61.402  -41.755 90.089   1.00 29.57  ? 483  VAL C CB    1 
ATOM   7364  C  CG1   . VAL C  2  483  ? 60.728  -40.572 89.423   1.00 26.41  ? 483  VAL C CG1   1 
ATOM   7365  C  CG2   . VAL C  2  483  ? 61.269  -41.670 91.600   1.00 29.33  ? 483  VAL C CG2   1 
ATOM   7366  N  N     . VAL C  2  484  ? 59.849  -43.148 87.349   1.00 21.97  ? 484  VAL C N     1 
ATOM   7367  C  CA    . VAL C  2  484  ? 59.842  -43.205 85.897   1.00 21.80  ? 484  VAL C CA    1 
ATOM   7368  C  C     . VAL C  2  484  ? 59.431  -41.860 85.309   1.00 20.72  ? 484  VAL C C     1 
ATOM   7369  O  O     . VAL C  2  484  ? 58.353  -41.349 85.614   1.00 29.39  ? 484  VAL C O     1 
ATOM   7370  C  CB    . VAL C  2  484  ? 58.858  -44.278 85.403   1.00 20.59  ? 484  VAL C CB    1 
ATOM   7371  C  CG1   . VAL C  2  484  ? 58.784  -44.285 83.882   1.00 17.28  ? 484  VAL C CG1   1 
ATOM   7372  C  CG2   . VAL C  2  484  ? 59.257  -45.642 85.938   1.00 26.85  ? 484  VAL C CG2   1 
ATOM   7373  N  N     . TYR C  2  485  ? 60.288  -41.286 84.471   1.00 15.01  ? 485  TYR C N     1 
ATOM   7374  C  CA    . TYR C  2  485  ? 59.957  -40.047 83.775   1.00 15.03  ? 485  TYR C CA    1 
ATOM   7375  C  C     . TYR C  2  485  ? 59.174  -40.339 82.496   1.00 16.15  ? 485  TYR C C     1 
ATOM   7376  O  O     . TYR C  2  485  ? 59.600  -41.150 81.678   1.00 23.04  ? 485  TYR C O     1 
ATOM   7377  C  CB    . TYR C  2  485  ? 61.228  -39.258 83.463   1.00 15.29  ? 485  TYR C CB    1 
ATOM   7378  C  CG    . TYR C  2  485  ? 61.627  -38.295 84.557   1.00 16.53  ? 485  TYR C CG    1 
ATOM   7379  C  CD1   . TYR C  2  485  ? 62.430  -38.701 85.613   1.00 18.34  ? 485  TYR C CD1   1 
ATOM   7380  C  CD2   . TYR C  2  485  ? 61.193  -36.977 84.533   1.00 21.48  ? 485  TYR C CD2   1 
ATOM   7381  C  CE1   . TYR C  2  485  ? 62.792  -37.813 86.616   1.00 24.66  ? 485  TYR C CE1   1 
ATOM   7382  C  CE2   . TYR C  2  485  ? 61.549  -36.085 85.528   1.00 20.68  ? 485  TYR C CE2   1 
ATOM   7383  C  CZ    . TYR C  2  485  ? 62.345  -36.505 86.567   1.00 20.67  ? 485  TYR C CZ    1 
ATOM   7384  O  OH    . TYR C  2  485  ? 62.693  -35.608 87.550   1.00 15.66  ? 485  TYR C OH    1 
ATOM   7385  N  N     . MET C  2  486  ? 58.033  -39.678 82.318   1.00 13.93  ? 486  MET C N     1 
ATOM   7386  C  CA    . MET C  2  486  ? 57.154  -39.987 81.190   1.00 17.62  ? 486  MET C CA    1 
ATOM   7387  C  C     . MET C  2  486  ? 56.836  -38.809 80.274   1.00 19.54  ? 486  MET C C     1 
ATOM   7388  O  O     . MET C  2  486  ? 56.593  -37.697 80.736   1.00 21.00  ? 486  MET C O     1 
ATOM   7389  C  CB    . MET C  2  486  ? 55.829  -40.560 81.690   1.00 21.15  ? 486  MET C CB    1 
ATOM   7390  C  CG    . MET C  2  486  ? 55.948  -41.756 82.602   1.00 23.39  ? 486  MET C CG    1 
ATOM   7391  S  SD    . MET C  2  486  ? 54.360  -42.593 82.753   1.00 33.14  ? 486  MET C SD    1 
ATOM   7392  C  CE    . MET C  2  486  ? 54.558  -43.334 84.357   1.00 28.68  ? 486  MET C CE    1 
ATOM   7393  N  N     . THR C  2  487  ? 56.823  -39.073 78.970   1.00 18.30  ? 487  THR C N     1 
ATOM   7394  C  CA    . THR C  2  487  ? 56.233  -38.157 78.002   1.00 15.22  ? 487  THR C CA    1 
ATOM   7395  C  C     . THR C  2  487  ? 54.722  -38.267 78.113   1.00 15.16  ? 487  THR C C     1 
ATOM   7396  O  O     . THR C  2  487  ? 54.214  -39.240 78.662   1.00 19.97  ? 487  THR C O     1 
ATOM   7397  C  CB    . THR C  2  487  ? 56.637  -38.511 76.574   1.00 16.67  ? 487  THR C CB    1 
ATOM   7398  O  OG1   . THR C  2  487  ? 56.095  -39.792 76.232   1.00 16.43  ? 487  THR C OG1   1 
ATOM   7399  C  CG2   . THR C  2  487  ? 58.152  -38.548 76.448   1.00 20.00  ? 487  THR C CG2   1 
ATOM   7400  N  N     . ALA C  2  488  ? 54.006  -37.270 77.608   1.00 14.95  ? 488  ALA C N     1 
ATOM   7401  C  CA    . ALA C  2  488  ? 52.546  -37.245 77.720   1.00 21.66  ? 488  ALA C CA    1 
ATOM   7402  C  C     . ALA C  2  488  ? 51.874  -38.488 77.137   1.00 23.20  ? 488  ALA C C     1 
ATOM   7403  O  O     . ALA C  2  488  ? 50.925  -39.022 77.720   1.00 27.36  ? 488  ALA C O     1 
ATOM   7404  C  CB    . ALA C  2  488  ? 51.981  -35.985 77.078   1.00 21.86  ? 488  ALA C CB    1 
ATOM   7405  N  N     . THR C  2  489  ? 52.377  -38.946 75.994   1.00 20.97  ? 489  THR C N     1 
ATOM   7406  C  CA    . THR C  2  489  ? 51.812  -40.108 75.316   1.00 20.99  ? 489  THR C CA    1 
ATOM   7407  C  C     . THR C  2  489  ? 51.940  -41.370 76.169   1.00 25.89  ? 489  THR C C     1 
ATOM   7408  O  O     . THR C  2  489  ? 51.032  -42.201 76.207   1.00 30.59  ? 489  THR C O     1 
ATOM   7409  C  CB    . THR C  2  489  ? 52.480  -40.338 73.950   1.00 19.74  ? 489  THR C CB    1 
ATOM   7410  O  OG1   . THR C  2  489  ? 52.464  -39.118 73.199   1.00 26.95  ? 489  THR C OG1   1 
ATOM   7411  C  CG2   . THR C  2  489  ? 51.745  -41.413 73.171   1.00 21.57  ? 489  THR C CG2   1 
ATOM   7412  N  N     . GLU C  2  490  ? 53.070  -41.507 76.855   1.00 25.20  ? 490  GLU C N     1 
ATOM   7413  C  CA    . GLU C  2  490  ? 53.278  -42.628 77.762   1.00 23.06  ? 490  GLU C CA    1 
ATOM   7414  C  C     . GLU C  2  490  ? 52.398  -42.488 78.995   1.00 24.77  ? 490  GLU C C     1 
ATOM   7415  O  O     . GLU C  2  490  ? 51.857  -43.469 79.497   1.00 30.94  ? 490  GLU C O     1 
ATOM   7416  C  CB    . GLU C  2  490  ? 54.748  -42.719 78.174   1.00 24.34  ? 490  GLU C CB    1 
ATOM   7417  C  CG    . GLU C  2  490  ? 55.541  -43.771 77.417   1.00 41.56  ? 490  GLU C CG    1 
ATOM   7418  C  CD    . GLU C  2  490  ? 55.270  -45.180 77.918   1.00 50.84  ? 490  GLU C CD    1 
ATOM   7419  O  OE1   . GLU C  2  490  ? 55.271  -46.122 77.093   1.00 43.46  ? 490  GLU C OE1   1 
ATOM   7420  O  OE2   . GLU C  2  490  ? 55.068  -45.346 79.141   1.00 46.40  ? 490  GLU C OE2   1 
ATOM   7421  N  N     . GLU C  2  491  ? 52.257  -41.258 79.477   1.00 23.91  ? 491  GLU C N     1 
ATOM   7422  C  CA    . GLU C  2  491  ? 51.450  -40.981 80.658   1.00 25.03  ? 491  GLU C CA    1 
ATOM   7423  C  C     . GLU C  2  491  ? 49.982  -41.323 80.417   1.00 25.86  ? 491  GLU C C     1 
ATOM   7424  O  O     . GLU C  2  491  ? 49.267  -41.722 81.338   1.00 25.30  ? 491  GLU C O     1 
ATOM   7425  C  CB    . GLU C  2  491  ? 51.592  -39.512 81.063   1.00 23.79  ? 491  GLU C CB    1 
ATOM   7426  C  CG    . GLU C  2  491  ? 50.701  -39.099 82.219   1.00 24.07  ? 491  GLU C CG    1 
ATOM   7427  C  CD    . GLU C  2  491  ? 50.687  -37.600 82.445   1.00 30.53  ? 491  GLU C CD    1 
ATOM   7428  O  OE1   . GLU C  2  491  ? 49.586  -37.043 82.646   1.00 34.55  ? 491  GLU C OE1   1 
ATOM   7429  O  OE2   . GLU C  2  491  ? 51.773  -36.981 82.428   1.00 28.98  ? 491  GLU C OE2   1 
ATOM   7430  N  N     . ASP C  2  492  ? 49.540  -41.172 79.172   1.00 23.88  ? 492  ASP C N     1 
ATOM   7431  C  CA    . ASP C  2  492  ? 48.149  -41.449 78.815   1.00 25.01  ? 492  ASP C CA    1 
ATOM   7432  C  C     . ASP C  2  492  ? 47.755  -42.911 79.020   1.00 32.14  ? 492  ASP C C     1 
ATOM   7433  O  O     . ASP C  2  492  ? 46.570  -43.236 79.087   1.00 37.01  ? 492  ASP C O     1 
ATOM   7434  C  CB    . ASP C  2  492  ? 47.873  -41.044 77.364   1.00 24.88  ? 492  ASP C CB    1 
ATOM   7435  C  CG    . ASP C  2  492  ? 47.536  -39.573 77.220   1.00 23.05  ? 492  ASP C CG    1 
ATOM   7436  O  OD1   . ASP C  2  492  ? 47.860  -38.791 78.137   1.00 27.17  ? 492  ASP C OD1   1 
ATOM   7437  O  OD2   . ASP C  2  492  ? 46.942  -39.197 76.188   1.00 21.62  ? 492  ASP C OD2   1 
ATOM   7438  N  N     . ARG C  2  493  ? 48.748  -43.788 79.124   1.00 33.46  ? 493  ARG C N     1 
ATOM   7439  C  CA    . ARG C  2  493  ? 48.492  -45.224 79.164   1.00 30.62  ? 493  ARG C CA    1 
ATOM   7440  C  C     . ARG C  2  493  ? 48.089  -45.732 80.544   1.00 26.82  ? 493  ARG C C     1 
ATOM   7441  O  O     . ARG C  2  493  ? 47.549  -46.829 80.666   1.00 29.49  ? 493  ARG C O     1 
ATOM   7442  C  CB    . ARG C  2  493  ? 49.720  -45.993 78.672   1.00 30.71  ? 493  ARG C CB    1 
ATOM   7443  C  CG    . ARG C  2  493  ? 50.345  -45.410 77.417   1.00 38.79  ? 493  ARG C CG    1 
ATOM   7444  C  CD    . ARG C  2  493  ? 51.410  -46.325 76.842   1.00 43.91  ? 493  ARG C CD    1 
ATOM   7445  N  NE    . ARG C  2  493  ? 50.840  -47.581 76.367   1.00 46.05  ? 493  ARG C NE    1 
ATOM   7446  C  CZ    . ARG C  2  493  ? 51.232  -48.783 76.775   1.00 47.49  ? 493  ARG C CZ    1 
ATOM   7447  N  NH1   . ARG C  2  493  ? 52.210  -48.895 77.666   1.00 44.99  ? 493  ARG C NH1   1 
ATOM   7448  N  NH2   . ARG C  2  493  ? 50.651  -49.871 76.287   1.00 48.07  ? 493  ARG C NH2   1 
ATOM   7449  N  N     . TYR C  2  494  ? 48.330  -44.929 81.576   1.00 29.24  ? 494  TYR C N     1 
ATOM   7450  C  CA    . TYR C  2  494  ? 48.198  -45.408 82.950   1.00 29.19  ? 494  TYR C CA    1 
ATOM   7451  C  C     . TYR C  2  494  ? 47.208  -44.622 83.803   1.00 30.29  ? 494  TYR C C     1 
ATOM   7452  O  O     . TYR C  2  494  ? 46.804  -43.510 83.459   1.00 34.08  ? 494  TYR C O     1 
ATOM   7453  C  CB    . TYR C  2  494  ? 49.561  -45.412 83.647   1.00 26.11  ? 494  TYR C CB    1 
ATOM   7454  C  CG    . TYR C  2  494  ? 50.655  -46.058 82.837   1.00 29.34  ? 494  TYR C CG    1 
ATOM   7455  C  CD1   . TYR C  2  494  ? 50.690  -47.433 82.660   1.00 30.89  ? 494  TYR C CD1   1 
ATOM   7456  C  CD2   . TYR C  2  494  ? 51.655  -45.295 82.251   1.00 32.79  ? 494  TYR C CD2   1 
ATOM   7457  C  CE1   . TYR C  2  494  ? 51.688  -48.033 81.918   1.00 31.14  ? 494  TYR C CE1   1 
ATOM   7458  C  CE2   . TYR C  2  494  ? 52.660  -45.886 81.509   1.00 39.04  ? 494  TYR C CE2   1 
ATOM   7459  C  CZ    . TYR C  2  494  ? 52.670  -47.257 81.345   1.00 34.98  ? 494  TYR C CZ    1 
ATOM   7460  O  OH    . TYR C  2  494  ? 53.664  -47.856 80.607   1.00 39.56  ? 494  TYR C OH    1 
ATOM   7461  N  N     . THR C  2  495  ? 46.818  -45.234 84.916   1.00 25.73  ? 495  THR C N     1 
ATOM   7462  C  CA    . THR C  2  495  ? 46.004  -44.590 85.933   1.00 25.84  ? 495  THR C CA    1 
ATOM   7463  C  C     . THR C  2  495  ? 46.937  -44.032 87.004   1.00 27.47  ? 495  THR C C     1 
ATOM   7464  O  O     . THR C  2  495  ? 47.630  -44.791 87.679   1.00 30.02  ? 495  THR C O     1 
ATOM   7465  C  CB    . THR C  2  495  ? 45.040  -45.603 86.575   1.00 25.64  ? 495  THR C CB    1 
ATOM   7466  O  OG1   . THR C  2  495  ? 44.189  -46.163 85.567   1.00 22.79  ? 495  THR C OG1   1 
ATOM   7467  C  CG2   . THR C  2  495  ? 44.192  -44.941 87.645   1.00 26.30  ? 495  THR C CG2   1 
ATOM   7468  N  N     . ILE C  2  496  ? 46.967  -42.711 87.157   1.00 27.80  ? 496  ILE C N     1 
ATOM   7469  C  CA    . ILE C  2  496  ? 47.940  -42.082 88.054   1.00 26.70  ? 496  ILE C CA    1 
ATOM   7470  C  C     . ILE C  2  496  ? 47.318  -41.385 89.268   1.00 27.17  ? 496  ILE C C     1 
ATOM   7471  O  O     . ILE C  2  496  ? 46.645  -40.361 89.136   1.00 28.70  ? 496  ILE C O     1 
ATOM   7472  C  CB    . ILE C  2  496  ? 48.836  -41.087 87.295   1.00 23.61  ? 496  ILE C CB    1 
ATOM   7473  C  CG1   . ILE C  2  496  ? 49.437  -41.761 86.062   1.00 23.55  ? 496  ILE C CG1   1 
ATOM   7474  C  CG2   . ILE C  2  496  ? 49.921  -40.538 88.210   1.00 19.43  ? 496  ILE C CG2   1 
ATOM   7475  C  CD1   . ILE C  2  496  ? 50.352  -40.873 85.267   1.00 24.76  ? 496  ILE C CD1   1 
ATOM   7476  N  N     . ALA C  2  497  ? 47.567  -41.945 90.449   1.00 22.04  ? 497  ALA C N     1 
ATOM   7477  C  CA    . ALA C  2  497  ? 47.002  -41.430 91.694   1.00 22.72  ? 497  ALA C CA    1 
ATOM   7478  C  C     . ALA C  2  497  ? 47.679  -40.148 92.161   1.00 23.73  ? 497  ALA C C     1 
ATOM   7479  O  O     . ALA C  2  497  ? 48.803  -39.847 91.760   1.00 21.95  ? 497  ALA C O     1 
ATOM   7480  C  CB    . ALA C  2  497  ? 47.071  -42.486 92.781   1.00 28.18  ? 497  ALA C CB    1 
ATOM   7481  N  N     . GLN C  2  498  ? 46.983  -39.402 93.014   1.00 22.69  ? 498  GLN C N     1 
ATOM   7482  C  CA    . GLN C  2  498  ? 47.498  -38.144 93.547   1.00 23.64  ? 498  GLN C CA    1 
ATOM   7483  C  C     . GLN C  2  498  ? 48.489  -38.357 94.690   1.00 23.52  ? 498  GLN C C     1 
ATOM   7484  O  O     . GLN C  2  498  ? 48.441  -39.375 95.375   1.00 27.82  ? 498  GLN C O     1 
ATOM   7485  C  CB    . GLN C  2  498  ? 46.345  -37.241 93.986   1.00 26.27  ? 498  GLN C CB    1 
ATOM   7486  C  CG    . GLN C  2  498  ? 45.499  -36.742 92.826   1.00 26.44  ? 498  GLN C CG    1 
ATOM   7487  C  CD    . GLN C  2  498  ? 46.324  -35.998 91.792   1.00 24.87  ? 498  GLN C CD    1 
ATOM   7488  O  OE1   . GLN C  2  498  ? 47.066  -35.073 92.124   1.00 23.29  ? 498  GLN C OE1   1 
ATOM   7489  N  NE2   . GLN C  2  498  ? 46.209  -36.410 90.532   1.00 22.42  ? 498  GLN C NE2   1 
ATOM   7490  N  N     . ALA C  2  499  ? 49.382  -37.389 94.891   1.00 22.39  ? 499  ALA C N     1 
ATOM   7491  C  CA    . ALA C  2  499  ? 50.486  -37.531 95.844   1.00 23.90  ? 499  ALA C CA    1 
ATOM   7492  C  C     . ALA C  2  499  ? 50.066  -37.411 97.307   1.00 28.47  ? 499  ALA C C     1 
ATOM   7493  O  O     . ALA C  2  499  ? 50.822  -37.778 98.209   1.00 23.39  ? 499  ALA C O     1 
ATOM   7494  C  CB    . ALA C  2  499  ? 51.585  -36.531 95.533   1.00 26.70  ? 499  ALA C CB    1 
ATOM   7495  N  N     . ASN C  2  500  ? 48.867  -36.890 97.540   1.00 29.67  ? 500  ASN C N     1 
ATOM   7496  C  CA    . ASN C  2  500  ? 48.359  -36.749 98.898   1.00 33.52  ? 500  ASN C CA    1 
ATOM   7497  C  C     . ASN C  2  500  ? 47.657  -38.018 99.372   1.00 41.73  ? 500  ASN C C     1 
ATOM   7498  O  O     . ASN C  2  500  ? 47.169  -38.080 100.502  1.00 50.13  ? 500  ASN C O     1 
ATOM   7499  C  CB    . ASN C  2  500  ? 47.410  -35.554 98.996   1.00 32.74  ? 500  ASN C CB    1 
ATOM   7500  C  CG    . ASN C  2  500  ? 46.047  -35.840 98.395   1.00 36.89  ? 500  ASN C CG    1 
ATOM   7501  O  OD1   . ASN C  2  500  ? 45.916  -36.643 97.472   1.00 32.38  ? 500  ASN C OD1   1 
ATOM   7502  N  ND2   . ASN C  2  500  ? 45.020  -35.180 98.919   1.00 49.13  ? 500  ASN C ND2   1 
ATOM   7503  N  N     . THR C  2  501  ? 47.606  -39.018 98.493   1.00 37.84  ? 501  THR C N     1 
ATOM   7504  C  CA    . THR C  2  501  ? 46.983  -40.308 98.785   1.00 36.60  ? 501  THR C CA    1 
ATOM   7505  C  C     . THR C  2  501  ? 47.556  -40.921 100.063  1.00 43.83  ? 501  THR C C     1 
ATOM   7506  O  O     . THR C  2  501  ? 48.775  -41.042 100.203  1.00 45.33  ? 501  THR C O     1 
ATOM   7507  C  CB    . THR C  2  501  ? 47.164  -41.296 97.602   1.00 37.71  ? 501  THR C CB    1 
ATOM   7508  O  OG1   . THR C  2  501  ? 46.452  -40.813 96.454   1.00 36.88  ? 501  THR C OG1   1 
ATOM   7509  C  CG2   . THR C  2  501  ? 46.650  -42.682 97.959   1.00 44.53  ? 501  THR C CG2   1 
ATOM   7510  N  N     . PRO C  2  502  ? 46.671  -41.295 101.005  1.00 43.25  ? 502  PRO C N     1 
ATOM   7511  C  CA    . PRO C  2  502  ? 47.049  -41.831 102.319  1.00 39.03  ? 502  PRO C CA    1 
ATOM   7512  C  C     . PRO C  2  502  ? 47.937  -43.064 102.208  1.00 38.14  ? 502  PRO C C     1 
ATOM   7513  O  O     . PRO C  2  502  ? 47.632  -43.978 101.444  1.00 39.33  ? 502  PRO C O     1 
ATOM   7514  C  CB    . PRO C  2  502  ? 45.704  -42.220 102.938  1.00 42.39  ? 502  PRO C CB    1 
ATOM   7515  C  CG    . PRO C  2  502  ? 44.706  -41.364 102.246  1.00 43.16  ? 502  PRO C CG    1 
ATOM   7516  C  CD    . PRO C  2  502  ? 45.208  -41.211 100.846  1.00 36.92  ? 502  PRO C CD    1 
ATOM   7517  N  N     . LEU C  2  503  ? 49.026  -43.084 102.966  1.00 40.22  ? 503  LEU C N     1 
ATOM   7518  C  CA    . LEU C  2  503  ? 49.951  -44.208 102.926  1.00 45.90  ? 503  LEU C CA    1 
ATOM   7519  C  C     . LEU C  2  503  ? 50.402  -44.614 104.325  1.00 57.38  ? 503  LEU C C     1 
ATOM   7520  O  O     . LEU C  2  503  ? 50.868  -43.782 105.104  1.00 66.67  ? 503  LEU C O     1 
ATOM   7521  C  CB    . LEU C  2  503  ? 51.180  -43.865 102.077  1.00 33.25  ? 503  LEU C CB    1 
ATOM   7522  C  CG    . LEU C  2  503  ? 50.976  -43.531 100.599  1.00 32.57  ? 503  LEU C CG    1 
ATOM   7523  C  CD1   . LEU C  2  503  ? 52.227  -42.885 100.035  1.00 37.77  ? 503  LEU C CD1   1 
ATOM   7524  C  CD2   . LEU C  2  503  ? 50.620  -44.773 99.807   1.00 35.62  ? 503  LEU C CD2   1 
ATOM   7525  N  N     . GLU C  2  504  ? 50.258  -45.897 104.639  1.00 49.33  ? 504  GLU C N     1 
ATOM   7526  C  CA    . GLU C  2  504  ? 50.874  -46.456 105.832  1.00 46.45  ? 504  GLU C CA    1 
ATOM   7527  C  C     . GLU C  2  504  ? 52.118  -47.207 105.378  1.00 48.44  ? 504  GLU C C     1 
ATOM   7528  O  O     . GLU C  2  504  ? 52.026  -48.264 104.758  1.00 52.59  ? 504  GLU C O     1 
ATOM   7529  C  CB    . GLU C  2  504  ? 49.898  -47.383 106.558  1.00 50.22  ? 504  GLU C CB    1 
ATOM   7530  C  CG    . GLU C  2  504  ? 49.024  -48.218 105.628  1.00 66.12  ? 504  GLU C CG    1 
ATOM   7531  C  CD    . GLU C  2  504  ? 47.860  -48.879 106.345  1.00 77.92  ? 504  GLU C CD    1 
ATOM   7532  O  OE1   . GLU C  2  504  ? 47.581  -48.499 107.503  1.00 77.99  ? 504  GLU C OE1   1 
ATOM   7533  O  OE2   . GLU C  2  504  ? 47.222  -49.775 105.749  1.00 68.11  ? 504  GLU C OE2   1 
ATOM   7534  N  N     . GLY C  2  505  ? 53.286  -46.653 105.684  1.00 45.17  ? 505  GLY C N     1 
ATOM   7535  C  CA    . GLY C  2  505  ? 54.515  -47.148 105.096  1.00 47.95  ? 505  GLY C CA    1 
ATOM   7536  C  C     . GLY C  2  505  ? 54.490  -46.900 103.599  1.00 48.68  ? 505  GLY C C     1 
ATOM   7537  O  O     . GLY C  2  505  ? 54.279  -45.773 103.156  1.00 55.81  ? 505  GLY C O     1 
ATOM   7538  N  N     . ASN C  2  506  ? 54.705  -47.952 102.817  1.00 49.41  ? 506  ASN C N     1 
ATOM   7539  C  CA    . ASN C  2  506  ? 54.672  -47.850 101.359  1.00 43.89  ? 506  ASN C CA    1 
ATOM   7540  C  C     . ASN C  2  506  ? 53.342  -48.264 100.727  1.00 46.79  ? 506  ASN C C     1 
ATOM   7541  O  O     . ASN C  2  506  ? 53.209  -48.286 99.502   1.00 42.44  ? 506  ASN C O     1 
ATOM   7542  C  CB    . ASN C  2  506  ? 55.819  -48.652 100.743  1.00 47.22  ? 506  ASN C CB    1 
ATOM   7543  C  CG    . ASN C  2  506  ? 57.174  -48.056 101.055  1.00 60.88  ? 506  ASN C CG    1 
ATOM   7544  O  OD1   . ASN C  2  506  ? 57.724  -47.288 100.265  1.00 66.18  ? 506  ASN C OD1   1 
ATOM   7545  N  ND2   . ASN C  2  506  ? 57.718  -48.398 102.219  1.00 64.53  ? 506  ASN C ND2   1 
ATOM   7546  N  N     . ARG C  2  507  ? 52.364  -48.599 101.564  1.00 47.70  ? 507  ARG C N     1 
ATOM   7547  C  CA    . ARG C  2  507  ? 51.098  -49.151 101.083  1.00 49.46  ? 507  ARG C CA    1 
ATOM   7548  C  C     . ARG C  2  507  ? 49.963  -48.128 101.084  1.00 43.88  ? 507  ARG C C     1 
ATOM   7549  O  O     . ARG C  2  507  ? 49.857  -47.308 101.995  1.00 46.62  ? 507  ARG C O     1 
ATOM   7550  C  CB    . ARG C  2  507  ? 50.708  -50.376 101.919  1.00 58.01  ? 507  ARG C CB    1 
ATOM   7551  C  CG    . ARG C  2  507  ? 49.459  -51.104 101.442  1.00 59.69  ? 507  ARG C CG    1 
ATOM   7552  C  CD    . ARG C  2  507  ? 49.307  -52.450 102.137  1.00 67.38  ? 507  ARG C CD    1 
ATOM   7553  N  NE    . ARG C  2  507  ? 50.470  -53.312 101.925  1.00 71.64  ? 507  ARG C NE    1 
ATOM   7554  C  CZ    . ARG C  2  507  ? 50.629  -54.115 100.876  1.00 70.32  ? 507  ARG C CZ    1 
ATOM   7555  N  NH1   . ARG C  2  507  ? 49.700  -54.173 99.930   1.00 64.06  ? 507  ARG C NH1   1 
ATOM   7556  N  NH2   . ARG C  2  507  ? 51.721  -54.862 100.771  1.00 59.94  ? 507  ARG C NH2   1 
ATOM   7557  N  N     . ILE C  2  508  ? 49.114  -48.191 100.061  1.00 40.35  ? 508  ILE C N     1 
ATOM   7558  C  CA    . ILE C  2  508  ? 47.966  -47.295 99.954   1.00 43.10  ? 508  ILE C CA    1 
ATOM   7559  C  C     . ILE C  2  508  ? 46.934  -47.628 101.026  1.00 43.43  ? 508  ILE C C     1 
ATOM   7560  O  O     . ILE C  2  508  ? 46.459  -48.761 101.115  1.00 51.01  ? 508  ILE C O     1 
ATOM   7561  C  CB    . ILE C  2  508  ? 47.311  -47.384 98.559   1.00 43.93  ? 508  ILE C CB    1 
ATOM   7562  C  CG1   . ILE C  2  508  ? 48.330  -47.044 97.470   1.00 40.77  ? 508  ILE C CG1   1 
ATOM   7563  C  CG2   . ILE C  2  508  ? 46.107  -46.459 98.469   1.00 45.24  ? 508  ILE C CG2   1 
ATOM   7564  C  CD1   . ILE C  2  508  ? 47.763  -47.096 96.066   1.00 40.77  ? 508  ILE C CD1   1 
ATOM   7565  N  N     . ALA C  2  509  ? 46.585  -46.631 101.833  1.00 40.23  ? 509  ALA C N     1 
ATOM   7566  C  CA    . ALA C  2  509  ? 45.767  -46.858 103.020  1.00 45.75  ? 509  ALA C CA    1 
ATOM   7567  C  C     . ALA C  2  509  ? 44.266  -46.620 102.830  1.00 47.53  ? 509  ALA C C     1 
ATOM   7568  O  O     . ALA C  2  509  ? 43.481  -46.848 103.748  1.00 57.17  ? 509  ALA C O     1 
ATOM   7569  C  CB    . ALA C  2  509  ? 46.292  -46.021 104.181  1.00 49.50  ? 509  ALA C CB    1 
ATOM   7570  N  N     . ALA C  2  510  ? 43.865  -46.170 101.647  1.00 45.57  ? 510  ALA C N     1 
ATOM   7571  C  CA    . ALA C  2  510  ? 42.457  -45.882 101.391  1.00 43.43  ? 510  ALA C CA    1 
ATOM   7572  C  C     . ALA C  2  510  ? 41.905  -46.780 100.291  1.00 45.81  ? 510  ALA C C     1 
ATOM   7573  O  O     . ALA C  2  510  ? 42.605  -47.088 99.329   1.00 46.61  ? 510  ALA C O     1 
ATOM   7574  C  CB    . ALA C  2  510  ? 42.274  -44.415 101.026  1.00 47.53  ? 510  ALA C CB    1 
ATOM   7575  N  N     . GLU C  2  511  ? 40.649  -47.198 100.433  1.00 50.35  ? 511  GLU C N     1 
ATOM   7576  C  CA    . GLU C  2  511  ? 40.018  -48.053 99.427   1.00 55.68  ? 511  GLU C CA    1 
ATOM   7577  C  C     . GLU C  2  511  ? 39.405  -47.247 98.287   1.00 52.36  ? 511  GLU C C     1 
ATOM   7578  O  O     . GLU C  2  511  ? 38.889  -47.810 97.320   1.00 52.71  ? 511  GLU C O     1 
ATOM   7579  C  CB    . GLU C  2  511  ? 38.973  -48.982 100.055  1.00 57.84  ? 511  GLU C CB    1 
ATOM   7580  C  CG    . GLU C  2  511  ? 39.506  -50.377 100.389  1.00 75.12  ? 511  GLU C CG    1 
ATOM   7581  C  CD    . GLU C  2  511  ? 40.010  -51.132 99.160   1.00 87.22  ? 511  GLU C CD    1 
ATOM   7582  O  OE1   . GLU C  2  511  ? 40.962  -51.935 99.298   1.00 73.45  ? 511  GLU C OE1   1 
ATOM   7583  O  OE2   . GLU C  2  511  ? 39.451  -50.931 98.059   1.00 79.03  ? 511  GLU C OE2   1 
ATOM   7584  N  N     . ARG C  2  512  ? 39.468  -45.925 98.408   1.00 52.24  ? 512  ARG C N     1 
ATOM   7585  C  CA    . ARG C  2  512  ? 39.095  -45.038 97.314   1.00 48.56  ? 512  ARG C CA    1 
ATOM   7586  C  C     . ARG C  2  512  ? 40.194  -43.995 97.113   1.00 44.59  ? 512  ARG C C     1 
ATOM   7587  O  O     . ARG C  2  512  ? 40.466  -43.183 97.999   1.00 45.03  ? 512  ARG C O     1 
ATOM   7588  C  CB    . ARG C  2  512  ? 37.745  -44.366 97.592   1.00 48.76  ? 512  ARG C CB    1 
ATOM   7589  C  CG    . ARG C  2  512  ? 36.598  -45.353 97.780   1.00 56.07  ? 512  ARG C CG    1 
ATOM   7590  C  CD    . ARG C  2  512  ? 35.295  -44.663 98.167   1.00 63.57  ? 512  ARG C CD    1 
ATOM   7591  N  NE    . ARG C  2  512  ? 34.660  -43.988 97.038   1.00 61.90  ? 512  ARG C NE    1 
ATOM   7592  C  CZ    . ARG C  2  512  ? 34.762  -42.686 96.791   1.00 71.44  ? 512  ARG C CZ    1 
ATOM   7593  N  NH1   . ARG C  2  512  ? 35.476  -41.910 97.596   1.00 73.12  ? 512  ARG C NH1   1 
ATOM   7594  N  NH2   . ARG C  2  512  ? 34.148  -42.159 95.739   1.00 71.45  ? 512  ARG C NH2   1 
ATOM   7595  N  N     . VAL C  2  513  ? 40.833  -44.032 95.947   1.00 37.65  ? 513  VAL C N     1 
ATOM   7596  C  CA    . VAL C  2  513  ? 41.905  -43.091 95.635   1.00 38.71  ? 513  VAL C CA    1 
ATOM   7597  C  C     . VAL C  2  513  ? 41.574  -42.243 94.404   1.00 42.43  ? 513  VAL C C     1 
ATOM   7598  O  O     . VAL C  2  513  ? 40.932  -42.716 93.452   1.00 36.05  ? 513  VAL C O     1 
ATOM   7599  C  CB    . VAL C  2  513  ? 43.284  -43.799 95.489   1.00 36.28  ? 513  VAL C CB    1 
ATOM   7600  C  CG1   . VAL C  2  513  ? 43.164  -45.278 95.811   1.00 39.11  ? 513  VAL C CG1   1 
ATOM   7601  C  CG2   . VAL C  2  513  ? 43.872  -43.599 94.098   1.00 31.29  ? 513  VAL C CG2   1 
ATOM   7602  N  N     . VAL C  2  514  ? 41.998  -40.981 94.452   1.00 42.58  ? 514  VAL C N     1 
ATOM   7603  C  CA    . VAL C  2  514  ? 41.762  -40.028 93.376   1.00 31.20  ? 514  VAL C CA    1 
ATOM   7604  C  C     . VAL C  2  514  ? 42.884  -40.084 92.354   1.00 29.00  ? 514  VAL C C     1 
ATOM   7605  O  O     . VAL C  2  514  ? 44.046  -39.838 92.685   1.00 28.52  ? 514  VAL C O     1 
ATOM   7606  C  CB    . VAL C  2  514  ? 41.679  -38.599 93.919   1.00 24.16  ? 514  VAL C CB    1 
ATOM   7607  C  CG1   . VAL C  2  514  ? 41.626  -37.604 92.775   1.00 25.32  ? 514  VAL C CG1   1 
ATOM   7608  C  CG2   . VAL C  2  514  ? 40.470  -38.455 94.825   1.00 26.56  ? 514  VAL C CG2   1 
ATOM   7609  N  N     . ALA C  2  515  ? 42.534  -40.396 91.110   1.00 25.84  ? 515  ALA C N     1 
ATOM   7610  C  CA    . ALA C  2  515  ? 43.541  -40.598 90.077   1.00 27.80  ? 515  ALA C CA    1 
ATOM   7611  C  C     . ALA C  2  515  ? 43.205  -39.917 88.755   1.00 24.53  ? 515  ALA C C     1 
ATOM   7612  O  O     . ALA C  2  515  ? 42.173  -39.258 88.621   1.00 24.57  ? 515  ALA C O     1 
ATOM   7613  C  CB    . ALA C  2  515  ? 43.770  -42.084 89.860   1.00 29.81  ? 515  ALA C CB    1 
ATOM   7614  N  N     . ARG C  2  516  ? 44.094  -40.085 87.781   1.00 21.18  ? 516  ARG C N     1 
ATOM   7615  C  CA    . ARG C  2  516  ? 43.892  -39.543 86.444   1.00 23.62  ? 516  ARG C CA    1 
ATOM   7616  C  C     . ARG C  2  516  ? 44.058  -40.621 85.381   1.00 30.55  ? 516  ARG C C     1 
ATOM   7617  O  O     . ARG C  2  516  ? 45.013  -41.399 85.415   1.00 39.39  ? 516  ARG C O     1 
ATOM   7618  C  CB    . ARG C  2  516  ? 44.885  -38.414 86.165   1.00 23.61  ? 516  ARG C CB    1 
ATOM   7619  C  CG    . ARG C  2  516  ? 44.738  -37.213 87.071   1.00 25.34  ? 516  ARG C CG    1 
ATOM   7620  C  CD    . ARG C  2  516  ? 45.767  -36.143 86.750   1.00 18.87  ? 516  ARG C CD    1 
ATOM   7621  N  NE    . ARG C  2  516  ? 47.133  -36.567 87.048   1.00 19.36  ? 516  ARG C NE    1 
ATOM   7622  C  CZ    . ARG C  2  516  ? 48.098  -36.672 86.140   1.00 19.00  ? 516  ARG C CZ    1 
ATOM   7623  N  NH1   . ARG C  2  516  ? 47.850  -36.384 84.869   1.00 18.84  ? 516  ARG C NH1   1 
ATOM   7624  N  NH2   . ARG C  2  516  ? 49.314  -37.060 86.502   1.00 17.78  ? 516  ARG C NH2   1 
ATOM   7625  N  N     . ARG C  2  517  ? 43.117  -40.664 84.443   1.00 28.28  ? 517  ARG C N     1 
ATOM   7626  C  CA    . ARG C  2  517  ? 43.257  -41.468 83.236   1.00 28.80  ? 517  ARG C CA    1 
ATOM   7627  C  C     . ARG C  2  517  ? 43.086  -40.541 82.048   1.00 29.60  ? 517  ARG C C     1 
ATOM   7628  O  O     . ARG C  2  517  ? 41.994  -40.016 81.824   1.00 30.46  ? 517  ARG C O     1 
ATOM   7629  C  CB    . ARG C  2  517  ? 42.195  -42.564 83.176   1.00 28.46  ? 517  ARG C CB    1 
ATOM   7630  C  CG    . ARG C  2  517  ? 42.483  -43.772 84.042   1.00 34.89  ? 517  ARG C CG    1 
ATOM   7631  C  CD    . ARG C  2  517  ? 41.311  -44.741 84.019   1.00 39.45  ? 517  ARG C CD    1 
ATOM   7632  N  NE    . ARG C  2  517  ? 41.512  -45.865 84.929   1.00 41.04  ? 517  ARG C NE    1 
ATOM   7633  C  CZ    . ARG C  2  517  ? 40.524  -46.552 85.491   1.00 40.35  ? 517  ARG C CZ    1 
ATOM   7634  N  NH1   . ARG C  2  517  ? 39.262  -46.227 85.243   1.00 42.32  ? 517  ARG C NH1   1 
ATOM   7635  N  NH2   . ARG C  2  517  ? 40.798  -47.560 86.309   1.00 41.78  ? 517  ARG C NH2   1 
ATOM   7636  N  N     . LYS C  2  518  ? 44.160  -40.356 81.286   1.00 26.09  ? 518  LYS C N     1 
ATOM   7637  C  CA    . LYS C  2  518  ? 44.174  -39.391 80.191   1.00 26.89  ? 518  LYS C CA    1 
ATOM   7638  C  C     . LYS C  2  518  ? 43.688  -38.024 80.671   1.00 29.30  ? 518  LYS C C     1 
ATOM   7639  O  O     . LYS C  2  518  ? 42.874  -37.375 80.012   1.00 26.31  ? 518  LYS C O     1 
ATOM   7640  C  CB    . LYS C  2  518  ? 43.333  -39.877 79.004   1.00 22.34  ? 518  LYS C CB    1 
ATOM   7641  C  CG    . LYS C  2  518  ? 43.906  -41.083 78.268   1.00 21.47  ? 518  LYS C CG    1 
ATOM   7642  C  CD    . LYS C  2  518  ? 43.170  -41.321 76.953   1.00 24.94  ? 518  LYS C CD    1 
ATOM   7643  C  CE    . LYS C  2  518  ? 43.774  -42.469 76.152   1.00 27.38  ? 518  LYS C CE    1 
ATOM   7644  N  NZ    . LYS C  2  518  ? 43.548  -43.796 76.792   1.00 38.12  ? 518  LYS C NZ    1 
ATOM   7645  N  N     . GLY C  2  519  ? 44.169  -37.615 81.842   1.00 28.50  ? 519  GLY C N     1 
ATOM   7646  C  CA    . GLY C  2  519  ? 43.863  -36.306 82.389   1.00 28.07  ? 519  GLY C CA    1 
ATOM   7647  C  C     . GLY C  2  519  ? 42.527  -36.251 83.103   1.00 33.21  ? 519  GLY C C     1 
ATOM   7648  O  O     . GLY C  2  519  ? 42.272  -35.341 83.893   1.00 37.83  ? 519  GLY C O     1 
ATOM   7649  N  N     . GLU C  2  520  ? 41.676  -37.234 82.831   1.00 31.24  ? 520  GLU C N     1 
ATOM   7650  C  CA    . GLU C  2  520  ? 40.345  -37.283 83.418   1.00 30.95  ? 520  GLU C CA    1 
ATOM   7651  C  C     . GLU C  2  520  ? 40.409  -37.752 84.871   1.00 32.18  ? 520  GLU C C     1 
ATOM   7652  O  O     . GLU C  2  520  ? 40.983  -38.801 85.160   1.00 31.82  ? 520  GLU C O     1 
ATOM   7653  C  CB    . GLU C  2  520  ? 39.450  -38.218 82.604   1.00 31.45  ? 520  GLU C CB    1 
ATOM   7654  C  CG    . GLU C  2  520  ? 37.985  -37.820 82.589   1.00 51.78  ? 520  GLU C CG    1 
ATOM   7655  C  CD    . GLU C  2  520  ? 37.743  -36.522 81.839   1.00 62.75  ? 520  GLU C CD    1 
ATOM   7656  O  OE1   . GLU C  2  520  ? 36.813  -35.780 82.221   1.00 64.42  ? 520  GLU C OE1   1 
ATOM   7657  O  OE2   . GLU C  2  520  ? 38.482  -36.249 80.867   1.00 58.80  ? 520  GLU C OE2   1 
ATOM   7658  N  N     . PRO C  2  521  ? 39.838  -36.962 85.795   1.00 34.09  ? 521  PRO C N     1 
ATOM   7659  C  CA    . PRO C  2  521  ? 39.776  -37.353 87.209   1.00 30.26  ? 521  PRO C CA    1 
ATOM   7660  C  C     . PRO C  2  521  ? 38.851  -38.551 87.423   1.00 29.16  ? 521  PRO C C     1 
ATOM   7661  O  O     . PRO C  2  521  ? 37.723  -38.550 86.927   1.00 27.31  ? 521  PRO C O     1 
ATOM   7662  C  CB    . PRO C  2  521  ? 39.193  -36.110 87.890   1.00 25.12  ? 521  PRO C CB    1 
ATOM   7663  C  CG    . PRO C  2  521  ? 39.435  -34.988 86.927   1.00 23.22  ? 521  PRO C CG    1 
ATOM   7664  C  CD    . PRO C  2  521  ? 39.308  -35.606 85.577   1.00 29.84  ? 521  PRO C CD    1 
ATOM   7665  N  N     . VAL C  2  522  ? 39.320  -39.553 88.161   1.00 27.95  ? 522  VAL C N     1 
ATOM   7666  C  CA    . VAL C  2  522  ? 38.533  -40.764 88.381   1.00 30.23  ? 522  VAL C CA    1 
ATOM   7667  C  C     . VAL C  2  522  ? 38.829  -41.414 89.738   1.00 32.10  ? 522  VAL C C     1 
ATOM   7668  O  O     . VAL C  2  522  ? 39.974  -41.420 90.202   1.00 28.53  ? 522  VAL C O     1 
ATOM   7669  C  CB    . VAL C  2  522  ? 38.744  -41.781 87.231   1.00 26.35  ? 522  VAL C CB    1 
ATOM   7670  C  CG1   . VAL C  2  522  ? 40.207  -42.178 87.128   1.00 26.83  ? 522  VAL C CG1   1 
ATOM   7671  C  CG2   . VAL C  2  522  ? 37.860  -43.008 87.414   1.00 37.98  ? 522  VAL C CG2   1 
ATOM   7672  N  N     . ILE C  2  523  ? 37.786  -41.951 90.369   1.00 30.50  ? 523  ILE C N     1 
ATOM   7673  C  CA    . ILE C  2  523  ? 37.920  -42.637 91.650   1.00 34.94  ? 523  ILE C CA    1 
ATOM   7674  C  C     . ILE C  2  523  ? 38.159  -44.128 91.433   1.00 36.82  ? 523  ILE C C     1 
ATOM   7675  O  O     . ILE C  2  523  ? 37.345  -44.806 90.806   1.00 38.25  ? 523  ILE C O     1 
ATOM   7676  C  CB    . ILE C  2  523  ? 36.663  -42.447 92.520   1.00 32.83  ? 523  ILE C CB    1 
ATOM   7677  C  CG1   . ILE C  2  523  ? 36.344  -40.959 92.679   1.00 36.52  ? 523  ILE C CG1   1 
ATOM   7678  C  CG2   . ILE C  2  523  ? 36.844  -43.111 93.874   1.00 37.78  ? 523  ILE C CG2   1 
ATOM   7679  C  CD1   . ILE C  2  523  ? 37.486  -40.143 93.248   1.00 31.66  ? 523  ILE C CD1   1 
ATOM   7680  N  N     . VAL C  2  524  ? 39.279  -44.638 91.940   1.00 36.95  ? 524  VAL C N     1 
ATOM   7681  C  CA    . VAL C  2  524  ? 39.641  -46.037 91.704   1.00 30.42  ? 524  VAL C CA    1 
ATOM   7682  C  C     . VAL C  2  524  ? 40.146  -46.744 92.962   1.00 40.61  ? 524  VAL C C     1 
ATOM   7683  O  O     . VAL C  2  524  ? 40.424  -46.104 93.975   1.00 44.32  ? 524  VAL C O     1 
ATOM   7684  C  CB    . VAL C  2  524  ? 40.710  -46.175 90.597   1.00 33.81  ? 524  VAL C CB    1 
ATOM   7685  C  CG1   . VAL C  2  524  ? 40.158  -45.719 89.251   1.00 34.11  ? 524  VAL C CG1   1 
ATOM   7686  C  CG2   . VAL C  2  524  ? 41.967  -45.396 90.965   1.00 31.50  ? 524  VAL C CG2   1 
ATOM   7687  N  N     . SER C  2  525  ? 40.255  -48.068 92.884   1.00 40.27  ? 525  SER C N     1 
ATOM   7688  C  CA    . SER C  2  525  ? 40.791  -48.875 93.977   1.00 36.95  ? 525  SER C CA    1 
ATOM   7689  C  C     . SER C  2  525  ? 42.311  -48.982 93.870   1.00 35.22  ? 525  SER C C     1 
ATOM   7690  O  O     . SER C  2  525  ? 42.863  -48.846 92.778   1.00 37.66  ? 525  SER C O     1 
ATOM   7691  C  CB    . SER C  2  525  ? 40.160  -50.268 93.959   1.00 41.33  ? 525  SER C CB    1 
ATOM   7692  O  OG    . SER C  2  525  ? 38.785  -50.203 94.291   1.00 59.30  ? 525  SER C OG    1 
ATOM   7693  N  N     . PRO C  2  526  ? 42.995  -49.226 95.003   1.00 31.54  ? 526  PRO C N     1 
ATOM   7694  C  CA    . PRO C  2  526  ? 44.461  -49.329 95.023   1.00 34.00  ? 526  PRO C CA    1 
ATOM   7695  C  C     . PRO C  2  526  ? 45.000  -50.404 94.083   1.00 36.51  ? 526  PRO C C     1 
ATOM   7696  O  O     . PRO C  2  526  ? 46.184  -50.388 93.742   1.00 33.72  ? 526  PRO C O     1 
ATOM   7697  C  CB    . PRO C  2  526  ? 44.763  -49.709 96.475   1.00 34.34  ? 526  PRO C CB    1 
ATOM   7698  C  CG    . PRO C  2  526  ? 43.633  -49.148 97.240   1.00 38.24  ? 526  PRO C CG    1 
ATOM   7699  C  CD    . PRO C  2  526  ? 42.428  -49.296 96.361   1.00 33.95  ? 526  PRO C CD    1 
ATOM   7700  N  N     . GLU C  2  527  ? 44.137  -51.332 93.682   1.00 43.41  ? 527  GLU C N     1 
ATOM   7701  C  CA    . GLU C  2  527  ? 44.511  -52.373 92.734   1.00 38.55  ? 527  GLU C CA    1 
ATOM   7702  C  C     . GLU C  2  527  ? 44.622  -51.824 91.314   1.00 36.66  ? 527  GLU C C     1 
ATOM   7703  O  O     . GLU C  2  527  ? 45.328  -52.385 90.478   1.00 39.18  ? 527  GLU C O     1 
ATOM   7704  C  CB    . GLU C  2  527  ? 43.505  -53.528 92.776   1.00 34.75  ? 527  GLU C CB    1 
ATOM   7705  C  CG    . GLU C  2  527  ? 43.604  -54.414 94.016   1.00 49.16  ? 527  GLU C CG    1 
ATOM   7706  C  CD    . GLU C  2  527  ? 42.891  -53.834 95.229   1.00 58.60  ? 527  GLU C CD    1 
ATOM   7707  O  OE1   . GLU C  2  527  ? 42.054  -52.923 95.057   1.00 57.19  ? 527  GLU C OE1   1 
ATOM   7708  O  OE2   . GLU C  2  527  ? 43.167  -54.296 96.357   1.00 66.57  ? 527  GLU C OE2   1 
ATOM   7709  N  N     . GLU C  2  528  ? 43.925  -50.723 91.047   1.00 36.30  ? 528  GLU C N     1 
ATOM   7710  C  CA    . GLU C  2  528  ? 43.914  -50.134 89.712   1.00 33.70  ? 528  GLU C CA    1 
ATOM   7711  C  C     . GLU C  2  528  ? 44.967  -49.043 89.550   1.00 33.50  ? 528  GLU C C     1 
ATOM   7712  O  O     . GLU C  2  528  ? 45.043  -48.404 88.500   1.00 34.21  ? 528  GLU C O     1 
ATOM   7713  C  CB    . GLU C  2  528  ? 42.535  -49.558 89.389   1.00 31.42  ? 528  GLU C CB    1 
ATOM   7714  C  CG    . GLU C  2  528  ? 41.375  -50.461 89.751   1.00 37.85  ? 528  GLU C CG    1 
ATOM   7715  C  CD    . GLU C  2  528  ? 40.034  -49.841 89.410   1.00 48.03  ? 528  GLU C CD    1 
ATOM   7716  O  OE1   . GLU C  2  528  ? 39.160  -49.775 90.302   1.00 48.14  ? 528  GLU C OE1   1 
ATOM   7717  O  OE2   . GLU C  2  528  ? 39.854  -49.419 88.247   1.00 45.05  ? 528  GLU C OE2   1 
ATOM   7718  N  N     . VAL C  2  529  ? 45.779  -48.830 90.583   1.00 29.59  ? 529  VAL C N     1 
ATOM   7719  C  CA    . VAL C  2  529  ? 46.739  -47.732 90.569   1.00 27.32  ? 529  VAL C CA    1 
ATOM   7720  C  C     . VAL C  2  529  ? 48.091  -48.184 90.026   1.00 27.81  ? 529  VAL C C     1 
ATOM   7721  O  O     . VAL C  2  529  ? 48.808  -48.950 90.668   1.00 30.65  ? 529  VAL C O     1 
ATOM   7722  C  CB    . VAL C  2  529  ? 46.926  -47.136 91.985   1.00 27.74  ? 529  VAL C CB    1 
ATOM   7723  C  CG1   . VAL C  2  529  ? 48.092  -46.159 92.014   1.00 24.24  ? 529  VAL C CG1   1 
ATOM   7724  C  CG2   . VAL C  2  529  ? 45.643  -46.465 92.456   1.00 24.58  ? 529  VAL C CG2   1 
ATOM   7725  N  N     . GLU C  2  530  ? 48.420  -47.713 88.828   1.00 27.74  ? 530  GLU C N     1 
ATOM   7726  C  CA    . GLU C  2  530  ? 49.701  -48.014 88.192   1.00 32.02  ? 530  GLU C CA    1 
ATOM   7727  C  C     . GLU C  2  530  ? 50.839  -47.098 88.648   1.00 30.36  ? 530  GLU C C     1 
ATOM   7728  O  O     . GLU C  2  530  ? 51.961  -47.554 88.879   1.00 31.19  ? 530  GLU C O     1 
ATOM   7729  C  CB    . GLU C  2  530  ? 49.558  -47.995 86.665   1.00 32.34  ? 530  GLU C CB    1 
ATOM   7730  C  CG    . GLU C  2  530  ? 48.885  -49.242 86.095   1.00 36.37  ? 530  GLU C CG    1 
ATOM   7731  C  CD    . GLU C  2  530  ? 47.849  -48.925 85.029   1.00 41.41  ? 530  GLU C CD    1 
ATOM   7732  O  OE1   . GLU C  2  530  ? 46.929  -48.125 85.308   1.00 42.72  ? 530  GLU C OE1   1 
ATOM   7733  O  OE2   . GLU C  2  530  ? 47.952  -49.475 83.912   1.00 44.62  ? 530  GLU C OE2   1 
ATOM   7734  N  N     . PHE C  2  531  ? 50.545  -45.807 88.769   1.00 27.74  ? 531  PHE C N     1 
ATOM   7735  C  CA    . PHE C  2  531  ? 51.556  -44.825 89.145   1.00 26.08  ? 531  PHE C CA    1 
ATOM   7736  C  C     . PHE C  2  531  ? 51.020  -43.790 90.130   1.00 27.97  ? 531  PHE C C     1 
ATOM   7737  O  O     . PHE C  2  531  ? 49.811  -43.680 90.330   1.00 30.36  ? 531  PHE C O     1 
ATOM   7738  C  CB    . PHE C  2  531  ? 52.112  -44.120 87.908   1.00 25.25  ? 531  PHE C CB    1 
ATOM   7739  C  CG    . PHE C  2  531  ? 52.941  -45.007 87.022   1.00 29.27  ? 531  PHE C CG    1 
ATOM   7740  C  CD1   . PHE C  2  531  ? 54.279  -45.229 87.301   1.00 28.31  ? 531  PHE C CD1   1 
ATOM   7741  C  CD2   . PHE C  2  531  ? 52.385  -45.611 85.904   1.00 28.30  ? 531  PHE C CD2   1 
ATOM   7742  C  CE1   . PHE C  2  531  ? 55.047  -46.039 86.484   1.00 26.29  ? 531  PHE C CE1   1 
ATOM   7743  C  CE2   . PHE C  2  531  ? 53.148  -46.422 85.085   1.00 25.97  ? 531  PHE C CE2   1 
ATOM   7744  C  CZ    . PHE C  2  531  ? 54.480  -46.635 85.375   1.00 25.91  ? 531  PHE C CZ    1 
ATOM   7745  N  N     . MET C  2  532  ? 51.928  -43.028 90.738   1.00 27.19  ? 532  MET C N     1 
ATOM   7746  C  CA    . MET C  2  532  ? 51.547  -41.999 91.706   1.00 24.66  ? 532  MET C CA    1 
ATOM   7747  C  C     . MET C  2  532  ? 52.380  -40.726 91.523   1.00 22.88  ? 532  MET C C     1 
ATOM   7748  O  O     . MET C  2  532  ? 53.540  -40.792 91.129   1.00 25.59  ? 532  MET C O     1 
ATOM   7749  C  CB    . MET C  2  532  ? 51.695  -42.543 93.130   1.00 20.72  ? 532  MET C CB    1 
ATOM   7750  C  CG    . MET C  2  532  ? 51.189  -41.622 94.227   1.00 21.18  ? 532  MET C CG    1 
ATOM   7751  S  SD    . MET C  2  532  ? 51.121  -42.459 95.824   1.00 21.50  ? 532  MET C SD    1 
ATOM   7752  C  CE    . MET C  2  532  ? 50.859  -41.086 96.944   1.00 33.31  ? 532  MET C CE    1 
ATOM   7753  N  N     . ASP C  2  533  ? 51.783  -39.569 91.796   1.00 19.44  ? 533  ASP C N     1 
ATOM   7754  C  CA    . ASP C  2  533  ? 52.504  -38.301 91.720   1.00 19.89  ? 533  ASP C CA    1 
ATOM   7755  C  C     . ASP C  2  533  ? 53.693  -38.272 92.682   1.00 21.31  ? 533  ASP C C     1 
ATOM   7756  O  O     . ASP C  2  533  ? 53.643  -38.863 93.763   1.00 25.83  ? 533  ASP C O     1 
ATOM   7757  C  CB    . ASP C  2  533  ? 51.569  -37.128 92.033   1.00 24.64  ? 533  ASP C CB    1 
ATOM   7758  C  CG    . ASP C  2  533  ? 50.701  -36.729 90.852   1.00 27.18  ? 533  ASP C CG    1 
ATOM   7759  O  OD1   . ASP C  2  533  ? 50.442  -37.582 89.975   1.00 33.94  ? 533  ASP C OD1   1 
ATOM   7760  O  OD2   . ASP C  2  533  ? 50.276  -35.553 90.810   1.00 20.29  ? 533  ASP C OD2   1 
ATOM   7761  N  N     . VAL C  2  534  ? 54.759  -37.582 92.285   1.00 17.52  ? 534  VAL C N     1 
ATOM   7762  C  CA    . VAL C  2  534  ? 55.933  -37.422 93.140   1.00 17.15  ? 534  VAL C CA    1 
ATOM   7763  C  C     . VAL C  2  534  ? 55.648  -36.428 94.259   1.00 19.20  ? 534  VAL C C     1 
ATOM   7764  O  O     . VAL C  2  534  ? 56.047  -36.635 95.410   1.00 21.03  ? 534  VAL C O     1 
ATOM   7765  C  CB    . VAL C  2  534  ? 57.148  -36.934 92.333   1.00 18.28  ? 534  VAL C CB    1 
ATOM   7766  C  CG1   . VAL C  2  534  ? 58.276  -36.492 93.259   1.00 17.40  ? 534  VAL C CG1   1 
ATOM   7767  C  CG2   . VAL C  2  534  ? 57.621  -38.021 91.380   1.00 19.93  ? 534  VAL C CG2   1 
ATOM   7768  N  N     . SER C  2  535  ? 54.928  -35.366 93.907   1.00 21.18  ? 535  SER C N     1 
ATOM   7769  C  CA    . SER C  2  535  ? 54.614  -34.263 94.812   1.00 22.39  ? 535  SER C CA    1 
ATOM   7770  C  C     . SER C  2  535  ? 53.713  -33.283 94.074   1.00 20.71  ? 535  SER C C     1 
ATOM   7771  O  O     . SER C  2  535  ? 53.699  -33.266 92.845   1.00 22.83  ? 535  SER C O     1 
ATOM   7772  C  CB    . SER C  2  535  ? 55.896  -33.544 95.243   1.00 27.22  ? 535  SER C CB    1 
ATOM   7773  O  OG    . SER C  2  535  ? 55.616  -32.338 95.936   1.00 22.20  ? 535  SER C OG    1 
ATOM   7774  N  N     . PRO C  2  536  ? 52.940  -32.475 94.815   1.00 21.14  ? 536  PRO C N     1 
ATOM   7775  C  CA    . PRO C  2  536  ? 52.207  -31.394 94.146   1.00 18.42  ? 536  PRO C CA    1 
ATOM   7776  C  C     . PRO C  2  536  ? 53.150  -30.366 93.509   1.00 16.73  ? 536  PRO C C     1 
ATOM   7777  O  O     . PRO C  2  536  ? 52.781  -29.734 92.516   1.00 16.71  ? 536  PRO C O     1 
ATOM   7778  C  CB    . PRO C  2  536  ? 51.388  -30.762 95.280   1.00 15.66  ? 536  PRO C CB    1 
ATOM   7779  C  CG    . PRO C  2  536  ? 52.009  -31.264 96.551   1.00 21.10  ? 536  PRO C CG    1 
ATOM   7780  C  CD    . PRO C  2  536  ? 52.546  -32.617 96.227   1.00 24.10  ? 536  PRO C CD    1 
ATOM   7781  N  N     . LYS C  2  537  ? 54.360  -30.235 94.050   1.00 14.84  ? 537  LYS C N     1 
ATOM   7782  C  CA    . LYS C  2  537  ? 55.348  -29.290 93.536   1.00 13.11  ? 537  LYS C CA    1 
ATOM   7783  C  C     . LYS C  2  537  ? 55.580  -29.431 92.032   1.00 14.49  ? 537  LYS C C     1 
ATOM   7784  O  O     . LYS C  2  537  ? 55.953  -28.468 91.366   1.00 13.29  ? 537  LYS C O     1 
ATOM   7785  C  CB    . LYS C  2  537  ? 56.685  -29.461 94.261   1.00 13.09  ? 537  LYS C CB    1 
ATOM   7786  C  CG    . LYS C  2  537  ? 56.632  -29.224 95.757   1.00 22.35  ? 537  LYS C CG    1 
ATOM   7787  C  CD    . LYS C  2  537  ? 58.029  -29.292 96.367   1.00 23.43  ? 537  LYS C CD    1 
ATOM   7788  C  CE    . LYS C  2  537  ? 57.995  -29.069 97.872   1.00 26.48  ? 537  LYS C CE    1 
ATOM   7789  N  NZ    . LYS C  2  537  ? 57.353  -27.773 98.237   1.00 26.23  ? 537  LYS C NZ    1 
ATOM   7790  N  N     . GLN C  2  538  ? 55.360  -30.633 91.506   1.00 16.02  ? 538  GLN C N     1 
ATOM   7791  C  CA    . GLN C  2  538  ? 55.651  -30.925 90.105   1.00 16.02  ? 538  GLN C CA    1 
ATOM   7792  C  C     . GLN C  2  538  ? 54.640  -30.312 89.144   1.00 16.16  ? 538  GLN C C     1 
ATOM   7793  O  O     . GLN C  2  538  ? 54.906  -30.216 87.945   1.00 15.04  ? 538  GLN C O     1 
ATOM   7794  C  CB    . GLN C  2  538  ? 55.732  -32.438 89.868   1.00 19.16  ? 538  GLN C CB    1 
ATOM   7795  C  CG    . GLN C  2  538  ? 54.387  -33.144 89.839   1.00 17.92  ? 538  GLN C CG    1 
ATOM   7796  C  CD    . GLN C  2  538  ? 54.522  -34.645 89.675   1.00 17.58  ? 538  GLN C CD    1 
ATOM   7797  O  OE1   . GLN C  2  538  ? 54.263  -35.410 90.604   1.00 19.99  ? 538  GLN C OE1   1 
ATOM   7798  N  NE2   . GLN C  2  538  ? 54.932  -35.074 88.489   1.00 16.77  ? 538  GLN C NE2   1 
ATOM   7799  N  N     . VAL C  2  539  ? 53.485  -29.907 89.668   1.00 15.15  ? 539  VAL C N     1 
ATOM   7800  C  CA    . VAL C  2  539  ? 52.423  -29.344 88.832   1.00 13.42  ? 539  VAL C CA    1 
ATOM   7801  C  C     . VAL C  2  539  ? 52.678  -27.875 88.481   1.00 10.36  ? 539  VAL C C     1 
ATOM   7802  O  O     . VAL C  2  539  ? 52.180  -27.369 87.474   1.00 9.59   ? 539  VAL C O     1 
ATOM   7803  C  CB    . VAL C  2  539  ? 51.042  -29.512 89.506   1.00 12.62  ? 539  VAL C CB    1 
ATOM   7804  C  CG1   . VAL C  2  539  ? 49.923  -28.985 88.618   1.00 10.22  ? 539  VAL C CG1   1 
ATOM   7805  C  CG2   . VAL C  2  539  ? 50.808  -30.974 89.834   1.00 14.84  ? 539  VAL C CG2   1 
ATOM   7806  N  N     . PHE C  2  540  ? 53.492  -27.210 89.294   1.00 9.32   ? 540  PHE C N     1 
ATOM   7807  C  CA    . PHE C  2  540  ? 53.694  -25.772 89.168   1.00 8.86   ? 540  PHE C CA    1 
ATOM   7808  C  C     . PHE C  2  540  ? 55.152  -25.382 88.939   1.00 8.39   ? 540  PHE C C     1 
ATOM   7809  O  O     . PHE C  2  540  ? 56.061  -26.184 89.140   1.00 9.26   ? 540  PHE C O     1 
ATOM   7810  C  CB    . PHE C  2  540  ? 53.158  -25.055 90.408   1.00 9.62   ? 540  PHE C CB    1 
ATOM   7811  C  CG    . PHE C  2  540  ? 51.713  -25.331 90.687   1.00 8.53   ? 540  PHE C CG    1 
ATOM   7812  C  CD1   . PHE C  2  540  ? 50.720  -24.628 90.027   1.00 9.72   ? 540  PHE C CD1   1 
ATOM   7813  C  CD2   . PHE C  2  540  ? 51.346  -26.293 91.608   1.00 8.46   ? 540  PHE C CD2   1 
ATOM   7814  C  CE1   . PHE C  2  540  ? 49.386  -24.880 90.281   1.00 9.07   ? 540  PHE C CE1   1 
ATOM   7815  C  CE2   . PHE C  2  540  ? 50.017  -26.550 91.864   1.00 10.04  ? 540  PHE C CE2   1 
ATOM   7816  C  CZ    . PHE C  2  540  ? 49.035  -25.841 91.203   1.00 10.41  ? 540  PHE C CZ    1 
ATOM   7817  N  N     . SER C  2  541  ? 55.356  -24.137 88.519   1.00 8.55   ? 541  SER C N     1 
ATOM   7818  C  CA    . SER C  2  541  ? 56.685  -23.606 88.235   1.00 8.51   ? 541  SER C CA    1 
ATOM   7819  C  C     . SER C  2  541  ? 57.484  -23.390 89.509   1.00 7.78   ? 541  SER C C     1 
ATOM   7820  O  O     . SER C  2  541  ? 57.017  -23.696 90.604   1.00 9.05   ? 541  SER C O     1 
ATOM   7821  C  CB    . SER C  2  541  ? 56.568  -22.276 87.494   1.00 10.72  ? 541  SER C CB    1 
ATOM   7822  O  OG    . SER C  2  541  ? 55.896  -21.314 88.288   1.00 9.64   ? 541  SER C OG    1 
ATOM   7823  N  N     . VAL C  2  542  ? 58.693  -22.860 89.360   1.00 7.77   ? 542  VAL C N     1 
ATOM   7824  C  CA    . VAL C  2  542  ? 59.543  -22.581 90.511   1.00 9.26   ? 542  VAL C CA    1 
ATOM   7825  C  C     . VAL C  2  542  ? 59.021  -21.369 91.281   1.00 9.81   ? 542  VAL C C     1 
ATOM   7826  O  O     . VAL C  2  542  ? 59.023  -21.356 92.512   1.00 9.92   ? 542  VAL C O     1 
ATOM   7827  C  CB    . VAL C  2  542  ? 61.009  -22.358 90.098   1.00 8.82   ? 542  VAL C CB    1 
ATOM   7828  C  CG1   . VAL C  2  542  ? 61.875  -22.134 91.319   1.00 7.04   ? 542  VAL C CG1   1 
ATOM   7829  C  CG2   . VAL C  2  542  ? 61.520  -23.549 89.303   1.00 9.35   ? 542  VAL C CG2   1 
ATOM   7830  N  N     . ASN C  2  543  ? 58.562  -20.358 90.551   1.00 9.48   ? 543  ASN C N     1 
ATOM   7831  C  CA    . ASN C  2  543  ? 57.990  -19.168 91.173   1.00 8.55   ? 543  ASN C CA    1 
ATOM   7832  C  C     . ASN C  2  543  ? 56.684  -19.449 91.898   1.00 7.04   ? 543  ASN C C     1 
ATOM   7833  O  O     . ASN C  2  543  ? 56.503  -19.039 93.041   1.00 8.24   ? 543  ASN C O     1 
ATOM   7834  C  CB    . ASN C  2  543  ? 57.781  -18.069 90.136   1.00 9.86   ? 543  ASN C CB    1 
ATOM   7835  C  CG    . ASN C  2  543  ? 59.083  -17.493 89.644   1.00 11.94  ? 543  ASN C CG    1 
ATOM   7836  O  OD1   . ASN C  2  543  ? 59.831  -18.154 88.927   1.00 13.70  ? 543  ASN C OD1   1 
ATOM   7837  N  ND2   . ASN C  2  543  ? 59.369  -16.258 90.030   1.00 9.82   ? 543  ASN C ND2   1 
ATOM   7838  N  N     . THR C  2  544  ? 55.777  -20.149 91.224   1.00 7.29   ? 544  THR C N     1 
ATOM   7839  C  CA    . THR C  2  544  ? 54.490  -20.516 91.804   1.00 7.49   ? 544  THR C CA    1 
ATOM   7840  C  C     . THR C  2  544  ? 54.681  -21.388 93.048   1.00 9.04   ? 544  THR C C     1 
ATOM   7841  O  O     . THR C  2  544  ? 53.854  -21.381 93.961   1.00 9.13   ? 544  THR C O     1 
ATOM   7842  C  CB    . THR C  2  544  ? 53.605  -21.260 90.779   1.00 6.83   ? 544  THR C CB    1 
ATOM   7843  O  OG1   . THR C  2  544  ? 53.586  -20.535 89.544   1.00 6.33   ? 544  THR C OG1   1 
ATOM   7844  C  CG2   . THR C  2  544  ? 52.183  -21.401 91.291   1.00 6.09   ? 544  THR C CG2   1 
ATOM   7845  N  N     . ASN C  2  545  ? 55.788  -22.123 93.088   1.00 8.97   ? 545  ASN C N     1 
ATOM   7846  C  CA    . ASN C  2  545  ? 56.104  -22.967 94.237   1.00 10.11  ? 545  ASN C CA    1 
ATOM   7847  C  C     . ASN C  2  545  ? 56.578  -22.192 95.465   1.00 13.25  ? 545  ASN C C     1 
ATOM   7848  O  O     . ASN C  2  545  ? 56.780  -22.776 96.529   1.00 13.80  ? 545  ASN C O     1 
ATOM   7849  C  CB    . ASN C  2  545  ? 57.138  -24.029 93.862   1.00 10.07  ? 545  ASN C CB    1 
ATOM   7850  C  CG    . ASN C  2  545  ? 56.500  -25.316 93.384   1.00 13.33  ? 545  ASN C CG    1 
ATOM   7851  O  OD1   . ASN C  2  545  ? 56.160  -26.188 94.185   1.00 14.61  ? 545  ASN C OD1   1 
ATOM   7852  N  ND2   . ASN C  2  545  ? 56.332  -25.442 92.071   1.00 12.47  ? 545  ASN C ND2   1 
ATOM   7853  N  N     . LEU C  2  546  ? 56.766  -20.885 95.313   1.00 11.97  ? 546  LEU C N     1 
ATOM   7854  C  CA    . LEU C  2  546  ? 57.234  -20.050 96.413   1.00 9.61   ? 546  LEU C CA    1 
ATOM   7855  C  C     . LEU C  2  546  ? 56.088  -19.393 97.176   1.00 10.12  ? 546  LEU C C     1 
ATOM   7856  O  O     . LEU C  2  546  ? 56.316  -18.668 98.145   1.00 10.91  ? 546  LEU C O     1 
ATOM   7857  C  CB    . LEU C  2  546  ? 58.195  -18.982 95.897   1.00 7.80   ? 546  LEU C CB    1 
ATOM   7858  C  CG    . LEU C  2  546  ? 59.458  -19.533 95.247   1.00 8.22   ? 546  LEU C CG    1 
ATOM   7859  C  CD1   . LEU C  2  546  ? 60.373  -18.401 94.849   1.00 10.27  ? 546  LEU C CD1   1 
ATOM   7860  C  CD2   . LEU C  2  546  ? 60.164  -20.482 96.194   1.00 10.32  ? 546  LEU C CD2   1 
ATOM   7861  N  N     . ILE C  2  547  ? 54.860  -19.654 96.739   1.00 9.79   ? 547  ILE C N     1 
ATOM   7862  C  CA    . ILE C  2  547  ? 53.680  -19.057 97.356   1.00 10.71  ? 547  ILE C CA    1 
ATOM   7863  C  C     . ILE C  2  547  ? 53.075  -19.966 98.422   1.00 11.62  ? 547  ILE C C     1 
ATOM   7864  O  O     . ILE C  2  547  ? 52.467  -20.985 98.101   1.00 15.40  ? 547  ILE C O     1 
ATOM   7865  C  CB    . ILE C  2  547  ? 52.590  -18.781 96.308   1.00 7.88   ? 547  ILE C CB    1 
ATOM   7866  C  CG1   . ILE C  2  547  ? 53.130  -17.905 95.182   1.00 5.71   ? 547  ILE C CG1   1 
ATOM   7867  C  CG2   . ILE C  2  547  ? 51.379  -18.139 96.959   1.00 8.89   ? 547  ILE C CG2   1 
ATOM   7868  C  CD1   . ILE C  2  547  ? 52.143  -17.722 94.057   1.00 6.63   ? 547  ILE C CD1   1 
ATOM   7869  N  N     . PRO C  2  548  ? 53.224  -19.592 99.698   1.00 8.67   ? 548  PRO C N     1 
ATOM   7870  C  CA    . PRO C  2  548  ? 52.629  -20.390 100.773  1.00 9.08   ? 548  PRO C CA    1 
ATOM   7871  C  C     . PRO C  2  548  ? 51.114  -20.269 100.739  1.00 8.47   ? 548  PRO C C     1 
ATOM   7872  O  O     . PRO C  2  548  ? 50.606  -19.251 100.282  1.00 9.45   ? 548  PRO C O     1 
ATOM   7873  C  CB    . PRO C  2  548  ? 53.187  -19.739 102.037  1.00 11.20  ? 548  PRO C CB    1 
ATOM   7874  C  CG    . PRO C  2  548  ? 53.484  -18.340 101.637  1.00 13.03  ? 548  PRO C CG    1 
ATOM   7875  C  CD    . PRO C  2  548  ? 53.921  -18.401 100.207  1.00 10.10  ? 548  PRO C CD    1 
ATOM   7876  N  N     . PHE C  2  549  ? 50.413  -21.301 101.198  1.00 8.84   ? 549  PHE C N     1 
ATOM   7877  C  CA    . PHE C  2  549  ? 48.953  -21.330 101.177  1.00 9.79   ? 549  PHE C CA    1 
ATOM   7878  C  C     . PHE C  2  549  ? 48.381  -21.070 99.783   1.00 10.28  ? 549  PHE C C     1 
ATOM   7879  O  O     . PHE C  2  549  ? 47.304  -20.490 99.641   1.00 11.63  ? 549  PHE C O     1 
ATOM   7880  C  CB    . PHE C  2  549  ? 48.377  -20.338 102.188  1.00 10.32  ? 549  PHE C CB    1 
ATOM   7881  C  CG    . PHE C  2  549  ? 48.904  -20.525 103.579  1.00 12.70  ? 549  PHE C CG    1 
ATOM   7882  C  CD1   . PHE C  2  549  ? 48.428  -21.548 104.383  1.00 14.69  ? 549  PHE C CD1   1 
ATOM   7883  C  CD2   . PHE C  2  549  ? 49.878  -19.679 104.084  1.00 14.53  ? 549  PHE C CD2   1 
ATOM   7884  C  CE1   . PHE C  2  549  ? 48.916  -21.727 105.666  1.00 16.00  ? 549  PHE C CE1   1 
ATOM   7885  C  CE2   . PHE C  2  549  ? 50.369  -19.849 105.368  1.00 14.87  ? 549  PHE C CE2   1 
ATOM   7886  C  CZ    . PHE C  2  549  ? 49.887  -20.875 106.159  1.00 15.27  ? 549  PHE C CZ    1 
ATOM   7887  N  N     . LEU C  2  550  ? 49.107  -21.510 98.761   1.00 8.98   ? 550  LEU C N     1 
ATOM   7888  C  CA    . LEU C  2  550  ? 48.687  -21.327 97.378   1.00 9.08   ? 550  LEU C CA    1 
ATOM   7889  C  C     . LEU C  2  550  ? 47.317  -21.939 97.097   1.00 10.76  ? 550  LEU C C     1 
ATOM   7890  O  O     . LEU C  2  550  ? 46.589  -21.463 96.229   1.00 12.23  ? 550  LEU C O     1 
ATOM   7891  C  CB    . LEU C  2  550  ? 49.724  -21.923 96.427   1.00 8.94   ? 550  LEU C CB    1 
ATOM   7892  C  CG    . LEU C  2  550  ? 49.352  -21.934 94.945   1.00 9.04   ? 550  LEU C CG    1 
ATOM   7893  C  CD1   . LEU C  2  550  ? 49.211  -20.513 94.426   1.00 9.17   ? 550  LEU C CD1   1 
ATOM   7894  C  CD2   . LEU C  2  550  ? 50.371  -22.716 94.134   1.00 9.84   ? 550  LEU C CD2   1 
ATOM   7895  N  N     . GLU C  2  551  ? 46.963  -22.985 97.840   1.00 10.90  ? 551  GLU C N     1 
ATOM   7896  C  CA    . GLU C  2  551  ? 45.688  -23.664 97.624   1.00 12.47  ? 551  GLU C CA    1 
ATOM   7897  C  C     . GLU C  2  551  ? 44.502  -22.787 98.011   1.00 12.09  ? 551  GLU C C     1 
ATOM   7898  O  O     . GLU C  2  551  ? 43.362  -23.072 97.642   1.00 12.04  ? 551  GLU C O     1 
ATOM   7899  C  CB    . GLU C  2  551  ? 45.629  -24.999 98.377   1.00 12.46  ? 551  GLU C CB    1 
ATOM   7900  C  CG    . GLU C  2  551  ? 45.694  -24.889 99.894   1.00 14.10  ? 551  GLU C CG    1 
ATOM   7901  C  CD    . GLU C  2  551  ? 47.112  -24.982 100.429  1.00 15.24  ? 551  GLU C CD    1 
ATOM   7902  O  OE1   . GLU C  2  551  ? 47.291  -25.400 101.597  1.00 15.11  ? 551  GLU C OE1   1 
ATOM   7903  O  OE2   . GLU C  2  551  ? 48.049  -24.637 99.679   1.00 13.84  ? 551  GLU C OE2   1 
ATOM   7904  N  N     . HIS C  2  552  ? 44.777  -21.724 98.759   1.00 11.13  ? 552  HIS C N     1 
ATOM   7905  C  CA    . HIS C  2  552  ? 43.732  -20.799 99.184   1.00 13.81  ? 552  HIS C CA    1 
ATOM   7906  C  C     . HIS C  2  552  ? 43.632  -19.555 98.299   1.00 11.98  ? 552  HIS C C     1 
ATOM   7907  O  O     . HIS C  2  552  ? 42.780  -18.698 98.530   1.00 11.99  ? 552  HIS C O     1 
ATOM   7908  C  CB    . HIS C  2  552  ? 43.934  -20.400 100.648  1.00 15.46  ? 552  HIS C CB    1 
ATOM   7909  C  CG    . HIS C  2  552  ? 43.994  -21.563 101.591  1.00 14.93  ? 552  HIS C CG    1 
ATOM   7910  N  ND1   . HIS C  2  552  ? 42.865  -22.190 102.075  1.00 13.78  ? 552  HIS C ND1   1 
ATOM   7911  C  CD2   . HIS C  2  552  ? 45.048  -22.210 102.145  1.00 12.59  ? 552  HIS C CD2   1 
ATOM   7912  C  CE1   . HIS C  2  552  ? 43.221  -23.171 102.884  1.00 15.62  ? 552  HIS C CE1   1 
ATOM   7913  N  NE2   . HIS C  2  552  ? 44.541  -23.204 102.944  1.00 14.46  ? 552  HIS C NE2   1 
ATOM   7914  N  N     . ASP C  2  553  ? 44.501  -19.461 97.294   1.00 10.96  ? 553  ASP C N     1 
ATOM   7915  C  CA    . ASP C  2  553  ? 44.532  -18.304 96.397   1.00 9.78   ? 553  ASP C CA    1 
ATOM   7916  C  C     . ASP C  2  553  ? 43.946  -18.605 95.020   1.00 9.94   ? 553  ASP C C     1 
ATOM   7917  O  O     . ASP C  2  553  ? 44.298  -19.603 94.396   1.00 11.90  ? 553  ASP C O     1 
ATOM   7918  C  CB    . ASP C  2  553  ? 45.967  -17.799 96.221   1.00 9.42   ? 553  ASP C CB    1 
ATOM   7919  C  CG    . ASP C  2  553  ? 46.498  -17.096 97.454   1.00 11.89  ? 553  ASP C CG    1 
ATOM   7920  O  OD1   . ASP C  2  553  ? 45.677  -16.603 98.257   1.00 15.96  ? 553  ASP C OD1   1 
ATOM   7921  O  OD2   . ASP C  2  553  ? 47.736  -17.028 97.618   1.00 8.46   ? 553  ASP C OD2   1 
ATOM   7922  N  N     . ASP C  2  554  ? 43.073  -17.725 94.539   1.00 10.22  ? 554  ASP C N     1 
ATOM   7923  C  CA    . ASP C  2  554  ? 42.527  -17.846 93.190   1.00 9.86   ? 554  ASP C CA    1 
ATOM   7924  C  C     . ASP C  2  554  ? 43.646  -17.779 92.154   1.00 9.31   ? 554  ASP C C     1 
ATOM   7925  O  O     . ASP C  2  554  ? 44.671  -17.134 92.371   1.00 10.20  ? 554  ASP C O     1 
ATOM   7926  C  CB    . ASP C  2  554  ? 41.494  -16.747 92.923   1.00 14.28  ? 554  ASP C CB    1 
ATOM   7927  C  CG    . ASP C  2  554  ? 40.860  -16.858 91.542   1.00 19.66  ? 554  ASP C CG    1 
ATOM   7928  O  OD1   . ASP C  2  554  ? 41.454  -16.348 90.566   1.00 19.64  ? 554  ASP C OD1   1 
ATOM   7929  O  OD2   . ASP C  2  554  ? 39.766  -17.453 91.431   1.00 22.94  ? 554  ASP C OD2   1 
ATOM   7930  N  N     . ALA C  2  555  ? 43.431  -18.452 91.030   1.00 10.45  ? 555  ALA C N     1 
ATOM   7931  C  CA    . ALA C  2  555  ? 44.443  -18.611 89.990   1.00 11.20  ? 555  ALA C CA    1 
ATOM   7932  C  C     . ALA C  2  555  ? 45.064  -17.307 89.496   1.00 12.10  ? 555  ALA C C     1 
ATOM   7933  O  O     . ALA C  2  555  ? 46.277  -17.226 89.318   1.00 13.56  ? 555  ALA C O     1 
ATOM   7934  C  CB    . ALA C  2  555  ? 43.867  -19.392 88.818   1.00 13.16  ? 555  ALA C CB    1 
ATOM   7935  N  N     . ASN C  2  556  ? 44.238  -16.292 89.270   1.00 11.53  ? 556  ASN C N     1 
ATOM   7936  C  CA    . ASN C  2  556  ? 44.714  -15.062 88.646   1.00 11.04  ? 556  ASN C CA    1 
ATOM   7937  C  C     . ASN C  2  556  ? 45.642  -14.237 89.539   1.00 10.55  ? 556  ASN C C     1 
ATOM   7938  O  O     . ASN C  2  556  ? 46.722  -13.820 89.110   1.00 13.37  ? 556  ASN C O     1 
ATOM   7939  C  CB    . ASN C  2  556  ? 43.534  -14.233 88.143   1.00 11.49  ? 556  ASN C CB    1 
ATOM   7940  C  CG    . ASN C  2  556  ? 42.593  -15.045 87.274   1.00 14.71  ? 556  ASN C CG    1 
ATOM   7941  O  OD1   . ASN C  2  556  ? 42.780  -15.147 86.060   1.00 17.31  ? 556  ASN C OD1   1 
ATOM   7942  N  ND2   . ASN C  2  556  ? 41.582  -15.644 87.896   1.00 13.98  ? 556  ASN C ND2   1 
ATOM   7943  N  N     . ARG C  2  557  ? 45.230  -14.016 90.781   1.00 9.40   ? 557  ARG C N     1 
ATOM   7944  C  CA    . ARG C  2  557  ? 46.092  -13.332 91.737   1.00 11.49  ? 557  ARG C CA    1 
ATOM   7945  C  C     . ARG C  2  557  ? 47.366  -14.130 91.988   1.00 13.55  ? 557  ARG C C     1 
ATOM   7946  O  O     . ARG C  2  557  ? 48.432  -13.549 92.212   1.00 14.32  ? 557  ARG C O     1 
ATOM   7947  C  CB    . ARG C  2  557  ? 45.360  -13.076 93.053   1.00 14.37  ? 557  ARG C CB    1 
ATOM   7948  C  CG    . ARG C  2  557  ? 44.409  -11.898 93.000   1.00 15.94  ? 557  ARG C CG    1 
ATOM   7949  C  CD    . ARG C  2  557  ? 45.159  -10.596 92.778   1.00 12.39  ? 557  ARG C CD    1 
ATOM   7950  N  NE    . ARG C  2  557  ? 44.378  -9.664  91.972   1.00 13.35  ? 557  ARG C NE    1 
ATOM   7951  C  CZ    . ARG C  2  557  ? 44.675  -8.380  91.814   1.00 14.03  ? 557  ARG C CZ    1 
ATOM   7952  N  NH1   . ARG C  2  557  ? 45.738  -7.866  92.417   1.00 12.42  ? 557  ARG C NH1   1 
ATOM   7953  N  NH2   . ARG C  2  557  ? 43.906  -7.608  91.058   1.00 16.01  ? 557  ARG C NH2   1 
ATOM   7954  N  N     . ALA C  2  558  ? 47.251  -15.458 91.946   1.00 10.32  ? 558  ALA C N     1 
ATOM   7955  C  CA    . ALA C  2  558  ? 48.408  -16.336 92.094   1.00 7.87   ? 558  ALA C CA    1 
ATOM   7956  C  C     . ALA C  2  558  ? 49.383  -16.083 90.958   1.00 8.31   ? 558  ALA C C     1 
ATOM   7957  O  O     . ALA C  2  558  ? 50.596  -16.028 91.164   1.00 7.93   ? 558  ALA C O     1 
ATOM   7958  C  CB    . ALA C  2  558  ? 47.976  -17.785 92.102   1.00 8.30   ? 558  ALA C CB    1 
ATOM   7959  N  N     . LEU C  2  559  ? 48.833  -15.934 89.756   1.00 9.78   ? 559  LEU C N     1 
ATOM   7960  C  CA    . LEU C  2  559  ? 49.614  -15.583 88.579   1.00 10.46  ? 559  LEU C CA    1 
ATOM   7961  C  C     . LEU C  2  559  ? 50.360  -14.284 88.834   1.00 11.12  ? 559  LEU C C     1 
ATOM   7962  O  O     . LEU C  2  559  ? 51.564  -14.187 88.589   1.00 13.06  ? 559  LEU C O     1 
ATOM   7963  C  CB    . LEU C  2  559  ? 48.694  -15.443 87.362   1.00 8.57   ? 559  LEU C CB    1 
ATOM   7964  C  CG    . LEU C  2  559  ? 49.219  -14.880 86.039   1.00 8.98   ? 559  LEU C CG    1 
ATOM   7965  C  CD1   . LEU C  2  559  ? 48.395  -15.436 84.897   1.00 11.73  ? 559  LEU C CD1   1 
ATOM   7966  C  CD2   . LEU C  2  559  ? 49.153  -13.369 86.017   1.00 10.37  ? 559  LEU C CD2   1 
ATOM   7967  N  N     . MET C  2  560  ? 49.635  -13.284 89.323   1.00 10.90  ? 560  MET C N     1 
ATOM   7968  C  CA    . MET C  2  560  ? 50.239  -11.984 89.582   1.00 9.93   ? 560  MET C CA    1 
ATOM   7969  C  C     . MET C  2  560  ? 51.384  -12.065 90.581   1.00 9.43   ? 560  MET C C     1 
ATOM   7970  O  O     . MET C  2  560  ? 52.443  -11.499 90.348   1.00 12.80  ? 560  MET C O     1 
ATOM   7971  C  CB    . MET C  2  560  ? 49.192  -10.977 90.055   1.00 14.61  ? 560  MET C CB    1 
ATOM   7972  C  CG    . MET C  2  560  ? 48.305  -10.460 88.942   1.00 17.32  ? 560  MET C CG    1 
ATOM   7973  S  SD    . MET C  2  560  ? 47.024  -9.354  89.540   1.00 17.17  ? 560  MET C SD    1 
ATOM   7974  C  CE    . MET C  2  560  ? 46.122  -9.036  88.025   1.00 27.81  ? 560  MET C CE    1 
ATOM   7975  N  N     . GLY C  2  561  ? 51.174  -12.770 91.687   1.00 7.74   ? 561  GLY C N     1 
ATOM   7976  C  CA    . GLY C  2  561  ? 52.204  -12.889 92.706   1.00 8.18   ? 561  GLY C CA    1 
ATOM   7977  C  C     . GLY C  2  561  ? 53.427  -13.606 92.172   1.00 8.09   ? 561  GLY C C     1 
ATOM   7978  O  O     . GLY C  2  561  ? 54.571  -13.159 92.344   1.00 11.01  ? 561  GLY C O     1 
ATOM   7979  N  N     . SER C  2  562  ? 53.168  -14.722 91.501   1.00 9.48   ? 562  SER C N     1 
ATOM   7980  C  CA    . SER C  2  562  ? 54.213  -15.528 90.895   1.00 9.62   ? 562  SER C CA    1 
ATOM   7981  C  C     . SER C  2  562  ? 55.071  -14.678 89.968   1.00 9.71   ? 562  SER C C     1 
ATOM   7982  O  O     . SER C  2  562  ? 56.297  -14.744 90.017   1.00 9.83   ? 562  SER C O     1 
ATOM   7983  C  CB    . SER C  2  562  ? 53.594  -16.695 90.124   1.00 8.71   ? 562  SER C CB    1 
ATOM   7984  O  OG    . SER C  2  562  ? 54.567  -17.676 89.824   1.00 12.62  ? 562  SER C OG    1 
ATOM   7985  N  N     . ASN C  2  563  ? 54.418  -13.870 89.136   1.00 11.94  ? 563  ASN C N     1 
ATOM   7986  C  CA    . ASN C  2  563  ? 55.125  -12.986 88.213   1.00 11.82  ? 563  ASN C CA    1 
ATOM   7987  C  C     . ASN C  2  563  ? 55.909  -11.900 88.930   1.00 9.16   ? 563  ASN C C     1 
ATOM   7988  O  O     . ASN C  2  563  ? 57.062  -11.629 88.604   1.00 10.39  ? 563  ASN C O     1 
ATOM   7989  C  CB    . ASN C  2  563  ? 54.150  -12.333 87.231   1.00 14.57  ? 563  ASN C CB    1 
ATOM   7990  C  CG    . ASN C  2  563  ? 53.728  -13.268 86.117   1.00 22.39  ? 563  ASN C CG    1 
ATOM   7991  O  OD1   . ASN C  2  563  ? 54.509  -14.107 85.662   1.00 22.34  ? 563  ASN C OD1   1 
ATOM   7992  N  ND2   . ASN C  2  563  ? 52.487  -13.128 85.669   1.00 25.31  ? 563  ASN C ND2   1 
ATOM   7993  N  N     . MET C  2  564  ? 55.271  -11.279 89.910   1.00 8.09   ? 564  MET C N     1 
ATOM   7994  C  CA    . MET C  2  564  ? 55.848  -10.125 90.572   1.00 7.76   ? 564  MET C CA    1 
ATOM   7995  C  C     . MET C  2  564  ? 57.061  -10.488 91.400   1.00 8.38   ? 564  MET C C     1 
ATOM   7996  O  O     . MET C  2  564  ? 57.914  -9.642  91.658   1.00 9.89   ? 564  MET C O     1 
ATOM   7997  C  CB    . MET C  2  564  ? 54.801  -9.424  91.427   1.00 5.90   ? 564  MET C CB    1 
ATOM   7998  C  CG    . MET C  2  564  ? 53.811  -8.648  90.599   1.00 8.34   ? 564  MET C CG    1 
ATOM   7999  S  SD    . MET C  2  564  ? 52.668  -7.735  91.626   1.00 28.31  ? 564  MET C SD    1 
ATOM   8000  C  CE    . MET C  2  564  ? 52.036  -9.058  92.653   1.00 11.59  ? 564  MET C CE    1 
ATOM   8001  N  N     . GLN C  2  565  ? 57.152  -11.748 91.805   1.00 9.36   ? 565  GLN C N     1 
ATOM   8002  C  CA    . GLN C  2  565  ? 58.322  -12.187 92.557   1.00 9.29   ? 565  GLN C CA    1 
ATOM   8003  C  C     . GLN C  2  565  ? 59.633  -12.020 91.780   1.00 10.32  ? 565  GLN C C     1 
ATOM   8004  O  O     . GLN C  2  565  ? 60.706  -11.953 92.376   1.00 13.40  ? 565  GLN C O     1 
ATOM   8005  C  CB    . GLN C  2  565  ? 58.153  -13.629 93.027   1.00 8.71   ? 565  GLN C CB    1 
ATOM   8006  C  CG    . GLN C  2  565  ? 58.033  -13.757 94.525   1.00 7.18   ? 565  GLN C CG    1 
ATOM   8007  C  CD    . GLN C  2  565  ? 57.517  -15.112 94.941   1.00 10.19  ? 565  GLN C CD    1 
ATOM   8008  O  OE1   . GLN C  2  565  ? 57.988  -15.695 95.918   1.00 14.99  ? 565  GLN C OE1   1 
ATOM   8009  N  NE2   . GLN C  2  565  ? 56.538  -15.623 94.202   1.00 8.71   ? 565  GLN C NE2   1 
ATOM   8010  N  N     . THR C  2  566  ? 59.550  -11.942 90.456   1.00 7.68   ? 566  THR C N     1 
ATOM   8011  C  CA    . THR C  2  566  ? 60.743  -11.741 89.642   1.00 8.48   ? 566  THR C CA    1 
ATOM   8012  C  C     . THR C  2  566  ? 61.054  -10.255 89.494   1.00 10.36  ? 566  THR C C     1 
ATOM   8013  O  O     . THR C  2  566  ? 62.084  -9.872  88.936   1.00 9.58   ? 566  THR C O     1 
ATOM   8014  C  CB    . THR C  2  566  ? 60.578  -12.347 88.246   1.00 10.77  ? 566  THR C CB    1 
ATOM   8015  O  OG1   . THR C  2  566  ? 59.929  -11.403 87.385   1.00 13.98  ? 566  THR C OG1   1 
ATOM   8016  C  CG2   . THR C  2  566  ? 59.751  -13.605 88.321   1.00 11.66  ? 566  THR C CG2   1 
ATOM   8017  N  N     . GLN C  2  567  ? 60.139  -9.421  89.973   1.00 10.94  ? 567  GLN C N     1 
ATOM   8018  C  CA    . GLN C  2  567  ? 60.329  -7.980  89.937   1.00 8.67   ? 567  GLN C CA    1 
ATOM   8019  C  C     . GLN C  2  567  ? 60.851  -7.470  91.270   1.00 8.16   ? 567  GLN C C     1 
ATOM   8020  O  O     . GLN C  2  567  ? 61.111  -6.279  91.427   1.00 9.82   ? 567  GLN C O     1 
ATOM   8021  C  CB    . GLN C  2  567  ? 59.015  -7.284  89.592   1.00 8.66   ? 567  GLN C CB    1 
ATOM   8022  C  CG    . GLN C  2  567  ? 58.441  -7.694  88.253   1.00 8.27   ? 567  GLN C CG    1 
ATOM   8023  C  CD    . GLN C  2  567  ? 57.091  -7.069  87.988   1.00 11.75  ? 567  GLN C CD    1 
ATOM   8024  O  OE1   . GLN C  2  567  ? 56.530  -6.383  88.841   1.00 12.80  ? 567  GLN C OE1   1 
ATOM   8025  N  NE2   . GLN C  2  567  ? 56.558  -7.303  86.798   1.00 26.04  ? 567  GLN C NE2   1 
ATOM   8026  N  N     . ALA C  2  568  ? 61.001  -8.377  92.230   1.00 8.37   ? 568  ALA C N     1 
ATOM   8027  C  CA    . ALA C  2  568  ? 61.427  -7.996  93.572   1.00 9.33   ? 568  ALA C CA    1 
ATOM   8028  C  C     . ALA C  2  568  ? 62.846  -7.442  93.564   1.00 8.78   ? 568  ALA C C     1 
ATOM   8029  O  O     . ALA C  2  568  ? 63.751  -8.032  92.976   1.00 10.49  ? 568  ALA C O     1 
ATOM   8030  C  CB    . ALA C  2  568  ? 61.315  -9.176  94.528   1.00 8.89   ? 568  ALA C CB    1 
ATOM   8031  N  N     . VAL C  2  569  ? 63.029  -6.297  94.208   1.00 8.11   ? 569  VAL C N     1 
ATOM   8032  C  CA    . VAL C  2  569  ? 64.337  -5.666  94.280   1.00 8.55   ? 569  VAL C CA    1 
ATOM   8033  C  C     . VAL C  2  569  ? 65.077  -6.157  95.513   1.00 12.01  ? 569  VAL C C     1 
ATOM   8034  O  O     . VAL C  2  569  ? 64.500  -6.209  96.600   1.00 12.61  ? 569  VAL C O     1 
ATOM   8035  C  CB    . VAL C  2  569  ? 64.216  -4.133  94.331   1.00 7.85   ? 569  VAL C CB    1 
ATOM   8036  C  CG1   . VAL C  2  569  ? 65.527  -3.512  94.723   1.00 7.27   ? 569  VAL C CG1   1 
ATOM   8037  C  CG2   . VAL C  2  569  ? 63.773  -3.600  92.988   1.00 10.85  ? 569  VAL C CG2   1 
ATOM   8038  N  N     . PRO C  2  570  ? 66.352  -6.547  95.341   1.00 11.94  ? 570  PRO C N     1 
ATOM   8039  C  CA    . PRO C  2  570  ? 67.206  -6.944  96.465   1.00 12.13  ? 570  PRO C CA    1 
ATOM   8040  C  C     . PRO C  2  570  ? 67.396  -5.794  97.453   1.00 12.34  ? 570  PRO C C     1 
ATOM   8041  O  O     . PRO C  2  570  ? 67.757  -4.684  97.059   1.00 12.06  ? 570  PRO C O     1 
ATOM   8042  C  CB    . PRO C  2  570  ? 68.534  -7.285  95.787   1.00 10.69  ? 570  PRO C CB    1 
ATOM   8043  C  CG    . PRO C  2  570  ? 68.159  -7.654  94.398   1.00 9.55   ? 570  PRO C CG    1 
ATOM   8044  C  CD    . PRO C  2  570  ? 67.020  -6.749  94.046   1.00 9.51   ? 570  PRO C CD    1 
ATOM   8045  N  N     . LEU C  2  571  ? 67.161  -6.075  98.729   1.00 9.88   ? 571  LEU C N     1 
ATOM   8046  C  CA    . LEU C  2  571  ? 67.215  -5.056  99.763   1.00 10.71  ? 571  LEU C CA    1 
ATOM   8047  C  C     . LEU C  2  571  ? 68.442  -5.274  100.629  1.00 14.33  ? 571  LEU C C     1 
ATOM   8048  O  O     . LEU C  2  571  ? 68.863  -6.412  100.830  1.00 16.09  ? 571  LEU C O     1 
ATOM   8049  C  CB    . LEU C  2  571  ? 65.960  -5.131  100.624  1.00 11.37  ? 571  LEU C CB    1 
ATOM   8050  C  CG    . LEU C  2  571  ? 64.643  -5.164  99.854   1.00 9.92   ? 571  LEU C CG    1 
ATOM   8051  C  CD1   . LEU C  2  571  ? 63.481  -5.348  100.809  1.00 12.57  ? 571  LEU C CD1   1 
ATOM   8052  C  CD2   . LEU C  2  571  ? 64.478  -3.889  99.049   1.00 13.23  ? 571  LEU C CD2   1 
ATOM   8053  N  N     . ILE C  2  572  ? 69.013  -4.188  101.146  1.00 13.84  ? 572  ILE C N     1 
ATOM   8054  C  CA    . ILE C  2  572  ? 70.235  -4.282  101.941  1.00 13.18  ? 572  ILE C CA    1 
ATOM   8055  C  C     . ILE C  2  572  ? 70.025  -5.042  103.254  1.00 12.82  ? 572  ILE C C     1 
ATOM   8056  O  O     . ILE C  2  572  ? 70.922  -5.732  103.734  1.00 15.46  ? 572  ILE C O     1 
ATOM   8057  C  CB    . ILE C  2  572  ? 70.851  -2.892  102.211  1.00 10.89  ? 572  ILE C CB    1 
ATOM   8058  C  CG1   . ILE C  2  572  ? 69.927  -2.047  103.089  1.00 14.91  ? 572  ILE C CG1   1 
ATOM   8059  C  CG2   . ILE C  2  572  ? 71.131  -2.180  100.899  1.00 10.96  ? 572  ILE C CG2   1 
ATOM   8060  C  CD1   . ILE C  2  572  ? 70.537  -0.732  103.527  1.00 16.40  ? 572  ILE C CD1   1 
ATOM   8061  N  N     . ARG C  2  573  ? 68.845  -4.890  103.841  1.00 9.75   ? 573  ARG C N     1 
ATOM   8062  C  CA    . ARG C  2  573  ? 68.487  -5.607  105.057  1.00 10.94  ? 573  ARG C CA    1 
ATOM   8063  C  C     . ARG C  2  573  ? 67.633  -6.866  104.845  1.00 15.49  ? 573  ARG C C     1 
ATOM   8064  O  O     . ARG C  2  573  ? 67.123  -7.440  105.811  1.00 18.77  ? 573  ARG C O     1 
ATOM   8065  C  CB    . ARG C  2  573  ? 67.882  -4.662  106.091  1.00 11.78  ? 573  ARG C CB    1 
ATOM   8066  C  CG    . ARG C  2  573  ? 68.853  -3.578  106.523  1.00 14.89  ? 573  ARG C CG    1 
ATOM   8067  C  CD    . ARG C  2  573  ? 68.474  -2.983  107.869  1.00 22.12  ? 573  ARG C CD    1 
ATOM   8068  N  NE    . ARG C  2  573  ? 68.856  -3.842  108.986  1.00 18.97  ? 573  ARG C NE    1 
ATOM   8069  C  CZ    . ARG C  2  573  ? 68.436  -3.666  110.234  1.00 22.24  ? 573  ARG C CZ    1 
ATOM   8070  N  NH1   . ARG C  2  573  ? 67.612  -2.668  110.521  1.00 18.44  ? 573  ARG C NH1   1 
ATOM   8071  N  NH2   . ARG C  2  573  ? 68.829  -4.491  111.194  1.00 35.73  ? 573  ARG C NH2   1 
ATOM   8072  N  N     . ALA C  2  574  ? 67.464  -7.272  103.588  1.00 10.79  ? 574  ALA C N     1 
ATOM   8073  C  CA    . ALA C  2  574  ? 66.476  -8.288  103.196  1.00 12.99  ? 574  ALA C CA    1 
ATOM   8074  C  C     . ALA C  2  574  ? 66.467  -9.580  104.018  1.00 11.46  ? 574  ALA C C     1 
ATOM   8075  O  O     . ALA C  2  574  ? 67.514  -10.086 104.415  1.00 14.24  ? 574  ALA C O     1 
ATOM   8076  C  CB    . ALA C  2  574  ? 66.623  -8.617  101.716  1.00 15.36  ? 574  ALA C CB    1 
ATOM   8077  N  N     . GLN C  2  575  ? 65.265  -10.086 104.284  1.00 10.45  ? 575  GLN C N     1 
ATOM   8078  C  CA    . GLN C  2  575  ? 65.085  -11.317 105.045  1.00 12.96  ? 575  GLN C CA    1 
ATOM   8079  C  C     . GLN C  2  575  ? 64.223  -12.329 104.293  1.00 14.13  ? 575  GLN C C     1 
ATOM   8080  O  O     . GLN C  2  575  ? 63.466  -11.965 103.397  1.00 14.47  ? 575  GLN C O     1 
ATOM   8081  C  CB    . GLN C  2  575  ? 64.450  -11.006 106.401  1.00 15.59  ? 575  GLN C CB    1 
ATOM   8082  C  CG    . GLN C  2  575  ? 64.021  -9.561  106.558  1.00 14.06  ? 575  GLN C CG    1 
ATOM   8083  C  CD    . GLN C  2  575  ? 63.178  -9.327  107.796  1.00 16.33  ? 575  GLN C CD    1 
ATOM   8084  O  OE1   . GLN C  2  575  ? 62.311  -8.449  107.811  1.00 16.04  ? 575  GLN C OE1   1 
ATOM   8085  N  NE2   . GLN C  2  575  ? 63.427  -10.111 108.842  1.00 16.91  ? 575  GLN C NE2   1 
ATOM   8086  N  N     . ALA C  2  576  ? 64.357  -13.602 104.652  1.00 17.12  ? 576  ALA C N     1 
ATOM   8087  C  CA    . ALA C  2  576  ? 63.517  -14.658 104.101  1.00 13.17  ? 576  ALA C CA    1 
ATOM   8088  C  C     . ALA C  2  576  ? 62.167  -14.601 104.798  1.00 15.06  ? 576  ALA C C     1 
ATOM   8089  O  O     . ALA C  2  576  ? 62.080  -14.129 105.928  1.00 17.98  ? 576  ALA C O     1 
ATOM   8090  C  CB    . ALA C  2  576  ? 64.170  -16.012 104.313  1.00 15.60  ? 576  ALA C CB    1 
ATOM   8091  N  N     . PRO C  2  577  ? 61.104  -15.075 104.127  1.00 15.65  ? 577  PRO C N     1 
ATOM   8092  C  CA    . PRO C  2  577  ? 59.745  -14.994 104.680  1.00 16.20  ? 577  PRO C CA    1 
ATOM   8093  C  C     . PRO C  2  577  ? 59.571  -15.791 105.971  1.00 16.34  ? 577  PRO C C     1 
ATOM   8094  O  O     . PRO C  2  577  ? 60.172  -16.855 106.110  1.00 18.96  ? 577  PRO C O     1 
ATOM   8095  C  CB    . PRO C  2  577  ? 58.883  -15.615 103.575  1.00 17.32  ? 577  PRO C CB    1 
ATOM   8096  C  CG    . PRO C  2  577  ? 59.687  -15.465 102.332  1.00 16.92  ? 577  PRO C CG    1 
ATOM   8097  C  CD    . PRO C  2  577  ? 61.107  -15.626 102.761  1.00 16.74  ? 577  PRO C CD    1 
ATOM   8098  N  N     . VAL C  2  578  ? 58.758  -15.279 106.894  1.00 16.11  ? 578  VAL C N     1 
ATOM   8099  C  CA    . VAL C  2  578  ? 58.451  -15.992 108.133  1.00 16.89  ? 578  VAL C CA    1 
ATOM   8100  C  C     . VAL C  2  578  ? 57.757  -17.310 107.814  1.00 18.94  ? 578  VAL C C     1 
ATOM   8101  O  O     . VAL C  2  578  ? 57.953  -18.315 108.501  1.00 24.37  ? 578  VAL C O     1 
ATOM   8102  C  CB    . VAL C  2  578  ? 57.554  -15.158 109.068  1.00 15.97  ? 578  VAL C CB    1 
ATOM   8103  C  CG1   . VAL C  2  578  ? 57.237  -15.933 110.340  1.00 17.61  ? 578  VAL C CG1   1 
ATOM   8104  C  CG2   . VAL C  2  578  ? 58.224  -13.842 109.411  1.00 17.00  ? 578  VAL C CG2   1 
ATOM   8105  N  N     . VAL C  2  579  ? 56.949  -17.302 106.761  1.00 13.79  ? 579  VAL C N     1 
ATOM   8106  C  CA    . VAL C  2  579  ? 56.349  -18.526 106.258  1.00 14.07  ? 579  VAL C CA    1 
ATOM   8107  C  C     . VAL C  2  579  ? 56.925  -18.842 104.885  1.00 17.30  ? 579  VAL C C     1 
ATOM   8108  O  O     . VAL C  2  579  ? 56.770  -18.054 103.952  1.00 17.36  ? 579  VAL C O     1 
ATOM   8109  C  CB    . VAL C  2  579  ? 54.826  -18.394 106.146  1.00 12.95  ? 579  VAL C CB    1 
ATOM   8110  C  CG1   . VAL C  2  579  ? 54.220  -19.673 105.595  1.00 10.37  ? 579  VAL C CG1   1 
ATOM   8111  C  CG2   . VAL C  2  579  ? 54.233  -18.059 107.500  1.00 20.94  ? 579  VAL C CG2   1 
ATOM   8112  N  N     . MET C  2  580  ? 57.595  -19.986 104.759  1.00 17.67  ? 580  MET C N     1 
ATOM   8113  C  CA    . MET C  2  580  ? 58.171  -20.374 103.476  1.00 16.33  ? 580  MET C CA    1 
ATOM   8114  C  C     . MET C  2  580  ? 57.507  -21.623 102.916  1.00 16.08  ? 580  MET C C     1 
ATOM   8115  O  O     . MET C  2  580  ? 56.701  -22.263 103.590  1.00 18.69  ? 580  MET C O     1 
ATOM   8116  C  CB    . MET C  2  580  ? 59.661  -20.647 103.650  1.00 16.64  ? 580  MET C CB    1 
ATOM   8117  C  CG    . MET C  2  580  ? 60.461  -19.454 104.129  1.00 20.44  ? 580  MET C CG    1 
ATOM   8118  S  SD    . MET C  2  580  ? 62.123  -19.926 104.645  1.00 24.60  ? 580  MET C SD    1 
ATOM   8119  C  CE    . MET C  2  580  ? 61.748  -20.977 106.045  1.00 19.58  ? 580  MET C CE    1 
ATOM   8120  N  N     . THR C  2  581  ? 57.845  -21.969 101.678  1.00 14.14  ? 581  THR C N     1 
ATOM   8121  C  CA    . THR C  2  581  ? 57.413  -23.237 101.102  1.00 15.77  ? 581  THR C CA    1 
ATOM   8122  C  C     . THR C  2  581  ? 58.485  -24.318 101.193  1.00 18.86  ? 581  THR C C     1 
ATOM   8123  O  O     . THR C  2  581  ? 58.218  -25.491 100.932  1.00 20.57  ? 581  THR C O     1 
ATOM   8124  C  CB    . THR C  2  581  ? 56.968  -23.079 99.645   1.00 17.74  ? 581  THR C CB    1 
ATOM   8125  O  OG1   . THR C  2  581  ? 57.975  -22.371 98.913   1.00 17.70  ? 581  THR C OG1   1 
ATOM   8126  C  CG2   . THR C  2  581  ? 55.660  -22.306 99.571   1.00 16.68  ? 581  THR C CG2   1 
ATOM   8127  N  N     . GLY C  2  582  ? 59.695  -23.915 101.568  1.00 17.89  ? 582  GLY C N     1 
ATOM   8128  C  CA    . GLY C  2  582  ? 60.810  -24.841 101.655  1.00 22.67  ? 582  GLY C CA    1 
ATOM   8129  C  C     . GLY C  2  582  ? 61.667  -24.882 100.402  1.00 25.78  ? 582  GLY C C     1 
ATOM   8130  O  O     . GLY C  2  582  ? 62.760  -25.451 100.403  1.00 29.52  ? 582  GLY C O     1 
ATOM   8131  N  N     . LEU C  2  583  ? 61.178  -24.267 99.330   1.00 20.60  ? 583  LEU C N     1 
ATOM   8132  C  CA    . LEU C  2  583  ? 61.900  -24.265 98.062   1.00 18.90  ? 583  LEU C CA    1 
ATOM   8133  C  C     . LEU C  2  583  ? 62.945  -23.152 97.980   1.00 20.84  ? 583  LEU C C     1 
ATOM   8134  O  O     . LEU C  2  583  ? 63.619  -23.011 96.963   1.00 21.05  ? 583  LEU C O     1 
ATOM   8135  C  CB    . LEU C  2  583  ? 60.926  -24.128 96.892   1.00 14.54  ? 583  LEU C CB    1 
ATOM   8136  C  CG    . LEU C  2  583  ? 61.103  -25.137 95.759   1.00 12.20  ? 583  LEU C CG    1 
ATOM   8137  C  CD1   . LEU C  2  583  ? 60.263  -26.366 96.040   1.00 23.24  ? 583  LEU C CD1   1 
ATOM   8138  C  CD2   . LEU C  2  583  ? 60.747  -24.537 94.413   1.00 11.05  ? 583  LEU C CD2   1 
ATOM   8139  N  N     . GLU C  2  584  ? 63.078  -22.368 99.047   1.00 18.23  ? 584  GLU C N     1 
ATOM   8140  C  CA    . GLU C  2  584  ? 63.941  -21.189 99.035   1.00 15.19  ? 584  GLU C CA    1 
ATOM   8141  C  C     . GLU C  2  584  ? 65.426  -21.504 98.840   1.00 22.17  ? 584  GLU C C     1 
ATOM   8142  O  O     . GLU C  2  584  ? 66.075  -20.958 97.935   1.00 27.56  ? 584  GLU C O     1 
ATOM   8143  C  CB    . GLU C  2  584  ? 63.741  -20.367 100.310  1.00 16.58  ? 584  GLU C CB    1 
ATOM   8144  C  CG    . GLU C  2  584  ? 62.425  -19.603 100.361  1.00 19.73  ? 584  GLU C CG    1 
ATOM   8145  C  CD    . GLU C  2  584  ? 61.230  -20.490 100.666  1.00 20.63  ? 584  GLU C CD    1 
ATOM   8146  O  OE1   . GLU C  2  584  ? 60.081  -20.037 100.467  1.00 14.90  ? 584  GLU C OE1   1 
ATOM   8147  O  OE2   . GLU C  2  584  ? 61.440  -21.637 101.115  1.00 24.79  ? 584  GLU C OE2   1 
ATOM   8148  N  N     . GLU C  2  585  ? 65.958  -22.381 99.688   1.00 27.39  ? 585  GLU C N     1 
ATOM   8149  C  CA    . GLU C  2  585  ? 67.378  -22.728 99.648   1.00 25.05  ? 585  GLU C CA    1 
ATOM   8150  C  C     . GLU C  2  585  ? 67.814  -23.265 98.289   1.00 26.09  ? 585  GLU C C     1 
ATOM   8151  O  O     . GLU C  2  585  ? 68.871  -22.888 97.779   1.00 26.77  ? 585  GLU C O     1 
ATOM   8152  C  CB    . GLU C  2  585  ? 67.724  -23.729 100.752  1.00 23.42  ? 585  GLU C CB    1 
ATOM   8153  C  CG    . GLU C  2  585  ? 67.733  -23.120 102.143  1.00 31.62  ? 585  GLU C CG    1 
ATOM   8154  C  CD    . GLU C  2  585  ? 68.024  -24.140 103.228  1.00 50.49  ? 585  GLU C CD    1 
ATOM   8155  O  OE1   . GLU C  2  585  ? 67.496  -25.270 103.139  1.00 55.78  ? 585  GLU C OE1   1 
ATOM   8156  O  OE2   . GLU C  2  585  ? 68.783  -23.815 104.169  1.00 54.92  ? 585  GLU C OE2   1 
ATOM   8157  N  N     . ARG C  2  586  ? 66.997  -24.136 97.704   1.00 22.53  ? 586  ARG C N     1 
ATOM   8158  C  CA    . ARG C  2  586  ? 67.279  -24.666 96.374   1.00 22.02  ? 586  ARG C CA    1 
ATOM   8159  C  C     . ARG C  2  586  ? 67.332  -23.555 95.329   1.00 26.52  ? 586  ARG C C     1 
ATOM   8160  O  O     . ARG C  2  586  ? 68.229  -23.531 94.487   1.00 27.94  ? 586  ARG C O     1 
ATOM   8161  C  CB    . ARG C  2  586  ? 66.245  -25.717 95.969   1.00 21.29  ? 586  ARG C CB    1 
ATOM   8162  C  CG    . ARG C  2  586  ? 66.527  -27.107 96.507   1.00 27.15  ? 586  ARG C CG    1 
ATOM   8163  C  CD    . ARG C  2  586  ? 67.892  -27.608 96.055   1.00 25.16  ? 586  ARG C CD    1 
ATOM   8164  N  NE    . ARG C  2  586  ? 68.035  -27.601 94.602   1.00 18.41  ? 586  ARG C NE    1 
ATOM   8165  C  CZ    . ARG C  2  586  ? 67.582  -28.562 93.804   1.00 18.22  ? 586  ARG C CZ    1 
ATOM   8166  N  NH1   . ARG C  2  586  ? 66.946  -29.606 94.318   1.00 19.58  ? 586  ARG C NH1   1 
ATOM   8167  N  NH2   . ARG C  2  586  ? 67.759  -28.478 92.491   1.00 16.78  ? 586  ARG C NH2   1 
ATOM   8168  N  N     . VAL C  2  587  ? 66.369  -22.640 95.388   1.00 25.74  ? 587  VAL C N     1 
ATOM   8169  C  CA    . VAL C  2  587  ? 66.332  -21.512 94.464   1.00 20.07  ? 587  VAL C CA    1 
ATOM   8170  C  C     . VAL C  2  587  ? 67.616  -20.696 94.576   1.00 21.73  ? 587  VAL C C     1 
ATOM   8171  O  O     . VAL C  2  587  ? 68.193  -20.300 93.566   1.00 26.44  ? 587  VAL C O     1 
ATOM   8172  C  CB    . VAL C  2  587  ? 65.097  -20.610 94.699   1.00 14.36  ? 587  VAL C CB    1 
ATOM   8173  C  CG1   . VAL C  2  587  ? 65.215  -19.321 93.906   1.00 14.42  ? 587  VAL C CG1   1 
ATOM   8174  C  CG2   . VAL C  2  587  ? 63.822  -21.343 94.322   1.00 10.32  ? 587  VAL C CG2   1 
ATOM   8175  N  N     . VAL C  2  588  ? 68.078  -20.467 95.802   1.00 19.22  ? 588  VAL C N     1 
ATOM   8176  C  CA    . VAL C  2  588  ? 69.327  -19.733 95.996   1.00 21.92  ? 588  VAL C CA    1 
ATOM   8177  C  C     . VAL C  2  588  ? 70.529  -20.497 95.443   1.00 26.35  ? 588  VAL C C     1 
ATOM   8178  O  O     . VAL C  2  588  ? 71.406  -19.916 94.800   1.00 27.52  ? 588  VAL C O     1 
ATOM   8179  C  CB    . VAL C  2  588  ? 69.580  -19.420 97.482   1.00 23.57  ? 588  VAL C CB    1 
ATOM   8180  C  CG1   . VAL C  2  588  ? 70.879  -18.639 97.653   1.00 24.93  ? 588  VAL C CG1   1 
ATOM   8181  C  CG2   . VAL C  2  588  ? 68.425  -18.642 98.050   1.00 20.16  ? 588  VAL C CG2   1 
ATOM   8182  N  N     . ARG C  2  589  ? 70.559  -21.803 95.693   1.00 24.51  ? 589  ARG C N     1 
ATOM   8183  C  CA    . ARG C  2  589  ? 71.711  -22.626 95.333   1.00 27.11  ? 589  ARG C CA    1 
ATOM   8184  C  C     . ARG C  2  589  ? 71.859  -22.831 93.826   1.00 26.92  ? 589  ARG C C     1 
ATOM   8185  O  O     . ARG C  2  589  ? 72.971  -22.797 93.295   1.00 27.66  ? 589  ARG C O     1 
ATOM   8186  C  CB    . ARG C  2  589  ? 71.649  -23.982 96.044   1.00 27.43  ? 589  ARG C CB    1 
ATOM   8187  C  CG    . ARG C  2  589  ? 72.827  -24.896 95.736   1.00 28.20  ? 589  ARG C CG    1 
ATOM   8188  C  CD    . ARG C  2  589  ? 72.730  -26.212 96.495   1.00 30.68  ? 589  ARG C CD    1 
ATOM   8189  N  NE    . ARG C  2  589  ? 72.852  -26.031 97.940   1.00 27.76  ? 589  ARG C NE    1 
ATOM   8190  C  CZ    . ARG C  2  589  ? 74.007  -26.043 98.600   1.00 28.37  ? 589  ARG C CZ    1 
ATOM   8191  N  NH1   . ARG C  2  589  ? 75.147  -26.225 97.947   1.00 27.48  ? 589  ARG C NH1   1 
ATOM   8192  N  NH2   . ARG C  2  589  ? 74.023  -25.873 99.915   1.00 27.37  ? 589  ARG C NH2   1 
ATOM   8193  N  N     . ASP C  2  590  ? 70.741  -23.049 93.142   1.00 23.85  ? 590  ASP C N     1 
ATOM   8194  C  CA    . ASP C  2  590  ? 70.764  -23.275 91.702   1.00 24.03  ? 590  ASP C CA    1 
ATOM   8195  C  C     . ASP C  2  590  ? 70.960  -21.970 90.938   1.00 30.01  ? 590  ASP C C     1 
ATOM   8196  O  O     . ASP C  2  590  ? 71.280  -21.976 89.749   1.00 40.17  ? 590  ASP C O     1 
ATOM   8197  C  CB    . ASP C  2  590  ? 69.481  -23.976 91.240   1.00 21.99  ? 590  ASP C CB    1 
ATOM   8198  C  CG    . ASP C  2  590  ? 69.404  -25.421 91.703   1.00 23.76  ? 590  ASP C CG    1 
ATOM   8199  O  OD1   . ASP C  2  590  ? 69.795  -25.703 92.857   1.00 23.58  ? 590  ASP C OD1   1 
ATOM   8200  O  OD2   . ASP C  2  590  ? 68.958  -26.278 90.908   1.00 22.22  ? 590  ASP C OD2   1 
ATOM   8201  N  N     . SER C  2  591  ? 70.765  -20.852 91.628   1.00 28.02  ? 591  SER C N     1 
ATOM   8202  C  CA    . SER C  2  591  ? 70.912  -19.541 91.013   1.00 29.08  ? 591  SER C CA    1 
ATOM   8203  C  C     . SER C  2  591  ? 72.374  -19.138 90.963   1.00 28.55  ? 591  SER C C     1 
ATOM   8204  O  O     . SER C  2  591  ? 72.736  -18.168 90.298   1.00 35.20  ? 591  SER C O     1 
ATOM   8205  C  CB    . SER C  2  591  ? 70.138  -18.494 91.808   1.00 34.51  ? 591  SER C CB    1 
ATOM   8206  O  OG    . SER C  2  591  ? 70.714  -18.318 93.093   1.00 39.45  ? 591  SER C OG    1 
ATOM   8207  N  N     . LEU C  2  592  ? 73.204  -19.873 91.696   1.00 31.64  ? 592  LEU C N     1 
ATOM   8208  C  CA    . LEU C  2  592  ? 74.629  -19.573 91.800   1.00 39.18  ? 592  LEU C CA    1 
ATOM   8209  C  C     . LEU C  2  592  ? 74.881  -18.150 92.308   1.00 37.78  ? 592  LEU C C     1 
ATOM   8210  O  O     . LEU C  2  592  ? 75.900  -17.538 91.992   1.00 36.64  ? 592  LEU C O     1 
ATOM   8211  C  CB    . LEU C  2  592  ? 75.335  -19.817 90.465   1.00 32.85  ? 592  LEU C CB    1 
ATOM   8212  C  CG    . LEU C  2  592  ? 75.442  -21.288 90.068   1.00 33.38  ? 592  LEU C CG    1 
ATOM   8213  C  CD1   . LEU C  2  592  ? 75.778  -21.433 88.598   1.00 32.86  ? 592  LEU C CD1   1 
ATOM   8214  C  CD2   . LEU C  2  592  ? 76.490  -21.985 90.924   1.00 42.12  ? 592  LEU C CD2   1 
ATOM   8215  N  N     . ALA C  2  593  ? 73.941  -17.629 93.091   1.00 33.62  ? 593  ALA C N     1 
ATOM   8216  C  CA    . ALA C  2  593  ? 74.108  -16.332 93.734   1.00 36.28  ? 593  ALA C CA    1 
ATOM   8217  C  C     . ALA C  2  593  ? 74.984  -16.459 94.979   1.00 43.69  ? 593  ALA C C     1 
ATOM   8218  O  O     . ALA C  2  593  ? 75.910  -15.671 95.184   1.00 39.83  ? 593  ALA C O     1 
ATOM   8219  C  CB    . ALA C  2  593  ? 72.757  -15.747 94.097   1.00 40.24  ? 593  ALA C CB    1 
ATOM   8220  N  N     . ALA C  2  594  ? 74.679  -17.458 95.805   1.00 43.73  ? 594  ALA C N     1 
ATOM   8221  C  CA    . ALA C  2  594  ? 75.424  -17.709 97.039   1.00 34.71  ? 594  ALA C CA    1 
ATOM   8222  C  C     . ALA C  2  594  ? 76.729  -18.475 96.795   1.00 31.25  ? 594  ALA C C     1 
ATOM   8223  O  O     . ALA C  2  594  ? 76.854  -19.220 95.822   1.00 36.01  ? 594  ALA C O     1 
ATOM   8224  C  CB    . ALA C  2  594  ? 74.551  -18.449 98.044   1.00 28.02  ? 594  ALA C CB    1 
ATOM   8225  N  N     . LEU C  2  595  ? 77.692  -18.288 97.691   1.00 27.43  ? 595  LEU C N     1 
ATOM   8226  C  CA    . LEU C  2  595  ? 78.983  -18.963 97.609   1.00 24.92  ? 595  LEU C CA    1 
ATOM   8227  C  C     . LEU C  2  595  ? 79.000  -20.159 98.559   1.00 29.02  ? 595  LEU C C     1 
ATOM   8228  O  O     . LEU C  2  595  ? 78.719  -20.011 99.747   1.00 33.51  ? 595  LEU C O     1 
ATOM   8229  C  CB    . LEU C  2  595  ? 80.094  -17.983 97.984   1.00 23.63  ? 595  LEU C CB    1 
ATOM   8230  C  CG    . LEU C  2  595  ? 81.402  -18.081 97.208   1.00 24.74  ? 595  LEU C CG    1 
ATOM   8231  C  CD1   . LEU C  2  595  ? 82.178  -19.322 97.607   1.00 30.73  ? 595  LEU C CD1   1 
ATOM   8232  C  CD2   . LEU C  2  595  ? 81.103  -18.083 95.718   1.00 35.13  ? 595  LEU C CD2   1 
ATOM   8233  N  N     . TYR C  2  596  ? 79.332  -21.341 98.045   1.00 30.66  ? 596  TYR C N     1 
ATOM   8234  C  CA    . TYR C  2  596  ? 79.303  -22.554 98.864   1.00 32.86  ? 596  TYR C CA    1 
ATOM   8235  C  C     . TYR C  2  596  ? 80.667  -23.237 99.014   1.00 42.95  ? 596  TYR C C     1 
ATOM   8236  O  O     . TYR C  2  596  ? 81.519  -23.154 98.126   1.00 47.07  ? 596  TYR C O     1 
ATOM   8237  C  CB    . TYR C  2  596  ? 78.270  -23.546 98.322   1.00 28.98  ? 596  TYR C CB    1 
ATOM   8238  C  CG    . TYR C  2  596  ? 76.840  -23.067 98.440   1.00 29.14  ? 596  TYR C CG    1 
ATOM   8239  C  CD1   . TYR C  2  596  ? 76.190  -23.050 99.669   1.00 30.50  ? 596  TYR C CD1   1 
ATOM   8240  C  CD2   . TYR C  2  596  ? 76.138  -22.634 97.322   1.00 30.78  ? 596  TYR C CD2   1 
ATOM   8241  C  CE1   . TYR C  2  596  ? 74.880  -22.612 99.782   1.00 27.45  ? 596  TYR C CE1   1 
ATOM   8242  C  CE2   . TYR C  2  596  ? 74.827  -22.195 97.424   1.00 30.15  ? 596  TYR C CE2   1 
ATOM   8243  C  CZ    . TYR C  2  596  ? 74.203  -22.185 98.655   1.00 28.26  ? 596  TYR C CZ    1 
ATOM   8244  O  OH    . TYR C  2  596  ? 72.899  -21.750 98.757   1.00 26.03  ? 596  TYR C OH    1 
ATOM   8245  N  N     . ALA C  2  597  ? 80.860  -23.913 100.146  1.00 40.93  ? 597  ALA C N     1 
ATOM   8246  C  CA    . ALA C  2  597  ? 82.105  -24.622 100.432  1.00 40.46  ? 597  ALA C CA    1 
ATOM   8247  C  C     . ALA C  2  597  ? 82.255  -25.860 99.552   1.00 48.03  ? 597  ALA C C     1 
ATOM   8248  O  O     . ALA C  2  597  ? 81.376  -26.721 99.526   1.00 51.56  ? 597  ALA C O     1 
ATOM   8249  C  CB    . ALA C  2  597  ? 82.171  -25.005 101.901  1.00 35.63  ? 597  ALA C CB    1 
ATOM   8250  N  N     . GLU C  2  598  ? 83.379  -25.944 98.845   1.00 51.71  ? 598  GLU C N     1 
ATOM   8251  C  CA    . GLU C  2  598  ? 83.615  -27.012 97.874   1.00 52.83  ? 598  GLU C CA    1 
ATOM   8252  C  C     . GLU C  2  598  ? 83.815  -28.380 98.520   1.00 58.27  ? 598  GLU C C     1 
ATOM   8253  O  O     . GLU C  2  598  ? 83.289  -29.384 98.040   1.00 64.92  ? 598  GLU C O     1 
ATOM   8254  C  CB    . GLU C  2  598  ? 84.817  -26.670 96.993   1.00 59.78  ? 598  GLU C CB    1 
ATOM   8255  C  CG    . GLU C  2  598  ? 85.197  -27.756 96.005   1.00 67.33  ? 598  GLU C CG    1 
ATOM   8256  C  CD    . GLU C  2  598  ? 86.324  -27.330 95.087   1.00 82.51  ? 598  GLU C CD    1 
ATOM   8257  O  OE1   . GLU C  2  598  ? 86.546  -26.108 94.950   1.00 78.74  ? 598  GLU C OE1   1 
ATOM   8258  O  OE2   . GLU C  2  598  ? 86.988  -28.216 94.506   1.00 92.32  ? 598  GLU C OE2   1 
ATOM   8259  N  N     . GLU C  2  599  ? 84.585  -28.415 99.602   1.00 62.23  ? 599  GLU C N     1 
ATOM   8260  C  CA    . GLU C  2  599  ? 84.812  -29.648 100.346  1.00 62.90  ? 599  GLU C CA    1 
ATOM   8261  C  C     . GLU C  2  599  ? 84.804  -29.323 101.835  1.00 59.05  ? 599  GLU C C     1 
ATOM   8262  O  O     . GLU C  2  599  ? 84.622  -28.169 102.215  1.00 66.38  ? 599  GLU C O     1 
ATOM   8263  C  CB    . GLU C  2  599  ? 86.151  -30.272 99.944   1.00 65.13  ? 599  GLU C CB    1 
ATOM   8264  C  CG    . GLU C  2  599  ? 86.197  -31.791 100.059  1.00 78.75  ? 599  GLU C CG    1 
ATOM   8265  C  CD    . GLU C  2  599  ? 85.318  -32.485 99.031   1.00 89.10  ? 599  GLU C CD    1 
ATOM   8266  O  OE1   . GLU C  2  599  ? 85.117  -31.917 97.935   1.00 85.59  ? 599  GLU C OE1   1 
ATOM   8267  O  OE2   . GLU C  2  599  ? 84.826  -33.598 99.320   1.00 88.04  ? 599  GLU C OE2   1 
ATOM   8268  N  N     . ASP C  2  600  ? 84.985  -30.333 102.680  1.00 53.07  ? 600  ASP C N     1 
ATOM   8269  C  CA    . ASP C  2  600  ? 85.117  -30.088 104.110  1.00 51.13  ? 600  ASP C CA    1 
ATOM   8270  C  C     . ASP C  2  600  ? 86.422  -29.341 104.322  1.00 53.18  ? 600  ASP C C     1 
ATOM   8271  O  O     . ASP C  2  600  ? 87.372  -29.529 103.566  1.00 65.16  ? 600  ASP C O     1 
ATOM   8272  C  CB    . ASP C  2  600  ? 85.126  -31.402 104.892  1.00 61.04  ? 600  ASP C CB    1 
ATOM   8273  C  CG    . ASP C  2  600  ? 83.872  -32.229 104.664  1.00 66.91  ? 600  ASP C CG    1 
ATOM   8274  O  OD1   . ASP C  2  600  ? 83.840  -33.003 103.683  1.00 76.17  ? 600  ASP C OD1   1 
ATOM   8275  O  OD2   . ASP C  2  600  ? 82.921  -32.112 105.466  1.00 57.48  ? 600  ASP C OD2   1 
ATOM   8276  N  N     . GLY C  2  601  ? 86.474  -28.483 105.332  1.00 46.08  ? 601  GLY C N     1 
ATOM   8277  C  CA    . GLY C  2  601  ? 87.685  -27.725 105.582  1.00 48.89  ? 601  GLY C CA    1 
ATOM   8278  C  C     . GLY C  2  601  ? 87.535  -26.644 106.629  1.00 50.84  ? 601  GLY C C     1 
ATOM   8279  O  O     . GLY C  2  601  ? 86.474  -26.491 107.233  1.00 57.17  ? 601  GLY C O     1 
ATOM   8280  N  N     . GLU C  2  602  ? 88.609  -25.893 106.843  1.00 45.38  ? 602  GLU C N     1 
ATOM   8281  C  CA    . GLU C  2  602  ? 88.614  -24.821 107.827  1.00 49.77  ? 602  GLU C CA    1 
ATOM   8282  C  C     . GLU C  2  602  ? 88.781  -23.474 107.135  1.00 47.55  ? 602  GLU C C     1 
ATOM   8283  O  O     . GLU C  2  602  ? 89.513  -23.358 106.151  1.00 43.70  ? 602  GLU C O     1 
ATOM   8284  C  CB    . GLU C  2  602  ? 89.736  -25.041 108.846  1.00 56.88  ? 602  GLU C CB    1 
ATOM   8285  C  CG    . GLU C  2  602  ? 89.775  -24.017 109.974  1.00 61.71  ? 602  GLU C CG    1 
ATOM   8286  C  CD    . GLU C  2  602  ? 90.889  -24.284 110.970  1.00 60.50  ? 602  GLU C CD    1 
ATOM   8287  O  OE1   . GLU C  2  602  ? 91.609  -25.291 110.801  1.00 61.05  ? 602  GLU C OE1   1 
ATOM   8288  O  OE2   . GLU C  2  602  ? 91.042  -23.487 111.921  1.00 57.91  ? 602  GLU C OE2   1 
ATOM   8289  N  N     . VAL C  2  603  ? 88.102  -22.454 107.650  1.00 43.61  ? 603  VAL C N     1 
ATOM   8290  C  CA    . VAL C  2  603  ? 88.191  -21.131 107.054  1.00 44.68  ? 603  VAL C CA    1 
ATOM   8291  C  C     . VAL C  2  603  ? 89.468  -20.436 107.505  1.00 39.91  ? 603  VAL C C     1 
ATOM   8292  O  O     . VAL C  2  603  ? 89.657  -20.162 108.690  1.00 38.14  ? 603  VAL C O     1 
ATOM   8293  C  CB    . VAL C  2  603  ? 86.985  -20.260 107.436  1.00 44.62  ? 603  VAL C CB    1 
ATOM   8294  C  CG1   . VAL C  2  603  ? 87.101  -18.891 106.790  1.00 41.36  ? 603  VAL C CG1   1 
ATOM   8295  C  CG2   . VAL C  2  603  ? 85.687  -20.941 107.024  1.00 47.19  ? 603  VAL C CG2   1 
ATOM   8296  N  N     . ALA C  2  604  ? 90.340  -20.148 106.545  1.00 39.57  ? 604  ALA C N     1 
ATOM   8297  C  CA    . ALA C  2  604  ? 91.602  -19.485 106.833  1.00 41.83  ? 604  ALA C CA    1 
ATOM   8298  C  C     . ALA C  2  604  ? 91.428  -17.983 107.015  1.00 38.81  ? 604  ALA C C     1 
ATOM   8299  O  O     . ALA C  2  604  ? 91.905  -17.404 107.989  1.00 44.29  ? 604  ALA C O     1 
ATOM   8300  C  CB    . ALA C  2  604  ? 92.605  -19.770 105.726  1.00 50.38  ? 604  ALA C CB    1 
ATOM   8301  N  N     . LYS C  2  605  ? 90.729  -17.360 106.075  1.00 41.16  ? 605  LYS C N     1 
ATOM   8302  C  CA    . LYS C  2  605  ? 90.613  -15.909 106.051  1.00 47.08  ? 605  LYS C CA    1 
ATOM   8303  C  C     . LYS C  2  605  ? 89.200  -15.435 105.723  1.00 44.84  ? 605  LYS C C     1 
ATOM   8304  O  O     . LYS C  2  605  ? 88.521  -16.019 104.878  1.00 50.13  ? 605  LYS C O     1 
ATOM   8305  C  CB    . LYS C  2  605  ? 91.600  -15.315 105.040  1.00 49.32  ? 605  LYS C CB    1 
ATOM   8306  C  CG    . LYS C  2  605  ? 93.063  -15.451 105.427  1.00 46.96  ? 605  LYS C CG    1 
ATOM   8307  C  CD    . LYS C  2  605  ? 93.969  -14.804 104.391  1.00 49.39  ? 605  LYS C CD    1 
ATOM   8308  C  CE    . LYS C  2  605  ? 95.437  -14.973 104.757  1.00 53.40  ? 605  LYS C CE    1 
ATOM   8309  N  NZ    . LYS C  2  605  ? 96.346  -14.362 103.747  1.00 57.64  ? 605  LYS C NZ    1 
ATOM   8310  N  N     . VAL C  2  606  ? 88.765  -14.371 106.394  1.00 39.94  ? 606  VAL C N     1 
ATOM   8311  C  CA    . VAL C  2  606  ? 87.476  -13.751 106.101  1.00 41.99  ? 606  VAL C CA    1 
ATOM   8312  C  C     . VAL C  2  606  ? 87.604  -12.244 105.906  1.00 49.73  ? 606  VAL C C     1 
ATOM   8313  O  O     . VAL C  2  606  ? 88.045  -11.516 106.798  1.00 42.85  ? 606  VAL C O     1 
ATOM   8314  C  CB    . VAL C  2  606  ? 86.427  -14.035 107.193  1.00 48.35  ? 606  VAL C CB    1 
ATOM   8315  C  CG1   . VAL C  2  606  ? 85.222  -13.119 107.024  1.00 43.20  ? 606  VAL C CG1   1 
ATOM   8316  C  CG2   . VAL C  2  606  ? 85.998  -15.487 107.144  1.00 51.44  ? 606  VAL C CG2   1 
ATOM   8317  N  N     . ASP C  2  607  ? 87.205  -11.787 104.726  1.00 55.75  ? 607  ASP C N     1 
ATOM   8318  C  CA    . ASP C  2  607  ? 87.285  -10.381 104.375  1.00 48.80  ? 607  ASP C CA    1 
ATOM   8319  C  C     . ASP C  2  607  ? 86.052  -10.015 103.558  1.00 48.11  ? 607  ASP C C     1 
ATOM   8320  O  O     . ASP C  2  607  ? 85.402  -10.890 102.982  1.00 44.48  ? 607  ASP C O     1 
ATOM   8321  C  CB    . ASP C  2  607  ? 88.557  -10.125 103.565  1.00 44.44  ? 607  ASP C CB    1 
ATOM   8322  C  CG    . ASP C  2  607  ? 88.920  -8.659  103.497  1.00 53.45  ? 607  ASP C CG    1 
ATOM   8323  O  OD1   . ASP C  2  607  ? 88.522  -7.909  104.416  1.00 54.93  ? 607  ASP C OD1   1 
ATOM   8324  O  OD2   . ASP C  2  607  ? 89.607  -8.259  102.531  1.00 52.12  ? 607  ASP C OD2   1 
ATOM   8325  N  N     . GLY C  2  608  ? 85.722  -8.728  103.518  1.00 48.59  ? 608  GLY C N     1 
ATOM   8326  C  CA    . GLY C  2  608  ? 84.616  -8.257  102.703  1.00 42.28  ? 608  GLY C CA    1 
ATOM   8327  C  C     . GLY C  2  608  ? 84.899  -8.503  101.234  1.00 44.67  ? 608  GLY C C     1 
ATOM   8328  O  O     . GLY C  2  608  ? 83.986  -8.723  100.437  1.00 44.10  ? 608  GLY C O     1 
ATOM   8329  N  N     . ASN C  2  609  ? 86.179  -8.451  100.880  1.00 44.22  ? 609  ASN C N     1 
ATOM   8330  C  CA    . ASN C  2  609  ? 86.629  -8.714  99.520   1.00 34.81  ? 609  ASN C CA    1 
ATOM   8331  C  C     . ASN C  2  609  ? 86.797  -10.193 99.168   1.00 40.07  ? 609  ASN C C     1 
ATOM   8332  O  O     . ASN C  2  609  ? 86.472  -10.610 98.056   1.00 45.45  ? 609  ASN C O     1 
ATOM   8333  C  CB    . ASN C  2  609  ? 87.925  -7.956  99.247   1.00 31.83  ? 609  ASN C CB    1 
ATOM   8334  C  CG    . ASN C  2  609  ? 87.734  -6.460  99.298   1.00 35.50  ? 609  ASN C CG    1 
ATOM   8335  O  OD1   . ASN C  2  609  ? 86.772  -5.932  98.742   1.00 36.18  ? 609  ASN C OD1   1 
ATOM   8336  N  ND2   . ASN C  2  609  ? 88.639  -5.767  99.979   1.00 39.98  ? 609  ASN C ND2   1 
ATOM   8337  N  N     . ARG C  2  610  ? 87.311  -10.982 100.107  1.00 35.35  ? 610  ARG C N     1 
ATOM   8338  C  CA    . ARG C  2  610  ? 87.674  -12.364 99.799   1.00 37.52  ? 610  ARG C CA    1 
ATOM   8339  C  C     . ARG C  2  610  ? 87.588  -13.316 100.991  1.00 39.17  ? 610  ARG C C     1 
ATOM   8340  O  O     . ARG C  2  610  ? 87.803  -12.915 102.132  1.00 44.26  ? 610  ARG C O     1 
ATOM   8341  C  CB    . ARG C  2  610  ? 89.077  -12.402 99.180   1.00 45.73  ? 610  ARG C CB    1 
ATOM   8342  C  CG    . ARG C  2  610  ? 90.057  -13.372 99.834   1.00 48.58  ? 610  ARG C CG    1 
ATOM   8343  C  CD    . ARG C  2  610  ? 91.185  -12.649 100.562  1.00 47.81  ? 610  ARG C CD    1 
ATOM   8344  N  NE    . ARG C  2  610  ? 90.881  -12.417 101.971  1.00 50.91  ? 610  ARG C NE    1 
ATOM   8345  C  CZ    . ARG C  2  610  ? 91.748  -11.920 102.847  1.00 51.88  ? 610  ARG C CZ    1 
ATOM   8346  N  NH1   . ARG C  2  610  ? 91.391  -11.742 104.112  1.00 52.41  ? 610  ARG C NH1   1 
ATOM   8347  N  NH2   . ARG C  2  610  ? 92.976  -11.603 102.458  1.00 45.50  ? 610  ARG C NH2   1 
ATOM   8348  N  N     . ILE C  2  611  ? 87.269  -14.577 100.709  1.00 37.16  ? 611  ILE C N     1 
ATOM   8349  C  CA    . ILE C  2  611  ? 87.246  -15.627 101.724  1.00 37.45  ? 611  ILE C CA    1 
ATOM   8350  C  C     . ILE C  2  611  ? 88.218  -16.744 101.348  1.00 40.21  ? 611  ILE C C     1 
ATOM   8351  O  O     . ILE C  2  611  ? 88.091  -17.344 100.284  1.00 38.84  ? 611  ILE C O     1 
ATOM   8352  C  CB    . ILE C  2  611  ? 85.832  -16.229 101.885  1.00 34.55  ? 611  ILE C CB    1 
ATOM   8353  C  CG1   . ILE C  2  611  ? 84.848  -15.173 102.393  1.00 32.75  ? 611  ILE C CG1   1 
ATOM   8354  C  CG2   . ILE C  2  611  ? 85.857  -17.426 102.825  1.00 35.14  ? 611  ILE C CG2   1 
ATOM   8355  C  CD1   . ILE C  2  611  ? 83.429  -15.685 102.545  1.00 25.97  ? 611  ILE C CD1   1 
ATOM   8356  N  N     . VAL C  2  612  ? 89.185  -17.021 102.219  1.00 45.17  ? 612  VAL C N     1 
ATOM   8357  C  CA    . VAL C  2  612  ? 90.188  -18.053 101.949  1.00 41.76  ? 612  VAL C CA    1 
ATOM   8358  C  C     . VAL C  2  612  ? 89.957  -19.299 102.801  1.00 43.99  ? 612  VAL C C     1 
ATOM   8359  O  O     . VAL C  2  612  ? 89.857  -19.211 104.023  1.00 47.86  ? 612  VAL C O     1 
ATOM   8360  C  CB    . VAL C  2  612  ? 91.615  -17.531 102.197  1.00 41.26  ? 612  VAL C CB    1 
ATOM   8361  C  CG1   . VAL C  2  612  ? 92.634  -18.612 101.888  1.00 46.26  ? 612  VAL C CG1   1 
ATOM   8362  C  CG2   . VAL C  2  612  ? 91.878  -16.289 101.360  1.00 42.59  ? 612  VAL C CG2   1 
ATOM   8363  N  N     . VAL C  2  613  ? 89.882  -20.458 102.151  1.00 48.37  ? 613  VAL C N     1 
ATOM   8364  C  CA    . VAL C  2  613  ? 89.573  -21.713 102.836  1.00 50.80  ? 613  VAL C CA    1 
ATOM   8365  C  C     . VAL C  2  613  ? 90.637  -22.788 102.615  1.00 56.18  ? 613  VAL C C     1 
ATOM   8366  O  O     . VAL C  2  613  ? 91.068  -23.026 101.487  1.00 56.02  ? 613  VAL C O     1 
ATOM   8367  C  CB    . VAL C  2  613  ? 88.210  -22.278 102.379  1.00 45.84  ? 613  VAL C CB    1 
ATOM   8368  C  CG1   . VAL C  2  613  ? 87.893  -23.574 103.108  1.00 43.96  ? 613  VAL C CG1   1 
ATOM   8369  C  CG2   . VAL C  2  613  ? 87.108  -21.258 102.606  1.00 52.90  ? 613  VAL C CG2   1 
ATOM   8370  N  N     . ARG C  2  614  ? 91.046  -23.439 103.701  1.00 61.93  ? 614  ARG C N     1 
ATOM   8371  C  CA    . ARG C  2  614  ? 91.959  -24.575 103.626  1.00 61.02  ? 614  ARG C CA    1 
ATOM   8372  C  C     . ARG C  2  614  ? 91.175  -25.876 103.748  1.00 57.56  ? 614  ARG C C     1 
ATOM   8373  O  O     . ARG C  2  614  ? 90.620  -26.176 104.805  1.00 58.62  ? 614  ARG C O     1 
ATOM   8374  C  CB    . ARG C  2  614  ? 93.005  -24.498 104.740  1.00 65.50  ? 614  ARG C CB    1 
ATOM   8375  C  CG    . ARG C  2  614  ? 93.894  -25.729 104.847  1.00 67.79  ? 614  ARG C CG    1 
ATOM   8376  C  CD    . ARG C  2  614  ? 94.901  -25.598 105.982  1.00 72.93  ? 614  ARG C CD    1 
ATOM   8377  N  NE    . ARG C  2  614  ? 95.821  -24.482 105.778  1.00 74.93  ? 614  ARG C NE    1 
ATOM   8378  C  CZ    . ARG C  2  614  ? 96.941  -24.557 105.066  1.00 70.13  ? 614  ARG C CZ    1 
ATOM   8379  N  NH1   . ARG C  2  614  ? 97.718  -23.491 104.935  1.00 70.10  ? 614  ARG C NH1   1 
ATOM   8380  N  NH2   . ARG C  2  614  ? 97.285  -25.697 104.484  1.00 62.48  ? 614  ARG C NH2   1 
ATOM   8381  N  N     . TYR C  2  615  ? 91.130  -26.647 102.666  1.00 59.17  ? 615  TYR C N     1 
ATOM   8382  C  CA    . TYR C  2  615  ? 90.361  -27.890 102.652  1.00 66.14  ? 615  TYR C CA    1 
ATOM   8383  C  C     . TYR C  2  615  ? 91.137  -29.065 103.248  1.00 78.99  ? 615  TYR C C     1 
ATOM   8384  O  O     . TYR C  2  615  ? 92.255  -28.898 103.740  1.00 80.25  ? 615  TYR C O     1 
ATOM   8385  C  CB    . TYR C  2  615  ? 89.874  -28.219 101.234  1.00 66.64  ? 615  TYR C CB    1 
ATOM   8386  C  CG    . TYR C  2  615  ? 88.825  -27.258 100.717  1.00 66.42  ? 615  TYR C CG    1 
ATOM   8387  C  CD1   . TYR C  2  615  ? 87.613  -27.102 101.378  1.00 59.79  ? 615  TYR C CD1   1 
ATOM   8388  C  CD2   . TYR C  2  615  ? 89.046  -26.505 99.570   1.00 65.22  ? 615  TYR C CD2   1 
ATOM   8389  C  CE1   . TYR C  2  615  ? 86.653  -26.223 100.915  1.00 54.00  ? 615  TYR C CE1   1 
ATOM   8390  C  CE2   . TYR C  2  615  ? 88.088  -25.623 99.098   1.00 59.70  ? 615  TYR C CE2   1 
ATOM   8391  C  CZ    . TYR C  2  615  ? 86.894  -25.487 99.776   1.00 56.64  ? 615  TYR C CZ    1 
ATOM   8392  O  OH    . TYR C  2  615  ? 85.933  -24.613 99.318   1.00 50.59  ? 615  TYR C OH    1 
ATOM   8393  N  N     . GLU C  2  616  ? 90.528  -30.249 103.206  1.00 87.01  ? 616  GLU C N     1 
ATOM   8394  C  CA    . GLU C  2  616  ? 91.131  -31.465 103.750  1.00 83.64  ? 616  GLU C CA    1 
ATOM   8395  C  C     . GLU C  2  616  ? 92.413  -31.821 103.007  1.00 84.78  ? 616  GLU C C     1 
ATOM   8396  O  O     . GLU C  2  616  ? 93.339  -32.392 103.583  1.00 83.45  ? 616  GLU C O     1 
ATOM   8397  C  CB    . GLU C  2  616  ? 90.147  -32.636 103.667  1.00 79.27  ? 616  GLU C CB    1 
ATOM   8398  C  CG    . GLU C  2  616  ? 88.839  -32.430 104.422  1.00 80.50  ? 616  GLU C CG    1 
ATOM   8399  C  CD    . GLU C  2  616  ? 88.997  -32.546 105.928  1.00 95.86  ? 616  GLU C CD    1 
ATOM   8400  O  OE1   . GLU C  2  616  ? 89.543  -31.609 106.550  1.00 98.45  ? 616  GLU C OE1   1 
ATOM   8401  O  OE2   . GLU C  2  616  ? 88.573  -33.578 106.491  1.00 107.51 ? 616  GLU C OE2   1 
ATOM   8402  N  N     . ASP C  2  617  ? 92.455  -31.473 101.725  1.00 89.59  ? 617  ASP C N     1 
ATOM   8403  C  CA    . ASP C  2  617  ? 93.608  -31.752 100.878  1.00 84.17  ? 617  ASP C CA    1 
ATOM   8404  C  C     . ASP C  2  617  ? 94.836  -30.981 101.352  1.00 78.58  ? 617  ASP C C     1 
ATOM   8405  O  O     . ASP C  2  617  ? 95.970  -31.389 101.104  1.00 76.84  ? 617  ASP C O     1 
ATOM   8406  C  CB    . ASP C  2  617  ? 93.294  -31.385 99.426   1.00 78.91  ? 617  ASP C CB    1 
ATOM   8407  C  CG    . ASP C  2  617  ? 91.807  -31.429 99.122   1.00 80.28  ? 617  ASP C CG    1 
ATOM   8408  O  OD1   . ASP C  2  617  ? 91.070  -32.135 99.842   1.00 79.63  ? 617  ASP C OD1   1 
ATOM   8409  O  OD2   . ASP C  2  617  ? 91.375  -30.754 98.165   1.00 76.83  ? 617  ASP C OD2   1 
ATOM   8410  N  N     . GLY C  2  618  ? 94.599  -29.868 102.039  1.00 79.95  ? 618  GLY C N     1 
ATOM   8411  C  CA    . GLY C  2  618  ? 95.673  -29.020 102.522  1.00 79.89  ? 618  GLY C CA    1 
ATOM   8412  C  C     . GLY C  2  618  ? 95.884  -27.825 101.614  1.00 81.96  ? 618  GLY C C     1 
ATOM   8413  O  O     . GLY C  2  618  ? 96.623  -26.898 101.948  1.00 75.93  ? 618  GLY C O     1 
ATOM   8414  N  N     . ARG C  2  619  ? 95.225  -27.848 100.459  1.00 77.57  ? 619  ARG C N     1 
ATOM   8415  C  CA    . ARG C  2  619  ? 95.353  -26.775 99.482   1.00 79.23  ? 619  ARG C CA    1 
ATOM   8416  C  C     . ARG C  2  619  ? 94.580  -25.533 99.912   1.00 72.08  ? 619  ARG C C     1 
ATOM   8417  O  O     . ARG C  2  619  ? 93.494  -25.631 100.484  1.00 70.28  ? 619  ARG C O     1 
ATOM   8418  C  CB    . ARG C  2  619  ? 94.885  -27.247 98.103   1.00 80.30  ? 619  ARG C CB    1 
ATOM   8419  C  CG    . ARG C  2  619  ? 93.463  -27.774 98.076   1.00 72.47  ? 619  ARG C CG    1 
ATOM   8420  C  CD    . ARG C  2  619  ? 93.152  -28.427 96.742   1.00 73.94  ? 619  ARG C CD    1 
ATOM   8421  N  NE    . ARG C  2  619  ? 91.766  -28.877 96.669   1.00 82.32  ? 619  ARG C NE    1 
ATOM   8422  C  CZ    . ARG C  2  619  ? 90.796  -28.208 96.055   1.00 81.50  ? 619  ARG C CZ    1 
ATOM   8423  N  NH1   . ARG C  2  619  ? 89.561  -28.692 96.039   1.00 77.44  ? 619  ARG C NH1   1 
ATOM   8424  N  NH2   . ARG C  2  619  ? 91.064  -27.057 95.452   1.00 69.86  ? 619  ARG C NH2   1 
ATOM   8425  N  N     . LEU C  2  620  ? 95.151  -24.365 99.635   1.00 65.15  ? 620  LEU C N     1 
ATOM   8426  C  CA    . LEU C  2  620  ? 94.534  -23.103 100.021  1.00 60.56  ? 620  LEU C CA    1 
ATOM   8427  C  C     . LEU C  2  620  ? 93.754  -22.507 98.851   1.00 60.74  ? 620  LEU C C     1 
ATOM   8428  O  O     . LEU C  2  620  ? 94.342  -22.077 97.858   1.00 55.64  ? 620  LEU C O     1 
ATOM   8429  C  CB    . LEU C  2  620  ? 95.603  -22.120 100.501  1.00 54.02  ? 620  LEU C CB    1 
ATOM   8430  C  CG    . LEU C  2  620  ? 95.228  -21.225 101.681  1.00 48.37  ? 620  LEU C CG    1 
ATOM   8431  C  CD1   . LEU C  2  620  ? 94.937  -22.067 102.908  1.00 48.44  ? 620  LEU C CD1   1 
ATOM   8432  C  CD2   . LEU C  2  620  ? 96.335  -20.224 101.966  1.00 47.39  ? 620  LEU C CD2   1 
ATOM   8433  N  N     . VAL C  2  621  ? 92.429  -22.477 98.981   1.00 57.59  ? 621  VAL C N     1 
ATOM   8434  C  CA    . VAL C  2  621  ? 91.560  -21.963 97.926   1.00 49.64  ? 621  VAL C CA    1 
ATOM   8435  C  C     . VAL C  2  621  ? 91.021  -20.579 98.270   1.00 46.88  ? 621  VAL C C     1 
ATOM   8436  O  O     . VAL C  2  621  ? 90.394  -20.387 99.311   1.00 41.96  ? 621  VAL C O     1 
ATOM   8437  C  CB    . VAL C  2  621  ? 90.368  -22.903 97.664   1.00 52.15  ? 621  VAL C CB    1 
ATOM   8438  C  CG1   . VAL C  2  621  ? 89.468  -22.331 96.575   1.00 46.55  ? 621  VAL C CG1   1 
ATOM   8439  C  CG2   . VAL C  2  621  ? 90.860  -24.291 97.285   1.00 59.63  ? 621  VAL C CG2   1 
ATOM   8440  N  N     . GLU C  2  622  ? 91.265  -19.617 97.386   1.00 47.53  ? 622  GLU C N     1 
ATOM   8441  C  CA    . GLU C  2  622  ? 90.808  -18.253 97.610   1.00 45.40  ? 622  GLU C CA    1 
ATOM   8442  C  C     . GLU C  2  622  ? 89.575  -17.935 96.769   1.00 46.44  ? 622  GLU C C     1 
ATOM   8443  O  O     . GLU C  2  622  ? 89.609  -18.028 95.541   1.00 44.21  ? 622  GLU C O     1 
ATOM   8444  C  CB    . GLU C  2  622  ? 91.926  -17.256 97.303   1.00 43.87  ? 622  GLU C CB    1 
ATOM   8445  C  CG    . GLU C  2  622  ? 91.598  -15.826 97.692   1.00 44.73  ? 622  GLU C CG    1 
ATOM   8446  C  CD    . GLU C  2  622  ? 92.702  -14.855 97.328   1.00 54.24  ? 622  GLU C CD    1 
ATOM   8447  O  OE1   . GLU C  2  622  ? 92.876  -13.852 98.053   1.00 57.84  ? 622  GLU C OE1   1 
ATOM   8448  O  OE2   . GLU C  2  622  ? 93.394  -15.092 96.316   1.00 63.38  ? 622  GLU C OE2   1 
ATOM   8449  N  N     . TYR C  2  623  ? 88.488  -17.570 97.441   1.00 42.77  ? 623  TYR C N     1 
ATOM   8450  C  CA    . TYR C  2  623  ? 87.264  -17.156 96.768   1.00 32.62  ? 623  TYR C CA    1 
ATOM   8451  C  C     . TYR C  2  623  ? 87.130  -15.643 96.819   1.00 34.47  ? 623  TYR C C     1 
ATOM   8452  O  O     . TYR C  2  623  ? 86.854  -15.078 97.878   1.00 32.71  ? 623  TYR C O     1 
ATOM   8453  C  CB    . TYR C  2  623  ? 86.039  -17.788 97.431   1.00 29.48  ? 623  TYR C CB    1 
ATOM   8454  C  CG    . TYR C  2  623  ? 86.003  -19.298 97.385   1.00 34.74  ? 623  TYR C CG    1 
ATOM   8455  C  CD1   . TYR C  2  623  ? 85.821  -19.971 96.184   1.00 36.32  ? 623  TYR C CD1   1 
ATOM   8456  C  CD2   . TYR C  2  623  ? 86.131  -20.051 98.545   1.00 42.88  ? 623  TYR C CD2   1 
ATOM   8457  C  CE1   . TYR C  2  623  ? 85.782  -21.352 96.138   1.00 40.17  ? 623  TYR C CE1   1 
ATOM   8458  C  CE2   . TYR C  2  623  ? 86.091  -21.434 98.509   1.00 44.44  ? 623  TYR C CE2   1 
ATOM   8459  C  CZ    . TYR C  2  623  ? 85.916  -22.077 97.302   1.00 46.55  ? 623  TYR C CZ    1 
ATOM   8460  O  OH    . TYR C  2  623  ? 85.875  -23.451 97.257   1.00 55.87  ? 623  TYR C OH    1 
ATOM   8461  N  N     . PRO C  2  624  ? 87.334  -14.976 95.674   1.00 37.19  ? 624  PRO C N     1 
ATOM   8462  C  CA    . PRO C  2  624  ? 87.099  -13.532 95.590   1.00 39.86  ? 624  PRO C CA    1 
ATOM   8463  C  C     . PRO C  2  624  ? 85.601  -13.253 95.566   1.00 41.29  ? 624  PRO C C     1 
ATOM   8464  O  O     . PRO C  2  624  ? 84.849  -13.991 94.927   1.00 37.84  ? 624  PRO C O     1 
ATOM   8465  C  CB    . PRO C  2  624  ? 87.733  -13.158 94.252   1.00 35.47  ? 624  PRO C CB    1 
ATOM   8466  C  CG    . PRO C  2  624  ? 87.616  -14.396 93.431   1.00 34.54  ? 624  PRO C CG    1 
ATOM   8467  C  CD    . PRO C  2  624  ? 87.784  -15.542 94.391   1.00 32.65  ? 624  PRO C CD    1 
ATOM   8468  N  N     . LEU C  2  625  ? 85.170  -12.202 96.252   1.00 38.21  ? 625  LEU C N     1 
ATOM   8469  C  CA    . LEU C  2  625  ? 83.746  -11.916 96.356   1.00 35.37  ? 625  LEU C CA    1 
ATOM   8470  C  C     . LEU C  2  625  ? 83.325  -10.741 95.482   1.00 37.42  ? 625  LEU C C     1 
ATOM   8471  O  O     . LEU C  2  625  ? 83.961  -9.686  95.487   1.00 39.75  ? 625  LEU C O     1 
ATOM   8472  C  CB    . LEU C  2  625  ? 83.345  -11.679 97.816   1.00 32.90  ? 625  LEU C CB    1 
ATOM   8473  C  CG    . LEU C  2  625  ? 83.423  -12.904 98.732   1.00 32.22  ? 625  LEU C CG    1 
ATOM   8474  C  CD1   . LEU C  2  625  ? 82.996  -12.560 100.151  1.00 32.07  ? 625  LEU C CD1   1 
ATOM   8475  C  CD2   . LEU C  2  625  ? 82.581  -14.046 98.181   1.00 29.24  ? 625  LEU C CD2   1 
ATOM   8476  N  N     . ARG C  2  626  ? 82.250  -10.941 94.726   1.00 38.14  ? 626  ARG C N     1 
ATOM   8477  C  CA    . ARG C  2  626  ? 81.667  -9.886  93.911   1.00 35.92  ? 626  ARG C CA    1 
ATOM   8478  C  C     . ARG C  2  626  ? 80.994  -8.857  94.813   1.00 32.73  ? 626  ARG C C     1 
ATOM   8479  O  O     . ARG C  2  626  ? 80.122  -9.205  95.606   1.00 35.39  ? 626  ARG C O     1 
ATOM   8480  C  CB    . ARG C  2  626  ? 80.647  -10.484 92.945   1.00 35.06  ? 626  ARG C CB    1 
ATOM   8481  C  CG    . ARG C  2  626  ? 79.833  -9.457  92.191   1.00 41.85  ? 626  ARG C CG    1 
ATOM   8482  C  CD    . ARG C  2  626  ? 78.812  -10.115 91.274   1.00 51.14  ? 626  ARG C CD    1 
ATOM   8483  N  NE    . ARG C  2  626  ? 79.443  -10.842 90.176   1.00 58.80  ? 626  ARG C NE    1 
ATOM   8484  C  CZ    . ARG C  2  626  ? 79.605  -12.160 90.149   1.00 62.08  ? 626  ARG C CZ    1 
ATOM   8485  N  NH1   . ARG C  2  626  ? 79.177  -12.904 91.162   1.00 56.13  ? 626  ARG C NH1   1 
ATOM   8486  N  NH2   . ARG C  2  626  ? 80.193  -12.734 89.108   1.00 59.80  ? 626  ARG C NH2   1 
ATOM   8487  N  N     . ARG C  2  627  ? 81.394  -7.594  94.684   1.00 31.36  ? 627  ARG C N     1 
ATOM   8488  C  CA    . ARG C  2  627  ? 80.922  -6.541  95.584   1.00 29.09  ? 627  ARG C CA    1 
ATOM   8489  C  C     . ARG C  2  627  ? 80.436  -5.286  94.858   1.00 30.58  ? 627  ARG C C     1 
ATOM   8490  O  O     . ARG C  2  627  ? 81.197  -4.650  94.130   1.00 35.69  ? 627  ARG C O     1 
ATOM   8491  C  CB    . ARG C  2  627  ? 82.026  -6.165  96.574   1.00 29.69  ? 627  ARG C CB    1 
ATOM   8492  C  CG    . ARG C  2  627  ? 82.067  -7.035  97.812   1.00 26.79  ? 627  ARG C CG    1 
ATOM   8493  C  CD    . ARG C  2  627  ? 80.845  -6.790  98.669   1.00 26.57  ? 627  ARG C CD    1 
ATOM   8494  N  NE    . ARG C  2  627  ? 80.973  -7.403  99.985   1.00 34.40  ? 627  ARG C NE    1 
ATOM   8495  C  CZ    . ARG C  2  627  ? 80.152  -7.158  101.000  1.00 40.53  ? 627  ARG C CZ    1 
ATOM   8496  N  NH1   . ARG C  2  627  ? 79.146  -6.307  100.844  1.00 38.26  ? 627  ARG C NH1   1 
ATOM   8497  N  NH2   . ARG C  2  627  ? 80.339  -7.758  102.170  1.00 37.45  ? 627  ARG C NH2   1 
ATOM   8498  N  N     . PHE C  2  628  ? 79.171  -4.936  95.081   1.00 29.08  ? 628  PHE C N     1 
ATOM   8499  C  CA    . PHE C  2  628  ? 78.539  -3.769  94.461   1.00 29.76  ? 628  PHE C CA    1 
ATOM   8500  C  C     . PHE C  2  628  ? 78.639  -3.786  92.938   1.00 36.40  ? 628  PHE C C     1 
ATOM   8501  O  O     . PHE C  2  628  ? 79.100  -2.825  92.318   1.00 37.87  ? 628  PHE C O     1 
ATOM   8502  C  CB    . PHE C  2  628  ? 79.106  -2.473  95.038   1.00 26.06  ? 628  PHE C CB    1 
ATOM   8503  C  CG    . PHE C  2  628  ? 79.004  -2.388  96.530   1.00 30.66  ? 628  PHE C CG    1 
ATOM   8504  C  CD1   . PHE C  2  628  ? 77.821  -1.993  97.133   1.00 27.93  ? 628  PHE C CD1   1 
ATOM   8505  C  CD2   . PHE C  2  628  ? 80.084  -2.718  97.332   1.00 28.15  ? 628  PHE C CD2   1 
ATOM   8506  C  CE1   . PHE C  2  628  ? 77.721  -1.920  98.508   1.00 28.75  ? 628  PHE C CE1   1 
ATOM   8507  C  CE2   . PHE C  2  628  ? 79.990  -2.647  98.708   1.00 26.47  ? 628  PHE C CE2   1 
ATOM   8508  C  CZ    . PHE C  2  628  ? 78.807  -2.247  99.297   1.00 29.32  ? 628  PHE C CZ    1 
ATOM   8509  N  N     . TYR C  2  629  ? 78.202  -4.896  92.351   1.00 35.49  ? 629  TYR C N     1 
ATOM   8510  C  CA    . TYR C  2  629  ? 78.231  -5.097  90.909   1.00 30.13  ? 629  TYR C CA    1 
ATOM   8511  C  C     . TYR C  2  629  ? 76.879  -4.724  90.316   1.00 25.65  ? 629  TYR C C     1 
ATOM   8512  O  O     . TYR C  2  629  ? 75.834  -5.119  90.836   1.00 21.97  ? 629  TYR C O     1 
ATOM   8513  C  CB    . TYR C  2  629  ? 78.542  -6.562  90.604   1.00 39.45  ? 629  TYR C CB    1 
ATOM   8514  C  CG    . TYR C  2  629  ? 79.153  -6.825  89.245   1.00 54.16  ? 629  TYR C CG    1 
ATOM   8515  C  CD1   . TYR C  2  629  ? 80.534  -6.849  89.078   1.00 67.81  ? 629  TYR C CD1   1 
ATOM   8516  C  CD2   . TYR C  2  629  ? 78.352  -7.071  88.135   1.00 47.93  ? 629  TYR C CD2   1 
ATOM   8517  C  CE1   . TYR C  2  629  ? 81.100  -7.097  87.843   1.00 81.37  ? 629  TYR C CE1   1 
ATOM   8518  C  CE2   . TYR C  2  629  ? 78.910  -7.320  86.892   1.00 56.17  ? 629  TYR C CE2   1 
ATOM   8519  C  CZ    . TYR C  2  629  ? 80.285  -7.332  86.753   1.00 79.26  ? 629  TYR C CZ    1 
ATOM   8520  O  OH    . TYR C  2  629  ? 80.847  -7.579  85.520   1.00 75.39  ? 629  TYR C OH    1 
ATOM   8521  N  N     . ARG C  2  630  ? 76.905  -3.955  89.233   1.00 23.79  ? 630  ARG C N     1 
ATOM   8522  C  CA    . ARG C  2  630  ? 75.681  -3.507  88.581   1.00 20.46  ? 630  ARG C CA    1 
ATOM   8523  C  C     . ARG C  2  630  ? 75.152  -4.580  87.640   1.00 24.59  ? 630  ARG C C     1 
ATOM   8524  O  O     . ARG C  2  630  ? 75.884  -5.068  86.780   1.00 33.63  ? 630  ARG C O     1 
ATOM   8525  C  CB    . ARG C  2  630  ? 75.928  -2.214  87.800   1.00 17.92  ? 630  ARG C CB    1 
ATOM   8526  C  CG    . ARG C  2  630  ? 74.700  -1.699  87.069   1.00 18.99  ? 630  ARG C CG    1 
ATOM   8527  C  CD    . ARG C  2  630  ? 75.023  -0.537  86.141   1.00 22.71  ? 630  ARG C CD    1 
ATOM   8528  N  NE    . ARG C  2  630  ? 73.810  0.015   85.541   1.00 25.19  ? 630  ARG C NE    1 
ATOM   8529  C  CZ    . ARG C  2  630  ? 73.241  -0.452  84.434   1.00 22.89  ? 630  ARG C CZ    1 
ATOM   8530  N  NH1   . ARG C  2  630  ? 72.134  0.109   83.968   1.00 23.76  ? 630  ARG C NH1   1 
ATOM   8531  N  NH2   . ARG C  2  630  ? 73.777  -1.482  83.794   1.00 20.13  ? 630  ARG C NH2   1 
ATOM   8532  N  N     . SER C  2  631  ? 73.884  -4.947  87.805   1.00 22.06  ? 631  SER C N     1 
ATOM   8533  C  CA    . SER C  2  631  ? 73.260  -5.928  86.927   1.00 19.86  ? 631  SER C CA    1 
ATOM   8534  C  C     . SER C  2  631  ? 72.606  -5.215  85.755   1.00 18.61  ? 631  SER C C     1 
ATOM   8535  O  O     . SER C  2  631  ? 72.611  -3.985  85.696   1.00 19.98  ? 631  SER C O     1 
ATOM   8536  C  CB    . SER C  2  631  ? 72.212  -6.739  87.685   1.00 21.10  ? 631  SER C CB    1 
ATOM   8537  O  OG    . SER C  2  631  ? 71.012  -6.001  87.837   1.00 21.90  ? 631  SER C OG    1 
ATOM   8538  N  N     . ASN C  2  632  ? 72.034  -5.993  84.839   1.00 17.77  ? 632  ASN C N     1 
ATOM   8539  C  CA    . ASN C  2  632  ? 71.343  -5.456  83.668   1.00 18.48  ? 632  ASN C CA    1 
ATOM   8540  C  C     . ASN C  2  632  ? 70.313  -4.396  84.029   1.00 17.28  ? 632  ASN C C     1 
ATOM   8541  O  O     . ASN C  2  632  ? 70.189  -3.374  83.353   1.00 17.19  ? 632  ASN C O     1 
ATOM   8542  C  CB    . ASN C  2  632  ? 70.636  -6.578  82.906   1.00 18.67  ? 632  ASN C CB    1 
ATOM   8543  C  CG    . ASN C  2  632  ? 71.597  -7.495  82.184   1.00 19.40  ? 632  ASN C CG    1 
ATOM   8544  O  OD1   . ASN C  2  632  ? 72.762  -7.157  81.971   1.00 24.71  ? 632  ASN C OD1   1 
ATOM   8545  N  ND2   . ASN C  2  632  ? 71.106  -8.666  81.790   1.00 16.17  ? 632  ASN C ND2   1 
ATOM   8546  N  N     . GLN C  2  633  ? 69.577  -4.653  85.103   1.00 16.81  ? 633  GLN C N     1 
ATOM   8547  C  CA    . GLN C  2  633  ? 68.479  -3.789  85.504   1.00 17.23  ? 633  GLN C CA    1 
ATOM   8548  C  C     . GLN C  2  633  ? 68.931  -2.712  86.484   1.00 20.51  ? 633  GLN C C     1 
ATOM   8549  O  O     . GLN C  2  633  ? 68.149  -1.844  86.868   1.00 27.94  ? 633  GLN C O     1 
ATOM   8550  C  CB    . GLN C  2  633  ? 67.339  -4.618  86.100   1.00 16.68  ? 633  GLN C CB    1 
ATOM   8551  C  CG    . GLN C  2  633  ? 66.555  -5.434  85.078   1.00 14.12  ? 633  GLN C CG    1 
ATOM   8552  C  CD    . GLN C  2  633  ? 67.362  -6.568  84.486   1.00 12.34  ? 633  GLN C CD    1 
ATOM   8553  O  OE1   . GLN C  2  633  ? 68.293  -7.073  85.112   1.00 16.20  ? 633  GLN C OE1   1 
ATOM   8554  N  NE2   . GLN C  2  633  ? 67.015  -6.972  83.270   1.00 10.39  ? 633  GLN C NE2   1 
ATOM   8555  N  N     . GLY C  2  634  ? 70.196  -2.766  86.884   1.00 16.61  ? 634  GLY C N     1 
ATOM   8556  C  CA    . GLY C  2  634  ? 70.750  -1.740  87.747   1.00 16.84  ? 634  GLY C CA    1 
ATOM   8557  C  C     . GLY C  2  634  ? 70.558  -2.005  89.228   1.00 17.72  ? 634  GLY C C     1 
ATOM   8558  O  O     . GLY C  2  634  ? 70.771  -1.117  90.054   1.00 14.85  ? 634  GLY C O     1 
ATOM   8559  N  N     . THR C  2  635  ? 70.139  -3.222  89.566   1.00 19.64  ? 635  THR C N     1 
ATOM   8560  C  CA    . THR C  2  635  ? 70.084  -3.643  90.961   1.00 18.76  ? 635  THR C CA    1 
ATOM   8561  C  C     . THR C  2  635  ? 71.484  -4.067  91.398   1.00 23.85  ? 635  THR C C     1 
ATOM   8562  O  O     . THR C  2  635  ? 72.258  -4.582  90.591   1.00 24.94  ? 635  THR C O     1 
ATOM   8563  C  CB    . THR C  2  635  ? 69.078  -4.798  91.184   1.00 13.02  ? 635  THR C CB    1 
ATOM   8564  O  OG1   . THR C  2  635  ? 69.409  -5.906  90.339   1.00 13.96  ? 635  THR C OG1   1 
ATOM   8565  C  CG2   . THR C  2  635  ? 67.669  -4.344  90.865   1.00 12.94  ? 635  THR C CG2   1 
ATOM   8566  N  N     . ALA C  2  636  ? 71.814  -3.841  92.667   1.00 26.78  ? 636  ALA C N     1 
ATOM   8567  C  CA    . ALA C  2  636  ? 73.157  -4.137  93.169   1.00 22.73  ? 636  ALA C CA    1 
ATOM   8568  C  C     . ALA C  2  636  ? 73.399  -5.629  93.383   1.00 24.78  ? 636  ALA C C     1 
ATOM   8569  O  O     . ALA C  2  636  ? 72.571  -6.332  93.961   1.00 26.14  ? 636  ALA C O     1 
ATOM   8570  C  CB    . ALA C  2  636  ? 73.425  -3.372  94.451   1.00 18.83  ? 636  ALA C CB    1 
ATOM   8571  N  N     . LEU C  2  637  ? 74.540  -6.109  92.905   1.00 26.21  ? 637  LEU C N     1 
ATOM   8572  C  CA    . LEU C  2  637  ? 74.925  -7.500  93.102   1.00 30.95  ? 637  LEU C CA    1 
ATOM   8573  C  C     . LEU C  2  637  ? 76.159  -7.575  93.983   1.00 34.83  ? 637  LEU C C     1 
ATOM   8574  O  O     . LEU C  2  637  ? 77.250  -7.201  93.558   1.00 39.09  ? 637  LEU C O     1 
ATOM   8575  C  CB    . LEU C  2  637  ? 75.232  -8.161  91.759   1.00 31.75  ? 637  LEU C CB    1 
ATOM   8576  C  CG    . LEU C  2  637  ? 74.123  -8.931  91.045   1.00 32.64  ? 637  LEU C CG    1 
ATOM   8577  C  CD1   . LEU C  2  637  ? 72.792  -8.194  91.110   1.00 27.23  ? 637  LEU C CD1   1 
ATOM   8578  C  CD2   . LEU C  2  637  ? 74.536  -9.183  89.602   1.00 26.06  ? 637  LEU C CD2   1 
ATOM   8579  N  N     . ASP C  2  638  ? 75.998  -8.060  95.209   1.00 33.41  ? 638  ASP C N     1 
ATOM   8580  C  CA    . ASP C  2  638  ? 77.156  -8.233  96.079   1.00 36.76  ? 638  ASP C CA    1 
ATOM   8581  C  C     . ASP C  2  638  ? 77.027  -9.412  97.036   1.00 35.35  ? 638  ASP C C     1 
ATOM   8582  O  O     . ASP C  2  638  ? 75.947  -9.705  97.552   1.00 35.46  ? 638  ASP C O     1 
ATOM   8583  C  CB    . ASP C  2  638  ? 77.483  -6.945  96.842   1.00 33.27  ? 638  ASP C CB    1 
ATOM   8584  C  CG    . ASP C  2  638  ? 76.431  -6.587  97.859   1.00 42.71  ? 638  ASP C CG    1 
ATOM   8585  O  OD1   . ASP C  2  638  ? 75.235  -6.842  97.598   1.00 52.55  ? 638  ASP C OD1   1 
ATOM   8586  O  OD2   . ASP C  2  638  ? 76.806  -6.050  98.923   1.00 45.91  ? 638  ASP C OD2   1 
ATOM   8587  N  N     . GLN C  2  639  ? 78.151  -10.080 97.262   1.00 30.32  ? 639  GLN C N     1 
ATOM   8588  C  CA    . GLN C  2  639  ? 78.193  -11.245 98.126   1.00 32.35  ? 639  GLN C CA    1 
ATOM   8589  C  C     . GLN C  2  639  ? 78.843  -10.901 99.460   1.00 32.27  ? 639  GLN C C     1 
ATOM   8590  O  O     . GLN C  2  639  ? 79.982  -10.444 99.510   1.00 34.68  ? 639  GLN C O     1 
ATOM   8591  C  CB    . GLN C  2  639  ? 78.941  -12.383 97.434   1.00 35.75  ? 639  GLN C CB    1 
ATOM   8592  C  CG    . GLN C  2  639  ? 78.242  -12.904 96.188   1.00 34.53  ? 639  GLN C CG    1 
ATOM   8593  C  CD    . GLN C  2  639  ? 79.143  -13.772 95.335   1.00 39.00  ? 639  GLN C CD    1 
ATOM   8594  O  OE1   . GLN C  2  639  ? 80.256  -13.376 94.989   1.00 37.41  ? 639  GLN C OE1   1 
ATOM   8595  N  NE2   . GLN C  2  639  ? 78.667  -14.966 94.992   1.00 36.76  ? 639  GLN C NE2   1 
ATOM   8596  N  N     . ARG C  2  640  ? 78.099  -11.111 100.539  1.00 31.65  ? 640  ARG C N     1 
ATOM   8597  C  CA    . ARG C  2  640  ? 78.582  -10.814 101.882  1.00 34.40  ? 640  ARG C CA    1 
ATOM   8598  C  C     . ARG C  2  640  ? 79.052  -12.091 102.569  1.00 32.68  ? 640  ARG C C     1 
ATOM   8599  O  O     . ARG C  2  640  ? 78.346  -13.097 102.552  1.00 32.05  ? 640  ARG C O     1 
ATOM   8600  C  CB    . ARG C  2  640  ? 77.488  -10.142 102.720  1.00 40.60  ? 640  ARG C CB    1 
ATOM   8601  C  CG    . ARG C  2  640  ? 77.125  -8.718  102.302  1.00 38.88  ? 640  ARG C CG    1 
ATOM   8602  C  CD    . ARG C  2  640  ? 76.171  -8.694  101.116  1.00 36.12  ? 640  ARG C CD    1 
ATOM   8603  N  NE    . ARG C  2  640  ? 75.081  -9.652  101.277  1.00 36.64  ? 640  ARG C NE    1 
ATOM   8604  C  CZ    . ARG C  2  640  ? 73.993  -9.430  102.007  1.00 41.92  ? 640  ARG C CZ    1 
ATOM   8605  N  NH1   . ARG C  2  640  ? 73.051  -10.361 102.096  1.00 36.64  ? 640  ARG C NH1   1 
ATOM   8606  N  NH2   . ARG C  2  640  ? 73.849  -8.278  102.651  1.00 44.19  ? 640  ARG C NH2   1 
ATOM   8607  N  N     . PRO C  2  641  ? 80.253  -12.060 103.164  1.00 35.32  ? 641  PRO C N     1 
ATOM   8608  C  CA    . PRO C  2  641  ? 80.760  -13.248 103.860  1.00 28.02  ? 641  PRO C CA    1 
ATOM   8609  C  C     . PRO C  2  641  ? 79.865  -13.633 105.040  1.00 29.03  ? 641  PRO C C     1 
ATOM   8610  O  O     . PRO C  2  641  ? 79.566  -12.789 105.885  1.00 29.73  ? 641  PRO C O     1 
ATOM   8611  C  CB    . PRO C  2  641  ? 82.133  -12.791 104.361  1.00 33.48  ? 641  PRO C CB    1 
ATOM   8612  C  CG    . PRO C  2  641  ? 82.026  -11.297 104.457  1.00 32.00  ? 641  PRO C CG    1 
ATOM   8613  C  CD    . PRO C  2  641  ? 81.139  -10.893 103.325  1.00 34.21  ? 641  PRO C CD    1 
ATOM   8614  N  N     . ARG C  2  642  ? 79.432  -14.890 105.078  1.00 30.51  ? 642  ARG C N     1 
ATOM   8615  C  CA    . ARG C  2  642  ? 78.593  -15.395 106.169  1.00 31.35  ? 642  ARG C CA    1 
ATOM   8616  C  C     . ARG C  2  642  ? 79.344  -16.198 107.235  1.00 31.43  ? 642  ARG C C     1 
ATOM   8617  O  O     . ARG C  2  642  ? 78.731  -16.740 108.156  1.00 30.77  ? 642  ARG C O     1 
ATOM   8618  C  CB    . ARG C  2  642  ? 77.401  -16.187 105.626  1.00 25.98  ? 642  ARG C CB    1 
ATOM   8619  C  CG    . ARG C  2  642  ? 76.324  -15.304 105.015  1.00 26.91  ? 642  ARG C CG    1 
ATOM   8620  C  CD    . ARG C  2  642  ? 75.715  -14.374 106.058  1.00 29.40  ? 642  ARG C CD    1 
ATOM   8621  N  NE    . ARG C  2  642  ? 75.001  -13.248 105.458  1.00 32.33  ? 642  ARG C NE    1 
ATOM   8622  C  CZ    . ARG C  2  642  ? 75.469  -12.003 105.411  1.00 34.51  ? 642  ARG C CZ    1 
ATOM   8623  N  NH1   . ARG C  2  642  ? 76.652  -11.714 105.935  1.00 32.37  ? 642  ARG C NH1   1 
ATOM   8624  N  NH2   . ARG C  2  642  ? 74.751  -11.041 104.845  1.00 35.51  ? 642  ARG C NH2   1 
ATOM   8625  N  N     . VAL C  2  643  ? 80.664  -16.285 107.095  1.00 32.48  ? 643  VAL C N     1 
ATOM   8626  C  CA    . VAL C  2  643  ? 81.485  -17.077 108.007  1.00 30.79  ? 643  VAL C CA    1 
ATOM   8627  C  C     . VAL C  2  643  ? 82.571  -16.236 108.675  1.00 35.17  ? 643  VAL C C     1 
ATOM   8628  O  O     . VAL C  2  643  ? 82.887  -15.139 108.218  1.00 36.90  ? 643  VAL C O     1 
ATOM   8629  C  CB    . VAL C  2  643  ? 82.149  -18.250 107.271  1.00 31.32  ? 643  VAL C CB    1 
ATOM   8630  C  CG1   . VAL C  2  643  ? 81.092  -19.173 106.694  1.00 34.30  ? 643  VAL C CG1   1 
ATOM   8631  C  CG2   . VAL C  2  643  ? 83.067  -17.735 106.174  1.00 30.65  ? 643  VAL C CG2   1 
ATOM   8632  N  N     . VAL C  2  644  ? 83.140  -16.757 109.760  1.00 34.56  ? 644  VAL C N     1 
ATOM   8633  C  CA    . VAL C  2  644  ? 84.194  -16.053 110.489  1.00 39.52  ? 644  VAL C CA    1 
ATOM   8634  C  C     . VAL C  2  644  ? 85.490  -16.872 110.488  1.00 41.18  ? 644  VAL C C     1 
ATOM   8635  O  O     . VAL C  2  644  ? 85.457  -18.086 110.288  1.00 40.44  ? 644  VAL C O     1 
ATOM   8636  C  CB    . VAL C  2  644  ? 83.754  -15.742 111.936  1.00 40.43  ? 644  VAL C CB    1 
ATOM   8637  C  CG1   . VAL C  2  644  ? 83.788  -17.004 112.788  1.00 37.64  ? 644  VAL C CG1   1 
ATOM   8638  C  CG2   . VAL C  2  644  ? 84.619  -14.637 112.544  1.00 42.46  ? 644  VAL C CG2   1 
ATOM   8639  N  N     . VAL C  2  645  ? 86.627  -16.206 110.692  1.00 41.18  ? 645  VAL C N     1 
ATOM   8640  C  CA    . VAL C  2  645  ? 87.932  -16.868 110.644  1.00 39.57  ? 645  VAL C CA    1 
ATOM   8641  C  C     . VAL C  2  645  ? 88.057  -17.988 111.670  1.00 37.25  ? 645  VAL C C     1 
ATOM   8642  O  O     . VAL C  2  645  ? 87.833  -17.777 112.862  1.00 35.62  ? 645  VAL C O     1 
ATOM   8643  C  CB    . VAL C  2  645  ? 89.090  -15.873 110.868  1.00 39.51  ? 645  VAL C CB    1 
ATOM   8644  C  CG1   . VAL C  2  645  ? 90.424  -16.594 110.802  1.00 35.37  ? 645  VAL C CG1   1 
ATOM   8645  C  CG2   . VAL C  2  645  ? 89.042  -14.754 109.842  1.00 48.18  ? 645  VAL C CG2   1 
ATOM   8646  N  N     . GLY C  2  646  ? 88.424  -19.176 111.197  1.00 40.57  ? 646  GLY C N     1 
ATOM   8647  C  CA    . GLY C  2  646  ? 88.605  -20.326 112.063  1.00 39.57  ? 646  GLY C CA    1 
ATOM   8648  C  C     . GLY C  2  646  ? 87.379  -21.213 112.132  1.00 36.66  ? 646  GLY C C     1 
ATOM   8649  O  O     . GLY C  2  646  ? 87.335  -22.173 112.900  1.00 40.85  ? 646  GLY C O     1 
ATOM   8650  N  N     . GLN C  2  647  ? 86.376  -20.891 111.325  1.00 38.68  ? 647  GLN C N     1 
ATOM   8651  C  CA    . GLN C  2  647  ? 85.135  -21.653 111.312  1.00 43.58  ? 647  GLN C CA    1 
ATOM   8652  C  C     . GLN C  2  647  ? 85.319  -22.984 110.596  1.00 42.34  ? 647  GLN C C     1 
ATOM   8653  O  O     . GLN C  2  647  ? 85.930  -23.043 109.529  1.00 43.34  ? 647  GLN C O     1 
ATOM   8654  C  CB    . GLN C  2  647  ? 84.024  -20.840 110.645  1