data_5D4D
# 
_entry.id   5D4D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5D4D         
WWPDB D_1000212662 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '4G7H contains a Thermus thermophilus RPo complex' 4G7H unspecified 
PDB .                                                  5D4E unspecified 
PDB .                                                  5D4C unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5D4D 
_pdbx_database_status.recvd_initial_deposition_date   2015-08-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'     1 
'Ebright, R.H.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            535 
_citation.language                  ? 
_citation.page_first                444 
_citation.page_last                 447 
_citation.title                     
;The mechanism of RNA 5' capping with NAD(+), NADH and desphospho-CoA.
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature18622 
_citation.pdbx_database_id_PubMed   27383794 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bird, J.G.'    1  
primary 'Zhang, Y.'     2  
primary 'Tian, Y.'      3  
primary 'Panova, N.'    4  
primary 'Barvik, I.'    5  
primary 'Greene, L.'    6  
primary 'Liu, M.'       7  
primary 'Buckley, B.'   8  
primary 'Krasny, L.'    9  
primary 'Lee, J.K.'     10 
primary 'Kaplan, C.D.'  11 
primary 'Ebright, R.H.' 12 
primary 'Nickels, B.E.' 13 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   98.270 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5D4D 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     185.000 
_cell.length_a_esd                 ? 
_cell.length_b                     103.510 
_cell.length_b_esd                 ? 
_cell.length_c                     296.300 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5D4D 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                              35056.164  4   2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                               125436.539 2   2.7.7.6 ? ? ? 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 2   2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                              11533.316  2   2.7.7.6 ? ? ? 
5  polymer     man 'RNA polymerase sigma factor SigA'                                       50769.398  2   ?       ? ? ? 
6  polymer     syn 
;DNA (5'-D(*CP*C*TP*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*AP*GP*AP*G)-3')
;
5845.786   2   ?       ? ? ? 
7  polymer     syn 'DNA (27-MER)'                                                           8421.432   2   ?       ? ? ? 
8  non-polymer syn 'MAGNESIUM ION'                                                          24.305     10  ?       ? ? ? 
9  non-polymer syn 'ZINC ION'                                                               65.409     4   ?       ? ? ? 
10 non-polymer syn "CYTIDINE-5'-MONOPHOSPHATE"                                              323.197    2   ?       ? ? ? 
11 non-polymer syn "CYTIDINE-5'-TRIPHOSPHATE"                                               483.156    2   ?       ? ? ? 
12 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE                                        663.425    1   ?       ? ? ? 
13 non-polymer syn "ADENOSINE-5'-MONOPHOSPHATE"                                             347.221    1   ?       ? ? ? 
14 water       nat water                                                                    18.015     895 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B,K,L ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C,M     ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D,N     ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E,O     ? 
5 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F,P     ? 
6 polydeoxyribonucleotide no no '(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DA)(DG)(DA)(DG)' CCTGCATCCGTGAGTAGAG 
G,R     ? 
7 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H,S     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DA  n 
6 17   DG  n 
6 18   DA  n 
6 19   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   443 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'sigA, rpoD, TT_C0164' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB27 / ATCC BAA-163 / DSM 7039' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     262724 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plsamid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 315  ? 'Thermus thermophilus'                                     274    ? ? ?                            ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2 1 sample 1 1119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3 1 sample 1 1524 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 19 'Thermus thermophilus' ? 274 ? 
7 1 sample 1 27 'Thermus thermophilus' ? 274 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_THETH Q9Z9H6 ? 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 
2 UNP RPOB_THET8 Q8RQE9 ? 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 
3 UNP RPOC_THET8 Q8RQE8 ? 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 
4 UNP RPOZ_THET8 Q8RQE7 ? 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 
5 UNP SIGA_THET2 Q72L95 ? 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLALEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 
6 PDB 5D4D       5D4D   ? 6 ? 1 
7 PDB 5D4D       5D4D   ? 7 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5D4D A 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
2  1 5D4D B 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
3  2 5D4D C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4  3 5D4D D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5  4 5D4D E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6  5 5D4D F 21 ? 443  ? Q72L95 1 ? 423  ? 1 423  
7  6 5D4D G 1  ? 19   ? 5D4D   2 ? 20   ? 2 20   
8  7 5D4D H 1  ? 27   ? 5D4D   1 ? 27   ? 1 27   
9  1 5D4D K 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
10 1 5D4D L 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
11 2 5D4D M 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
12 3 5D4D N 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
13 4 5D4D O 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
14 5 5D4D P 21 ? 443  ? Q72L95 1 ? 423  ? 1 423  
15 6 5D4D R 1  ? 19   ? 5D4D   2 ? 20   ? 2 20   
16 7 5D4D S 1  ? 27   ? 5D4D   1 ? 27   ? 1 27   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6  5D4D MET F 1  ? UNP Q72L95 ?   ?  'initiating methionine' -19 1  
6  5D4D GLY F 2  ? UNP Q72L95 ?   ?  'expression tag'        -18 2  
6  5D4D SER F 3  ? UNP Q72L95 ?   ?  'expression tag'        -17 3  
6  5D4D SER F 4  ? UNP Q72L95 ?   ?  'expression tag'        -16 4  
6  5D4D HIS F 5  ? UNP Q72L95 ?   ?  'expression tag'        -15 5  
6  5D4D HIS F 6  ? UNP Q72L95 ?   ?  'expression tag'        -14 6  
6  5D4D HIS F 7  ? UNP Q72L95 ?   ?  'expression tag'        -13 7  
6  5D4D HIS F 8  ? UNP Q72L95 ?   ?  'expression tag'        -12 8  
6  5D4D HIS F 9  ? UNP Q72L95 ?   ?  'expression tag'        -11 9  
6  5D4D HIS F 10 ? UNP Q72L95 ?   ?  'expression tag'        -10 10 
6  5D4D SER F 11 ? UNP Q72L95 ?   ?  'expression tag'        -9  11 
6  5D4D SER F 12 ? UNP Q72L95 ?   ?  'expression tag'        -8  12 
6  5D4D GLY F 13 ? UNP Q72L95 ?   ?  'expression tag'        -7  13 
6  5D4D LEU F 14 ? UNP Q72L95 ?   ?  'expression tag'        -6  14 
6  5D4D VAL F 15 ? UNP Q72L95 ?   ?  'expression tag'        -5  15 
6  5D4D PRO F 16 ? UNP Q72L95 ?   ?  'expression tag'        -4  16 
6  5D4D ARG F 17 ? UNP Q72L95 ?   ?  'expression tag'        -3  17 
6  5D4D GLY F 18 ? UNP Q72L95 ?   ?  'expression tag'        -2  18 
6  5D4D SER F 19 ? UNP Q72L95 ?   ?  'expression tag'        -1  19 
6  5D4D HIS F 20 ? UNP Q72L95 ?   ?  'expression tag'        0   20 
6  5D4D THR F 66 ? UNP Q72L95 ALA 46 conflict                46  21 
14 5D4D MET P 1  ? UNP Q72L95 ?   ?  'initiating methionine' -19 22 
14 5D4D GLY P 2  ? UNP Q72L95 ?   ?  'expression tag'        -18 23 
14 5D4D SER P 3  ? UNP Q72L95 ?   ?  'expression tag'        -17 24 
14 5D4D SER P 4  ? UNP Q72L95 ?   ?  'expression tag'        -16 25 
14 5D4D HIS P 5  ? UNP Q72L95 ?   ?  'expression tag'        -15 26 
14 5D4D HIS P 6  ? UNP Q72L95 ?   ?  'expression tag'        -14 27 
14 5D4D HIS P 7  ? UNP Q72L95 ?   ?  'expression tag'        -13 28 
14 5D4D HIS P 8  ? UNP Q72L95 ?   ?  'expression tag'        -12 29 
14 5D4D HIS P 9  ? UNP Q72L95 ?   ?  'expression tag'        -11 30 
14 5D4D HIS P 10 ? UNP Q72L95 ?   ?  'expression tag'        -10 31 
14 5D4D SER P 11 ? UNP Q72L95 ?   ?  'expression tag'        -9  32 
14 5D4D SER P 12 ? UNP Q72L95 ?   ?  'expression tag'        -8  33 
14 5D4D GLY P 13 ? UNP Q72L95 ?   ?  'expression tag'        -7  34 
14 5D4D LEU P 14 ? UNP Q72L95 ?   ?  'expression tag'        -6  35 
14 5D4D VAL P 15 ? UNP Q72L95 ?   ?  'expression tag'        -5  36 
14 5D4D PRO P 16 ? UNP Q72L95 ?   ?  'expression tag'        -4  37 
14 5D4D ARG P 17 ? UNP Q72L95 ?   ?  'expression tag'        -3  38 
14 5D4D GLY P 18 ? UNP Q72L95 ?   ?  'expression tag'        -2  39 
14 5D4D SER P 19 ? UNP Q72L95 ?   ?  'expression tag'        -1  40 
14 5D4D HIS P 20 ? UNP Q72L95 ?   ?  'expression tag'        0   41 
14 5D4D THR P 66 ? UNP Q72L95 ALA 46 conflict                46  42 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'    323.197 
CTP non-polymer         . "CYTIDINE-5'-TRIPHOSPHATE"           ? 'C9 H16 N3 O14 P3'  483.156 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE    ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5D4D 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.17 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.17 
_exptl_crystal.description                 rod 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.4 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM Tris-HCl, pH 8.4, 200 mM potassium chloride, 50 mM magnesium chloride, 9.5% PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-02-23 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            48.750 
_reflns.entry_id                         5D4D 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.000 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       219058 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.000 
_reflns.pdbx_Rmerge_I_obs                0.119 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.119 
_reflns.pdbx_netI_over_av_sigmaI         10.571 
_reflns.pdbx_netI_over_sigmaI            7.200 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.095 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.132 
_reflns.pdbx_Rpim_I_all                  0.067 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         869839 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.000 3.050  ? ? ? ? ? 10483 ? 93.700 ? ? ? ? 0.920 ? ? ? ? ? ? ? ? 3.700 ? 1.000 ? ? ?     0.535 0 1  1 0.677 ? 
3.050 3.110  ? ? ? ? ? 10578 ? 96.000 ? ? ? ? 0.803 ? ? ? ? ? ? ? ? 3.700 ? 1.019 ? ? 0.930 0.465 0 2  1 0.748 ? 
3.110 3.170  ? ? ? ? ? 10559 ? 94.600 ? ? ? ? 0.686 ? ? ? ? ? ? ? ? 3.800 ? 1.035 ? ? 0.795 0.397 0 3  1 0.783 ? 
3.170 3.230  ? ? ? ? ? 10677 ? 95.600 ? ? ? ? 0.598 ? ? ? ? ? ? ? ? 3.800 ? 1.057 ? ? 0.692 0.345 0 4  1 0.814 ? 
3.230 3.300  ? ? ? ? ? 10683 ? 96.600 ? ? ? ? 0.473 ? ? ? ? ? ? ? ? 3.800 ? 1.064 ? ? 0.548 0.273 0 5  1 0.877 ? 
3.300 3.380  ? ? ? ? ? 10718 ? 95.900 ? ? ? ? 0.405 ? ? ? ? ? ? ? ? 3.800 ? 1.110 ? ? 0.469 0.233 0 6  1 0.908 ? 
3.380 3.460  ? ? ? ? ? 10709 ? 96.500 ? ? ? ? 0.336 ? ? ? ? ? ? ? ? 3.900 ? 1.142 ? ? 0.388 0.193 0 7  1 0.930 ? 
3.460 3.560  ? ? ? ? ? 10909 ? 97.900 ? ? ? ? 0.281 ? ? ? ? ? ? ? ? 3.900 ? 1.134 ? ? 0.325 0.161 0 8  1 0.952 ? 
3.560 3.660  ? ? ? ? ? 10893 ? 97.900 ? ? ? ? 0.238 ? ? ? ? ? ? ? ? 3.900 ? 1.157 ? ? 0.275 0.136 0 9  1 0.959 ? 
3.660 3.780  ? ? ? ? ? 10959 ? 98.300 ? ? ? ? 0.195 ? ? ? ? ? ? ? ? 3.900 ? 1.178 ? ? 0.225 0.111 0 10 1 0.974 ? 
3.780 3.910  ? ? ? ? ? 11009 ? 98.900 ? ? ? ? 0.166 ? ? ? ? ? ? ? ? 4.000 ? 1.217 ? ? 0.192 0.094 0 11 1 0.980 ? 
3.910 4.070  ? ? ? ? ? 11105 ? 99.200 ? ? ? ? 0.131 ? ? ? ? ? ? ? ? 4.100 ? 1.195 ? ? 0.151 0.074 0 12 1 0.988 ? 
4.070 4.260  ? ? ? ? ? 11125 ? 99.400 ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 4.100 ? 1.173 ? ? 0.127 0.062 0 13 1 0.990 ? 
4.260 4.480  ? ? ? ? ? 11154 ? 99.500 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 4.200 ? 1.144 ? ? 0.107 0.052 0 14 1 0.993 ? 
4.480 4.760  ? ? ? ? ? 11120 ? 99.300 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 4.200 ? 1.106 ? ? 0.096 0.046 0 15 1 0.992 ? 
4.760 5.130  ? ? ? ? ? 11139 ? 99.700 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 4.200 ? 1.100 ? ? 0.092 0.044 0 16 1 0.995 ? 
5.130 5.640  ? ? ? ? ? 11196 ? 99.600 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 4.200 ? 1.091 ? ? 0.094 0.045 0 17 1 0.995 ? 
5.640 6.460  ? ? ? ? ? 11276 ? 99.800 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 4.100 ? 1.079 ? ? 0.090 0.043 0 18 1 0.995 ? 
6.460 8.130  ? ? ? ? ? 11266 ? 99.800 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 4.000 ? 1.006 ? ? 0.064 0.031 0 19 1 0.997 ? 
8.130 50.000 ? ? ? ? ? 11500 ? 99.100 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 4.000 ? 0.868 ? ? 0.038 0.018 0 20 1 0.999 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                170.100 
_refine.B_iso_mean                               31.8400 
_refine.B_iso_min                                0.010 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5D4D 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.0 
_refine.ls_d_res_low                             42.1730 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     218774 
_refine.ls_number_reflns_R_free                  10932 
_refine.ls_number_reflns_R_work                  207842 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.5400 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2040 
_refine.ls_R_factor_R_free                       0.2535 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2014 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4G7H 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.5900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4100 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.8048 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        42.1730 
_refine_hist.pdbx_number_atoms_ligand         139 
_refine_hist.number_atoms_solvent             895 
_refine_hist.number_atoms_total               57349 
_refine_hist.pdbx_number_residues_total       6992 
_refine_hist.pdbx_B_iso_mean_ligand           39.47 
_refine_hist.pdbx_B_iso_mean_solvent          11.68 
_refine_hist.pdbx_number_atoms_protein        54790 
_refine_hist.pdbx_number_atoms_nucleic_acid   1525 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 57674 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.952  ? 78278 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.069  ? 8807  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 9988  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 15.444 ? 22355 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.9916 3.0256  6465 . 324 6141 87.0000  . . . 0.3645 . 0.3145 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0256 3.0612  6968 . 343 6625 94.0000  . . . 0.3388 . 0.2958 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0612 3.0985  7113 . 361 6752 96.0000  . . . 0.3376 . 0.2898 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0985 3.1377  7042 . 354 6688 94.0000  . . . 0.3607 . 0.2917 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.1377 3.1790  7099 . 352 6747 97.0000  . . . 0.3451 . 0.2785 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.1790 3.2225  7139 . 348 6791 95.0000  . . . 0.3489 . 0.2750 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.2225 3.2685  7109 . 353 6756 96.0000  . . . 0.3238 . 0.2691 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.2685 3.3173  7211 . 359 6852 97.0000  . . . 0.3052 . 0.2579 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.3173 3.3691  7127 . 354 6773 96.0000  . . . 0.3192 . 0.2484 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.3691 3.4243  7233 . 359 6874 97.0000  . . . 0.2907 . 0.2332 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.4243 3.4833  7182 . 365 6817 97.0000  . . . 0.2880 . 0.2270 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.4833 3.5467  7279 . 363 6916 98.0000  . . . 0.2861 . 0.2181 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.5467 3.6148  7241 . 362 6879 97.0000  . . . 0.2706 . 0.2140 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.6148 3.6886  7345 . 368 6977 98.0000  . . . 0.2781 . 0.2093 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.6886 3.7687  7340 . 370 6970 99.0000  . . . 0.2680 . 0.2103 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.7687 3.8563  7386 . 370 7016 99.0000  . . . 0.2564 . 0.1966 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.8563 3.9527  7365 . 368 6997 100.0000 . . . 0.2346 . 0.1867 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.9527 4.0595  7398 . 370 7028 99.0000  . . . 0.2259 . 0.1803 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.0595 4.1789  7391 . 368 7023 99.0000  . . . 0.2442 . 0.1770 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.1789 4.3136  7465 . 375 7090 99.0000  . . . 0.2158 . 0.1720 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.3136 4.4676  7448 . 371 7077 100.0000 . . . 0.2243 . 0.1651 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.4676 4.6463  7413 . 373 7040 99.0000  . . . 0.1849 . 0.1584 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.6463 4.8575  7433 . 373 7060 99.0000  . . . 0.2139 . 0.1649 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.8575 5.1131  7473 . 373 7100 100.0000 . . . 0.2255 . 0.1691 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 5.1131 5.4329  7537 . 377 7160 100.0000 . . . 0.2230 . 0.1775 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 5.4329 5.8513  7417 . 370 7047 100.0000 . . . 0.2463 . 0.1839 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 5.8513 6.4383  7562 . 379 7183 100.0000 . . . 0.2481 . 0.1899 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 6.4383 7.3657  7525 . 376 7149 100.0000 . . . 0.2228 . 0.1799 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 7.3657 9.2638  7602 . 378 7224 100.0000 . . . 0.2079 . 0.1559 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 9.2638 42.1776 7466 . 376 7090 96.0000  . . . 0.2107 . 0.1886 . . . . . . 30 . . . 
# 
_struct.entry_id                     5D4D 
_struct.title                        
'Crystal structure of Thermus thermophilus product complex for transcription initiation with NAD and CTP' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5D4D 
_struct_keywords.text            
;RNA polymerase, transcription initiation, bacterial, NCIN, non-canonical initiating nucleotide, primer-dependent initiation, DNA, Single-Stranded, DNA-Directed RNA Polymerases, Gene Expression Regulation, Promoter Regions, Genetic, Protein Conformation, Sigma Factor, transcription-dna complex
;
_struct_keywords.pdbx_keywords   transcription/dna 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 4  ? 
F  N N 5  ? 
G  N N 6  ? 
H  N N 7  ? 
I  N N 1  ? 
J  N N 1  ? 
K  N N 2  ? 
L  N N 3  ? 
M  N N 4  ? 
N  N N 5  ? 
O  N N 6  ? 
P  N N 7  ? 
Q  N N 8  ? 
R  N N 9  ? 
S  N N 9  ? 
T  N N 8  ? 
U  N N 8  ? 
V  N N 10 ? 
W  N N 11 ? 
X  N N 8  ? 
Y  N N 12 ? 
Z  N N 8  ? 
AA N N 8  ? 
BA N N 11 ? 
CA N N 9  ? 
DA N N 9  ? 
EA N N 8  ? 
FA N N 8  ? 
GA N N 10 ? 
HA N N 8  ? 
IA N N 8  ? 
JA N N 13 ? 
KA N N 14 ? 
LA N N 14 ? 
MA N N 14 ? 
NA N N 14 ? 
OA N N 14 ? 
PA N N 14 ? 
QA N N 14 ? 
RA N N 14 ? 
SA N N 14 ? 
TA N N 14 ? 
UA N N 14 ? 
VA N N 14 ? 
WA N N 14 ? 
XA N N 14 ? 
YA N N 14 ? 
ZA N N 14 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   AA2 ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   AA6 TYR A 224  ? ASN A 227  ? TYR A 224  ASN A 227  5 ? 4  
HELX_P HELX_P7   AA7 GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P8   AA8 ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P9   AA9 ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P10  AB1 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P11  AB2 THR B 206  ? TYR B 224  ? THR B 206  TYR B 224  1 ? 19 
HELX_P HELX_P12  AB3 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P13  AB4 PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P14  AB5 VAL C 42   ? PHE C 52   ? VAL C 42   PHE C 52   1 ? 11 
HELX_P HELX_P15  AB6 PRO C 79   ? LYS C 86   ? PRO C 79   LYS C 86   1 ? 8  
HELX_P HELX_P16  AB7 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P17  AB8 ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P18  AB9 GLU C 216  ? MET C 222  ? GLU C 216  MET C 222  1 ? 7  
HELX_P HELX_P19  AC1 ASP C 223  ? MET C 229  ? ASP C 223  MET C 229  1 ? 7  
HELX_P HELX_P20  AC2 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P21  AC3 LYS C 249  ? ALA C 262  ? LYS C 249  ALA C 262  1 ? 14 
HELX_P HELX_P22  AC4 GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P23  AC5 VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P24  AC6 THR C 335  ? LEU C 360  ? THR C 335  LEU C 360  1 ? 26 
HELX_P HELX_P25  AC7 THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P26  AC8 SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P27  AC9 ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P28  AD1 GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P29  AD2 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P30  AD3 THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P31  AD4 SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P32  AD5 PRO C 536  ? PHE C 540  ? PRO C 536  PHE C 540  5 ? 5  
HELX_P HELX_P33  AD6 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P34  AD7 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P35  AD8 ASP C 554  ? GLN C 565  ? ASP C 554  GLN C 565  1 ? 12 
HELX_P HELX_P36  AD9 THR C 566  ? ALA C 568  ? THR C 566  ALA C 568  5 ? 3  
HELX_P HELX_P37  AE1 LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P38  AE2 ASN C 683  ? ALA C 687  ? ASN C 683  ALA C 687  5 ? 5  
HELX_P HELX_P39  AE3 GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P40  AE4 SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P41  AE5 THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P42  AE6 PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P43  AE7 ASN C 872  ? VAL C 876  ? ASN C 872  VAL C 876  5 ? 5  
HELX_P HELX_P44  AE8 LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P45  AE9 LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P46  AF1 ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P47  AF2 THR C 958  ? LEU C 968  ? THR C 958  LEU C 968  1 ? 11 
HELX_P HELX_P48  AF3 MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P49  AF4 GLY C 1023 ? PHE C 1027 ? GLY C 1023 PHE C 1027 5 ? 5  
HELX_P HELX_P50  AF5 GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P51  AF6 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P52  AF7 ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P53  AF8 PRO C 1082 ? LEU C 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P54  AF9 SER D 14   ? TRP D 21   ? SER D 14   TRP D 21   1 ? 8  
HELX_P HELX_P55  AG1 ARG D 65   ? GLU D 69   ? ARG D 65   GLU D 69   5 ? 5  
HELX_P HELX_P56  AG2 LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P57  AG3 ILE D 102  ? ASP D 107  ? ILE D 102  ASP D 107  1 ? 6  
HELX_P HELX_P58  AG4 SER D 110  ? ASP D 117  ? SER D 110  ASP D 117  1 ? 8  
HELX_P HELX_P59  AG5 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P60  AG6 THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P61  AG7 ASP D 372  ? GLU D 376  ? ASP D 372  GLU D 376  5 ? 5  
HELX_P HELX_P62  AG8 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P63  AG9 GLY D 457  ? GLU D 467  ? GLY D 457  GLU D 467  1 ? 11 
HELX_P HELX_P64  AH1 ASP D 469  ? LYS D 482  ? ASP D 469  LYS D 482  1 ? 14 
HELX_P HELX_P65  AH2 SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P66  AH3 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P67  AH4 PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P68  AH5 SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P69  AH6 PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P70  AH7 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P71  AH8 GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P72  AH9 LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P73  AI1 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P74  AI2 ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P75  AI3 GLN D 680  ? ILE D 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P76  AI4 LYS D 684  ? ILE D 695  ? LYS D 684  ILE D 695  1 ? 12 
HELX_P HELX_P77  AI5 HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P78  AI6 HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P79  AI7 VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P80  AI8 SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P81  AI9 LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P82  AJ1 ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P83  AJ2 THR D 808  ? ARG D 818  ? THR D 808  ARG D 818  1 ? 11 
HELX_P HELX_P84  AJ3 VAL D 836  ? TYR D 841  ? VAL D 836  TYR D 841  1 ? 6  
HELX_P HELX_P85  AJ4 ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P86  AJ5 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P87  AJ6 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P88  AJ7 GLU D 907  ? SER D 945  ? GLU D 907  SER D 945  1 ? 39 
HELX_P HELX_P89  AJ8 GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P90  AJ9 GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P91  AK1 THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P92  AK2 ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P93  AK3 ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P94  AK4 THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P95  AK5 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P96  AK6 SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P97  AK7 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P98  AK8 ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P99  AK9 PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P100 AL1 GLN D 1254 ? GLU D 1264 ? GLN D 1254 GLU D 1264 1 ? 11 
HELX_P HELX_P101 AL2 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P102 AL3 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P103 AL4 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P104 AL5 LYS D 1397 ? GLY D 1411 ? LYS D 1397 GLY D 1411 1 ? 15 
HELX_P HELX_P105 AL6 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P106 AL7 SER D 1433 ? SER D 1439 ? SER D 1433 SER D 1439 1 ? 7  
HELX_P HELX_P107 AL8 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P108 AL9 GLY D 1461 ? GLY D 1469 ? GLY D 1461 GLY D 1469 1 ? 9  
HELX_P HELX_P109 AM1 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P110 AM2 GLN D 1489 ? ARG D 1499 ? GLN D 1489 ARG D 1499 1 ? 11 
HELX_P HELX_P111 AM3 GLY E 5    ? MET E 12   ? GLY E 5    MET E 12   1 ? 8  
HELX_P HELX_P112 AM4 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P113 AM5 GLU E 41   ? ARG E 45   ? GLU E 41   ARG E 45   5 ? 5  
HELX_P HELX_P114 AM6 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P115 AM7 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P116 AM8 ASP F 99   ? GLN F 110  ? ASP F 79   GLN F 90   1 ? 12 
HELX_P HELX_P117 AM9 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P118 AN1 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P119 AN2 ASP F 172  ? LYS F 184  ? ASP F 152  LYS F 164  1 ? 13 
HELX_P HELX_P120 AN3 PRO F 187  ? ASN F 211  ? PRO F 167  ASN F 191  1 ? 25 
HELX_P HELX_P121 AN4 ASN F 211  ? LYS F 220  ? ASN F 191  LYS F 200  1 ? 10 
HELX_P HELX_P122 AN5 LYS F 221  ? THR F 223  ? LYS F 201  THR F 203  5 ? 3  
HELX_P HELX_P123 AN6 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P124 AN7 GLU F 248  ? ARG F 252  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P125 AN8 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P126 AN9 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P127 AO1 THR F 307  ? MET F 315  ? THR F 287  MET F 295  1 ? 9  
HELX_P HELX_P128 AO2 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P129 AO3 PHE F 348  ? ILE F 353  ? PHE F 328  ILE F 333  5 ? 6  
HELX_P HELX_P130 AO4 SER F 360  ? SER F 379  ? SER F 340  SER F 359  1 ? 20 
HELX_P HELX_P131 AO5 SER F 382  ? LYS F 393  ? SER F 362  LYS F 373  1 ? 12 
HELX_P HELX_P132 AO6 THR F 402  ? PHE F 410  ? THR F 382  PHE F 390  1 ? 9  
HELX_P HELX_P133 AO7 THR F 413  ? ARG F 436  ? THR F 393  ARG F 416  1 ? 24 
HELX_P HELX_P134 AO8 LEU F 438  ? ASP F 443  ? LEU F 418  ASP F 423  5 ? 6  
HELX_P HELX_P135 AO9 GLY I 31   ? SER I 47   ? GLY K 31   SER K 47   1 ? 17 
HELX_P HELX_P136 AP1 ASP I 74   ? LYS I 83   ? ASP K 74   LYS K 83   1 ? 10 
HELX_P HELX_P137 AP2 PRO I 152  ? GLY I 157  ? PRO K 152  GLY K 157  1 ? 6  
HELX_P HELX_P138 AP3 THR I 206  ? TYR I 224  ? THR K 206  TYR K 224  1 ? 19 
HELX_P HELX_P139 AP4 GLY J 31   ? SER J 47   ? GLY L 31   SER L 47   1 ? 17 
HELX_P HELX_P140 AP5 ASP J 74   ? GLU J 84   ? ASP L 74   GLU L 84   1 ? 11 
HELX_P HELX_P141 AP6 ARG J 112  ? PHE J 114  ? ARG L 112  PHE L 114  5 ? 3  
HELX_P HELX_P142 AP7 PRO J 152  ? GLY J 157  ? PRO L 152  GLY L 157  1 ? 6  
HELX_P HELX_P143 AP8 THR J 206  ? TYR J 224  ? THR L 206  TYR L 224  1 ? 19 
HELX_P HELX_P144 AP9 THR K 19   ? GLN K 31   ? THR M 19   GLN M 31   1 ? 13 
HELX_P HELX_P145 AQ1 GLY K 43   ? PHE K 52   ? GLY M 43   PHE M 52   1 ? 10 
HELX_P HELX_P146 AQ2 PRO K 79   ? ASP K 87   ? PRO M 79   ASP M 87   1 ? 9  
HELX_P HELX_P147 AQ3 LEU K 193  ? LEU K 200  ? LEU M 193  LEU M 200  1 ? 8  
HELX_P HELX_P148 AQ4 ASP K 203  ? GLY K 212  ? ASP M 203  GLY M 212  1 ? 10 
HELX_P HELX_P149 AQ5 TYR K 214  ? GLY K 220  ? TYR M 214  GLY M 220  1 ? 7  
HELX_P HELX_P150 AQ6 ASP K 223  ? ALA K 228  ? ASP M 223  ALA M 228  1 ? 6  
HELX_P HELX_P151 AQ7 ARG K 230  ? ARG K 243  ? ARG M 230  ARG M 243  1 ? 14 
HELX_P HELX_P152 AQ8 LYS K 249  ? ALA K 262  ? LYS M 249  ALA M 262  1 ? 14 
HELX_P HELX_P153 AQ9 GLY K 270  ? GLY K 282  ? GLY M 270  GLY M 282  1 ? 13 
HELX_P HELX_P154 AR1 VAL K 302  ? GLY K 316  ? VAL M 302  GLY M 316  1 ? 15 
HELX_P HELX_P155 AR2 THR K 335  ? MET K 359  ? THR M 335  MET M 359  1 ? 25 
HELX_P HELX_P156 AR3 PRO K 369  ? VAL K 373  ? PRO M 369  VAL M 373  1 ? 5  
HELX_P HELX_P157 AR4 SER K 375  ? SER K 389  ? SER M 375  SER M 389  1 ? 15 
HELX_P HELX_P158 AR5 ASN K 399  ? ARG K 408  ? ASN M 399  ARG M 408  1 ? 10 
HELX_P HELX_P159 AR6 HIS K 431  ? TYR K 435  ? HIS M 431  TYR M 435  5 ? 5  
HELX_P HELX_P160 AR7 THR K 487  ? ARG K 493  ? THR M 487  ARG M 493  1 ? 7  
HELX_P HELX_P161 AR8 SER K 525  ? VAL K 529  ? SER M 525  VAL M 529  5 ? 5  
HELX_P HELX_P162 AR9 SER K 535  ? PHE K 540  ? SER M 535  PHE M 540  5 ? 6  
HELX_P HELX_P163 AS1 SER K 541  ? LEU K 546  ? SER M 541  LEU M 546  1 ? 6  
HELX_P HELX_P164 AS2 PHE K 549  ? ASP K 553  ? PHE M 549  ASP M 553  5 ? 5  
HELX_P HELX_P165 AS3 ASP K 554  ? THR K 566  ? ASP M 554  THR M 566  1 ? 13 
HELX_P HELX_P166 AS4 LEU K 583  ? SER K 591  ? LEU M 583  SER M 591  1 ? 9  
HELX_P HELX_P167 AS5 ASN K 683  ? ALA K 687  ? ASN M 683  ALA M 687  5 ? 5  
HELX_P HELX_P168 AS6 GLU K 692  ? ARG K 697  ? GLU M 692  ARG M 697  1 ? 6  
HELX_P HELX_P169 AS7 SER K 730  ? ARG K 735  ? SER M 730  ARG M 735  1 ? 6  
HELX_P HELX_P170 AS8 THR K 768  ? GLY K 779  ? THR M 768  GLY M 779  1 ? 12 
HELX_P HELX_P171 AS9 PRO K 854  ? MET K 858  ? PRO M 854  MET M 858  5 ? 5  
HELX_P HELX_P172 AT1 ASN K 872  ? VAL K 876  ? ASN M 872  VAL M 876  5 ? 5  
HELX_P HELX_P173 AT2 LEU K 882  ? LEU K 897  ? LEU M 882  LEU M 897  1 ? 16 
HELX_P HELX_P174 AT3 LYS K 910  ? GLU K 932  ? LYS M 910  GLU M 932  1 ? 23 
HELX_P HELX_P175 AT4 ASP K 937  ? LEU K 950  ? ASP M 937  LEU M 950  1 ? 14 
HELX_P HELX_P176 AT5 THR K 958  ? GLN K 969  ? THR M 958  GLN M 969  1 ? 12 
HELX_P HELX_P177 AT6 MET K 1000 ? MET K 1005 ? MET M 1000 MET M 1005 1 ? 6  
HELX_P HELX_P178 AT7 GLY K 1033 ? GLY K 1044 ? GLY M 1033 GLY M 1044 1 ? 12 
HELX_P HELX_P179 AT8 ALA K 1045 ? THR K 1054 ? ALA M 1045 THR M 1054 1 ? 10 
HELX_P HELX_P180 AT9 ASP K 1059 ? LYS K 1072 ? ASP M 1059 LYS M 1072 1 ? 14 
HELX_P HELX_P181 AU1 PRO K 1082 ? ALA K 1094 ? PRO M 1082 ALA M 1094 1 ? 13 
HELX_P HELX_P182 AU2 SER L 14   ? SER L 22   ? SER N 14   SER N 22   1 ? 9  
HELX_P HELX_P183 AU3 ARG L 65   ? GLU L 69   ? ARG N 65   GLU N 69   5 ? 5  
HELX_P HELX_P184 AU4 ILE L 84   ? ARG L 89   ? ILE N 84   ARG N 89   1 ? 6  
HELX_P HELX_P185 AU5 ILE L 102  ? ASP L 107  ? ILE N 102  ASP N 107  1 ? 6  
HELX_P HELX_P186 AU6 SER L 110  ? ASP L 117  ? SER N 110  ASP N 117  1 ? 8  
HELX_P HELX_P187 AU7 SER L 119  ? TYR L 128  ? SER N 119  TYR N 128  1 ? 10 
HELX_P HELX_P188 AU8 THR L 154  ? GLY L 164  ? THR N 154  GLY N 164  1 ? 11 
HELX_P HELX_P189 AU9 ASP L 372  ? GLU L 376  ? ASP N 372  GLU N 376  5 ? 5  
HELX_P HELX_P190 AV1 ASP L 423  ? LYS L 426  ? ASP N 423  LYS N 426  5 ? 4  
HELX_P HELX_P191 AV2 MET L 456  ? LEU L 468  ? MET N 456  LEU N 468  1 ? 13 
HELX_P HELX_P192 AV3 ASP L 469  ? MET L 481  ? ASP N 469  MET N 481  1 ? 13 
HELX_P HELX_P193 AV4 SER L 485  ? GLY L 506  ? SER N 485  GLY N 506  1 ? 22 
HELX_P HELX_P194 AV5 ARG L 508  ? TRP L 511  ? ARG N 508  TRP N 511  5 ? 4  
HELX_P HELX_P195 AV6 PRO L 521  ? ARG L 525  ? PRO N 521  ARG N 525  5 ? 5  
HELX_P HELX_P196 AV7 ASP L 539  ? GLN L 560  ? ASP N 539  GLN N 560  1 ? 22 
HELX_P HELX_P197 AV8 PRO L 563  ? ASP L 583  ? PRO N 563  ASP N 583  1 ? 21 
HELX_P HELX_P198 AV9 SER L 602  ? SER L 608  ? SER N 602  SER N 608  1 ? 7  
HELX_P HELX_P199 AW1 GLY L 612  ? ASN L 617  ? GLY N 612  ASN N 617  1 ? 6  
HELX_P HELX_P200 AW2 LYS L 646  ? PHE L 653  ? LYS N 646  PHE N 653  1 ? 8  
HELX_P HELX_P201 AW3 PHE L 653  ? LYS L 664  ? PHE N 653  LYS N 664  1 ? 12 
HELX_P HELX_P202 AW4 ASN L 669  ? ARG L 679  ? ASN N 669  ARG N 679  1 ? 11 
HELX_P HELX_P203 AW5 ASP L 685  ? ILE L 695  ? ASP N 685  ILE N 695  1 ? 11 
HELX_P HELX_P204 AW6 HIS L 709  ? LEU L 711  ? HIS N 709  LEU N 711  5 ? 3  
HELX_P HELX_P205 AW7 HIS L 729  ? LEU L 731  ? HIS N 729  LEU N 731  5 ? 3  
HELX_P HELX_P206 AW8 VAL L 732  ? ASN L 737  ? VAL N 732  ASN N 737  1 ? 6  
HELX_P HELX_P207 AW9 SER L 752  ? MET L 763  ? SER N 752  MET N 763  1 ? 12 
HELX_P HELX_P208 AX1 LEU L 764  ? ASN L 768  ? LEU N 764  ASN N 768  5 ? 5  
HELX_P HELX_P209 AX2 ARG L 783  ? GLN L 794  ? ARG N 783  GLN N 794  1 ? 12 
HELX_P HELX_P210 AX3 THR L 808  ? ARG L 818  ? THR N 808  ARG N 818  1 ? 11 
HELX_P HELX_P211 AX4 SER L 835  ? TYR L 841  ? SER N 835  TYR N 841  1 ? 7  
HELX_P HELX_P212 AX5 ASN L 845  ? HIS L 855  ? ASN N 845  HIS N 855  1 ? 11 
HELX_P HELX_P213 AX6 SER L 876  ? GLU L 891  ? SER N 876  GLU N 891  1 ? 16 
HELX_P HELX_P214 AX7 ASP L 892  ? ILE L 900  ? ASP N 892  ILE N 900  1 ? 9  
HELX_P HELX_P215 AX8 GLU L 907  ? SER L 945  ? GLU N 907  SER N 945  1 ? 39 
HELX_P HELX_P216 AX9 GLY L 950  ? ALA L 954  ? GLY N 950  ALA N 954  5 ? 5  
HELX_P HELX_P217 AY1 GLU L 958  ? MET L 980  ? GLU N 958  MET N 980  1 ? 23 
HELX_P HELX_P218 AY2 THR L 984  ? ASN L 1014 ? THR N 984  ASN N 1014 1 ? 31 
HELX_P HELX_P219 AY3 ASN L 1018 ? SER L 1026 ? ASN N 1018 SER N 1026 1 ? 9  
HELX_P HELX_P220 AY4 ASN L 1031 ? GLY L 1040 ? ASN N 1031 GLY N 1040 1 ? 10 
HELX_P HELX_P221 AY5 THR L 1066 ? HIS L 1103 ? THR N 1066 HIS N 1103 1 ? 38 
HELX_P HELX_P222 AY6 LYS L 1136 ? TYR L 1145 ? LYS N 1136 TYR N 1145 1 ? 10 
HELX_P HELX_P223 AY7 SER L 1167 ? ALA L 1180 ? SER N 1167 ALA N 1180 1 ? 14 
HELX_P HELX_P224 AY8 GLN L 1202 ? GLY L 1206 ? GLN N 1202 GLY N 1206 1 ? 5  
HELX_P HELX_P225 AY9 ALA L 1220 ? GLU L 1231 ? ALA N 1220 GLU N 1231 1 ? 12 
HELX_P HELX_P226 AZ1 PRO L 1232 ? LEU L 1236 ? PRO N 1232 LEU N 1236 5 ? 5  
HELX_P HELX_P227 AZ2 GLY L 1255 ? GLU L 1264 ? GLY N 1255 GLU N 1264 1 ? 10 
HELX_P HELX_P228 AZ3 ASP L 1331 ? GLY L 1340 ? ASP N 1331 GLY N 1340 1 ? 10 
HELX_P HELX_P229 AZ4 GLY L 1340 ? GLN L 1359 ? GLY N 1340 GLN N 1359 1 ? 20 
HELX_P HELX_P230 AZ5 HIS L 1364 ? MET L 1376 ? HIS N 1364 MET N 1376 1 ? 13 
HELX_P HELX_P231 AZ6 LYS L 1397 ? ALA L 1409 ? LYS N 1397 ALA N 1409 1 ? 13 
HELX_P HELX_P232 AZ7 GLY L 1423 ? SER L 1430 ? GLY N 1423 SER N 1430 1 ? 8  
HELX_P HELX_P233 AZ8 SER L 1433 ? SER L 1439 ? SER N 1433 SER N 1439 1 ? 7  
HELX_P HELX_P234 AZ9 ASN L 1442 ? GLY L 1454 ? ASN N 1442 GLY N 1454 1 ? 13 
HELX_P HELX_P235 BA1 GLY L 1461 ? LEU L 1468 ? GLY N 1461 LEU N 1468 1 ? 8  
HELX_P HELX_P236 BA2 ALA L 1474 ? SER L 1478 ? ALA N 1474 SER N 1478 5 ? 5  
HELX_P HELX_P237 BA3 GLN L 1489 ? ARG L 1499 ? GLN N 1489 ARG N 1499 1 ? 11 
HELX_P HELX_P238 BA4 GLY M 5    ? VAL M 13   ? GLY O 5    VAL O 13   1 ? 9  
HELX_P HELX_P239 BA5 SER M 15   ? HIS M 33   ? SER O 15   HIS O 33   1 ? 19 
HELX_P HELX_P240 BA6 ASN M 59   ? GLY M 71   ? ASN O 59   GLY O 71   1 ? 13 
HELX_P HELX_P241 BA7 PRO M 81   ? TYR M 93   ? PRO O 81   TYR O 93   1 ? 13 
HELX_P HELX_P242 BA8 ASP N 99   ? GLY N 109  ? ASP P 79   GLY P 89   1 ? 11 
HELX_P HELX_P243 BA9 THR N 115  ? GLY N 141  ? THR P 95   GLY P 121  1 ? 27 
HELX_P HELX_P244 BB1 ASP N 143  ? LEU N 156  ? ASP P 123  LEU P 136  1 ? 14 
HELX_P HELX_P245 BB2 ASP N 172  ? LYS N 184  ? ASP P 152  LYS P 164  1 ? 13 
HELX_P HELX_P246 BB3 PRO N 187  ? ASN N 211  ? PRO P 167  ASN P 191  1 ? 25 
HELX_P HELX_P247 BB4 ASN N 211  ? LYS N 220  ? ASN P 191  LYS P 200  1 ? 10 
HELX_P HELX_P248 BB5 LYS N 221  ? THR N 223  ? LYS P 201  THR P 203  5 ? 3  
HELX_P HELX_P249 BB6 SER N 228  ? PHE N 247  ? SER P 208  PHE P 227  1 ? 20 
HELX_P HELX_P250 BB7 GLU N 248  ? ARG N 252  ? GLU P 228  ARG P 232  5 ? 5  
HELX_P HELX_P251 BB8 LYS N 254  ? ALA N 275  ? LYS P 234  ALA P 255  1 ? 22 
HELX_P HELX_P252 BB9 PRO N 281  ? GLY N 303  ? PRO P 261  GLY P 283  1 ? 23 
HELX_P HELX_P253 BC1 THR N 307  ? MET N 315  ? THR P 287  MET P 295  1 ? 9  
HELX_P HELX_P254 BC2 ASP N 320  ? ALA N 331  ? ASP P 300  ALA P 311  1 ? 12 
HELX_P HELX_P255 BC3 PHE N 348  ? PHE N 352  ? PHE P 328  PHE P 332  5 ? 5  
HELX_P HELX_P256 BC4 SER N 360  ? LYS N 376  ? SER P 340  LYS P 356  1 ? 17 
HELX_P HELX_P257 BC5 ALA N 386  ? LEU N 391  ? ALA P 366  LEU P 371  1 ? 6  
HELX_P HELX_P258 BC6 ARG N 418  ? ARG N 436  ? ARG P 398  ARG P 416  1 ? 19 
HELX_P HELX_P259 BC7 LYS N 437  ? ASP N 443  ? LYS P 417  ASP P 423  5 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?   ? L  CYS 60   SG    ? ? ? 1_555 L  CYS 76 SG    ? ? N CYS 60   N CYS 76   1_555 ? ? ? ? ? ? ?            2.056 
? 
metalc1  metalc ?   ? B  ASP 191  O     ? ? ? 1_555 Q  MG  .  MG    ? ? B ASP 191  B MG  2001 1_555 ? ? ? ? ? ? ?            2.746 
? 
metalc2  metalc ?   ? B  ASP 193  OD1   ? ? ? 1_555 Q  MG  .  MG    ? ? B ASP 193  B MG  2001 1_555 ? ? ? ? ? ? ?            2.900 
? 
metalc3  metalc ?   ? D  CYS 58   SG    ? ? ? 1_555 S  ZN  .  ZN    ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.326 
? 
metalc4  metalc ?   ? D  CYS 60   SG    ? ? ? 1_555 S  ZN  .  ZN    ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.326 
? 
metalc5  metalc ?   ? D  CYS 73   SG    ? ? ? 1_555 S  ZN  .  ZN    ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.304 
? 
metalc6  metalc ?   ? D  CYS 76   SG    ? ? ? 1_555 S  ZN  .  ZN    ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.290 
? 
metalc7  metalc ?   ? D  ASP 739  OD1   ? ? ? 1_555 T  MG  .  MG    ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?            1.956 
? 
metalc8  metalc ?   ? D  ASP 741  OD1   ? ? ? 1_555 T  MG  .  MG    ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.211 
? 
metalc9  metalc ?   ? D  ASP 741  OD2   ? ? ? 1_555 T  MG  .  MG    ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.956 
? 
metalc10 metalc ?   ? D  ASP 743  OD1   ? ? ? 1_555 T  MG  .  MG    ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.131 
? 
metalc11 metalc ?   ? D  ASP 743  OD2   ? ? ? 1_555 T  MG  .  MG    ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.782 
? 
metalc12 metalc ?   ? D  LYS 840  O     ? ? ? 1_555 U  MG  .  MG    ? ? D LYS 840  D MG  2004 1_555 ? ? ? ? ? ? ?            2.328 
? 
metalc13 metalc ?   ? D  CYS 1112 SG    ? ? ? 1_555 R  ZN  .  ZN    ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.165 
? 
metalc14 metalc ?   ? D  CYS 1194 SG    ? ? ? 1_555 R  ZN  .  ZN    ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.234 
? 
metalc15 metalc ?   ? D  CYS 1201 SG    ? ? ? 1_555 R  ZN  .  ZN    ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.282 
? 
metalc16 metalc ?   ? D  CYS 1204 SG    ? ? ? 1_555 R  ZN  .  ZN    ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.145 
? 
metalc17 metalc ?   ? F  ALA 312  O     ? ? ? 1_555 Z  MG  .  MG    ? ? F ALA 292  F MG  2001 1_555 ? ? ? ? ? ? ?            2.500 
? 
metalc18 metalc ?   ? F  GLY 316  O     ? ? ? 1_555 Z  MG  .  MG    ? ? F GLY 296  F MG  2001 1_555 ? ? ? ? ? ? ?            2.548 
? 
metalc19 metalc ?   ? F  TRP 319  O     ? ? ? 1_555 Z  MG  .  MG    ? ? F TRP 299  F MG  2001 1_555 ? ? ? ? ? ? ?            2.598 
? 
metalc20 metalc ?   ? J  ASP 191  O     ? ? ? 1_555 AA MG  .  MG    ? ? L ASP 191  L MG  2001 1_555 ? ? ? ? ? ? ?            2.851 
? 
metalc21 metalc ?   ? J  ASP 193  OD1   ? ? ? 1_555 AA MG  .  MG    ? ? L ASP 193  L MG  2001 1_555 ? ? ? ? ? ? ?            2.084 
? 
metalc22 metalc ?   ? L  CYS 58   SG    ? ? ? 1_555 DA ZN  .  ZN    ? ? N CYS 58   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.304 
? 
metalc23 metalc ?   ? L  CYS 60   SG    ? ? ? 1_555 DA ZN  .  ZN    ? ? N CYS 60   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.312 
? 
metalc24 metalc ?   ? L  CYS 73   SG    ? ? ? 1_555 DA ZN  .  ZN    ? ? N CYS 73   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.419 
? 
metalc25 metalc ?   ? L  CYS 76   SG    ? ? ? 1_555 DA ZN  .  ZN    ? ? N CYS 76   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.329 
? 
metalc26 metalc ?   ? L  ASP 739  OD1   ? ? ? 1_555 EA MG  .  MG    ? ? N ASP 739  N MG  2003 1_555 ? ? ? ? ? ? ?            2.116 
? 
metalc27 metalc ?   ? L  ASP 741  OD1   ? ? ? 1_555 EA MG  .  MG    ? ? N ASP 741  N MG  2003 1_555 ? ? ? ? ? ? ?            2.184 
? 
metalc28 metalc ?   ? L  ASP 741  OD2   ? ? ? 1_555 EA MG  .  MG    ? ? N ASP 741  N MG  2003 1_555 ? ? ? ? ? ? ?            2.942 
? 
metalc29 metalc ?   ? L  ASP 743  OD1   ? ? ? 1_555 EA MG  .  MG    ? ? N ASP 743  N MG  2003 1_555 ? ? ? ? ? ? ?            2.198 
? 
metalc30 metalc ?   ? L  ASP 743  OD2   ? ? ? 1_555 EA MG  .  MG    ? ? N ASP 743  N MG  2003 1_555 ? ? ? ? ? ? ?            2.951 
? 
metalc31 metalc ?   ? L  LYS 840  O     ? ? ? 1_555 FA MG  .  MG    ? ? N LYS 840  N MG  2004 1_555 ? ? ? ? ? ? ?            2.148 
? 
metalc32 metalc ?   ? L  CYS 1112 SG    ? ? ? 1_555 CA ZN  .  ZN    ? ? N CYS 1112 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.359 
? 
metalc33 metalc ?   ? L  CYS 1194 SG    ? ? ? 1_555 CA ZN  .  ZN    ? ? N CYS 1194 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.208 
? 
metalc34 metalc ?   ? L  CYS 1201 SG    ? ? ? 1_555 CA ZN  .  ZN    ? ? N CYS 1201 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.252 
? 
metalc35 metalc ?   ? L  CYS 1204 SG    ? ? ? 1_555 CA ZN  .  ZN    ? ? N CYS 1204 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.097 
? 
metalc36 metalc ?   ? N  GLY 316  O     ? ? ? 1_555 IA MG  .  MG    ? ? P GLY 296  P MG  2001 1_555 ? ? ? ? ? ? ?            2.487 
? 
metalc37 metalc ?   ? N  TRP 319  O     ? ? ? 1_555 IA MG  .  MG    ? ? P TRP 299  P MG  2001 1_555 ? ? ? ? ? ? ?            2.855 
? 
metalc38 metalc ?   ? T  MG  .    MG    ? ? ? 1_555 V  C   .  "O3'" ? ? D MG  2003 D C   2005 1_555 ? ? ? ? ? ? ?            1.766 
? 
metalc39 metalc ?   ? U  MG  .    MG    ? ? ? 1_555 NA HOH .  O     ? ? D MG  2004 D HOH 2101 1_555 ? ? ? ? ? ? ?            2.077 
? 
covale1  covale one ? V  C   .    P     ? ? ? 1_555 Y  NAD .  O3B   ? ? D C   2005 D NAD 2008 1_555 ? ? ? ? ? ? ?            1.604 
? 
metalc40 metalc ?   ? W  CTP .    "O5'" ? ? ? 1_555 X  MG  .  MG    ? ? D CTP 2006 D MG  2007 1_555 ? ? ? ? ? ? ?            2.913 
? 
metalc41 metalc ?   ? W  CTP .    O2A   ? ? ? 1_555 X  MG  .  MG    ? ? D CTP 2006 D MG  2007 1_555 ? ? ? ? ? ? ?            2.619 
? 
metalc42 metalc ?   ? W  CTP .    O3B   ? ? ? 1_555 X  MG  .  MG    ? ? D CTP 2006 D MG  2007 1_555 ? ? ? ? ? ? ?            2.656 
? 
metalc43 metalc ?   ? BA CTP .    O1A   ? ? ? 1_555 HA MG  .  MG    ? ? M CTP 1201 N MG  2006 1_555 ? ? ? ? ? ? ?            2.235 
? 
metalc44 metalc ?   ? BA CTP .    O2A   ? ? ? 1_555 HA MG  .  MG    ? ? M CTP 1201 N MG  2006 1_555 ? ? ? ? ? ? ?            2.597 
? 
metalc45 metalc ?   ? BA CTP .    O3B   ? ? ? 1_555 HA MG  .  MG    ? ? M CTP 1201 N MG  2006 1_555 ? ? ? ? ? ? ?            2.642 
? 
metalc46 metalc ?   ? EA MG  .    MG    ? ? ? 1_555 GA C   .  "O3'" ? ? N MG  2003 N C   2005 1_555 ? ? ? ? ? ? ?            1.980 
? 
metalc47 metalc ?   ? FA MG  .    MG    ? ? ? 1_555 VA HOH .  O     ? ? N MG  2004 N HOH 2117 1_555 ? ? ? ? ? ? ?            2.078 
? 
metalc48 metalc ?   ? FA MG  .    MG    ? ? ? 1_555 VA HOH .  O     ? ? N MG  2004 N HOH 2149 1_555 ? ? ? ? ? ? ?            2.077 
? 
metalc49 metalc ?   ? FA MG  .    MG    ? ? ? 1_555 TA HOH .  O     ? ? N MG  2004 L HOH 2103 1_555 ? ? ? ? ? ? ?            2.072 
? 
metalc50 metalc ?   ? FA MG  .    MG    ? ? ? 1_555 VA HOH .  O     ? ? N MG  2004 N HOH 2101 1_555 ? ? ? ? ? ? ?            2.090 
? 
metalc51 metalc ?   ? HA MG  .    MG    ? ? ? 1_555 UA HOH .  O     ? ? N MG  2006 M HOH 1368 1_555 ? ? ? ? ? ? ?            2.880 
? 
metalc52 metalc ?   ? HA MG  .    MG    ? ? ? 1_555 VA HOH .  O     ? ? N MG  2006 N HOH 2242 1_555 ? ? ? ? ? ? ?            2.916 
? 
hydrog1  hydrog ?   ? G  DT  3    N3    ? ? ? 1_555 H  DA  25 N1    ? ? G DT  4    H DA  25   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     
? 
hydrog2  hydrog ?   ? G  DG  4    N1    ? ? ? 1_555 H  DC  24 N3    ? ? G DG  5    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog3  hydrog ?   ? G  DG  4    N2    ? ? ? 1_555 H  DC  24 O2    ? ? G DG  5    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog4  hydrog ?   ? G  DG  4    O6    ? ? ? 1_555 H  DC  24 N4    ? ? G DG  5    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog5  hydrog ?   ? G  DC  5    N3    ? ? ? 1_555 H  DG  23 N1    ? ? G DC  6    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog6  hydrog ?   ? G  DC  5    N4    ? ? ? 1_555 H  DG  23 O6    ? ? G DC  6    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog7  hydrog ?   ? G  DC  5    O2    ? ? ? 1_555 H  DG  23 N2    ? ? G DC  6    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog8  hydrog ?   ? G  DA  6    N1    ? ? ? 1_555 H  DT  22 N3    ? ? G DA  7    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog9  hydrog ?   ? G  DA  6    N6    ? ? ? 1_555 H  DT  22 O4    ? ? G DA  7    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog10 hydrog ?   ? G  DT  7    N3    ? ? ? 1_555 H  DA  21 N1    ? ? G DT  8    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog11 hydrog ?   ? G  DT  7    O4    ? ? ? 1_555 H  DA  21 N6    ? ? G DT  8    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog12 hydrog ?   ? G  DC  8    N3    ? ? ? 1_555 H  DG  20 N1    ? ? G DC  9    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog13 hydrog ?   ? G  DC  8    N4    ? ? ? 1_555 H  DG  20 O6    ? ? G DC  9    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog14 hydrog ?   ? G  DC  8    O2    ? ? ? 1_555 H  DG  20 N2    ? ? G DC  9    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog15 hydrog ?   ? G  DC  9    N3    ? ? ? 1_555 H  DG  19 N1    ? ? G DC  10   H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog16 hydrog ?   ? G  DC  9    N4    ? ? ? 1_555 H  DG  19 O6    ? ? G DC  10   H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog17 hydrog ?   ? G  DC  9    O2    ? ? ? 1_555 H  DG  19 N2    ? ? G DC  10   H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog18 hydrog ?   ? G  DG  10   N1    ? ? ? 1_555 H  DC  18 N3    ? ? G DG  11   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog19 hydrog ?   ? G  DG  10   N2    ? ? ? 1_555 H  DC  18 O2    ? ? G DG  11   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog20 hydrog ?   ? G  DG  10   O6    ? ? ? 1_555 H  DC  18 N4    ? ? G DG  11   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog21 hydrog ?   ? G  DT  11   N3    ? ? ? 1_555 H  DA  17 N1    ? ? G DT  12   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog22 hydrog ?   ? G  DT  11   O4    ? ? ? 1_555 H  DA  17 N6    ? ? G DT  12   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog23 hydrog ?   ? G  DG  12   N1    ? ? ? 1_555 H  DC  16 N3    ? ? G DG  13   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog24 hydrog ?   ? G  DG  12   N2    ? ? ? 1_555 H  DC  16 O2    ? ? G DG  13   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog25 hydrog ?   ? G  DG  12   O6    ? ? ? 1_555 H  DC  16 N4    ? ? G DG  13   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog26 hydrog ?   ? O  DT  3    N3    ? ? ? 1_555 P  DA  25 N1    ? ? R DT  4    S DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog27 hydrog ?   ? O  DT  3    O4    ? ? ? 1_555 P  DA  25 N6    ? ? R DT  4    S DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog28 hydrog ?   ? O  DG  4    N1    ? ? ? 1_555 P  DC  24 N3    ? ? R DG  5    S DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog29 hydrog ?   ? O  DG  4    N2    ? ? ? 1_555 P  DC  24 O2    ? ? R DG  5    S DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog30 hydrog ?   ? O  DG  4    O6    ? ? ? 1_555 P  DC  24 N4    ? ? R DG  5    S DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog31 hydrog ?   ? O  DC  5    O2    ? ? ? 1_555 P  DG  23 N2    ? ? R DC  6    S DG  23   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     
? 
hydrog32 hydrog ?   ? O  DA  6    N1    ? ? ? 1_555 P  DT  22 N3    ? ? R DA  7    S DT  22   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     
? 
hydrog33 hydrog ?   ? O  DT  7    N3    ? ? ? 1_555 P  DA  21 N1    ? ? R DT  8    S DA  21   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     
? 
hydrog34 hydrog ?   ? O  DC  8    N3    ? ? ? 1_555 P  DG  20 N1    ? ? R DC  9    S DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog35 hydrog ?   ? O  DC  8    N4    ? ? ? 1_555 P  DG  20 O6    ? ? R DC  9    S DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog36 hydrog ?   ? O  DC  8    O2    ? ? ? 1_555 P  DG  20 N2    ? ? R DC  9    S DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog37 hydrog ?   ? O  DC  9    N4    ? ? ? 1_555 P  DG  19 O6    ? ? R DC  10   S DG  19   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     
? 
hydrog38 hydrog ?   ? O  DC  9    O2    ? ? ? 1_555 P  DG  19 N1    ? ? R DC  10   S DG  19   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     
? 
hydrog39 hydrog ?   ? O  DG  10   N1    ? ? ? 1_555 P  DC  18 N3    ? ? R DG  11   S DC  18   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     
? 
hydrog40 hydrog ?   ? O  DT  11   N3    ? ? ? 1_555 P  DA  17 N1    ? ? R DT  12   S DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog41 hydrog ?   ? O  DT  11   O4    ? ? ? 1_555 P  DA  17 N6    ? ? R DT  12   S DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog42 hydrog ?   ? O  DG  12   N1    ? ? ? 1_555 P  DC  16 N3    ? ? R DG  13   S DC  16   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -13.33 
2  GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -13.08 
3  PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 0.13   
4  VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -8.16  
5  ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 -1.25  
6  GLU 26  I . ? GLU 26  K PRO 27  I ? PRO 27  K 1 -13.61 
7  GLU 26  J . ? GLU 26  L PRO 27  J ? PRO 27  L 1 -10.80 
8  PHE 52  K . ? PHE 52  M PRO 53  K ? PRO 53  M 1 3.49   
9  VAL 108 L . ? VAL 108 N PRO 109 L ? PRO 109 N 1 -7.71  
10 ALA 705 L . ? ALA 705 N PRO 706 L ? PRO 706 N 1 -4.32  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 4 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 8 ? 
AD2 ? 2 ? 
AD3 ? 3 ? 
AD4 ? 3 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 5 ? 
AD8 ? 4 ? 
AD9 ? 2 ? 
AE1 ? 3 ? 
AE2 ? 3 ? 
AE3 ? 4 ? 
AE4 ? 3 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 3 ? 
AE8 ? 3 ? 
AE9 ? 3 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 4 ? 
AF6 ? 3 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
AF9 ? 4 ? 
AG1 ? 4 ? 
AG2 ? 2 ? 
AG3 ? 2 ? 
AG4 ? 2 ? 
AG5 ? 4 ? 
AG6 ? 4 ? 
AG7 ? 2 ? 
AG8 ? 2 ? 
AG9 ? 2 ? 
AH1 ? 3 ? 
AH2 ? 3 ? 
AH3 ? 3 ? 
AH4 ? 4 ? 
AH5 ? 5 ? 
AH6 ? 2 ? 
AH7 ? 3 ? 
AH8 ? 6 ? 
AH9 ? 2 ? 
AI1 ? 3 ? 
AI2 ? 4 ? 
AI3 ? 2 ? 
AI4 ? 2 ? 
AI5 ? 8 ? 
AI6 ? 4 ? 
AI7 ? 3 ? 
AI8 ? 2 ? 
AI9 ? 8 ? 
AJ1 ? 2 ? 
AJ2 ? 3 ? 
AJ3 ? 2 ? 
AJ4 ? 3 ? 
AJ5 ? 2 ? 
AJ6 ? 5 ? 
AJ7 ? 4 ? 
AJ8 ? 3 ? 
AJ9 ? 3 ? 
AK1 ? 4 ? 
AK2 ? 3 ? 
AK3 ? 4 ? 
AK4 ? 2 ? 
AK5 ? 3 ? 
AK6 ? 3 ? 
AK7 ? 3 ? 
AK8 ? 2 ? 
AK9 ? 2 ? 
AL1 ? 2 ? 
AL2 ? 2 ? 
AL3 ? 4 ? 
AL4 ? 3 ? 
AL5 ? 2 ? 
AL6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? parallel      
AD1 6 7 ? anti-parallel 
AD1 7 8 ? parallel      
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? parallel      
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? parallel      
AE8 1 2 ? parallel      
AE8 2 3 ? anti-parallel 
AE9 1 2 ? parallel      
AE9 2 3 ? anti-parallel 
AF1 1 2 ? parallel      
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AF9 3 4 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? parallel      
AH1 2 3 ? parallel      
AH2 1 2 ? anti-parallel 
AH2 2 3 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH3 2 3 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH4 2 3 ? parallel      
AH4 3 4 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH5 2 3 ? anti-parallel 
AH5 3 4 ? anti-parallel 
AH5 4 5 ? anti-parallel 
AH6 1 2 ? anti-parallel 
AH7 1 2 ? anti-parallel 
AH7 2 3 ? anti-parallel 
AH8 1 2 ? anti-parallel 
AH8 2 3 ? anti-parallel 
AH8 3 4 ? parallel      
AH8 4 5 ? anti-parallel 
AH8 5 6 ? anti-parallel 
AH9 1 2 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI1 2 3 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI2 3 4 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI5 2 3 ? anti-parallel 
AI5 3 4 ? anti-parallel 
AI5 4 5 ? parallel      
AI5 5 6 ? anti-parallel 
AI5 6 7 ? parallel      
AI5 7 8 ? anti-parallel 
AI6 1 2 ? anti-parallel 
AI6 2 3 ? anti-parallel 
AI6 3 4 ? anti-parallel 
AI7 1 2 ? anti-parallel 
AI7 2 3 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI9 1 2 ? anti-parallel 
AI9 2 3 ? anti-parallel 
AI9 3 4 ? anti-parallel 
AI9 4 5 ? anti-parallel 
AI9 5 6 ? parallel      
AI9 6 7 ? anti-parallel 
AI9 7 8 ? parallel      
AJ1 1 2 ? anti-parallel 
AJ2 1 2 ? anti-parallel 
AJ2 2 3 ? anti-parallel 
AJ3 1 2 ? anti-parallel 
AJ4 1 2 ? anti-parallel 
AJ4 2 3 ? anti-parallel 
AJ5 1 2 ? anti-parallel 
AJ6 1 2 ? anti-parallel 
AJ6 2 3 ? anti-parallel 
AJ6 3 4 ? anti-parallel 
AJ6 4 5 ? anti-parallel 
AJ7 1 2 ? anti-parallel 
AJ7 2 3 ? anti-parallel 
AJ7 3 4 ? anti-parallel 
AJ8 1 2 ? anti-parallel 
AJ8 2 3 ? anti-parallel 
AJ9 1 2 ? anti-parallel 
AJ9 2 3 ? anti-parallel 
AK1 1 2 ? anti-parallel 
AK1 2 3 ? anti-parallel 
AK1 3 4 ? anti-parallel 
AK2 1 2 ? anti-parallel 
AK2 2 3 ? anti-parallel 
AK3 1 2 ? anti-parallel 
AK3 2 3 ? anti-parallel 
AK3 3 4 ? anti-parallel 
AK4 1 2 ? anti-parallel 
AK5 1 2 ? anti-parallel 
AK5 2 3 ? parallel      
AK6 1 2 ? parallel      
AK6 2 3 ? anti-parallel 
AK7 1 2 ? parallel      
AK7 2 3 ? anti-parallel 
AK8 1 2 ? parallel      
AK9 1 2 ? anti-parallel 
AL1 1 2 ? anti-parallel 
AL2 1 2 ? anti-parallel 
AL3 1 2 ? anti-parallel 
AL3 2 3 ? anti-parallel 
AL3 3 4 ? anti-parallel 
AL4 1 2 ? anti-parallel 
AL4 2 3 ? anti-parallel 
AL5 1 2 ? anti-parallel 
AL6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
AA1 2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
AA1 3 LEU A 192  ? THR A 201  ? LEU A 192  THR A 201  
AA1 4 VAL A 174  ? THR A 184  ? VAL A 174  THR A 184  
AA2 1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
AA2 2 ARG A 137  ? GLY A 147  ? ARG A 137  GLY A 147  
AA2 3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
AA3 2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
AA4 1 LYS A 107  ? LYS A 110  ? LYS A 107  LYS A 110  
AA4 2 HIS A 128  ? LEU A 132  ? HIS A 128  LEU A 132  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
AA6 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA6 3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
AA6 4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
AA7 1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
AA7 2 ARG B 137  ? VAL B 148  ? ARG B 137  VAL B 148  
AA7 3 PRO B 49   ? ILE B 58   ? PRO B 49   ILE B 58   
AA7 4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
AA8 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA8 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AA9 1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
AA9 2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
AB1 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB1 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB2 1 GLU C 2    ? ARG C 5    ? GLU C 2    ARG C 5    
AB2 2 GLN C 899  ? ILE C 902  ? GLN C 899  ILE C 902  
AB2 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB3 1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
AB3 2 GLN C 91   ? HIS C 102  ? GLN C 91   HIS C 102  
AB3 3 LEU C 107  ? PRO C 119  ? LEU C 107  PRO C 119  
AB4 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB4 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB4 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB5 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB5 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB5 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB5 4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
AB6 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB6 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB6 3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
AB6 4 VAL C 182  ? VAL C 186  ? VAL C 182  VAL C 186  
AB6 5 ARG C 189  ? PRO C 192  ? ARG C 189  PRO C 192  
AB7 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB7 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB8 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB8 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB8 3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
AB9 4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
AB9 5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AB9 6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
AC1 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC1 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC2 1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
AC2 2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
AC2 3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC3 1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
AC3 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC3 3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
AC3 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC4 1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
AC4 2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
AC5 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC5 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC6 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AC6 2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC6 3 LYS C 838  ? ALA C 840  ? LYS C 838  ALA C 840  
AC6 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC6 5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
AC6 6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC6 7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
AC6 8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC7 1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
AC7 2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC7 3 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
AC7 4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
AC8 1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
AC8 2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
AC8 3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AC9 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AC9 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AD1 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD1 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD1 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AD1 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AD1 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AD1 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AD1 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AD1 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD2 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AD2 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AD3 1 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD3 2 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD3 3 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD4 1 SER D 22   ? GLU D 25   ? SER D 22   GLU D 25   
AD4 2 MET D 90   ? ALA D 100  ? MET D 90   ALA D 100  
AD4 3 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AD5 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AD5 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AD5 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AD6 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AD6 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AD7 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AD7 2 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD7 3 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD7 4 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AD7 5 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AD8 1 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AD8 2 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD8 3 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD8 4 ALA D 359  ? VAL D 361  ? ALA D 359  VAL D 361  
AD9 1 GLU D 190  ? ALA D 192  ? GLU D 190  ALA D 192  
AD9 2 VAL D 195  ? VAL D 196  ? VAL D 195  VAL D 196  
AE1 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE1 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE1 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AE2 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE2 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE2 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AE3 1 GLU D 277  ? LEU D 284  ? GLU D 277  LEU D 284  
AE3 2 ALA D 268  ? ARG D 274  ? ALA D 268  ARG D 274  
AE3 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AE3 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AE4 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AE4 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AE4 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AE5 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AE5 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AE5 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AE5 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE6 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE6 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE7 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AE7 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AE7 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AE8 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AE8 2 PRO D 826  ? VAL D 829  ? PRO D 826  VAL D 829  
AE8 3 ARG D 832  ? SER D 835  ? ARG D 832  SER D 835  
AE9 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AE9 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE9 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AF1 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AF1 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AF2 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AF2 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AF3 1 PHE D 1123 ? PRO D 1125 ? PHE D 1123 PRO D 1125 
AF3 2 LEU D 1132 ? LEU D 1134 ? LEU D 1132 LEU D 1134 
AF4 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AF4 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AF5 1 SER D 1300 ? LEU D 1305 ? SER D 1300 LEU D 1305 
AF5 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AF5 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AF5 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AF6 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF6 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF6 3 ALA D 1416 ? PRO D 1419 ? ALA D 1416 PRO D 1419 
AF7 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AF7 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AF8 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF8 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
AF9 1 VAL I 10   ? GLN I 16   ? VAL K 10   GLN K 16   
AF9 2 TYR I 20   ? LEU I 28   ? TYR K 20   LEU K 28   
AF9 3 ARG I 189  ? THR I 201  ? ARG K 189  THR K 201  
AF9 4 VAL I 174  ? LEU I 186  ? VAL K 174  LEU K 186  
AG1 1 THR I 96   ? GLU I 104  ? THR K 96   GLU K 104  
AG1 2 ARG I 137  ? GLY I 147  ? ARG K 137  GLY K 147  
AG1 3 GLY I 50   ? ILE I 58   ? GLY K 50   ILE K 58   
AG1 4 ILE I 165  ? PRO I 166  ? ILE K 165  PRO K 166  
AG2 1 VAL I 87   ? PHE I 89   ? VAL K 87   PHE K 89   
AG2 2 VAL I 120  ? ILE I 122  ? VAL K 120  ILE K 122  
AG3 1 GLU I 108  ? LYS I 110  ? GLU K 108  LYS K 110  
AG3 2 HIS I 128  ? THR I 131  ? HIS K 128  THR K 131  
AG4 1 TYR I 150  ? VAL I 151  ? TYR K 150  VAL K 151  
AG4 2 ALA I 169  ? VAL I 170  ? ALA K 169  VAL K 170  
AG5 1 VAL J 10   ? GLN J 16   ? VAL L 10   GLN L 16   
AG5 2 TYR J 20   ? LEU J 28   ? TYR L 20   LEU L 28   
AG5 3 ARG J 189  ? THR J 201  ? ARG L 189  THR L 201  
AG5 4 VAL J 174  ? LEU J 186  ? VAL L 174  LEU L 186  
AG6 1 THR J 96   ? GLU J 104  ? THR L 96   GLU L 104  
AG6 2 ARG J 137  ? VAL J 148  ? ARG L 137  VAL L 148  
AG6 3 PRO J 49   ? ILE J 58   ? PRO L 49   ILE L 58   
AG6 4 ILE J 165  ? PRO J 166  ? ILE L 165  PRO L 166  
AG7 1 VAL J 87   ? PHE J 89   ? VAL L 87   PHE L 89   
AG7 2 VAL J 120  ? ILE J 122  ? VAL L 120  ILE L 122  
AG8 1 LYS J 107  ? LYS J 110  ? LYS L 107  LYS L 110  
AG8 2 HIS J 128  ? LEU J 132  ? HIS L 128  LEU L 132  
AG9 1 TYR J 150  ? VAL J 151  ? TYR L 150  VAL L 151  
AG9 2 ALA J 169  ? VAL J 170  ? ALA L 169  VAL L 170  
AH1 1 ILE K 3    ? ARG K 5    ? ILE M 3    ARG M 5    
AH1 2 ARG K 900  ? ILE K 902  ? ARG M 900  ILE M 902  
AH1 3 VAL K 579  ? MET K 580  ? VAL M 579  MET M 580  
AH2 1 GLU K 70   ? LEU K 73   ? GLU M 70   LEU M 73   
AH2 2 GLN K 91   ? ARG K 97   ? GLN M 91   ARG M 97   
AH2 3 VAL K 113  ? PRO K 119  ? VAL M 113  PRO M 119  
AH3 1 PHE K 127  ? ILE K 129  ? PHE M 127  ILE M 129  
AH3 2 ALA K 132  ? ILE K 136  ? ALA M 132  ILE M 136  
AH3 3 SER K 392  ? PHE K 394  ? SER M 392  PHE M 394  
AH4 1 ARG K 331  ? ARG K 334  ? ARG M 331  ARG M 334  
AH4 2 SER K 138  ? ARG K 142  ? SER M 138  ARG M 142  
AH4 3 ARG K 409  ? SER K 411  ? ARG M 409  SER M 411  
AH4 4 THR K 453  ? SER K 454  ? THR M 453  SER M 454  
AH5 1 GLY K 145  ? PRO K 150  ? GLY M 145  PRO M 150  
AH5 2 TYR K 158  ? ILE K 163  ? TYR M 158  ILE M 163  
AH5 3 ILE K 172  ? VAL K 176  ? ILE M 172  VAL M 176  
AH5 4 VAL K 182  ? VAL K 186  ? VAL M 182  VAL M 186  
AH5 5 ARG K 189  ? PRO K 192  ? ARG M 189  PRO M 192  
AH6 1 ALA K 291  ? GLU K 294  ? ALA M 291  GLU M 294  
AH6 2 GLU K 297  ? ASP K 300  ? GLU M 297  ASP M 300  
AH7 1 ARG K 460  ? VAL K 461  ? ARG M 460  VAL M 461  
AH7 2 ILE K 467  ? VAL K 475  ? ILE M 467  VAL M 475  
AH7 3 VAL K 478  ? MET K 486  ? VAL M 478  MET M 486  
AH8 1 ARG K 460  ? VAL K 461  ? ARG M 460  VAL M 461  
AH8 2 ILE K 467  ? VAL K 475  ? ILE M 467  VAL M 475  
AH8 3 PHE K 531  ? ASP K 533  ? PHE M 531  ASP M 533  
AH8 4 THR K 495  ? ALA K 497  ? THR M 495  ALA M 497  
AH8 5 VAL K 513  ? ARG K 517  ? VAL M 513  ARG M 517  
AH8 6 GLU K 520  ? VAL K 524  ? GLU M 520  VAL M 524  
AH9 1 LEU K 503  ? GLU K 504  ? LEU M 503  GLU M 504  
AH9 2 ARG K 507  ? ILE K 508  ? ARG M 507  ILE M 508  
AI1 1 LEU K 595  ? TYR K 596  ? LEU M 595  TYR M 596  
AI1 2 LEU K 654  ? ASP K 657  ? LEU M 654  ASP M 657  
AI1 3 ARG K 640  ? PRO K 641  ? ARG M 640  PRO M 641  
AI2 1 LEU K 620  ? PRO K 624  ? LEU M 620  PRO M 624  
AI2 2 ARG K 610  ? TYR K 615  ? ARG M 610  TYR M 615  
AI2 3 GLY K 601  ? VAL K 606  ? GLY M 601  VAL M 606  
AI2 4 ARG K 648  ? VAL K 649  ? ARG M 648  VAL M 649  
AI3 1 TYR K 629  ? ARG K 630  ? TYR M 629  ARG M 630  
AI3 2 ALA K 636  ? LEU K 637  ? ALA M 636  LEU M 637  
AI4 1 SER K 661  ? GLU K 662  ? SER M 661  GLU M 662  
AI4 2 PHE K 665  ? LEU K 666  ? PHE M 665  LEU M 666  
AI5 1 LYS K 971  ? VAL K 972  ? LYS M 971  VAL M 972  
AI5 2 ILE K 987  ? LYS K 996  ? ILE M 987  LYS M 996  
AI5 3 LYS K 838  ? ASN K 841  ? LYS M 838  ASN M 841  
AI5 4 LYS K 846  ? LEU K 853  ? LYS M 846  LEU M 853  
AI5 5 ILE K 688  ? SER K 691  ? ILE M 688  SER M 691  
AI5 6 VAL K 869  ? LEU K 871  ? VAL M 869  LEU M 871  
AI5 7 GLN K 670  ? ILE K 676  ? GLN M 670  ILE M 676  
AI5 8 ILE K 987  ? LYS K 996  ? ILE M 987  LYS M 996  
AI6 1 SER K 702  ? ARG K 713  ? SER M 702  ARG M 713  
AI6 2 VAL K 819  ? ARG K 831  ? VAL M 819  ARG M 831  
AI6 3 GLY K 798  ? ARG K 807  ? GLY M 798  ARG M 807  
AI6 4 GLU K 748  ? VAL K 749  ? GLU M 748  VAL M 749  
AI7 1 ARG K 721  ? ILE K 722  ? ARG M 721  ILE M 722  
AI7 2 ARG K 758  ? PHE K 761  ? ARG M 758  PHE M 761  
AI7 3 VAL K 785  ? ASP K 787  ? VAL M 785  ASP M 787  
AI8 1 ILE K 754  ? VAL K 756  ? ILE M 754  VAL M 756  
AI8 2 LEU K 790  ? ARG K 791  ? LEU M 790  ARG M 791  
AI9 1 HIS K 1006 ? ARG K 1008 ? HIS M 1006 ARG M 1008 
AI9 2 SER L 626  ? VAL L 633  ? SER N 626  VAL N 633  
AI9 3 GLN L 744  ? HIS L 748  ? GLN N 744  HIS N 748  
AI9 4 VAL L 700  ? ASN L 703  ? VAL N 700  ASN N 703  
AI9 5 ILE L 713  ? VAL L 721  ? ILE N 713  VAL N 721  
AI9 6 GLN L 641  ? PRO L 645  ? GLN N 641  PRO N 645  
AI9 7 ILE L 726  ? LEU L 728  ? ILE N 726  LEU N 728  
AI9 8 SER L 626  ? VAL L 633  ? SER N 626  VAL N 633  
AJ1 1 GLN K 1030 ? PHE K 1032 ? GLN M 1030 PHE M 1032 
AJ1 2 LYS L 621  ? VAL L 623  ? LYS N 621  VAL N 623  
AJ2 1 LEU K 1097 ? LEU K 1102 ? LEU M 1097 LEU M 1102 
AJ2 2 LYS L 7    ? LEU L 12   ? LYS N 7    LEU N 12   
AJ2 3 LYS L 1456 ? ASP L 1457 ? LYS N 1456 ASP N 1457 
AJ3 1 GLY L 91   ? ALA L 100  ? GLY N 91   ALA N 100  
AJ3 2 ILE L 513  ? VAL L 519  ? ILE N 513  VAL N 519  
AJ4 1 LEU L 152  ? LEU L 153  ? LEU N 152  LEU N 153  
AJ4 2 TYR L 132  ? ASP L 136  ? TYR N 132  ASP N 136  
AJ4 3 ASP L 453  ? ARG L 455  ? ASP N 453  ARG N 455  
AJ5 1 ILE L 141  ? LEU L 142  ? ILE N 141  LEU N 142  
AJ5 2 VAL L 145  ? PRO L 146  ? VAL N 145  PRO N 146  
AJ6 1 GLN L 166  ? PRO L 170  ? GLN N 166  PRO N 170  
AJ6 2 GLY L 383  ? VAL L 396  ? GLY N 383  VAL N 396  
AJ6 3 GLY L 201  ? PRO L 226  ? GLY N 201  PRO N 226  
AJ6 4 THR L 330  ? ARG L 346  ? THR N 330  ARG N 346  
AJ6 5 ARG L 318  ? GLU L 327  ? ARG N 318  GLU N 327  
AJ7 1 GLU L 184  ? VAL L 185  ? GLU N 184  VAL N 185  
AJ7 2 GLY L 201  ? PRO L 226  ? GLY N 201  PRO N 226  
AJ7 3 GLY L 383  ? VAL L 396  ? GLY N 383  VAL N 396  
AJ7 4 ARG L 360  ? VAL L 361  ? ARG N 360  VAL N 361  
AJ8 1 ILE L 241  ? GLU L 244  ? ILE N 241  GLU N 244  
AJ8 2 PRO L 303  ? ARG L 312  ? PRO N 303  ARG N 312  
AJ8 3 TYR L 249  ? ARG L 252  ? TYR N 249  ARG N 252  
AJ9 1 ILE L 241  ? GLU L 244  ? ILE N 241  GLU N 244  
AJ9 2 PRO L 303  ? ARG L 312  ? PRO N 303  ARG N 312  
AJ9 3 VAL L 286  ? PRO L 290  ? VAL N 286  PRO N 290  
AK1 1 GLU L 277  ? LEU L 284  ? GLU N 277  LEU N 284  
AK1 2 ALA L 268  ? ARG L 274  ? ALA N 268  ARG N 274  
AK1 3 GLY L 257  ? GLU L 263  ? GLY N 257  GLU N 263  
AK1 4 ILE L 297  ? VAL L 298  ? ILE N 297  VAL N 298  
AK2 1 ASN L 352  ? VAL L 353  ? ASN N 352  VAL N 353  
AK2 2 LYS L 366  ? ALA L 369  ? LYS N 366  ALA N 369  
AK2 3 VAL L 377  ? ILE L 378  ? VAL N 377  ILE N 378  
AK3 1 ALA L 398  ? PRO L 402  ? ALA N 398  PRO N 402  
AK3 2 VAL L 443  ? GLU L 448  ? VAL N 443  GLU N 448  
AK3 3 GLY L 433  ? ASP L 438  ? GLY N 433  ASP N 438  
AK3 4 ARG L 414  ? VAL L 415  ? ARG N 414  VAL N 415  
AK4 1 VAL L 420  ? ALA L 422  ? VAL N 420  ALA N 422  
AK4 2 VAL L 427  ? LYS L 428  ? VAL N 427  LYS N 428  
AK5 1 MET L 527  ? GLN L 529  ? MET N 527  GLN N 529  
AK5 2 PHE L 535  ? THR L 537  ? PHE N 535  THR N 537  
AK5 3 VAL N 335  ? SER N 336  ? VAL P 315  SER P 316  
AK6 1 GLU L 805  ? PHE L 806  ? GLU N 805  PHE N 806  
AK6 2 ILE L 827  ? VAL L 829  ? ILE N 827  VAL N 829  
AK6 3 ARG L 832  ? THR L 834  ? ARG N 832  THR N 834  
AK7 1 VAL L 842  ? PHE L 843  ? VAL N 842  PHE N 843  
AK7 2 VAL L 864  ? TYR L 868  ? VAL N 864  TYR N 868  
AK7 3 LYS L 871  ? THR L 875  ? LYS N 871  THR N 875  
AK8 1 VAL L 1106 ? GLU L 1109 ? VAL N 1106 GLU N 1109 
AK8 2 GLY L 1199 ? CYS L 1201 ? GLY N 1199 CYS N 1201 
AK9 1 ILE L 1118 ? PRO L 1121 ? ILE N 1118 PRO N 1121 
AK9 2 GLU L 1185 ? VAL L 1188 ? GLU N 1185 VAL N 1188 
AL1 1 PHE L 1123 ? PRO L 1125 ? PHE N 1123 PRO N 1125 
AL1 2 LEU L 1132 ? LEU L 1134 ? LEU N 1132 LEU N 1134 
AL2 1 VAL L 1153 ? VAL L 1155 ? VAL N 1153 VAL N 1155 
AL2 2 VAL L 1158 ? LEU L 1160 ? VAL N 1158 LEU N 1160 
AL3 1 SER L 1300 ? LYS L 1304 ? SER N 1300 LYS N 1304 
AL3 2 LEU L 1290 ? GLU L 1295 ? LEU N 1290 GLU N 1295 
AL3 3 GLY L 1279 ? GLU L 1285 ? GLY N 1279 GLU N 1285 
AL3 4 TYR L 1318 ? VAL L 1319 ? TYR N 1318 VAL N 1319 
AL4 1 VAL L 1394 ? GLU L 1396 ? VAL N 1394 GLU N 1396 
AL4 2 TYR L 1378 ? ASP L 1383 ? TYR N 1378 ASP N 1383 
AL4 3 ALA L 1416 ? PRO L 1419 ? ALA N 1416 PRO N 1419 
AL5 1 GLN L 1485 ? ASP L 1488 ? GLN N 1485 ASP N 1488 
AL5 2 LEU M 73   ? GLY M 76   ? LEU O 73   GLY O 76   
AL6 1 LYS M 47   ? GLN M 49   ? LYS O 47   GLN O 49   
AL6 2 LEU M 54   ? ASP M 56   ? LEU O 54   ASP O 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
AA1 2 3 N LEU A 28   ? N LEU A 28   O ASP A 193  ? O ASP A 193  
AA1 3 4 O TRP A 200  ? O TRP A 200  N ARG A 176  ? N ARG A 176  
AA2 1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
AA2 2 3 O GLU A 141  ? O GLU A 141  N TYR A 57   ? N TYR A 57   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
AA4 1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N ARG B 14   ? N ARG B 14   O GLU B 22   ? O GLU B 22   
AA6 2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
AA6 3 4 O ARG B 189  ? O ARG B 189  N LEU B 186  ? N LEU B 186  
AA7 1 2 N VAL B 97   ? N VAL B 97   O VAL B 144  ? O VAL B 144  
AA7 2 3 O GLY B 147  ? O GLY B 147  N GLY B 50   ? N GLY B 50   
AA7 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA8 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AA9 1 2 N VAL B 109  ? N VAL B 109  O ILE B 129  ? O ILE B 129  
AB1 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB2 1 2 N LYS C 4    ? N LYS C 4    O ILE C 902  ? O ILE C 902  
AB2 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB3 1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
AB3 2 3 N LEU C 94   ? N LEU C 94   O GLY C 116  ? O GLY C 116  
AB4 1 2 N PHE C 127  ? N PHE C 127  O ARG C 134  ? O ARG C 134  
AB4 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB5 1 2 O ARG C 332  ? O ARG C 332  N HIS C 141  ? N HIS C 141  
AB5 2 3 N SER C 138  ? N SER C 138  O SER C 411  ? O SER C 411  
AB5 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB6 1 2 N THR C 149  ? N THR C 149  O ILE C 159  ? O ILE C 159  
AB6 2 3 N ALA C 160  ? N ALA C 160  O LEU C 174  ? O LEU C 174  
AB6 3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
AB6 4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
AB7 1 2 N GLU C 294  ? N GLU C 294  O GLU C 297  ? O GLU C 297  
AB8 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB8 2 3 N ARG C 473  ? N ARG C 473  O GLU C 482  ? O GLU C 482  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AB9 3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
AB9 4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AB9 5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
AC1 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC2 1 2 N LEU C 595  ? N LEU C 595  O ALA C 656  ? O ALA C 656  
AC2 2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
AC3 1 2 O VAL C 621  ? O VAL C 621  N VAL C 613  ? N VAL C 613  
AC3 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC3 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC4 1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
AC5 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC6 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AC6 2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
AC6 3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
AC6 4 5 O VAL C 848  ? O VAL C 848  N ILE C 688  ? N ILE C 688  
AC6 5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
AC6 6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
AC6 7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
AC7 1 2 N SER C 702  ? N SER C 702  O ARG C 831  ? O ARG C 831  
AC7 2 3 O ALA C 828  ? O ALA C 828  N ILE C 799  ? N ILE C 799  
AC7 3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
AC8 1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
AC8 2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AC9 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AD1 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD1 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AD1 3 4 O HIS D 748  ? O HIS D 748  N LEU D 701  ? N LEU D 701  
AD1 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AD1 5 6 O VAL D 719  ? O VAL D 719  N CYS D 642  ? N CYS D 642  
AD1 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AD1 7 8 O LEU D 728  ? O LEU D 728  N VAL D 632  ? N VAL D 632  
AD2 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD3 1 2 N LEU C 1102 ? N LEU C 1102 O LYS D 7    ? O LYS D 7    
AD3 2 3 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD4 1 2 N TYR D 23   ? N TYR D 23   O MET D 90   ? O MET D 90   
AD4 2 3 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD5 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD5 2 3 N ILE D 133  ? N ILE D 133  O ARG D 455  ? O ARG D 455  
AD6 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AD7 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AD7 2 3 O GLU D 389  ? O GLU D 389  N ARG D 209  ? N ARG D 209  
AD7 3 4 N LEU D 225  ? N LEU D 225  O VAL D 331  ? O VAL D 331  
AD7 4 5 O THR D 334  ? O THR D 334  N GLU D 323  ? N GLU D 323  
AD8 1 2 N VAL D 185  ? N VAL D 185  O GLY D 201  ? O GLY D 201  
AD8 2 3 N ARG D 209  ? N ARG D 209  O GLU D 389  ? O GLU D 389  
AD8 3 4 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AD9 1 2 N LEU D 191  ? N LEU D 191  O VAL D 195  ? O VAL D 195  
AE1 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AE1 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AE2 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AE2 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AE3 1 2 O TYR D 282  ? O TYR D 282  N LEU D 270  ? N LEU D 270  
AE3 2 3 O PHE D 269  ? O PHE D 269  N LYS D 262  ? N LYS D 262  
AE3 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AE4 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AE4 2 3 N ILE D 367  ? N ILE D 367  O VAL D 377  ? O VAL D 377  
AE5 1 2 N TYR D 401  ? N TYR D 401  O VAL D 444  ? O VAL D 444  
AE5 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AE5 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE6 1 2 N ALA D 422  ? N ALA D 422  O VAL D 427  ? O VAL D 427  
AE7 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AE7 2 3 N PHE D 535  ? N PHE D 535  O VAL F 335  ? O VAL F 315  
AE8 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AE8 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AE9 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AE9 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AF1 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AF2 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AF3 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AF4 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AF5 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AF5 2 3 O SER D 1291 ? O SER D 1291 N GLU D 1284 ? N GLU D 1284 
AF5 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AF6 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF6 2 3 N THR D 1382 ? N THR D 1382 O ALA D 1416 ? O ALA D 1416 
AF7 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AF8 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
AF9 1 2 N ARG I 14   ? N ARG K 14   O GLU I 22   ? O GLU K 22   
AF9 2 3 N PHE I 23   ? N PHE K 23   O LEU I 197  ? O LEU K 197  
AF9 3 4 O ARG I 198  ? O ARG K 198  N ALA I 178  ? N ALA K 178  
AG1 1 2 N VAL I 97   ? N VAL K 97   O VAL I 144  ? O VAL K 144  
AG1 2 3 O ASP I 145  ? O ASP K 145  N ALA I 52   ? N ALA K 52   
AG1 3 4 N VAL I 56   ? N VAL K 56   O ILE I 165  ? O ILE K 165  
AG2 1 2 N ARG I 88   ? N ARG K 88   O GLU I 121  ? O GLU K 121  
AG3 1 2 N VAL I 109  ? N VAL K 109  O ILE I 129  ? O ILE K 129  
AG4 1 2 N VAL I 151  ? N VAL K 151  O ALA I 169  ? O ALA K 169  
AG5 1 2 N ARG J 14   ? N ARG L 14   O GLU J 22   ? O GLU L 22   
AG5 2 3 N LEU J 28   ? N LEU L 28   O ASP J 193  ? O ASP L 193  
AG5 3 4 O ARG J 198  ? O ARG L 198  N ALA J 178  ? N ALA L 178  
AG6 1 2 N ALA J 103  ? N ALA L 103  O LEU J 138  ? O LEU L 138  
AG6 2 3 O ARG J 143  ? O ARG L 143  N THR J 54   ? N THR L 54   
AG6 3 4 N VAL J 56   ? N VAL L 56   O ILE J 165  ? O ILE L 165  
AG7 1 2 N ARG J 88   ? N ARG L 88   O GLU J 121  ? O GLU L 121  
AG8 1 2 N VAL J 109  ? N VAL L 109  O ILE J 129  ? O ILE L 129  
AG9 1 2 N VAL J 151  ? N VAL L 151  O ALA J 169  ? O ALA L 169  
AH1 1 2 N LYS K 4    ? N LYS M 4    O ARG K 900  ? O ARG M 900  
AH1 2 3 O TYR K 901  ? O TYR M 901  N MET K 580  ? N MET M 580  
AH2 1 2 N GLU K 70   ? N GLU M 70   O ARG K 97   ? O ARG M 97   
AH2 2 3 N ALA K 96   ? N ALA M 96   O VAL K 113  ? O VAL M 113  
AH3 1 2 N PHE K 127  ? N PHE M 127  O ARG K 134  ? O ARG M 134  
AH3 2 3 N VAL K 135  ? N VAL M 135  O GLN K 393  ? O GLN M 393  
AH4 1 2 O ARG K 334  ? O ARG M 334  N GLN K 139  ? N GLN M 139  
AH4 2 3 N SER K 138  ? N SER M 138  O SER K 411  ? O SER M 411  
AH4 3 4 N ILE K 410  ? N ILE M 410  O THR K 453  ? O THR M 453  
AH5 1 2 N THR K 149  ? N THR M 149  O ILE K 159  ? O ILE M 159  
AH5 2 3 N ILE K 162  ? N ILE M 162  O ILE K 172  ? O ILE M 172  
AH5 3 4 N GLU K 175  ? N GLU M 175  O SER K 183  ? O SER M 183  
AH5 4 5 N MET K 184  ? N MET M 184  O PHE K 191  ? O PHE M 191  
AH6 1 2 N ARG K 292  ? N ARG M 292  O LYS K 299  ? O LYS M 299  
AH7 1 2 N ARG K 460  ? N ARG M 460  O ARG K 468  ? O ARG M 468  
AH7 2 3 N TYR K 471  ? N TYR M 471  O VAL K 484  ? O VAL M 484  
AH8 1 2 N ARG K 460  ? N ARG M 460  O ARG K 468  ? O ARG M 468  
AH8 2 3 N ARG K 472  ? N ARG M 472  O MET K 532  ? O MET M 532  
AH8 3 4 O PHE K 531  ? O PHE M 531  N ALA K 497  ? N ALA M 497  
AH8 4 5 N ILE K 496  ? N ILE M 496  O ARG K 516  ? O ARG M 516  
AH8 5 6 N VAL K 513  ? N VAL M 513  O VAL K 524  ? O VAL M 524  
AH9 1 2 N GLU K 504  ? N GLU M 504  O ARG K 507  ? O ARG M 507  
AI1 1 2 N LEU K 595  ? N LEU M 595  O LEU K 655  ? O LEU M 655  
AI1 2 3 O ASP K 657  ? O ASP M 657  N ARG K 640  ? N ARG M 640  
AI2 1 2 O VAL K 621  ? O VAL M 621  N VAL K 613  ? N VAL M 613  
AI2 2 3 O ARG K 614  ? O ARG M 614  N GLU K 602  ? N GLU M 602  
AI2 3 4 N GLY K 601  ? N GLY M 601  O VAL K 649  ? O VAL M 649  
AI3 1 2 N TYR K 629  ? N TYR M 629  O LEU K 637  ? O LEU M 637  
AI4 1 2 N GLU K 662  ? N GLU M 662  O PHE K 665  ? O PHE M 665  
AI5 1 2 N VAL K 972  ? N VAL M 972  O ILE K 987  ? O ILE M 987  
AI5 2 3 O MET K 995  ? O MET M 995  N ALA K 840  ? N ALA M 840  
AI5 3 4 N LEU K 839  ? N LEU M 839  O GLY K 847  ? O GLY M 847  
AI5 4 5 O ALA K 850  ? O ALA M 850  N ILE K 688  ? N ILE M 688  
AI5 5 6 N VAL K 689  ? N VAL M 689  O ILE K 870  ? O ILE M 870  
AI5 6 7 O LEU K 871  ? O LEU M 871  N ALA K 675  ? N ALA M 675  
AI5 7 8 N VAL K 674  ? N VAL M 674  O GLY K 990  ? O GLY M 990  
AI6 1 2 N SER K 702  ? N SER M 702  O ARG K 831  ? O ARG M 831  
AI6 2 3 O VAL K 822  ? O VAL M 822  N LEU K 806  ? N LEU M 806  
AI6 3 4 O GLY K 798  ? O GLY M 798  N VAL K 749  ? N VAL M 749  
AI7 1 2 N ARG K 721  ? N ARG M 721  O THR K 759  ? O THR M 759  
AI7 2 3 N SER K 760  ? N SER M 760  O LYS K 786  ? O LYS M 786  
AI8 1 2 N LEU K 755  ? N LEU M 755  O LEU K 790  ? O LEU M 790  
AI9 1 2 N ARG K 1008 ? N ARG M 1008 O SER L 626  ? O SER N 626  
AI9 2 3 N SER L 629  ? N SER N 629  O MET L 745  ? O MET N 745  
AI9 3 4 O ALA L 746  ? O ALA N 746  N ASN L 703  ? N ASN N 703  
AI9 4 5 N LEU L 702  ? N LEU N 702  O GLN L 714  ? O GLN N 714  
AI9 5 6 O VAL L 719  ? O VAL N 719  N CYS L 642  ? N CYS N 642  
AI9 6 7 N GLY L 643  ? N GLY N 643  O GLN L 727  ? O GLN N 727  
AI9 7 8 O ILE L 726  ? O ILE N 726  N VAL L 630  ? N VAL N 630  
AJ1 1 2 N PHE K 1032 ? N PHE M 1032 O LYS L 621  ? O LYS N 621  
AJ2 1 2 N LEU K 1102 ? N LEU M 1102 O LYS L 7    ? O LYS N 7    
AJ2 2 3 N VAL L 8    ? N VAL N 8    O ASP L 1457 ? O ASP N 1457 
AJ3 1 2 N ALA L 99   ? N ALA N 99   O LEU L 514  ? O LEU N 514  
AJ4 1 2 O LEU L 153  ? O LEU N 153  N TYR L 132  ? N TYR N 132  
AJ4 2 3 N ASP L 136  ? N ASP N 136  O ASP L 453  ? O ASP N 453  
AJ5 1 2 N LEU L 142  ? N LEU N 142  O VAL L 145  ? O VAL N 145  
AJ6 1 2 N TYR L 169  ? N TYR N 169  O ILE L 393  ? O ILE N 393  
AJ6 2 3 O GLU L 389  ? O GLU N 389  N ARG L 209  ? N ARG N 209  
AJ6 3 4 N LEU L 223  ? N LEU N 223  O LEU L 333  ? O LEU N 333  
AJ6 4 5 O GLU L 338  ? O GLU N 338  N ARG L 318  ? N ARG N 318  
AJ7 1 2 N VAL L 185  ? N VAL N 185  O GLY L 201  ? O GLY N 201  
AJ7 2 3 N ARG L 209  ? N ARG N 209  O GLU L 389  ? O GLU N 389  
AJ7 3 4 O GLY L 383  ? O GLY N 383  N VAL L 361  ? N VAL N 361  
AJ8 1 2 N ALA L 243  ? N ALA N 243  O LEU L 311  ? O LEU N 311  
AJ8 2 3 O ALA L 305  ? O ALA N 305  N PHE L 251  ? N PHE N 251  
AJ9 1 2 N ALA L 243  ? N ALA N 243  O LEU L 311  ? O LEU N 311  
AJ9 2 3 O ARG L 312  ? O ARG N 312  N VAL L 286  ? N VAL N 286  
AK1 1 2 O TYR L 282  ? O TYR N 282  N LEU L 270  ? N LEU N 270  
AK1 2 3 O PHE L 269  ? O PHE N 269  N LYS L 262  ? N LYS N 262  
AK1 3 4 N GLY L 257  ? N GLY N 257  O VAL L 298  ? O VAL N 298  
AK2 1 2 N ASN L 352  ? N ASN N 352  O ALA L 369  ? O ALA N 369  
AK2 2 3 N VAL L 368  ? N VAL N 368  O VAL L 377  ? O VAL N 377  
AK3 1 2 N ARG L 399  ? N ARG N 399  O VAL L 446  ? O VAL N 446  
AK3 2 3 O ARG L 445  ? O ARG N 445  N GLU L 436  ? N GLU N 436  
AK3 3 4 O GLY L 433  ? O GLY N 433  N VAL L 415  ? N VAL N 415  
AK4 1 2 N ALA L 422  ? N ALA N 422  O VAL L 427  ? O VAL N 427  
AK5 1 2 N VAL L 528  ? N VAL N 528  O ALA L 536  ? O ALA N 536  
AK5 2 3 N PHE L 535  ? N PHE N 535  O VAL N 335  ? O VAL P 315  
AK6 1 2 N PHE L 806  ? N PHE N 806  O LYS L 828  ? O LYS N 828  
AK6 2 3 N ILE L 827  ? N ILE N 827  O THR L 834  ? O THR N 834  
AK7 1 2 N PHE L 843  ? N PHE N 843  O THR L 865  ? O THR N 865  
AK7 2 3 N VAL L 866  ? N VAL N 866  O LEU L 873  ? O LEU N 873  
AK8 1 2 N ARG L 1108 ? N ARG N 1108 O VAL L 1200 ? O VAL N 1200 
AK9 1 2 N ILE L 1118 ? N ILE N 1118 O VAL L 1188 ? O VAL N 1188 
AL1 1 2 N GLN L 1124 ? N GLN N 1124 O ARG L 1133 ? O ARG N 1133 
AL2 1 2 N VAL L 1153 ? N VAL N 1153 O LEU L 1160 ? O LEU N 1160 
AL3 1 2 O LYS L 1301 ? O LYS N 1301 N VAL L 1294 ? N VAL N 1294 
AL3 2 3 O SER L 1291 ? O SER N 1291 N GLU L 1284 ? N GLU N 1284 
AL3 3 4 N GLY L 1279 ? N GLY N 1279 O VAL L 1319 ? O VAL N 1319 
AL4 1 2 O LEU L 1395 ? O LEU N 1395 N VAL L 1379 ? N VAL N 1379 
AL4 2 3 N ASP L 1383 ? N ASP N 1383 O ALA L 1416 ? O ALA N 1416 
AL5 1 2 N GLN L 1485 ? N GLN N 1485 O GLY M 76   ? O GLY O 76   
AL6 1 2 N MET M 48   ? N MET O 48   O PHE M 55   ? O PHE O 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MG  2001 ? 4 'binding site for residue MG B 2001'  
AC2 Software D ZN  2001 ? 4 'binding site for residue ZN D 2001'  
AC3 Software D ZN  2002 ? 4 'binding site for residue ZN D 2002'  
AC4 Software D MG  2003 ? 4 'binding site for residue MG D 2003'  
AC5 Software D MG  2004 ? 3 'binding site for residue MG D 2004'  
AC6 Software D C   2005 ? 9 'binding site for residue C D 2005'   
AC7 Software D CTP 2006 ? 6 'binding site for residue CTP D 2006' 
AC8 Software D MG  2007 ? 2 'binding site for residue MG D 2007'  
AC9 Software F MG  2001 ? 3 'binding site for residue MG F 2001'  
AD1 Software L MG  2001 ? 4 'binding site for residue MG L 2001'  
AD2 Software M CTP 1201 ? 5 'binding site for residue CTP M 1201' 
AD3 Software N ZN  2001 ? 4 'binding site for residue ZN N 2001'  
AD4 Software N ZN  2002 ? 4 'binding site for residue ZN N 2002'  
AD5 Software N MG  2003 ? 4 'binding site for residue MG N 2003'  
AD6 Software N MG  2004 ? 5 'binding site for residue MG N 2004'  
AD7 Software N C   2005 ? 9 'binding site for residue C N 2005'   
AD8 Software N MG  2006 ? 4 'binding site for residue MG N 2006'  
AD9 Software P MG  2001 ? 3 'binding site for residue MG P 2001'  
AE1 Software R A   101  ? 6 'binding site for residue A R 101'    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ASP B  183  ? ASP B 183  . ? 1_555 ? 
2  AC1 4 ASP B  191  ? ASP B 191  . ? 1_555 ? 
3  AC1 4 LEU B  192  ? LEU B 192  . ? 1_555 ? 
4  AC1 4 ASP B  193  ? ASP B 193  . ? 1_555 ? 
5  AC2 4 CYS D  1112 ? CYS D 1112 . ? 1_555 ? 
6  AC2 4 CYS D  1194 ? CYS D 1194 . ? 1_555 ? 
7  AC2 4 CYS D  1201 ? CYS D 1201 . ? 1_555 ? 
8  AC2 4 CYS D  1204 ? CYS D 1204 . ? 1_555 ? 
9  AC3 4 CYS D  58   ? CYS D 58   . ? 1_555 ? 
10 AC3 4 CYS D  60   ? CYS D 60   . ? 1_555 ? 
11 AC3 4 CYS D  73   ? CYS D 73   . ? 1_555 ? 
12 AC3 4 CYS D  76   ? CYS D 76   . ? 1_555 ? 
13 AC4 4 ASP D  739  ? ASP D 739  . ? 1_555 ? 
14 AC4 4 ASP D  741  ? ASP D 741  . ? 1_555 ? 
15 AC4 4 ASP D  743  ? ASP D 743  . ? 1_555 ? 
16 AC4 4 C   V  .    ? C   D 2005 . ? 1_555 ? 
17 AC5 3 LEU D  839  ? LEU D 839  . ? 1_555 ? 
18 AC5 3 LYS D  840  ? LYS D 840  . ? 1_555 ? 
19 AC5 3 HOH NA .    ? HOH D 2101 . ? 1_555 ? 
20 AC6 9 LYS C  838  ? LYS C 838  . ? 1_555 ? 
21 AC6 9 LYS C  846  ? LYS C 846  . ? 1_555 ? 
22 AC6 9 ARG D  704  ? ARG D 704  . ? 1_555 ? 
23 AC6 9 ASP D  741  ? ASP D 741  . ? 1_555 ? 
24 AC6 9 ASP D  743  ? ASP D 743  . ? 1_555 ? 
25 AC6 9 MG  T  .    ? MG  D 2003 . ? 1_555 ? 
26 AC6 9 HOH NA .    ? HOH D 2237 . ? 1_555 ? 
27 AC6 9 HOH NA .    ? HOH D 2239 . ? 1_555 ? 
28 AC6 9 DG  G  14   ? DG  G 15   . ? 1_555 ? 
29 AC7 6 SER C  878  ? SER C 878  . ? 1_555 ? 
30 AC7 6 ARG C  879  ? ARG C 879  . ? 1_555 ? 
31 AC7 6 ARG D  1029 ? ARG D 1029 . ? 1_555 ? 
32 AC7 6 MG  X  .    ? MG  D 2007 . ? 1_555 ? 
33 AC7 6 HOH NA .    ? HOH D 2118 . ? 1_555 ? 
34 AC7 6 HOH NA .    ? HOH D 2139 . ? 1_555 ? 
35 AC8 2 ASP D  739  ? ASP D 739  . ? 1_555 ? 
36 AC8 2 CTP W  .    ? CTP D 2006 . ? 1_555 ? 
37 AC9 3 ALA F  312  ? ALA F 292  . ? 1_555 ? 
38 AC9 3 GLY F  316  ? GLY F 296  . ? 1_555 ? 
39 AC9 3 TRP F  319  ? TRP F 299  . ? 1_555 ? 
40 AD1 4 ASP J  183  ? ASP L 183  . ? 1_555 ? 
41 AD1 4 ASP J  191  ? ASP L 191  . ? 1_555 ? 
42 AD1 4 LEU J  192  ? LEU L 192  . ? 1_555 ? 
43 AD1 4 ASP J  193  ? ASP L 193  . ? 1_555 ? 
44 AD2 5 SER K  878  ? SER M 878  . ? 1_555 ? 
45 AD2 5 ARG K  879  ? ARG M 879  . ? 1_555 ? 
46 AD2 5 HOH UA .    ? HOH M 1368 . ? 1_555 ? 
47 AD2 5 ARG L  1029 ? ARG N 1029 . ? 1_555 ? 
48 AD2 5 MG  HA .    ? MG  N 2006 . ? 1_555 ? 
49 AD3 4 CYS L  1112 ? CYS N 1112 . ? 1_555 ? 
50 AD3 4 CYS L  1194 ? CYS N 1194 . ? 1_555 ? 
51 AD3 4 CYS L  1201 ? CYS N 1201 . ? 1_555 ? 
52 AD3 4 CYS L  1204 ? CYS N 1204 . ? 1_555 ? 
53 AD4 4 CYS L  58   ? CYS N 58   . ? 1_555 ? 
54 AD4 4 CYS L  60   ? CYS N 60   . ? 1_555 ? 
55 AD4 4 CYS L  73   ? CYS N 73   . ? 1_555 ? 
56 AD4 4 CYS L  76   ? CYS N 76   . ? 1_555 ? 
57 AD5 4 ASP L  739  ? ASP N 739  . ? 1_555 ? 
58 AD5 4 ASP L  741  ? ASP N 741  . ? 1_555 ? 
59 AD5 4 ASP L  743  ? ASP N 743  . ? 1_555 ? 
60 AD5 4 C   GA .    ? C   N 2005 . ? 1_555 ? 
61 AD6 5 HOH TA .    ? HOH L 2103 . ? 1_555 ? 
62 AD6 5 LYS L  840  ? LYS N 840  . ? 1_555 ? 
63 AD6 5 HOH VA .    ? HOH N 2101 . ? 1_555 ? 
64 AD6 5 HOH VA .    ? HOH N 2117 . ? 1_555 ? 
65 AD6 5 HOH VA .    ? HOH N 2149 . ? 1_555 ? 
66 AD7 9 LYS K  838  ? LYS M 838  . ? 1_555 ? 
67 AD7 9 LYS K  846  ? LYS M 846  . ? 1_555 ? 
68 AD7 9 ARG L  704  ? ARG N 704  . ? 1_555 ? 
69 AD7 9 ASP L  741  ? ASP N 741  . ? 1_555 ? 
70 AD7 9 ASP L  743  ? ASP N 743  . ? 1_555 ? 
71 AD7 9 MG  EA .    ? MG  N 2003 . ? 1_555 ? 
72 AD7 9 DG  O  14   ? DG  R 15   . ? 1_555 ? 
73 AD7 9 DT  O  15   ? DT  R 16   . ? 1_555 ? 
74 AD7 9 A   JA .    ? A   R 101  . ? 1_555 ? 
75 AD8 4 CTP BA .    ? CTP M 1201 . ? 1_555 ? 
76 AD8 4 HOH UA .    ? HOH M 1368 . ? 1_555 ? 
77 AD8 4 ASP L  739  ? ASP N 739  . ? 1_555 ? 
78 AD8 4 HOH VA .    ? HOH N 2242 . ? 1_555 ? 
79 AD9 3 ALA N  312  ? ALA P 292  . ? 1_555 ? 
80 AD9 3 GLY N  316  ? GLY P 296  . ? 1_555 ? 
81 AD9 3 TRP N  319  ? TRP P 299  . ? 1_555 ? 
82 AE1 6 LYS K  838  ? LYS M 838  . ? 1_555 ? 
83 AE1 6 HIS K  999  ? HIS M 999  . ? 1_555 ? 
84 AE1 6 C   GA .    ? C   N 2005 . ? 1_555 ? 
85 AE1 6 DT  O  15   ? DT  R 16   . ? 1_555 ? 
86 AE1 6 DA  O  16   ? DA  R 17   . ? 1_555 ? 
87 AE1 6 HOH YA .    ? HOH R 201  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5D4D 
_atom_sites.fract_transf_matrix[1][1]   0.005405 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000786 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009661 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003410 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1  4    ? 31.853  17.401  144.727  1.00 51.03  ? 4    SER A N     1 
ATOM   2     C  CA    . SER A  1  4    ? 31.604  16.361  143.729  1.00 73.07  ? 4    SER A CA    1 
ATOM   3     C  C     . SER A  1  4    ? 32.723  16.339  142.694  1.00 68.38  ? 4    SER A C     1 
ATOM   4     O  O     . SER A  1  4    ? 32.790  15.448  141.845  1.00 58.81  ? 4    SER A O     1 
ATOM   5     C  CB    . SER A  1  4    ? 30.250  16.579  143.043  1.00 68.83  ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A  1  4    ? 29.950  15.525  142.141  1.00 41.63  ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A  1  5    ? 33.599  17.333  142.777  1.00 66.47  ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A  1  5    ? 34.741  17.440  141.881  1.00 55.97  ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A  1  5    ? 35.890  16.560  142.369  1.00 54.25  ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A  1  5    ? 36.167  16.497  143.568  1.00 63.27  ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A  1  5    ? 35.188  18.901  141.795  1.00 58.61  ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A  1  5    ? 36.585  19.116  141.244  1.00 54.90  ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A  1  5    ? 36.653  18.857  139.753  1.00 51.58  ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A  1  5    ? 38.046  19.161  139.225  1.00 57.24  ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A  1  5    ? 38.503  20.525  139.619  1.00 42.48  ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A  1  6    ? 36.546  15.876  141.436  1.00 49.48  ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A  1  6    ? 37.694  15.034  141.757  1.00 43.57  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A  1  6    ? 38.891  15.906  142.132  1.00 35.03  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A  1  6    ? 39.048  17.006  141.609  1.00 39.44  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A  1  6    ? 38.039  14.142  140.559  1.00 36.32  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A  1  6    ? 38.349  12.660  140.798  1.00 30.15  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A  1  6    ? 39.687  12.472  141.489  1.00 39.18  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A  1  6    ? 37.245  11.997  141.594  1.00 32.56  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A  1  7    ? 39.726  15.423  143.046  1.00 31.94  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A  1  7    ? 40.927  16.151  143.438  1.00 33.42  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A  1  7    ? 42.163  15.562  142.761  1.00 24.53  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A  1  7    ? 42.073  14.554  142.067  1.00 25.90  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A  1  7    ? 41.096  16.123  144.961  1.00 48.02  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A  1  7    ? 40.065  16.942  145.740  1.00 55.14  ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A  1  7    ? 40.390  18.432  145.706  1.00 56.12  ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A  1  7    ? 39.463  19.235  146.613  1.00 50.53  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A  1  7    ? 39.805  20.692  146.624  1.00 44.55  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A  1  8    ? 43.317  16.186  142.979  1.00 22.68  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A  1  8    ? 44.563  15.734  142.370  1.00 18.94  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A  1  8    ? 44.883  14.296  142.773  1.00 26.45  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A  1  8    ? 44.894  13.965  143.958  1.00 30.09  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A  1  8    ? 45.708  16.664  142.739  1.00 16.46  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A  1  9    ? 45.114  13.432  141.773  1.00 26.91  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A  1  9    ? 45.395  11.999  141.912  1.00 20.47  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A  1  9    ? 46.841  11.681  142.288  1.00 18.79  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A  1  9    ? 47.749  12.459  141.996  1.00 17.59  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A  1  9    ? 45.097  11.463  140.515  1.00 20.60  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A  1  9    ? 45.448  12.592  139.621  1.00 24.44  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A  1  9    ? 45.069  13.844  140.359  1.00 23.25  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A  1  10   ? 47.043  10.529  142.920  1.00 21.44  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A  1  10   ? 48.381  10.067  143.267  1.00 26.64  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A  1  10   ? 49.155  9.622   142.026  1.00 23.42  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A  1  10   ? 48.647  8.851   141.186  1.00 21.03  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A  1  10   ? 48.358  8.943   144.344  1.00 24.02  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A  1  10   ? 47.391  7.838   143.963  1.00 24.99  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A  1  10   ? 49.761  8.385   144.577  1.00 21.21  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A  1  11   ? 50.381  10.136  141.929  1.00 22.38  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A  1  11   ? 51.279  9.887   140.806  1.00 28.39  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A  1  11   ? 52.421  8.977   141.224  1.00 24.62  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A  1  11   ? 53.320  9.394   141.944  1.00 31.10  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A  1  11   ? 51.844  11.216  140.298  1.00 35.59  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A  1  11   ? 52.964  11.068  139.303  1.00 30.06  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A  1  11   ? 54.145  11.772  139.465  1.00 31.72  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A  1  11   ? 52.834  10.233  138.203  1.00 27.12  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A  1  11   ? 55.177  11.644  138.551  1.00 33.58  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A  1  11   ? 53.861  10.104  137.283  1.00 27.19  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A  1  11   ? 55.034  10.810  137.457  1.00 28.17  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A  1  12   ? 52.399  7.742   140.739  1.00 24.68  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A  1  12   ? 53.346  6.726   141.181  1.00 24.51  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A  1  12   ? 54.369  6.410   140.095  1.00 20.84  ? 12   THR A C     1 
ATOM   66    O  O     . THR A  1  12   ? 54.045  6.404   138.915  1.00 21.52  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A  1  12   ? 52.607  5.441   141.582  1.00 28.39  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A  1  12   ? 51.323  5.779   142.128  1.00 26.62  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A  1  12   ? 53.414  4.655   142.607  1.00 34.62  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A  1  13   ? 55.606  6.144   140.500  1.00 22.54  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A  1  13   ? 56.699  5.967   139.549  1.00 18.88  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A  1  13   ? 57.473  4.676   139.796  1.00 20.13  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A  1  13   ? 58.103  4.519   140.840  1.00 28.26  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A  1  13   ? 57.681  7.148   139.622  1.00 14.41  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A  1  13   ? 58.901  6.882   138.768  1.00 16.59  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A  1  13   ? 56.995  8.430   139.196  1.00 19.12  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A  1  14   ? 57.433  3.759   138.834  1.00 16.50  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A  1  14   ? 58.146  2.493   138.967  1.00 17.89  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A  1  14   ? 59.184  2.364   137.860  1.00 21.29  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A  1  14   ? 58.828  2.168   136.704  1.00 25.13  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A  1  14   ? 57.160  1.323   138.891  1.00 17.55  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A  1  14   ? 55.884  1.529   139.704  1.00 22.88  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A  1  14   ? 55.030  0.265   139.763  1.00 19.44  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A  1  14   ? 54.092  0.163   138.648  1.00 22.13  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A  1  14   ? 52.779  0.369   138.745  1.00 28.26  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A  1  14   ? 52.235  0.687   139.914  1.00 20.52  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A  1  14   ? 52.004  0.249   137.670  1.00 28.94  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A  1  15   ? 60.466  2.442   138.208  1.00 25.08  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A  1  15   ? 61.517  2.447   137.190  1.00 27.99  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A  1  15   ? 62.481  1.259   137.260  1.00 33.94  ? 15   THR A C     1 
ATOM   91    O  O     . THR A  1  15   ? 62.872  0.816   138.345  1.00 33.68  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A  1  15   ? 62.338  3.760   137.211  1.00 22.76  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A  1  15   ? 63.116  3.827   138.411  1.00 27.42  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A  1  15   ? 61.423  4.967   137.129  1.00 18.01  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A  1  16   ? 62.851  0.750   136.086  1.00 29.19  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A  1  16   ? 63.869  -0.285  135.975  1.00 27.14  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A  1  16   ? 65.017  0.235   135.125  1.00 25.56  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A  1  16   ? 64.877  0.392   133.913  1.00 28.71  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A  1  16   ? 63.284  -1.547  135.339  1.00 28.17  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A  1  16   ? 62.078  -2.105  136.079  1.00 46.70  ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A  1  16   ? 61.613  -3.439  135.525  1.00 56.66  ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A  1  16   ? 62.119  -3.909  134.504  1.00 53.03  ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A  1  16   ? 60.645  -4.058  136.200  1.00 51.65  ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A  1  17   ? 66.158  0.479   135.761  1.00 26.16  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A  1  17   ? 67.304  1.042   135.074  1.00 23.09  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A  1  17   ? 66.987  2.370   134.409  1.00 28.32  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A  1  17   ? 66.078  3.094   134.827  1.00 26.61  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A  1  18   ? 67.744  2.691   133.367  1.00 27.11  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A  1  18   ? 67.505  3.906   132.604  1.00 25.27  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A  1  18   ? 66.657  3.600   131.379  1.00 25.14  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A  1  18   ? 66.311  4.497   130.615  1.00 24.68  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A  1  18   ? 68.830  4.525   132.169  1.00 28.31  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A  1  18   ? 69.814  4.756   133.298  1.00 25.21  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A  1  18   ? 71.038  5.502   132.799  1.00 25.29  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A  1  18   ? 70.669  6.736   132.114  1.00 24.29  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A  1  18   ? 70.515  7.906   132.722  1.00 25.25  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A  1  18   ? 70.698  7.995   134.031  1.00 34.65  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A  1  18   ? 70.176  8.985   132.027  1.00 26.09  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A  1  19   ? 66.322  2.325   131.205  1.00 26.94  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A  1  19   ? 65.644  1.848   130.000  1.00 29.25  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A  1  19   ? 64.121  1.979   130.069  1.00 29.40  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A  1  19   ? 63.510  2.668   129.253  1.00 25.11  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A  1  19   ? 66.015  0.387   129.716  1.00 34.62  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A  1  19   ? 67.493  0.038   129.899  1.00 47.50  ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A  1  19   ? 68.371  0.472   128.732  1.00 47.84  ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A  1  19   ? 68.265  1.642   128.300  1.00 42.66  ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A  1  19   ? 69.173  -0.362  128.253  1.00 49.05  ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A  1  20   ? 63.519  1.290   131.035  1.00 27.04  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A  1  20   ? 62.070  1.145   131.121  1.00 15.21  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A  1  20   ? 61.471  1.896   132.303  1.00 17.72  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A  1  20   ? 62.118  2.065   133.333  1.00 21.79  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A  1  20   ? 61.732  -0.338  131.244  1.00 17.61  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A  1  20   ? 60.263  -0.645  131.378  1.00 17.32  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A  1  20   ? 59.780  -1.333  132.479  1.00 19.54  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A  1  20   ? 59.360  -0.253  130.401  1.00 16.85  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A  1  20   ? 58.439  -1.623  132.604  1.00 19.89  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A  1  20   ? 58.018  -0.533  130.520  1.00 18.54  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A  1  20   ? 57.563  -1.221  131.621  1.00 21.09  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A  1  20   ? 56.225  -1.506  131.740  1.00 23.93  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A  1  21   ? 60.228  2.340   132.153  1.00 19.01  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A  1  21   ? 59.525  2.974   133.253  1.00 15.98  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A  1  21   ? 58.018  2.836   133.175  1.00 15.35  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A  1  21   ? 57.454  2.664   132.091  1.00 17.93  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A  1  22   ? 57.374  2.917   134.338  1.00 16.50  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A  1  22   ? 55.920  2.863   134.462  1.00 14.83  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A  1  22   ? 55.445  4.043   135.292  1.00 14.35  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A  1  22   ? 55.981  4.314   136.361  1.00 17.42  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A  1  22   ? 55.476  1.562   135.125  1.00 13.37  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A  1  22   ? 55.693  0.330   134.276  1.00 16.47  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A  1  22   ? 55.122  -0.920  134.911  1.00 23.61  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A  1  22   ? 54.581  -0.817  136.033  1.00 22.12  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A  1  22   ? 55.214  -2.005  134.293  1.00 24.66  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A  1  23   ? 54.446  4.757   134.793  1.00 13.42  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A  1  23   ? 53.999  5.964   135.464  1.00 11.67  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A  1  23   ? 52.497  5.939   135.653  1.00 15.38  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A  1  23   ? 51.746  5.980   134.690  1.00 16.64  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A  1  23   ? 54.434  7.185   134.665  1.00 11.95  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A  1  23   ? 55.910  7.230   134.415  1.00 17.27  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A  1  23   ? 56.741  7.960   135.244  1.00 17.58  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A  1  23   ? 56.474  6.515   133.367  1.00 18.44  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A  1  23   ? 58.105  7.994   135.022  1.00 20.77  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A  1  23   ? 57.835  6.536   133.146  1.00 18.74  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A  1  23   ? 58.653  7.279   133.974  1.00 22.44  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A  1  24   ? 52.058  5.874   136.902  1.00 14.71  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A  1  24   ? 50.644  5.726   137.187  1.00 13.29  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A  1  24   ? 50.040  7.026   137.697  1.00 15.27  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A  1  24   ? 50.682  7.788   138.410  1.00 20.80  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A  1  24   ? 50.389  4.587   138.188  1.00 14.59  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A  1  24   ? 48.909  4.251   138.252  1.00 14.78  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A  1  24   ? 51.171  3.363   137.782  1.00 15.17  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A  1  25   ? 48.808  7.284   137.291  1.00 12.42  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A  1  25   ? 48.057  8.414   137.780  1.00 12.75  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A  1  25   ? 46.688  7.882   138.151  1.00 16.56  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A  1  25   ? 45.951  7.410   137.272  1.00 18.92  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A  1  25   ? 47.914  9.441   136.669  1.00 10.59  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A  1  25   ? 48.143  10.886  137.076  1.00 16.26  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A  1  25   ? 49.597  11.079  137.446  1.00 13.72  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A  1  25   ? 47.734  11.816  135.950  1.00 18.50  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A  1  26   ? 46.345  7.914   139.441  1.00 20.57  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A  1  26   ? 44.989  7.494   139.828  1.00 19.95  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A  1  26   ? 44.408  8.190   141.057  1.00 18.02  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A  1  26   ? 45.148  8.603   141.940  1.00 16.35  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A  1  26   ? 44.891  5.965   139.965  1.00 17.16  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A  1  26   ? 45.377  5.376   141.278  1.00 18.38  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A  1  26   ? 45.102  3.871   141.373  1.00 30.84  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A  1  26   ? 43.998  3.432   140.970  1.00 21.12  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A  1  26   ? 45.994  3.124   141.841  1.00 30.90  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A  1  27   ? 43.071  8.329   141.110  1.00 17.26  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A  1  27   ? 42.111  8.137   140.016  1.00 13.95  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A  1  27   ? 42.001  9.370   139.131  1.00 16.41  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A  1  27   ? 42.258  10.487  139.590  1.00 18.47  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A  1  27   ? 40.794  7.918   140.751  1.00 14.96  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A  1  27   ? 40.937  8.747   141.966  1.00 21.17  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A  1  27   ? 42.386  8.659   142.371  1.00 16.87  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A  1  28   ? 41.600  9.167   137.882  1.00 14.82  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A  1  28   ? 41.293  10.270  136.981  1.00 11.25  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A  1  28   ? 39.826  10.157  136.577  1.00 11.71  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A  1  28   ? 39.237  9.079   136.670  1.00 10.35  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A  1  28   ? 42.203  10.232  135.753  1.00 9.67   ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A  1  28   ? 43.696  10.516  135.965  1.00 11.71  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A  1  28   ? 44.527  9.851   134.889  1.00 12.72  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A  1  28   ? 43.975  12.009  135.979  1.00 16.32  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A  1  29   ? 39.237  11.266  136.139  1.00 13.00  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A  1  29   ? 37.833  11.278  135.734  1.00 13.40  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A  1  29   ? 37.616  10.360  134.536  1.00 15.25  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A  1  29   ? 38.558  10.052  133.809  1.00 16.52  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A  1  29   ? 37.386  12.700  135.384  1.00 14.93  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A  1  29   ? 37.120  13.594  136.580  1.00 25.25  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A  1  29   ? 35.829  13.237  137.304  1.00 46.14  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A  1  29   ? 35.054  12.403  136.777  1.00 55.26  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A  1  29   ? 35.591  13.791  138.401  1.00 35.88  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A  1  30   ? 36.381  9.911   134.338  1.00 14.00  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A  1  30   ? 36.072  9.036   133.210  1.00 14.81  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A  1  30   ? 36.483  9.659   131.874  1.00 13.98  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A  1  30   ? 36.208  10.830  131.608  1.00 11.75  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A  1  30   ? 34.584  8.685   133.191  1.00 22.97  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A  1  30   ? 34.193  7.688   132.110  1.00 27.70  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A  1  30   ? 32.715  7.337   132.191  1.00 30.79  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A  1  30   ? 31.850  8.441   131.784  1.00 35.25  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A  1  30   ? 31.260  8.525   130.596  1.00 30.55  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A  1  30   ? 31.441  7.567   129.696  1.00 31.17  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A  1  30   ? 30.483  9.561   130.307  1.00 29.71  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A  1  31   ? 37.154  8.868   131.045  1.00 13.09  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A  1  31   ? 37.608  9.331   129.748  1.00 11.54  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A  1  31   ? 39.000  9.939   129.753  1.00 11.41  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A  1  31   ? 39.636  10.037  128.707  1.00 10.73  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A  1  32   ? 39.484  10.339  130.926  1.00 12.07  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A  1  32   ? 40.738  11.086  131.012  1.00 10.91  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A  1  32   ? 41.992  10.246  130.843  1.00 7.55   ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A  1  32   ? 43.085  10.784  130.650  1.00 8.26   ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A  1  32   ? 40.808  11.896  132.307  1.00 10.58  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A  1  32   ? 40.322  13.296  132.152  1.00 9.50   ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A  1  32   ? 38.974  13.583  132.231  1.00 10.31  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A  1  32   ? 41.209  14.323  131.890  1.00 10.23  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A  1  32   ? 38.519  14.873  132.071  1.00 9.31   ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A  1  32   ? 40.759  15.616  131.728  1.00 11.36  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A  1  32   ? 39.411  15.891  131.819  1.00 8.96   ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A  1  33   ? 41.835  8.932   130.912  1.00 6.67   ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A  1  33   ? 42.955  8.041   130.687  1.00 9.28   ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A  1  33   ? 43.492  8.239   129.287  1.00 10.13  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A  1  33   ? 44.700  8.295   129.071  1.00 9.97   ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A  1  34   ? 42.573  8.359   128.336  1.00 12.78  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A  1  34   ? 42.908  8.599   126.940  1.00 6.94   ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A  1  34   ? 43.300  10.053  126.702  1.00 7.56   ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A  1  34   ? 44.282  10.328  126.012  1.00 10.21  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A  1  34   ? 41.733  8.211   126.021  1.00 5.00   ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A  1  34   ? 41.972  8.686   124.605  1.00 6.52   ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A  1  34   ? 41.533  6.706   126.048  1.00 6.58   ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A  1  35   ? 42.539  10.978  127.281  1.00 6.87   ? 35   THR A N     1 
ATOM   250   C  CA    . THR A  1  35   ? 42.799  12.402  127.103  1.00 6.89   ? 35   THR A CA    1 
ATOM   251   C  C     . THR A  1  35   ? 44.212  12.790  127.527  1.00 7.05   ? 35   THR A C     1 
ATOM   252   O  O     . THR A  1  35   ? 44.881  13.557  126.846  1.00 9.36   ? 35   THR A O     1 
ATOM   253   C  CB    . THR A  1  35   ? 41.797  13.272  127.873  1.00 8.28   ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A  1  35   ? 40.460  12.912  127.505  1.00 9.19   ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A  1  35   ? 42.027  14.740  127.552  1.00 5.95   ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A  1  36   ? 44.669  12.283  128.660  1.00 7.25   ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A  1  36   ? 46.051  12.536  129.040  1.00 6.60   ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A  1  36   ? 47.006  11.590  128.338  1.00 9.42   ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A  1  36   ? 48.046  12.002  127.827  1.00 9.75   ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A  1  36   ? 46.224  12.403  130.545  1.00 7.80   ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A  1  36   ? 45.658  13.585  131.313  1.00 11.50  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A  1  36   ? 45.996  13.458  132.785  1.00 17.56  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A  1  36   ? 46.217  14.866  130.725  1.00 16.25  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A  1  37   ? 46.632  10.315  128.312  1.00 11.25  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A  1  37   ? 47.508  9.254   127.854  1.00 9.39   ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A  1  37   ? 47.966  9.371   126.417  1.00 8.64   ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A  1  37   ? 49.156  9.281   126.134  1.00 10.50  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A  1  38   ? 47.031  9.574   125.501  1.00 7.01   ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A  1  38   ? 47.394  9.584   124.091  1.00 9.55   ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A  1  38   ? 48.280  10.724  123.559  1.00 7.65   ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A  1  38   ? 49.201  10.464  122.787  1.00 7.82   ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A  1  38   ? 46.174  9.393   123.203  1.00 11.63  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A  1  38   ? 46.545  8.880   121.832  1.00 10.70  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A  1  38   ? 46.866  7.701   121.662  1.00 7.30   ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A  1  38   ? 46.517  9.765   120.844  1.00 12.82  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A  1  39   ? 48.001  11.982  123.940  1.00 7.58   ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A  1  39   ? 48.870  13.045  123.428  1.00 7.55   ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A  1  39   ? 50.276  12.893  123.976  1.00 8.36   ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A  1  39   ? 51.248  13.258  123.314  1.00 7.96   ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A  1  39   ? 48.235  14.321  123.987  1.00 5.93   ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A  1  39   ? 46.875  13.956  124.313  1.00 5.18   ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A  1  39   ? 46.891  12.532  124.728  1.00 8.77   ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A  1  40   ? 50.384  12.358  125.185  1.00 7.12   ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A  1  40   ? 51.696  12.146  125.767  1.00 7.85   ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A  1  40   ? 52.422  11.076  124.971  1.00 9.06   ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A  1  40   ? 53.616  11.191  124.723  1.00 10.53  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A  1  40   ? 51.600  11.769  127.245  1.00 11.14  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A  1  40   ? 51.156  12.892  128.188  1.00 9.90   ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A  1  40   ? 51.133  12.416  129.636  1.00 7.31   ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A  1  40   ? 52.049  14.115  128.020  1.00 8.87   ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A  1  41   ? 51.691  10.049  124.547  1.00 9.03   ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A  1  41   ? 52.279  8.999   123.723  1.00 7.02   ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A  1  41   ? 52.747  9.575   122.400  1.00 6.76   ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A  1  41   ? 53.847  9.286   121.943  1.00 9.60   ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A  1  41   ? 51.283  7.871   123.461  1.00 6.45   ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A  1  41   ? 51.830  6.788   122.543  1.00 7.05   ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A  1  41   ? 50.822  5.677   122.319  1.00 9.35   ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A  1  41   ? 51.406  4.546   121.603  1.00 7.26   ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A  1  41   ? 51.481  4.466   120.281  1.00 7.94   ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A  1  41   ? 51.016  5.454   119.528  1.00 8.11   ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A  1  41   ? 52.029  3.403   119.710  1.00 7.13   ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A  1  42   ? 51.915  10.400  121.785  1.00 5.09   ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A  1  42   ? 52.286  10.978  120.508  1.00 7.21   ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A  1  42   ? 53.500  11.904  120.652  1.00 9.23   ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A  1  42   ? 54.453  11.820  119.872  1.00 10.58  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A  1  42   ? 51.090  11.683  119.865  1.00 7.71   ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A  1  42   ? 49.930  10.739  119.555  1.00 6.65   ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A  1  42   ? 48.742  11.475  118.948  1.00 8.02   ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A  1  42   ? 49.152  12.399  117.895  1.00 10.10  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A  1  42   ? 49.286  12.067  116.615  1.00 8.93   ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A  1  42   ? 49.032  10.829  116.210  1.00 6.21   ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A  1  42   ? 49.667  12.983  115.735  1.00 9.42   ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A  1  43   ? 53.483  12.756  121.669  1.00 7.63   ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A  1  43   ? 54.597  13.664  121.902  1.00 7.31   ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A  1  43   ? 55.866  12.885  122.250  1.00 7.54   ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A  1  43   ? 56.968  13.278  121.870  1.00 6.95   ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A  1  43   ? 54.247  14.706  122.984  1.00 6.89   ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A  1  43   ? 53.251  15.714  122.422  1.00 6.34   ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A  1  43   ? 55.474  15.456  123.437  1.00 8.11   ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A  1  43   ? 52.472  16.436  123.470  1.00 6.57   ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A  1  44   ? 55.702  11.759  122.940  1.00 8.02   ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A  1  44   ? 56.841  10.919  123.313  1.00 8.89   ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A  1  44   ? 57.454  10.194  122.125  1.00 9.46   ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A  1  44   ? 58.675  10.057  122.037  1.00 14.03  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A  1  44   ? 56.457  9.907   124.395  1.00 9.11   ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A  1  44   ? 56.410  10.439  125.829  1.00 8.01   ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A  1  44   ? 55.733  9.432   126.724  1.00 7.68   ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A  1  44   ? 57.798  10.754  126.337  1.00 7.31   ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A  1  45   ? 56.616  9.728   121.208  1.00 7.44   ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A  1  45   ? 57.127  8.989   120.061  1.00 7.13   ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A  1  45   ? 57.775  9.906   119.025  1.00 8.20   ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A  1  45   ? 58.602  9.464   118.231  1.00 11.49  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A  1  45   ? 56.029  8.128   119.426  1.00 5.46   ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A  1  45   ? 55.584  6.915   120.251  1.00 5.34   ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A  1  45   ? 54.365  6.264   119.634  1.00 5.06   ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A  1  45   ? 56.707  5.898   120.428  1.00 4.84   ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A  1  46   ? 57.423  11.185  119.047  1.00 6.98   ? 46   SER A N     1 
ATOM   338   C  CA    . SER A  1  46   ? 57.905  12.105  118.026  1.00 7.20   ? 46   SER A CA    1 
ATOM   339   C  C     . SER A  1  46   ? 58.910  13.149  118.520  1.00 10.87  ? 46   SER A C     1 
ATOM   340   O  O     . SER A  1  46   ? 60.071  13.150  118.104  1.00 10.61  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A  1  46   ? 56.726  12.808  117.361  1.00 7.33   ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A  1  46   ? 56.012  13.581  118.303  1.00 7.97   ? 46   SER A OG    1 
ATOM   343   N  N     . SER A  1  47   ? 58.456  14.025  119.414  1.00 13.92  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A  1  47   ? 59.139  15.294  119.694  1.00 12.35  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A  1  47   ? 60.209  15.318  120.797  1.00 8.84   ? 47   SER A C     1 
ATOM   346   O  O     . SER A  1  47   ? 60.726  16.383  121.131  1.00 7.39   ? 47   SER A O     1 
ATOM   347   C  CB    . SER A  1  47   ? 58.101  16.387  119.951  1.00 10.77  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A  1  47   ? 57.217  16.488  118.848  1.00 15.32  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A  1  48   ? 60.532  14.160  121.360  1.00 11.13  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A  1  48   ? 61.540  14.084  122.417  1.00 11.10  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A  1  48   ? 62.958  14.127  121.856  1.00 11.20  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A  1  48   ? 63.363  13.233  121.114  1.00 15.52  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A  1  48   ? 61.373  12.805  123.260  1.00 11.73  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A  1  48   ? 59.993  12.788  123.923  1.00 11.11  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A  1  48   ? 62.472  12.700  124.298  1.00 9.78   ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A  1  48   ? 59.607  14.105  124.570  1.00 12.24  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A  1  49   ? 63.718  15.173  122.206  1.00 9.59   ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A  1  49   ? 65.084  15.309  121.703  1.00 11.56  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A  1  49   ? 65.992  14.170  122.151  1.00 11.32  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A  1  49   ? 65.760  13.558  123.193  1.00 9.02   ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A  1  49   ? 65.541  16.638  122.306  1.00 8.88   ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A  1  49   ? 64.284  17.407  122.466  1.00 9.11   ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A  1  49   ? 63.286  16.383  122.920  1.00 13.99  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A  1  50   ? 67.024  13.907  121.355  1.00 11.58  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A  1  50   ? 67.928  12.802  121.599  1.00 14.08  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A  1  50   ? 69.198  12.920  120.779  1.00 17.52  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A  1  50   ? 69.527  13.994  120.269  1.00 18.04  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A  1  51   ? 69.932  11.817  120.676  1.00 18.37  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A  1  51   ? 71.157  11.792  119.889  1.00 20.20  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A  1  51   ? 71.144  10.658  118.864  1.00 19.67  ? 51   THR A C     1 
ATOM   371   O  O     . THR A  1  51   ? 70.484  9.636   119.068  1.00 21.84  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A  1  51   ? 72.408  11.644  120.790  1.00 21.34  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A  1  51   ? 72.365  10.386  121.480  1.00 17.10  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A  1  51   ? 72.489  12.792  121.797  1.00 16.63  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A  1  52   ? 71.854  10.862  117.755  1.00 15.65  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A  1  52   ? 72.117  9.800   116.785  1.00 12.65  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A  1  52   ? 73.344  10.140  115.947  1.00 11.38  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A  1  52   ? 73.693  11.312  115.807  1.00 11.27  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A  1  52   ? 70.915  9.582   115.892  1.00 14.89  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A  1  53   ? 73.980  9.122   115.368  1.00 13.30  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A  1  53   ? 75.162  9.345   114.544  1.00 12.76  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A  1  53   ? 74.718  10.032  113.278  1.00 11.34  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A  1  53   ? 73.916  9.480   112.527  1.00 10.53  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A  1  53   ? 75.800  8.013   114.120  1.00 10.24  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A  1  53   ? 76.828  8.241   113.022  1.00 10.59  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A  1  53   ? 76.423  7.313   115.313  1.00 15.74  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A  1  54   ? 75.220  11.241  113.044  1.00 11.30  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A  1  54   ? 74.857  11.958  111.830  1.00 13.72  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A  1  54   ? 75.864  11.872  110.682  1.00 13.80  ? 54   THR A C     1 
ATOM   390   O  O     . THR A  1  54   ? 75.520  12.199  109.545  1.00 16.41  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A  1  54   ? 74.487  13.440  112.115  1.00 12.65  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A  1  54   ? 75.670  14.235  112.218  1.00 14.93  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A  1  54   ? 73.700  13.550  113.400  1.00 13.51  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A  1  55   ? 77.089  11.426  110.955  1.00 11.85  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A  1  55   ? 78.066  11.322  109.860  1.00 10.32  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A  1  55   ? 79.195  10.333  110.125  1.00 10.64  ? 55   SER A C     1 
ATOM   397   O  O     . SER A  1  55   ? 79.538  10.079  111.270  1.00 14.61  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A  1  55   ? 78.641  12.699  109.521  1.00 12.71  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A  1  55   ? 79.539  12.619  108.429  1.00 17.31  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A  1  56   ? 79.783  9.775   109.071  1.00 10.67  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A  1  56   ? 80.889  8.828   109.247  1.00 14.00  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A  1  56   ? 82.013  8.989   108.225  1.00 17.75  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A  1  56   ? 81.769  9.024   107.018  1.00 17.43  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A  1  56   ? 80.414  7.355   109.204  1.00 16.22  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A  1  56   ? 81.590  6.407   109.365  1.00 14.28  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A  1  56   ? 79.382  7.086   110.283  1.00 24.61  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A  1  57   ? 83.245  9.084   108.720  1.00 18.38  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A  1  57   ? 84.427  9.002   107.873  1.00 16.67  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A  1  57   ? 85.159  7.708   108.179  1.00 16.51  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A  1  57   ? 85.283  7.318   109.336  1.00 21.51  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A  1  57   ? 85.359  10.194  108.099  1.00 19.23  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A  1  57   ? 86.717  10.041  107.442  1.00 21.61  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A  1  57   ? 86.864  10.162  106.065  1.00 23.08  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A  1  57   ? 87.852  9.778   108.200  1.00 26.08  ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A  1  57   ? 88.105  10.026  105.458  1.00 29.08  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A  1  57   ? 89.098  9.636   107.604  1.00 30.96  ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A  1  57   ? 89.219  9.761   106.233  1.00 34.95  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A  1  57   ? 90.454  9.619   105.639  1.00 34.85  ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A  1  58   ? 85.621  7.032   107.136  1.00 13.81  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A  1  58   ? 86.407  5.822   107.297  1.00 14.96  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A  1  58   ? 87.615  5.957   106.394  1.00 20.61  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A  1  58   ? 87.472  6.281   105.219  1.00 23.64  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A  1  58   ? 85.607  4.566   106.909  1.00 19.79  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A  1  58   ? 84.340  4.456   107.762  1.00 20.67  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A  1  58   ? 86.457  3.316   107.066  1.00 20.04  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A  1  58   ? 83.518  3.205   107.504  1.00 19.52  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A  1  59   ? 88.803  5.730   106.943  1.00 22.35  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A  1  59   ? 90.034  5.952   106.193  1.00 26.66  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A  1  59   ? 90.120  5.031   104.979  1.00 28.89  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A  1  59   ? 89.837  3.835   105.077  1.00 26.48  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A  1  59   ? 91.260  5.779   107.094  1.00 34.06  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A  1  59   ? 92.575  6.177   106.427  1.00 49.57  ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A  1  59   ? 93.757  6.181   107.385  1.00 50.29  ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A  1  59   ? 93.550  5.980   108.602  1.00 46.28  ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A  1  59   ? 94.897  6.391   106.915  1.00 55.90  ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A  1  60   ? 90.496  5.606   103.838  1.00 31.63  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A  1  60   ? 90.610  4.866   102.581  1.00 33.41  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A  1  60   ? 89.260  4.296   102.124  1.00 31.89  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A  1  60   ? 89.191  3.224   101.517  1.00 27.58  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A  1  60   ? 91.679  3.766   102.682  1.00 40.76  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A  1  60   ? 93.078  4.322   102.929  1.00 49.10  ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A  1  60   ? 93.474  5.283   102.234  1.00 53.00  ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A  1  60   ? 93.781  3.799   103.822  1.00 54.17  ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A  1  61   ? 88.191  5.027   102.427  1.00 28.65  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A  1  61   ? 86.848  4.683   101.972  1.00 16.52  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A  1  61   ? 86.206  5.932   101.391  1.00 18.86  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A  1  61   ? 86.001  6.921   102.097  1.00 20.06  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A  1  61   ? 85.984  4.139   103.122  1.00 15.78  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A  1  61   ? 84.511  4.230   102.778  1.00 13.37  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A  1  61   ? 86.373  2.705   103.438  1.00 23.04  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A  1  62   ? 85.915  5.891   100.093  1.00 20.88  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A  1  62   ? 85.426  7.064   99.370   1.00 15.24  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A  1  62   ? 83.926  7.336   99.507   1.00 12.98  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A  1  62   ? 83.488  8.485   99.420   1.00 16.14  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A  1  62   ? 85.830  6.978   97.899   1.00 11.51  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A  1  62   ? 87.322  7.200   97.660   1.00 7.89   ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A  1  62   ? 87.667  7.031   96.195   1.00 10.22  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A  1  62   ? 87.704  8.576   98.135   1.00 10.28  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A  1  63   ? 83.148  6.280   99.719   1.00 11.16  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A  1  63   ? 81.693  6.388   99.731   1.00 11.84  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A  1  63   ? 81.061  5.173   100.394  1.00 12.15  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A  1  63   ? 81.762  4.245   100.800  1.00 13.63  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A  1  63   ? 81.182  6.497   98.302   1.00 11.26  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A  1  63   ? 81.733  5.444   97.397   1.00 7.83   ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A  1  63   ? 81.412  4.112   97.528   1.00 8.06   ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A  1  63   ? 82.606  5.524   96.367   1.00 8.05   ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A  1  63   ? 82.055  3.415   96.608   1.00 10.68  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A  1  63   ? 82.786  4.248   95.890   1.00 10.68  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A  1  64   ? 79.734  5.161   100.471  1.00 9.91   ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A  1  64   ? 79.027  4.133   101.232  1.00 12.23  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A  1  64   ? 79.069  2.756   100.565  1.00 12.58  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A  1  64   ? 78.863  1.732   101.210  1.00 17.56  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A  1  64   ? 77.578  4.563   101.478  1.00 15.72  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A  1  64   ? 76.838  3.745   102.529  1.00 16.89  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A  1  64   ? 75.513  4.376   102.924  1.00 27.08  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A  1  64   ? 75.267  5.542   102.530  1.00 34.13  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A  1  64   ? 74.721  3.708   103.624  1.00 20.99  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A  1  65   ? 79.376  2.742   99.277   1.00 12.53  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A  1  65   ? 79.251  1.548   98.443   1.00 11.94  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A  1  65   ? 80.490  0.661   98.371   1.00 15.04  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A  1  65   ? 80.616  -0.165  97.472   1.00 18.89  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A  1  65   ? 78.678  1.904   97.078   1.00 9.09   ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A  1  65   ? 77.371  2.616   97.176   1.00 9.20   ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A  1  65   ? 77.315  4.002   97.125   1.00 9.64   ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A  1  65   ? 76.203  1.907   97.392   1.00 7.97   ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A  1  65   ? 76.110  4.666   97.244   1.00 8.14   ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A  1  65   ? 74.993  2.563   97.513   1.00 7.89   ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A  1  65   ? 74.946  3.946   97.437   1.00 8.26   ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A  1  66   ? 81.418  0.878   99.296   1.00 14.15  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A  1  66   ? 82.737  0.253   99.259   1.00 15.08  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A  1  66   ? 82.939  -0.799  100.358  1.00 11.30  ? 66   SER A C     1 
ATOM   492   O  O     . SER A  1  66   ? 82.194  -0.837  101.333  1.00 10.70  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A  1  66   ? 83.806  1.341   99.372   1.00 14.26  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A  1  66   ? 83.320  2.432   100.136  1.00 9.05   ? 66   SER A OG    1 
ATOM   495   N  N     . THR A  1  67   ? 83.901  -1.698  100.146  1.00 11.60  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A  1  67   ? 84.317  -2.670  101.160  1.00 13.87  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A  1  67   ? 85.745  -2.381  101.597  1.00 15.99  ? 67   THR A C     1 
ATOM   498   O  O     . THR A  1  67   ? 86.548  -1.917  100.795  1.00 20.51  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A  1  67   ? 84.294  -4.107  100.619  1.00 15.11  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A  1  67   ? 85.102  -4.181  99.441   1.00 14.72  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A  1  67   ? 82.883  -4.533  100.278  1.00 17.24  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A  1  68   ? 86.064  -2.671  102.858  1.00 20.30  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A  1  68   ? 87.395  -2.398  103.417  1.00 20.35  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A  1  68   ? 88.164  -3.694  103.620  1.00 19.70  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A  1  68   ? 87.705  -4.571  104.346  1.00 22.09  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A  1  68   ? 87.299  -1.702  104.792  1.00 21.60  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A  1  68   ? 86.031  -0.851  104.879  1.00 24.56  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A  1  68   ? 88.542  -0.869  105.061  1.00 17.56  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A  1  68   ? 85.737  -0.325  106.257  1.00 17.94  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A  1  69   ? 89.342  -3.819  102.987  1.00 22.51  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A  1  69   ? 90.114  -5.064  103.074  1.00 20.39  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A  1  69   ? 90.425  -5.429  104.521  1.00 23.79  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A  1  69   ? 90.791  -4.560  105.316  1.00 24.34  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A  1  69   ? 91.400  -4.731  102.315  1.00 20.54  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A  1  69   ? 91.006  -3.637  101.374  1.00 20.26  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A  1  69   ? 90.013  -2.815  102.143  1.00 23.93  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A  1  70   ? 90.255  -6.704  104.857  1.00 22.84  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A  1  70   ? 90.458  -7.181  106.211  1.00 18.45  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A  1  70   ? 89.179  -7.144  107.019  1.00 20.95  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A  1  70   ? 89.046  -7.852  108.013  1.00 23.51  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A  1  71   ? 88.230  -6.320  106.583  1.00 23.56  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A  1  71   ? 86.943  -6.188  107.261  1.00 20.28  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A  1  71   ? 85.905  -7.104  106.616  1.00 19.34  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A  1  71   ? 85.851  -7.221  105.392  1.00 19.81  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A  1  71   ? 86.433  -4.734  107.204  1.00 18.62  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A  1  71   ? 85.142  -4.585  107.993  1.00 18.02  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A  1  71   ? 87.493  -3.780  107.720  1.00 21.49  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A  1  72   ? 85.093  -7.761  107.438  1.00 17.20  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A  1  72   ? 84.023  -8.610  106.924  1.00 17.06  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A  1  72   ? 82.852  -7.774  106.416  1.00 18.32  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A  1  72   ? 82.355  -7.986  105.310  1.00 19.90  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A  1  72   ? 83.535  -9.592  107.990  1.00 13.31  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A  1  72   ? 82.637  -10.672 107.429  1.00 13.38  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A  1  72   ? 82.059  -11.565 108.506  1.00 15.66  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A  1  72   ? 81.149  -12.620 107.889  1.00 15.48  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A  1  72   ? 80.152  -13.173 108.850  1.00 15.85  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A  1  73   ? 82.422  -6.821  107.234  1.00 17.68  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A  1  73   ? 81.300  -5.955  106.895  1.00 16.53  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A  1  73   ? 81.630  -4.984  105.765  1.00 17.66  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A  1  73   ? 82.742  -4.464  105.685  1.00 18.69  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A  1  73   ? 80.849  -5.167  108.131  1.00 14.76  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A  1  73   ? 80.079  -5.980  109.168  1.00 22.13  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A  1  73   ? 80.968  -6.855  110.039  1.00 20.32  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A  1  73   ? 82.180  -6.939  109.764  1.00 18.58  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A  1  73   ? 80.451  -7.458  111.007  1.00 21.50  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A  1  74   ? 80.661  -4.762  104.880  1.00 18.74  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A  1  74   ? 80.725  -3.666  103.917  1.00 16.38  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A  1  74   ? 80.294  -2.364  104.590  1.00 14.53  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A  1  74   ? 79.566  -2.391  105.580  1.00 14.18  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A  1  74   ? 79.861  -3.956  102.683  1.00 18.57  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A  1  74   ? 78.417  -4.270  103.036  1.00 27.36  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A  1  74   ? 77.682  -3.331  103.409  1.00 29.86  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A  1  74   ? 78.013  -5.451  102.933  1.00 34.29  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A  1  75   ? 80.747  -1.234  104.056  1.00 14.49  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A  1  75   ? 80.458  0.066   104.655  1.00 10.56  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A  1  75   ? 78.964  0.290   104.873  1.00 13.44  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A  1  75   ? 78.570  0.885   105.874  1.00 16.61  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A  1  75   ? 81.061  1.219   103.835  1.00 6.36   ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A  1  75   ? 80.655  2.554   104.410  1.00 7.40   ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A  1  75   ? 82.555  1.110   103.832  1.00 9.48   ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A  1  76   ? 78.133  -0.201  103.957  1.00 10.79  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A  1  76   ? 76.687  -0.085  104.126  1.00 12.72  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A  1  76   ? 76.256  -0.723  105.446  1.00 14.98  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A  1  76   ? 75.515  -0.112  106.229  1.00 14.97  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A  1  76   ? 75.907  -0.701  102.938  1.00 14.56  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A  1  76   ? 74.535  -1.179  103.371  1.00 11.70  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A  1  76   ? 75.775  0.304   101.816  1.00 16.32  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A  1  77   ? 76.758  -1.930  105.705  1.00 14.83  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A  1  77   ? 76.445  -2.645  106.942  1.00 15.03  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A  1  77   ? 77.065  -1.980  108.172  1.00 16.13  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A  1  77   ? 76.438  -1.924  109.228  1.00 17.73  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A  1  77   ? 76.880  -4.112  106.860  1.00 16.84  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A  1  77   ? 76.492  -4.940  108.088  1.00 16.95  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A  1  77   ? 76.694  -6.441  107.893  1.00 24.33  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A  1  77   ? 76.292  -7.204  108.799  1.00 20.06  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A  1  77   ? 77.247  -6.857  106.844  1.00 21.01  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A  1  78   ? 78.292  -1.482  108.032  1.00 15.45  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A  1  78   ? 78.981  -0.804  109.131  1.00 13.92  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A  1  78   ? 78.198  0.420   109.585  1.00 13.18  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A  1  78   ? 77.979  0.622   110.776  1.00 15.19  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A  1  78   ? 80.428  -0.408  108.743  1.00 14.39  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A  1  78   ? 81.338  -1.640  108.785  1.00 15.41  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A  1  78   ? 80.968  0.683   109.663  1.00 8.50   ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A  1  78   ? 82.593  -1.508  107.952  1.00 16.37  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A  1  79   ? 77.760  1.223   108.625  1.00 12.12  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A  1  79   ? 76.947  2.387   108.930  1.00 12.62  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A  1  79   ? 75.601  1.952   109.498  1.00 12.61  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A  1  79   ? 75.071  2.587   110.414  1.00 12.46  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A  1  79   ? 76.773  3.289   107.694  1.00 11.72  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A  1  79   ? 78.137  3.867   107.294  1.00 11.67  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A  1  79   ? 75.763  4.397   107.974  1.00 6.99   ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A  1  79   ? 78.120  4.746   106.065  1.00 12.26  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A  1  80   ? 75.065  0.852   108.973  1.00 11.54  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A  1  80   ? 73.823  0.298   109.507  1.00 11.61  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A  1  80   ? 73.960  -0.058  110.982  1.00 14.59  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A  1  80   ? 72.997  0.047   111.742  1.00 12.66  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A  1  80   ? 73.373  -0.931  108.717  1.00 11.81  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A  1  80   ? 72.401  -0.676  107.563  1.00 9.78   ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A  1  80   ? 71.738  -1.969  107.147  1.00 4.77   ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A  1  80   ? 71.366  0.370   107.941  1.00 8.71   ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A  1  81   ? 75.159  -0.483  111.376  1.00 17.43  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A  1  81   ? 75.459  -0.782  112.770  1.00 12.09  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A  1  81   ? 75.645  0.492   113.583  1.00 13.72  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A  1  81   ? 75.139  0.602   114.695  1.00 16.11  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A  1  81   ? 76.695  -1.673  112.875  1.00 11.62  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A  1  81   ? 76.457  -3.061  112.315  1.00 14.89  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A  1  81   ? 75.313  -3.480  112.142  1.00 16.97  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A  1  81   ? 77.536  -3.785  112.035  1.00 13.40  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A  1  82   ? 76.356  1.461   113.015  1.00 15.97  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A  1  82   ? 76.560  2.753   113.666  1.00 14.94  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A  1  82   ? 75.246  3.494   113.913  1.00 14.06  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A  1  82   ? 75.166  4.340   114.796  1.00 17.62  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A  1  82   ? 77.515  3.626   112.850  1.00 13.59  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A  1  82   ? 78.949  3.105   112.733  1.00 16.51  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A  1  82   ? 79.711  3.873   111.672  1.00 18.84  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A  1  82   ? 79.676  3.183   114.066  1.00 17.51  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A  1  83   ? 74.214  3.179   113.139  1.00 12.82  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A  1  83   ? 72.897  3.745   113.402  1.00 14.04  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A  1  83   ? 72.326  3.199   114.706  1.00 12.90  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A  1  83   ? 71.446  3.803   115.312  1.00 14.02  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A  1  83   ? 71.928  3.435   112.258  1.00 13.40  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A  1  83   ? 72.261  4.112   110.953  1.00 14.47  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A  1  83   ? 71.227  3.784   109.890  1.00 20.36  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A  1  83   ? 69.873  4.409   110.207  1.00 18.64  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A  1  83   ? 68.931  4.303   109.046  1.00 17.66  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A  1  84   ? 72.830  2.049   115.135  1.00 13.54  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A  1  84   ? 72.284  1.375   116.304  1.00 19.20  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A  1  84   ? 73.009  1.805   117.594  1.00 20.79  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A  1  84   ? 72.685  1.334   118.688  1.00 20.08  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A  1  84   ? 72.349  -0.144  116.106  1.00 16.72  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A  1  84   ? 71.271  -0.934  116.834  1.00 28.51  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A  1  84   ? 71.607  -2.418  116.928  1.00 57.89  ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A  1  84   ? 71.056  -3.109  117.817  1.00 47.73  ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A  1  84   ? 72.429  -2.892  116.112  1.00 60.30  ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A  1  85   ? 73.976  2.711   117.455  1.00 16.09  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A  1  85   ? 74.762  3.205   118.585  1.00 15.15  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A  1  85   ? 74.016  4.238   119.433  1.00 17.59  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A  1  85   ? 73.383  5.153   118.902  1.00 13.91  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A  1  85   ? 76.070  3.814   118.080  1.00 17.86  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A  1  85   ? 77.033  4.382   119.125  1.00 17.08  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A  1  85   ? 77.789  3.267   119.822  1.00 16.98  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A  1  85   ? 77.994  5.371   118.491  1.00 16.16  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A  1  86   ? 74.114  4.096   120.753  1.00 19.06  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A  1  86   ? 73.438  4.998   121.682  1.00 17.67  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A  1  86   ? 74.428  5.871   122.450  1.00 18.83  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A  1  86   ? 75.152  5.382   123.317  1.00 18.49  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A  1  86   ? 72.627  4.209   122.712  1.00 17.02  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A  1  86   ? 71.724  5.147   123.492  1.00 18.34  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A  1  86   ? 71.826  3.111   122.032  1.00 13.75  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A  1  87   ? 74.447  7.166   122.149  1.00 18.83  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A  1  87   ? 75.409  8.067   122.780  1.00 19.26  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A  1  87   ? 74.750  9.095   123.682  1.00 19.80  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A  1  87   ? 74.099  10.028  123.211  1.00 18.23  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A  1  87   ? 76.245  8.833   121.744  1.00 26.92  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A  1  87   ? 77.294  9.674   122.447  1.00 24.93  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A  1  87   ? 76.898  7.875   120.767  1.00 29.08  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A  1  88   ? 74.956  8.930   124.981  1.00 22.76  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A  1  88   ? 74.422  9.844   125.973  1.00 25.28  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A  1  88   ? 75.394  10.981  126.231  1.00 23.69  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A  1  88   ? 76.570  10.753  126.513  1.00 25.04  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A  1  88   ? 74.153  9.103   127.281  1.00 27.22  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A  1  88   ? 73.647  10.003  128.391  1.00 25.88  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A  1  88   ? 73.690  9.299   129.734  1.00 28.07  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A  1  88   ? 73.107  10.126  130.785  1.00 29.44  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A  1  88   ? 73.253  9.901   132.085  1.00 22.80  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A  1  88   ? 73.978  8.873   132.509  1.00 18.01  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A  1  88   ? 72.680  10.714  132.961  1.00 26.83  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A  1  89   ? 74.896  12.206  126.131  1.00 23.44  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A  1  89   ? 75.686  13.374  126.477  1.00 24.10  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A  1  89   ? 75.373  13.764  127.913  1.00 35.00  ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A  1  89   ? 74.229  14.087  128.237  1.00 38.60  ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A  1  89   ? 75.359  14.547  125.554  1.00 23.88  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A  1  89   ? 75.820  14.361  124.135  1.00 29.54  ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A  1  89   ? 76.597  13.271  123.773  1.00 28.07  ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A  1  89   ? 75.485  15.292  123.161  1.00 32.77  ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A  1  89   ? 77.021  13.108  122.461  1.00 26.55  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A  1  89   ? 75.908  15.136  121.849  1.00 27.56  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A  1  89   ? 76.676  14.043  121.499  1.00 25.36  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A  1  90   ? 76.383  13.730  128.776  1.00 31.35  ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A  1  90   ? 76.203  14.155  130.157  1.00 24.98  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A  1  90   ? 75.998  15.672  130.230  1.00 29.31  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A  1  90   ? 75.058  16.155  130.859  1.00 27.01  ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A  1  90   ? 77.387  13.719  131.025  1.00 27.81  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A  1  90   ? 77.514  12.253  131.472  1.00 26.93  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A  1  90   ? 76.187  11.707  131.964  1.00 23.56  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A  1  90   ? 78.073  11.362  130.377  1.00 28.89  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A  1  91   ? 76.872  16.420  129.568  1.00 34.62  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A  1  91   ? 76.779  17.876  129.568  1.00 35.56  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A  1  91   ? 75.669  18.397  128.654  1.00 38.72  ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A  1  91   ? 75.691  18.166  127.444  1.00 38.91  ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A  1  91   ? 78.121  18.495  129.176  1.00 41.82  ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A  1  91   ? 78.184  19.985  129.460  1.00 47.60  ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A  1  91   ? 77.269  20.742  129.121  1.00 42.71  ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A  1  91   ? 79.270  20.414  130.095  1.00 57.27  ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A  1  92   ? 74.703  19.120  129.239  1.00 39.66  ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A  1  92   ? 73.524  19.673  128.560  1.00 37.52  ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A  1  92   ? 73.862  20.662  127.454  1.00 35.41  ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A  1  92   ? 73.053  20.866  126.552  1.00 42.54  ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A  1  92   ? 72.789  20.411  129.685  1.00 43.07  ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A  1  92   ? 73.240  19.748  130.933  1.00 47.75  ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A  1  92   ? 74.673  19.388  130.687  1.00 46.37  ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A  1  93   ? 75.036  21.275  127.526  1.00 36.06  ? 93   SER A N     1 
ATOM   703   C  CA    . SER A  1  93   ? 75.382  22.331  126.585  1.00 39.32  ? 93   SER A CA    1 
ATOM   704   C  C     . SER A  1  93   ? 75.969  21.781  125.287  1.00 42.57  ? 93   SER A C     1 
ATOM   705   O  O     . SER A  1  93   ? 76.131  22.512  124.311  1.00 42.08  ? 93   SER A O     1 
ATOM   706   C  CB    . SER A  1  93   ? 76.357  23.313  127.237  1.00 40.62  ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A  1  93   ? 75.819  23.838  128.439  1.00 42.77  ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A  1  94   ? 76.252  20.482  125.276  1.00 45.50  ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A  1  94   ? 77.008  19.856  124.192  1.00 42.61  ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A  1  94   ? 76.114  19.452  123.017  1.00 41.41  ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A  1  94   ? 75.249  18.587  123.158  1.00 42.39  ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A  1  94   ? 77.715  18.619  124.754  1.00 39.78  ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A  1  94   ? 78.746  17.854  123.930  1.00 31.31  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A  1  94   ? 79.882  18.775  123.510  1.00 30.80  ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A  1  94   ? 79.267  16.676  124.748  1.00 25.37  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A  1  95   ? 76.318  20.088  121.863  1.00 41.92  ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A  1  95   ? 75.536  19.776  120.662  1.00 40.91  ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A  1  95   ? 76.135  18.719  119.728  1.00 37.70  ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A  1  95   ? 75.425  18.166  118.886  1.00 41.42  ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A  1  95   ? 75.261  21.054  119.857  1.00 36.11  ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A  1  95   ? 74.380  22.066  120.572  1.00 45.80  ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A  1  95   ? 72.979  21.542  120.822  1.00 53.75  ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A  1  95   ? 72.334  21.003  119.919  1.00 49.99  ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A  1  95   ? 72.503  21.691  122.056  1.00 52.05  ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A  1  96   ? 77.430  18.443  119.863  1.00 34.02  ? 96   THR A N     1 
ATOM   726   C  CA    . THR A  1  96   ? 78.092  17.516  118.943  1.00 30.57  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A  1  96   ? 79.353  16.837  119.493  1.00 24.64  ? 96   THR A C     1 
ATOM   728   O  O     . THR A  1  96   ? 80.125  17.437  120.238  1.00 25.68  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A  1  96   ? 78.436  18.208  117.610  1.00 26.51  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A  1  96   ? 79.293  17.355  116.842  1.00 29.98  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A  1  96   ? 79.139  19.537  117.864  1.00 26.67  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A  1  97   ? 79.579  15.596  119.082  1.00 18.41  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A  1  97   ? 80.748  14.851  119.525  1.00 20.23  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A  1  97   ? 81.283  14.030  118.373  1.00 21.68  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A  1  97   ? 80.515  13.408  117.652  1.00 26.71  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A  1  97   ? 80.393  13.899  120.686  1.00 20.51  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A  1  97   ? 81.473  12.852  120.891  1.00 17.39  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A  1  97   ? 80.188  14.681  121.950  1.00 30.46  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A  1  98   ? 82.597  14.024  118.188  1.00 20.42  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A  1  98   ? 83.183  13.137  117.196  1.00 20.53  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A  1  98   ? 83.965  12.005  117.856  1.00 21.67  ? 98   THR A C     1 
ATOM   742   O  O     . THR A  1  98   ? 85.044  12.222  118.403  1.00 28.42  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A  1  98   ? 84.081  13.905  116.216  1.00 20.67  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A  1  98   ? 83.288  14.863  115.500  1.00 24.98  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A  1  98   ? 84.729  12.945  115.230  1.00 18.55  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A  1  99   ? 83.417  10.794  117.789  1.00 23.50  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A  1  99   ? 84.084  9.620   118.342  1.00 21.29  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A  1  99   ? 85.153  9.140   117.377  1.00 25.03  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A  1  99   ? 84.945  9.135   116.165  1.00 27.43  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A  1  99   ? 83.090  8.484   118.583  1.00 20.70  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A  1  99   ? 82.099  8.531   119.747  1.00 29.87  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A  1  99   ? 81.063  9.623   119.575  1.00 24.91  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A  1  99   ? 81.418  7.178   119.891  1.00 29.65  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A  1  100  ? 86.297  8.732   117.910  1.00 28.54  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A  1  100  ? 87.368  8.205   117.076  1.00 22.21  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A  1  100  ? 87.536  6.720   117.361  1.00 24.49  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A  1  100  ? 87.525  6.300   118.517  1.00 32.46  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A  1  100  ? 88.672  8.955   117.350  1.00 16.56  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A  1  100  ? 88.527  10.478  117.421  1.00 21.48  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A  1  100  ? 89.759  11.119  118.028  1.00 30.64  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A  1  100  ? 88.256  11.062  116.050  1.00 23.79  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A  1  101  ? 87.670  5.920   116.311  1.00 22.61  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A  1  101  ? 87.955  4.504   116.498  1.00 20.38  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A  1  101  ? 89.186  4.117   115.699  1.00 26.94  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A  1  101  ? 89.335  4.507   114.548  1.00 32.86  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A  1  101  ? 86.759  3.645   116.087  1.00 23.71  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A  1  101  ? 86.757  2.170   116.512  1.00 27.98  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A  1  101  ? 85.330  1.678   116.706  1.00 24.50  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A  1  101  ? 87.477  1.284   115.505  1.00 24.77  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A  1  102  ? 90.085  3.374   116.327  1.00 32.53  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A  1  102  ? 91.229  2.814   115.627  1.00 25.57  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A  1  102  ? 91.385  1.381   116.099  1.00 32.92  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A  1  102  ? 91.597  1.131   117.289  1.00 44.75  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A  1  102  ? 92.487  3.627   115.928  1.00 29.53  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A  1  102  ? 93.213  4.132   114.694  1.00 37.12  ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A  1  102  ? 93.856  5.495   114.947  1.00 42.44  ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A  1  102  ? 92.818  6.519   115.404  1.00 37.95  ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A  1  102  ? 93.342  7.917   115.378  1.00 35.48  ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A  1  103  ? 91.264  0.436   115.174  1.00 27.11  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A  1  103  ? 91.303  -0.973  115.544  1.00 27.50  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A  1  103  ? 91.950  -1.787  114.449  1.00 30.25  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A  1  103  ? 91.986  -1.361  113.295  1.00 37.15  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A  1  103  ? 89.902  -1.487  115.823  1.00 27.34  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A  1  104  ? 92.453  -2.963  114.808  1.00 31.45  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A  1  104  ? 93.095  -3.829  113.830  1.00 32.87  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A  1  104  ? 93.222  -5.272  114.293  1.00 29.41  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A  1  104  ? 92.688  -5.655  115.335  1.00 31.84  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A  1  104  ? 94.469  -3.277  113.445  1.00 42.46  ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A  1  104  ? 95.375  -2.968  114.623  1.00 49.33  ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A  1  104  ? 96.685  -2.338  114.190  1.00 68.35  ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A  1  104  ? 97.527  -2.052  115.071  1.00 75.97  ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A  1  104  ? 96.871  -2.128  112.969  1.00 67.73  ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A  1  105  ? 93.919  -6.072  113.492  1.00 30.34  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A  1  105  ? 94.232  -7.441  113.850  1.00 28.22  ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A  1  105  ? 92.979  -8.273  113.957  1.00 33.27  ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A  1  105  ? 91.892  -7.790  113.657  1.00 36.25  ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A  1  106  ? 93.121  -9.526  114.406  1.00 37.01  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A  1  106  ? 92.006  -10.473 114.505  1.00 32.10  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A  1  106  ? 91.076  -10.128 115.660  1.00 37.15  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A  1  106  ? 91.243  -10.670 116.755  1.00 49.76  ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A  1  106  ? 92.702  -11.812 114.783  1.00 33.11  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A  1  106  ? 94.125  -11.608 114.382  1.00 43.92  ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A  1  106  ? 94.412  -10.172 114.684  1.00 43.78  ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A  1  107  ? 90.127  -9.223  115.433  1.00 30.06  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A  1  107  ? 89.223  -8.823  116.511  1.00 32.71  ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A  1  107  ? 87.792  -8.583  116.040  1.00 24.99  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A  1  107  ? 87.527  -8.491  114.846  1.00 22.67  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A  1  107  ? 89.749  -7.571  117.215  1.00 32.43  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A  1  107  ? 89.293  -6.263  116.589  1.00 26.28  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A  1  107  ? 89.756  -5.076  117.417  1.00 29.06  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A  1  107  ? 89.287  -5.193  118.861  1.00 29.94  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A  1  107  ? 89.954  -4.190  119.737  1.00 31.05  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A  1  108  ? 86.865  -8.503  116.986  1.00 19.71  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A  1  108  ? 85.523  -8.053  116.665  1.00 21.02  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A  1  108  ? 85.291  -6.696  117.311  1.00 20.67  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A  1  108  ? 85.094  -6.599  118.519  1.00 26.21  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A  1  108  ? 84.492  -9.064  117.154  1.00 22.59  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A  1  108  ? 84.618  -10.424 116.496  1.00 26.90  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A  1  108  ? 83.728  -11.470 117.142  1.00 51.68  ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A  1  108  ? 82.702  -11.094 117.756  1.00 45.45  ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A  1  108  ? 84.063  -12.670 117.042  1.00 66.74  ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A  1  109  ? 85.269  -5.652  116.493  1.00 17.77  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A  1  109  ? 85.208  -4.296  116.999  1.00 17.40  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A  1  109  ? 83.801  -3.977  117.460  1.00 17.40  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A  1  109  ? 82.858  -3.945  116.654  1.00 21.97  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A  1  109  ? 85.573  -3.290  115.899  1.00 16.72  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A  1  109  ? 85.483  -1.867  116.425  1.00 16.35  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A  1  109  ? 86.952  -3.586  115.358  1.00 19.51  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A  1  110  ? 83.686  -3.714  118.759  1.00 17.53  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A  1  110  ? 82.430  -3.343  119.389  1.00 18.48  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A  1  110  ? 82.448  -1.850  119.683  1.00 20.63  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A  1  110  ? 83.440  -1.170  119.416  1.00 20.79  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A  1  110  ? 82.208  -4.135  120.679  1.00 17.08  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A  1  110  ? 82.393  -5.643  120.535  1.00 18.06  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A  1  110  ? 81.590  -6.204  119.371  1.00 22.89  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A  1  110  ? 81.767  -7.712  119.225  1.00 27.71  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A  1  110  ? 81.021  -8.498  120.251  1.00 34.42  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A  1  111  ? 81.356  -1.342  120.242  1.00 18.85  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A  1  111  ? 81.204  0.094   120.431  1.00 20.17  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A  1  111  ? 82.176  0.623   121.474  1.00 25.78  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A  1  111  ? 82.470  1.819   121.507  1.00 25.32  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A  1  111  ? 79.776  0.426   120.811  1.00 23.72  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A  1  112  ? 82.666  -0.286  122.317  1.00 34.20  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A  1  112  ? 83.637  0.018   123.372  1.00 29.22  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A  1  112  ? 84.935  0.603   122.848  1.00 30.84  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A  1  112  ? 85.470  1.556   123.417  1.00 34.39  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A  1  112  ? 83.982  -1.249  124.144  1.00 22.29  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A  1  112  ? 83.267  -1.382  125.454  1.00 33.37  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A  1  112  ? 83.753  -2.612  126.166  1.00 42.76  ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A  1  112  ? 83.655  -3.785  125.308  1.00 34.23  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A  1  112  ? 82.624  -4.619  125.320  1.00 40.18  ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A  1  112  ? 81.608  -4.399  126.151  1.00 29.90  ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A  1  112  ? 82.613  -5.671  124.510  1.00 41.54  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A  1  113  ? 85.432  0.030   121.756  1.00 25.68  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A  1  113  ? 86.743  0.374   121.218  1.00 23.41  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A  1  113  ? 86.838  1.841   120.796  1.00 25.82  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A  1  113  ? 87.923  2.348   120.499  1.00 30.67  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A  1  113  ? 87.091  -0.559  120.058  1.00 28.27  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A  1  113  ? 86.999  -2.029  120.446  1.00 32.09  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A  1  113  ? 87.945  -2.535  121.085  1.00 46.12  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A  1  113  ? 85.985  -2.680  120.115  1.00 25.41  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A  1  114  ? 85.695  2.514   120.769  1.00 20.78  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A  1  114  ? 85.656  3.949   120.568  1.00 23.13  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A  1  114  ? 86.447  4.630   121.666  1.00 27.26  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A  1  114  ? 86.251  4.337   122.842  1.00 29.72  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A  1  114  ? 84.211  4.440   120.603  1.00 31.34  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A  1  114  ? 83.504  4.337   119.284  1.00 36.68  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A  1  114  ? 82.210  3.853   119.212  1.00 29.62  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A  1  114  ? 84.133  4.736   118.112  1.00 31.70  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A  1  114  ? 81.560  3.764   117.995  1.00 31.18  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A  1  114  ? 83.486  4.647   116.894  1.00 24.94  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A  1  114  ? 82.200  4.160   116.835  1.00 24.14  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A  1  115  ? 87.346  5.532   121.283  1.00 28.65  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A  1  115  ? 88.096  6.307   122.265  1.00 33.76  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A  1  115  ? 87.159  7.223   123.041  1.00 32.55  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A  1  115  ? 86.319  7.902   122.446  1.00 31.25  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A  1  115  ? 89.221  7.111   121.604  1.00 33.79  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A  1  115  ? 90.427  6.295   121.125  1.00 34.32  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A  1  115  ? 91.587  7.204   120.726  1.00 34.85  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A  1  115  ? 90.862  5.284   122.187  1.00 26.57  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A  1  116  ? 87.298  7.231   124.379  1.00 35.51  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A  1  116  ? 86.412  7.963   125.292  1.00 35.64  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A  1  116  ? 86.510  9.473   125.112  1.00 36.18  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A  1  116  ? 87.565  9.980   124.730  1.00 37.72  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A  1  116  ? 86.931  7.559   126.680  1.00 28.04  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A  1  116  ? 87.684  6.286   126.461  1.00 23.26  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A  1  116  ? 88.316  6.464   125.116  1.00 33.53  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A  1  117  ? 85.414  10.179  125.372  1.00 29.63  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A  1  117  ? 85.403  11.636  125.294  1.00 39.89  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A  1  117  ? 84.759  12.218  126.558  1.00 50.23  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A  1  117  ? 83.889  11.587  127.168  1.00 43.13  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A  1  117  ? 84.677  12.138  124.010  1.00 37.46  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A  1  117  ? 84.661  13.666  123.933  1.00 34.66  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A  1  117  ? 85.332  11.560  122.763  1.00 31.20  ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A  1  118  ? 85.210  13.406  126.957  1.00 55.30  ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A  1  118  ? 84.694  14.093  128.138  1.00 47.18  ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A  1  118  ? 83.194  14.359  128.048  1.00 43.25  ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A  1  118  ? 82.715  14.927  127.062  1.00 38.98  ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A  1  118  ? 85.444  15.398  128.351  1.00 50.90  ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A  1  119  ? 82.472  13.947  129.090  1.00 39.04  ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A  1  119  ? 81.022  14.131  129.192  1.00 47.09  ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A  1  119  ? 80.246  13.361  128.124  1.00 45.15  ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A  1  119  ? 79.239  13.848  127.598  1.00 38.31  ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A  1  119  ? 80.643  15.618  129.153  1.00 47.87  ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A  1  119  ? 81.287  16.412  130.270  1.00 54.01  ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A  1  119  ? 81.570  15.822  131.338  1.00 49.15  ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A  1  119  ? 81.506  17.628  130.078  1.00 55.77  ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A  1  120  ? 80.722  12.160  127.807  1.00 36.02  ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A  1  120  ? 80.091  11.319  126.796  1.00 28.32  ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A  1  120  ? 80.101  9.868   127.246  1.00 26.84  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A  1  120  ? 81.139  9.351   127.659  1.00 32.10  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A  1  120  ? 80.831  11.417  125.446  1.00 29.02  ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A  1  120  ? 80.297  10.386  124.460  1.00 22.62  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A  1  120  ? 80.721  12.821  124.876  1.00 28.86  ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A  1  121  ? 78.950  9.208   127.162  1.00 22.85  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A  1  121  ? 78.855  7.807   127.554  1.00 22.74  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A  1  121  ? 78.153  6.969   126.498  1.00 25.66  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A  1  121  ? 77.068  7.322   126.051  1.00 30.46  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A  1  121  ? 78.105  7.673   128.880  1.00 24.60  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A  1  121  ? 77.819  6.232   129.275  1.00 24.08  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A  1  121  ? 76.898  6.121   130.473  1.00 26.62  ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A  1  121  ? 76.403  7.170   130.947  1.00 25.47  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A  1  121  ? 76.672  4.982   130.940  1.00 29.57  ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A  1  122  ? 78.764  5.854   126.111  1.00 22.34  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A  1  122  ? 78.119  4.913   125.200  1.00 19.28  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A  1  122  ? 77.261  3.941   126.007  1.00 23.12  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A  1  122  ? 77.769  3.191   126.840  1.00 28.96  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A  1  122  ? 79.153  4.141   124.344  1.00 19.84  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A  1  122  ? 79.515  4.937   123.090  1.00 19.05  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A  1  122  ? 78.617  2.771   123.933  1.00 19.80  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A  1  122  ? 80.217  6.245   123.356  1.00 21.48  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A  1  123  ? 75.956  3.959   125.759  1.00 21.22  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A  1  123  ? 75.018  3.152   126.535  1.00 24.85  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A  1  123  ? 75.024  1.673   126.142  1.00 26.52  ? 123  MET A C     1 
ATOM   935   O  O     . MET A  1  123  ? 74.675  0.808   126.950  1.00 20.39  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A  1  123  ? 73.604  3.714   126.400  1.00 23.20  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A  1  123  ? 73.519  5.198   126.668  1.00 26.63  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A  1  123  ? 74.021  5.591   128.346  1.00 33.91  ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A  1  123  ? 72.782  4.695   129.279  1.00 32.52  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A  1  124  ? 75.415  1.389   124.901  1.00 24.71  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A  1  124  ? 75.420  0.018   124.391  1.00 22.76  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A  1  124  ? 76.795  -0.429  123.919  1.00 26.28  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A  1  124  ? 77.014  -0.615  122.723  1.00 26.10  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A  1  124  ? 74.392  -0.153  123.264  1.00 23.58  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A  1  124  ? 74.555  0.873   122.150  1.00 23.62  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A  1  124  ? 75.160  1.932   122.338  1.00 23.27  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A  1  124  ? 74.006  0.561   120.983  1.00 19.33  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A  1  125  ? 77.724  -0.627  124.867  1.00 29.78  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A  1  125  ? 79.126  -0.897  124.545  1.00 25.56  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A  1  125  ? 79.310  -2.244  123.853  1.00 24.25  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A  1  125  ? 80.304  -2.445  123.154  1.00 23.69  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A  1  125  ? 79.789  -0.909  125.920  1.00 29.29  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A  1  125  ? 78.718  -1.361  126.834  1.00 25.88  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A  1  125  ? 77.467  -0.733  126.313  1.00 27.21  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A  1  126  ? 78.353  -3.148  124.030  1.00 22.80  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A  1  126  ? 78.444  -4.467  123.411  1.00 30.01  ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A  1  126  ? 77.923  -4.487  121.974  1.00 31.22  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A  1  126  ? 77.921  -5.538  121.323  1.00 36.21  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A  1  126  ? 77.715  -5.519  124.253  1.00 33.41  ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A  1  126  ? 78.572  -6.061  125.385  1.00 49.80  ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A  1  126  ? 78.826  -7.285  125.400  1.00 55.87  ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A  1  126  ? 78.987  -5.268  126.261  1.00 52.01  ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A  1  127  ? 77.481  -3.331  121.483  1.00 21.84  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A  1  127  ? 76.994  -3.234  120.114  1.00 21.69  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A  1  127  ? 78.093  -3.599  119.138  1.00 22.23  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A  1  127  ? 79.160  -2.987  119.141  1.00 21.76  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A  1  127  ? 76.527  -1.817  119.802  1.00 20.96  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A  1  127  ? 76.362  -1.559  118.304  1.00 13.07  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A  1  127  ? 75.166  -2.318  117.769  1.00 15.51  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A  1  127  ? 76.234  -0.081  118.030  1.00 16.68  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A  1  128  ? 77.822  -4.575  118.281  1.00 22.87  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A  1  128  ? 78.817  -4.999  117.309  1.00 22.17  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A  1  128  ? 78.942  -3.989  116.178  1.00 18.92  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A  1  128  ? 77.945  -3.560  115.599  1.00 17.67  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A  1  128  ? 78.474  -6.370  116.743  1.00 22.61  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A  1  128  ? 79.435  -6.842  115.701  1.00 18.97  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A  1  128  ? 80.513  -7.647  115.995  1.00 27.10  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A  1  128  ? 79.486  -6.614  114.367  1.00 22.97  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A  1  128  ? 81.183  -7.903  114.886  1.00 27.72  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A  1  128  ? 80.582  -7.288  113.883  1.00 27.00  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A  1  129  ? 80.173  -3.608  115.869  1.00 17.52  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A  1  129  ? 80.415  -2.692  114.767  1.00 18.65  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A  1  129  ? 81.009  -3.408  113.559  1.00 17.90  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A  1  129  ? 80.405  -3.429  112.491  1.00 19.64  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A  1  129  ? 81.270  -1.493  115.185  1.00 14.90  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A  1  129  ? 80.493  -0.644  116.188  1.00 14.74  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A  1  129  ? 81.658  -0.663  113.968  1.00 14.41  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A  1  129  ? 81.115  0.692   116.448  1.00 21.05  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A  1  130  ? 82.188  -3.994  113.713  1.00 16.18  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A  1  130  ? 82.796  -4.667  112.566  1.00 16.70  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A  1  130  ? 83.512  -5.953  112.953  1.00 21.44  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A  1  130  ? 83.783  -6.185  114.120  1.00 26.87  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A  1  130  ? 83.749  -3.724  111.851  1.00 18.45  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A  1  131  ? 83.803  -6.803  111.978  1.00 19.69  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A  1  131  ? 84.643  -7.964  112.239  1.00 16.04  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A  1  131  ? 85.937  -7.822  111.460  1.00 18.28  ? 131  THR A C     1 
ATOM   997   O  O     . THR A  1  131  ? 85.960  -7.930  110.234  1.00 20.17  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A  1  131  ? 83.937  -9.288  111.882  1.00 17.62  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A  1  131  ? 82.903  -9.550  112.840  1.00 23.70  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A  1  131  ? 84.922  -10.446 111.889  1.00 14.76  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A  1  132  ? 87.019  -7.565  112.179  1.00 20.01  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A  1  132  ? 88.312  -7.404  111.544  1.00 16.87  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A  1  132  ? 89.105  -8.702  111.610  1.00 20.60  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A  1  132  ? 89.139  -9.395  112.633  1.00 22.48  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A  1  132  ? 89.091  -6.234  112.152  1.00 20.00  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A  1  132  ? 88.819  -4.838  111.573  1.00 24.20  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A  1  132  ? 87.386  -4.376  111.816  1.00 20.74  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A  1  132  ? 89.806  -3.813  112.120  1.00 26.50  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A  1  133  ? 89.734  -9.007  110.484  1.00 26.57  ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A  1  133  ? 90.482  -10.229 110.253  1.00 25.75  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A  1  133  ? 91.957  -9.841  110.359  1.00 30.87  ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A  1  133  ? 92.263  -8.665  110.559  1.00 31.29  ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A  1  133  ? 90.116  -10.698 108.841  1.00 25.78  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A  1  133  ? 90.810  -11.904 108.269  1.00 28.27  ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A  1  133  ? 90.779  -11.875 106.750  1.00 31.09  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A  1  133  ? 90.551  -10.788 106.176  1.00 26.66  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A  1  133  ? 90.976  -12.933 106.127  1.00 33.91  ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A  1  134  ? 92.868  -10.804 110.235  1.00 33.85  ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A  1  134  ? 94.297  -10.498 110.235  1.00 36.80  ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A  1  134  ? 94.634  -9.475  109.152  1.00 31.52  ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A  1  134  ? 94.312  -9.668  107.979  1.00 31.94  ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A  1  134  ? 95.125  -11.770 110.016  1.00 43.95  ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A  1  134  ? 95.766  -12.341 111.278  1.00 55.84  ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A  1  134  ? 96.865  -11.452 111.847  1.00 62.15  ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A  1  134  ? 97.132  -11.541 113.067  1.00 55.70  ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A  1  134  ? 97.469  -10.671 111.076  1.00 58.63  ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A  1  135  ? 95.282  -8.387  109.550  1.00 28.15  ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A  1  135  ? 95.669  -7.354  108.608  1.00 29.34  ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A  1  135  ? 94.565  -6.342  108.390  1.00 33.56  ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A  1  135  ? 94.769  -5.295  107.768  1.00 30.76  ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A  1  136  ? 93.382  -6.663  108.901  1.00 34.95  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A  1  136  ? 92.248  -5.766  108.814  1.00 30.88  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A  1  136  ? 92.449  -4.539  109.672  1.00 29.48  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A  1  136  ? 92.720  -4.640  110.865  1.00 31.37  ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A  1  137  ? 92.309  -3.372  109.064  1.00 28.67  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A  1  137  ? 92.504  -2.130  109.784  1.00 31.78  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A  1  137  ? 91.298  -1.223  109.609  1.00 29.45  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A  1  137  ? 90.811  -1.034  108.496  1.00 33.45  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A  1  137  ? 93.792  -1.442  109.320  1.00 41.45  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A  1  137  ? 95.058  -2.213  109.698  1.00 55.12  ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A  1  137  ? 96.324  -1.554  109.170  1.00 65.79  ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A  1  137  ? 96.424  -0.153  109.566  1.00 78.59  ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A  1  137  ? 96.305  0.869   108.724  1.00 87.98  ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A  1  137  ? 96.088  0.643   107.434  1.00 86.81  ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A  1  137  ? 96.409  2.117   109.169  1.00 76.82  ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A  1  138  ? 90.806  -0.683  110.718  1.00 25.97  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A  1  138  ? 89.671  0.226   110.682  1.00 22.75  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A  1  138  ? 89.960  1.509   111.460  1.00 21.02  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A  1  138  ? 90.140  1.482   112.675  1.00 34.85  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A  1  138  ? 88.435  -0.474  111.248  1.00 25.64  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A  1  138  ? 87.091  0.226   111.061  1.00 26.44  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A  1  138  ? 86.830  0.444   109.588  1.00 27.83  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A  1  138  ? 85.967  -0.584  111.685  1.00 26.18  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A  1  139  ? 90.021  2.631   110.758  1.00 15.63  ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A  1  139  ? 90.171  3.917   111.414  0.50 19.50  ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A  1  139  ? 88.991  4.802   111.045  1.00 21.99  ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A  1  139  ? 88.888  5.268   109.914  1.00 28.63  ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A  1  139  ? 91.493  4.566   111.002  0.50 19.78  ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A  1  139  ? 91.706  5.922   111.639  0.50 21.17  ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A  1  139  ? 90.970  6.327   112.538  0.50 22.40  ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A  1  139  ? 92.727  6.631   111.178  0.50 24.07  ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A  1  140  ? 88.116  5.051   112.013  1.00 21.53  ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A  1  140  ? 86.867  5.765   111.771  1.00 19.02  ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A  1  140  ? 86.746  7.033   112.588  1.00 19.65  ? 140  MET A C     1 
ATOM   1065  O  O     . MET A  1  140  ? 87.338  7.155   113.661  1.00 35.26  ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A  1  140  ? 85.672  4.892   112.148  1.00 21.57  ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A  1  140  ? 85.443  3.682   111.286  1.00 22.68  ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A  1  140  ? 83.813  3.008   111.640  1.00 32.68  ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A  1  140  ? 84.002  2.508   113.346  1.00 31.84  ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A  1  141  ? 85.947  7.962   112.080  1.00 15.56  ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A  1  141  ? 85.474  9.093   112.859  1.00 17.83  ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A  1  141  ? 83.961  9.150   112.711  1.00 20.89  ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A  1  141  ? 83.448  9.252   111.599  1.00 21.15  ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A  1  141  ? 86.081  10.400  112.355  1.00 18.02  ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A  1  141  ? 87.569  10.527  112.559  1.00 21.11  ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A  1  141  ? 88.096  11.847  112.043  1.00 35.78  ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A  1  141  ? 87.267  12.728  111.727  1.00 37.04  ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A  1  141  ? 89.333  12.001  111.950  1.00 35.06  ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A  1  142  ? 83.239  9.072   113.821  1.00 16.12  ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A  1  142  ? 81.788  9.133   113.746  1.00 15.91  ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A  1  142  ? 81.226  10.360  114.468  1.00 16.25  ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A  1  142  ? 81.381  10.519  115.677  1.00 20.49  ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A  1  142  ? 81.115  7.809   114.212  1.00 16.99  ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A  1  142  ? 81.567  6.655   113.336  1.00 24.09  ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A  1  142  ? 81.449  7.497   115.643  1.00 22.94  ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A  1  143  ? 80.601  11.247  113.704  1.00 15.44  ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A  1  143  ? 79.974  12.422  114.281  1.00 11.42  ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A  1  143  ? 78.544  12.145  114.738  1.00 17.02  ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A  1  143  ? 77.670  11.768  113.931  1.00 20.42  ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A  1  143  ? 80.004  13.609  113.320  1.00 11.43  ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A  1  143  ? 79.144  14.755  113.802  1.00 12.19  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A  1  143  ? 79.355  16.034  113.026  1.00 14.06  ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A  1  143  ? 78.185  16.894  113.158  1.00 17.35  ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A  1  143  ? 78.144  18.176  112.816  1.00 19.07  ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A  1  143  ? 79.223  18.773  112.326  1.00 22.97  ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A  1  143  ? 77.019  18.860  112.974  1.00 15.06  ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A  1  144  ? 78.347  12.350  116.042  1.00 18.93  ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A  1  144  ? 77.076  12.232  116.745  1.00 13.16  ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A  1  144  ? 76.569  13.629  117.107  1.00 14.63  ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A  1  144  ? 77.345  14.472  117.556  1.00 18.31  ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A  1  144  ? 77.281  11.450  118.059  1.00 15.62  ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A  1  144  ? 75.991  11.366  118.850  1.00 15.97  ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A  1  144  ? 77.846  10.063  117.781  1.00 14.93  ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A  1  145  ? 75.274  13.876  116.913  1.00 17.16  ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A  1  145  ? 74.668  15.170  117.237  1.00 17.23  ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A  1  145  ? 73.420  15.005  118.087  1.00 19.32  ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A  1  145  ? 72.799  13.941  118.092  1.00 17.79  ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A  1  145  ? 74.246  15.914  115.965  1.00 19.61  ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A  1  145  ? 75.403  16.566  115.246  1.00 24.84  ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A  1  145  ? 75.599  17.788  115.415  1.00 32.79  ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A  1  145  ? 76.101  15.862  114.493  1.00 26.46  ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A  1  146  ? 73.047  16.071  118.793  1.00 22.42  ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A  1  146  ? 71.719  16.169  119.383  1.00 16.71  ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A  1  146  ? 70.780  16.555  118.262  1.00 15.77  ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A  1  146  ? 71.177  17.237  117.319  1.00 18.68  ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A  1  146  ? 71.662  17.253  120.457  1.00 26.59  ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A  1  146  ? 72.167  16.837  121.819  1.00 35.35  ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A  1  146  ? 72.043  17.984  122.821  1.00 37.29  ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A  1  146  ? 72.754  17.700  124.065  1.00 32.88  ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A  1  146  ? 72.280  16.919  125.029  1.00 33.66  ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A  1  146  ? 71.093  16.345  124.887  1.00 39.26  ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A  1  146  ? 72.988  16.708  126.130  1.00 32.37  ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A  1  147  ? 69.530  16.133  118.369  1.00 17.43  ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A  1  147  ? 68.547  16.439  117.349  1.00 16.32  ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A  1  147  ? 67.205  15.830  117.688  1.00 14.43  ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A  1  147  ? 67.044  15.186  118.724  1.00 14.36  ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A  1  148  ? 66.233  16.020  116.810  1.00 15.30  ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A  1  148  ? 64.895  15.538  117.093  1.00 16.79  ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A  1  148  ? 64.264  14.866  115.873  1.00 15.57  ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A  1  148  ? 64.422  15.317  114.735  1.00 11.88  ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A  1  148  ? 63.993  16.673  117.661  1.00 13.30  ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A  1  148  ? 63.510  17.604  116.552  1.00 17.86  ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A  1  148  ? 62.828  16.097  118.451  1.00 9.99   ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A  1  149  ? 63.571  13.762  116.129  1.00 15.76  ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A  1  149  ? 62.836  13.062  115.099  1.00 13.87  ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A  1  149  ? 63.724  12.275  114.163  1.00 17.42  ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A  1  149  ? 64.877  11.967  114.475  1.00 16.95  ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A  1  150  ? 63.168  11.942  113.005  1.00 19.61  ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A  1  150  ? 63.889  11.210  111.977  1.00 15.20  ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A  1  150  ? 64.263  12.196  110.887  1.00 14.21  ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A  1  150  ? 63.395  12.693  110.166  1.00 15.15  ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A  1  150  ? 63.000  10.087  111.422  1.00 13.90  ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A  1  150  ? 63.485  9.421   110.149  1.00 12.20  ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A  1  150  ? 64.557  8.535   110.163  1.00 11.02  ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A  1  150  ? 62.848  9.653   108.939  1.00 12.03  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A  1  150  ? 64.993  7.915   109.003  1.00 9.88   ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A  1  150  ? 63.277  9.039   107.774  1.00 14.40  ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A  1  150  ? 64.349  8.170   107.811  1.00 11.70  ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A  1  150  ? 64.772  7.558   106.652  1.00 9.71   ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A  1  151  ? 65.553  12.501  110.794  1.00 13.08  ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A  1  151  ? 66.054  13.365  109.737  1.00 12.00  ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A  1  151  ? 66.960  12.550  108.831  1.00 14.05  ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A  1  151  ? 68.068  12.184  109.225  1.00 13.04  ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A  1  151  ? 66.831  14.551  110.294  1.00 8.25   ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A  1  151  ? 67.223  15.479  109.171  1.00 10.09  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A  1  151  ? 65.994  15.285  111.321  1.00 9.84   ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A  1  152  ? 66.480  12.255  107.612  1.00 17.21  ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A  1  152  ? 67.176  11.367  106.682  1.00 13.53  ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A  1  152  ? 68.439  12.023  106.180  1.00 13.93  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A  1  152  ? 68.521  13.250  106.148  1.00 13.55  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A  1  152  ? 66.176  11.207  105.532  1.00 13.48  ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A  1  152  ? 64.861  11.657  106.083  1.00 13.00  ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A  1  152  ? 65.208  12.735  107.049  1.00 17.57  ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A  1  153  ? 69.405  11.202  105.790  1.00 15.70  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A  1  153  ? 70.706  11.679  105.355  1.00 15.13  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A  1  153  ? 70.607  12.660  104.190  1.00 16.67  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A  1  153  ? 71.344  13.642  104.144  1.00 17.68  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A  1  153  ? 71.607  10.502  104.999  1.00 13.89  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A  1  154  ? 69.692  12.400  103.261  1.00 16.83  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A  1  154  ? 69.496  13.282  102.112  1.00 20.74  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A  1  154  ? 69.214  14.706  102.564  1.00 16.93  ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A  1  154  ? 69.622  15.666  101.914  1.00 16.00  ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A  1  154  ? 68.339  12.795  101.229  1.00 22.69  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A  1  154  ? 68.531  11.407  100.629  1.00 36.05  ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A  1  154  ? 68.290  10.295  101.638  1.00 50.70  ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A  1  154  ? 67.301  10.388  102.398  1.00 52.43  ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A  1  154  ? 69.093  9.336   101.681  1.00 56.48  ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A  1  155  ? 68.512  14.827  103.685  1.00 16.07  ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A  1  155  ? 68.068  16.119  104.185  1.00 18.26  ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A  1  155  ? 69.156  16.921  104.907  1.00 22.80  ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A  1  155  ? 69.337  18.107  104.630  1.00 25.42  ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A  1  155  ? 66.845  15.937  105.088  1.00 16.51  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A  1  155  ? 66.255  17.237  105.609  1.00 30.76  ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A  1  155  ? 65.889  18.172  104.467  1.00 47.16  ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A  1  155  ? 65.387  19.516  104.982  1.00 50.07  ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A  1  155  ? 65.006  20.428  103.862  1.00 49.64  ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A  1  156  ? 69.866  16.287  105.839  1.00 20.97  ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A  1  156  ? 70.885  16.995  106.622  1.00 15.43  ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A  1  156  ? 72.250  17.133  105.940  1.00 17.67  ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A  1  156  ? 72.935  18.142  106.116  1.00 19.85  ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A  1  156  ? 71.006  16.437  108.047  1.00 11.07  ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A  1  156  ? 71.592  15.062  108.131  1.00 11.37  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A  1  156  ? 72.940  14.816  107.985  1.00 13.46  ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A  1  156  ? 71.019  13.864  108.394  1.00 11.19  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A  1  156  ? 73.169  13.524  108.134  1.00 11.80  ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A  1  156  ? 72.019  12.923  108.381  1.00 11.13  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A  1  157  ? 72.636  16.113  105.176  1.00 21.48  ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A  1  157  ? 73.856  16.131  104.378  1.00 19.02  ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A  1  157  ? 75.139  16.470  105.117  1.00 18.64  ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A  1  157  ? 76.077  16.995  104.527  1.00 26.35  ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A  1  158  ? 75.188  16.151  106.405  1.00 20.99  ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A  1  158  ? 76.307  16.546  107.257  1.00 25.35  ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A  1  158  ? 77.605  15.827  106.893  1.00 31.40  ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A  1  158  ? 77.666  14.593  106.882  1.00 29.86  ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A  1  158  ? 75.984  16.259  108.738  1.00 23.09  ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A  1  158  ? 74.843  17.159  109.211  1.00 17.31  ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A  1  158  ? 77.227  16.419  109.615  1.00 16.14  ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A  1  158  ? 74.183  16.666  110.469  1.00 18.06  ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A  1  159  ? 78.641  16.609  106.600  1.00 32.35  ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A  1  159  ? 79.970  16.062  106.342  1.00 31.42  ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A  1  159  ? 81.049  16.900  107.022  1.00 37.34  ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A  1  159  ? 81.146  18.111  106.800  1.00 38.95  ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A  1  159  ? 80.231  15.947  104.834  1.00 24.43  ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A  1  159  ? 79.460  14.814  104.175  1.00 21.53  ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A  1  159  ? 79.296  15.004  102.674  1.00 25.73  ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A  1  159  ? 80.520  14.543  101.899  1.00 23.89  ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A  1  159  ? 80.214  14.375  100.447  1.00 25.06  ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A  1  160  ? 81.843  16.248  107.867  1.00 34.59  ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A  1  160  ? 82.980  16.892  108.516  1.00 34.75  ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A  1  160  ? 84.177  16.982  107.568  1.00 29.63  ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A  1  160  ? 85.063  17.817  107.745  1.00 34.68  ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A  1  160  ? 83.360  16.150  109.802  1.00 45.77  ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A  1  160  ? 82.593  16.651  111.018  1.00 46.18  ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A  1  160  ? 81.693  17.504  110.845  1.00 38.58  ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A  1  160  ? 82.889  16.187  112.144  1.00 39.47  ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A  1  161  ? 84.201  16.116  106.562  1.00 28.46  ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A  1  161  ? 85.231  16.186  105.532  1.00 30.69  ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A  1  161  ? 84.762  15.613  104.186  1.00 30.81  ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A  1  161  ? 83.635  15.129  104.063  1.00 33.43  ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A  1  161  ? 86.524  15.510  106.007  1.00 29.35  ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A  1  161  ? 86.391  14.034  106.334  1.00 26.36  ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A  1  161  ? 87.758  13.420  106.595  1.00 31.16  ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A  1  161  ? 88.271  13.774  107.915  1.00 46.72  ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A  1  161  ? 89.493  13.478  108.350  1.00 48.15  ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A  1  161  ? 90.339  12.824  107.563  1.00 36.81  ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A  1  161  ? 89.870  13.840  109.572  1.00 41.60  ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A  1  162  ? 85.637  15.676  103.187  1.00 26.19  ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A  1  162  ? 85.313  15.270  101.824  1.00 25.27  ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A  1  162  ? 84.771  13.845  101.716  1.00 21.76  ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A  1  162  ? 83.743  13.612  101.084  1.00 25.48  ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A  1  162  ? 86.546  15.398  100.908  1.00 32.35  ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A  1  162  ? 87.104  16.822  100.963  1.00 24.37  ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A  1  162  ? 86.206  14.987  99.477   1.00 23.81  ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A  1  162  ? 86.126  17.877  100.512  1.00 27.69  ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A  1  163  ? 85.457  12.897  102.339  1.00 19.67  ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A  1  163  ? 85.091  11.490  102.214  1.00 21.72  ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A  1  163  ? 84.072  11.033  103.250  1.00 23.55  ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A  1  163  ? 83.778  9.843   103.349  1.00 21.46  ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A  1  163  ? 86.328  10.593  102.284  1.00 26.42  ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A  1  163  ? 87.322  10.885  101.182  1.00 37.21  ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A  1  163  ? 86.973  11.462  100.146  1.00 34.53  ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A  1  163  ? 88.574  10.483  101.396  1.00 37.18  ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A  1  164  ? 83.561  11.969  104.042  1.00 25.55  ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A  1  164  ? 82.570  11.638  105.059  1.00 20.74  ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A  1  164  ? 81.249  11.209  104.426  1.00 22.40  ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A  1  164  ? 80.834  11.744  103.397  1.00 22.01  ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A  1  164  ? 82.355  12.813  105.994  1.00 26.30  ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A  1  165  ? 80.592  10.239  105.052  1.00 19.35  ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A  1  165  ? 79.330  9.717   104.554  1.00 13.09  ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A  1  165  ? 78.173  10.147  105.455  1.00 12.26  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A  1  165  ? 78.076  9.686   106.593  1.00 12.63  ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A  1  165  ? 79.382  8.186   104.488  1.00 12.54  ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A  1  165  ? 80.638  7.738   103.740  1.00 12.28  ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A  1  165  ? 78.128  7.630   103.829  1.00 21.43  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A  1  165  ? 80.861  6.244   103.755  1.00 12.21  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A  1  166  ? 77.302  11.045  104.957  1.00 11.75  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A  1  166  ? 76.155  11.489  105.754  1.00 12.28  ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A  1  166  ? 75.303  10.297  106.151  1.00 13.61  ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A  1  166  ? 75.080  9.408   105.331  1.00 19.31  ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A  1  166  ? 75.388  12.393  104.789  1.00 10.13  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A  1  166  ? 76.404  12.881  103.853  1.00 13.20  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A  1  166  ? 77.355  11.734  103.660  1.00 15.77  ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A  1  167  ? 74.850  10.273  107.398  1.00 11.45  ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A  1  167  ? 74.112  9.131   107.910  1.00 11.04  ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A  1  167  ? 72.706  9.521   108.356  1.00 13.39  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A  1  167  ? 72.519  10.569  108.978  1.00 11.93  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A  1  167  ? 74.873  8.478   109.076  1.00 10.48  ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A  1  167  ? 74.060  7.352   109.697  1.00 10.14  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A  1  167  ? 76.218  7.964   108.592  1.00 11.00  ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A  1  168  ? 71.726  8.682   108.012  1.00 16.16  ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A  1  168  ? 70.355  8.822   108.504  1.00 14.76  ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A  1  168  ? 70.348  8.925   110.020  1.00 11.28  ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A  1  168  ? 70.960  8.110   110.711  1.00 11.10  ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A  1  168  ? 69.505  7.613   108.108  1.00 16.83  ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A  1  168  ? 69.208  7.559   106.626  1.00 19.77  ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A  1  168  ? 69.111  8.629   105.991  1.00 23.48  ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A  1  168  ? 69.062  6.436   106.100  1.00 21.57  ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A  1  169  ? 69.644  9.922   110.535  1.00 10.16  ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A  1  169  ? 69.609  10.147  111.968  1.00 10.96  ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A  1  169  ? 68.220  9.912   112.554  1.00 10.96  ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A  1  169  ? 67.291  10.686  112.312  1.00 11.35  ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A  1  169  ? 70.087  11.551  112.283  1.00 13.84  ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A  1  170  ? 68.086  8.852   113.343  1.00 9.08   ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A  1  170  ? 66.859  8.645   114.082  1.00 9.75   ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A  1  170  ? 67.184  9.143   115.466  1.00 13.94  ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A  1  170  ? 67.841  8.455   116.248  1.00 19.13  ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A  1  170  ? 66.526  7.153   114.201  1.00 9.39   ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A  1  170  ? 65.188  6.961   114.903  1.00 11.22  ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A  1  170  ? 66.532  6.485   112.833  1.00 10.37  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A  1  171  ? 66.685  10.326  115.793  1.00 14.43  ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A  1  171  ? 67.155  11.006  116.991  1.00 15.01  ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A  1  171  ? 66.506  10.495  118.272  1.00 18.39  ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A  1  171  ? 67.194  10.290  119.273  1.00 18.40  ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A  1  171  ? 67.010  12.524  116.849  1.00 12.13  ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A  1  171  ? 68.087  13.152  116.013  1.00 13.47  ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A  1  171  ? 69.420  13.023  116.370  1.00 13.96  ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A  1  171  ? 67.775  13.871  114.874  1.00 15.26  ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A  1  171  ? 70.419  13.598  115.606  1.00 11.63  ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A  1  171  ? 68.773  14.448  114.107  1.00 11.70  ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A  1  171  ? 70.094  14.313  114.476  1.00 8.74   ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A  1  172  ? 65.198  10.253  118.211  1.00 18.21  ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A  1  172  ? 64.397  9.969   119.395  1.00 15.23  ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A  1  172  ? 65.010  8.873   120.251  1.00 15.28  ? 172  SER A C     1 
ATOM   1314  O  O     . SER A  1  172  ? 65.318  7.790   119.759  1.00 18.03  ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A  1  172  ? 62.963  9.593   119.006  1.00 15.18  ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A  1  172  ? 62.091  9.646   120.127  1.00 15.70  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A  1  173  ? 65.234  9.184   121.534  1.00 15.13  ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A  1  173  ? 65.706  8.252   122.558  1.00 15.60  ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A  1  173  ? 64.601  7.278   122.925  1.00 15.21  ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A  1  173  ? 64.867  6.253   123.551  1.00 14.95  ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A  1  173  ? 66.021  9.167   123.737  1.00 16.78  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A  1  173  ? 65.053  10.284  123.586  1.00 17.06  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A  1  173  ? 64.913  10.505  122.106  1.00 16.56  ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A  1  174  ? 63.371  7.604   122.537  1.00 15.71  ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A  1  174  ? 62.210  6.822   122.943  1.00 15.69  ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A  1  174  ? 61.960  5.666   121.982  1.00 14.88  ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A  1  174  ? 61.643  5.878   120.808  1.00 12.00  ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A  1  174  ? 60.956  7.698   122.986  1.00 11.54  ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A  1  174  ? 59.797  6.926   123.580  1.00 12.26  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A  1  174  ? 61.230  8.952   123.790  1.00 13.19  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A  1  175  ? 62.119  4.446   122.495  1.00 12.65  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A  1  175  ? 61.918  3.240   121.704  1.00 8.34   ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A  1  175  ? 60.456  2.833   121.593  1.00 7.12   ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A  1  175  ? 59.991  2.482   120.511  1.00 6.61   ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A  1  175  ? 62.739  2.082   122.266  1.00 7.06   ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A  1  175  ? 64.230  2.291   122.173  1.00 12.56  ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A  1  175  ? 64.991  0.969   122.295  1.00 23.45  ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A  1  175  ? 66.437  1.170   122.198  1.00 36.68  ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A  1  175  ? 67.094  1.392   121.059  1.00 44.52  ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A  1  175  ? 66.444  1.441   119.898  1.00 39.29  ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A  1  175  ? 68.409  1.568   121.079  1.00 34.57  ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A  1  176  ? 59.733  2.862   122.709  1.00 9.63   ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A  1  176  ? 58.328  2.449   122.683  1.00 7.80   ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A  1  176  ? 57.496  3.136   123.757  1.00 9.97   ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A  1  176  ? 57.983  3.395   124.854  1.00 12.34  ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A  1  176  ? 58.208  0.925   122.806  1.00 7.38   ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A  1  176  ? 56.786  0.397   122.715  1.00 9.32   ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A  1  176  ? 56.716  -0.939  121.974  1.00 14.36  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A  1  176  ? 57.607  -1.934  122.557  1.00 21.50  ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A  1  176  ? 57.272  -2.753  123.549  1.00 28.02  ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A  1  176  ? 56.053  -2.708  124.075  1.00 20.27  ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A  1  176  ? 58.159  -3.620  124.018  1.00 36.90  ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A  1  177  ? 56.242  3.440   123.438  1.00 10.28  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A  1  177  ? 55.320  3.998   124.420  1.00 7.67   ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A  1  177  ? 53.945  3.342   124.339  1.00 9.83   ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A  1  177  ? 53.311  3.319   123.282  1.00 8.84   ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A  1  177  ? 55.139  5.514   124.246  1.00 7.67   ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A  1  177  ? 54.048  6.015   125.168  1.00 9.18   ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A  1  177  ? 56.435  6.244   124.528  1.00 10.45  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A  1  178  ? 53.485  2.809   125.464  1.00 11.78  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A  1  178  ? 52.125  2.302   125.551  1.00 9.38   ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A  1  178  ? 51.473  2.926   126.768  1.00 11.15  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A  1  178  ? 52.164  3.386   127.666  1.00 12.00  ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A  1  178  ? 52.131  0.796   125.674  1.00 9.33   ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A  1  179  ? 50.147  2.968   126.800  1.00 13.81  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A  1  179  ? 49.465  3.356   128.028  1.00 8.94   ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A  1  179  ? 48.213  2.538   128.295  1.00 11.22  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A  1  179  ? 47.367  2.347   127.424  1.00 9.12   ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A  1  179  ? 49.179  4.856   128.089  1.00 8.63   ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A  1  179  ? 48.104  5.314   127.155  1.00 8.10   ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A  1  179  ? 46.790  5.378   127.569  1.00 9.73   ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A  1  179  ? 48.412  5.706   125.869  1.00 9.61   ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A  1  179  ? 45.798  5.808   126.712  1.00 10.10  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A  1  179  ? 47.425  6.136   125.008  1.00 12.15  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A  1  179  ? 46.118  6.190   125.431  1.00 10.60  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A  1  180  ? 48.125  2.054   129.525  1.00 17.58  ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A  1  180  ? 47.033  1.217   129.979  1.00 13.52  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A  1  180  ? 46.022  2.103   130.698  1.00 13.02  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A  1  180  ? 46.400  2.988   131.466  1.00 12.46  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A  1  180  ? 47.592  0.173   130.944  1.00 17.32  ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A  1  180  ? 46.631  -0.924  131.337  1.00 26.22  ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A  1  180  ? 46.740  -2.137  130.441  1.00 31.67  ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A  1  180  ? 47.508  -2.144  129.475  1.00 30.93  ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A  1  180  ? 45.971  -3.177  130.758  1.00 29.74  ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A  1  181  ? 44.742  1.891   130.424  1.00 12.26  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A  1  181  ? 43.693  2.565   131.177  1.00 13.41  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A  1  181  ? 42.818  1.520   131.850  1.00 17.30  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A  1  181  ? 42.070  0.793   131.184  1.00 13.44  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A  1  181  ? 42.823  3.459   130.283  1.00 9.98   ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A  1  181  ? 41.639  3.992   131.070  1.00 10.12  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A  1  181  ? 43.645  4.598   129.720  1.00 8.70   ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A  1  182  ? 42.907  1.450   133.176  1.00 21.46  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A  1  182  ? 42.192  0.414   133.919  1.00 22.40  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A  1  182  ? 41.099  0.997   134.794  1.00 18.61  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A  1  182  ? 41.201  2.134   135.247  1.00 17.64  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A  1  182  ? 43.155  -0.407  134.775  1.00 19.80  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A  1  182  ? 44.041  -1.338  133.990  1.00 21.64  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A  1  182  ? 45.033  -2.063  134.873  1.00 39.98  ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A  1  182  ? 45.017  -3.312  134.876  1.00 48.83  ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A  1  182  ? 45.831  -1.387  135.562  1.00 37.76  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A  1  183  ? 40.058  0.205   135.034  1.00 18.05  ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A  1  183  ? 38.948  0.637   135.871  1.00 21.07  ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A  1  183  ? 39.389  0.857   137.316  1.00 19.11  ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A  1  183  ? 40.217  0.115   137.843  1.00 17.79  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A  1  183  ? 37.805  -0.376  135.808  1.00 20.05  ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A  1  183  ? 36.447  0.274   135.983  1.00 27.62  ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A  1  183  ? 36.374  1.518   135.882  1.00 27.60  ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A  1  183  ? 35.454  -0.454  136.212  1.00 33.69  ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A  1  184  ? 38.841  1.893   137.941  1.00 19.89  ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A  1  184  ? 39.148  2.228   139.331  1.00 25.76  ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A  1  184  ? 38.009  3.045   139.942  1.00 32.70  ? 184  THR A C     1 
ATOM   1412  O  O     . THR A  1  184  ? 37.125  3.540   139.222  1.00 35.83  ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A  1  184  ? 40.488  2.993   139.474  1.00 19.30  ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A  1  184  ? 40.810  3.147   140.858  1.00 18.20  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A  1  184  ? 40.396  4.367   138.844  1.00 22.48  ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A  1  185  ? 38.023  3.166   141.267  1.00 33.13  ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A  1  185  ? 36.977  3.886   141.989  1.00 41.75  ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A  1  185  ? 37.508  4.553   143.254  1.00 41.63  ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A  1  185  ? 38.481  4.088   143.853  1.00 31.88  ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A  1  185  ? 35.830  2.941   142.356  1.00 49.84  ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A  1  185  ? 36.240  1.782   143.261  1.00 53.00  ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A  1  185  ? 35.025  1.087   143.859  1.00 67.91  ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A  1  185  ? 34.300  1.962   144.778  1.00 79.94  ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A  1  185  ? 33.131  1.662   145.339  1.00 79.35  ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A  1  185  ? 32.540  0.503   145.074  1.00 70.56  ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A  1  185  ? 32.552  2.527   146.163  1.00 68.49  ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A  1  186  ? 36.875  5.659   143.638  1.00 41.95  ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A  1  186  ? 37.169  6.322   144.905  1.00 41.47  ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A  1  186  ? 35.891  6.782   145.597  1.00 48.48  ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A  1  186  ? 35.153  7.610   145.062  1.00 46.10  ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A  1  186  ? 38.091  7.516   144.689  1.00 39.15  ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A  1  186  ? 38.524  8.215   145.975  1.00 46.54  ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A  1  186  ? 39.464  7.325   146.771  1.00 46.23  ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A  1  186  ? 39.171  9.554   145.662  1.00 50.89  ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A  1  187  ? 35.647  6.264   146.795  1.00 50.50  ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A  1  187  ? 34.424  6.568   147.511  1.00 48.68  ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A  1  187  ? 33.227  5.929   146.835  1.00 60.40  ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A  1  187  ? 33.275  4.760   146.441  1.00 52.83  ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A  1  188  ? 32.153  6.701   146.692  1.00 60.79  ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A  1  188  ? 30.920  6.206   146.083  1.00 66.46  ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A  1  188  ? 30.996  6.246   144.555  1.00 58.13  ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A  1  188  ? 30.144  5.679   143.866  1.00 53.91  ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A  1  188  ? 29.719  7.023   146.576  1.00 71.98  ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A  1  188  ? 29.586  7.106   148.098  1.00 75.42  ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A  1  188  ? 29.003  5.845   148.719  1.00 79.42  ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A  1  188  ? 27.936  5.374   148.317  1.00 70.71  ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A  1  188  ? 29.704  5.293   149.705  1.00 69.44  ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A  1  189  ? 32.025  6.915   144.040  1.00 53.18  ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A  1  189  ? 32.228  7.083   142.601  1.00 47.84  ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A  1  189  ? 32.670  5.799   141.907  1.00 47.79  ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A  1  189  ? 33.454  5.023   142.453  1.00 53.34  ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A  1  189  ? 33.284  8.156   142.341  1.00 39.21  ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A  1  189  ? 32.810  9.583   142.487  1.00 32.00  ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A  1  189  ? 33.990  10.524  142.364  1.00 26.51  ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A  1  189  ? 33.607  11.867  141.943  1.00 46.80  ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A  1  189  ? 33.350  12.215  140.684  1.00 50.26  ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A  1  189  ? 33.018  13.468  140.398  1.00 52.16  ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A  1  189  ? 33.419  11.314  139.710  1.00 41.03  ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A  1  190  ? 32.178  5.591   140.691  1.00 36.70  ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A  1  190  ? 32.608  4.457   139.883  1.00 44.83  ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A  1  190  ? 33.033  4.910   138.490  1.00 42.85  ? 190  THR A C     1 
ATOM   1462  O  O     . THR A  1  190  ? 33.004  6.106   138.181  1.00 36.74  ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A  1  190  ? 31.499  3.394   139.744  1.00 46.35  ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A  1  190  ? 30.326  3.991   139.175  1.00 42.26  ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A  1  190  ? 31.161  2.794   141.100  1.00 48.61  ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A  1  191  ? 33.437  3.945   137.666  1.00 33.25  ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A  1  191  ? 33.772  4.194   136.269  1.00 31.32  ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A  1  191  ? 34.929  5.190   136.123  1.00 27.29  ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A  1  191  ? 34.923  6.023   135.220  1.00 27.99  ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A  1  191  ? 32.528  4.690   135.514  1.00 37.25  ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A  1  191  ? 32.619  4.476   134.003  1.00 49.39  ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A  1  191  ? 33.724  4.197   133.485  1.00 51.38  ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A  1  191  ? 31.572  4.604   133.328  1.00 40.39  ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A  1  192  ? 35.929  5.102   136.996  1.00 25.07  ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A  1  192  ? 37.036  6.054   136.931  1.00 20.00  ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A  1  192  ? 38.251  5.448   136.240  1.00 22.93  ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A  1  192  ? 38.475  4.239   136.305  1.00 23.55  ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A  1  192  ? 37.416  6.573   138.319  1.00 23.04  ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A  1  192  ? 36.374  7.364   139.109  1.00 21.71  ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A  1  192  ? 37.002  7.882   140.390  1.00 26.16  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A  1  192  ? 35.813  8.506   138.284  1.00 18.59  ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A  1  193  ? 39.014  6.288   135.549  1.00 19.95  ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A  1  193  ? 40.198  5.828   134.837  1.00 14.15  ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A  1  193  ? 41.428  5.838   135.735  1.00 13.46  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A  1  193  ? 41.628  6.755   136.524  1.00 17.52  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A  1  193  ? 40.479  6.702   133.608  1.00 14.07  ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A  1  193  ? 39.369  6.652   132.565  1.00 15.32  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A  1  193  ? 39.300  7.596   131.751  1.00 14.17  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A  1  193  ? 38.576  5.686   132.543  1.00 18.44  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A  1  194  ? 42.247  4.805   135.601  1.00 16.77  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A  1  194  ? 43.578  4.772   136.184  1.00 13.52  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A  1  194  ? 44.552  4.675   135.022  1.00 18.13  ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A  1  194  ? 44.438  3.769   134.184  1.00 18.93  ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A  1  194  ? 43.720  3.550   137.080  1.00 13.66  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A  1  194  ? 45.137  3.228   137.510  1.00 12.47  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A  1  194  ? 45.196  1.792   137.981  1.00 12.92  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A  1  194  ? 46.587  1.368   138.361  1.00 13.98  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A  1  194  ? 46.601  -0.088  138.675  1.00 20.82  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A  1  195  ? 45.502  5.604   134.960  1.00 13.66  ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A  1  195  ? 46.372  5.691   133.794  1.00 11.83  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A  1  195  ? 47.777  5.181   134.056  1.00 11.27  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A  1  195  ? 48.392  5.551   135.037  1.00 13.85  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A  1  195  ? 46.444  7.134   133.309  1.00 11.65  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A  1  195  ? 47.429  7.365   132.166  1.00 12.96  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A  1  195  ? 47.059  6.499   130.968  1.00 12.42  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A  1  195  ? 47.461  8.837   131.790  1.00 13.79  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A  1  196  ? 48.298  4.344   133.168  1.00 14.82  ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A  1  196  ? 49.683  3.900   133.301  1.00 15.00  ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A  1  196  ? 50.486  4.067   132.015  1.00 15.55  ? 196  THR A C     1 
ATOM   1510  O  O     . THR A  1  196  ? 50.215  3.402   131.022  1.00 19.73  ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A  1  196  ? 49.761  2.434   133.721  1.00 15.11  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A  1  196  ? 48.840  2.194   134.790  1.00 19.57  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A  1  196  ? 51.166  2.108   134.184  1.00 20.23  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A  1  197  ? 51.484  4.942   132.042  1.00 11.88  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A  1  197  ? 52.349  5.153   130.892  1.00 11.59  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A  1  197  ? 53.592  4.282   130.986  1.00 14.32  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A  1  197  ? 54.434  4.469   131.867  1.00 17.30  ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A  1  197  ? 52.757  6.620   130.788  1.00 11.77  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A  1  197  ? 51.775  7.535   130.065  1.00 13.50  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A  1  197  ? 52.131  8.991   130.298  1.00 12.50  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A  1  197  ? 51.778  7.219   128.582  1.00 11.02  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A  1  198  ? 53.693  3.321   130.076  1.00 13.46  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A  1  198  ? 54.863  2.470   129.975  1.00 13.30  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A  1  198  ? 55.757  3.021   128.885  1.00 12.60  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A  1  198  ? 55.340  3.155   127.728  1.00 12.36  ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A  1  198  ? 54.456  1.035   129.662  1.00 14.09  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A  1  198  ? 53.331  0.540   130.536  1.00 15.19  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A  1  198  ? 53.434  -0.938  130.755  1.00 16.18  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A  1  198  ? 52.929  -1.716  129.635  1.00 23.15  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A  1  198  ? 53.403  -2.907  129.291  1.00 29.32  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A  1  198  ? 52.881  -3.555  128.258  1.00 31.65  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A  1  198  ? 54.408  -3.446  129.976  1.00 21.66  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A  1  199  ? 56.986  3.350   129.269  1.00 13.80  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A  1  199  ? 57.919  4.022   128.379  1.00 10.48  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A  1  199  ? 59.253  3.298   128.338  1.00 13.69  ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A  1  199  ? 59.919  3.158   129.366  1.00 15.26  ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A  1  199  ? 58.180  5.458   128.843  1.00 8.85   ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A  1  199  ? 56.869  6.235   128.936  1.00 9.85   ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A  1  199  ? 59.144  6.144   127.907  1.00 11.35  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A  1  199  ? 57.019  7.597   129.540  1.00 9.20   ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A  1  200  ? 59.629  2.832   127.149  1.00 12.43  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A  1  200  ? 60.946  2.257   126.919  1.00 11.13  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A  1  200  ? 61.804  3.225   126.121  1.00 11.90  ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A  1  200  ? 61.372  3.733   125.076  1.00 12.04  ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A  1  200  ? 60.851  0.988   126.094  1.00 9.87   ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A  1  200  ? 60.177  -0.175  126.707  1.00 11.36  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A  1  200  ? 60.777  -1.279  127.232  1.00 11.93  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A  1  200  ? 58.767  -0.402  126.794  1.00 14.66  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A  1  200  ? 59.828  -2.173  127.662  1.00 16.34  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A  1  200  ? 58.584  -1.660  127.403  1.00 16.99  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A  1  200  ? 57.640  0.339   126.422  1.00 13.87  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A  1  200  ? 57.319  -2.195  127.653  1.00 17.27  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A  1  200  ? 56.384  -0.193  126.670  1.00 15.18  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A  1  200  ? 56.235  -1.448  127.281  1.00 17.59  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A  1  201  ? 63.025  3.450   126.602  1.00 15.15  ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A  1  201  ? 64.020  4.232   125.880  1.00 14.98  ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A  1  201  ? 65.324  3.453   125.744  1.00 18.60  ? 201  THR A C     1 
ATOM   1558  O  O     . THR A  1  201  ? 65.416  2.292   126.142  1.00 20.64  ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A  1  201  ? 64.340  5.561   126.577  1.00 14.09  ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A  1  201  ? 65.112  5.305   127.753  1.00 15.18  ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A  1  201  ? 63.061  6.314   126.935  1.00 12.85  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A  1  202  ? 66.330  4.115   125.184  1.00 23.00  ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A  1  202  ? 67.620  3.501   124.884  1.00 21.58  ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A  1  202  ? 68.632  3.720   126.003  1.00 24.90  ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A  1  202  ? 69.770  3.254   125.925  1.00 23.01  ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A  1  202  ? 68.173  4.090   123.585  1.00 21.27  ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A  1  202  ? 68.244  5.614   123.617  1.00 20.60  ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A  1  202  ? 67.687  6.217   124.555  1.00 22.57  ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A  1  202  ? 68.843  6.213   122.699  1.00 20.28  ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A  1  203  ? 68.216  4.441   127.039  1.00 24.88  ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A  1  203  ? 69.115  4.805   128.115  1.00 24.28  ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A  1  203  ? 69.720  6.181   127.905  1.00 27.44  ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A  1  203  ? 70.252  6.774   128.846  1.00 29.71  ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A  1  204  ? 69.644  6.684   126.673  1.00 22.71  ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A  1  204  ? 70.178  8.003   126.347  1.00 23.55  ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A  1  204  ? 69.563  9.034   127.282  1.00 24.30  ? 204  SER A C     1 
ATOM   1577  O  O     . SER A  1  204  ? 70.271  9.728   128.004  1.00 28.17  ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A  1  204  ? 69.890  8.361   124.885  1.00 25.10  ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A  1  204  ? 70.217  9.713   124.601  1.00 28.65  ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A  1  205  ? 68.239  9.122   127.274  1.00 21.88  ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A  1  205  ? 67.529  9.828   128.328  1.00 20.36  ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A  1  205  ? 66.502  8.876   128.939  1.00 22.46  ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A  1  205  ? 65.971  7.996   128.257  1.00 21.69  ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A  1  205  ? 66.889  11.146  127.842  1.00 17.38  ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A  1  205  ? 67.625  11.668  126.617  1.00 21.67  ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A  1  205  ? 65.414  10.966  127.554  1.00 18.37  ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A  1  206  ? 66.254  9.035   130.233  1.00 25.36  ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A  1  206  ? 65.441  8.084   130.982  1.00 20.57  ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A  1  206  ? 63.957  8.298   130.727  1.00 17.51  ? 206  THR A C     1 
ATOM   1590  O  O     . THR A  1  206  ? 63.545  9.400   130.348  1.00 17.33  ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A  1  206  ? 65.715  8.199   132.490  1.00 22.38  ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A  1  206  ? 65.314  9.494   132.958  1.00 26.47  ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A  1  206  ? 67.185  7.994   132.767  1.00 20.07  ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A  1  207  ? 63.151  7.240   130.924  1.00 15.54  ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A  1  207  ? 61.696  7.338   130.768  1.00 18.71  ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A  1  207  ? 61.117  8.524   131.529  1.00 16.94  ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A  1  207  ? 60.274  9.241   130.989  1.00 13.56  ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A  1  207  ? 61.197  6.024   131.375  1.00 15.17  ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A  1  207  ? 62.303  5.061   131.110  1.00 15.90  ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A  1  207  ? 63.583  5.853   131.182  1.00 16.05  ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A  1  208  ? 61.581  8.739   132.755  1.00 16.12  ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A  1  208  ? 61.071  9.841   133.556  1.00 21.42  ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A  1  208  ? 61.396  11.184  132.908  1.00 21.45  ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A  1  208  ? 60.527  12.057  132.799  1.00 20.64  ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A  1  208  ? 61.614  9.785   134.986  1.00 29.57  ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A  1  208  ? 61.165  10.924  135.911  1.00 24.29  ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A  1  208  ? 59.648  11.055  135.942  1.00 19.47  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A  1  208  ? 61.708  10.716  137.308  1.00 26.76  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A  1  209  ? 62.644  11.343  132.479  1.00 18.18  ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A  1  209  ? 63.058  12.567  131.805  1.00 20.73  ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A  1  209  ? 62.171  12.823  130.587  1.00 20.81  ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A  1  209  ? 61.628  13.927  130.411  1.00 17.34  ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A  1  209  ? 64.537  12.490  131.418  1.00 19.69  ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A  1  209  ? 65.478  12.716  132.593  1.00 21.72  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A  1  209  ? 66.872  12.145  132.371  1.00 33.33  ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A  1  209  ? 67.784  12.479  133.162  1.00 38.46  ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A  1  209  ? 67.056  11.355  131.419  1.00 29.16  ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A  1  210  ? 61.994  11.780  129.780  1.00 16.40  ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A  1  210  ? 61.171  11.860  128.578  1.00 15.61  ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A  1  210  ? 59.740  12.299  128.883  1.00 14.45  ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A  1  210  ? 59.223  13.220  128.254  1.00 10.96  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A  1  210  ? 61.177  10.529  127.845  1.00 14.44  ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A  1  211  ? 59.110  11.637  129.849  1.00 15.08  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A  1  211  ? 57.741  11.958  130.238  1.00 11.92  ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A  1  211  ? 57.636  13.398  130.711  1.00 14.40  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A  1  211  ? 56.668  14.097  130.405  1.00 14.04  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A  1  211  ? 57.259  11.011  131.336  1.00 11.93  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A  1  211  ? 55.948  11.385  132.032  1.00 15.37  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A  1  211  ? 54.769  11.363  131.066  1.00 11.06  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A  1  211  ? 55.690  10.467  133.216  1.00 15.23  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A  1  212  ? 58.646  13.840  131.452  1.00 16.37  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A  1  212  ? 58.667  15.209  131.944  1.00 17.35  ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A  1  212  ? 58.728  16.231  130.812  1.00 15.33  ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A  1  212  ? 57.899  17.146  130.754  1.00 14.19  ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A  1  212  ? 59.793  15.414  132.965  1.00 18.88  ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A  1  212  ? 59.440  14.855  134.340  1.00 25.32  ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A  1  212  ? 58.292  14.954  134.785  1.00 25.42  ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A  1  212  ? 60.424  14.263  135.017  1.00 17.32  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A  1  213  ? 59.675  16.075  129.892  1.00 16.74  ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A  1  213  ? 59.737  17.036  128.790  1.00 19.38  ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A  1  213  ? 58.560  16.894  127.834  1.00 16.21  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A  1  213  ? 58.232  17.832  127.117  1.00 17.75  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A  1  213  ? 61.073  16.996  128.046  1.00 15.20  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A  1  213  ? 61.681  15.634  127.938  1.00 14.15  ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A  1  213  ? 63.166  15.697  127.658  1.00 19.04  ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A  1  213  ? 63.624  16.508  126.847  1.00 19.97  ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A  1  213  ? 63.933  14.845  128.336  1.00 15.14  ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A  1  214  ? 57.918  15.729  127.845  1.00 15.57  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A  1  214  ? 56.695  15.510  127.074  1.00 14.86  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A  1  214  ? 55.567  16.383  127.621  1.00 16.57  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A  1  214  ? 54.953  17.181  126.888  1.00 12.12  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A  1  214  ? 56.298  14.043  127.119  1.00 10.31  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A  1  215  ? 55.312  16.231  128.921  1.00 17.31  ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A  1  215  ? 54.335  17.064  129.615  1.00 17.02  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A  1  215  ? 54.657  18.548  129.414  1.00 15.21  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A  1  215  ? 53.760  19.369  129.188  1.00 13.35  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A  1  215  ? 54.274  16.733  131.122  1.00 14.58  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A  1  215  ? 53.254  17.617  131.816  1.00 16.72  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A  1  215  ? 53.928  15.264  131.331  1.00 11.33  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A  1  216  ? 55.943  18.883  129.468  1.00 12.91  ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A  1  216  ? 56.355  20.255  129.213  1.00 15.17  ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A  1  216  ? 56.003  20.728  127.798  1.00 19.54  ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A  1  216  ? 55.514  21.847  127.628  1.00 21.41  ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A  1  216  ? 57.843  20.451  129.509  1.00 20.05  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A  1  216  ? 58.395  21.820  129.100  1.00 29.07  ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A  1  216  ? 57.670  23.002  129.746  1.00 35.05  ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A  1  216  ? 56.993  22.824  130.788  1.00 29.80  ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A  1  216  ? 57.786  24.125  129.204  1.00 29.90  ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A  1  217  ? 56.235  19.877  126.796  1.00 16.23  ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A  1  217  ? 55.876  20.193  125.408  1.00 16.04  ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A  1  217  ? 54.378  20.452  125.259  1.00 14.13  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A  1  217  ? 53.959  21.405  124.596  1.00 12.49  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A  1  217  ? 56.275  19.060  124.430  1.00 13.97  ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A  1  217  ? 57.791  18.979  124.287  1.00 12.79  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A  1  217  ? 55.653  19.281  123.052  1.00 9.57   ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A  1  217  ? 58.250  17.802  123.461  1.00 10.62  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A  1  218  ? 53.572  19.599  125.878  1.00 9.75   ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A  1  218  ? 52.133  19.764  125.785  1.00 10.41  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A  1  218  ? 51.674  21.057  126.469  1.00 13.34  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A  1  218  ? 50.868  21.800  125.915  1.00 13.01  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A  1  218  ? 51.417  18.544  126.366  1.00 13.33  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A  1  218  ? 49.894  18.465  126.240  1.00 8.51   ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A  1  218  ? 49.444  18.761  124.825  1.00 5.75   ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A  1  218  ? 49.437  17.090  126.669  1.00 6.77   ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A  1  219  ? 52.195  21.319  127.666  1.00 15.42  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A  1  219  ? 51.860  22.531  128.414  1.00 15.99  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A  1  219  ? 52.186  23.754  127.559  1.00 15.78  ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A  1  219  ? 51.345  24.648  127.330  1.00 15.04  ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A  1  219  ? 52.669  22.558  129.717  1.00 16.31  ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A  1  219  ? 52.060  23.373  130.864  1.00 27.27  ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A  1  219  ? 52.671  24.768  130.958  1.00 25.67  ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A  1  219  ? 54.123  24.721  130.804  1.00 22.99  ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A  1  219  ? 54.859  25.737  130.363  1.00 17.91  ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A  1  219  ? 54.278  26.883  130.035  1.00 13.66  ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A  1  219  ? 56.172  25.607  130.248  1.00 14.41  ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A  1  220  ? 53.419  23.758  127.068  1.00 14.51  ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A  1  220  ? 53.919  24.814  126.208  1.00 16.61  ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A  1  220  ? 53.056  24.975  124.964  1.00 19.34  ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A  1  220  ? 52.928  26.074  124.431  1.00 25.34  ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A  1  220  ? 55.366  24.524  125.813  1.00 18.94  ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A  1  220  ? 56.017  25.606  124.973  1.00 25.95  ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A  1  220  ? 57.426  25.241  124.555  1.00 42.64  ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A  1  220  ? 58.240  24.894  125.441  1.00 44.79  ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A  1  220  ? 57.713  25.291  123.338  1.00 52.26  ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A  1  221  ? 52.456  23.889  124.493  1.00 16.98  ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A  1  221  ? 51.591  24.003  123.329  1.00 16.19  ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A  1  221  ? 50.248  24.598  123.694  1.00 16.15  ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A  1  221  ? 49.703  25.407  122.949  1.00 17.84  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A  1  221  ? 51.420  22.666  122.618  1.00 14.13  ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A  1  221  ? 52.289  22.526  121.410  1.00 15.72  ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A  1  221  ? 53.596  22.092  121.481  1.00 17.17  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A  1  221  ? 52.049  22.794  120.106  1.00 16.37  ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A  1  221  ? 54.118  22.084  120.268  1.00 22.61  ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A  1  221  ? 53.201  22.505  119.415  1.00 24.62  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A  1  222  ? 49.728  24.204  124.851  1.00 14.77  ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A  1  222  ? 48.469  24.733  125.344  1.00 14.16  ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A  1  222  ? 48.568  26.241  125.543  1.00 20.73  ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A  1  222  ? 47.559  26.951  125.474  1.00 18.20  ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A  1  222  ? 48.077  24.041  126.643  1.00 11.59  ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A  1  222  ? 47.593  22.605  126.472  1.00 14.87  ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A  1  222  ? 47.494  21.900  127.817  1.00 14.58  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A  1  222  ? 46.249  22.600  125.762  1.00 16.60  ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A  1  223  ? 49.791  26.719  125.783  1.00 19.65  ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A  1  223  ? 50.061  28.158  125.833  1.00 17.55  ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A  1  223  ? 49.485  28.911  124.633  1.00 25.03  ? 223  THR A C     1 
ATOM   1726  O  O     . THR A  1  223  ? 48.919  29.993  124.778  1.00 28.53  ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A  1  223  ? 51.570  28.435  125.859  1.00 17.15  ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A  1  223  ? 52.146  27.846  127.029  1.00 20.35  ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A  1  223  ? 51.847  29.928  125.851  1.00 26.04  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A  1  224  ? 49.616  28.311  123.453  1.00 28.87  ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A  1  224  ? 49.343  28.980  122.178  1.00 25.51  ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A  1  224  ? 47.922  29.516  121.982  1.00 26.64  ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A  1  224  ? 47.697  30.374  121.127  1.00 31.07  ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A  1  224  ? 49.737  28.058  121.019  1.00 23.17  ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A  1  224  ? 51.203  27.674  121.046  1.00 26.82  ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A  1  224  ? 52.158  28.551  121.549  1.00 23.65  ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A  1  224  ? 51.634  26.436  120.583  1.00 26.75  ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A  1  224  ? 53.495  28.214  121.584  1.00 20.57  ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A  1  224  ? 52.977  26.090  120.611  1.00 24.70  ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A  1  224  ? 53.903  26.985  121.115  1.00 22.63  ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A  1  224  ? 55.240  26.655  121.154  1.00 24.47  ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A  1  225  ? 46.974  29.032  122.779  1.00 28.22  ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A  1  225  ? 45.576  29.449  122.644  1.00 34.25  ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A  1  225  ? 45.293  30.753  123.388  1.00 33.95  ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A  1  225  ? 44.158  31.231  123.410  1.00 35.12  ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A  1  225  ? 44.629  28.358  123.159  1.00 30.46  ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A  1  225  ? 44.609  27.111  122.313  1.00 29.10  ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A  1  225  ? 45.553  26.113  122.498  1.00 26.34  ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A  1  225  ? 43.637  26.929  121.343  1.00 26.78  ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A  1  225  ? 45.532  24.963  121.721  1.00 21.78  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A  1  225  ? 43.615  25.779  120.563  1.00 18.78  ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A  1  225  ? 44.560  24.799  120.753  1.00 13.61  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A  1  226  ? 46.330  31.321  123.993  1.00 35.64  ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A  1  226  ? 46.169  32.438  124.922  1.00 48.70  ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A  1  226  ? 45.981  33.829  124.297  1.00 61.64  ? 226  SER A C     1 
ATOM   1756  O  O     . SER A  1  226  ? 45.513  34.749  124.970  1.00 59.91  ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A  1  226  ? 47.338  32.470  125.916  1.00 42.34  ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A  1  226  ? 48.580  32.604  125.245  1.00 43.35  ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A  1  227  ? 46.339  33.993  123.026  1.00 52.98  ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A  1  227  ? 46.339  35.324  122.419  1.00 53.03  ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A  1  227  ? 45.408  35.456  121.207  1.00 49.33  ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A  1  227  ? 45.874  35.522  120.069  1.00 47.99  ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A  1  227  ? 47.775  35.722  122.046  1.00 58.56  ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A  1  227  ? 47.878  37.146  121.527  1.00 69.50  ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A  1  227  ? 47.150  38.037  121.968  1.00 74.71  ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A  1  227  ? 48.783  37.363  120.575  1.00 60.62  ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A  1  228  ? 44.086  35.515  121.453  1.00 50.74  ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A  1  228  ? 43.075  35.530  120.384  1.00 49.21  ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A  1  228  ? 43.272  36.663  119.382  1.00 49.54  ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A  1  228  ? 43.706  37.746  119.773  1.00 58.56  ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A  1  228  ? 41.763  35.741  121.148  1.00 43.32  ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A  1  228  ? 42.037  35.216  122.517  1.00 56.19  ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A  1  228  ? 43.469  35.572  122.789  1.00 52.31  ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A  1  229  ? 42.970  36.402  118.111  1.00 41.97  ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A  1  229  ? 42.985  37.432  117.072  1.00 40.73  ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A  1  229  ? 41.749  37.325  116.183  1.00 42.80  ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A  1  229  ? 41.512  36.293  115.555  1.00 38.14  ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A  1  229  ? 44.253  37.340  116.220  1.00 36.02  ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A  1  229  ? 45.186  38.538  116.356  1.00 45.68  ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A  1  229  ? 46.358  38.276  117.290  1.00 59.89  ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A  1  229  ? 47.096  37.302  117.123  1.00 60.14  ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A  1  229  ? 46.535  39.148  118.280  1.00 56.55  ? 229  GLN A NE2   1 
ATOM   1783  N  N     . ALA A  1  230  ? 40.961  38.396  116.136  1.00 50.69  ? 230  ALA A N     1 
ATOM   1784  C  CA    . ALA A  1  230  ? 39.750  38.424  115.323  1.00 54.92  ? 230  ALA A CA    1 
ATOM   1785  C  C     . ALA A  1  230  ? 40.084  38.295  113.840  1.00 65.34  ? 230  ALA A C     1 
ATOM   1786  O  O     . ALA A  1  230  ? 40.887  39.065  113.312  1.00 68.89  ? 230  ALA A O     1 
ATOM   1787  C  CB    . ALA A  1  230  ? 38.970  39.705  115.584  1.00 56.13  ? 230  ALA A CB    1 
ATOM   1788  N  N     . ALA A  1  231  ? 39.460  37.327  113.173  1.00 70.79  ? 231  ALA A N     1 
ATOM   1789  C  CA    . ALA A  1  231  ? 39.751  37.043  111.768  1.00 79.03  ? 231  ALA A CA    1 
ATOM   1790  C  C     . ALA A  1  231  ? 39.026  37.986  110.809  1.00 85.50  ? 231  ALA A C     1 
ATOM   1791  O  O     . ALA A  1  231  ? 37.900  38.408  111.070  1.00 93.97  ? 231  ALA A O     1 
ATOM   1792  C  CB    . ALA A  1  231  ? 39.414  35.596  111.440  1.00 67.63  ? 231  ALA A CB    1 
ATOM   1793  N  N     . ALA A  1  232  ? 39.675  38.305  109.695  1.00 76.95  ? 232  ALA A N     1 
ATOM   1794  C  CA    . ALA A  1  232  ? 39.085  39.186  108.695  1.00 81.18  ? 232  ALA A CA    1 
ATOM   1795  C  C     . ALA A  1  232  ? 38.166  38.411  107.755  1.00 79.48  ? 232  ALA A C     1 
ATOM   1796  O  O     . ALA A  1  232  ? 37.514  38.993  106.887  1.00 76.01  ? 232  ALA A O     1 
ATOM   1797  C  CB    . ALA A  1  232  ? 40.173  39.900  107.910  1.00 81.42  ? 232  ALA A CB    1 
ATOM   1798  N  N     . LEU B  1  6    ? 60.625  26.197  115.821  1.00 34.78  ? 6    LEU B N     1 
ATOM   1799  C  CA    . LEU B  1  6    ? 59.509  26.705  115.026  1.00 60.14  ? 6    LEU B CA    1 
ATOM   1800  C  C     . LEU B  1  6    ? 58.815  27.890  115.702  1.00 68.73  ? 6    LEU B C     1 
ATOM   1801  O  O     . LEU B  1  6    ? 58.549  27.863  116.907  1.00 57.60  ? 6    LEU B O     1 
ATOM   1802  C  CB    . LEU B  1  6    ? 58.497  25.589  114.735  1.00 68.44  ? 6    LEU B CB    1 
ATOM   1803  C  CG    . LEU B  1  6    ? 57.249  25.966  113.924  1.00 66.71  ? 6    LEU B CG    1 
ATOM   1804  C  CD1   . LEU B  1  6    ? 57.622  26.614  112.594  1.00 60.51  ? 6    LEU B CD1   1 
ATOM   1805  C  CD2   . LEU B  1  6    ? 56.358  24.752  113.700  1.00 39.53  ? 6    LEU B CD2   1 
ATOM   1806  N  N     . LYS B  1  7    ? 58.517  28.921  114.913  1.00 70.04  ? 7    LYS B N     1 
ATOM   1807  C  CA    . LYS B  1  7    ? 57.900  30.139  115.431  1.00 68.38  ? 7    LYS B CA    1 
ATOM   1808  C  C     . LYS B  1  7    ? 56.496  29.887  115.985  1.00 58.71  ? 7    LYS B C     1 
ATOM   1809  O  O     . LYS B  1  7    ? 55.684  29.205  115.355  1.00 47.04  ? 7    LYS B O     1 
ATOM   1810  C  CB    . LYS B  1  7    ? 57.866  31.231  114.356  1.00 64.07  ? 7    LYS B CB    1 
ATOM   1811  C  CG    . LYS B  1  7    ? 57.396  32.581  114.877  1.00 63.12  ? 7    LYS B CG    1 
ATOM   1812  C  CD    . LYS B  1  7    ? 57.726  33.708  113.913  1.00 70.66  ? 7    LYS B CD    1 
ATOM   1813  C  CE    . LYS B  1  7    ? 57.402  35.064  114.529  1.00 78.82  ? 7    LYS B CE    1 
ATOM   1814  N  NZ    . LYS B  1  7    ? 57.690  36.203  113.611  1.00 66.94  ? 7    LYS B NZ    1 
ATOM   1815  N  N     . ALA B  1  8    ? 56.233  30.450  117.166  1.00 52.05  ? 8    ALA B N     1 
ATOM   1816  C  CA    . ALA B  1  8    ? 54.965  30.282  117.876  1.00 36.80  ? 8    ALA B CA    1 
ATOM   1817  C  C     . ALA B  1  8    ? 53.762  30.622  117.004  1.00 29.65  ? 8    ALA B C     1 
ATOM   1818  O  O     . ALA B  1  8    ? 53.722  31.678  116.376  1.00 29.11  ? 8    ALA B O     1 
ATOM   1819  C  CB    . ALA B  1  8    ? 54.954  31.119  119.150  1.00 30.75  ? 8    ALA B CB    1 
ATOM   1820  N  N     . PRO B  1  9    ? 52.773  29.718  116.976  1.00 26.73  ? 9    PRO B N     1 
ATOM   1821  C  CA    . PRO B  1  9    ? 51.642  29.779  116.047  1.00 29.19  ? 9    PRO B CA    1 
ATOM   1822  C  C     . PRO B  1  9    ? 50.671  30.897  116.364  1.00 21.16  ? 9    PRO B C     1 
ATOM   1823  O  O     . PRO B  1  9    ? 50.622  31.370  117.492  1.00 30.01  ? 9    PRO B O     1 
ATOM   1824  C  CB    . PRO B  1  9    ? 50.956  28.428  116.258  1.00 31.53  ? 9    PRO B CB    1 
ATOM   1825  C  CG    . PRO B  1  9    ? 51.267  28.080  117.659  1.00 25.85  ? 9    PRO B CG    1 
ATOM   1826  C  CD    . PRO B  1  9    ? 52.665  28.569  117.891  1.00 29.02  ? 9    PRO B CD    1 
ATOM   1827  N  N     . VAL B  1  10   ? 49.899  31.305  115.366  1.00 19.71  ? 10   VAL B N     1 
ATOM   1828  C  CA    . VAL B  1  10   ? 48.913  32.353  115.560  1.00 24.07  ? 10   VAL B CA    1 
ATOM   1829  C  C     . VAL B  1  10   ? 47.521  31.766  115.778  1.00 30.04  ? 10   VAL B C     1 
ATOM   1830  O  O     . VAL B  1  10   ? 46.999  31.030  114.933  1.00 27.76  ? 10   VAL B O     1 
ATOM   1831  C  CB    . VAL B  1  10   ? 48.905  33.367  114.386  1.00 28.16  ? 10   VAL B CB    1 
ATOM   1832  C  CG1   . VAL B  1  10   ? 49.204  32.673  113.064  1.00 34.71  ? 10   VAL B CG1   1 
ATOM   1833  C  CG2   . VAL B  1  10   ? 47.578  34.122  114.326  1.00 28.46  ? 10   VAL B CG2   1 
ATOM   1834  N  N     . PHE B  1  11   ? 46.942  32.091  116.931  1.00 30.07  ? 11   PHE B N     1 
ATOM   1835  C  CA    . PHE B  1  11   ? 45.584  31.695  117.283  1.00 23.12  ? 11   PHE B CA    1 
ATOM   1836  C  C     . PHE B  1  11   ? 44.600  32.677  116.656  1.00 24.03  ? 11   PHE B C     1 
ATOM   1837  O  O     . PHE B  1  11   ? 44.833  33.881  116.658  1.00 32.67  ? 11   PHE B O     1 
ATOM   1838  C  CB    . PHE B  1  11   ? 45.442  31.677  118.803  1.00 27.48  ? 11   PHE B CB    1 
ATOM   1839  C  CG    . PHE B  1  11   ? 44.151  31.096  119.291  1.00 32.94  ? 11   PHE B CG    1 
ATOM   1840  C  CD1   . PHE B  1  11   ? 43.616  29.964  118.700  1.00 32.48  ? 11   PHE B CD1   1 
ATOM   1841  C  CD2   . PHE B  1  11   ? 43.485  31.667  120.363  1.00 36.16  ? 11   PHE B CD2   1 
ATOM   1842  C  CE1   . PHE B  1  11   ? 42.429  29.420  119.158  1.00 29.70  ? 11   PHE B CE1   1 
ATOM   1843  C  CE2   . PHE B  1  11   ? 42.300  31.132  120.825  1.00 38.64  ? 11   PHE B CE2   1 
ATOM   1844  C  CZ    . PHE B  1  11   ? 41.771  30.004  120.222  1.00 34.57  ? 11   PHE B CZ    1 
ATOM   1845  N  N     . THR B  1  12   ? 43.507  32.167  116.103  1.00 22.83  ? 12   THR B N     1 
ATOM   1846  C  CA    . THR B  1  12   ? 42.607  33.004  115.317  1.00 21.13  ? 12   THR B CA    1 
ATOM   1847  C  C     . THR B  1  12   ? 41.151  32.665  115.605  1.00 24.98  ? 12   THR B C     1 
ATOM   1848  O  O     . THR B  1  12   ? 40.765  31.506  115.553  1.00 27.17  ? 12   THR B O     1 
ATOM   1849  C  CB    . THR B  1  12   ? 42.881  32.814  113.821  1.00 20.75  ? 12   THR B CB    1 
ATOM   1850  O  OG1   . THR B  1  12   ? 44.274  33.026  113.567  1.00 30.09  ? 12   THR B OG1   1 
ATOM   1851  C  CG2   . THR B  1  12   ? 42.062  33.781  112.992  1.00 23.76  ? 12   THR B CG2   1 
ATOM   1852  N  N     . VAL B  1  13   ? 40.335  33.670  115.897  1.00 28.27  ? 13   VAL B N     1 
ATOM   1853  C  CA    . VAL B  1  13   ? 38.968  33.409  116.336  1.00 20.15  ? 13   VAL B CA    1 
ATOM   1854  C  C     . VAL B  1  13   ? 37.919  34.044  115.430  1.00 22.16  ? 13   VAL B C     1 
ATOM   1855  O  O     . VAL B  1  13   ? 38.106  35.152  114.935  1.00 28.91  ? 13   VAL B O     1 
ATOM   1856  C  CB    . VAL B  1  13   ? 38.756  33.898  117.781  1.00 23.65  ? 13   VAL B CB    1 
ATOM   1857  C  CG1   . VAL B  1  13   ? 37.360  33.548  118.267  1.00 24.71  ? 13   VAL B CG1   1 
ATOM   1858  C  CG2   . VAL B  1  13   ? 39.814  33.304  118.708  1.00 25.92  ? 13   VAL B CG2   1 
ATOM   1859  N  N     . ARG B  1  14   ? 36.828  33.321  115.199  1.00 22.22  ? 14   ARG B N     1 
ATOM   1860  C  CA    . ARG B  1  14   ? 35.683  33.856  114.470  1.00 27.66  ? 14   ARG B CA    1 
ATOM   1861  C  C     . ARG B  1  14   ? 34.384  33.434  115.158  1.00 29.67  ? 14   ARG B C     1 
ATOM   1862  O  O     . ARG B  1  14   ? 34.119  32.248  115.286  1.00 27.23  ? 14   ARG B O     1 
ATOM   1863  C  CB    . ARG B  1  14   ? 35.705  33.347  113.030  1.00 34.43  ? 14   ARG B CB    1 
ATOM   1864  C  CG    . ARG B  1  14   ? 34.595  33.886  112.141  1.00 50.72  ? 14   ARG B CG    1 
ATOM   1865  C  CD    . ARG B  1  14   ? 34.698  33.285  110.749  1.00 60.12  ? 14   ARG B CD    1 
ATOM   1866  N  NE    . ARG B  1  14   ? 36.088  33.223  110.303  1.00 73.12  ? 14   ARG B NE    1 
ATOM   1867  C  CZ    . ARG B  1  14   ? 36.504  32.551  109.234  1.00 77.63  ? 14   ARG B CZ    1 
ATOM   1868  N  NH1   . ARG B  1  14   ? 37.791  32.550  108.908  1.00 66.45  ? 14   ARG B NH1   1 
ATOM   1869  N  NH2   . ARG B  1  14   ? 35.634  31.877  108.493  1.00 73.77  ? 14   ARG B NH2   1 
ATOM   1870  N  N     . THR B  1  15   ? 33.565  34.385  115.600  1.00 37.81  ? 15   THR B N     1 
ATOM   1871  C  CA    . THR B  1  15   ? 32.364  34.016  116.355  1.00 35.48  ? 15   THR B CA    1 
ATOM   1872  C  C     . THR B  1  15   ? 31.049  34.531  115.777  1.00 34.64  ? 15   THR B C     1 
ATOM   1873  O  O     . THR B  1  15   ? 31.008  35.553  115.095  1.00 43.29  ? 15   THR B O     1 
ATOM   1874  C  CB    . THR B  1  15   ? 32.436  34.480  117.834  1.00 35.78  ? 15   THR B CB    1 
ATOM   1875  O  OG1   . THR B  1  15   ? 31.666  35.679  118.004  1.00 35.47  ? 15   THR B OG1   1 
ATOM   1876  C  CG2   . THR B  1  15   ? 33.882  34.715  118.273  1.00 21.21  ? 15   THR B CG2   1 
ATOM   1877  N  N     . GLN B  1  16   ? 29.975  33.801  116.059  1.00 35.67  ? 16   GLN B N     1 
ATOM   1878  C  CA    . GLN B  1  16   ? 28.623  34.315  115.875  1.00 47.90  ? 16   GLN B CA    1 
ATOM   1879  C  C     . GLN B  1  16   ? 27.810  34.124  117.158  1.00 50.91  ? 16   GLN B C     1 
ATOM   1880  O  O     . GLN B  1  16   ? 27.469  32.996  117.533  1.00 35.78  ? 16   GLN B O     1 
ATOM   1881  C  CB    . GLN B  1  16   ? 27.928  33.612  114.712  1.00 43.13  ? 16   GLN B CB    1 
ATOM   1882  C  CG    . GLN B  1  16   ? 28.603  33.803  113.372  1.00 62.68  ? 16   GLN B CG    1 
ATOM   1883  C  CD    . GLN B  1  16   ? 27.818  33.168  112.239  1.00 83.43  ? 16   GLN B CD    1 
ATOM   1884  O  OE1   . GLN B  1  16   ? 26.649  32.808  112.404  1.00 83.25  ? 16   GLN B OE1   1 
ATOM   1885  N  NE2   . GLN B  1  16   ? 28.457  33.025  111.082  1.00 77.24  ? 16   GLN B NE2   1 
ATOM   1886  N  N     . GLY B  1  17   ? 27.478  35.235  117.810  1.00 47.24  ? 17   GLY B N     1 
ATOM   1887  C  CA    . GLY B  1  17   ? 26.737  35.200  119.059  1.00 33.76  ? 17   GLY B CA    1 
ATOM   1888  C  C     . GLY B  1  17   ? 27.491  34.473  120.153  1.00 31.25  ? 17   GLY B C     1 
ATOM   1889  O  O     . GLY B  1  17   ? 28.718  34.362  120.107  1.00 32.40  ? 17   GLY B O     1 
ATOM   1890  N  N     . ARG B  1  18   ? 26.750  33.983  121.141  1.00 28.54  ? 18   ARG B N     1 
ATOM   1891  C  CA    . ARG B  1  18   ? 27.324  33.179  122.216  1.00 34.38  ? 18   ARG B CA    1 
ATOM   1892  C  C     . ARG B  1  18   ? 27.197  31.689  121.885  1.00 35.66  ? 18   ARG B C     1 
ATOM   1893  O  O     . ARG B  1  18   ? 27.619  30.829  122.659  1.00 30.65  ? 18   ARG B O     1 
ATOM   1894  C  CB    . ARG B  1  18   ? 26.610  33.480  123.541  1.00 38.17  ? 18   ARG B CB    1 
ATOM   1895  C  CG    . ARG B  1  18   ? 26.657  34.943  123.977  1.00 31.42  ? 18   ARG B CG    1 
ATOM   1896  C  CD    . ARG B  1  18   ? 25.811  35.198  125.224  1.00 22.84  ? 18   ARG B CD    1 
ATOM   1897  N  NE    . ARG B  1  18   ? 26.223  34.375  126.357  1.00 26.80  ? 18   ARG B NE    1 
ATOM   1898  C  CZ    . ARG B  1  18   ? 27.309  34.602  127.091  1.00 33.24  ? 18   ARG B CZ    1 
ATOM   1899  N  NH1   . ARG B  1  18   ? 27.609  33.799  128.106  1.00 26.02  ? 18   ARG B NH1   1 
ATOM   1900  N  NH2   . ARG B  1  18   ? 28.102  35.628  126.805  1.00 30.10  ? 18   ARG B NH2   1 
ATOM   1901  N  N     . GLU B  1  19   ? 26.585  31.406  120.736  1.00 37.94  ? 19   GLU B N     1 
ATOM   1902  C  CA    . GLU B  1  19   ? 26.269  30.045  120.299  1.00 28.93  ? 19   GLU B CA    1 
ATOM   1903  C  C     . GLU B  1  19   ? 27.404  29.271  119.606  1.00 27.85  ? 19   GLU B C     1 
ATOM   1904  O  O     . GLU B  1  19   ? 27.534  28.061  119.787  1.00 22.17  ? 19   GLU B O     1 
ATOM   1905  C  CB    . GLU B  1  19   ? 25.055  30.081  119.368  1.00 36.51  ? 19   GLU B CB    1 
ATOM   1906  C  CG    . GLU B  1  19   ? 23.907  30.956  119.850  1.00 37.59  ? 19   GLU B CG    1 
ATOM   1907  C  CD    . GLU B  1  19   ? 23.036  30.260  120.869  1.00 37.16  ? 19   GLU B CD    1 
ATOM   1908  O  OE1   . GLU B  1  19   ? 21.830  30.059  120.592  1.00 35.93  ? 19   GLU B OE1   1 
ATOM   1909  O  OE2   . GLU B  1  19   ? 23.559  29.917  121.947  1.00 40.34  ? 19   GLU B OE2   1 
ATOM   1910  N  N     . TYR B  1  20   ? 28.206  29.960  118.799  1.00 25.15  ? 20   TYR B N     1 
ATOM   1911  C  CA    . TYR B  1  20   ? 29.128  29.275  117.899  1.00 19.62  ? 20   TYR B CA    1 
ATOM   1912  C  C     . TYR B  1  20   ? 30.452  30.007  117.678  1.00 20.66  ? 20   TYR B C     1 
ATOM   1913  O  O     . TYR B  1  20   ? 30.481  31.232  117.589  1.00 22.40  ? 20   TYR B O     1 
ATOM   1914  C  CB    . TYR B  1  20   ? 28.446  29.042  116.545  1.00 19.91  ? 20   TYR B CB    1 
ATOM   1915  C  CG    . TYR B  1  20   ? 29.350  28.407  115.514  1.00 22.57  ? 20   TYR B CG    1 
ATOM   1916  C  CD1   . TYR B  1  20   ? 29.905  29.157  114.485  1.00 21.20  ? 20   TYR B CD1   1 
ATOM   1917  C  CD2   . TYR B  1  20   ? 29.664  27.058  115.584  1.00 21.11  ? 20   TYR B CD2   1 
ATOM   1918  C  CE1   . TYR B  1  20   ? 30.743  28.572  113.549  1.00 26.50  ? 20   TYR B CE1   1 
ATOM   1919  C  CE2   . TYR B  1  20   ? 30.498  26.469  114.660  1.00 21.14  ? 20   TYR B CE2   1 
ATOM   1920  C  CZ    . TYR B  1  20   ? 31.034  27.224  113.644  1.00 23.44  ? 20   TYR B CZ    1 
ATOM   1921  O  OH    . TYR B  1  20   ? 31.861  26.614  112.727  1.00 20.57  ? 20   TYR B OH    1 
ATOM   1922  N  N     . GLY B  1  21   ? 31.544  29.252  117.571  1.00 20.06  ? 21   GLY B N     1 
ATOM   1923  C  CA    . GLY B  1  21   ? 32.822  29.837  117.202  1.00 18.27  ? 21   GLY B CA    1 
ATOM   1924  C  C     . GLY B  1  21   ? 33.801  28.898  116.509  1.00 23.42  ? 21   GLY B C     1 
ATOM   1925  O  O     . GLY B  1  21   ? 33.772  27.683  116.709  1.00 22.51  ? 21   GLY B O     1 
ATOM   1926  N  N     . GLU B  1  22   ? 34.684  29.480  115.700  1.00 22.43  ? 22   GLU B N     1 
ATOM   1927  C  CA    . GLU B  1  22   ? 35.736  28.747  115.007  1.00 17.27  ? 22   GLU B CA    1 
ATOM   1928  C  C     . GLU B  1  22   ? 37.086  29.256  115.464  1.00 17.32  ? 22   GLU B C     1 
ATOM   1929  O  O     . GLU B  1  22   ? 37.280  30.455  115.663  1.00 22.35  ? 22   GLU B O     1 
ATOM   1930  C  CB    . GLU B  1  22   ? 35.636  28.927  113.499  1.00 20.04  ? 22   GLU B CB    1 
ATOM   1931  C  CG    . GLU B  1  22   ? 34.287  28.589  112.918  1.00 31.84  ? 22   GLU B CG    1 
ATOM   1932  C  CD    . GLU B  1  22   ? 34.297  28.614  111.402  1.00 52.23  ? 22   GLU B CD    1 
ATOM   1933  O  OE1   . GLU B  1  22   ? 35.406  28.665  110.821  1.00 49.30  ? 22   GLU B OE1   1 
ATOM   1934  O  OE2   . GLU B  1  22   ? 33.201  28.588  110.796  1.00 48.72  ? 22   GLU B OE2   1 
ATOM   1935  N  N     . PHE B  1  23   ? 38.022  28.332  115.616  1.00 14.64  ? 23   PHE B N     1 
ATOM   1936  C  CA    . PHE B  1  23   ? 39.318  28.640  116.183  1.00 16.08  ? 23   PHE B CA    1 
ATOM   1937  C  C     . PHE B  1  23   ? 40.410  27.982  115.360  1.00 18.25  ? 23   PHE B C     1 
ATOM   1938  O  O     . PHE B  1  23   ? 40.445  26.765  115.214  1.00 21.27  ? 23   PHE B O     1 
ATOM   1939  C  CB    . PHE B  1  23   ? 39.377  28.159  117.633  1.00 16.38  ? 23   PHE B CB    1 
ATOM   1940  C  CG    . PHE B  1  23   ? 38.300  28.739  118.498  1.00 19.58  ? 23   PHE B CG    1 
ATOM   1941  C  CD1   . PHE B  1  23   ? 38.512  29.917  119.192  1.00 22.09  ? 23   PHE B CD1   1 
ATOM   1942  C  CD2   . PHE B  1  23   ? 37.070  28.114  118.609  1.00 21.40  ? 23   PHE B CD2   1 
ATOM   1943  C  CE1   . PHE B  1  23   ? 37.521  30.454  119.983  1.00 23.32  ? 23   PHE B CE1   1 
ATOM   1944  C  CE2   . PHE B  1  23   ? 36.074  28.650  119.396  1.00 21.30  ? 23   PHE B CE2   1 
ATOM   1945  C  CZ    . PHE B  1  23   ? 36.300  29.821  120.084  1.00 21.84  ? 23   PHE B CZ    1 
ATOM   1946  N  N     . VAL B  1  24   ? 41.304  28.792  114.820  1.00 14.30  ? 24   VAL B N     1 
ATOM   1947  C  CA    . VAL B  1  24   ? 42.337  28.280  113.956  1.00 13.23  ? 24   VAL B CA    1 
ATOM   1948  C  C     . VAL B  1  24   ? 43.708  28.490  114.574  1.00 22.74  ? 24   VAL B C     1 
ATOM   1949  O  O     . VAL B  1  24   ? 44.129  29.622  114.818  1.00 27.16  ? 24   VAL B O     1 
ATOM   1950  C  CB    . VAL B  1  24   ? 42.278  28.943  112.582  1.00 17.68  ? 24   VAL B CB    1 
ATOM   1951  C  CG1   . VAL B  1  24   ? 43.458  28.498  111.732  1.00 32.16  ? 24   VAL B CG1   1 
ATOM   1952  C  CG2   . VAL B  1  24   ? 40.962  28.615  111.901  1.00 14.58  ? 24   VAL B CG2   1 
ATOM   1953  N  N     . LEU B  1  25   ? 44.392  27.384  114.839  1.00 21.99  ? 25   LEU B N     1 
ATOM   1954  C  CA    . LEU B  1  25   ? 45.747  27.420  115.350  1.00 20.46  ? 25   LEU B CA    1 
ATOM   1955  C  C     . LEU B  1  25   ? 46.675  26.847  114.294  1.00 23.76  ? 25   LEU B C     1 
ATOM   1956  O  O     . LEU B  1  25   ? 46.635  25.648  114.021  1.00 24.67  ? 25   LEU B O     1 
ATOM   1957  C  CB    . LEU B  1  25   ? 45.842  26.596  116.634  1.00 16.98  ? 25   LEU B CB    1 
ATOM   1958  C  CG    . LEU B  1  25   ? 47.191  26.611  117.348  1.00 17.67  ? 25   LEU B CG    1 
ATOM   1959  C  CD1   . LEU B  1  25   ? 47.601  28.035  117.626  1.00 31.87  ? 25   LEU B CD1   1 
ATOM   1960  C  CD2   . LEU B  1  25   ? 47.116  25.834  118.637  1.00 15.36  ? 25   LEU B CD2   1 
ATOM   1961  N  N     . GLU B  1  26   ? 47.476  27.716  113.677  1.00 34.05  ? 26   GLU B N     1 
ATOM   1962  C  CA    . GLU B  1  26   ? 48.495  27.313  112.702  1.00 26.24  ? 26   GLU B CA    1 
ATOM   1963  C  C     . GLU B  1  26   ? 49.701  28.258  112.701  1.00 21.30  ? 26   GLU B C     1 
ATOM   1964  O  O     . GLU B  1  26   ? 49.596  29.398  113.155  1.00 23.99  ? 26   GLU B O     1 
ATOM   1965  C  CB    . GLU B  1  26   ? 47.896  27.236  111.299  1.00 21.77  ? 26   GLU B CB    1 
ATOM   1966  C  CG    . GLU B  1  26   ? 47.499  28.574  110.725  1.00 27.29  ? 26   GLU B CG    1 
ATOM   1967  C  CD    . GLU B  1  26   ? 47.243  28.499  109.234  1.00 36.99  ? 26   GLU B CD    1 
ATOM   1968  O  OE1   . GLU B  1  26   ? 48.143  28.023  108.502  1.00 27.61  ? 26   GLU B OE1   1 
ATOM   1969  O  OE2   . GLU B  1  26   ? 46.141  28.906  108.801  1.00 36.54  ? 26   GLU B OE2   1 
ATOM   1970  N  N     . PRO B  1  27   ? 50.853  27.792  112.197  1.00 18.62  ? 27   PRO B N     1 
ATOM   1971  C  CA    . PRO B  1  27   ? 51.233  26.419  111.865  1.00 20.07  ? 27   PRO B CA    1 
ATOM   1972  C  C     . PRO B  1  27   ? 51.678  25.646  113.096  1.00 22.56  ? 27   PRO B C     1 
ATOM   1973  O  O     . PRO B  1  27   ? 52.318  26.217  113.979  1.00 25.05  ? 27   PRO B O     1 
ATOM   1974  C  CB    . PRO B  1  27   ? 52.422  26.613  110.929  1.00 22.42  ? 27   PRO B CB    1 
ATOM   1975  C  CG    . PRO B  1  27   ? 53.058  27.840  111.413  1.00 24.94  ? 27   PRO B CG    1 
ATOM   1976  C  CD    . PRO B  1  27   ? 51.928  28.739  111.862  1.00 25.20  ? 27   PRO B CD    1 
ATOM   1977  N  N     . LEU B  1  28   ? 51.376  24.354  113.132  1.00 19.60  ? 28   LEU B N     1 
ATOM   1978  C  CA    . LEU B  1  28   ? 51.851  23.488  114.197  1.00 18.10  ? 28   LEU B CA    1 
ATOM   1979  C  C     . LEU B  1  28   ? 52.793  22.460  113.600  1.00 15.73  ? 28   LEU B C     1 
ATOM   1980  O  O     . LEU B  1  28   ? 52.639  22.077  112.448  1.00 15.94  ? 28   LEU B O     1 
ATOM   1981  C  CB    . LEU B  1  28   ? 50.678  22.787  114.879  1.00 16.40  ? 28   LEU B CB    1 
ATOM   1982  C  CG    . LEU B  1  28   ? 49.633  23.668  115.559  1.00 12.99  ? 28   LEU B CG    1 
ATOM   1983  C  CD1   . LEU B  1  28   ? 48.389  22.857  115.833  1.00 14.22  ? 28   LEU B CD1   1 
ATOM   1984  C  CD2   . LEU B  1  28   ? 50.177  24.243  116.851  1.00 18.86  ? 28   LEU B CD2   1 
ATOM   1985  N  N     . GLU B  1  29   ? 53.758  21.997  114.386  1.00 21.18  ? 29   GLU B N     1 
ATOM   1986  C  CA    . GLU B  1  29   ? 54.698  20.997  113.904  1.00 21.86  ? 29   GLU B CA    1 
ATOM   1987  C  C     . GLU B  1  29   ? 53.899  19.750  113.563  1.00 23.70  ? 29   GLU B C     1 
ATOM   1988  O  O     . GLU B  1  29   ? 52.786  19.575  114.055  1.00 24.00  ? 29   GLU B O     1 
ATOM   1989  C  CB    . GLU B  1  29   ? 55.759  20.693  114.963  1.00 22.63  ? 29   GLU B CB    1 
ATOM   1990  C  CG    . GLU B  1  29   ? 56.921  19.842  114.461  1.00 38.44  ? 29   GLU B CG    1 
ATOM   1991  C  CD    . GLU B  1  29   ? 57.621  20.446  113.246  1.00 53.83  ? 29   GLU B CD    1 
ATOM   1992  O  OE1   . GLU B  1  29   ? 57.344  20.000  112.107  1.00 43.37  ? 29   GLU B OE1   1 
ATOM   1993  O  OE2   . GLU B  1  29   ? 58.457  21.359  113.432  1.00 57.58  ? 29   GLU B OE2   1 
ATOM   1994  N  N     . ARG B  1  30   ? 54.448  18.903  112.700  1.00 25.09  ? 30   ARG B N     1 
ATOM   1995  C  CA    . ARG B  1  30   ? 53.688  17.795  112.145  1.00 19.21  ? 30   ARG B CA    1 
ATOM   1996  C  C     . ARG B  1  30   ? 53.080  16.915  113.228  1.00 17.10  ? 30   ARG B C     1 
ATOM   1997  O  O     . ARG B  1  30   ? 53.780  16.421  114.112  1.00 16.94  ? 30   ARG B O     1 
ATOM   1998  C  CB    . ARG B  1  30   ? 54.578  16.954  111.237  1.00 19.47  ? 30   ARG B CB    1 
ATOM   1999  C  CG    . ARG B  1  30   ? 53.836  15.869  110.488  1.00 19.07  ? 30   ARG B CG    1 
ATOM   2000  C  CD    . ARG B  1  30   ? 54.805  14.924  109.804  1.00 16.40  ? 30   ARG B CD    1 
ATOM   2001  N  NE    . ARG B  1  30   ? 55.464  14.043  110.762  1.00 16.30  ? 30   ARG B NE    1 
ATOM   2002  C  CZ    . ARG B  1  30   ? 56.502  13.266  110.468  1.00 17.94  ? 30   ARG B CZ    1 
ATOM   2003  N  NH1   . ARG B  1  30   ? 57.009  13.270  109.241  1.00 17.44  ? 30   ARG B NH1   1 
ATOM   2004  N  NH2   . ARG B  1  30   ? 57.038  12.493  111.404  1.00 11.28  ? 30   ARG B NH2   1 
ATOM   2005  N  N     . GLY B  1  31   ? 51.765  16.740  113.151  1.00 15.56  ? 31   GLY B N     1 
ATOM   2006  C  CA    . GLY B  1  31   ? 51.053  15.832  114.029  1.00 16.15  ? 31   GLY B CA    1 
ATOM   2007  C  C     . GLY B  1  31   ? 50.323  16.488  115.183  1.00 16.83  ? 31   GLY B C     1 
ATOM   2008  O  O     . GLY B  1  31   ? 49.377  15.916  115.733  1.00 16.99  ? 31   GLY B O     1 
ATOM   2009  N  N     . PHE B  1  32   ? 50.744  17.694  115.546  1.00 17.60  ? 32   PHE B N     1 
ATOM   2010  C  CA    . PHE B  1  32   ? 50.223  18.339  116.747  1.00 12.77  ? 32   PHE B CA    1 
ATOM   2011  C  C     . PHE B  1  32   ? 48.803  18.839  116.590  1.00 10.33  ? 32   PHE B C     1 
ATOM   2012  O  O     . PHE B  1  32   ? 48.167  19.218  117.566  1.00 10.77  ? 32   PHE B O     1 
ATOM   2013  C  CB    . PHE B  1  32   ? 51.155  19.454  117.221  1.00 13.02  ? 32   PHE B CB    1 
ATOM   2014  C  CG    . PHE B  1  32   ? 52.278  18.958  118.074  1.00 15.50  ? 32   PHE B CG    1 
ATOM   2015  C  CD1   . PHE B  1  32   ? 53.387  18.363  117.501  1.00 16.34  ? 32   PHE B CD1   1 
ATOM   2016  C  CD2   . PHE B  1  32   ? 52.211  19.054  119.452  1.00 14.55  ? 32   PHE B CD2   1 
ATOM   2017  C  CE1   . PHE B  1  32   ? 54.418  17.888  118.285  1.00 13.62  ? 32   PHE B CE1   1 
ATOM   2018  C  CE2   . PHE B  1  32   ? 53.240  18.579  120.242  1.00 15.87  ? 32   PHE B CE2   1 
ATOM   2019  C  CZ    . PHE B  1  32   ? 54.346  17.996  119.656  1.00 14.29  ? 32   PHE B CZ    1 
ATOM   2020  N  N     . GLY B  1  33   ? 48.306  18.828  115.362  1.00 12.47  ? 33   GLY B N     1 
ATOM   2021  C  CA    . GLY B  1  33   ? 46.929  19.201  115.108  1.00 11.50  ? 33   GLY B CA    1 
ATOM   2022  C  C     . GLY B  1  33   ? 45.970  18.249  115.787  1.00 7.64   ? 33   GLY B C     1 
ATOM   2023  O  O     . GLY B  1  33   ? 45.006  18.679  116.414  1.00 5.83   ? 33   GLY B O     1 
ATOM   2024  N  N     . VAL B  1  34   ? 46.221  16.951  115.652  1.00 8.54   ? 34   VAL B N     1 
ATOM   2025  C  CA    . VAL B  1  34   ? 45.397  15.960  116.340  1.00 10.84  ? 34   VAL B CA    1 
ATOM   2026  C  C     . VAL B  1  34   ? 45.813  15.785  117.801  1.00 8.97   ? 34   VAL B C     1 
ATOM   2027  O  O     . VAL B  1  34   ? 44.982  15.447  118.646  1.00 10.57  ? 34   VAL B O     1 
ATOM   2028  C  CB    . VAL B  1  34   ? 45.366  14.593  115.617  1.00 10.18  ? 34   VAL B CB    1 
ATOM   2029  C  CG1   . VAL B  1  34   ? 45.004  14.778  114.156  1.00 10.65  ? 34   VAL B CG1   1 
ATOM   2030  C  CG2   . VAL B  1  34   ? 46.685  13.901  115.736  1.00 8.40   ? 34   VAL B CG2   1 
ATOM   2031  N  N     . THR B  1  35   ? 47.090  16.027  118.094  1.00 9.75   ? 35   THR B N     1 
ATOM   2032  C  CA    . THR B  1  35   ? 47.579  15.978  119.471  1.00 10.67  ? 35   THR B CA    1 
ATOM   2033  C  C     . THR B  1  35   ? 46.869  17.013  120.351  1.00 9.33   ? 35   THR B C     1 
ATOM   2034  O  O     . THR B  1  35   ? 46.522  16.730  121.494  1.00 8.49   ? 35   THR B O     1 
ATOM   2035  C  CB    . THR B  1  35   ? 49.112  16.190  119.570  1.00 11.17  ? 35   THR B CB    1 
ATOM   2036  O  OG1   . THR B  1  35   ? 49.792  15.321  118.657  1.00 12.03  ? 35   THR B OG1   1 
ATOM   2037  C  CG2   . THR B  1  35   ? 49.596  15.887  120.981  1.00 9.03   ? 35   THR B CG2   1 
ATOM   2038  N  N     . LEU B  1  36   ? 46.670  18.215  119.824  1.00 8.00   ? 36   LEU B N     1 
ATOM   2039  C  CA    . LEU B  1  36   ? 45.902  19.222  120.537  1.00 5.98   ? 36   LEU B CA    1 
ATOM   2040  C  C     . LEU B  1  36   ? 44.412  19.006  120.360  1.00 5.76   ? 36   LEU B C     1 
ATOM   2041  O  O     . LEU B  1  36   ? 43.643  19.114  121.308  1.00 8.52   ? 36   LEU B O     1 
ATOM   2042  C  CB    . LEU B  1  36   ? 46.290  20.622  120.075  1.00 6.16   ? 36   LEU B CB    1 
ATOM   2043  C  CG    . LEU B  1  36   ? 47.750  20.965  120.355  1.00 7.19   ? 36   LEU B CG    1 
ATOM   2044  C  CD1   . LEU B  1  36   ? 48.033  22.408  119.994  1.00 11.02  ? 36   LEU B CD1   1 
ATOM   2045  C  CD2   . LEU B  1  36   ? 48.093  20.698  121.808  1.00 7.23   ? 36   LEU B CD2   1 
ATOM   2046  N  N     . GLY B  1  37   ? 44.009  18.690  119.139  1.00 6.53   ? 37   GLY B N     1 
ATOM   2047  C  CA    . GLY B  1  37   ? 42.600  18.594  118.800  1.00 7.78   ? 37   GLY B CA    1 
ATOM   2048  C  C     . GLY B  1  37   ? 41.815  17.554  119.573  1.00 5.31   ? 37   GLY B C     1 
ATOM   2049  O  O     . GLY B  1  37   ? 40.748  17.846  120.094  1.00 5.16   ? 37   GLY B O     1 
ATOM   2050  N  N     . ASN B  1  38   ? 42.329  16.335  119.649  1.00 5.60   ? 38   ASN B N     1 
ATOM   2051  C  CA    . ASN B  1  38   ? 41.576  15.278  120.319  1.00 6.81   ? 38   ASN B CA    1 
ATOM   2052  C  C     . ASN B  1  38   ? 41.275  15.505  121.802  1.00 9.17   ? 38   ASN B C     1 
ATOM   2053  O  O     . ASN B  1  38   ? 40.112  15.420  122.198  1.00 11.74  ? 38   ASN B O     1 
ATOM   2054  C  CB    . ASN B  1  38   ? 42.176  13.889  120.068  1.00 8.41   ? 38   ASN B CB    1 
ATOM   2055  C  CG    . ASN B  1  38   ? 41.689  13.278  118.768  1.00 9.15   ? 38   ASN B CG    1 
ATOM   2056  O  OD1   . ASN B  1  38   ? 40.491  13.291  118.473  1.00 8.35   ? 38   ASN B OD1   1 
ATOM   2057  N  ND2   . ASN B  1  38   ? 42.618  12.758  117.972  1.00 8.06   ? 38   ASN B ND2   1 
ATOM   2058  N  N     . PRO B  1  39   ? 42.304  15.805  122.623  1.00 9.49   ? 39   PRO B N     1 
ATOM   2059  C  CA    . PRO B  1  39   ? 42.039  15.995  124.057  1.00 8.91   ? 39   PRO B CA    1 
ATOM   2060  C  C     . PRO B  1  39   ? 41.037  17.103  124.301  1.00 7.45   ? 39   PRO B C     1 
ATOM   2061  O  O     . PRO B  1  39   ? 40.084  16.908  125.048  1.00 7.70   ? 39   PRO B O     1 
ATOM   2062  C  CB    . PRO B  1  39   ? 43.394  16.438  124.609  1.00 7.65   ? 39   PRO B CB    1 
ATOM   2063  C  CG    . PRO B  1  39   ? 44.366  15.941  123.653  1.00 7.17   ? 39   PRO B CG    1 
ATOM   2064  C  CD    . PRO B  1  39   ? 43.728  15.991  122.313  1.00 7.94   ? 39   PRO B CD    1 
ATOM   2065  N  N     . LEU B  1  40   ? 41.241  18.243  123.656  1.00 6.83   ? 40   LEU B N     1 
ATOM   2066  C  CA    . LEU B  1  40   ? 40.322  19.352  123.808  1.00 9.32   ? 40   LEU B CA    1 
ATOM   2067  C  C     . LEU B  1  40   ? 38.892  18.913  123.523  1.00 9.85   ? 40   LEU B C     1 
ATOM   2068  O  O     . LEU B  1  40   ? 37.980  19.198  124.300  1.00 10.47  ? 40   LEU B O     1 
ATOM   2069  C  CB    . LEU B  1  40   ? 40.716  20.509  122.895  1.00 10.76  ? 40   LEU B CB    1 
ATOM   2070  C  CG    . LEU B  1  40   ? 42.048  21.158  123.256  1.00 10.65  ? 40   LEU B CG    1 
ATOM   2071  C  CD1   . LEU B  1  40   ? 42.287  22.366  122.375  1.00 10.81  ? 40   LEU B CD1   1 
ATOM   2072  C  CD2   . LEU B  1  40   ? 42.073  21.529  124.732  1.00 8.11   ? 40   LEU B CD2   1 
ATOM   2073  N  N     . ARG B  1  41   ? 38.698  18.196  122.424  1.00 8.94   ? 41   ARG B N     1 
ATOM   2074  C  CA    . ARG B  1  41   ? 37.350  17.816  122.049  1.00 9.42   ? 41   ARG B CA    1 
ATOM   2075  C  C     . ARG B  1  41   ? 36.731  16.917  123.108  1.00 9.21   ? 41   ARG B C     1 
ATOM   2076  O  O     . ARG B  1  41   ? 35.577  17.113  123.491  1.00 11.28  ? 41   ARG B O     1 
ATOM   2077  C  CB    . ARG B  1  41   ? 37.305  17.144  120.681  1.00 8.46   ? 41   ARG B CB    1 
ATOM   2078  C  CG    . ARG B  1  41   ? 35.904  16.700  120.326  1.00 12.24  ? 41   ARG B CG    1 
ATOM   2079  C  CD    . ARG B  1  41   ? 35.809  16.026  118.978  1.00 14.05  ? 41   ARG B CD    1 
ATOM   2080  N  NE    . ARG B  1  41   ? 34.526  15.341  118.831  1.00 13.28  ? 41   ARG B NE    1 
ATOM   2081  C  CZ    . ARG B  1  41   ? 34.287  14.117  119.287  1.00 9.19   ? 41   ARG B CZ    1 
ATOM   2082  N  NH1   . ARG B  1  41   ? 35.245  13.445  119.915  1.00 5.34   ? 41   ARG B NH1   1 
ATOM   2083  N  NH2   . ARG B  1  41   ? 33.094  13.566  119.113  1.00 7.64   ? 41   ARG B NH2   1 
ATOM   2084  N  N     . ARG B  1  42   ? 37.506  15.946  123.587  1.00 9.19   ? 42   ARG B N     1 
ATOM   2085  C  CA    . ARG B  1  42   ? 37.032  15.031  124.624  1.00 8.16   ? 42   ARG B CA    1 
ATOM   2086  C  C     . ARG B  1  42   ? 36.641  15.809  125.869  1.00 9.28   ? 42   ARG B C     1 
ATOM   2087  O  O     . ARG B  1  42   ? 35.563  15.602  126.422  1.00 10.73  ? 42   ARG B O     1 
ATOM   2088  C  CB    . ARG B  1  42   ? 38.096  13.994  124.976  1.00 5.78   ? 42   ARG B CB    1 
ATOM   2089  C  CG    . ARG B  1  42   ? 38.308  12.938  123.920  1.00 6.42   ? 42   ARG B CG    1 
ATOM   2090  C  CD    . ARG B  1  42   ? 39.560  12.107  124.206  1.00 7.66   ? 42   ARG B CD    1 
ATOM   2091  N  NE    . ARG B  1  42   ? 39.393  11.211  125.343  1.00 6.57   ? 42   ARG B NE    1 
ATOM   2092  C  CZ    . ARG B  1  42   ? 38.773  10.036  125.280  1.00 7.78   ? 42   ARG B CZ    1 
ATOM   2093  N  NH1   . ARG B  1  42   ? 38.259  9.615   124.131  1.00 7.16   ? 42   ARG B NH1   1 
ATOM   2094  N  NH2   . ARG B  1  42   ? 38.660  9.282   126.365  1.00 9.31   ? 42   ARG B NH2   1 
ATOM   2095  N  N     . ILE B  1  43   ? 37.524  16.708  126.292  1.00 9.01   ? 43   ILE B N     1 
ATOM   2096  C  CA    . ILE B  1  43   ? 37.275  17.558  127.446  1.00 7.61   ? 43   ILE B CA    1 
ATOM   2097  C  C     . ILE B  1  43   ? 36.045  18.420  127.210  1.00 9.43   ? 43   ILE B C     1 
ATOM   2098  O  O     . ILE B  1  43   ? 35.132  18.454  128.035  1.00 11.03  ? 43   ILE B O     1 
ATOM   2099  C  CB    . ILE B  1  43   ? 38.480  18.458  127.737  1.00 5.39   ? 43   ILE B CB    1 
ATOM   2100  C  CG1   . ILE B  1  43   ? 39.660  17.615  128.218  1.00 6.58   ? 43   ILE B CG1   1 
ATOM   2101  C  CG2   . ILE B  1  43   ? 38.127  19.490  128.775  1.00 6.51   ? 43   ILE B CG2   1 
ATOM   2102  C  CD1   . ILE B  1  43   ? 40.971  18.366  128.263  1.00 7.20   ? 43   ILE B CD1   1 
ATOM   2103  N  N     . LEU B  1  44   ? 36.019  19.097  126.068  1.00 7.83   ? 44   LEU B N     1 
ATOM   2104  C  CA    . LEU B  1  44   ? 34.930  20.008  125.734  1.00 10.61  ? 44   LEU B CA    1 
ATOM   2105  C  C     . LEU B  1  44   ? 33.562  19.333  125.811  1.00 12.95  ? 44   LEU B C     1 
ATOM   2106  O  O     . LEU B  1  44   ? 32.550  19.979  126.103  1.00 14.97  ? 44   LEU B O     1 
ATOM   2107  C  CB    . LEU B  1  44   ? 35.149  20.607  124.343  1.00 12.36  ? 44   LEU B CB    1 
ATOM   2108  C  CG    . LEU B  1  44   ? 36.019  21.862  124.264  1.00 11.02  ? 44   LEU B CG    1 
ATOM   2109  C  CD1   . LEU B  1  44   ? 36.778  21.892  122.963  1.00 10.44  ? 44   LEU B CD1   1 
ATOM   2110  C  CD2   . LEU B  1  44   ? 35.151  23.101  124.393  1.00 12.44  ? 44   LEU B CD2   1 
ATOM   2111  N  N     . LEU B  1  45   ? 33.534  18.038  125.518  1.00 9.57   ? 45   LEU B N     1 
ATOM   2112  C  CA    . LEU B  1  45   ? 32.309  17.259  125.633  1.00 11.00  ? 45   LEU B CA    1 
ATOM   2113  C  C     . LEU B  1  45   ? 32.005  16.720  127.037  1.00 12.51  ? 45   LEU B C     1 
ATOM   2114  O  O     . LEU B  1  45   ? 30.853  16.703  127.466  1.00 12.26  ? 45   LEU B O     1 
ATOM   2115  C  CB    . LEU B  1  45   ? 32.320  16.127  124.612  1.00 12.62  ? 45   LEU B CB    1 
ATOM   2116  C  CG    . LEU B  1  45   ? 32.313  16.662  123.184  1.00 11.65  ? 45   LEU B CG    1 
ATOM   2117  C  CD1   . LEU B  1  45   ? 32.416  15.530  122.174  1.00 10.50  ? 45   LEU B CD1   1 
ATOM   2118  C  CD2   . LEU B  1  45   ? 31.053  17.477  122.970  1.00 10.21  ? 45   LEU B CD2   1 
ATOM   2119  N  N     . SER B  1  46   ? 33.028  16.213  127.717  1.00 10.97  ? 46   SER B N     1 
ATOM   2120  C  CA    . SER B  1  46   ? 32.846  15.620  129.040  1.00 9.59   ? 46   SER B CA    1 
ATOM   2121  C  C     . SER B  1  46   ? 32.889  16.552  130.255  1.00 13.74  ? 46   SER B C     1 
ATOM   2122  O  O     . SER B  1  46   ? 32.073  16.428  131.165  1.00 19.16  ? 46   SER B O     1 
ATOM   2123  C  CB    . SER B  1  46   ? 33.854  14.488  129.245  1.00 11.23  ? 46   SER B CB    1 
ATOM   2124  O  OG    . SER B  1  46   ? 35.176  14.991  129.309  1.00 11.93  ? 46   SER B OG    1 
ATOM   2125  N  N     . SER B  1  47   ? 33.878  17.439  130.288  1.00 13.35  ? 47   SER B N     1 
ATOM   2126  C  CA    . SER B  1  47   ? 34.247  18.137  131.529  1.00 11.81  ? 47   SER B CA    1 
ATOM   2127  C  C     . SER B  1  47   ? 33.821  19.592  131.774  1.00 11.76  ? 47   SER B C     1 
ATOM   2128  O  O     . SER B  1  47   ? 34.165  20.156  132.809  1.00 11.39  ? 47   SER B O     1 
ATOM   2129  C  CB    . SER B  1  47   ? 35.748  17.988  131.775  1.00 14.93  ? 47   SER B CB    1 
ATOM   2130  O  OG    . SER B  1  47   ? 36.099  16.617  131.837  1.00 14.61  ? 47   SER B OG    1 
ATOM   2131  N  N     . ILE B  1  48   ? 33.128  20.217  130.831  1.00 15.29  ? 48   ILE B N     1 
ATOM   2132  C  CA    . ILE B  1  48   ? 32.802  21.637  130.980  1.00 14.42  ? 48   ILE B CA    1 
ATOM   2133  C  C     . ILE B  1  48   ? 31.528  21.811  131.794  1.00 18.12  ? 48   ILE B C     1 
ATOM   2134  O  O     . ILE B  1  48   ? 30.472  21.318  131.401  1.00 18.86  ? 48   ILE B O     1 
ATOM   2135  C  CB    . ILE B  1  48   ? 32.651  22.351  129.622  1.00 17.89  ? 48   ILE B CB    1 
ATOM   2136  C  CG1   . ILE B  1  48   ? 33.923  22.193  128.778  1.00 16.78  ? 48   ILE B CG1   1 
ATOM   2137  C  CG2   . ILE B  1  48   ? 32.339  23.819  129.832  1.00 12.52  ? 48   ILE B CG2   1 
ATOM   2138  C  CD1   . ILE B  1  48   ? 35.086  23.042  129.234  1.00 11.89  ? 48   ILE B CD1   1 
ATOM   2139  N  N     . PRO B  1  49   ? 31.633  22.508  132.941  1.00 23.69  ? 49   PRO B N     1 
ATOM   2140  C  CA    . PRO B  1  49   ? 30.562  22.678  133.931  1.00 14.72  ? 49   PRO B CA    1 
ATOM   2141  C  C     . PRO B  1  49   ? 29.356  23.430  133.385  1.00 14.45  ? 49   PRO B C     1 
ATOM   2142  O  O     . PRO B  1  49   ? 29.508  24.514  132.823  1.00 12.99  ? 49   PRO B O     1 
ATOM   2143  C  CB    . PRO B  1  49   ? 31.231  23.513  135.021  1.00 14.22  ? 49   PRO B CB    1 
ATOM   2144  C  CG    . PRO B  1  49   ? 32.691  23.307  134.829  1.00 13.01  ? 49   PRO B CG    1 
ATOM   2145  C  CD    . PRO B  1  49   ? 32.866  23.195  133.358  1.00 20.60  ? 49   PRO B CD    1 
ATOM   2146  N  N     . GLY B  1  50   ? 28.172  22.865  133.587  1.00 13.08  ? 50   GLY B N     1 
ATOM   2147  C  CA    . GLY B  1  50   ? 26.936  23.428  133.077  1.00 12.63  ? 50   GLY B CA    1 
ATOM   2148  C  C     . GLY B  1  50   ? 25.760  22.924  133.894  1.00 20.49  ? 50   GLY B C     1 
ATOM   2149  O  O     . GLY B  1  50   ? 25.952  22.290  134.932  1.00 29.14  ? 50   GLY B O     1 
ATOM   2150  N  N     . THR B  1  51   ? 24.542  23.210  133.446  1.00 13.75  ? 51   THR B N     1 
ATOM   2151  C  CA    . THR B  1  51   ? 23.357  22.817  134.201  1.00 15.93  ? 51   THR B CA    1 
ATOM   2152  C  C     . THR B  1  51   ? 22.389  21.972  133.378  1.00 18.47  ? 51   THR B C     1 
ATOM   2153  O  O     . THR B  1  51   ? 22.358  22.065  132.151  1.00 22.72  ? 51   THR B O     1 
ATOM   2154  C  CB    . THR B  1  51   ? 22.591  24.046  134.710  1.00 16.46  ? 51   THR B CB    1 
ATOM   2155  O  OG1   . THR B  1  51   ? 21.612  24.434  133.740  1.00 14.28  ? 51   THR B OG1   1 
ATOM   2156  C  CG2   . THR B  1  51   ? 23.545  25.203  134.964  1.00 20.39  ? 51   THR B CG2   1 
ATOM   2157  N  N     . ALA B  1  52   ? 21.591  21.155  134.060  1.00 15.77  ? 52   ALA B N     1 
ATOM   2158  C  CA    . ALA B  1  52   ? 20.562  20.362  133.398  1.00 14.87  ? 52   ALA B CA    1 
ATOM   2159  C  C     . ALA B  1  52   ? 19.397  20.050  134.322  1.00 15.14  ? 52   ALA B C     1 
ATOM   2160  O  O     . ALA B  1  52   ? 19.566  19.949  135.530  1.00 20.21  ? 52   ALA B O     1 
ATOM   2161  C  CB    . ALA B  1  52   ? 21.150  19.076  132.890  1.00 20.23  ? 52   ALA B CB    1 
ATOM   2162  N  N     . VAL B  1  53   ? 18.221  19.849  133.744  1.00 12.74  ? 53   VAL B N     1 
ATOM   2163  C  CA    . VAL B  1  53   ? 17.091  19.403  134.527  1.00 15.79  ? 53   VAL B CA    1 
ATOM   2164  C  C     . VAL B  1  53   ? 17.240  17.906  134.762  1.00 22.52  ? 53   VAL B C     1 
ATOM   2165  O  O     . VAL B  1  53   ? 17.205  17.115  133.819  1.00 25.24  ? 53   VAL B O     1 
ATOM   2166  C  CB    . VAL B  1  53   ? 15.786  19.650  133.768  1.00 15.29  ? 53   VAL B CB    1 
ATOM   2167  C  CG1   . VAL B  1  53   ? 14.624  18.935  134.447  1.00 22.49  ? 53   VAL B CG1   1 
ATOM   2168  C  CG2   . VAL B  1  53   ? 15.526  21.136  133.650  1.00 17.36  ? 53   VAL B CG2   1 
ATOM   2169  N  N     . THR B  1  54   ? 17.419  17.520  136.023  1.00 23.55  ? 54   THR B N     1 
ATOM   2170  C  CA    . THR B  1  54   ? 17.604  16.112  136.366  1.00 28.61  ? 54   THR B CA    1 
ATOM   2171  C  C     . THR B  1  54   ? 16.359  15.332  136.809  1.00 29.79  ? 54   THR B C     1 
ATOM   2172  O  O     . THR B  1  54   ? 16.361  14.100  136.776  1.00 26.15  ? 54   THR B O     1 
ATOM   2173  C  CB    . THR B  1  54   ? 18.676  15.968  137.460  1.00 31.41  ? 54   THR B CB    1 
ATOM   2174  O  OG1   . THR B  1  54   ? 18.442  16.944  138.479  1.00 28.89  ? 54   THR B OG1   1 
ATOM   2175  C  CG2   . THR B  1  54   ? 20.060  16.197  136.881  1.00 32.08  ? 54   THR B CG2   1 
ATOM   2176  N  N     . SER B  1  55   ? 15.296  16.032  137.199  1.00 31.75  ? 55   SER B N     1 
ATOM   2177  C  CA    . SER B  1  55   ? 14.099  15.352  137.710  1.00 35.91  ? 55   SER B CA    1 
ATOM   2178  C  C     . SER B  1  55   ? 12.835  16.189  137.533  1.00 31.07  ? 55   SER B C     1 
ATOM   2179  O  O     . SER B  1  55   ? 12.887  17.410  137.610  1.00 32.16  ? 55   SER B O     1 
ATOM   2180  C  CB    . SER B  1  55   ? 14.285  14.976  139.186  1.00 40.20  ? 55   SER B CB    1 
ATOM   2181  O  OG    . SER B  1  55   ? 13.450  13.889  139.558  1.00 39.37  ? 55   SER B OG    1 
ATOM   2182  N  N     . VAL B  1  56   ? 11.699  15.534  137.305  1.00 30.83  ? 56   VAL B N     1 
ATOM   2183  C  CA    . VAL B  1  56   ? 10.437  16.251  137.126  1.00 33.00  ? 56   VAL B CA    1 
ATOM   2184  C  C     . VAL B  1  56   ? 9.276   15.564  137.831  1.00 38.66  ? 56   VAL B C     1 
ATOM   2185  O  O     . VAL B  1  56   ? 9.056   14.366  137.644  1.00 39.18  ? 56   VAL B O     1 
ATOM   2186  C  CB    . VAL B  1  56   ? 10.068  16.405  135.637  1.00 31.03  ? 56   VAL B CB    1 
ATOM   2187  C  CG1   . VAL B  1  56   ? 8.685   17.018  135.489  1.00 32.14  ? 56   VAL B CG1   1 
ATOM   2188  C  CG2   . VAL B  1  56   ? 11.088  17.261  134.928  1.00 41.09  ? 56   VAL B CG2   1 
ATOM   2189  N  N     . TYR B  1  57   ? 8.537   16.328  138.636  1.00 37.21  ? 57   TYR B N     1 
ATOM   2190  C  CA    . TYR B  1  57   ? 7.294   15.844  139.231  1.00 37.00  ? 57   TYR B CA    1 
ATOM   2191  C  C     . TYR B  1  57   ? 6.124   16.608  138.639  1.00 33.71  ? 57   TYR B C     1 
ATOM   2192  O  O     . TYR B  1  57   ? 6.164   17.828  138.568  1.00 27.31  ? 57   TYR B O     1 
ATOM   2193  C  CB    . TYR B  1  57   ? 7.310   16.014  140.754  1.00 46.85  ? 57   TYR B CB    1 
ATOM   2194  C  CG    . TYR B  1  57   ? 5.944   15.882  141.412  1.00 56.00  ? 57   TYR B CG    1 
ATOM   2195  C  CD1   . TYR B  1  57   ? 5.342   14.637  141.582  1.00 51.89  ? 57   TYR B CD1   1 
ATOM   2196  C  CD2   . TYR B  1  57   ? 5.261   17.005  141.869  1.00 50.52  ? 57   TYR B CD2   1 
ATOM   2197  C  CE1   . TYR B  1  57   ? 4.097   14.518  142.185  1.00 47.90  ? 57   TYR B CE1   1 
ATOM   2198  C  CE2   . TYR B  1  57   ? 4.018   16.894  142.470  1.00 51.07  ? 57   TYR B CE2   1 
ATOM   2199  C  CZ    . TYR B  1  57   ? 3.441   15.651  142.625  1.00 53.92  ? 57   TYR B CZ    1 
ATOM   2200  O  OH    . TYR B  1  57   ? 2.205   15.547  143.225  1.00 55.02  ? 57   TYR B OH    1 
ATOM   2201  N  N     . ILE B  1  58   ? 5.090   15.892  138.203  1.00 37.17  ? 58   ILE B N     1 
ATOM   2202  C  CA    . ILE B  1  58   ? 3.885   16.539  137.685  1.00 44.34  ? 58   ILE B CA    1 
ATOM   2203  C  C     . ILE B  1  58   ? 2.644   16.001  138.382  1.00 50.55  ? 58   ILE B C     1 
ATOM   2204  O  O     . ILE B  1  58   ? 2.486   14.787  138.524  1.00 49.17  ? 58   ILE B O     1 
ATOM   2205  C  CB    . ILE B  1  58   ? 3.727   16.354  136.161  1.00 45.75  ? 58   ILE B CB    1 
ATOM   2206  C  CG1   . ILE B  1  58   ? 4.994   16.794  135.426  1.00 43.64  ? 58   ILE B CG1   1 
ATOM   2207  C  CG2   . ILE B  1  58   ? 2.538   17.149  135.654  1.00 42.36  ? 58   ILE B CG2   1 
ATOM   2208  C  CD1   . ILE B  1  58   ? 4.965   16.511  133.945  1.00 33.64  ? 58   ILE B CD1   1 
ATOM   2209  N  N     . GLU B  1  59   ? 1.773   16.914  138.815  1.00 54.23  ? 59   GLU B N     1 
ATOM   2210  C  CA    . GLU B  1  59   ? 0.560   16.565  139.555  1.00 58.75  ? 59   GLU B CA    1 
ATOM   2211  C  C     . GLU B  1  59   ? -0.343  15.601  138.796  1.00 59.61  ? 59   GLU B C     1 
ATOM   2212  O  O     . GLU B  1  59   ? -0.608  15.790  137.608  1.00 57.00  ? 59   GLU B O     1 
ATOM   2213  C  CB    . GLU B  1  59   ? -0.240  17.819  139.926  1.00 65.22  ? 59   GLU B CB    1 
ATOM   2214  C  CG    . GLU B  1  59   ? 0.146   18.455  141.255  1.00 73.29  ? 59   GLU B CG    1 
ATOM   2215  C  CD    . GLU B  1  59   ? -0.883  19.468  141.734  1.00 72.28  ? 59   GLU B CD    1 
ATOM   2216  O  OE1   . GLU B  1  59   ? -0.510  20.391  142.492  1.00 67.47  ? 59   GLU B OE1   1 
ATOM   2217  O  OE2   . GLU B  1  59   ? -2.066  19.337  141.353  1.00 64.20  ? 59   GLU B OE2   1 
ATOM   2218  N  N     . ASP B  1  60   ? -0.807  14.574  139.506  1.00 57.90  ? 60   ASP B N     1 
ATOM   2219  C  CA    . ASP B  1  60   ? -1.701  13.555  138.958  1.00 63.37  ? 60   ASP B CA    1 
ATOM   2220  C  C     . ASP B  1  60   ? -1.065  12.803  137.787  1.00 62.93  ? 60   ASP B C     1 
ATOM   2221  O  O     . ASP B  1  60   ? -1.767  12.213  136.963  1.00 61.85  ? 60   ASP B O     1 
ATOM   2222  C  CB    . ASP B  1  60   ? -3.045  14.168  138.537  1.00 68.48  ? 60   ASP B CB    1 
ATOM   2223  C  CG    . ASP B  1  60   ? -3.773  14.844  139.691  1.00 73.48  ? 60   ASP B CG    1 
ATOM   2224  O  OD1   . ASP B  1  60   ? -3.968  14.195  140.743  1.00 72.93  ? 60   ASP B OD1   1 
ATOM   2225  O  OD2   . ASP B  1  60   ? -4.149  16.029  139.547  1.00 69.99  ? 60   ASP B OD2   1 
ATOM   2226  N  N     . VAL B  1  61   ? 0.264   12.812  137.734  1.00 61.13  ? 61   VAL B N     1 
ATOM   2227  C  CA    . VAL B  1  61   ? 0.998   12.105  136.690  1.00 52.99  ? 61   VAL B CA    1 
ATOM   2228  C  C     . VAL B  1  61   ? 1.844   11.004  137.304  1.00 51.57  ? 61   VAL B C     1 
ATOM   2229  O  O     . VAL B  1  61   ? 2.758   11.269  138.084  1.00 53.17  ? 61   VAL B O     1 
ATOM   2230  C  CB    . VAL B  1  61   ? 1.900   13.049  135.877  1.00 46.83  ? 61   VAL B CB    1 
ATOM   2231  C  CG1   . VAL B  1  61   ? 2.811   12.250  134.968  1.00 51.15  ? 61   VAL B CG1   1 
ATOM   2232  C  CG2   . VAL B  1  61   ? 1.058   14.012  135.064  1.00 46.89  ? 61   VAL B CG2   1 
ATOM   2233  N  N     . LEU B  1  62   ? 1.532   9.765   136.945  1.00 52.49  ? 62   LEU B N     1 
ATOM   2234  C  CA    . LEU B  1  62   ? 2.172   8.610   137.558  1.00 56.98  ? 62   LEU B CA    1 
ATOM   2235  C  C     . LEU B  1  62   ? 3.582   8.385   137.022  1.00 59.48  ? 62   LEU B C     1 
ATOM   2236  O  O     . LEU B  1  62   ? 4.561   8.547   137.752  1.00 58.15  ? 62   LEU B O     1 
ATOM   2237  C  CB    . LEU B  1  62   ? 1.308   7.363   137.363  1.00 62.85  ? 62   LEU B CB    1 
ATOM   2238  C  CG    . LEU B  1  62   ? -0.151  7.558   137.790  1.00 69.53  ? 62   LEU B CG    1 
ATOM   2239  C  CD1   . LEU B  1  62   ? -0.984  6.308   137.539  1.00 50.92  ? 62   LEU B CD1   1 
ATOM   2240  C  CD2   . LEU B  1  62   ? -0.226  7.981   139.252  1.00 62.98  ? 62   LEU B CD2   1 
ATOM   2241  N  N     . HIS B  1  63   ? 3.683   8.022   135.746  1.00 65.44  ? 63   HIS B N     1 
ATOM   2242  C  CA    . HIS B  1  63   ? 4.979   7.719   135.139  1.00 60.98  ? 63   HIS B CA    1 
ATOM   2243  C  C     . HIS B  1  63   ? 5.250   8.488   133.846  1.00 56.58  ? 63   HIS B C     1 
ATOM   2244  O  O     . HIS B  1  63   ? 4.472   9.354   133.446  1.00 53.26  ? 63   HIS B O     1 
ATOM   2245  C  CB    . HIS B  1  63   ? 5.137   6.212   134.913  1.00 63.36  ? 63   HIS B CB    1 
ATOM   2246  C  CG    . HIS B  1  63   ? 3.956   5.568   134.253  1.00 71.29  ? 63   HIS B CG    1 
ATOM   2247  N  ND1   . HIS B  1  63   ? 3.613   5.807   132.939  1.00 68.83  ? 63   HIS B ND1   1 
ATOM   2248  C  CD2   . HIS B  1  63   ? 3.042   4.685   134.725  1.00 76.98  ? 63   HIS B CD2   1 
ATOM   2249  C  CE1   . HIS B  1  63   ? 2.538   5.102   132.631  1.00 77.29  ? 63   HIS B CE1   1 
ATOM   2250  N  NE2   . HIS B  1  63   ? 2.172   4.413   133.698  1.00 83.70  ? 63   HIS B NE2   1 
ATOM   2251  N  N     . GLU B  1  64   ? 6.366   8.158   133.205  1.00 57.76  ? 64   GLU B N     1 
ATOM   2252  C  CA    . GLU B  1  64   ? 6.850   8.875   132.025  1.00 58.46  ? 64   GLU B CA    1 
ATOM   2253  C  C     . GLU B  1  64   ? 5.972   8.675   130.785  1.00 54.19  ? 64   GLU B C     1 
ATOM   2254  O  O     . GLU B  1  64   ? 5.879   9.553   129.928  1.00 50.15  ? 64   GLU B O     1 
ATOM   2255  C  CB    . GLU B  1  64   ? 8.296   8.453   131.730  1.00 56.02  ? 64   GLU B CB    1 
ATOM   2256  C  CG    . GLU B  1  64   ? 9.035   9.320   130.721  1.00 53.34  ? 64   GLU B CG    1 
ATOM   2257  C  CD    . GLU B  1  64   ? 10.539  9.079   130.733  1.00 54.91  ? 64   GLU B CD    1 
ATOM   2258  O  OE1   . GLU B  1  64   ? 11.277  9.908   130.159  1.00 47.64  ? 64   GLU B OE1   1 
ATOM   2259  O  OE2   . GLU B  1  64   ? 10.985  8.066   131.319  1.00 48.93  ? 64   GLU B OE2   1 
ATOM   2260  N  N     . PHE B  1  65   ? 5.332   7.516   130.692  1.00 55.49  ? 65   PHE B N     1 
ATOM   2261  C  CA    . PHE B  1  65   ? 4.544   7.169   129.514  1.00 56.43  ? 65   PHE B CA    1 
ATOM   2262  C  C     . PHE B  1  65   ? 3.060   7.479   129.660  1.00 63.38  ? 65   PHE B C     1 
ATOM   2263  O  O     . PHE B  1  65   ? 2.258   7.152   128.786  1.00 62.21  ? 65   PHE B O     1 
ATOM   2264  C  CB    . PHE B  1  65   ? 4.769   5.707   129.144  1.00 57.10  ? 65   PHE B CB    1 
ATOM   2265  C  CG    . PHE B  1  65   ? 6.194   5.396   128.828  1.00 58.43  ? 65   PHE B CG    1 
ATOM   2266  C  CD1   . PHE B  1  65   ? 6.703   5.641   127.566  1.00 55.64  ? 65   PHE B CD1   1 
ATOM   2267  C  CD2   . PHE B  1  65   ? 7.039   4.897   129.803  1.00 60.17  ? 65   PHE B CD2   1 
ATOM   2268  C  CE1   . PHE B  1  65   ? 8.021   5.371   127.275  1.00 56.42  ? 65   PHE B CE1   1 
ATOM   2269  C  CE2   . PHE B  1  65   ? 8.361   4.627   129.519  1.00 59.71  ? 65   PHE B CE2   1 
ATOM   2270  C  CZ    . PHE B  1  65   ? 8.853   4.863   128.252  1.00 59.31  ? 65   PHE B CZ    1 
ATOM   2271  N  N     . SER B  1  66   ? 2.699   8.109   130.771  1.00 65.25  ? 66   SER B N     1 
ATOM   2272  C  CA    . SER B  1  66   ? 1.311   8.462   131.020  1.00 60.18  ? 66   SER B CA    1 
ATOM   2273  C  C     . SER B  1  66   ? 0.891   9.605   130.108  1.00 61.65  ? 66   SER B C     1 
ATOM   2274  O  O     . SER B  1  66   ? 1.689   10.111  129.317  1.00 54.73  ? 66   SER B O     1 
ATOM   2275  C  CB    . SER B  1  66   ? 1.129   8.881   132.479  1.00 67.43  ? 66   SER B CB    1 
ATOM   2276  O  OG    . SER B  1  66   ? 1.717   7.940   133.359  1.00 68.68  ? 66   SER B OG    1 
ATOM   2277  N  N     . THR B  1  67   ? -0.367  10.010  130.224  1.00 64.77  ? 67   THR B N     1 
ATOM   2278  C  CA    . THR B  1  67   ? -0.865  11.151  129.472  1.00 64.27  ? 67   THR B CA    1 
ATOM   2279  C  C     . THR B  1  67   ? -1.528  12.140  130.423  1.00 65.09  ? 67   THR B C     1 
ATOM   2280  O  O     . THR B  1  67   ? -2.038  11.755  131.477  1.00 65.72  ? 67   THR B O     1 
ATOM   2281  C  CB    . THR B  1  67   ? -1.859  10.723  128.377  1.00 56.56  ? 67   THR B CB    1 
ATOM   2282  O  OG1   . THR B  1  67   ? -2.350  11.883  127.695  1.00 62.69  ? 67   THR B OG1   1 
ATOM   2283  C  CG2   . THR B  1  67   ? -3.027  9.961   128.984  1.00 66.56  ? 67   THR B CG2   1 
ATOM   2284  N  N     . ILE B  1  68   ? -1.503  13.416  130.056  1.00 54.18  ? 68   ILE B N     1 
ATOM   2285  C  CA    . ILE B  1  68   ? -2.120  14.452  130.866  1.00 43.74  ? 68   ILE B CA    1 
ATOM   2286  C  C     . ILE B  1  68   ? -3.362  14.993  130.177  1.00 59.75  ? 68   ILE B C     1 
ATOM   2287  O  O     . ILE B  1  68   ? -3.283  15.500  129.056  1.00 59.91  ? 68   ILE B O     1 
ATOM   2288  C  CB    . ILE B  1  68   ? -1.164  15.620  131.101  1.00 47.68  ? 68   ILE B CB    1 
ATOM   2289  C  CG1   . ILE B  1  68   ? 0.164   15.118  131.663  1.00 53.74  ? 68   ILE B CG1   1 
ATOM   2290  C  CG2   . ILE B  1  68   ? -1.797  16.641  132.030  1.00 56.69  ? 68   ILE B CG2   1 
ATOM   2291  C  CD1   . ILE B  1  68   ? 1.206   16.208  131.806  1.00 58.33  ? 68   ILE B CD1   1 
ATOM   2292  N  N     . PRO B  1  69   ? -4.520  14.870  130.841  1.00 63.30  ? 69   PRO B N     1 
ATOM   2293  C  CA    . PRO B  1  69   ? -5.765  15.441  130.319  1.00 51.18  ? 69   PRO B CA    1 
ATOM   2294  C  C     . PRO B  1  69   ? -5.692  16.963  130.311  1.00 52.76  ? 69   PRO B C     1 
ATOM   2295  O  O     . PRO B  1  69   ? -5.172  17.552  131.260  1.00 51.77  ? 69   PRO B O     1 
ATOM   2296  C  CB    . PRO B  1  69   ? -6.814  14.968  131.329  1.00 48.65  ? 69   PRO B CB    1 
ATOM   2297  C  CG    . PRO B  1  69   ? -6.210  13.759  131.970  1.00 48.39  ? 69   PRO B CG    1 
ATOM   2298  C  CD    . PRO B  1  69   ? -4.749  14.063  132.051  1.00 50.65  ? 69   PRO B CD    1 
ATOM   2299  N  N     . GLY B  1  70   ? -6.192  17.587  129.249  1.00 53.23  ? 70   GLY B N     1 
ATOM   2300  C  CA    . GLY B  1  70   ? -6.209  19.036  129.160  1.00 56.02  ? 70   GLY B CA    1 
ATOM   2301  C  C     . GLY B  1  70   ? -4.909  19.635  128.658  1.00 58.15  ? 70   GLY B C     1 
ATOM   2302  O  O     . GLY B  1  70   ? -4.776  20.857  128.553  1.00 57.24  ? 70   GLY B O     1 
ATOM   2303  N  N     . VAL B  1  71   ? -3.945  18.772  128.353  1.00 58.50  ? 71   VAL B N     1 
ATOM   2304  C  CA    . VAL B  1  71   ? -2.680  19.205  127.770  1.00 49.07  ? 71   VAL B CA    1 
ATOM   2305  C  C     . VAL B  1  71   ? -2.424  18.452  126.467  1.00 41.33  ? 71   VAL B C     1 
ATOM   2306  O  O     . VAL B  1  71   ? -2.499  17.222  126.428  1.00 34.56  ? 71   VAL B O     1 
ATOM   2307  C  CB    . VAL B  1  71   ? -1.500  18.993  128.738  1.00 41.82  ? 71   VAL B CB    1 
ATOM   2308  C  CG1   . VAL B  1  71   ? -0.206  19.452  128.097  1.00 40.40  ? 71   VAL B CG1   1 
ATOM   2309  C  CG2   . VAL B  1  71   ? -1.734  19.743  130.037  1.00 46.50  ? 71   VAL B CG2   1 
ATOM   2310  N  N     . LYS B  1  72   ? -2.128  19.200  125.405  1.00 46.11  ? 72   LYS B N     1 
ATOM   2311  C  CA    . LYS B  1  72   ? -1.928  18.625  124.075  1.00 44.52  ? 72   LYS B CA    1 
ATOM   2312  C  C     . LYS B  1  72   ? -0.706  17.707  124.007  1.00 40.25  ? 72   LYS B C     1 
ATOM   2313  O  O     . LYS B  1  72   ? -0.778  16.614  123.447  1.00 40.58  ? 72   LYS B O     1 
ATOM   2314  C  CB    . LYS B  1  72   ? -1.852  19.732  123.012  1.00 44.83  ? 72   LYS B CB    1 
ATOM   2315  C  CG    . LYS B  1  72   ? -1.504  19.244  121.605  1.00 60.75  ? 72   LYS B CG    1 
ATOM   2316  C  CD    . LYS B  1  72   ? -2.093  20.142  120.509  1.00 58.72  ? 72   LYS B CD    1 
ATOM   2317  C  CE    . LYS B  1  72   ? -1.609  21.589  120.602  1.00 62.42  ? 72   LYS B CE    1 
ATOM   2318  N  NZ    . LYS B  1  72   ? -0.153  21.752  120.317  1.00 49.17  ? 72   LYS B NZ    1 
ATOM   2319  N  N     . GLU B  1  73   ? 0.407   18.148  124.586  1.00 37.72  ? 73   GLU B N     1 
ATOM   2320  C  CA    . GLU B  1  73   ? 1.615   17.330  124.651  1.00 31.84  ? 73   GLU B CA    1 
ATOM   2321  C  C     . GLU B  1  73   ? 1.475   16.217  125.683  1.00 35.14  ? 73   GLU B C     1 
ATOM   2322  O  O     . GLU B  1  73   ? 0.841   16.405  126.717  1.00 42.44  ? 73   GLU B O     1 
ATOM   2323  C  CB    . GLU B  1  73   ? 2.823   18.192  125.022  1.00 32.76  ? 73   GLU B CB    1 
ATOM   2324  C  CG    . GLU B  1  73   ? 3.197   19.247  123.994  1.00 43.73  ? 73   GLU B CG    1 
ATOM   2325  C  CD    . GLU B  1  73   ? 2.373   20.509  124.114  1.00 42.67  ? 73   GLU B CD    1 
ATOM   2326  O  OE1   . GLU B  1  73   ? 1.399   20.514  124.896  1.00 41.75  ? 73   GLU B OE1   1 
ATOM   2327  O  OE2   . GLU B  1  73   ? 2.705   21.498  123.427  1.00 44.56  ? 73   GLU B OE2   1 
ATOM   2328  N  N     . ASP B  1  74   ? 2.067   15.058  125.408  1.00 36.40  ? 74   ASP B N     1 
ATOM   2329  C  CA    . ASP B  1  74   ? 2.151   14.011  126.423  1.00 37.94  ? 74   ASP B CA    1 
ATOM   2330  C  C     . ASP B  1  74   ? 3.311   14.310  127.369  1.00 33.62  ? 74   ASP B C     1 
ATOM   2331  O  O     . ASP B  1  74   ? 3.994   15.319  127.207  1.00 37.76  ? 74   ASP B O     1 
ATOM   2332  C  CB    . ASP B  1  74   ? 2.269   12.610  125.804  1.00 42.12  ? 74   ASP B CB    1 
ATOM   2333  C  CG    . ASP B  1  74   ? 3.436   12.478  124.836  1.00 44.21  ? 74   ASP B CG    1 
ATOM   2334  O  OD1   . ASP B  1  74   ? 4.322   13.362  124.819  1.00 39.92  ? 74   ASP B OD1   1 
ATOM   2335  O  OD2   . ASP B  1  74   ? 3.468   11.469  124.094  1.00 38.59  ? 74   ASP B OD2   1 
ATOM   2336  N  N     . VAL B  1  75   ? 3.527   13.443  128.353  1.00 33.88  ? 75   VAL B N     1 
ATOM   2337  C  CA    . VAL B  1  75   ? 4.565   13.672  129.355  1.00 39.62  ? 75   VAL B CA    1 
ATOM   2338  C  C     . VAL B  1  75   ? 5.946   13.758  128.709  1.00 30.89  ? 75   VAL B C     1 
ATOM   2339  O  O     . VAL B  1  75   ? 6.732   14.678  128.983  1.00 21.83  ? 75   VAL B O     1 
ATOM   2340  C  CB    . VAL B  1  75   ? 4.566   12.555  130.411  1.00 35.31  ? 75   VAL B CB    1 
ATOM   2341  C  CG1   . VAL B  1  75   ? 5.595   12.844  131.489  1.00 33.77  ? 75   VAL B CG1   1 
ATOM   2342  C  CG2   . VAL B  1  75   ? 3.188   12.409  131.016  1.00 34.71  ? 75   VAL B CG2   1 
ATOM   2343  N  N     . VAL B  1  76   ? 6.211   12.797  127.830  1.00 28.89  ? 76   VAL B N     1 
ATOM   2344  C  CA    . VAL B  1  76   ? 7.482   12.688  127.127  1.00 29.97  ? 76   VAL B CA    1 
ATOM   2345  C  C     . VAL B  1  76   ? 7.910   13.992  126.465  1.00 27.94  ? 76   VAL B C     1 
ATOM   2346  O  O     . VAL B  1  76   ? 9.019   14.480  126.692  1.00 21.61  ? 76   VAL B O     1 
ATOM   2347  C  CB    . VAL B  1  76   ? 7.399   11.612  126.038  1.00 25.36  ? 76   VAL B CB    1 
ATOM   2348  C  CG1   . VAL B  1  76   ? 8.617   11.681  125.137  1.00 30.66  ? 76   VAL B CG1   1 
ATOM   2349  C  CG2   . VAL B  1  76   ? 7.253   10.232  126.665  1.00 39.15  ? 76   VAL B CG2   1 
ATOM   2350  N  N     . GLU B  1  77   ? 7.019   14.550  125.650  1.00 28.35  ? 77   GLU B N     1 
ATOM   2351  C  CA    . GLU B  1  77   ? 7.319   15.760  124.902  1.00 24.59  ? 77   GLU B CA    1 
ATOM   2352  C  C     . GLU B  1  77   ? 7.657   16.908  125.839  1.00 25.76  ? 77   GLU B C     1 
ATOM   2353  O  O     . GLU B  1  77   ? 8.556   17.703  125.557  1.00 26.02  ? 77   GLU B O     1 
ATOM   2354  C  CB    . GLU B  1  77   ? 6.145   16.138  124.001  1.00 28.28  ? 77   GLU B CB    1 
ATOM   2355  C  CG    . GLU B  1  77   ? 6.468   17.222  122.975  1.00 36.94  ? 77   GLU B CG    1 
ATOM   2356  C  CD    . GLU B  1  77   ? 7.261   16.708  121.777  1.00 35.13  ? 77   GLU B CD    1 
ATOM   2357  O  OE1   . GLU B  1  77   ? 7.786   17.547  121.015  1.00 32.29  ? 77   GLU B OE1   1 
ATOM   2358  O  OE2   . GLU B  1  77   ? 7.351   15.474  121.588  1.00 32.89  ? 77   GLU B OE2   1 
ATOM   2359  N  N     . ILE B  1  78   ? 6.944   16.984  126.959  1.00 28.95  ? 78   ILE B N     1 
ATOM   2360  C  CA    . ILE B  1  78   ? 7.198   18.034  127.938  1.00 29.57  ? 78   ILE B CA    1 
ATOM   2361  C  C     . ILE B  1  78   ? 8.586   17.858  128.527  1.00 23.74  ? 78   ILE B C     1 
ATOM   2362  O  O     . ILE B  1  78   ? 9.331   18.825  128.677  1.00 25.09  ? 78   ILE B O     1 
ATOM   2363  C  CB    . ILE B  1  78   ? 6.169   18.038  129.084  1.00 29.89  ? 78   ILE B CB    1 
ATOM   2364  C  CG1   . ILE B  1  78   ? 4.746   18.063  128.533  1.00 28.76  ? 78   ILE B CG1   1 
ATOM   2365  C  CG2   . ILE B  1  78   ? 6.398   19.236  130.000  1.00 20.01  ? 78   ILE B CG2   1 
ATOM   2366  C  CD1   . ILE B  1  78   ? 3.689   17.988  129.605  1.00 32.03  ? 78   ILE B CD1   1 
ATOM   2367  N  N     . ILE B  1  79   ? 8.933   16.617  128.850  1.00 22.78  ? 79   ILE B N     1 
ATOM   2368  C  CA    . ILE B  1  79   ? 10.249  16.341  129.409  1.00 24.44  ? 79   ILE B CA    1 
ATOM   2369  C  C     . ILE B  1  79   ? 11.336  16.746  128.419  1.00 26.16  ? 79   ILE B C     1 
ATOM   2370  O  O     . ILE B  1  79   ? 12.332  17.365  128.798  1.00 24.34  ? 79   ILE B O     1 
ATOM   2371  C  CB    . ILE B  1  79   ? 10.413  14.859  129.781  1.00 25.52  ? 79   ILE B CB    1 
ATOM   2372  C  CG1   . ILE B  1  79   ? 9.355   14.445  130.802  1.00 28.31  ? 79   ILE B CG1   1 
ATOM   2373  C  CG2   . ILE B  1  79   ? 11.792  14.602  130.345  1.00 19.88  ? 79   ILE B CG2   1 
ATOM   2374  C  CD1   . ILE B  1  79   ? 9.339   12.956  131.090  1.00 39.07  ? 79   ILE B CD1   1 
ATOM   2375  N  N     . LEU B  1  80   ? 11.129  16.406  127.148  1.00 27.85  ? 80   LEU B N     1 
ATOM   2376  C  CA    . LEU B  1  80   ? 12.076  16.756  126.093  1.00 20.52  ? 80   LEU B CA    1 
ATOM   2377  C  C     . LEU B  1  80   ? 12.253  18.263  126.012  1.00 22.00  ? 80   LEU B C     1 
ATOM   2378  O  O     . LEU B  1  80   ? 13.378  18.758  125.983  1.00 22.24  ? 80   LEU B O     1 
ATOM   2379  C  CB    . LEU B  1  80   ? 11.621  16.196  124.747  1.00 17.84  ? 80   LEU B CB    1 
ATOM   2380  C  CG    . LEU B  1  80   ? 11.666  14.671  124.664  1.00 17.29  ? 80   LEU B CG    1 
ATOM   2381  C  CD1   . LEU B  1  80   ? 11.352  14.181  123.259  1.00 14.77  ? 80   LEU B CD1   1 
ATOM   2382  C  CD2   . LEU B  1  80   ? 13.024  14.171  125.125  1.00 17.45  ? 80   LEU B CD2   1 
ATOM   2383  N  N     . ASN B  1  81   ? 11.137  18.986  125.990  1.00 22.29  ? 81   ASN B N     1 
ATOM   2384  C  CA    . ASN B  1  81   ? 11.165  20.443  126.030  1.00 20.57  ? 81   ASN B CA    1 
ATOM   2385  C  C     . ASN B  1  81   ? 11.999  20.944  127.203  1.00 20.86  ? 81   ASN B C     1 
ATOM   2386  O  O     . ASN B  1  81   ? 12.814  21.861  127.063  1.00 18.97  ? 81   ASN B O     1 
ATOM   2387  C  CB    . ASN B  1  81   ? 9.742   20.993  126.117  1.00 19.28  ? 81   ASN B CB    1 
ATOM   2388  C  CG    . ASN B  1  81   ? 9.003   20.905  124.797  1.00 26.53  ? 81   ASN B CG    1 
ATOM   2389  O  OD1   . ASN B  1  81   ? 9.444   21.456  123.786  1.00 31.83  ? 81   ASN B OD1   1 
ATOM   2390  N  ND2   . ASN B  1  81   ? 7.877   20.200  124.793  1.00 23.12  ? 81   ASN B ND2   1 
ATOM   2391  N  N     . LEU B  1  82   ? 11.803  20.312  128.354  1.00 20.40  ? 82   LEU B N     1 
ATOM   2392  C  CA    . LEU B  1  82   ? 12.534  20.665  129.561  1.00 23.56  ? 82   LEU B CA    1 
ATOM   2393  C  C     . LEU B  1  82   ? 14.027  20.420  129.412  1.00 23.12  ? 82   LEU B C     1 
ATOM   2394  O  O     . LEU B  1  82   ? 14.837  21.151  129.978  1.00 24.70  ? 82   LEU B O     1 
ATOM   2395  C  CB    . LEU B  1  82   ? 11.994  19.885  130.757  1.00 29.22  ? 82   LEU B CB    1 
ATOM   2396  C  CG    . LEU B  1  82   ? 10.638  20.354  131.276  1.00 28.22  ? 82   LEU B CG    1 
ATOM   2397  C  CD1   . LEU B  1  82   ? 10.080  19.352  132.263  1.00 22.65  ? 82   LEU B CD1   1 
ATOM   2398  C  CD2   . LEU B  1  82   ? 10.773  21.726  131.912  1.00 27.87  ? 82   LEU B CD2   1 
ATOM   2399  N  N     . LYS B  1  83   ? 14.387  19.386  128.657  1.00 20.68  ? 83   LYS B N     1 
ATOM   2400  C  CA    . LYS B  1  83   ? 15.787  19.100  128.383  1.00 16.47  ? 83   LYS B CA    1 
ATOM   2401  C  C     . LYS B  1  83   ? 16.419  20.276  127.659  1.00 22.77  ? 83   LYS B C     1 
ATOM   2402  O  O     . LYS B  1  83   ? 17.576  20.621  127.901  1.00 21.78  ? 83   LYS B O     1 
ATOM   2403  C  CB    . LYS B  1  83   ? 15.919  17.859  127.512  1.00 17.12  ? 83   LYS B CB    1 
ATOM   2404  C  CG    . LYS B  1  83   ? 15.884  16.537  128.241  1.00 21.45  ? 83   LYS B CG    1 
ATOM   2405  C  CD    . LYS B  1  83   ? 15.845  15.404  127.227  1.00 18.62  ? 83   LYS B CD    1 
ATOM   2406  C  CE    . LYS B  1  83   ? 16.127  14.060  127.854  1.00 17.92  ? 83   LYS B CE    1 
ATOM   2407  N  NZ    . LYS B  1  83   ? 15.860  12.978  126.869  1.00 23.56  ? 83   LYS B NZ    1 
ATOM   2408  N  N     . GLU B  1  84   ? 15.646  20.894  126.770  1.00 23.41  ? 84   GLU B N     1 
ATOM   2409  C  CA    . GLU B  1  84   ? 16.160  21.980  125.945  1.00 24.74  ? 84   GLU B CA    1 
ATOM   2410  C  C     . GLU B  1  84   ? 16.260  23.286  126.710  1.00 28.89  ? 84   GLU B C     1 
ATOM   2411  O  O     . GLU B  1  84   ? 16.819  24.261  126.211  1.00 38.46  ? 84   GLU B O     1 
ATOM   2412  C  CB    . GLU B  1  84   ? 15.317  22.160  124.683  1.00 26.46  ? 84   GLU B CB    1 
ATOM   2413  C  CG    . GLU B  1  84   ? 15.550  21.080  123.640  1.00 27.67  ? 84   GLU B CG    1 
ATOM   2414  C  CD    . GLU B  1  84   ? 14.893  21.397  122.312  1.00 46.67  ? 84   GLU B CD    1 
ATOM   2415  O  OE1   . GLU B  1  84   ? 14.306  22.495  122.182  1.00 47.11  ? 84   GLU B OE1   1 
ATOM   2416  O  OE2   . GLU B  1  84   ? 14.965  20.546  121.398  1.00 49.86  ? 84   GLU B OE2   1 
ATOM   2417  N  N     . LEU B  1  85   ? 15.727  23.298  127.926  1.00 29.85  ? 85   LEU B N     1 
ATOM   2418  C  CA    . LEU B  1  85   ? 15.804  24.476  128.783  1.00 33.90  ? 85   LEU B CA    1 
ATOM   2419  C  C     . LEU B  1  85   ? 17.250  24.800  129.170  1.00 28.34  ? 85   LEU B C     1 
ATOM   2420  O  O     . LEU B  1  85   ? 17.973  23.950  129.685  1.00 32.72  ? 85   LEU B O     1 
ATOM   2421  C  CB    . LEU B  1  85   ? 14.944  24.270  130.033  1.00 31.33  ? 85   LEU B CB    1 
ATOM   2422  C  CG    . LEU B  1  85   ? 14.940  25.365  131.097  1.00 31.29  ? 85   LEU B CG    1 
ATOM   2423  C  CD1   . LEU B  1  85   ? 14.446  26.678  130.513  1.00 38.28  ? 85   LEU B CD1   1 
ATOM   2424  C  CD2   . LEU B  1  85   ? 14.080  24.938  132.269  1.00 28.42  ? 85   LEU B CD2   1 
ATOM   2425  N  N     . VAL B  1  86   ? 17.665  26.034  128.913  1.00 23.90  ? 86   VAL B N     1 
ATOM   2426  C  CA    . VAL B  1  86   ? 19.006  26.475  129.267  1.00 25.01  ? 86   VAL B CA    1 
ATOM   2427  C  C     . VAL B  1  86   ? 18.948  27.372  130.492  1.00 32.95  ? 86   VAL B C     1 
ATOM   2428  O  O     . VAL B  1  86   ? 18.395  28.470  130.443  1.00 36.69  ? 86   VAL B O     1 
ATOM   2429  C  CB    . VAL B  1  86   ? 19.655  27.258  128.119  1.00 28.29  ? 86   VAL B CB    1 
ATOM   2430  C  CG1   . VAL B  1  86   ? 21.030  27.762  128.531  1.00 27.84  ? 86   VAL B CG1   1 
ATOM   2431  C  CG2   . VAL B  1  86   ? 19.743  26.394  126.876  1.00 36.51  ? 86   VAL B CG2   1 
ATOM   2432  N  N     . VAL B  1  87   ? 19.520  26.906  131.594  1.00 29.77  ? 87   VAL B N     1 
ATOM   2433  C  CA    . VAL B  1  87   ? 19.455  27.644  132.850  1.00 26.34  ? 87   VAL B CA    1 
ATOM   2434  C  C     . VAL B  1  87   ? 20.848  28.028  133.328  1.00 22.39  ? 87   VAL B C     1 
ATOM   2435  O  O     . VAL B  1  87   ? 21.755  27.204  133.351  1.00 25.15  ? 87   VAL B O     1 
ATOM   2436  C  CB    . VAL B  1  87   ? 18.722  26.828  133.937  1.00 29.14  ? 87   VAL B CB    1 
ATOM   2437  C  CG1   . VAL B  1  87   ? 18.934  27.437  135.309  1.00 29.02  ? 87   VAL B CG1   1 
ATOM   2438  C  CG2   . VAL B  1  87   ? 17.236  26.726  133.611  1.00 29.77  ? 87   VAL B CG2   1 
ATOM   2439  N  N     . ARG B  1  88   ? 21.013  29.291  133.697  1.00 26.04  ? 88   ARG B N     1 
ATOM   2440  C  CA    . ARG B  1  88   ? 22.302  29.797  134.141  1.00 32.23  ? 88   ARG B CA    1 
ATOM   2441  C  C     . ARG B  1  88   ? 22.287  30.104  135.639  1.00 38.88  ? 88   ARG B C     1 
ATOM   2442  O  O     . ARG B  1  88   ? 21.315  30.646  136.166  1.00 39.23  ? 88   ARG B O     1 
ATOM   2443  C  CB    . ARG B  1  88   ? 22.666  31.045  133.339  1.00 32.10  ? 88   ARG B CB    1 
ATOM   2444  C  CG    . ARG B  1  88   ? 24.039  31.615  133.629  1.00 36.25  ? 88   ARG B CG    1 
ATOM   2445  C  CD    . ARG B  1  88   ? 24.349  32.732  132.648  1.00 39.92  ? 88   ARG B CD    1 
ATOM   2446  N  NE    . ARG B  1  88   ? 25.624  33.382  132.924  1.00 52.59  ? 88   ARG B NE    1 
ATOM   2447  C  CZ    . ARG B  1  88   ? 26.139  34.347  132.168  1.00 66.55  ? 88   ARG B CZ    1 
ATOM   2448  N  NH1   . ARG B  1  88   ? 25.482  34.763  131.091  1.00 58.12  ? 88   ARG B NH1   1 
ATOM   2449  N  NH2   . ARG B  1  88   ? 27.309  34.893  132.483  1.00 65.35  ? 88   ARG B NH2   1 
ATOM   2450  N  N     . PHE B  1  89   ? 23.363  29.740  136.325  1.00 31.23  ? 89   PHE B N     1 
ATOM   2451  C  CA    . PHE B  1  89   ? 23.482  30.022  137.746  1.00 27.53  ? 89   PHE B CA    1 
ATOM   2452  C  C     . PHE B  1  89   ? 24.415  31.204  137.965  1.00 39.48  ? 89   PHE B C     1 
ATOM   2453  O  O     . PHE B  1  89   ? 25.600  31.144  137.635  1.00 41.84  ? 89   PHE B O     1 
ATOM   2454  C  CB    . PHE B  1  89   ? 23.995  28.795  138.503  1.00 32.16  ? 89   PHE B CB    1 
ATOM   2455  C  CG    . PHE B  1  89   ? 22.975  27.697  138.653  1.00 32.75  ? 89   PHE B CG    1 
ATOM   2456  C  CD1   . PHE B  1  89   ? 21.651  27.897  138.274  1.00 31.56  ? 89   PHE B CD1   1 
ATOM   2457  C  CD2   . PHE B  1  89   ? 23.337  26.469  139.183  1.00 26.11  ? 89   PHE B CD2   1 
ATOM   2458  C  CE1   . PHE B  1  89   ? 20.707  26.884  138.415  1.00 21.43  ? 89   PHE B CE1   1 
ATOM   2459  C  CE2   . PHE B  1  89   ? 22.398  25.456  139.328  1.00 29.40  ? 89   PHE B CE2   1 
ATOM   2460  C  CZ    . PHE B  1  89   ? 21.082  25.666  138.943  1.00 22.83  ? 89   PHE B CZ    1 
ATOM   2461  N  N     . LEU B  1  90   ? 23.874  32.283  138.519  1.00 42.39  ? 90   LEU B N     1 
ATOM   2462  C  CA    . LEU B  1  90   ? 24.665  33.475  138.800  1.00 46.61  ? 90   LEU B CA    1 
ATOM   2463  C  C     . LEU B  1  90   ? 25.490  33.296  140.076  1.00 53.13  ? 90   LEU B C     1 
ATOM   2464  O  O     . LEU B  1  90   ? 26.544  33.913  140.241  1.00 52.53  ? 90   LEU B O     1 
ATOM   2465  C  CB    . LEU B  1  90   ? 23.764  34.709  138.907  1.00 46.17  ? 90   LEU B CB    1 
ATOM   2466  C  CG    . LEU B  1  90   ? 23.248  35.332  137.605  1.00 43.57  ? 90   LEU B CG    1 
ATOM   2467  C  CD1   . LEU B  1  90   ? 24.414  35.744  136.704  1.00 45.25  ? 90   LEU B CD1   1 
ATOM   2468  C  CD2   . LEU B  1  90   ? 22.286  34.404  136.868  1.00 36.13  ? 90   LEU B CD2   1 
ATOM   2469  N  N     . PRO B  1  92   ? 27.972  31.251  141.959  1.00 50.04  ? 92   PRO B N     1 
ATOM   2470  C  CA    . PRO B  1  92   ? 28.990  30.235  141.663  1.00 47.18  ? 92   PRO B CA    1 
ATOM   2471  C  C     . PRO B  1  92   ? 28.964  29.092  142.675  1.00 51.95  ? 92   PRO B C     1 
ATOM   2472  O  O     . PRO B  1  92   ? 29.526  28.027  142.416  1.00 54.39  ? 92   PRO B O     1 
ATOM   2473  C  CB    . PRO B  1  92   ? 30.303  31.013  141.776  1.00 36.08  ? 92   PRO B CB    1 
ATOM   2474  C  CG    . PRO B  1  92   ? 29.991  32.145  142.688  1.00 45.74  ? 92   PRO B CG    1 
ATOM   2475  C  CD    . PRO B  1  92   ? 28.574  32.530  142.370  1.00 45.61  ? 92   PRO B CD    1 
ATOM   2476  N  N     . SER B  1  93   ? 28.322  29.324  143.816  1.00 48.60  ? 93   SER B N     1 
ATOM   2477  C  CA    . SER B  1  93   ? 28.249  28.334  144.883  1.00 41.81  ? 93   SER B CA    1 
ATOM   2478  C  C     . SER B  1  93   ? 26.954  27.521  144.877  1.00 40.19  ? 93   SER B C     1 
ATOM   2479  O  O     . SER B  1  93   ? 26.754  26.668  145.738  1.00 43.55  ? 93   SER B O     1 
ATOM   2480  C  CB    . SER B  1  93   ? 28.416  29.026  146.232  1.00 44.98  ? 93   SER B CB    1 
ATOM   2481  O  OG    . SER B  1  93   ? 29.401  30.038  146.147  1.00 51.02  ? 93   SER B OG    1 
ATOM   2482  N  N     . LEU B  1  94   ? 26.078  27.777  143.911  1.00 38.50  ? 94   LEU B N     1 
ATOM   2483  C  CA    . LEU B  1  94   ? 24.760  27.146  143.899  1.00 33.93  ? 94   LEU B CA    1 
ATOM   2484  C  C     . LEU B  1  94   ? 24.741  25.859  143.072  1.00 33.90  ? 94   LEU B C     1 
ATOM   2485  O  O     . LEU B  1  94   ? 24.846  25.894  141.849  1.00 37.78  ? 94   LEU B O     1 
ATOM   2486  C  CB    . LEU B  1  94   ? 23.730  28.138  143.360  1.00 29.18  ? 94   LEU B CB    1 
ATOM   2487  C  CG    . LEU B  1  94   ? 22.324  27.627  143.073  1.00 26.93  ? 94   LEU B CG    1 
ATOM   2488  C  CD1   . LEU B  1  94   ? 21.780  26.935  144.291  1.00 35.27  ? 94   LEU B CD1   1 
ATOM   2489  C  CD2   . LEU B  1  94   ? 21.436  28.791  142.670  1.00 28.88  ? 94   LEU B CD2   1 
ATOM   2490  N  N     . GLN B  1  95   ? 24.616  24.719  143.747  1.00 35.68  ? 95   GLN B N     1 
ATOM   2491  C  CA    . GLN B  1  95   ? 24.655  23.431  143.059  1.00 27.80  ? 95   GLN B CA    1 
ATOM   2492  C  C     . GLN B  1  95   ? 23.299  22.874  142.615  1.00 27.46  ? 95   GLN B C     1 
ATOM   2493  O  O     . GLN B  1  95   ? 23.249  21.958  141.792  1.00 28.15  ? 95   GLN B O     1 
ATOM   2494  C  CB    . GLN B  1  95   ? 25.373  22.391  143.926  1.00 26.49  ? 95   GLN B CB    1 
ATOM   2495  C  CG    . GLN B  1  95   ? 26.366  22.969  144.923  1.00 37.78  ? 95   GLN B CG    1 
ATOM   2496  C  CD    . GLN B  1  95   ? 27.685  23.396  144.294  1.00 55.67  ? 95   GLN B CD    1 
ATOM   2497  O  OE1   . GLN B  1  95   ? 27.786  23.579  143.078  1.00 50.85  ? 95   GLN B OE1   1 
ATOM   2498  N  NE2   . GLN B  1  95   ? 28.710  23.554  145.129  1.00 61.42  ? 95   GLN B NE2   1 
ATOM   2499  N  N     . THR B  1  96   ? 22.207  23.396  143.165  1.00 24.38  ? 96   THR B N     1 
ATOM   2500  C  CA    . THR B  1  96   ? 20.886  22.879  142.807  1.00 26.79  ? 96   THR B CA    1 
ATOM   2501  C  C     . THR B  1  96   ? 19.732  23.856  143.031  1.00 24.94  ? 96   THR B C     1 
ATOM   2502  O  O     . THR B  1  96   ? 19.760  24.658  143.957  1.00 24.21  ? 96   THR B O     1 
ATOM   2503  C  CB    . THR B  1  96   ? 20.579  21.568  143.550  1.00 30.28  ? 96   THR B CB    1 
ATOM   2504  O  OG1   . THR B  1  96   ? 19.243  21.149  143.247  1.00 28.33  ? 96   THR B OG1   1 
ATOM   2505  C  CG2   . THR B  1  96   ? 20.720  21.765  145.052  1.00 38.80  ? 96   THR B CG2   1 
ATOM   2506  N  N     . VAL B  1  97   ? 18.707  23.774  142.189  1.00 20.92  ? 97   VAL B N     1 
ATOM   2507  C  CA    . VAL B  1  97   ? 17.511  24.590  142.361  1.00 22.84  ? 97   VAL B CA    1 
ATOM   2508  C  C     . VAL B  1  97   ? 16.287  23.781  141.962  1.00 29.27  ? 97   VAL B C     1 
ATOM   2509  O  O     . VAL B  1  97   ? 16.380  22.872  141.142  1.00 29.23  ? 97   VAL B O     1 
ATOM   2510  C  CB    . VAL B  1  97   ? 17.534  25.885  141.502  1.00 26.51  ? 97   VAL B CB    1 
ATOM   2511  C  CG1   . VAL B  1  97   ? 16.445  26.841  141.957  1.00 30.04  ? 97   VAL B CG1   1 
ATOM   2512  C  CG2   . VAL B  1  97   ? 18.875  26.587  141.589  1.00 31.37  ? 97   VAL B CG2   1 
ATOM   2513  N  N     . THR B  1  98   ? 15.143  24.111  142.552  1.00 34.26  ? 98   THR B N     1 
ATOM   2514  C  CA    . THR B  1  98   ? 13.871  23.526  142.154  1.00 30.25  ? 98   THR B CA    1 
ATOM   2515  C  C     . THR B  1  98   ? 12.918  24.617  141.673  1.00 30.71  ? 98   THR B C     1 
ATOM   2516  O  O     . THR B  1  98   ? 12.488  25.465  142.451  1.00 41.37  ? 98   THR B O     1 
ATOM   2517  C  CB    . THR B  1  98   ? 13.224  22.752  143.313  1.00 42.48  ? 98   THR B CB    1 
ATOM   2518  O  OG1   . THR B  1  98   ? 14.088  21.679  143.721  1.00 45.35  ? 98   THR B OG1   1 
ATOM   2519  C  CG2   . THR B  1  98   ? 11.871  22.190  142.887  1.00 40.66  ? 98   THR B CG2   1 
ATOM   2520  N  N     . LEU B  1  99   ? 12.598  24.590  140.384  1.00 37.95  ? 99   LEU B N     1 
ATOM   2521  C  CA    . LEU B  1  99   ? 11.725  25.586  139.772  1.00 35.41  ? 99   LEU B CA    1 
ATOM   2522  C  C     . LEU B  1  99   ? 10.290  25.079  139.735  1.00 38.13  ? 99   LEU B C     1 
ATOM   2523  O  O     . LEU B  1  99   ? 10.038  23.931  139.362  1.00 34.34  ? 99   LEU B O     1 
ATOM   2524  C  CB    . LEU B  1  99   ? 12.190  25.895  138.350  1.00 32.77  ? 99   LEU B CB    1 
ATOM   2525  C  CG    . LEU B  1  99   ? 13.295  26.924  138.113  1.00 38.19  ? 99   LEU B CG    1 
ATOM   2526  C  CD1   . LEU B  1  99   ? 14.462  26.727  139.055  1.00 29.34  ? 99   LEU B CD1   1 
ATOM   2527  C  CD2   . LEU B  1  99   ? 13.762  26.844  136.665  1.00 42.03  ? 99   LEU B CD2   1 
ATOM   2528  N  N     . LEU B  1  100  ? 9.346   25.933  140.111  1.00 41.83  ? 100  LEU B N     1 
ATOM   2529  C  CA    . LEU B  1  100  ? 7.947   25.522  140.157  1.00 40.16  ? 100  LEU B CA    1 
ATOM   2530  C  C     . LEU B  1  100  ? 7.112   26.172  139.058  1.00 37.33  ? 100  LEU B C     1 
ATOM   2531  O  O     . LEU B  1  100  ? 7.352   27.318  138.669  1.00 37.34  ? 100  LEU B O     1 
ATOM   2532  C  CB    . LEU B  1  100  ? 7.336   25.796  141.539  1.00 44.43  ? 100  LEU B CB    1 
ATOM   2533  C  CG    . LEU B  1  100  ? 7.752   24.872  142.693  1.00 42.96  ? 100  LEU B CG    1 
ATOM   2534  C  CD1   . LEU B  1  100  ? 9.067   25.311  143.333  1.00 33.79  ? 100  LEU B CD1   1 
ATOM   2535  C  CD2   . LEU B  1  100  ? 6.645   24.767  143.740  1.00 56.89  ? 100  LEU B CD2   1 
ATOM   2536  N  N     . LEU B  1  101  ? 6.141   25.420  138.553  1.00 34.45  ? 101  LEU B N     1 
ATOM   2537  C  CA    . LEU B  1  101  ? 5.242   25.913  137.520  1.00 45.37  ? 101  LEU B CA    1 
ATOM   2538  C  C     . LEU B  1  101  ? 3.803   25.482  137.760  1.00 51.72  ? 101  LEU B C     1 
ATOM   2539  O  O     . LEU B  1  101  ? 3.512   24.293  137.851  1.00 45.27  ? 101  LEU B O     1 
ATOM   2540  C  CB    . LEU B  1  101  ? 5.674   25.405  136.151  1.00 53.48  ? 101  LEU B CB    1 
ATOM   2541  C  CG    . LEU B  1  101  ? 4.820   25.924  134.998  1.00 51.06  ? 101  LEU B CG    1 
ATOM   2542  C  CD1   . LEU B  1  101  ? 5.555   27.053  134.299  1.00 51.49  ? 101  LEU B CD1   1 
ATOM   2543  C  CD2   . LEU B  1  101  ? 4.453   24.803  134.033  1.00 43.40  ? 101  LEU B CD2   1 
ATOM   2544  N  N     . LYS B  1  102  ? 2.902   26.453  137.841  1.00 57.19  ? 102  LYS B N     1 
ATOM   2545  C  CA    . LYS B  1  102  ? 1.480   26.169  137.953  1.00 48.87  ? 102  LYS B CA    1 
ATOM   2546  C  C     . LYS B  1  102  ? 0.763   27.020  136.923  1.00 45.75  ? 102  LYS B C     1 
ATOM   2547  O  O     . LYS B  1  102  ? 0.942   28.236  136.885  1.00 52.48  ? 102  LYS B O     1 
ATOM   2548  C  CB    . LYS B  1  102  ? 0.969   26.496  139.358  1.00 55.35  ? 102  LYS B CB    1 
ATOM   2549  C  CG    . LYS B  1  102  ? 1.774   25.855  140.484  1.00 53.93  ? 102  LYS B CG    1 
ATOM   2550  C  CD    . LYS B  1  102  ? 1.301   26.316  141.856  1.00 59.81  ? 102  LYS B CD    1 
ATOM   2551  C  CE    . LYS B  1  102  ? 2.227   25.814  142.959  1.00 72.18  ? 102  LYS B CE    1 
ATOM   2552  N  NZ    . LYS B  1  102  ? 1.837   26.314  144.311  1.00 54.05  ? 102  LYS B NZ    1 
ATOM   2553  N  N     . ALA B  1  103  ? -0.031  26.383  136.074  1.00 44.15  ? 103  ALA B N     1 
ATOM   2554  C  CA    . ALA B  1  103  ? -0.777  27.105  135.053  1.00 57.07  ? 103  ALA B CA    1 
ATOM   2555  C  C     . ALA B  1  103  ? -2.032  26.342  134.665  1.00 58.70  ? 103  ALA B C     1 
ATOM   2556  O  O     . ALA B  1  103  ? -2.114  25.128  134.857  1.00 56.80  ? 103  ALA B O     1 
ATOM   2557  C  CB    . ALA B  1  103  ? 0.095   27.356  133.831  1.00 61.51  ? 103  ALA B CB    1 
ATOM   2558  N  N     . GLU B  1  104  ? -3.007  27.058  134.115  1.00 62.20  ? 104  GLU B N     1 
ATOM   2559  C  CA    . GLU B  1  104  ? -4.260  26.441  133.705  1.00 63.91  ? 104  GLU B CA    1 
ATOM   2560  C  C     . GLU B  1  104  ? -4.938  27.208  132.572  1.00 68.42  ? 104  GLU B C     1 
ATOM   2561  O  O     . GLU B  1  104  ? -4.434  28.233  132.109  1.00 64.51  ? 104  GLU B O     1 
ATOM   2562  C  CB    . GLU B  1  104  ? -5.207  26.337  134.898  1.00 65.61  ? 104  GLU B CB    1 
ATOM   2563  C  CG    . GLU B  1  104  ? -5.494  27.668  135.564  1.00 73.48  ? 104  GLU B CG    1 
ATOM   2564  C  CD    . GLU B  1  104  ? -6.699  27.609  136.476  1.00 82.54  ? 104  GLU B CD    1 
ATOM   2565  O  OE1   . GLU B  1  104  ? -7.054  28.655  137.058  1.00 90.48  ? 104  GLU B OE1   1 
ATOM   2566  O  OE2   . GLU B  1  104  ? -7.291  26.516  136.606  1.00 77.44  ? 104  GLU B OE2   1 
ATOM   2567  N  N     . GLY B  1  105  ? -6.086  26.699  132.131  1.00 73.27  ? 105  GLY B N     1 
ATOM   2568  C  CA    . GLY B  1  105  ? -6.887  27.363  131.119  1.00 68.52  ? 105  GLY B CA    1 
ATOM   2569  C  C     . GLY B  1  105  ? -6.321  27.246  129.719  1.00 70.05  ? 105  GLY B C     1 
ATOM   2570  O  O     . GLY B  1  105  ? -5.524  26.353  129.442  1.00 74.52  ? 105  GLY B O     1 
ATOM   2571  N  N     . PRO B  1  106  ? -6.745  28.145  128.821  1.00 72.80  ? 106  PRO B N     1 
ATOM   2572  C  CA    . PRO B  1  106  ? -6.284  28.215  127.430  1.00 72.10  ? 106  PRO B CA    1 
ATOM   2573  C  C     . PRO B  1  106  ? -4.949  28.953  127.301  1.00 73.50  ? 106  PRO B C     1 
ATOM   2574  O  O     . PRO B  1  106  ? -4.938  30.153  127.018  1.00 68.62  ? 106  PRO B O     1 
ATOM   2575  C  CB    . PRO B  1  106  ? -7.399  28.997  126.740  1.00 75.25  ? 106  PRO B CB    1 
ATOM   2576  C  CG    . PRO B  1  106  ? -7.932  29.892  127.810  1.00 87.25  ? 106  PRO B CG    1 
ATOM   2577  C  CD    . PRO B  1  106  ? -7.802  29.133  129.104  1.00 83.06  ? 106  PRO B CD    1 
ATOM   2578  N  N     . LYS B  1  107  ? -3.836  28.255  127.517  1.00 69.90  ? 107  LYS B N     1 
ATOM   2579  C  CA    . LYS B  1  107  ? -2.541  28.941  127.540  1.00 61.87  ? 107  LYS B CA    1 
ATOM   2580  C  C     . LYS B  1  107  ? -1.373  28.137  126.966  1.00 62.23  ? 107  LYS B C     1 
ATOM   2581  O  O     . LYS B  1  107  ? -1.315  26.914  127.110  1.00 59.31  ? 107  LYS B O     1 
ATOM   2582  C  CB    . LYS B  1  107  ? -2.201  29.389  128.966  1.00 64.47  ? 107  LYS B CB    1 
ATOM   2583  C  CG    . LYS B  1  107  ? -1.013  30.337  129.051  1.00 59.54  ? 107  LYS B CG    1 
ATOM   2584  C  CD    . LYS B  1  107  ? -0.626  30.641  130.487  1.00 58.34  ? 107  LYS B CD    1 
ATOM   2585  C  CE    . LYS B  1  107  ? 0.454   31.710  130.537  1.00 56.72  ? 107  LYS B CE    1 
ATOM   2586  N  NZ    . LYS B  1  107  ? 0.915   31.981  131.927  1.00 52.58  ? 107  LYS B NZ    1 
ATOM   2587  N  N     . GLU B  1  108  ? -0.445  28.844  126.321  1.00 56.67  ? 108  GLU B N     1 
ATOM   2588  C  CA    . GLU B  1  108  ? 0.812   28.256  125.868  1.00 51.67  ? 108  GLU B CA    1 
ATOM   2589  C  C     . GLU B  1  108  ? 1.931   28.650  126.824  1.00 52.85  ? 108  GLU B C     1 
ATOM   2590  O  O     . GLU B  1  108  ? 2.370   29.800  126.843  1.00 54.10  ? 108  GLU B O     1 
ATOM   2591  C  CB    . GLU B  1  108  ? 1.156   28.726  124.453  1.00 52.14  ? 108  GLU B CB    1 
ATOM   2592  C  CG    . GLU B  1  108  ? 0.207   28.222  123.377  1.00 61.99  ? 108  GLU B CG    1 
ATOM   2593  C  CD    . GLU B  1  108  ? 0.620   28.652  121.979  1.00 64.03  ? 108  GLU B CD    1 
ATOM   2594  O  OE1   . GLU B  1  108  ? 1.702   29.263  121.835  1.00 60.32  ? 108  GLU B OE1   1 
ATOM   2595  O  OE2   . GLU B  1  108  ? -0.141  28.379  121.025  1.00 61.07  ? 108  GLU B OE2   1 
ATOM   2596  N  N     . VAL B  1  109  ? 2.403   27.678  127.597  1.00 47.53  ? 109  VAL B N     1 
ATOM   2597  C  CA    . VAL B  1  109  ? 3.383   27.930  128.643  1.00 44.24  ? 109  VAL B CA    1 
ATOM   2598  C  C     . VAL B  1  109  ? 4.802   28.020  128.102  1.00 47.28  ? 109  VAL B C     1 
ATOM   2599  O  O     . VAL B  1  109  ? 5.314   27.065  127.518  1.00 42.33  ? 109  VAL B O     1 
ATOM   2600  C  CB    . VAL B  1  109  ? 3.361   26.816  129.697  1.00 48.85  ? 109  VAL B CB    1 
ATOM   2601  C  CG1   . VAL B  1  109  ? 4.287   27.167  130.848  1.00 47.45  ? 109  VAL B CG1   1 
ATOM   2602  C  CG2   . VAL B  1  109  ? 1.948   26.583  130.195  1.00 52.05  ? 109  VAL B CG2   1 
ATOM   2603  N  N     . LYS B  1  110  ? 5.439   29.166  128.320  1.00 49.11  ? 110  LYS B N     1 
ATOM   2604  C  CA    . LYS B  1  110  ? 6.838   29.347  127.952  1.00 43.45  ? 110  LYS B CA    1 
ATOM   2605  C  C     . LYS B  1  110  ? 7.720   29.242  129.193  1.00 39.74  ? 110  LYS B C     1 
ATOM   2606  O  O     . LYS B  1  110  ? 7.221   29.027  130.294  1.00 41.56  ? 110  LYS B O     1 
ATOM   2607  C  CB    . LYS B  1  110  ? 7.040   30.691  127.252  1.00 46.17  ? 110  LYS B CB    1 
ATOM   2608  C  CG    . LYS B  1  110  ? 6.198   30.862  125.990  1.00 45.39  ? 110  LYS B CG    1 
ATOM   2609  C  CD    . LYS B  1  110  ? 6.704   29.988  124.851  1.00 46.15  ? 110  LYS B CD    1 
ATOM   2610  C  CE    . LYS B  1  110  ? 5.776   30.041  123.645  1.00 45.67  ? 110  LYS B CE    1 
ATOM   2611  N  NZ    . LYS B  1  110  ? 4.425   29.496  123.962  1.00 48.01  ? 110  LYS B NZ    1 
ATOM   2612  N  N     . ALA B  1  111  ? 9.028   29.387  129.016  1.00 41.52  ? 111  ALA B N     1 
ATOM   2613  C  CA    . ALA B  1  111  ? 9.968   29.196  130.116  1.00 41.82  ? 111  ALA B CA    1 
ATOM   2614  C  C     . ALA B  1  111  ? 9.883   30.308  131.156  1.00 53.74  ? 111  ALA B C     1 
ATOM   2615  O  O     . ALA B  1  111  ? 10.251  30.108  132.313  1.00 60.08  ? 111  ALA B O     1 
ATOM   2616  C  CB    . ALA B  1  111  ? 11.387  29.069  129.591  1.00 41.54  ? 111  ALA B CB    1 
ATOM   2617  N  N     . ARG B  1  112  ? 9.403   31.477  130.741  1.00 53.35  ? 112  ARG B N     1 
ATOM   2618  C  CA    . ARG B  1  112  ? 9.212   32.596  131.658  1.00 50.61  ? 112  ARG B CA    1 
ATOM   2619  C  C     . ARG B  1  112  ? 8.296   32.212  132.813  1.00 48.09  ? 112  ARG B C     1 
ATOM   2620  O  O     . ARG B  1  112  ? 8.518   32.618  133.951  1.00 50.48  ? 112  ARG B O     1 
ATOM   2621  C  CB    . ARG B  1  112  ? 8.618   33.798  130.922  1.00 59.19  ? 112  ARG B CB    1 
ATOM   2622  C  CG    . ARG B  1  112  ? 9.610   34.904  130.596  1.00 61.92  ? 112  ARG B CG    1 
ATOM   2623  C  CD    . ARG B  1  112  ? 8.931   36.003  129.796  1.00 64.46  ? 112  ARG B CD    1 
ATOM   2624  N  NE    . ARG B  1  112  ? 8.181   35.451  128.670  1.00 63.57  ? 112  ARG B NE    1 
ATOM   2625  C  CZ    . ARG B  1  112  ? 8.676   35.304  127.446  1.00 65.14  ? 112  ARG B CZ    1 
ATOM   2626  N  NH1   . ARG B  1  112  ? 9.924   35.679  127.189  1.00 57.35  ? 112  ARG B NH1   1 
ATOM   2627  N  NH2   . ARG B  1  112  ? 7.926   34.788  126.479  1.00 55.92  ? 112  ARG B NH2   1 
ATOM   2628  N  N     . ASP B  1  113  ? 7.284   31.402  132.514  1.00 49.76  ? 113  ASP B N     1 
ATOM   2629  C  CA    . ASP B  1  113  ? 6.237   31.057  133.474  1.00 48.08  ? 113  ASP B CA    1 
ATOM   2630  C  C     . ASP B  1  113  ? 6.768   30.321  134.701  1.00 51.93  ? 113  ASP B C     1 
ATOM   2631  O  O     . ASP B  1  113  ? 6.047   30.125  135.678  1.00 58.93  ? 113  ASP B O     1 
ATOM   2632  C  CB    . ASP B  1  113  ? 5.143   30.231  132.796  1.00 47.11  ? 113  ASP B CB    1 
ATOM   2633  C  CG    . ASP B  1  113  ? 4.529   30.940  131.606  1.00 63.54  ? 113  ASP B CG    1 
ATOM   2634  O  OD1   . ASP B  1  113  ? 3.366   30.636  131.268  1.00 69.07  ? 113  ASP B OD1   1 
ATOM   2635  O  OD2   . ASP B  1  113  ? 5.207   31.805  131.008  1.00 61.63  ? 113  ASP B OD2   1 
ATOM   2636  N  N     . PHE B  1  114  ? 8.026   29.901  134.643  1.00 48.63  ? 114  PHE B N     1 
ATOM   2637  C  CA    . PHE B  1  114  ? 8.701   29.395  135.825  1.00 52.12  ? 114  PHE B CA    1 
ATOM   2638  C  C     . PHE B  1  114  ? 8.947   30.556  136.775  1.00 51.78  ? 114  PHE B C     1 
ATOM   2639  O  O     . PHE B  1  114  ? 9.585   31.544  136.402  1.00 46.80  ? 114  PHE B O     1 
ATOM   2640  C  CB    . PHE B  1  114  ? 10.032  28.750  135.440  1.00 54.15  ? 114  PHE B CB    1 
ATOM   2641  C  CG    . PHE B  1  114  ? 9.897   27.350  134.908  1.00 51.49  ? 114  PHE B CG    1 
ATOM   2642  C  CD1   . PHE B  1  114  ? 9.075   26.428  135.541  1.00 47.70  ? 114  PHE B CD1   1 
ATOM   2643  C  CD2   . PHE B  1  114  ? 10.582  26.959  133.771  1.00 45.08  ? 114  PHE B CD2   1 
ATOM   2644  C  CE1   . PHE B  1  114  ? 8.951   25.139  135.056  1.00 44.56  ? 114  PHE B CE1   1 
ATOM   2645  C  CE2   . PHE B  1  114  ? 10.458  25.675  133.281  1.00 47.78  ? 114  PHE B CE2   1 
ATOM   2646  C  CZ    . PHE B  1  114  ? 9.639   24.763  133.925  1.00 45.70  ? 114  PHE B CZ    1 
ATOM   2647  N  N     . LEU B  1  115  ? 8.445   30.431  138.001  1.00 48.74  ? 115  LEU B N     1 
ATOM   2648  C  CA    . LEU B  1  115  ? 8.571   31.497  138.990  1.00 45.96  ? 115  LEU B CA    1 
ATOM   2649  C  C     . LEU B  1  115  ? 10.030  31.811  139.288  1.00 43.37  ? 115  LEU B C     1 
ATOM   2650  O  O     . LEU B  1  115  ? 10.788  30.927  139.693  1.00 42.77  ? 115  LEU B O     1 
ATOM   2651  C  CB    . LEU B  1  115  ? 7.832   31.137  140.278  1.00 41.24  ? 115  LEU B CB    1 
ATOM   2652  C  CG    . LEU B  1  115  ? 6.318   31.012  140.128  1.00 39.91  ? 115  LEU B CG    1 
ATOM   2653  C  CD1   . LEU B  1  115  ? 5.659   30.968  141.496  1.00 35.26  ? 115  LEU B CD1   1 
ATOM   2654  C  CD2   . LEU B  1  115  ? 5.758   32.151  139.283  1.00 37.81  ? 115  LEU B CD2   1 
ATOM   2655  N  N     . PRO B  1  116  ? 10.419  33.081  139.092  1.00 39.87  ? 116  PRO B N     1 
ATOM   2656  C  CA    . PRO B  1  116  ? 11.804  33.550  139.203  1.00 41.04  ? 116  PRO B CA    1 
ATOM   2657  C  C     . PRO B  1  116  ? 12.456  33.103  140.500  1.00 35.94  ? 116  PRO B C     1 
ATOM   2658  O  O     . PRO B  1  116  ? 11.831  33.132  141.557  1.00 42.29  ? 116  PRO B O     1 
ATOM   2659  C  CB    . PRO B  1  116  ? 11.657  35.072  139.189  1.00 42.21  ? 116  PRO B CB    1 
ATOM   2660  C  CG    . PRO B  1  116  ? 10.412  35.311  138.414  1.00 48.56  ? 116  PRO B CG    1 
ATOM   2661  C  CD    . PRO B  1  116  ? 9.491   34.177  138.766  1.00 41.24  ? 116  PRO B CD    1 
ATOM   2662  N  N     . VAL B  1  117  ? 13.703  32.666  140.404  1.00 32.27  ? 117  VAL B N     1 
ATOM   2663  C  CA    . VAL B  1  117  ? 14.449  32.251  141.575  1.00 28.60  ? 117  VAL B CA    1 
ATOM   2664  C  C     . VAL B  1  117  ? 15.722  33.078  141.641  1.00 29.80  ? 117  VAL B C     1 
ATOM   2665  O  O     . VAL B  1  117  ? 16.291  33.431  140.609  1.00 27.20  ? 117  VAL B O     1 
ATOM   2666  C  CB    . VAL B  1  117  ? 14.766  30.745  141.534  1.00 31.76  ? 117  VAL B CB    1 
ATOM   2667  C  CG1   . VAL B  1  117  ? 15.594  30.330  142.741  1.00 31.31  ? 117  VAL B CG1   1 
ATOM   2668  C  CG2   . VAL B  1  117  ? 13.471  29.939  141.472  1.00 31.71  ? 117  VAL B CG2   1 
ATOM   2669  N  N     . ALA B  1  118  ? 16.141  33.405  142.860  1.00 37.27  ? 118  ALA B N     1 
ATOM   2670  C  CA    . ALA B  1  118  ? 17.294  34.263  143.092  1.00 42.99  ? 118  ALA B CA    1 
ATOM   2671  C  C     . ALA B  1  118  ? 18.556  33.730  142.417  1.00 40.11  ? 118  ALA B C     1 
ATOM   2672  O  O     . ALA B  1  118  ? 18.943  32.579  142.625  1.00 35.87  ? 118  ALA B O     1 
ATOM   2673  C  CB    . ALA B  1  118  ? 17.520  34.437  144.592  1.00 44.14  ? 118  ALA B CB    1 
ATOM   2674  N  N     . ASP B  1  119  ? 19.181  34.582  141.607  1.00 37.39  ? 119  ASP B N     1 
ATOM   2675  C  CA    . ASP B  1  119  ? 20.417  34.251  140.892  1.00 49.09  ? 119  ASP B CA    1 
ATOM   2676  C  C     . ASP B  1  119  ? 20.280  33.069  139.926  1.00 40.39  ? 119  ASP B C     1 
ATOM   2677  O  O     . ASP B  1  119  ? 21.261  32.403  139.594  1.00 38.43  ? 119  ASP B O     1 
ATOM   2678  C  CB    . ASP B  1  119  ? 21.571  34.014  141.874  1.00 55.02  ? 119  ASP B CB    1 
ATOM   2679  C  CG    . ASP B  1  119  ? 21.743  35.155  142.857  1.00 53.80  ? 119  ASP B CG    1 
ATOM   2680  O  OD1   . ASP B  1  119  ? 21.136  36.228  142.636  1.00 47.93  ? 119  ASP B OD1   1 
ATOM   2681  O  OD2   . ASP B  1  119  ? 22.488  34.978  143.845  1.00 56.15  ? 119  ASP B OD2   1 
ATOM   2682  N  N     . VAL B  1  120  ? 19.058  32.824  139.469  1.00 38.84  ? 120  VAL B N     1 
ATOM   2683  C  CA    . VAL B  1  120  ? 18.801  31.777  138.493  1.00 32.88  ? 120  VAL B CA    1 
ATOM   2684  C  C     . VAL B  1  120  ? 18.213  32.404  137.240  1.00 37.75  ? 120  VAL B C     1 
ATOM   2685  O  O     . VAL B  1  120  ? 17.087  32.908  137.252  1.00 36.16  ? 120  VAL B O     1 
ATOM   2686  C  CB    . VAL B  1  120  ? 17.836  30.712  139.046  1.00 32.30  ? 120  VAL B CB    1 
ATOM   2687  C  CG1   . VAL B  1  120  ? 17.374  29.784  137.944  1.00 31.70  ? 120  VAL B CG1   1 
ATOM   2688  C  CG2   . VAL B  1  120  ? 18.503  29.927  140.157  1.00 34.50  ? 120  VAL B CG2   1 
ATOM   2689  N  N     . GLU B  1  121  ? 18.986  32.364  136.160  1.00 43.35  ? 121  GLU B N     1 
ATOM   2690  C  CA    . GLU B  1  121  ? 18.618  33.021  134.911  1.00 45.26  ? 121  GLU B CA    1 
ATOM   2691  C  C     . GLU B  1  121  ? 18.108  32.031  133.868  1.00 43.06  ? 121  GLU B C     1 
ATOM   2692  O  O     . GLU B  1  121  ? 18.689  30.965  133.672  1.00 35.79  ? 121  GLU B O     1 
ATOM   2693  C  CB    . GLU B  1  121  ? 19.823  33.783  134.354  1.00 39.83  ? 121  GLU B CB    1 
ATOM   2694  C  CG    . GLU B  1  121  ? 19.559  34.512  133.052  1.00 40.47  ? 121  GLU B CG    1 
ATOM   2695  C  CD    . GLU B  1  121  ? 20.763  35.301  132.584  1.00 53.37  ? 121  GLU B CD    1 
ATOM   2696  O  OE1   . GLU B  1  121  ? 20.650  35.997  131.551  1.00 65.40  ? 121  GLU B OE1   1 
ATOM   2697  O  OE2   . GLU B  1  121  ? 21.822  35.225  133.250  1.00 42.52  ? 121  GLU B OE2   1 
ATOM   2698  N  N     . ILE B  1  122  ? 17.017  32.383  133.199  1.00 36.47  ? 122  ILE B N     1 
ATOM   2699  C  CA    . ILE B  1  122  ? 16.544  31.570  132.094  1.00 32.58  ? 122  ILE B CA    1 
ATOM   2700  C  C     . ILE B  1  122  ? 16.942  32.227  130.779  1.00 40.32  ? 122  ILE B C     1 
ATOM   2701  O  O     . ILE B  1  122  ? 16.397  33.263  130.398  1.00 43.26  ? 122  ILE B O     1 
ATOM   2702  C  CB    . ILE B  1  122  ? 15.035  31.356  132.159  1.00 30.01  ? 122  ILE B CB    1 
ATOM   2703  C  CG1   . ILE B  1  122  ? 14.693  30.494  133.370  1.00 24.64  ? 122  ILE B CG1   1 
ATOM   2704  C  CG2   . ILE B  1  122  ? 14.537  30.683  130.890  1.00 42.11  ? 122  ILE B CG2   1 
ATOM   2705  C  CD1   . ILE B  1  122  ? 13.218  30.210  133.515  1.00 33.11  ? 122  ILE B CD1   1 
ATOM   2706  N  N     . MET B  1  123  ? 17.900  31.606  130.095  1.00 44.70  ? 123  MET B N     1 
ATOM   2707  C  CA    . MET B  1  123  ? 18.489  32.153  128.877  1.00 38.79  ? 123  MET B CA    1 
ATOM   2708  C  C     . MET B  1  123  ? 17.517  32.092  127.711  1.00 36.39  ? 123  MET B C     1 
ATOM   2709  O  O     . MET B  1  123  ? 17.564  32.929  126.814  1.00 35.23  ? 123  MET B O     1 
ATOM   2710  C  CB    . MET B  1  123  ? 19.757  31.380  128.512  1.00 32.78  ? 123  MET B CB    1 
ATOM   2711  C  CG    . MET B  1  123  ? 20.743  31.219  129.653  1.00 31.28  ? 123  MET B CG    1 
ATOM   2712  S  SD    . MET B  1  123  ? 21.823  32.643  129.844  1.00 37.01  ? 123  MET B SD    1 
ATOM   2713  C  CE    . MET B  1  123  ? 22.633  32.670  128.251  1.00 36.57  ? 123  MET B CE    1 
ATOM   2714  N  N     . ASN B  1  124  ? 16.640  31.092  127.725  1.00 36.43  ? 124  ASN B N     1 
ATOM   2715  C  CA    . ASN B  1  124  ? 15.679  30.902  126.644  1.00 38.74  ? 124  ASN B CA    1 
ATOM   2716  C  C     . ASN B  1  124  ? 14.231  30.928  127.124  1.00 40.49  ? 124  ASN B C     1 
ATOM   2717  O  O     . ASN B  1  124  ? 13.539  29.913  127.070  1.00 39.50  ? 124  ASN B O     1 
ATOM   2718  C  CB    . ASN B  1  124  ? 15.966  29.597  125.889  1.00 37.96  ? 124  ASN B CB    1 
ATOM   2719  C  CG    . ASN B  1  124  ? 16.103  28.395  126.816  1.00 37.72  ? 124  ASN B CG    1 
ATOM   2720  O  OD1   . ASN B  1  124  ? 16.642  28.502  127.917  1.00 40.67  ? 124  ASN B OD1   1 
ATOM   2721  N  ND2   . ASN B  1  124  ? 15.613  27.246  126.370  1.00 29.75  ? 124  ASN B ND2   1 
ATOM   2722  N  N     . PRO B  1  125  ? 13.760  32.103  127.575  1.00 46.29  ? 125  PRO B N     1 
ATOM   2723  C  CA    . PRO B  1  125  ? 12.424  32.224  128.168  1.00 45.96  ? 125  PRO B CA    1 
ATOM   2724  C  C     . PRO B  1  125  ? 11.308  32.021  127.147  1.00 43.03  ? 125  PRO B C     1 
ATOM   2725  O  O     . PRO B  1  125  ? 10.169  31.753  127.530  1.00 38.76  ? 125  PRO B O     1 
ATOM   2726  C  CB    . PRO B  1  125  ? 12.413  33.659  128.692  1.00 54.29  ? 125  PRO B CB    1 
ATOM   2727  C  CG    . PRO B  1  125  ? 13.343  34.385  127.787  1.00 49.29  ? 125  PRO B CG    1 
ATOM   2728  C  CD    . PRO B  1  125  ? 14.430  33.411  127.456  1.00 42.61  ? 125  PRO B CD    1 
ATOM   2729  N  N     . ASP B  1  126  ? 11.641  32.136  125.865  1.00 49.51  ? 126  ASP B N     1 
ATOM   2730  C  CA    . ASP B  1  126  ? 10.658  31.979  124.795  1.00 51.74  ? 126  ASP B CA    1 
ATOM   2731  C  C     . ASP B  1  126  ? 10.427  30.509  124.460  1.00 40.69  ? 126  ASP B C     1 
ATOM   2732  O  O     . ASP B  1  126  ? 9.633   30.185  123.578  1.00 36.03  ? 126  ASP B O     1 
ATOM   2733  C  CB    . ASP B  1  126  ? 11.092  32.738  123.534  1.00 58.36  ? 126  ASP B CB    1 
ATOM   2734  C  CG    . ASP B  1  126  ? 11.092  34.251  123.724  1.00 75.37  ? 126  ASP B CG    1 
ATOM   2735  O  OD1   . ASP B  1  126  ? 10.555  34.967  122.850  1.00 68.16  ? 126  ASP B OD1   1 
ATOM   2736  O  OD2   . ASP B  1  126  ? 11.641  34.726  124.741  1.00 82.94  ? 126  ASP B OD2   1 
ATOM   2737  N  N     . LEU B  1  127  ? 11.129  29.625  125.165  1.00 45.37  ? 127  LEU B N     1 
ATOM   2738  C  CA    . LEU B  1  127  ? 11.036  28.189  124.915  1.00 43.26  ? 127  LEU B CA    1 
ATOM   2739  C  C     . LEU B  1  127  ? 9.681   27.627  125.327  1.00 36.13  ? 127  LEU B C     1 
ATOM   2740  O  O     . LEU B  1  127  ? 9.271   27.745  126.477  1.00 39.66  ? 127  LEU B O     1 
ATOM   2741  C  CB    . LEU B  1  127  ? 12.149  27.441  125.653  1.00 34.82  ? 127  LEU B CB    1 
ATOM   2742  C  CG    . LEU B  1  127  ? 11.983  25.919  125.682  1.00 40.73  ? 127  LEU B CG    1 
ATOM   2743  C  CD1   . LEU B  1  127  ? 11.999  25.334  124.270  1.00 40.53  ? 127  LEU B CD1   1 
ATOM   2744  C  CD2   . LEU B  1  127  ? 13.044  25.265  126.554  1.00 34.97  ? 127  LEU B CD2   1 
ATOM   2745  N  N     . HIS B  1  128  ? 9.002   26.990  124.384  1.00 22.88  ? 128  HIS B N     1 
ATOM   2746  C  CA    . HIS B  1  128  ? 7.672   26.473  124.634  1.00 28.16  ? 128  HIS B CA    1 
ATOM   2747  C  C     . HIS B  1  128  ? 7.706   25.185  125.444  1.00 33.70  ? 128  HIS B C     1 
ATOM   2748  O  O     . HIS B  1  128  ? 8.431   24.255  125.104  1.00 37.49  ? 128  HIS B O     1 
ATOM   2749  C  CB    . HIS B  1  128  ? 6.962   26.225  123.308  1.00 41.81  ? 128  HIS B CB    1 
ATOM   2750  C  CG    . HIS B  1  128  ? 5.736   25.379  123.434  1.00 39.97  ? 128  HIS B CG    1 
ATOM   2751  N  ND1   . HIS B  1  128  ? 4.511   25.895  123.795  1.00 43.07  ? 128  HIS B ND1   1 
ATOM   2752  C  CD2   . HIS B  1  128  ? 5.547   24.050  123.256  1.00 40.11  ? 128  HIS B CD2   1 
ATOM   2753  C  CE1   . HIS B  1  128  ? 3.620   24.921  123.831  1.00 46.62  ? 128  HIS B CE1   1 
ATOM   2754  N  NE2   . HIS B  1  128  ? 4.221   23.791  123.506  1.00 40.00  ? 128  HIS B NE2   1 
ATOM   2755  N  N     . ILE B  1  129  ? 6.913   25.127  126.511  1.00 39.71  ? 129  ILE B N     1 
ATOM   2756  C  CA    . ILE B  1  129  ? 6.806   23.908  127.311  1.00 33.44  ? 129  ILE B CA    1 
ATOM   2757  C  C     . ILE B  1  129  ? 5.591   23.069  126.910  1.00 37.99  ? 129  ILE B C     1 
ATOM   2758  O  O     . ILE B  1  129  ? 5.745   21.952  126.421  1.00 44.71  ? 129  ILE B O     1 
ATOM   2759  C  CB    . ILE B  1  129  ? 6.790   24.184  128.836  1.00 25.99  ? 129  ILE B CB    1 
ATOM   2760  C  CG1   . ILE B  1  129  ? 8.193   24.514  129.345  1.00 19.83  ? 129  ILE B CG1   1 
ATOM   2761  C  CG2   . ILE B  1  129  ? 6.292   22.966  129.592  1.00 28.79  ? 129  ILE B CG2   1 
ATOM   2762  C  CD1   . ILE B  1  129  ? 8.596   25.945  129.171  1.00 25.63  ? 129  ILE B CD1   1 
ATOM   2763  N  N     . ALA B  1  130  ? 4.387   23.598  127.112  1.00 41.43  ? 130  ALA B N     1 
ATOM   2764  C  CA    . ALA B  1  130  ? 3.177   22.853  126.768  1.00 41.38  ? 130  ALA B CA    1 
ATOM   2765  C  C     . ALA B  1  130  ? 1.994   23.768  126.475  1.00 44.95  ? 130  ALA B C     1 
ATOM   2766  O  O     . ALA B  1  130  ? 1.969   24.916  126.907  1.00 47.88  ? 130  ALA B O     1 
ATOM   2767  C  CB    . ALA B  1  130  ? 2.827   21.871  127.875  1.00 32.20  ? 130  ALA B CB    1 
ATOM   2768  N  N     . THR B  1  131  ? 1.020   23.248  125.732  1.00 50.63  ? 131  THR B N     1 
ATOM   2769  C  CA    . THR B  1  131  ? -0.212  23.977  125.444  1.00 53.50  ? 131  THR B CA    1 
ATOM   2770  C  C     . THR B  1  131  ? -1.376  23.355  126.197  1.00 54.27  ? 131  THR B C     1 
ATOM   2771  O  O     . THR B  1  131  ? -1.485  22.131  126.292  1.00 46.60  ? 131  THR B O     1 
ATOM   2772  C  CB    . THR B  1  131  ? -0.578  23.942  123.944  1.00 57.50  ? 131  THR B CB    1 
ATOM   2773  O  OG1   . THR B  1  131  ? -0.737  22.583  123.521  1.00 56.48  ? 131  THR B OG1   1 
ATOM   2774  C  CG2   . THR B  1  131  ? 0.486   24.613  123.099  1.00 51.12  ? 131  THR B CG2   1 
ATOM   2775  N  N     . LEU B  1  132  ? -2.257  24.201  126.717  1.00 62.78  ? 132  LEU B N     1 
ATOM   2776  C  CA    . LEU B  1  132  ? -3.443  23.718  127.407  1.00 64.33  ? 132  LEU B CA    1 
ATOM   2777  C  C     . LEU B  1  132  ? -4.708  24.340  126.830  1.00 62.98  ? 132  LEU B C     1 
ATOM   2778  O  O     . LEU B  1  132  ? -4.837  25.567  126.765  1.00 60.16  ? 132  LEU B O     1 
ATOM   2779  C  CB    . LEU B  1  132  ? -3.359  24.006  128.906  1.00 63.93  ? 132  LEU B CB    1 
ATOM   2780  C  CG    . LEU B  1  132  ? -2.077  23.624  129.650  1.00 61.70  ? 132  LEU B CG    1 
ATOM   2781  C  CD1   . LEU B  1  132  ? -1.060  24.757  129.602  1.00 62.32  ? 132  LEU B CD1   1 
ATOM   2782  C  CD2   . LEU B  1  132  ? -2.392  23.250  131.088  1.00 60.61  ? 132  LEU B CD2   1 
ATOM   2783  N  N     . GLU B  1  133  ? -5.620  23.475  126.393  1.00 66.17  ? 133  GLU B N     1 
ATOM   2784  C  CA    . GLU B  1  133  ? -6.963  23.876  125.990  1.00 75.71  ? 133  GLU B CA    1 
ATOM   2785  C  C     . GLU B  1  133  ? -7.766  24.198  127.241  1.00 77.69  ? 133  GLU B C     1 
ATOM   2786  O  O     . GLU B  1  133  ? -7.359  23.842  128.348  1.00 75.44  ? 133  GLU B O     1 
ATOM   2787  C  CB    . GLU B  1  133  ? -7.663  22.772  125.193  1.00 65.84  ? 133  GLU B CB    1 
ATOM   2788  C  CG    . GLU B  1  133  ? -6.741  21.916  124.340  1.00 67.00  ? 133  GLU B CG    1 
ATOM   2789  C  CD    . GLU B  1  133  ? -6.330  20.631  125.041  1.00 68.39  ? 133  GLU B CD    1 
ATOM   2790  O  OE1   . GLU B  1  133  ? -6.553  20.526  126.267  1.00 59.82  ? 133  GLU B OE1   1 
ATOM   2791  O  OE2   . GLU B  1  133  ? -5.795  19.725  124.365  1.00 60.84  ? 133  GLU B OE2   1 
ATOM   2792  N  N     . GLU B  1  134  ? -8.888  24.890  127.062  1.00 76.50  ? 134  GLU B N     1 
ATOM   2793  C  CA    . GLU B  1  134  ? -9.749  25.270  128.177  1.00 80.66  ? 134  GLU B CA    1 
ATOM   2794  C  C     . GLU B  1  134  ? -10.079 24.053  129.043  1.00 74.48  ? 134  GLU B C     1 
ATOM   2795  O  O     . GLU B  1  134  ? -10.528 23.020  128.543  1.00 68.47  ? 134  GLU B O     1 
ATOM   2796  C  CB    . GLU B  1  134  ? -11.045 25.890  127.648  1.00 88.90  ? 134  GLU B CB    1 
ATOM   2797  C  CG    . GLU B  1  134  ? -10.856 26.853  126.477  1.00 92.83  ? 134  GLU B CG    1 
ATOM   2798  C  CD    . GLU B  1  134  ? -10.904 28.313  126.895  1.00 90.62  ? 134  GLU B CD    1 
ATOM   2799  O  OE1   . GLU B  1  134  ? -10.912 29.188  126.000  1.00 71.39  ? 134  GLU B OE1   1 
ATOM   2800  O  OE2   . GLU B  1  134  ? -10.937 28.585  128.115  1.00 88.84  ? 134  GLU B OE2   1 
ATOM   2801  N  N     . GLY B  1  135  ? -9.846  24.180  130.345  1.00 68.97  ? 135  GLY B N     1 
ATOM   2802  C  CA    . GLY B  1  135  ? -10.085 23.085  131.266  1.00 68.18  ? 135  GLY B CA    1 
ATOM   2803  C  C     . GLY B  1  135  ? -8.845  22.263  131.569  1.00 66.96  ? 135  GLY B C     1 
ATOM   2804  O  O     . GLY B  1  135  ? -8.920  21.255  132.271  1.00 57.62  ? 135  GLY B O     1 
ATOM   2805  N  N     . GLY B  1  136  ? -7.706  22.675  131.020  1.00 75.15  ? 136  GLY B N     1 
ATOM   2806  C  CA    . GLY B  1  136  ? -6.445  22.011  131.303  1.00 75.55  ? 136  GLY B CA    1 
ATOM   2807  C  C     . GLY B  1  136  ? -5.747  22.514  132.555  1.00 67.48  ? 136  GLY B C     1 
ATOM   2808  O  O     . GLY B  1  136  ? -5.768  23.710  132.847  1.00 59.24  ? 136  GLY B O     1 
ATOM   2809  N  N     . ARG B  1  137  ? -5.103  21.604  133.280  1.00 59.72  ? 137  ARG B N     1 
ATOM   2810  C  CA    . ARG B  1  137  ? -4.370  21.976  134.486  1.00 64.25  ? 137  ARG B CA    1 
ATOM   2811  C  C     . ARG B  1  137  ? -2.973  21.366  134.519  1.00 62.79  ? 137  ARG B C     1 
ATOM   2812  O  O     . ARG B  1  137  ? -2.809  20.148  134.421  1.00 52.62  ? 137  ARG B O     1 
ATOM   2813  C  CB    . ARG B  1  137  ? -5.146  21.587  135.751  1.00 74.75  ? 137  ARG B CB    1 
ATOM   2814  C  CG    . ARG B  1  137  ? -6.348  22.480  136.056  1.00 84.08  ? 137  ARG B CG    1 
ATOM   2815  C  CD    . ARG B  1  137  ? -6.916  22.205  137.448  1.00 89.63  ? 137  ARG B CD    1 
ATOM   2816  N  NE    . ARG B  1  137  ? -6.028  22.661  138.518  1.00 91.77  ? 137  ARG B NE    1 
ATOM   2817  C  CZ    . ARG B  1  137  ? -6.080  23.871  139.069  1.00 85.41  ? 137  ARG B CZ    1 
ATOM   2818  N  NH1   . ARG B  1  137  ? -6.978  24.754  138.651  1.00 85.16  ? 137  ARG B NH1   1 
ATOM   2819  N  NH2   . ARG B  1  137  ? -5.235  24.201  140.037  1.00 74.54  ? 137  ARG B NH2   1 
ATOM   2820  N  N     . LEU B  1  138  ? -1.969  22.226  134.664  1.00 63.43  ? 138  LEU B N     1 
ATOM   2821  C  CA    . LEU B  1  138  ? -0.582  21.784  134.713  1.00 60.56  ? 138  LEU B CA    1 
ATOM   2822  C  C     . LEU B  1  138  ? 0.118   22.327  135.954  1.00 56.01  ? 138  LEU B C     1 
ATOM   2823  O  O     . LEU B  1  138  ? 0.349   23.531  136.076  1.00 55.45  ? 138  LEU B O     1 
ATOM   2824  C  CB    . LEU B  1  138  ? 0.164   22.245  133.457  1.00 61.46  ? 138  LEU B CB    1 
ATOM   2825  C  CG    . LEU B  1  138  ? 1.548   21.651  133.181  1.00 50.41  ? 138  LEU B CG    1 
ATOM   2826  C  CD1   . LEU B  1  138  ? 1.439   20.189  132.754  1.00 42.77  ? 138  LEU B CD1   1 
ATOM   2827  C  CD2   . LEU B  1  138  ? 2.284   22.472  132.133  1.00 39.62  ? 138  LEU B CD2   1 
ATOM   2828  N  N     . ASN B  1  139  ? 0.466   21.430  136.866  1.00 44.57  ? 139  ASN B N     1 
ATOM   2829  C  CA    . ASN B  1  139  ? 1.215   21.808  138.050  1.00 48.49  ? 139  ASN B CA    1 
ATOM   2830  C  C     . ASN B  1  139  ? 2.413   20.880  138.163  1.00 51.85  ? 139  ASN B C     1 
ATOM   2831  O  O     . ASN B  1  139  ? 2.248   19.666  138.280  1.00 57.71  ? 139  ASN B O     1 
ATOM   2832  C  CB    . ASN B  1  139  ? 0.331   21.710  139.294  1.00 58.89  ? 139  ASN B CB    1 
ATOM   2833  C  CG    . ASN B  1  139  ? 0.890   22.487  140.475  1.00 64.62  ? 139  ASN B CG    1 
ATOM   2834  O  OD1   . ASN B  1  139  ? 2.103   22.579  140.658  1.00 63.21  ? 139  ASN B OD1   1 
ATOM   2835  N  ND2   . ASN B  1  139  ? 0.001   23.052  141.285  1.00 67.22  ? 139  ASN B ND2   1 
ATOM   2836  N  N     . MET B  1  140  ? 3.616   21.445  138.108  1.00 45.42  ? 140  MET B N     1 
ATOM   2837  C  CA    . MET B  1  140  ? 4.827   20.636  138.093  1.00 41.56  ? 140  MET B CA    1 
ATOM   2838  C  C     . MET B  1  140  ? 6.041   21.327  138.709  1.00 35.09  ? 140  MET B C     1 
ATOM   2839  O  O     . MET B  1  140  ? 6.116   22.552  138.773  1.00 27.11  ? 140  MET B O     1 
ATOM   2840  C  CB    . MET B  1  140  ? 5.162   20.197  136.665  1.00 43.38  ? 140  MET B CB    1 
ATOM   2841  C  CG    . MET B  1  140  ? 5.790   21.289  135.812  1.00 49.92  ? 140  MET B CG    1 
ATOM   2842  S  SD    . MET B  1  140  ? 6.513   20.656  134.286  1.00 55.80  ? 140  MET B SD    1 
ATOM   2843  C  CE    . MET B  1  140  ? 5.055   20.039  133.454  1.00 49.17  ? 140  MET B CE    1 
ATOM   2844  N  N     . GLU B  1  141  ? 6.988   20.510  139.158  1.00 33.57  ? 141  GLU B N     1 
ATOM   2845  C  CA    . GLU B  1  141  ? 8.248   20.979  139.703  1.00 32.25  ? 141  GLU B CA    1 
ATOM   2846  C  C     . GLU B  1  141  ? 9.398   20.340  138.933  1.00 41.30  ? 141  GLU B C     1 
ATOM   2847  O  O     . GLU B  1  141  ? 9.414   19.122  138.716  1.00 40.39  ? 141  GLU B O     1 
ATOM   2848  C  CB    . GLU B  1  141  ? 8.358   20.614  141.183  1.00 39.41  ? 141  GLU B CB    1 
ATOM   2849  C  CG    . GLU B  1  141  ? 7.258   21.195  142.052  1.00 50.76  ? 141  GLU B CG    1 
ATOM   2850  C  CD    . GLU B  1  141  ? 7.379   20.782  143.510  1.00 61.76  ? 141  GLU B CD    1 
ATOM   2851  O  OE1   . GLU B  1  141  ? 8.477   20.343  143.925  1.00 57.55  ? 141  GLU B OE1   1 
ATOM   2852  O  OE2   . GLU B  1  141  ? 6.368   20.895  144.237  1.00 57.89  ? 141  GLU B OE2   1 
ATOM   2853  N  N     . VAL B  1  142  ? 10.352  21.168  138.514  1.00 38.19  ? 142  VAL B N     1 
ATOM   2854  C  CA    . VAL B  1  142  ? 11.524  20.687  137.797  1.00 28.18  ? 142  VAL B CA    1 
ATOM   2855  C  C     . VAL B  1  142  ? 12.782  20.924  138.622  1.00 32.10  ? 142  VAL B C     1 
ATOM   2856  O  O     . VAL B  1  142  ? 12.902  21.924  139.324  1.00 34.25  ? 142  VAL B O     1 
ATOM   2857  C  CB    . VAL B  1  142  ? 11.662  21.342  136.403  1.00 32.15  ? 142  VAL B CB    1 
ATOM   2858  C  CG1   . VAL B  1  142  ? 10.421  21.072  135.567  1.00 32.55  ? 142  VAL B CG1   1 
ATOM   2859  C  CG2   . VAL B  1  142  ? 11.905  22.836  136.526  1.00 37.73  ? 142  VAL B CG2   1 
ATOM   2860  N  N     . ARG B  1  143  ? 13.716  19.986  138.528  1.00 38.77  ? 143  ARG B N     1 
ATOM   2861  C  CA    . ARG B  1  143  ? 14.910  19.965  139.362  1.00 30.62  ? 143  ARG B CA    1 
ATOM   2862  C  C     . ARG B  1  143  ? 16.145  20.199  138.503  1.00 24.75  ? 143  ARG B C     1 
ATOM   2863  O  O     . ARG B  1  143  ? 16.411  19.439  137.577  1.00 22.97  ? 143  ARG B O     1 
ATOM   2864  C  CB    . ARG B  1  143  ? 14.996  18.614  140.077  1.00 29.75  ? 143  ARG B CB    1 
ATOM   2865  C  CG    . ARG B  1  143  ? 16.375  18.229  140.576  1.00 34.79  ? 143  ARG B CG    1 
ATOM   2866  C  CD    . ARG B  1  143  ? 16.746  18.936  141.865  1.00 36.01  ? 143  ARG B CD    1 
ATOM   2867  N  NE    . ARG B  1  143  ? 18.060  18.509  142.345  1.00 40.13  ? 143  ARG B NE    1 
ATOM   2868  C  CZ    . ARG B  1  143  ? 18.262  17.498  143.183  1.00 29.32  ? 143  ARG B CZ    1 
ATOM   2869  N  NH1   . ARG B  1  143  ? 17.236  16.798  143.644  1.00 28.23  ? 143  ARG B NH1   1 
ATOM   2870  N  NH2   . ARG B  1  143  ? 19.494  17.185  143.560  1.00 23.04  ? 143  ARG B NH2   1 
ATOM   2871  N  N     . VAL B  1  144  ? 16.890  21.254  138.813  1.00 21.87  ? 144  VAL B N     1 
ATOM   2872  C  CA    . VAL B  1  144  ? 18.037  21.661  138.010  1.00 19.17  ? 144  VAL B CA    1 
ATOM   2873  C  C     . VAL B  1  144  ? 19.328  21.583  138.813  1.00 24.23  ? 144  VAL B C     1 
ATOM   2874  O  O     . VAL B  1  144  ? 19.435  22.165  139.889  1.00 29.51  ? 144  VAL B O     1 
ATOM   2875  C  CB    . VAL B  1  144  ? 17.863  23.098  137.472  1.00 19.20  ? 144  VAL B CB    1 
ATOM   2876  C  CG1   . VAL B  1  144  ? 19.150  23.600  136.841  1.00 20.61  ? 144  VAL B CG1   1 
ATOM   2877  C  CG2   . VAL B  1  144  ? 16.725  23.155  136.474  1.00 21.55  ? 144  VAL B CG2   1 
ATOM   2878  N  N     . ASP B  1  145  ? 20.309  20.862  138.281  1.00 23.18  ? 145  ASP B N     1 
ATOM   2879  C  CA    . ASP B  1  145  ? 21.571  20.665  138.975  1.00 23.46  ? 145  ASP B CA    1 
ATOM   2880  C  C     . ASP B  1  145  ? 22.753  21.081  138.122  1.00 25.83  ? 145  ASP B C     1 
ATOM   2881  O  O     . ASP B  1  145  ? 22.712  20.992  136.897  1.00 26.61  ? 145  ASP B O     1 
ATOM   2882  C  CB    . ASP B  1  145  ? 21.742  19.197  139.370  1.00 31.55  ? 145  ASP B CB    1 
ATOM   2883  C  CG    . ASP B  1  145  ? 20.790  18.771  140.472  1.00 36.76  ? 145  ASP B CG    1 
ATOM   2884  O  OD1   . ASP B  1  145  ? 19.648  18.383  140.146  1.00 28.84  ? 145  ASP B OD1   1 
ATOM   2885  O  OD2   . ASP B  1  145  ? 21.190  18.817  141.660  1.00 38.08  ? 145  ASP B OD2   1 
ATOM   2886  N  N     . ARG B  1  146  ? 23.810  21.532  138.785  1.00 29.47  ? 146  ARG B N     1 
ATOM   2887  C  CA    . ARG B  1  146  ? 25.088  21.756  138.130  1.00 27.06  ? 146  ARG B CA    1 
ATOM   2888  C  C     . ARG B  1  146  ? 25.779  20.403  137.945  1.00 27.71  ? 146  ARG B C     1 
ATOM   2889  O  O     . ARG B  1  146  ? 25.832  19.591  138.868  1.00 26.80  ? 146  ARG B O     1 
ATOM   2890  C  CB    . ARG B  1  146  ? 25.952  22.692  138.977  1.00 30.20  ? 146  ARG B CB    1 
ATOM   2891  C  CG    . ARG B  1  146  ? 27.320  22.989  138.393  1.00 37.33  ? 146  ARG B CG    1 
ATOM   2892  C  CD    . ARG B  1  146  ? 27.528  24.485  138.238  1.00 42.73  ? 146  ARG B CD    1 
ATOM   2893  N  NE    . ARG B  1  146  ? 27.490  25.178  139.522  1.00 44.38  ? 146  ARG B NE    1 
ATOM   2894  C  CZ    . ARG B  1  146  ? 27.402  26.499  139.655  1.00 47.50  ? 146  ARG B CZ    1 
ATOM   2895  N  NH1   . ARG B  1  146  ? 27.332  27.276  138.581  1.00 42.41  ? 146  ARG B NH1   1 
ATOM   2896  N  NH2   . ARG B  1  146  ? 27.378  27.044  140.862  1.00 46.35  ? 146  ARG B NH2   1 
ATOM   2897  N  N     . GLY B  1  147  ? 26.297  20.157  136.747  1.00 23.65  ? 147  GLY B N     1 
ATOM   2898  C  CA    . GLY B  1  147  ? 26.964  18.901  136.457  1.00 20.07  ? 147  GLY B CA    1 
ATOM   2899  C  C     . GLY B  1  147  ? 27.899  19.025  135.271  1.00 19.44  ? 147  GLY B C     1 
ATOM   2900  O  O     . GLY B  1  147  ? 28.134  20.126  134.771  1.00 22.19  ? 147  GLY B O     1 
ATOM   2901  N  N     . VAL B  1  148  ? 28.443  17.895  134.826  1.00 20.11  ? 148  VAL B N     1 
ATOM   2902  C  CA    . VAL B  1  148  ? 29.316  17.865  133.654  1.00 17.71  ? 148  VAL B CA    1 
ATOM   2903  C  C     . VAL B  1  148  ? 28.947  16.730  132.696  1.00 19.16  ? 148  VAL B C     1 
ATOM   2904  O  O     . VAL B  1  148  ? 28.573  15.638  133.124  1.00 28.05  ? 148  VAL B O     1 
ATOM   2905  C  CB    . VAL B  1  148  ? 30.795  17.710  134.054  1.00 14.58  ? 148  VAL B CB    1 
ATOM   2906  C  CG1   . VAL B  1  148  ? 31.342  19.017  134.596  1.00 15.51  ? 148  VAL B CG1   1 
ATOM   2907  C  CG2   . VAL B  1  148  ? 30.959  16.582  135.063  1.00 15.09  ? 148  VAL B CG2   1 
ATOM   2908  N  N     . GLY B  1  149  ? 29.051  16.987  131.398  1.00 12.40  ? 149  GLY B N     1 
ATOM   2909  C  CA    . GLY B  1  149  ? 28.849  15.935  130.423  1.00 13.57  ? 149  GLY B CA    1 
ATOM   2910  C  C     . GLY B  1  149  ? 27.418  15.443  130.334  1.00 15.06  ? 149  GLY B C     1 
ATOM   2911  O  O     . GLY B  1  149  ? 26.485  16.233  130.396  1.00 18.70  ? 149  GLY B O     1 
ATOM   2912  N  N     . TYR B  1  150  ? 27.241  14.136  130.170  1.00 14.31  ? 150  TYR B N     1 
ATOM   2913  C  CA    . TYR B  1  150  ? 25.914  13.583  129.921  1.00 13.62  ? 150  TYR B CA    1 
ATOM   2914  C  C     . TYR B  1  150  ? 25.636  12.355  130.777  1.00 22.14  ? 150  TYR B C     1 
ATOM   2915  O  O     . TYR B  1  150  ? 26.293  11.324  130.636  1.00 27.76  ? 150  TYR B O     1 
ATOM   2916  C  CB    . TYR B  1  150  ? 25.762  13.232  128.443  1.00 11.21  ? 150  TYR B CB    1 
ATOM   2917  C  CG    . TYR B  1  150  ? 24.377  12.787  128.047  1.00 13.57  ? 150  TYR B CG    1 
ATOM   2918  C  CD1   . TYR B  1  150  ? 23.416  13.714  127.661  1.00 14.09  ? 150  TYR B CD1   1 
ATOM   2919  C  CD2   . TYR B  1  150  ? 24.031  11.442  128.042  1.00 11.95  ? 150  TYR B CD2   1 
ATOM   2920  C  CE1   . TYR B  1  150  ? 22.146  13.318  127.288  1.00 10.13  ? 150  TYR B CE1   1 
ATOM   2921  C  CE2   . TYR B  1  150  ? 22.763  11.037  127.673  1.00 12.72  ? 150  TYR B CE2   1 
ATOM   2922  C  CZ    . TYR B  1  150  ? 21.825  11.982  127.297  1.00 11.77  ? 150  TYR B CZ    1 
ATOM   2923  O  OH    . TYR B  1  150  ? 20.559  11.590  126.928  1.00 14.04  ? 150  TYR B OH    1 
ATOM   2924  N  N     . VAL B  1  151  ? 24.654  12.472  131.663  1.00 22.84  ? 151  VAL B N     1 
ATOM   2925  C  CA    . VAL B  1  151  ? 24.270  11.377  132.540  1.00 17.84  ? 151  VAL B CA    1 
ATOM   2926  C  C     . VAL B  1  151  ? 22.826  10.953  132.278  1.00 21.34  ? 151  VAL B C     1 
ATOM   2927  O  O     . VAL B  1  151  ? 21.897  11.730  132.518  1.00 18.39  ? 151  VAL B O     1 
ATOM   2928  C  CB    . VAL B  1  151  ? 24.435  11.776  134.013  1.00 15.25  ? 151  VAL B CB    1 
ATOM   2929  C  CG1   . VAL B  1  151  ? 24.299  10.563  134.907  1.00 18.02  ? 151  VAL B CG1   1 
ATOM   2930  C  CG2   . VAL B  1  151  ? 25.786  12.434  134.226  1.00 14.21  ? 151  VAL B CG2   1 
ATOM   2931  N  N     . PRO B  1  152  ? 22.633  9.715   131.786  1.00 21.69  ? 152  PRO B N     1 
ATOM   2932  C  CA    . PRO B  1  152  ? 21.299  9.163   131.516  1.00 21.66  ? 152  PRO B CA    1 
ATOM   2933  C  C     . PRO B  1  152  ? 20.479  9.089   132.798  1.00 25.13  ? 152  PRO B C     1 
ATOM   2934  O  O     . PRO B  1  152  ? 21.058  9.080   133.884  1.00 27.82  ? 152  PRO B O     1 
ATOM   2935  C  CB    . PRO B  1  152  ? 21.598  7.747   131.012  1.00 22.34  ? 152  PRO B CB    1 
ATOM   2936  C  CG    . PRO B  1  152  ? 23.017  7.783   130.571  1.00 18.23  ? 152  PRO B CG    1 
ATOM   2937  C  CD    . PRO B  1  152  ? 23.701  8.753   131.471  1.00 16.85  ? 152  PRO B CD    1 
ATOM   2938  N  N     . ALA B  1  153  ? 19.157  9.024   132.672  1.00 27.12  ? 153  ALA B N     1 
ATOM   2939  C  CA    . ALA B  1  153  ? 18.257  9.084   133.825  1.00 27.05  ? 153  ALA B CA    1 
ATOM   2940  C  C     . ALA B  1  153  ? 18.547  8.043   134.911  1.00 29.43  ? 153  ALA B C     1 
ATOM   2941  O  O     . ALA B  1  153  ? 18.546  8.361   136.101  1.00 30.22  ? 153  ALA B O     1 
ATOM   2942  C  CB    . ALA B  1  153  ? 16.811  8.980   133.368  1.00 27.36  ? 153  ALA B CB    1 
ATOM   2943  N  N     . GLU B  1  154  ? 18.824  6.812   134.500  1.00 27.33  ? 154  GLU B N     1 
ATOM   2944  C  CA    . GLU B  1  154  ? 18.995  5.717   135.449  1.00 27.84  ? 154  GLU B CA    1 
ATOM   2945  C  C     . GLU B  1  154  ? 20.394  5.646   136.065  1.00 31.56  ? 154  GLU B C     1 
ATOM   2946  O  O     . GLU B  1  154  ? 20.687  4.730   136.829  1.00 38.61  ? 154  GLU B O     1 
ATOM   2947  C  CB    . GLU B  1  154  ? 18.632  4.376   134.807  1.00 21.30  ? 154  GLU B CB    1 
ATOM   2948  C  CG    . GLU B  1  154  ? 19.059  4.237   133.360  1.00 29.83  ? 154  GLU B CG    1 
ATOM   2949  C  CD    . GLU B  1  154  ? 18.003  4.743   132.393  1.00 38.96  ? 154  GLU B CD    1 
ATOM   2950  O  OE1   . GLU B  1  154  ? 18.357  5.068   131.238  1.00 43.25  ? 154  GLU B OE1   1 
ATOM   2951  O  OE2   . GLU B  1  154  ? 16.820  4.810   132.788  1.00 31.93  ? 154  GLU B OE2   1 
ATOM   2952  N  N     . LYS B  1  155  ? 21.258  6.600   135.726  1.00 26.95  ? 155  LYS B N     1 
ATOM   2953  C  CA    . LYS B  1  155  ? 22.589  6.673   136.332  1.00 26.67  ? 155  LYS B CA    1 
ATOM   2954  C  C     . LYS B  1  155  ? 22.586  7.550   137.578  1.00 33.07  ? 155  LYS B C     1 
ATOM   2955  O  O     . LYS B  1  155  ? 22.919  7.084   138.666  1.00 36.63  ? 155  LYS B O     1 
ATOM   2956  C  CB    . LYS B  1  155  ? 23.650  7.144   135.334  1.00 26.69  ? 155  LYS B CB    1 
ATOM   2957  C  CG    . LYS B  1  155  ? 23.943  6.140   134.234  1.00 31.94  ? 155  LYS B CG    1 
ATOM   2958  C  CD    . LYS B  1  155  ? 24.327  4.784   134.810  1.00 37.27  ? 155  LYS B CD    1 
ATOM   2959  C  CE    . LYS B  1  155  ? 24.016  3.664   133.829  1.00 39.30  ? 155  LYS B CE    1 
ATOM   2960  N  NZ    . LYS B  1  155  ? 24.514  3.976   132.456  1.00 41.69  ? 155  LYS B NZ    1 
ATOM   2961  N  N     . HIS B  1  156  ? 22.246  8.826   137.414  1.00 30.13  ? 156  HIS B N     1 
ATOM   2962  C  CA    . HIS B  1  156  ? 22.088  9.712   138.561  1.00 25.53  ? 156  HIS B CA    1 
ATOM   2963  C  C     . HIS B  1  156  ? 20.887  9.253   139.387  1.00 34.99  ? 156  HIS B C     1 
ATOM   2964  O  O     . HIS B  1  156  ? 20.955  9.176   140.619  1.00 29.26  ? 156  HIS B O     1 
ATOM   2965  C  CB    . HIS B  1  156  ? 21.916  11.163  138.106  1.00 27.22  ? 156  HIS B CB    1 
ATOM   2966  C  CG    . HIS B  1  156  ? 20.607  11.437  137.433  1.00 28.72  ? 156  HIS B CG    1 
ATOM   2967  N  ND1   . HIS B  1  156  ? 19.490  11.856  138.125  1.00 32.92  ? 156  HIS B ND1   1 
ATOM   2968  C  CD2   . HIS B  1  156  ? 20.231  11.341  136.138  1.00 30.03  ? 156  HIS B CD2   1 
ATOM   2969  C  CE1   . HIS B  1  156  ? 18.485  12.011  137.283  1.00 31.05  ? 156  HIS B CE1   1 
ATOM   2970  N  NE2   . HIS B  1  156  ? 18.907  11.706  136.070  1.00 30.23  ? 156  HIS B NE2   1 
ATOM   2971  N  N     . GLY B  1  157  ? 19.793  8.946   138.689  1.00 39.38  ? 157  GLY B N     1 
ATOM   2972  C  CA    . GLY B  1  157  ? 18.594  8.373   139.281  1.00 42.73  ? 157  GLY B CA    1 
ATOM   2973  C  C     . GLY B  1  157  ? 17.961  9.123   140.441  1.00 55.99  ? 157  GLY B C     1 
ATOM   2974  O  O     . GLY B  1  157  ? 17.268  8.516   141.261  1.00 61.60  ? 157  GLY B O     1 
ATOM   2975  N  N     . ILE B  1  158  ? 18.177  10.434  140.512  1.00 47.21  ? 158  ILE B N     1 
ATOM   2976  C  CA    . ILE B  1  158  ? 17.707  11.201  141.662  1.00 43.84  ? 158  ILE B CA    1 
ATOM   2977  C  C     . ILE B  1  158  ? 16.181  11.340  141.707  1.00 49.05  ? 158  ILE B C     1 
ATOM   2978  O  O     . ILE B  1  158  ? 15.523  11.532  140.679  1.00 43.33  ? 158  ILE B O     1 
ATOM   2979  C  CB    . ILE B  1  158  ? 18.400  12.582  141.771  1.00 35.60  ? 158  ILE B CB    1 
ATOM   2980  C  CG1   . ILE B  1  158  ? 17.669  13.642  140.953  1.00 35.22  ? 158  ILE B CG1   1 
ATOM   2981  C  CG2   . ILE B  1  158  ? 19.863  12.487  141.357  1.00 29.63  ? 158  ILE B CG2   1 
ATOM   2982  C  CD1   . ILE B  1  158  ? 18.339  14.983  141.005  1.00 35.78  ? 158  ILE B CD1   1 
ATOM   2983  N  N     . LYS B  1  159  ? 15.631  11.193  142.912  1.00 59.73  ? 159  LYS B N     1 
ATOM   2984  C  CA    . LYS B  1  159  ? 14.204  11.386  143.163  1.00 59.26  ? 159  LYS B CA    1 
ATOM   2985  C  C     . LYS B  1  159  ? 13.978  12.194  144.437  1.00 48.56  ? 159  LYS B C     1 
ATOM   2986  O  O     . LYS B  1  159  ? 14.385  11.785  145.524  1.00 47.74  ? 159  LYS B O     1 
ATOM   2987  C  CB    . LYS B  1  159  ? 13.478  10.044  143.271  1.00 47.24  ? 159  LYS B CB    1 
ATOM   2988  C  CG    . LYS B  1  159  ? 12.802  9.586   141.989  1.00 50.30  ? 159  LYS B CG    1 
ATOM   2989  C  CD    . LYS B  1  159  ? 12.019  8.300   142.226  1.00 62.00  ? 159  LYS B CD    1 
ATOM   2990  C  CE    . LYS B  1  159  ? 11.442  7.743   140.933  1.00 65.01  ? 159  LYS B CE    1 
ATOM   2991  N  NZ    . LYS B  1  159  ? 12.500  7.435   139.926  1.00 51.96  ? 159  LYS B NZ    1 
ATOM   2992  N  N     . ASP B  1  160  ? 13.342  13.351  144.295  1.00 46.40  ? 160  ASP B N     1 
ATOM   2993  C  CA    . ASP B  1  160  ? 12.977  14.166  145.445  1.00 51.36  ? 160  ASP B CA    1 
ATOM   2994  C  C     . ASP B  1  160  ? 11.683  13.674  146.094  1.00 45.10  ? 160  ASP B C     1 
ATOM   2995  O  O     . ASP B  1  160  ? 11.501  13.800  147.304  1.00 41.08  ? 160  ASP B O     1 
ATOM   2996  C  CB    . ASP B  1  160  ? 12.865  15.642  145.052  1.00 59.83  ? 160  ASP B CB    1 
ATOM   2997  C  CG    . ASP B  1  160  ? 14.218  16.282  144.792  1.00 53.87  ? 160  ASP B CG    1 
ATOM   2998  O  OD1   . ASP B  1  160  ? 15.237  15.739  145.276  1.00 51.24  ? 160  ASP B OD1   1 
ATOM   2999  O  OD2   . ASP B  1  160  ? 14.261  17.331  144.111  1.00 47.82  ? 160  ASP B OD2   1 
ATOM   3000  N  N     . ARG B  1  161  ? 10.782  13.127  145.282  1.00 44.33  ? 161  ARG B N     1 
ATOM   3001  C  CA    . ARG B  1  161  ? 9.536   12.567  145.796  1.00 44.75  ? 161  ARG B CA    1 
ATOM   3002  C  C     . ARG B  1  161  ? 9.077   11.339  145.010  1.00 44.67  ? 161  ARG B C     1 
ATOM   3003  O  O     . ARG B  1  161  ? 9.773   10.866  144.113  1.00 46.41  ? 161  ARG B O     1 
ATOM   3004  C  CB    . ARG B  1  161  ? 8.435   13.625  145.854  1.00 46.44  ? 161  ARG B CB    1 
ATOM   3005  C  CG    . ARG B  1  161  ? 8.020   14.178  144.515  1.00 50.81  ? 161  ARG B CG    1 
ATOM   3006  C  CD    . ARG B  1  161  ? 6.848   15.124  144.680  1.00 53.45  ? 161  ARG B CD    1 
ATOM   3007  N  NE    . ARG B  1  161  ? 7.223   16.366  145.348  1.00 46.92  ? 161  ARG B NE    1 
ATOM   3008  C  CZ    . ARG B  1  161  ? 6.348   17.250  145.817  1.00 49.17  ? 161  ARG B CZ    1 
ATOM   3009  N  NH1   . ARG B  1  161  ? 5.046   17.018  145.703  1.00 44.71  ? 161  ARG B NH1   1 
ATOM   3010  N  NH2   . ARG B  1  161  ? 6.770   18.360  146.409  1.00 50.89  ? 161  ARG B NH2   1 
ATOM   3011  N  N     . ILE B  1  162  ? 7.899   10.830  145.350  1.00 49.91  ? 162  ILE B N     1 
ATOM   3012  C  CA    . ILE B  1  162  ? 7.462   9.526   144.860  1.00 53.83  ? 162  ILE B CA    1 
ATOM   3013  C  C     . ILE B  1  162  ? 7.130   9.495   143.367  1.00 58.42  ? 162  ILE B C     1 
ATOM   3014  O  O     . ILE B  1  162  ? 7.558   8.588   142.651  1.00 55.27  ? 162  ILE B O     1 
ATOM   3015  C  CB    . ILE B  1  162  ? 6.271   8.990   145.684  1.00 53.62  ? 162  ILE B CB    1 
ATOM   3016  C  CG1   . ILE B  1  162  ? 5.754   7.674   145.092  1.00 55.44  ? 162  ILE B CG1   1 
ATOM   3017  C  CG2   . ILE B  1  162  ? 5.167   10.041  145.780  1.00 55.11  ? 162  ILE B CG2   1 
ATOM   3018  C  CD1   . ILE B  1  162  ? 6.776   6.551   145.100  1.00 49.38  ? 162  ILE B CD1   1 
ATOM   3019  N  N     . ASN B  1  163  ? 6.383   10.489  142.896  1.00 63.03  ? 163  ASN B N     1 
ATOM   3020  C  CA    . ASN B  1  163  ? 5.983   10.540  141.493  1.00 65.61  ? 163  ASN B CA    1 
ATOM   3021  C  C     . ASN B  1  163  ? 7.004   11.267  140.624  1.00 58.81  ? 163  ASN B C     1 
ATOM   3022  O  O     . ASN B  1  163  ? 6.773   11.490  139.433  1.00 56.04  ? 163  ASN B O     1 
ATOM   3023  C  CB    . ASN B  1  163  ? 4.604   11.186  141.344  1.00 66.15  ? 163  ASN B CB    1 
ATOM   3024  C  CG    . ASN B  1  163  ? 3.490   10.312  141.878  1.00 64.18  ? 163  ASN B CG    1 
ATOM   3025  O  OD1   . ASN B  1  163  ? 3.537   9.085   141.762  1.00 59.00  ? 163  ASN B OD1   1 
ATOM   3026  N  ND2   . ASN B  1  163  ? 2.477   10.939  142.469  1.00 66.26  ? 163  ASN B ND2   1 
ATOM   3027  N  N     . ALA B  1  164  ? 8.124   11.648  141.235  1.00 51.14  ? 164  ALA B N     1 
ATOM   3028  C  CA    . ALA B  1  164  ? 9.193   12.342  140.528  1.00 47.02  ? 164  ALA B CA    1 
ATOM   3029  C  C     . ALA B  1  164  ? 9.759   11.486  139.399  1.00 48.04  ? 164  ALA B C     1 
ATOM   3030  O  O     . ALA B  1  164  ? 10.137  10.334  139.610  1.00 40.89  ? 164  ALA B O     1 
ATOM   3031  C  CB    . ALA B  1  164  ? 10.298  12.752  141.496  1.00 45.31  ? 164  ALA B CB    1 
ATOM   3032  N  N     . ILE B  1  165  ? 9.803   12.063  138.201  1.00 43.79  ? 165  ILE B N     1 
ATOM   3033  C  CA    . ILE B  1  165  ? 10.349  11.389  137.029  1.00 40.34  ? 165  ILE B CA    1 
ATOM   3034  C  C     . ILE B  1  165  ? 11.765  11.878  136.735  1.00 38.81  ? 165  ILE B C     1 
ATOM   3035  O  O     . ILE B  1  165  ? 11.968  13.057  136.440  1.00 38.70  ? 165  ILE B O     1 
ATOM   3036  C  CB    . ILE B  1  165  ? 9.479   11.642  135.786  1.00 40.25  ? 165  ILE B CB    1 
ATOM   3037  C  CG1   . ILE B  1  165  ? 8.083   11.047  135.979  1.00 43.93  ? 165  ILE B CG1   1 
ATOM   3038  C  CG2   . ILE B  1  165  ? 10.143  11.068  134.547  1.00 40.96  ? 165  ILE B CG2   1 
ATOM   3039  C  CD1   . ILE B  1  165  ? 7.178   11.220  134.778  1.00 40.13  ? 165  ILE B CD1   1 
ATOM   3040  N  N     . PRO B  1  166  ? 12.751  10.973  136.817  1.00 34.86  ? 166  PRO B N     1 
ATOM   3041  C  CA    . PRO B  1  166  ? 14.145  11.335  136.548  1.00 33.96  ? 166  PRO B CA    1 
ATOM   3042  C  C     . PRO B  1  166  ? 14.363  11.641  135.067  1.00 31.02  ? 166  PRO B C     1 
ATOM   3043  O  O     . PRO B  1  166  ? 13.889  10.901  134.203  1.00 29.01  ? 166  PRO B O     1 
ATOM   3044  C  CB    . PRO B  1  166  ? 14.913  10.078  136.960  1.00 34.40  ? 166  PRO B CB    1 
ATOM   3045  C  CG    . PRO B  1  166  ? 13.945  8.969   136.744  1.00 31.90  ? 166  PRO B CG    1 
ATOM   3046  C  CD    . PRO B  1  166  ? 12.596  9.533   137.089  1.00 38.66  ? 166  PRO B CD    1 
ATOM   3047  N  N     . VAL B  1  167  ? 15.079  12.724  134.787  1.00 26.80  ? 167  VAL B N     1 
ATOM   3048  C  CA    . VAL B  1  167  ? 15.299  13.176  133.418  1.00 27.16  ? 167  VAL B CA    1 
ATOM   3049  C  C     . VAL B  1  167  ? 16.758  13.001  133.012  1.00 28.55  ? 167  VAL B C     1 
ATOM   3050  O  O     . VAL B  1  167  ? 17.659  13.260  133.812  1.00 29.13  ? 167  VAL B O     1 
ATOM   3051  C  CB    . VAL B  1  167  ? 14.907  14.659  133.273  1.00 25.27  ? 167  VAL B CB    1 
ATOM   3052  C  CG1   . VAL B  1  167  ? 15.315  15.211  131.912  1.00 21.41  ? 167  VAL B CG1   1 
ATOM   3053  C  CG2   . VAL B  1  167  ? 13.421  14.824  133.501  1.00 27.20  ? 167  VAL B CG2   1 
ATOM   3054  N  N     . ASP B  1  168  ? 16.986  12.553  131.777  1.00 23.61  ? 168  ASP B N     1 
ATOM   3055  C  CA    . ASP B  1  168  ? 18.338  12.447  131.241  1.00 21.11  ? 168  ASP B CA    1 
ATOM   3056  C  C     . ASP B  1  168  ? 19.020  13.809  131.344  1.00 17.30  ? 168  ASP B C     1 
ATOM   3057  O  O     . ASP B  1  168  ? 18.498  14.820  130.878  1.00 18.96  ? 168  ASP B O     1 
ATOM   3058  C  CB    . ASP B  1  168  ? 18.300  11.959  129.792  1.00 20.07  ? 168  ASP B CB    1 
ATOM   3059  C  CG    . ASP B  1  168  ? 17.590  10.618  129.645  1.00 30.80  ? 168  ASP B CG    1 
ATOM   3060  O  OD1   . ASP B  1  168  ? 18.272  9.571   129.727  1.00 30.43  ? 168  ASP B OD1   1 
ATOM   3061  O  OD2   . ASP B  1  168  ? 16.351  10.609  129.454  1.00 31.51  ? 168  ASP B OD2   1 
ATOM   3062  N  N     . ALA B  1  169  ? 20.180  13.835  131.982  1.00 14.92  ? 169  ALA B N     1 
ATOM   3063  C  CA    . ALA B  1  169  ? 20.791  15.102  132.344  1.00 17.88  ? 169  ALA B CA    1 
ATOM   3064  C  C     . ALA B  1  169  ? 21.803  15.552  131.311  1.00 21.24  ? 169  ALA B C     1 
ATOM   3065  O  O     . ALA B  1  169  ? 22.894  14.990  131.218  1.00 19.40  ? 169  ALA B O     1 
ATOM   3066  C  CB    . ALA B  1  169  ? 21.457  14.984  133.700  1.00 20.46  ? 169  ALA B CB    1 
ATOM   3067  N  N     . VAL B  1  170  ? 21.479  16.603  130.568  1.00 20.93  ? 170  VAL B N     1 
ATOM   3068  C  CA    . VAL B  1  170  ? 22.438  17.088  129.602  1.00 16.01  ? 170  VAL B CA    1 
ATOM   3069  C  C     . VAL B  1  170  ? 23.119  18.272  130.251  1.00 14.16  ? 170  VAL B C     1 
ATOM   3070  O  O     . VAL B  1  170  ? 22.632  19.403  130.201  1.00 17.17  ? 170  VAL B O     1 
ATOM   3071  C  CB    . VAL B  1  170  ? 21.717  17.562  128.330  1.00 13.32  ? 170  VAL B CB    1 
ATOM   3072  C  CG1   . VAL B  1  170  ? 22.723  17.908  127.237  1.00 14.98  ? 170  VAL B CG1   1 
ATOM   3073  C  CG2   . VAL B  1  170  ? 20.742  16.501  127.854  1.00 11.09  ? 170  VAL B CG2   1 
ATOM   3074  N  N     . PHE B  1  171  ? 24.296  18.011  130.797  1.00 11.61  ? 171  PHE B N     1 
ATOM   3075  C  CA    . PHE B  1  171  ? 25.014  19.020  131.547  1.00 15.10  ? 171  PHE B CA    1 
ATOM   3076  C  C     . PHE B  1  171  ? 25.799  19.920  130.623  1.00 17.90  ? 171  PHE B C     1 
ATOM   3077  O  O     . PHE B  1  171  ? 25.813  21.135  130.806  1.00 24.83  ? 171  PHE B O     1 
ATOM   3078  C  CB    . PHE B  1  171  ? 25.939  18.379  132.579  1.00 16.86  ? 171  PHE B CB    1 
ATOM   3079  C  CG    . PHE B  1  171  ? 25.219  17.806  133.766  1.00 19.51  ? 171  PHE B CG    1 
ATOM   3080  C  CD1   . PHE B  1  171  ? 24.206  18.514  134.387  1.00 24.55  ? 171  PHE B CD1   1 
ATOM   3081  C  CD2   . PHE B  1  171  ? 25.552  16.559  134.259  1.00 17.55  ? 171  PHE B CD2   1 
ATOM   3082  C  CE1   . PHE B  1  171  ? 23.543  17.989  135.481  1.00 24.15  ? 171  PHE B CE1   1 
ATOM   3083  C  CE2   . PHE B  1  171  ? 24.894  16.034  135.351  1.00 16.40  ? 171  PHE B CE2   1 
ATOM   3084  C  CZ    . PHE B  1  171  ? 23.889  16.748  135.961  1.00 17.99  ? 171  PHE B CZ    1 
ATOM   3085  N  N     . SER B  1  172  ? 26.437  19.318  129.621  1.00 15.35  ? 172  SER B N     1 
ATOM   3086  C  CA    . SER B  1  172  ? 27.373  20.045  128.773  1.00 14.92  ? 172  SER B CA    1 
ATOM   3087  C  C     . SER B  1  172  ? 26.738  21.285  128.165  1.00 13.44  ? 172  SER B C     1 
ATOM   3088  O  O     . SER B  1  172  ? 25.708  21.205  127.494  1.00 13.76  ? 172  SER B O     1 
ATOM   3089  C  CB    . SER B  1  172  ? 27.944  19.146  127.669  1.00 16.74  ? 172  SER B CB    1 
ATOM   3090  O  OG    . SER B  1  172  ? 29.125  19.709  127.109  1.00 14.73  ? 172  SER B OG    1 
ATOM   3091  N  N     . PRO B  1  173  ? 27.342  22.446  128.435  1.00 12.49  ? 173  PRO B N     1 
ATOM   3092  C  CA    . PRO B  1  173  ? 26.923  23.681  127.782  1.00 13.23  ? 173  PRO B CA    1 
ATOM   3093  C  C     . PRO B  1  173  ? 27.326  23.603  126.319  1.00 13.80  ? 173  PRO B C     1 
ATOM   3094  O  O     . PRO B  1  173  ? 26.764  24.309  125.485  1.00 16.98  ? 173  PRO B O     1 
ATOM   3095  C  CB    . PRO B  1  173  ? 27.737  24.749  128.512  1.00 15.43  ? 173  PRO B CB    1 
ATOM   3096  C  CG    . PRO B  1  173  ? 28.946  24.035  128.994  1.00 10.87  ? 173  PRO B CG    1 
ATOM   3097  C  CD    . PRO B  1  173  ? 28.493  22.654  129.332  1.00 12.44  ? 173  PRO B CD    1 
ATOM   3098  N  N     . VAL B  1  174  ? 28.292  22.739  126.017  1.00 12.37  ? 174  VAL B N     1 
ATOM   3099  C  CA    . VAL B  1  174  ? 28.711  22.509  124.645  1.00 12.12  ? 174  VAL B CA    1 
ATOM   3100  C  C     . VAL B  1  174  ? 27.726  21.567  123.967  1.00 12.03  ? 174  VAL B C     1 
ATOM   3101  O  O     . VAL B  1  174  ? 27.508  20.449  124.426  1.00 13.34  ? 174  VAL B O     1 
ATOM   3102  C  CB    . VAL B  1  174  ? 30.108  21.883  124.579  1.00 10.55  ? 174  VAL B CB    1 
ATOM   3103  C  CG1   . VAL B  1  174  ? 30.539  21.748  123.136  1.00 14.44  ? 174  VAL B CG1   1 
ATOM   3104  C  CG2   . VAL B  1  174  ? 31.104  22.722  125.350  1.00 10.11  ? 174  VAL B CG2   1 
ATOM   3105  N  N     . ARG B  1  175  ? 27.103  22.033  122.893  1.00 11.50  ? 175  ARG B N     1 
ATOM   3106  C  CA    . ARG B  1  175  ? 26.211  21.185  122.119  1.00 12.51  ? 175  ARG B CA    1 
ATOM   3107  C  C     . ARG B  1  175  ? 26.982  20.300  121.134  1.00 16.24  ? 175  ARG B C     1 
ATOM   3108  O  O     . ARG B  1  175  ? 26.631  19.137  120.921  1.00 14.69  ? 175  ARG B O     1 
ATOM   3109  C  CB    . ARG B  1  175  ? 25.144  22.018  121.405  1.00 15.10  ? 175  ARG B CB    1 
ATOM   3110  C  CG    . ARG B  1  175  ? 24.197  22.729  122.359  1.00 22.97  ? 175  ARG B CG    1 
ATOM   3111  C  CD    . ARG B  1  175  ? 22.909  23.158  121.668  1.00 32.51  ? 175  ARG B CD    1 
ATOM   3112  N  NE    . ARG B  1  175  ? 22.020  23.904  122.560  1.00 40.92  ? 175  ARG B NE    1 
ATOM   3113  C  CZ    . ARG B  1  175  ? 21.214  23.345  123.462  1.00 46.13  ? 175  ARG B CZ    1 
ATOM   3114  N  NH1   . ARG B  1  175  ? 21.182  22.024  123.607  1.00 38.39  ? 175  ARG B NH1   1 
ATOM   3115  N  NH2   . ARG B  1  175  ? 20.438  24.108  124.224  1.00 43.46  ? 175  ARG B NH2   1 
ATOM   3116  N  N     . ARG B  1  176  ? 28.020  20.854  120.513  1.00 15.90  ? 176  ARG B N     1 
ATOM   3117  C  CA    . ARG B  1  176  ? 28.823  20.050  119.594  1.00 10.30  ? 176  ARG B CA    1 
ATOM   3118  C  C     . ARG B  1  176  ? 30.256  20.551  119.453  1.00 11.30  ? 176  ARG B C     1 
ATOM   3119  O  O     . ARG B  1  176  ? 30.505  21.749  119.521  1.00 13.83  ? 176  ARG B O     1 
ATOM   3120  C  CB    . ARG B  1  176  ? 28.141  19.956  118.216  1.00 11.77  ? 176  ARG B CB    1 
ATOM   3121  C  CG    . ARG B  1  176  ? 29.069  19.500  117.080  1.00 13.71  ? 176  ARG B CG    1 
ATOM   3122  C  CD    . ARG B  1  176  ? 28.362  18.658  116.036  1.00 9.33   ? 176  ARG B CD    1 
ATOM   3123  N  NE    . ARG B  1  176  ? 27.725  19.444  114.981  1.00 10.41  ? 176  ARG B NE    1 
ATOM   3124  C  CZ    . ARG B  1  176  ? 28.130  19.460  113.713  1.00 9.27   ? 176  ARG B CZ    1 
ATOM   3125  N  NH1   . ARG B  1  176  ? 29.175  18.740  113.333  1.00 9.80   ? 176  ARG B NH1   1 
ATOM   3126  N  NH2   . ARG B  1  176  ? 27.488  20.196  112.821  1.00 8.66   ? 176  ARG B NH2   1 
ATOM   3127  N  N     . VAL B  1  177  ? 31.192  19.627  119.258  1.00 11.02  ? 177  VAL B N     1 
ATOM   3128  C  CA    . VAL B  1  177  ? 32.547  19.975  118.850  1.00 10.18  ? 177  VAL B CA    1 
ATOM   3129  C  C     . VAL B  1  177  ? 32.864  19.246  117.555  1.00 9.69   ? 177  VAL B C     1 
ATOM   3130  O  O     . VAL B  1  177  ? 32.464  18.098  117.375  1.00 11.92  ? 177  VAL B O     1 
ATOM   3131  C  CB    . VAL B  1  177  ? 33.593  19.559  119.900  1.00 11.23  ? 177  VAL B CB    1 
ATOM   3132  C  CG1   . VAL B  1  177  ? 34.968  20.044  119.495  1.00 11.95  ? 177  VAL B CG1   1 
ATOM   3133  C  CG2   . VAL B  1  177  ? 33.232  20.106  121.261  1.00 13.23  ? 177  VAL B CG2   1 
ATOM   3134  N  N     . ALA B  1  178  ? 33.555  19.922  116.644  1.00 11.49  ? 178  ALA B N     1 
ATOM   3135  C  CA    . ALA B  1  178  ? 34.077  19.282  115.440  1.00 9.50   ? 178  ALA B CA    1 
ATOM   3136  C  C     . ALA B  1  178  ? 35.453  19.852  115.123  1.00 10.26  ? 178  ALA B C     1 
ATOM   3137  O  O     . ALA B  1  178  ? 35.601  21.058  115.054  1.00 13.92  ? 178  ALA B O     1 
ATOM   3138  C  CB    . ALA B  1  178  ? 33.134  19.511  114.278  1.00 9.13   ? 178  ALA B CB    1 
ATOM   3139  N  N     . PHE B  1  179  ? 36.462  19.011  114.922  1.00 8.29   ? 179  PHE B N     1 
ATOM   3140  C  CA    . PHE B  1  179  ? 37.782  19.545  114.578  1.00 9.45   ? 179  PHE B CA    1 
ATOM   3141  C  C     . PHE B  1  179  ? 38.425  18.925  113.331  1.00 9.84   ? 179  PHE B C     1 
ATOM   3142  O  O     . PHE B  1  179  ? 38.282  17.733  113.069  1.00 9.99   ? 179  PHE B O     1 
ATOM   3143  C  CB    . PHE B  1  179  ? 38.738  19.511  115.784  1.00 10.13  ? 179  PHE B CB    1 
ATOM   3144  C  CG    . PHE B  1  179  ? 39.499  18.215  115.944  1.00 12.19  ? 179  PHE B CG    1 
ATOM   3145  C  CD1   . PHE B  1  179  ? 40.755  18.054  115.369  1.00 8.08   ? 179  PHE B CD1   1 
ATOM   3146  C  CD2   . PHE B  1  179  ? 38.970  17.169  116.693  1.00 8.54   ? 179  PHE B CD2   1 
ATOM   3147  C  CE1   . PHE B  1  179  ? 41.456  16.872  115.522  1.00 8.03   ? 179  PHE B CE1   1 
ATOM   3148  C  CE2   . PHE B  1  179  ? 39.668  15.985  116.849  1.00 7.07   ? 179  PHE B CE2   1 
ATOM   3149  C  CZ    . PHE B  1  179  ? 40.912  15.836  116.265  1.00 7.84   ? 179  PHE B CZ    1 
ATOM   3150  N  N     . GLN B  1  180  ? 39.135  19.758  112.572  1.00 11.01  ? 180  GLN B N     1 
ATOM   3151  C  CA    . GLN B  1  180  ? 39.817  19.326  111.357  1.00 10.38  ? 180  GLN B CA    1 
ATOM   3152  C  C     . GLN B  1  180  ? 41.290  19.684  111.403  1.00 12.11  ? 180  GLN B C     1 
ATOM   3153  O  O     . GLN B  1  180  ? 41.664  20.735  111.906  1.00 16.15  ? 180  GLN B O     1 
ATOM   3154  C  CB    . GLN B  1  180  ? 39.187  19.975  110.126  1.00 12.74  ? 180  GLN B CB    1 
ATOM   3155  C  CG    . GLN B  1  180  ? 38.049  19.180  109.507  1.00 30.12  ? 180  GLN B CG    1 
ATOM   3156  C  CD    . GLN B  1  180  ? 38.378  18.685  108.104  1.00 50.59  ? 180  GLN B CD    1 
ATOM   3157  O  OE1   . GLN B  1  180  ? 39.551  18.575  107.730  1.00 48.01  ? 180  GLN B OE1   1 
ATOM   3158  N  NE2   . GLN B  1  180  ? 37.341  18.389  107.317  1.00 44.14  ? 180  GLN B NE2   1 
ATOM   3159  N  N     . VAL B  1  181  ? 42.131  18.807  110.876  1.00 11.34  ? 181  VAL B N     1 
ATOM   3160  C  CA    . VAL B  1  181  ? 43.541  19.120  110.742  1.00 12.61  ? 181  VAL B CA    1 
ATOM   3161  C  C     . VAL B  1  181  ? 43.875  19.120  109.261  1.00 18.93  ? 181  VAL B C     1 
ATOM   3162  O  O     . VAL B  1  181  ? 43.613  18.145  108.563  1.00 20.33  ? 181  VAL B O     1 
ATOM   3163  C  CB    . VAL B  1  181  ? 44.415  18.096  111.470  1.00 12.39  ? 181  VAL B CB    1 
ATOM   3164  C  CG1   . VAL B  1  181  ? 45.885  18.435  111.303  1.00 11.77  ? 181  VAL B CG1   1 
ATOM   3165  C  CG2   . VAL B  1  181  ? 44.043  18.047  112.932  1.00 11.92  ? 181  VAL B CG2   1 
ATOM   3166  N  N     . GLU B  1  182  ? 44.431  20.222  108.774  1.00 20.19  ? 182  GLU B N     1 
ATOM   3167  C  CA    . GLU B  1  182  ? 44.777  20.314  107.364  1.00 17.14  ? 182  GLU B CA    1 
ATOM   3168  C  C     . GLU B  1  182  ? 46.277  20.407  107.191  1.00 24.29  ? 182  GLU B C     1 
ATOM   3169  O  O     . GLU B  1  182  ? 46.984  20.890  108.076  1.00 22.88  ? 182  GLU B O     1 
ATOM   3170  C  CB    . GLU B  1  182  ? 44.123  21.536  106.732  1.00 21.96  ? 182  GLU B CB    1 
ATOM   3171  C  CG    . GLU B  1  182  ? 42.618  21.560  106.862  1.00 31.06  ? 182  GLU B CG    1 
ATOM   3172  C  CD    . GLU B  1  182  ? 42.046  22.919  106.527  1.00 51.47  ? 182  GLU B CD    1 
ATOM   3173  O  OE1   . GLU B  1  182  ? 40.855  23.149  106.828  1.00 66.24  ? 182  GLU B OE1   1 
ATOM   3174  O  OE2   . GLU B  1  182  ? 42.794  23.756  105.969  1.00 44.09  ? 182  GLU B OE2   1 
ATOM   3175  N  N     . ASP B  1  183  ? 46.765  19.930  106.052  1.00 31.60  ? 183  ASP B N     1 
ATOM   3176  C  CA    . ASP B  1  183  ? 48.151  20.153  105.688  1.00 29.44  ? 183  ASP B CA    1 
ATOM   3177  C  C     . ASP B  1  183  ? 48.361  21.649  105.555  1.00 30.31  ? 183  ASP B C     1 
ATOM   3178  O  O     . ASP B  1  183  ? 47.459  22.379  105.129  1.00 28.52  ? 183  ASP B O     1 
ATOM   3179  C  CB    . ASP B  1  183  ? 48.487  19.464  104.366  1.00 37.75  ? 183  ASP B CB    1 
ATOM   3180  C  CG    . ASP B  1  183  ? 48.803  17.989  104.538  1.00 60.67  ? 183  ASP B CG    1 
ATOM   3181  O  OD1   . ASP B  1  183  ? 48.379  17.189  103.673  1.00 68.06  ? 183  ASP B OD1   1 
ATOM   3182  O  OD2   . ASP B  1  183  ? 49.479  17.634  105.533  1.00 52.79  ? 183  ASP B OD2   1 
ATOM   3183  N  N     . THR B  1  184  ? 49.544  22.107  105.942  1.00 26.84  ? 184  THR B N     1 
ATOM   3184  C  CA    . THR B  1  184  ? 49.904  23.501  105.753  1.00 24.97  ? 184  THR B CA    1 
ATOM   3185  C  C     . THR B  1  184  ? 51.414  23.627  105.641  1.00 30.43  ? 184  THR B C     1 
ATOM   3186  O  O     . THR B  1  184  ? 52.163  22.703  106.003  1.00 26.50  ? 184  THR B O     1 
ATOM   3187  C  CB    . THR B  1  184  ? 49.354  24.409  106.879  1.00 24.35  ? 184  THR B CB    1 
ATOM   3188  O  OG1   . THR B  1  184  ? 49.011  25.691  106.338  1.00 21.69  ? 184  THR B OG1   1 
ATOM   3189  C  CG2   . THR B  1  184  ? 50.372  24.574  108.009  1.00 21.62  ? 184  THR B CG2   1 
ATOM   3190  N  N     . ARG B  1  185  ? 51.851  24.768  105.119  1.00 37.49  ? 185  ARG B N     1 
ATOM   3191  C  CA    . ARG B  1  185  ? 53.265  25.000  104.881  1.00 44.58  ? 185  ARG B CA    1 
ATOM   3192  C  C     . ARG B  1  185  ? 53.719  26.381  105.340  1.00 48.93  ? 185  ARG B C     1 
ATOM   3193  O  O     . ARG B  1  185  ? 52.998  27.371  105.192  1.00 45.57  ? 185  ARG B O     1 
ATOM   3194  C  CB    . ARG B  1  185  ? 53.600  24.797  103.398  1.00 46.83  ? 185  ARG B CB    1 
ATOM   3195  C  CG    . ARG B  1  185  ? 52.951  25.791  102.443  1.00 40.19  ? 185  ARG B CG    1 
ATOM   3196  C  CD    . ARG B  1  185  ? 53.339  25.477  101.003  1.00 44.37  ? 185  ARG B CD    1 
ATOM   3197  N  NE    . ARG B  1  185  ? 52.985  26.550  100.077  1.00 42.70  ? 185  ARG B NE    1 
ATOM   3198  C  CZ    . ARG B  1  185  ? 53.838  27.480  99.658   1.00 52.44  ? 185  ARG B CZ    1 
ATOM   3199  N  NH1   . ARG B  1  185  ? 55.098  27.464  100.085  1.00 46.28  ? 185  ARG B NH1   1 
ATOM   3200  N  NH2   . ARG B  1  185  ? 53.433  28.424  98.811   1.00 36.69  ? 185  ARG B NH2   1 
ATOM   3201  N  N     . LEU B  1  186  ? 54.914  26.433  105.918  1.00 49.94  ? 186  LEU B N     1 
ATOM   3202  C  CA    . LEU B  1  186  ? 55.561  27.702  106.202  1.00 60.12  ? 186  LEU B CA    1 
ATOM   3203  C  C     . LEU B  1  186  ? 56.791  27.798  105.320  1.00 61.87  ? 186  LEU B C     1 
ATOM   3204  O  O     . LEU B  1  186  ? 57.790  27.114  105.565  1.00 54.27  ? 186  LEU B O     1 
ATOM   3205  C  CB    . LEU B  1  186  ? 55.971  27.788  107.673  1.00 63.79  ? 186  LEU B CB    1 
ATOM   3206  C  CG    . LEU B  1  186  ? 56.816  29.007  108.060  1.00 67.87  ? 186  LEU B CG    1 
ATOM   3207  C  CD1   . LEU B  1  186  ? 55.996  30.293  107.981  1.00 60.77  ? 186  LEU B CD1   1 
ATOM   3208  C  CD2   . LEU B  1  186  ? 57.443  28.836  109.441  1.00 62.50  ? 186  LEU B CD2   1 
ATOM   3209  N  N     . GLY B  1  187  ? 56.729  28.655  104.306  1.00 60.33  ? 187  GLY B N     1 
ATOM   3210  C  CA    . GLY B  1  187  ? 57.832  28.760  103.372  1.00 70.55  ? 187  GLY B CA    1 
ATOM   3211  C  C     . GLY B  1  187  ? 58.083  27.420  102.711  1.00 67.94  ? 187  GLY B C     1 
ATOM   3212  O  O     . GLY B  1  187  ? 57.224  26.877  102.009  1.00 50.70  ? 187  GLY B O     1 
ATOM   3213  N  N     . GLN B  1  188  ? 59.290  26.905  102.919  1.00 66.31  ? 188  GLN B N     1 
ATOM   3214  C  CA    . GLN B  1  188  ? 59.656  25.593  102.408  1.00 68.16  ? 188  GLN B CA    1 
ATOM   3215  C  C     . GLN B  1  188  ? 59.427  24.464  103.422  1.00 74.74  ? 188  GLN B C     1 
ATOM   3216  O  O     . GLN B  1  188  ? 59.773  23.311  103.154  1.00 74.31  ? 188  GLN B O     1 
ATOM   3217  C  CB    . GLN B  1  188  ? 61.100  25.595  101.889  1.00 69.43  ? 188  GLN B CB    1 
ATOM   3218  C  CG    . GLN B  1  188  ? 61.370  24.598  100.757  1.00 66.50  ? 188  GLN B CG    1 
ATOM   3219  C  CD    . GLN B  1  188  ? 60.485  24.812  99.528   1.00 52.76  ? 188  GLN B CD    1 
ATOM   3220  O  OE1   . GLN B  1  188  ? 59.878  25.873  99.348   1.00 43.69  ? 188  GLN B OE1   1 
ATOM   3221  N  NE2   . GLN B  1  188  ? 60.415  23.796  98.674   1.00 44.15  ? 188  GLN B NE2   1 
ATOM   3222  N  N     . ARG B  1  189  ? 58.843  24.783  104.578  1.00 75.60  ? 189  ARG B N     1 
ATOM   3223  C  CA    . ARG B  1  189  ? 58.452  23.731  105.517  1.00 65.30  ? 189  ARG B CA    1 
ATOM   3224  C  C     . ARG B  1  189  ? 57.160  23.116  105.001  1.00 60.02  ? 189  ARG B C     1 
ATOM   3225  O  O     . ARG B  1  189  ? 56.133  23.784  104.914  1.00 50.35  ? 189  ARG B O     1 
ATOM   3226  C  CB    . ARG B  1  189  ? 58.232  24.295  106.920  1.00 64.59  ? 189  ARG B CB    1 
ATOM   3227  C  CG    . ARG B  1  189  ? 59.503  24.574  107.704  1.00 72.67  ? 189  ARG B CG    1 
ATOM   3228  C  CD    . ARG B  1  189  ? 60.154  23.290  108.200  1.00 72.10  ? 189  ARG B CD    1 
ATOM   3229  N  NE    . ARG B  1  189  ? 61.030  23.539  109.344  1.00 77.52  ? 189  ARG B NE    1 
ATOM   3230  C  CZ    . ARG B  1  189  ? 60.673  23.360  110.613  1.00 70.88  ? 189  ARG B CZ    1 
ATOM   3231  N  NH1   . ARG B  1  189  ? 61.532  23.617  111.590  1.00 67.08  ? 189  ARG B NH1   1 
ATOM   3232  N  NH2   . ARG B  1  189  ? 59.457  22.916  110.906  1.00 57.96  ? 189  ARG B NH2   1 
ATOM   3233  N  N     . THR B  1  190  ? 57.236  21.836  104.651  1.00 57.24  ? 190  THR B N     1 
ATOM   3234  C  CA    . THR B  1  190  ? 56.183  21.150  103.901  1.00 52.94  ? 190  THR B CA    1 
ATOM   3235  C  C     . THR B  1  190  ? 55.007  20.543  104.693  1.00 49.50  ? 190  THR B C     1 
ATOM   3236  O  O     . THR B  1  190  ? 53.843  20.672  104.306  1.00 43.32  ? 190  THR B O     1 
ATOM   3237  C  CB    . THR B  1  190  ? 56.815  20.073  102.994  1.00 56.87  ? 190  THR B CB    1 
ATOM   3238  O  OG1   . THR B  1  190  ? 57.450  19.073  103.800  1.00 43.83  ? 190  THR B OG1   1 
ATOM   3239  C  CG2   . THR B  1  190  ? 57.867  20.709  102.102  1.00 61.59  ? 190  THR B CG2   1 
ATOM   3240  N  N     . ASP B  1  191  ? 55.334  19.888  105.800  1.00 43.05  ? 191  ASP B N     1 
ATOM   3241  C  CA    . ASP B  1  191  ? 54.435  18.937  106.459  1.00 33.57  ? 191  ASP B CA    1 
ATOM   3242  C  C     . ASP B  1  191  ? 53.560  19.463  107.600  1.00 30.91  ? 191  ASP B C     1 
ATOM   3243  O  O     . ASP B  1  191  ? 52.968  18.669  108.330  1.00 29.20  ? 191  ASP B O     1 
ATOM   3244  C  CB    . ASP B  1  191  ? 55.209  17.692  106.909  1.00 36.19  ? 191  ASP B CB    1 
ATOM   3245  C  CG    . ASP B  1  191  ? 56.531  18.033  107.576  1.00 48.40  ? 191  ASP B CG    1 
ATOM   3246  O  OD1   . ASP B  1  191  ? 57.013  19.174  107.400  1.00 52.06  ? 191  ASP B OD1   1 
ATOM   3247  O  OD2   . ASP B  1  191  ? 57.094  17.153  108.266  1.00 50.31  ? 191  ASP B OD2   1 
ATOM   3248  N  N     . LEU B  1  192  ? 53.508  20.776  107.793  1.00 28.46  ? 192  LEU B N     1 
ATOM   3249  C  CA    . LEU B  1  192  ? 52.960  21.302  109.039  1.00 22.16  ? 192  LEU B CA    1 
ATOM   3250  C  C     . LEU B  1  192  ? 51.442  21.157  109.161  1.00 18.54  ? 192  LEU B C     1 
ATOM   3251  O  O     . LEU B  1  192  ? 50.765  20.752  108.218  1.00 25.18  ? 192  LEU B O     1 
ATOM   3252  C  CB    . LEU B  1  192  ? 53.371  22.767  109.218  1.00 25.34  ? 192  LEU B CB    1 
ATOM   3253  C  CG    . LEU B  1  192  ? 54.843  23.081  108.937  1.00 27.42  ? 192  LEU B CG    1 
ATOM   3254  C  CD1   . LEU B  1  192  ? 55.130  24.548  109.200  1.00 41.29  ? 192  LEU B CD1   1 
ATOM   3255  C  CD2   . LEU B  1  192  ? 55.777  22.191  109.747  1.00 24.67  ? 192  LEU B CD2   1 
ATOM   3256  N  N     . ASP B  1  193  ? 50.921  21.531  110.327  1.00 20.07  ? 193  ASP B N     1 
ATOM   3257  C  CA    . ASP B  1  193  ? 49.537  21.264  110.709  1.00 18.05  ? 193  ASP B CA    1 
ATOM   3258  C  C     . ASP B  1  193  ? 48.747  22.548  110.911  1.00 16.58  ? 193  ASP B C     1 
ATOM   3259  O  O     . ASP B  1  193  ? 49.224  23.484  111.543  1.00 18.81  ? 193  ASP B O     1 
ATOM   3260  C  CB    . ASP B  1  193  ? 49.499  20.462  112.018  1.00 16.79  ? 193  ASP B CB    1 
ATOM   3261  C  CG    . ASP B  1  193  ? 49.404  18.962  111.791  1.00 18.78  ? 193  ASP B CG    1 
ATOM   3262  O  OD1   . ASP B  1  193  ? 49.598  18.517  110.638  1.00 23.41  ? 193  ASP B OD1   1 
ATOM   3263  O  OD2   . ASP B  1  193  ? 49.142  18.227  112.773  1.00 12.75  ? 193  ASP B OD2   1 
ATOM   3264  N  N     . LYS B  1  194  ? 47.532  22.586  110.381  1.00 15.21  ? 194  LYS B N     1 
ATOM   3265  C  CA    . LYS B  1  194  ? 46.629  23.688  110.653  1.00 11.88  ? 194  LYS B CA    1 
ATOM   3266  C  C     . LYS B  1  194  ? 45.387  23.151  111.338  1.00 19.87  ? 194  LYS B C     1 
ATOM   3267  O  O     . LYS B  1  194  ? 44.600  22.403  110.737  1.00 21.03  ? 194  LYS B O     1 
ATOM   3268  C  CB    . LYS B  1  194  ? 46.243  24.412  109.369  1.00 14.37  ? 194  LYS B CB    1 
ATOM   3269  C  CG    . LYS B  1  194  ? 45.139  25.436  109.559  1.00 16.57  ? 194  LYS B CG    1 
ATOM   3270  C  CD    . LYS B  1  194  ? 44.634  25.945  108.222  1.00 24.94  ? 194  LYS B CD    1 
ATOM   3271  C  CE    . LYS B  1  194  ? 43.429  26.851  108.389  1.00 26.83  ? 194  LYS B CE    1 
ATOM   3272  N  NZ    . LYS B  1  194  ? 42.878  27.264  107.072  1.00 26.97  ? 194  LYS B NZ    1 
ATOM   3273  N  N     . LEU B  1  195  ? 45.216  23.538  112.598  1.00 18.46  ? 195  LEU B N     1 
ATOM   3274  C  CA    . LEU B  1  195  ? 44.093  23.076  113.403  1.00 15.28  ? 195  LEU B CA    1 
ATOM   3275  C  C     . LEU B  1  195  ? 42.891  24.009  113.313  1.00 14.37  ? 195  LEU B C     1 
ATOM   3276  O  O     . LEU B  1  195  ? 42.990  25.194  113.596  1.00 17.08  ? 195  LEU B O     1 
ATOM   3277  C  CB    . LEU B  1  195  ? 44.524  22.924  114.860  1.00 14.25  ? 195  LEU B CB    1 
ATOM   3278  C  CG    . LEU B  1  195  ? 43.473  22.431  115.849  1.00 8.85   ? 195  LEU B CG    1 
ATOM   3279  C  CD1   . LEU B  1  195  ? 42.922  21.103  115.404  1.00 12.29  ? 195  LEU B CD1   1 
ATOM   3280  C  CD2   . LEU B  1  195  ? 44.100  22.303  117.213  1.00 9.25   ? 195  LEU B CD2   1 
ATOM   3281  N  N     . THR B  1  196  ? 41.756  23.460  112.908  1.00 16.42  ? 196  THR B N     1 
ATOM   3282  C  CA    . THR B  1  196  ? 40.500  24.194  112.890  1.00 13.45  ? 196  THR B CA    1 
ATOM   3283  C  C     . THR B  1  196  ? 39.580  23.533  113.904  1.00 16.65  ? 196  THR B C     1 
ATOM   3284  O  O     . THR B  1  196  ? 39.462  22.309  113.941  1.00 15.37  ? 196  THR B O     1 
ATOM   3285  C  CB    . THR B  1  196  ? 39.847  24.157  111.500  1.00 12.70  ? 196  THR B CB    1 
ATOM   3286  O  OG1   . THR B  1  196  ? 40.724  24.768  110.547  1.00 25.80  ? 196  THR B OG1   1 
ATOM   3287  C  CG2   . THR B  1  196  ? 38.520  24.891  111.504  1.00 14.67  ? 196  THR B CG2   1 
ATOM   3288  N  N     . LEU B  1  197  ? 38.937  24.345  114.733  1.00 20.42  ? 197  LEU B N     1 
ATOM   3289  C  CA    . LEU B  1  197  ? 38.149  23.834  115.840  1.00 12.02  ? 197  LEU B CA    1 
ATOM   3290  C  C     . LEU B  1  197  ? 36.811  24.560  115.886  1.00 11.76  ? 197  LEU B C     1 
ATOM   3291  O  O     . LEU B  1  197  ? 36.759  25.769  116.048  1.00 16.67  ? 197  LEU B O     1 
ATOM   3292  C  CB    . LEU B  1  197  ? 38.937  24.020  117.135  1.00 8.47   ? 197  LEU B CB    1 
ATOM   3293  C  CG    . LEU B  1  197  ? 38.461  23.360  118.422  1.00 12.03  ? 197  LEU B CG    1 
ATOM   3294  C  CD1   . LEU B  1  197  ? 37.627  22.134  118.120  1.00 15.51  ? 197  LEU B CD1   1 
ATOM   3295  C  CD2   . LEU B  1  197  ? 39.669  22.991  119.272  1.00 9.67   ? 197  LEU B CD2   1 
ATOM   3296  N  N     . ARG B  1  198  ? 35.728  23.809  115.734  1.00 13.07  ? 198  ARG B N     1 
ATOM   3297  C  CA    . ARG B  1  198  ? 34.387  24.375  115.644  1.00 14.81  ? 198  ARG B CA    1 
ATOM   3298  C  C     . ARG B  1  198  ? 33.584  23.988  116.870  1.00 14.16  ? 198  ARG B C     1 
ATOM   3299  O  O     . ARG B  1  198  ? 33.424  22.802  117.161  1.00 14.70  ? 198  ARG B O     1 
ATOM   3300  C  CB    . ARG B  1  198  ? 33.679  23.860  114.393  1.00 14.34  ? 198  ARG B CB    1 
ATOM   3301  C  CG    . ARG B  1  198  ? 34.456  24.080  113.107  1.00 19.54  ? 198  ARG B CG    1 
ATOM   3302  C  CD    . ARG B  1  198  ? 33.942  23.190  111.982  1.00 18.04  ? 198  ARG B CD    1 
ATOM   3303  N  NE    . ARG B  1  198  ? 32.573  23.516  111.595  1.00 18.73  ? 198  ARG B NE    1 
ATOM   3304  C  CZ    . ARG B  1  198  ? 31.817  22.741  110.823  1.00 28.30  ? 198  ARG B CZ    1 
ATOM   3305  N  NH1   . ARG B  1  198  ? 30.576  23.106  110.515  1.00 27.58  ? 198  ARG B NH1   1 
ATOM   3306  N  NH2   . ARG B  1  198  ? 32.302  21.593  110.364  1.00 26.81  ? 198  ARG B NH2   1 
ATOM   3307  N  N     . ILE B  1  199  ? 33.081  24.991  117.589  1.00 17.96  ? 199  ILE B N     1 
ATOM   3308  C  CA    . ILE B  1  199  ? 32.367  24.754  118.841  1.00 13.32  ? 199  ILE B CA    1 
ATOM   3309  C  C     . ILE B  1  199  ? 30.980  25.398  118.873  1.00 14.89  ? 199  ILE B C     1 
ATOM   3310  O  O     . ILE B  1  199  ? 30.828  26.598  118.623  1.00 17.60  ? 199  ILE B O     1 
ATOM   3311  C  CB    . ILE B  1  199  ? 33.169  25.242  120.062  1.00 9.15   ? 199  ILE B CB    1 
ATOM   3312  C  CG1   . ILE B  1  199  ? 34.603  24.708  120.017  1.00 11.44  ? 199  ILE B CG1   1 
ATOM   3313  C  CG2   . ILE B  1  199  ? 32.481  24.813  121.332  1.00 12.05  ? 199  ILE B CG2   1 
ATOM   3314  C  CD1   . ILE B  1  199  ? 35.436  25.043  121.239  1.00 9.52   ? 199  ILE B CD1   1 
ATOM   3315  N  N     . TRP B  1  200  ? 29.976  24.579  119.170  1.00 14.00  ? 200  TRP B N     1 
ATOM   3316  C  CA    . TRP B  1  200  ? 28.608  25.039  119.342  1.00 14.90  ? 200  TRP B CA    1 
ATOM   3317  C  C     . TRP B  1  200  ? 28.216  24.864  120.805  1.00 19.75  ? 200  TRP B C     1 
ATOM   3318  O  O     . TRP B  1  200  ? 28.289  23.745  121.344  1.00 17.88  ? 200  TRP B O     1 
ATOM   3319  C  CB    . TRP B  1  200  ? 27.633  24.203  118.512  1.00 13.59  ? 200  TRP B CB    1 
ATOM   3320  C  CG    . TRP B  1  200  ? 27.746  24.269  117.016  1.00 15.76  ? 200  TRP B CG    1 
ATOM   3321  C  CD1   . TRP B  1  200  ? 26.905  24.919  116.158  1.00 17.94  ? 200  TRP B CD1   1 
ATOM   3322  C  CD2   . TRP B  1  200  ? 28.710  23.601  116.197  1.00 14.34  ? 200  TRP B CD2   1 
ATOM   3323  N  NE1   . TRP B  1  200  ? 27.301  24.720  114.860  1.00 12.47  ? 200  TRP B NE1   1 
ATOM   3324  C  CE2   . TRP B  1  200  ? 28.406  23.912  114.857  1.00 11.31  ? 200  TRP B CE2   1 
ATOM   3325  C  CE3   . TRP B  1  200  ? 29.810  22.783  116.467  1.00 13.42  ? 200  TRP B CE3   1 
ATOM   3326  C  CZ2   . TRP B  1  200  ? 29.160  23.435  113.794  1.00 12.10  ? 200  TRP B CZ2   1 
ATOM   3327  C  CZ3   . TRP B  1  200  ? 30.556  22.309  115.411  1.00 14.03  ? 200  TRP B CZ3   1 
ATOM   3328  C  CH2   . TRP B  1  200  ? 30.229  22.637  114.089  1.00 14.27  ? 200  TRP B CH2   1 
ATOM   3329  N  N     . THR B  1  201  ? 27.780  25.958  121.428  1.00 21.29  ? 201  THR B N     1 
ATOM   3330  C  CA    . THR B  1  201  ? 27.271  25.937  122.797  1.00 18.97  ? 201  THR B CA    1 
ATOM   3331  C  C     . THR B  1  201  ? 25.813  26.391  122.847  1.00 21.08  ? 201  THR B C     1 
ATOM   3332  O  O     . THR B  1  201  ? 25.231  26.730  121.818  1.00 21.81  ? 201  THR B O     1 
ATOM   3333  C  CB    . THR B  1  201  ? 28.099  26.844  123.725  1.00 25.31  ? 201  THR B CB    1 
ATOM   3334  O  OG1   . THR B  1  201  ? 27.989  28.207  123.294  1.00 31.84  ? 201  THR B OG1   1 
ATOM   3335  C  CG2   . THR B  1  201  ? 29.561  26.432  123.719  1.00 22.74  ? 201  THR B CG2   1 
ATOM   3336  N  N     . ASP B  1  202  ? 25.231  26.399  124.046  1.00 21.11  ? 202  ASP B N     1 
ATOM   3337  C  CA    . ASP B  1  202  ? 23.828  26.779  124.225  1.00 25.16  ? 202  ASP B CA    1 
ATOM   3338  C  C     . ASP B  1  202  ? 23.651  28.250  124.612  1.00 32.27  ? 202  ASP B C     1 
ATOM   3339  O  O     . ASP B  1  202  ? 22.530  28.719  124.827  1.00 31.37  ? 202  ASP B O     1 
ATOM   3340  C  CB    . ASP B  1  202  ? 23.127  25.864  125.243  1.00 25.46  ? 202  ASP B CB    1 
ATOM   3341  C  CG    . ASP B  1  202  ? 23.843  25.810  126.587  1.00 26.99  ? 202  ASP B CG    1 
ATOM   3342  O  OD1   . ASP B  1  202  ? 24.585  26.761  126.915  1.00 33.23  ? 202  ASP B OD1   1 
ATOM   3343  O  OD2   . ASP B  1  202  ? 23.657  24.816  127.325  1.00 20.43  ? 202  ASP B OD2   1 
ATOM   3344  N  N     . GLY B  1  203  ? 24.764  28.970  124.705  1.00 31.08  ? 203  GLY B N     1 
ATOM   3345  C  CA    . GLY B  1  203  ? 24.722  30.387  125.014  1.00 31.37  ? 203  GLY B CA    1 
ATOM   3346  C  C     . GLY B  1  203  ? 25.067  30.708  126.453  1.00 32.57  ? 203  GLY B C     1 
ATOM   3347  O  O     . GLY B  1  203  ? 25.457  31.835  126.762  1.00 32.88  ? 203  GLY B O     1 
ATOM   3348  N  N     . SER B  1  204  ? 24.931  29.719  127.335  1.00 31.91  ? 204  SER B N     1 
ATOM   3349  C  CA    . SER B  1  204  ? 25.300  29.893  128.736  1.00 28.12  ? 204  SER B CA    1 
ATOM   3350  C  C     . SER B  1  204  ? 26.804  30.138  128.855  1.00 28.89  ? 204  SER B C     1 
ATOM   3351  O  O     . SER B  1  204  ? 27.241  31.136  129.420  1.00 40.05  ? 204  SER B O     1 
ATOM   3352  C  CB    . SER B  1  204  ? 24.887  28.674  129.556  1.00 25.94  ? 204  SER B CB    1 
ATOM   3353  O  OG    . SER B  1  204  ? 25.555  27.510  129.105  1.00 28.27  ? 204  SER B OG    1 
ATOM   3354  N  N     . VAL B  1  205  ? 27.592  29.223  128.311  1.00 26.71  ? 205  VAL B N     1 
ATOM   3355  C  CA    . VAL B  1  205  ? 29.021  29.442  128.163  1.00 21.48  ? 205  VAL B CA    1 
ATOM   3356  C  C     . VAL B  1  205  ? 29.258  29.737  126.685  1.00 29.61  ? 205  VAL B C     1 
ATOM   3357  O  O     . VAL B  1  205  ? 28.603  29.147  125.826  1.00 31.27  ? 205  VAL B O     1 
ATOM   3358  C  CB    . VAL B  1  205  ? 29.820  28.191  128.581  1.00 18.54  ? 205  VAL B CB    1 
ATOM   3359  C  CG1   . VAL B  1  205  ? 31.295  28.447  128.478  1.00 21.96  ? 205  VAL B CG1   1 
ATOM   3360  C  CG2   . VAL B  1  205  ? 29.464  27.775  129.996  1.00 24.41  ? 205  VAL B CG2   1 
ATOM   3361  N  N     . THR B  1  206  ? 30.162  30.661  126.376  1.00 27.46  ? 206  THR B N     1 
ATOM   3362  C  CA    . THR B  1  206  ? 30.494  30.925  124.979  1.00 24.66  ? 206  THR B CA    1 
ATOM   3363  C  C     . THR B  1  206  ? 31.571  29.954  124.520  1.00 28.00  ? 206  THR B C     1 
ATOM   3364  O  O     . THR B  1  206  ? 32.335  29.440  125.347  1.00 25.19  ? 206  THR B O     1 
ATOM   3365  C  CB    . THR B  1  206  ? 30.993  32.365  124.750  1.00 29.03  ? 206  THR B CB    1 
ATOM   3366  O  OG1   . THR B  1  206  ? 32.243  32.558  125.422  1.00 26.03  ? 206  THR B OG1   1 
ATOM   3367  C  CG2   . THR B  1  206  ? 29.975  33.375  125.242  1.00 32.74  ? 206  THR B CG2   1 
ATOM   3368  N  N     . PRO B  1  207  ? 31.627  29.688  123.203  1.00 26.21  ? 207  PRO B N     1 
ATOM   3369  C  CA    . PRO B  1  207  ? 32.646  28.801  122.639  1.00 20.41  ? 207  PRO B CA    1 
ATOM   3370  C  C     . PRO B  1  207  ? 34.062  29.175  123.067  1.00 18.65  ? 207  PRO B C     1 
ATOM   3371  O  O     . PRO B  1  207  ? 34.827  28.288  123.451  1.00 18.47  ? 207  PRO B O     1 
ATOM   3372  C  CB    . PRO B  1  207  ? 32.459  28.992  121.136  1.00 19.08  ? 207  PRO B CB    1 
ATOM   3373  C  CG    . PRO B  1  207  ? 30.999  29.218  121.001  1.00 19.32  ? 207  PRO B CG    1 
ATOM   3374  C  CD    . PRO B  1  207  ? 30.621  30.059  122.192  1.00 24.77  ? 207  PRO B CD    1 
ATOM   3375  N  N     . LEU B  1  208  ? 34.403  30.458  123.031  1.00 17.49  ? 208  LEU B N     1 
ATOM   3376  C  CA    . LEU B  1  208  ? 35.726  30.881  123.478  1.00 19.66  ? 208  LEU B CA    1 
ATOM   3377  C  C     . LEU B  1  208  ? 35.925  30.564  124.966  1.00 22.19  ? 208  LEU B C     1 
ATOM   3378  O  O     . LEU B  1  208  ? 36.958  29.999  125.364  1.00 21.72  ? 208  LEU B O     1 
ATOM   3379  C  CB    . LEU B  1  208  ? 35.945  32.366  123.187  1.00 19.79  ? 208  LEU B CB    1 
ATOM   3380  C  CG    . LEU B  1  208  ? 37.276  32.992  123.612  1.00 22.44  ? 208  LEU B CG    1 
ATOM   3381  C  CD1   . LEU B  1  208  ? 38.455  32.124  123.217  1.00 22.59  ? 208  LEU B CD1   1 
ATOM   3382  C  CD2   . LEU B  1  208  ? 37.412  34.377  123.000  1.00 30.52  ? 208  LEU B CD2   1 
ATOM   3383  N  N     . GLU B  1  209  ? 34.923  30.912  125.773  1.00 21.27  ? 209  GLU B N     1 
ATOM   3384  C  CA    . GLU B  1  209  ? 34.923  30.593  127.198  1.00 24.10  ? 209  GLU B CA    1 
ATOM   3385  C  C     . GLU B  1  209  ? 35.188  29.105  127.409  1.00 20.52  ? 209  GLU B C     1 
ATOM   3386  O  O     . GLU B  1  209  ? 36.102  28.722  128.150  1.00 17.53  ? 209  GLU B O     1 
ATOM   3387  C  CB    . GLU B  1  209  ? 33.586  30.983  127.842  1.00 25.09  ? 209  GLU B CB    1 
ATOM   3388  C  CG    . GLU B  1  209  ? 33.443  32.453  128.242  1.00 28.39  ? 209  GLU B CG    1 
ATOM   3389  C  CD    . GLU B  1  209  ? 32.002  32.829  128.576  1.00 32.50  ? 209  GLU B CD    1 
ATOM   3390  O  OE1   . GLU B  1  209  ? 31.746  33.996  128.948  1.00 30.26  ? 209  GLU B OE1   1 
ATOM   3391  O  OE2   . GLU B  1  209  ? 31.119  31.952  128.461  1.00 37.63  ? 209  GLU B OE2   1 
ATOM   3392  N  N     . ALA B  1  210  ? 34.396  28.276  126.732  1.00 17.89  ? 210  ALA B N     1 
ATOM   3393  C  CA    . ALA B  1  210  ? 34.518  26.825  126.836  1.00 17.02  ? 210  ALA B CA    1 
ATOM   3394  C  C     . ALA B  1  210  ? 35.915  26.314  126.467  1.00 17.42  ? 210  ALA B C     1 
ATOM   3395  O  O     . ALA B  1  210  ? 36.484  25.483  127.179  1.00 16.55  ? 210  ALA B O     1 
ATOM   3396  C  CB    . ALA B  1  210  ? 33.457  26.146  125.990  1.00 13.54  ? 210  ALA B CB    1 
ATOM   3397  N  N     . LEU B  1  211  ? 36.465  26.817  125.363  1.00 13.72  ? 211  LEU B N     1 
ATOM   3398  C  CA    . LEU B  1  211  ? 37.797  26.412  124.926  1.00 13.52  ? 211  LEU B CA    1 
ATOM   3399  C  C     . LEU B  1  211  ? 38.852  26.760  125.974  1.00 19.55  ? 211  LEU B C     1 
ATOM   3400  O  O     . LEU B  1  211  ? 39.774  25.973  126.236  1.00 17.86  ? 211  LEU B O     1 
ATOM   3401  C  CB    . LEU B  1  211  ? 38.146  27.052  123.576  1.00 15.96  ? 211  LEU B CB    1 
ATOM   3402  C  CG    . LEU B  1  211  ? 39.545  26.775  123.009  1.00 15.44  ? 211  LEU B CG    1 
ATOM   3403  C  CD1   . LEU B  1  211  ? 39.813  25.284  122.911  1.00 14.57  ? 211  LEU B CD1   1 
ATOM   3404  C  CD2   . LEU B  1  211  ? 39.724  27.430  121.651  1.00 16.41  ? 211  LEU B CD2   1 
ATOM   3405  N  N     . ASN B  1  212  ? 38.711  27.939  126.579  1.00 23.85  ? 212  ASN B N     1 
ATOM   3406  C  CA    . ASN B  1  212  ? 39.634  28.353  127.637  1.00 22.39  ? 212  ASN B CA    1 
ATOM   3407  C  C     . ASN B  1  212  ? 39.531  27.462  128.883  1.00 18.84  ? 212  ASN B C     1 
ATOM   3408  O  O     . ASN B  1  212  ? 40.550  27.029  129.443  1.00 15.94  ? 212  ASN B O     1 
ATOM   3409  C  CB    . ASN B  1  212  ? 39.433  29.832  127.983  1.00 18.48  ? 212  ASN B CB    1 
ATOM   3410  C  CG    . ASN B  1  212  ? 39.868  30.755  126.854  1.00 21.48  ? 212  ASN B CG    1 
ATOM   3411  O  OD1   . ASN B  1  212  ? 40.941  30.580  126.274  1.00 20.89  ? 212  ASN B OD1   1 
ATOM   3412  N  ND2   . ASN B  1  212  ? 39.026  31.732  126.524  1.00 19.04  ? 212  ASN B ND2   1 
ATOM   3413  N  N     . GLN B  1  213  ? 38.301  27.177  129.304  1.00 16.45  ? 213  GLN B N     1 
ATOM   3414  C  CA    . GLN B  1  213  ? 38.086  26.280  130.433  1.00 17.98  ? 213  GLN B CA    1 
ATOM   3415  C  C     . GLN B  1  213  ? 38.734  24.933  130.150  1.00 20.13  ? 213  GLN B C     1 
ATOM   3416  O  O     . GLN B  1  213  ? 39.365  24.341  131.025  1.00 15.70  ? 213  GLN B O     1 
ATOM   3417  C  CB    . GLN B  1  213  ? 36.597  26.077  130.701  1.00 17.76  ? 213  GLN B CB    1 
ATOM   3418  C  CG    . GLN B  1  213  ? 35.838  27.328  131.101  1.00 19.20  ? 213  GLN B CG    1 
ATOM   3419  C  CD    . GLN B  1  213  ? 34.448  27.010  131.620  1.00 18.25  ? 213  GLN B CD    1 
ATOM   3420  O  OE1   . GLN B  1  213  ? 34.247  26.004  132.303  1.00 19.66  ? 213  GLN B OE1   1 
ATOM   3421  N  NE2   . GLN B  1  213  ? 33.481  27.861  131.294  1.00 16.64  ? 213  GLN B NE2   1 
ATOM   3422  N  N     . ALA B  1  214  ? 38.581  24.468  128.912  1.00 19.31  ? 214  ALA B N     1 
ATOM   3423  C  CA    . ALA B  1  214  ? 39.112  23.176  128.494  1.00 14.05  ? 214  ALA B CA    1 
ATOM   3424  C  C     . ALA B  1  214  ? 40.639  23.130  128.538  1.00 16.57  ? 214  ALA B C     1 
ATOM   3425  O  O     . ALA B  1  214  ? 41.215  22.220  129.152  1.00 15.62  ? 214  ALA B O     1 
ATOM   3426  C  CB    . ALA B  1  214  ? 38.608  22.825  127.110  1.00 11.72  ? 214  ALA B CB    1 
ATOM   3427  N  N     . VAL B  1  215  ? 41.296  24.100  127.897  1.00 13.44  ? 215  VAL B N     1 
ATOM   3428  C  CA    . VAL B  1  215  ? 42.761  24.129  127.913  1.00 14.72  ? 215  VAL B CA    1 
ATOM   3429  C  C     . VAL B  1  215  ? 43.281  24.252  129.343  1.00 19.10  ? 215  VAL B C     1 
ATOM   3430  O  O     . VAL B  1  215  ? 44.325  23.691  129.686  1.00 13.92  ? 215  VAL B O     1 
ATOM   3431  C  CB    . VAL B  1  215  ? 43.370  25.245  127.019  1.00 13.63  ? 215  VAL B CB    1 
ATOM   3432  C  CG1   . VAL B  1  215  ? 43.075  24.979  125.564  1.00 27.13  ? 215  VAL B CG1   1 
ATOM   3433  C  CG2   . VAL B  1  215  ? 42.845  26.607  127.403  1.00 28.63  ? 215  VAL B CG2   1 
ATOM   3434  N  N     . GLU B  1  216  ? 42.531  24.966  130.180  1.00 22.86  ? 216  GLU B N     1 
ATOM   3435  C  CA    . GLU B  1  216  ? 42.907  25.115  131.578  1.00 19.15  ? 216  GLU B CA    1 
ATOM   3436  C  C     . GLU B  1  216  ? 42.800  23.790  132.334  1.00 15.91  ? 216  GLU B C     1 
ATOM   3437  O  O     . GLU B  1  216  ? 43.704  23.422  133.091  1.00 15.31  ? 216  GLU B O     1 
ATOM   3438  C  CB    . GLU B  1  216  ? 42.070  26.208  132.245  1.00 18.03  ? 216  GLU B CB    1 
ATOM   3439  C  CG    . GLU B  1  216  ? 42.307  26.356  133.744  1.00 28.07  ? 216  GLU B CG    1 
ATOM   3440  C  CD    . GLU B  1  216  ? 43.771  26.595  134.119  1.00 32.36  ? 216  GLU B CD    1 
ATOM   3441  O  OE1   . GLU B  1  216  ? 44.124  26.312  135.285  1.00 26.76  ? 216  GLU B OE1   1 
ATOM   3442  O  OE2   . GLU B  1  216  ? 44.565  27.067  133.269  1.00 31.59  ? 216  GLU B OE2   1 
ATOM   3443  N  N     . ILE B  1  217  ? 41.698  23.078  132.115  1.00 14.18  ? 217  ILE B N     1 
ATOM   3444  C  CA    . ILE B  1  217  ? 41.500  21.745  132.678  1.00 15.34  ? 217  ILE B CA    1 
ATOM   3445  C  C     . ILE B  1  217  ? 42.658  20.831  132.297  1.00 17.13  ? 217  ILE B C     1 
ATOM   3446  O  O     . ILE B  1  217  ? 43.174  20.066  133.128  1.00 15.19  ? 217  ILE B O     1 
ATOM   3447  C  CB    . ILE B  1  217  ? 40.196  21.108  132.165  1.00 10.44  ? 217  ILE B CB    1 
ATOM   3448  C  CG1   . ILE B  1  217  ? 38.980  21.831  132.734  1.00 7.71   ? 217  ILE B CG1   1 
ATOM   3449  C  CG2   . ILE B  1  217  ? 40.138  19.638  132.533  1.00 9.69   ? 217  ILE B CG2   1 
ATOM   3450  C  CD1   . ILE B  1  217  ? 37.673  21.142  132.418  1.00 10.81  ? 217  ILE B CD1   1 
ATOM   3451  N  N     . LEU B  1  218  ? 43.072  20.931  131.036  1.00 14.19  ? 218  LEU B N     1 
ATOM   3452  C  CA    . LEU B  1  218  ? 44.157  20.102  130.531  1.00 15.36  ? 218  LEU B CA    1 
ATOM   3453  C  C     . LEU B  1  218  ? 45.520  20.452  131.149  1.00 16.96  ? 218  LEU B C     1 
ATOM   3454  O  O     . LEU B  1  218  ? 46.264  19.560  131.557  1.00 14.24  ? 218  LEU B O     1 
ATOM   3455  C  CB    . LEU B  1  218  ? 44.211  20.154  129.002  1.00 16.68  ? 218  LEU B CB    1 
ATOM   3456  C  CG    . LEU B  1  218  ? 45.163  19.149  128.345  1.00 14.45  ? 218  LEU B CG    1 
ATOM   3457  C  CD1   . LEU B  1  218  ? 44.826  17.739  128.786  1.00 11.17  ? 218  LEU B CD1   1 
ATOM   3458  C  CD2   . LEU B  1  218  ? 45.121  19.263  126.833  1.00 12.10  ? 218  LEU B CD2   1 
ATOM   3459  N  N     . ARG B  1  219  ? 45.844  21.742  131.215  1.00 18.42  ? 219  ARG B N     1 
ATOM   3460  C  CA    . ARG B  1  219  ? 47.092  22.185  131.838  1.00 20.71  ? 219  ARG B CA    1 
ATOM   3461  C  C     . ARG B  1  219  ? 47.149  21.691  133.279  1.00 23.68  ? 219  ARG B C     1 
ATOM   3462  O  O     . ARG B  1  219  ? 48.155  21.110  133.734  1.00 19.32  ? 219  ARG B O     1 
ATOM   3463  C  CB    . ARG B  1  219  ? 47.185  23.713  131.823  1.00 20.90  ? 219  ARG B CB    1 
ATOM   3464  C  CG    . ARG B  1  219  ? 48.525  24.253  132.310  1.00 29.59  ? 219  ARG B CG    1 
ATOM   3465  C  CD    . ARG B  1  219  ? 48.452  25.740  132.635  1.00 31.47  ? 219  ARG B CD    1 
ATOM   3466  N  NE    . ARG B  1  219  ? 47.385  26.031  133.590  1.00 27.88  ? 219  ARG B NE    1 
ATOM   3467  C  CZ    . ARG B  1  219  ? 47.466  25.804  134.899  1.00 26.85  ? 219  ARG B CZ    1 
ATOM   3468  N  NH1   . ARG B  1  219  ? 48.565  25.279  135.428  1.00 19.47  ? 219  ARG B NH1   1 
ATOM   3469  N  NH2   . ARG B  1  219  ? 46.442  26.098  135.684  1.00 27.53  ? 219  ARG B NH2   1 
ATOM   3470  N  N     . GLU B  1  220  ? 46.043  21.930  133.981  1.00 24.04  ? 220  GLU B N     1 
ATOM   3471  C  CA    . GLU B  1  220  ? 45.864  21.482  135.351  1.00 21.36  ? 220  GLU B CA    1 
ATOM   3472  C  C     . GLU B  1  220  ? 46.175  20.004  135.460  1.00 19.91  ? 220  GLU B C     1 
ATOM   3473  O  O     . GLU B  1  220  ? 46.956  19.593  136.319  1.00 20.73  ? 220  GLU B O     1 
ATOM   3474  C  CB    . GLU B  1  220  ? 44.432  21.748  135.808  1.00 26.58  ? 220  GLU B CB    1 
ATOM   3475  C  CG    . GLU B  1  220  ? 44.140  21.353  137.247  1.00 28.54  ? 220  GLU B CG    1 
ATOM   3476  C  CD    . GLU B  1  220  ? 42.791  21.871  137.717  1.00 49.03  ? 220  GLU B CD    1 
ATOM   3477  O  OE1   . GLU B  1  220  ? 42.365  22.953  137.244  1.00 40.99  ? 220  GLU B OE1   1 
ATOM   3478  O  OE2   . GLU B  1  220  ? 42.155  21.191  138.553  1.00 58.40  ? 220  GLU B OE2   1 
ATOM   3479  N  N     . HIS B  1  221  ? 45.579  19.207  134.576  1.00 18.34  ? 221  HIS B N     1 
ATOM   3480  C  CA    . HIS B  1  221  ? 45.840  17.772  134.579  1.00 16.76  ? 221  HIS B CA    1 
ATOM   3481  C  C     . HIS B  1  221  ? 47.299  17.442  134.282  1.00 18.68  ? 221  HIS B C     1 
ATOM   3482  O  O     . HIS B  1  221  ? 47.817  16.432  134.748  1.00 18.18  ? 221  HIS B O     1 
ATOM   3483  C  CB    . HIS B  1  221  ? 44.920  17.041  133.608  1.00 15.55  ? 221  HIS B CB    1 
ATOM   3484  C  CG    . HIS B  1  221  ? 43.613  16.637  134.211  1.00 18.40  ? 221  HIS B CG    1 
ATOM   3485  N  ND1   . HIS B  1  221  ? 42.506  17.458  134.208  1.00 19.77  ? 221  HIS B ND1   1 
ATOM   3486  C  CD2   . HIS B  1  221  ? 43.239  15.500  134.845  1.00 17.37  ? 221  HIS B CD2   1 
ATOM   3487  C  CE1   . HIS B  1  221  ? 41.503  16.842  134.809  1.00 21.47  ? 221  HIS B CE1   1 
ATOM   3488  N  NE2   . HIS B  1  221  ? 41.923  15.653  135.206  1.00 24.09  ? 221  HIS B NE2   1 
ATOM   3489  N  N     . LEU B  1  222  ? 47.963  18.294  133.511  1.00 19.95  ? 222  LEU B N     1 
ATOM   3490  C  CA    . LEU B  1  222  ? 49.374  18.083  133.225  1.00 17.09  ? 222  LEU B CA    1 
ATOM   3491  C  C     . LEU B  1  222  ? 50.208  18.294  134.482  1.00 19.79  ? 222  LEU B C     1 
ATOM   3492  O  O     . LEU B  1  222  ? 51.251  17.663  134.648  1.00 18.63  ? 222  LEU B O     1 
ATOM   3493  C  CB    . LEU B  1  222  ? 49.858  19.001  132.102  1.00 16.28  ? 222  LEU B CB    1 
ATOM   3494  C  CG    . LEU B  1  222  ? 49.328  18.693  130.706  1.00 11.92  ? 222  LEU B CG    1 
ATOM   3495  C  CD1   . LEU B  1  222  ? 49.952  19.638  129.706  1.00 12.18  ? 222  LEU B CD1   1 
ATOM   3496  C  CD2   . LEU B  1  222  ? 49.624  17.257  130.341  1.00 12.58  ? 222  LEU B CD2   1 
ATOM   3497  N  N     . THR B  1  223  ? 49.747  19.173  135.374  1.00 26.29  ? 223  THR B N     1 
ATOM   3498  C  CA    . THR B  1  223  ? 50.468  19.393  136.636  1.00 20.59  ? 223  THR B CA    1 
ATOM   3499  C  C     . THR B  1  223  ? 50.442  18.172  137.553  1.00 17.98  ? 223  THR B C     1 
ATOM   3500  O  O     . THR B  1  223  ? 51.276  18.048  138.439  1.00 23.33  ? 223  THR B O     1 
ATOM   3501  C  CB    . THR B  1  223  ? 49.910  20.573  137.435  1.00 16.08  ? 223  THR B CB    1 
ATOM   3502  O  OG1   . THR B  1  223  ? 48.700  20.171  138.088  1.00 21.54  ? 223  THR B OG1   1 
ATOM   3503  C  CG2   . THR B  1  223  ? 49.642  21.761  136.529  1.00 14.44  ? 223  THR B CG2   1 
ATOM   3504  N  N     . TYR B  1  224  ? 49.496  17.268  137.330  1.00 17.07  ? 224  TYR B N     1 
ATOM   3505  C  CA    . TYR B  1  224  ? 49.348  16.074  138.161  1.00 16.24  ? 224  TYR B CA    1 
ATOM   3506  C  C     . TYR B  1  224  ? 50.535  15.117  138.082  1.00 16.34  ? 224  TYR B C     1 
ATOM   3507  O  O     . TYR B  1  224  ? 50.572  14.113  138.786  1.00 18.70  ? 224  TYR B O     1 
ATOM   3508  C  CB    . TYR B  1  224  ? 48.071  15.320  137.792  1.00 19.92  ? 224  TYR B CB    1 
ATOM   3509  C  CG    . TYR B  1  224  ? 46.794  16.074  138.093  1.00 24.65  ? 224  TYR B CG    1 
ATOM   3510  C  CD1   . TYR B  1  224  ? 46.791  17.172  138.943  1.00 25.59  ? 224  TYR B CD1   1 
ATOM   3511  C  CD2   . TYR B  1  224  ? 45.586  15.682  137.530  1.00 25.69  ? 224  TYR B CD2   1 
ATOM   3512  C  CE1   . TYR B  1  224  ? 45.620  17.859  139.222  1.00 23.69  ? 224  TYR B CE1   1 
ATOM   3513  C  CE2   . TYR B  1  224  ? 44.414  16.360  137.806  1.00 23.61  ? 224  TYR B CE2   1 
ATOM   3514  C  CZ    . TYR B  1  224  ? 44.436  17.446  138.650  1.00 22.34  ? 224  TYR B CZ    1 
ATOM   3515  O  OH    . TYR B  1  224  ? 43.267  18.118  138.915  1.00 31.22  ? 224  TYR B OH    1 
ATOM   3516  N  N     . PHE B  1  225  ? 51.482  15.408  137.198  1.00 18.88  ? 225  PHE B N     1 
ATOM   3517  C  CA    . PHE B  1  225  ? 52.682  14.583  137.034  1.00 26.33  ? 225  PHE B CA    1 
ATOM   3518  C  C     . PHE B  1  225  ? 53.834  15.045  137.921  1.00 28.91  ? 225  PHE B C     1 
ATOM   3519  O  O     . PHE B  1  225  ? 54.973  14.618  137.739  1.00 28.28  ? 225  PHE B O     1 
ATOM   3520  C  CB    . PHE B  1  225  ? 53.109  14.485  135.564  1.00 20.51  ? 225  PHE B CB    1 
ATOM   3521  C  CG    . PHE B  1  225  ? 52.201  13.621  134.729  1.00 15.99  ? 225  PHE B CG    1 
ATOM   3522  C  CD1   . PHE B  1  225  ? 51.265  14.188  133.878  1.00 15.38  ? 225  PHE B CD1   1 
ATOM   3523  C  CD2   . PHE B  1  225  ? 52.270  12.242  134.812  1.00 15.95  ? 225  PHE B CD2   1 
ATOM   3524  C  CE1   . PHE B  1  225  ? 50.421  13.396  133.112  1.00 11.95  ? 225  PHE B CE1   1 
ATOM   3525  C  CE2   . PHE B  1  225  ? 51.426  11.445  134.050  1.00 17.00  ? 225  PHE B CE2   1 
ATOM   3526  C  CZ    . PHE B  1  225  ? 50.501  12.026  133.198  1.00 11.55  ? 225  PHE B CZ    1 
ATOM   3527  N  N     . SER B  1  226  ? 53.529  15.961  138.838  1.00 37.89  ? 226  SER B N     1 
ATOM   3528  C  CA    . SER B  1  226  ? 54.532  16.630  139.672  1.00 38.06  ? 226  SER B CA    1 
ATOM   3529  C  C     . SER B  1  226  ? 55.150  15.803  140.810  1.00 47.60  ? 226  SER B C     1 
ATOM   3530  O  O     . SER B  1  226  ? 56.343  15.499  140.777  1.00 53.42  ? 226  SER B O     1 
ATOM   3531  C  CB    . SER B  1  226  ? 53.963  17.936  140.237  1.00 36.10  ? 226  SER B CB    1 
ATOM   3532  O  OG    . SER B  1  226  ? 53.737  18.881  139.202  1.00 37.01  ? 226  SER B OG    1 
ATOM   3533  N  N     . ASN B  1  227  ? 54.366  15.457  141.825  1.00 41.54  ? 227  ASN B N     1 
ATOM   3534  C  CA    . ASN B  1  227  ? 54.961  14.851  143.016  1.00 41.80  ? 227  ASN B CA    1 
ATOM   3535  C  C     . ASN B  1  227  ? 54.654  13.371  143.224  1.00 40.89  ? 227  ASN B C     1 
ATOM   3536  O  O     . ASN B  1  227  ? 53.505  12.995  143.450  1.00 38.72  ? 227  ASN B O     1 
ATOM   3537  C  CB    . ASN B  1  227  ? 54.595  15.647  144.271  1.00 56.43  ? 227  ASN B CB    1 
ATOM   3538  C  CG    . ASN B  1  227  ? 55.404  15.224  145.485  1.00 56.44  ? 227  ASN B CG    1 
ATOM   3539  O  OD1   . ASN B  1  227  ? 54.885  14.585  146.403  1.00 43.80  ? 227  ASN B OD1   1 
ATOM   3540  N  ND2   . ASN B  1  227  ? 56.688  15.575  145.491  1.00 51.01  ? 227  ASN B ND2   1 
ATOM   3541  N  N     . PRO B  1  228  ? 55.693  12.526  143.149  1.00 41.85  ? 228  PRO B N     1 
ATOM   3542  C  CA    . PRO B  1  228  ? 55.567  11.082  143.380  1.00 38.09  ? 228  PRO B CA    1 
ATOM   3543  C  C     . PRO B  1  228  ? 55.457  10.734  144.862  1.00 36.82  ? 228  PRO B C     1 
ATOM   3544  O  O     . PRO B  1  228  ? 55.492  9.548   145.193  1.00 37.48  ? 228  PRO B O     1 
ATOM   3545  C  CB    . PRO B  1  228  ? 56.872  10.517  142.802  1.00 31.33  ? 228  PRO B CB    1 
ATOM   3546  C  CG    . PRO B  1  228  ? 57.433  11.622  141.935  1.00 33.89  ? 228  PRO B CG    1 
ATOM   3547  C  CD    . PRO B  1  228  ? 57.018  12.881  142.616  1.00 35.00  ? 228  PRO B CD    1 
ATOM   3548  N  N     . MET C  2  1    ? 66.520  -18.704 114.467  1.00 57.06  ? 1    MET C N     1 
ATOM   3549  C  CA    . MET C  2  1    ? 65.183  -19.061 114.931  1.00 62.70  ? 1    MET C CA    1 
ATOM   3550  C  C     . MET C  2  1    ? 64.739  -20.428 114.401  1.00 65.50  ? 1    MET C C     1 
ATOM   3551  O  O     . MET C  2  1    ? 65.399  -21.013 113.540  1.00 69.04  ? 1    MET C O     1 
ATOM   3552  C  CB    . MET C  2  1    ? 64.175  -17.968 114.559  1.00 67.39  ? 1    MET C CB    1 
ATOM   3553  C  CG    . MET C  2  1    ? 64.377  -17.364 113.173  1.00 64.30  ? 1    MET C CG    1 
ATOM   3554  S  SD    . MET C  2  1    ? 63.213  -16.028 112.818  1.00 75.85  ? 1    MET C SD    1 
ATOM   3555  C  CE    . MET C  2  1    ? 63.612  -14.855 114.115  1.00 55.24  ? 1    MET C CE    1 
ATOM   3556  N  N     . GLU C  2  2    ? 63.624  -20.930 114.927  1.00 55.64  ? 2    GLU C N     1 
ATOM   3557  C  CA    . GLU C  2  2    ? 63.137  -22.275 114.603  1.00 57.14  ? 2    GLU C CA    1 
ATOM   3558  C  C     . GLU C  2  2    ? 62.194  -22.300 113.387  1.00 42.03  ? 2    GLU C C     1 
ATOM   3559  O  O     . GLU C  2  2    ? 61.393  -21.384 113.196  1.00 32.09  ? 2    GLU C O     1 
ATOM   3560  C  CB    . GLU C  2  2    ? 62.440  -22.875 115.828  1.00 48.39  ? 2    GLU C CB    1 
ATOM   3561  C  CG    . GLU C  2  2    ? 62.452  -24.391 115.888  1.00 52.78  ? 2    GLU C CG    1 
ATOM   3562  C  CD    . GLU C  2  2    ? 61.748  -24.921 117.127  1.00 70.99  ? 2    GLU C CD    1 
ATOM   3563  O  OE1   . GLU C  2  2    ? 62.010  -26.081 117.517  1.00 71.22  ? 2    GLU C OE1   1 
ATOM   3564  O  OE2   . GLU C  2  2    ? 60.931  -24.172 117.709  1.00 61.79  ? 2    GLU C OE2   1 
ATOM   3565  N  N     . ILE C  2  3    ? 62.292  -23.345 112.566  1.00 28.27  ? 3    ILE C N     1 
ATOM   3566  C  CA    . ILE C  2  3    ? 61.408  -23.481 111.410  1.00 15.33  ? 3    ILE C CA    1 
ATOM   3567  C  C     . ILE C  2  3    ? 60.561  -24.749 111.465  1.00 16.56  ? 3    ILE C C     1 
ATOM   3568  O  O     . ILE C  2  3    ? 61.077  -25.857 111.318  1.00 21.99  ? 3    ILE C O     1 
ATOM   3569  C  CB    . ILE C  2  3    ? 62.192  -23.518 110.094  1.00 12.31  ? 3    ILE C CB    1 
ATOM   3570  C  CG1   . ILE C  2  3    ? 63.079  -22.289 109.955  1.00 16.28  ? 3    ILE C CG1   1 
ATOM   3571  C  CG2   . ILE C  2  3    ? 61.239  -23.609 108.916  1.00 11.55  ? 3    ILE C CG2   1 
ATOM   3572  C  CD1   . ILE C  2  3    ? 63.758  -22.205 108.608  1.00 15.86  ? 3    ILE C CD1   1 
ATOM   3573  N  N     . LYS C  2  4    ? 59.257  -24.579 111.647  1.00 10.57  ? 4    LYS C N     1 
ATOM   3574  C  CA    . LYS C  2  4    ? 58.335  -25.704 111.682  1.00 8.54   ? 4    LYS C CA    1 
ATOM   3575  C  C     . LYS C  2  4    ? 57.807  -25.978 110.284  1.00 9.70   ? 4    LYS C C     1 
ATOM   3576  O  O     . LYS C  2  4    ? 57.251  -25.089 109.649  1.00 10.45  ? 4    LYS C O     1 
ATOM   3577  C  CB    . LYS C  2  4    ? 57.172  -25.398 112.628  1.00 9.46   ? 4    LYS C CB    1 
ATOM   3578  C  CG    . LYS C  2  4    ? 56.174  -26.540 112.777  1.00 13.96  ? 4    LYS C CG    1 
ATOM   3579  C  CD    . LYS C  2  4    ? 55.179  -26.277 113.907  1.00 15.47  ? 4    LYS C CD    1 
ATOM   3580  C  CE    . LYS C  2  4    ? 54.453  -27.554 114.326  1.00 20.97  ? 4    LYS C CE    1 
ATOM   3581  N  NZ    . LYS C  2  4    ? 53.892  -28.302 113.161  1.00 21.81  ? 4    LYS C NZ    1 
ATOM   3582  N  N     . ARG C  2  5    ? 57.979  -27.196 109.786  1.00 10.89  ? 5    ARG C N     1 
ATOM   3583  C  CA    . ARG C  2  5    ? 57.442  -27.510 108.465  1.00 11.39  ? 5    ARG C CA    1 
ATOM   3584  C  C     . ARG C  2  5    ? 56.255  -28.455 108.508  1.00 9.71   ? 5    ARG C C     1 
ATOM   3585  O  O     . ARG C  2  5    ? 56.329  -29.527 109.093  1.00 13.92  ? 5    ARG C O     1 
ATOM   3586  C  CB    . ARG C  2  5    ? 58.523  -28.027 107.513  1.00 10.95  ? 5    ARG C CB    1 
ATOM   3587  C  CG    . ARG C  2  5    ? 59.378  -29.145 108.046  1.00 19.54  ? 5    ARG C CG    1 
ATOM   3588  C  CD    . ARG C  2  5    ? 60.482  -29.474 107.047  1.00 30.05  ? 5    ARG C CD    1 
ATOM   3589  N  NE    . ARG C  2  5    ? 59.966  -29.565 105.681  1.00 30.61  ? 5    ARG C NE    1 
ATOM   3590  C  CZ    . ARG C  2  5    ? 60.558  -29.021 104.620  1.00 30.61  ? 5    ARG C CZ    1 
ATOM   3591  N  NH1   . ARG C  2  5    ? 61.696  -28.341 104.764  1.00 17.56  ? 5    ARG C NH1   1 
ATOM   3592  N  NH2   . ARG C  2  5    ? 60.011  -29.155 103.413  1.00 17.38  ? 5    ARG C NH2   1 
ATOM   3593  N  N     . PHE C  2  6    ? 55.160  -28.043 107.880  1.00 8.92   ? 6    PHE C N     1 
ATOM   3594  C  CA    . PHE C  2  6    ? 53.961  -28.859 107.835  1.00 11.00  ? 6    PHE C CA    1 
ATOM   3595  C  C     . PHE C  2  6    ? 53.983  -29.804 106.638  1.00 17.94  ? 6    PHE C C     1 
ATOM   3596  O  O     . PHE C  2  6    ? 54.890  -29.766 105.802  1.00 19.50  ? 6    PHE C O     1 
ATOM   3597  C  CB    . PHE C  2  6    ? 52.714  -27.975 107.732  1.00 11.57  ? 6    PHE C CB    1 
ATOM   3598  C  CG    . PHE C  2  6    ? 52.603  -26.940 108.814  1.00 14.77  ? 6    PHE C CG    1 
ATOM   3599  C  CD1   . PHE C  2  6    ? 51.884  -27.201 109.967  1.00 16.05  ? 6    PHE C CD1   1 
ATOM   3600  C  CD2   . PHE C  2  6    ? 53.199  -25.698 108.668  1.00 14.67  ? 6    PHE C CD2   1 
ATOM   3601  C  CE1   . PHE C  2  6    ? 51.772  -26.251 110.961  1.00 12.97  ? 6    PHE C CE1   1 
ATOM   3602  C  CE2   . PHE C  2  6    ? 53.091  -24.740 109.660  1.00 12.71  ? 6    PHE C CE2   1 
ATOM   3603  C  CZ    . PHE C  2  6    ? 52.376  -25.020 110.807  1.00 14.60  ? 6    PHE C CZ    1 
ATOM   3604  N  N     . GLY C  2  7    ? 52.957  -30.646 106.573  1.00 19.29  ? 7    GLY C N     1 
ATOM   3605  C  CA    . GLY C  2  7    ? 52.667  -31.490 105.429  1.00 27.17  ? 7    GLY C CA    1 
ATOM   3606  C  C     . GLY C  2  7    ? 53.134  -32.932 105.522  1.00 31.14  ? 7    GLY C C     1 
ATOM   3607  O  O     . GLY C  2  7    ? 54.235  -33.234 105.985  1.00 27.99  ? 7    GLY C O     1 
ATOM   3608  N  N     . ARG C  2  8    ? 52.279  -33.820 105.023  1.00 35.53  ? 8    ARG C N     1 
ATOM   3609  C  CA    . ARG C  2  8    ? 52.492  -35.260 105.089  1.00 36.56  ? 8    ARG C CA    1 
ATOM   3610  C  C     . ARG C  2  8    ? 53.338  -35.821 103.952  1.00 35.22  ? 8    ARG C C     1 
ATOM   3611  O  O     . ARG C  2  8    ? 54.219  -36.652 104.178  1.00 44.69  ? 8    ARG C O     1 
ATOM   3612  C  CB    . ARG C  2  8    ? 51.143  -35.979 105.181  1.00 42.89  ? 8    ARG C CB    1 
ATOM   3613  C  CG    . ARG C  2  8    ? 50.205  -35.323 106.186  1.00 49.36  ? 8    ARG C CG    1 
ATOM   3614  C  CD    . ARG C  2  8    ? 49.062  -36.223 106.615  1.00 55.09  ? 8    ARG C CD    1 
ATOM   3615  N  NE    . ARG C  2  8    ? 48.306  -35.605 107.702  1.00 71.86  ? 8    ARG C NE    1 
ATOM   3616  C  CZ    . ARG C  2  8    ? 47.360  -36.217 108.408  1.00 76.57  ? 8    ARG C CZ    1 
ATOM   3617  N  NH1   . ARG C  2  8    ? 47.044  -37.478 108.147  1.00 77.98  ? 8    ARG C NH1   1 
ATOM   3618  N  NH2   . ARG C  2  8    ? 46.731  -35.565 109.379  1.00 70.56  ? 8    ARG C NH2   1 
ATOM   3619  N  N     . ILE C  2  9    ? 53.062  -35.353 102.735  1.00 39.38  ? 9    ILE C N     1 
ATOM   3620  C  CA    . ILE C  2  9    ? 53.688  -35.881 101.518  1.00 39.42  ? 9    ILE C CA    1 
ATOM   3621  C  C     . ILE C  2  9    ? 55.218  -35.815 101.547  1.00 38.80  ? 9    ILE C C     1 
ATOM   3622  O  O     . ILE C  2  9    ? 55.808  -34.766 101.803  1.00 27.88  ? 9    ILE C O     1 
ATOM   3623  C  CB    . ILE C  2  9    ? 53.172  -35.161 100.238  1.00 28.96  ? 9    ILE C CB    1 
ATOM   3624  C  CG1   . ILE C  2  9    ? 51.644  -35.227 100.142  1.00 30.06  ? 9    ILE C CG1   1 
ATOM   3625  C  CG2   . ILE C  2  9    ? 53.799  -35.762 98.994   1.00 26.59  ? 9    ILE C CG2   1 
ATOM   3626  C  CD1   . ILE C  2  9    ? 51.065  -34.535 98.908   1.00 18.96  ? 9    ILE C CD1   1 
ATOM   3627  N  N     . ARG C  2  10   ? 55.850  -36.955 101.295  1.00 43.67  ? 10   ARG C N     1 
ATOM   3628  C  CA    . ARG C  2  10   ? 57.296  -37.014 101.165  1.00 49.34  ? 10   ARG C CA    1 
ATOM   3629  C  C     . ARG C  2  10   ? 57.657  -37.054 99.681   1.00 50.47  ? 10   ARG C C     1 
ATOM   3630  O  O     . ARG C  2  10   ? 57.147  -37.895 98.933   1.00 46.25  ? 10   ARG C O     1 
ATOM   3631  C  CB    . ARG C  2  10   ? 57.848  -38.246 101.885  1.00 50.96  ? 10   ARG C CB    1 
ATOM   3632  C  CG    . ARG C  2  10   ? 59.336  -38.483 101.660  1.00 56.56  ? 10   ARG C CG    1 
ATOM   3633  C  CD    . ARG C  2  10   ? 59.797  -39.788 102.297  1.00 66.68  ? 10   ARG C CD    1 
ATOM   3634  N  NE    . ARG C  2  10   ? 59.128  -40.960 101.733  1.00 67.61  ? 10   ARG C NE    1 
ATOM   3635  C  CZ    . ARG C  2  10   ? 59.628  -41.712 100.755  1.00 67.18  ? 10   ARG C CZ    1 
ATOM   3636  N  NH1   . ARG C  2  10   ? 58.951  -42.764 100.307  1.00 55.91  ? 10   ARG C NH1   1 
ATOM   3637  N  NH2   . ARG C  2  10   ? 60.808  -41.414 100.225  1.00 57.91  ? 10   ARG C NH2   1 
ATOM   3638  N  N     . GLU C  2  11   ? 58.521  -36.139 99.250   1.00 45.63  ? 11   GLU C N     1 
ATOM   3639  C  CA    . GLU C  2  11   ? 58.931  -36.117 97.852   1.00 37.48  ? 11   GLU C CA    1 
ATOM   3640  C  C     . GLU C  2  11   ? 60.006  -37.165 97.608   1.00 31.43  ? 11   GLU C C     1 
ATOM   3641  O  O     . GLU C  2  11   ? 61.115  -37.077 98.142   1.00 29.60  ? 11   GLU C O     1 
ATOM   3642  C  CB    . GLU C  2  11   ? 59.439  -34.729 97.451   1.00 38.38  ? 11   GLU C CB    1 
ATOM   3643  C  CG    . GLU C  2  11   ? 58.354  -33.776 96.967   1.00 26.04  ? 11   GLU C CG    1 
ATOM   3644  C  CD    . GLU C  2  11   ? 57.712  -32.984 98.090   1.00 34.93  ? 11   GLU C CD    1 
ATOM   3645  O  OE1   . GLU C  2  11   ? 58.430  -32.624 99.049   1.00 41.09  ? 11   GLU C OE1   1 
ATOM   3646  O  OE2   . GLU C  2  11   ? 56.490  -32.717 98.013   1.00 36.15  ? 11   GLU C OE2   1 
ATOM   3647  N  N     . VAL C  2  12   ? 59.674  -38.133 96.761   1.00 27.43  ? 12   VAL C N     1 
ATOM   3648  C  CA    . VAL C  2  12   ? 60.532  -39.287 96.525   1.00 28.37  ? 12   VAL C CA    1 
ATOM   3649  C  C     . VAL C  2  12   ? 61.809  -38.891 95.802   1.00 24.93  ? 12   VAL C C     1 
ATOM   3650  O  O     . VAL C  2  12   ? 62.873  -39.473 96.024   1.00 28.88  ? 12   VAL C O     1 
ATOM   3651  C  CB    . VAL C  2  12   ? 59.773  -40.361 95.737   1.00 27.01  ? 12   VAL C CB    1 
ATOM   3652  C  CG1   . VAL C  2  12   ? 60.708  -41.469 95.275   1.00 34.66  ? 12   VAL C CG1   1 
ATOM   3653  C  CG2   . VAL C  2  12   ? 58.672  -40.919 96.603   1.00 34.94  ? 12   VAL C CG2   1 
ATOM   3654  N  N     . ILE C  2  13   ? 61.696  -37.879 94.952   1.00 22.99  ? 13   ILE C N     1 
ATOM   3655  C  CA    . ILE C  2  13   ? 62.835  -37.358 94.214   1.00 15.64  ? 13   ILE C CA    1 
ATOM   3656  C  C     . ILE C  2  13   ? 62.932  -35.847 94.418   1.00 13.12  ? 13   ILE C C     1 
ATOM   3657  O  O     . ILE C  2  13   ? 61.914  -35.178 94.583   1.00 12.36  ? 13   ILE C O     1 
ATOM   3658  C  CB    . ILE C  2  13   ? 62.698  -37.687 92.725   1.00 13.67  ? 13   ILE C CB    1 
ATOM   3659  C  CG1   . ILE C  2  13   ? 61.285  -37.362 92.244   1.00 11.98  ? 13   ILE C CG1   1 
ATOM   3660  C  CG2   . ILE C  2  13   ? 62.945  -39.158 92.493   1.00 19.88  ? 13   ILE C CG2   1 
ATOM   3661  C  CD1   . ILE C  2  13   ? 61.092  -37.570 90.768   1.00 8.01   ? 13   ILE C CD1   1 
ATOM   3662  N  N     . PRO C  2  14   ? 64.157  -35.302 94.425   1.00 10.22  ? 14   PRO C N     1 
ATOM   3663  C  CA    . PRO C  2  14   ? 64.305  -33.852 94.563   1.00 8.43   ? 14   PRO C CA    1 
ATOM   3664  C  C     . PRO C  2  14   ? 63.949  -33.146 93.267   1.00 9.01   ? 14   PRO C C     1 
ATOM   3665  O  O     . PRO C  2  14   ? 63.677  -33.808 92.260   1.00 9.20   ? 14   PRO C O     1 
ATOM   3666  C  CB    . PRO C  2  14   ? 65.800  -33.688 94.819   1.00 7.55   ? 14   PRO C CB    1 
ATOM   3667  C  CG    . PRO C  2  14   ? 66.411  -34.829 94.114   1.00 7.39   ? 14   PRO C CG    1 
ATOM   3668  C  CD    . PRO C  2  14   ? 65.461  -35.974 94.319   1.00 12.16  ? 14   PRO C CD    1 
ATOM   3669  N  N     . LEU C  2  15   ? 63.973  -31.818 93.282   1.00 6.72   ? 15   LEU C N     1 
ATOM   3670  C  CA    . LEU C  2  15   ? 63.730  -31.058 92.064   1.00 6.26   ? 15   LEU C CA    1 
ATOM   3671  C  C     . LEU C  2  15   ? 64.927  -31.183 91.144   1.00 6.05   ? 15   LEU C C     1 
ATOM   3672  O  O     . LEU C  2  15   ? 66.064  -31.009 91.583   1.00 7.94   ? 15   LEU C O     1 
ATOM   3673  C  CB    . LEU C  2  15   ? 63.470  -29.588 92.383   1.00 5.43   ? 15   LEU C CB    1 
ATOM   3674  C  CG    . LEU C  2  15   ? 62.031  -29.277 92.776   1.00 4.70   ? 15   LEU C CG    1 
ATOM   3675  C  CD1   . LEU C  2  15   ? 61.918  -27.853 93.269   1.00 4.69   ? 15   LEU C CD1   1 
ATOM   3676  C  CD2   . LEU C  2  15   ? 61.131  -29.510 91.582   1.00 4.89   ? 15   LEU C CD2   1 
ATOM   3677  N  N     . PRO C  2  16   ? 64.677  -31.472 89.858   1.00 4.90   ? 16   PRO C N     1 
ATOM   3678  C  CA    . PRO C  2  16   ? 65.753  -31.630 88.872   1.00 5.23   ? 16   PRO C CA    1 
ATOM   3679  C  C     . PRO C  2  16   ? 66.560  -30.342 88.765   1.00 5.62   ? 16   PRO C C     1 
ATOM   3680  O  O     . PRO C  2  16   ? 66.070  -29.295 89.192   1.00 4.61   ? 16   PRO C O     1 
ATOM   3681  C  CB    . PRO C  2  16   ? 64.997  -31.903 87.569   1.00 4.42   ? 16   PRO C CB    1 
ATOM   3682  C  CG    . PRO C  2  16   ? 63.630  -31.373 87.801   1.00 4.38   ? 16   PRO C CG    1 
ATOM   3683  C  CD    . PRO C  2  16   ? 63.342  -31.564 89.248   1.00 4.12   ? 16   PRO C CD    1 
ATOM   3684  N  N     . PRO C  2  17   ? 67.792  -30.414 88.236   1.00 7.23   ? 17   PRO C N     1 
ATOM   3685  C  CA    . PRO C  2  17   ? 68.560  -29.167 88.157   1.00 6.98   ? 17   PRO C CA    1 
ATOM   3686  C  C     . PRO C  2  17   ? 67.775  -28.172 87.315   1.00 6.31   ? 17   PRO C C     1 
ATOM   3687  O  O     . PRO C  2  17   ? 67.450  -28.464 86.160   1.00 5.41   ? 17   PRO C O     1 
ATOM   3688  C  CB    . PRO C  2  17   ? 69.831  -29.592 87.420   1.00 5.36   ? 17   PRO C CB    1 
ATOM   3689  C  CG    . PRO C  2  17   ? 69.920  -31.057 87.625   1.00 4.55   ? 17   PRO C CG    1 
ATOM   3690  C  CD    . PRO C  2  17   ? 68.520  -31.556 87.664   1.00 4.99   ? 17   PRO C CD    1 
ATOM   3691  N  N     . LEU C  2  18   ? 67.511  -26.998 87.876   1.00 4.98   ? 18   LEU C N     1 
ATOM   3692  C  CA    . LEU C  2  18   ? 66.462  -26.134 87.342   1.00 3.91   ? 18   LEU C CA    1 
ATOM   3693  C  C     . LEU C  2  18   ? 66.790  -25.455 86.013   1.00 4.13   ? 18   LEU C C     1 
ATOM   3694  O  O     . LEU C  2  18   ? 65.884  -25.129 85.253   1.00 4.37   ? 18   LEU C O     1 
ATOM   3695  C  CB    . LEU C  2  18   ? 66.017  -25.114 88.389   1.00 3.22   ? 18   LEU C CB    1 
ATOM   3696  C  CG    . LEU C  2  18   ? 65.228  -25.732 89.542   1.00 2.60   ? 18   LEU C CG    1 
ATOM   3697  C  CD1   . LEU C  2  18   ? 64.852  -24.683 90.567   1.00 1.98   ? 18   LEU C CD1   1 
ATOM   3698  C  CD2   . LEU C  2  18   ? 63.991  -26.438 89.012   1.00 2.34   ? 18   LEU C CD2   1 
ATOM   3699  N  N     . THR C  2  19   ? 68.072  -25.237 85.737   1.00 3.37   ? 19   THR C N     1 
ATOM   3700  C  CA    . THR C  2  19   ? 68.474  -24.651 84.465   1.00 3.03   ? 19   THR C CA    1 
ATOM   3701  C  C     . THR C  2  19   ? 68.893  -25.685 83.418   1.00 3.64   ? 19   THR C C     1 
ATOM   3702  O  O     . THR C  2  19   ? 69.401  -25.327 82.354   1.00 3.33   ? 19   THR C O     1 
ATOM   3703  C  CB    . THR C  2  19   ? 69.572  -23.589 84.626   1.00 3.67   ? 19   THR C CB    1 
ATOM   3704  O  OG1   . THR C  2  19   ? 70.770  -24.201 85.112   1.00 6.72   ? 19   THR C OG1   1 
ATOM   3705  C  CG2   . THR C  2  19   ? 69.125  -22.523 85.592   1.00 4.14   ? 19   THR C CG2   1 
ATOM   3706  N  N     . GLU C  2  20   ? 68.711  -26.964 83.723   1.00 4.58   ? 20   GLU C N     1 
ATOM   3707  C  CA    . GLU C  2  20   ? 69.191  -28.009 82.819   1.00 4.71   ? 20   GLU C CA    1 
ATOM   3708  C  C     . GLU C  2  20   ? 68.622  -27.913 81.404   1.00 5.07   ? 20   GLU C C     1 
ATOM   3709  O  O     . GLU C  2  20   ? 69.275  -28.332 80.449   1.00 9.30   ? 20   GLU C O     1 
ATOM   3710  C  CB    . GLU C  2  20   ? 68.982  -29.410 83.403   1.00 6.69   ? 20   GLU C CB    1 
ATOM   3711  C  CG    . GLU C  2  20   ? 67.571  -29.959 83.318   1.00 9.39   ? 20   GLU C CG    1 
ATOM   3712  C  CD    . GLU C  2  20   ? 67.517  -31.456 83.626   1.00 18.66  ? 20   GLU C CD    1 
ATOM   3713  O  OE1   . GLU C  2  20   ? 68.514  -32.167 83.350   1.00 16.99  ? 20   GLU C OE1   1 
ATOM   3714  O  OE2   . GLU C  2  20   ? 66.479  -31.921 84.146   1.00 17.74  ? 20   GLU C OE2   1 
ATOM   3715  N  N     . ILE C  2  21   ? 67.426  -27.345 81.265   1.00 5.01   ? 21   ILE C N     1 
ATOM   3716  C  CA    . ILE C  2  21   ? 66.819  -27.152 79.946   1.00 4.33   ? 21   ILE C CA    1 
ATOM   3717  C  C     . ILE C  2  21   ? 67.726  -26.318 79.028   1.00 3.93   ? 21   ILE C C     1 
ATOM   3718  O  O     . ILE C  2  21   ? 67.731  -26.497 77.814   1.00 4.68   ? 21   ILE C O     1 
ATOM   3719  C  CB    . ILE C  2  21   ? 65.399  -26.520 80.047   1.00 3.51   ? 21   ILE C CB    1 
ATOM   3720  C  CG1   . ILE C  2  21   ? 64.702  -26.517 78.685   1.00 1.75   ? 21   ILE C CG1   1 
ATOM   3721  C  CG2   . ILE C  2  21   ? 65.460  -25.116 80.641   1.00 1.92   ? 21   ILE C CG2   1 
ATOM   3722  C  CD1   . ILE C  2  21   ? 63.361  -25.851 78.704   1.00 1.56   ? 21   ILE C CD1   1 
ATOM   3723  N  N     . GLN C  2  22   ? 68.505  -25.421 79.625   1.00 3.20   ? 22   GLN C N     1 
ATOM   3724  C  CA    . GLN C  2  22   ? 69.483  -24.625 78.896   1.00 2.47   ? 22   GLN C CA    1 
ATOM   3725  C  C     . GLN C  2  22   ? 70.823  -25.362 78.832   1.00 2.29   ? 22   GLN C C     1 
ATOM   3726  O  O     . GLN C  2  22   ? 71.327  -25.694 77.754   1.00 2.04   ? 22   GLN C O     1 
ATOM   3727  C  CB    . GLN C  2  22   ? 69.669  -23.274 79.588   1.00 1.60   ? 22   GLN C CB    1 
ATOM   3728  C  CG    . GLN C  2  22   ? 68.416  -22.430 79.658   1.00 1.26   ? 22   GLN C CG    1 
ATOM   3729  C  CD    . GLN C  2  22   ? 68.187  -21.629 78.399   1.00 1.08   ? 22   GLN C CD    1 
ATOM   3730  O  OE1   . GLN C  2  22   ? 69.132  -21.247 77.718   1.00 0.88   ? 22   GLN C OE1   1 
ATOM   3731  N  NE2   . GLN C  2  22   ? 66.929  -21.362 78.086   1.00 1.03   ? 22   GLN C NE2   1 
ATOM   3732  N  N     . VAL C  2  23   ? 71.381  -25.598 80.014   1.00 2.59   ? 23   VAL C N     1 
ATOM   3733  C  CA    . VAL C  2  23   ? 72.703  -26.188 80.203   1.00 2.78   ? 23   VAL C CA    1 
ATOM   3734  C  C     . VAL C  2  23   ? 72.959  -27.469 79.416   1.00 2.68   ? 23   VAL C C     1 
ATOM   3735  O  O     . VAL C  2  23   ? 73.945  -27.568 78.684   1.00 2.77   ? 23   VAL C O     1 
ATOM   3736  C  CB    . VAL C  2  23   ? 72.926  -26.486 81.693   1.00 2.46   ? 23   VAL C CB    1 
ATOM   3737  C  CG1   . VAL C  2  23   ? 74.084  -27.432 81.878   1.00 4.31   ? 23   VAL C CG1   1 
ATOM   3738  C  CG2   . VAL C  2  23   ? 73.147  -25.196 82.456   1.00 2.80   ? 23   VAL C CG2   1 
ATOM   3739  N  N     . GLU C  2  24   ? 72.075  -28.450 79.565   1.00 3.55   ? 24   GLU C N     1 
ATOM   3740  C  CA    . GLU C  2  24   ? 72.266  -29.730 78.893   1.00 3.95   ? 24   GLU C CA    1 
ATOM   3741  C  C     . GLU C  2  24   ? 72.041  -29.632 77.395   1.00 3.20   ? 24   GLU C C     1 
ATOM   3742  O  O     . GLU C  2  24   ? 72.753  -30.254 76.615   1.00 5.88   ? 24   GLU C O     1 
ATOM   3743  C  CB    . GLU C  2  24   ? 71.390  -30.822 79.510   1.00 5.63   ? 24   GLU C CB    1 
ATOM   3744  C  CG    . GLU C  2  24   ? 71.984  -31.413 80.784   1.00 10.19  ? 24   GLU C CG    1 
ATOM   3745  C  CD    . GLU C  2  24   ? 73.407  -31.920 80.572   1.00 18.79  ? 24   GLU C CD    1 
ATOM   3746  O  OE1   . GLU C  2  24   ? 74.283  -31.632 81.425   1.00 13.33  ? 24   GLU C OE1   1 
ATOM   3747  O  OE2   . GLU C  2  24   ? 73.647  -32.605 79.546   1.00 18.26  ? 24   GLU C OE2   1 
ATOM   3748  N  N     . SER C  2  25   ? 71.053  -28.844 76.997   1.00 2.66   ? 25   SER C N     1 
ATOM   3749  C  CA    . SER C  2  25   ? 70.797  -28.605 75.587   1.00 1.84   ? 25   SER C CA    1 
ATOM   3750  C  C     . SER C  2  25   ? 72.013  -28.033 74.867   1.00 1.85   ? 25   SER C C     1 
ATOM   3751  O  O     . SER C  2  25   ? 72.381  -28.504 73.787   1.00 2.33   ? 25   SER C O     1 
ATOM   3752  C  CB    . SER C  2  25   ? 69.604  -27.671 75.416   1.00 1.88   ? 25   SER C CB    1 
ATOM   3753  O  OG    . SER C  2  25   ? 69.492  -27.246 74.073   1.00 1.73   ? 25   SER C OG    1 
ATOM   3754  N  N     . TYR C  2  26   ? 72.641  -27.019 75.456   1.00 2.33   ? 26   TYR C N     1 
ATOM   3755  C  CA    . TYR C  2  26   ? 73.797  -26.400 74.809   1.00 1.94   ? 26   TYR C CA    1 
ATOM   3756  C  C     . TYR C  2  26   ? 75.028  -27.300 74.880   1.00 2.53   ? 26   TYR C C     1 
ATOM   3757  O  O     . TYR C  2  26   ? 75.787  -27.411 73.914   1.00 2.18   ? 26   TYR C O     1 
ATOM   3758  C  CB    . TYR C  2  26   ? 74.105  -25.033 75.409   1.00 0.89   ? 26   TYR C CB    1 
ATOM   3759  C  CG    . TYR C  2  26   ? 74.786  -24.108 74.433   1.00 0.83   ? 26   TYR C CG    1 
ATOM   3760  C  CD1   . TYR C  2  26   ? 74.124  -23.669 73.292   1.00 0.86   ? 26   TYR C CD1   1 
ATOM   3761  C  CD2   . TYR C  2  26   ? 76.086  -23.679 74.641   1.00 0.93   ? 26   TYR C CD2   1 
ATOM   3762  C  CE1   . TYR C  2  26   ? 74.729  -22.827 72.392   1.00 0.81   ? 26   TYR C CE1   1 
ATOM   3763  C  CE2   . TYR C  2  26   ? 76.702  -22.833 73.747   1.00 1.22   ? 26   TYR C CE2   1 
ATOM   3764  C  CZ    . TYR C  2  26   ? 76.019  -22.408 72.620   1.00 1.47   ? 26   TYR C CZ    1 
ATOM   3765  O  OH    . TYR C  2  26   ? 76.628  -21.561 71.716   1.00 1.64   ? 26   TYR C OH    1 
ATOM   3766  N  N     . ARG C  2  27   ? 75.217  -27.940 76.030   1.00 2.92   ? 27   ARG C N     1 
ATOM   3767  C  CA    . ARG C  2  27   ? 76.315  -28.882 76.203   1.00 4.30   ? 27   ARG C CA    1 
ATOM   3768  C  C     . ARG C  2  27   ? 76.257  -29.927 75.105   1.00 3.94   ? 27   ARG C C     1 
ATOM   3769  O  O     . ARG C  2  27   ? 77.279  -30.313 74.537   1.00 5.47   ? 27   ARG C O     1 
ATOM   3770  C  CB    . ARG C  2  27   ? 76.221  -29.550 77.575   1.00 6.40   ? 27   ARG C CB    1 
ATOM   3771  C  CG    . ARG C  2  27   ? 77.215  -30.656 77.824   1.00 6.46   ? 27   ARG C CG    1 
ATOM   3772  C  CD    . ARG C  2  27   ? 76.944  -31.302 79.168   1.00 17.65  ? 27   ARG C CD    1 
ATOM   3773  N  NE    . ARG C  2  27   ? 77.448  -32.672 79.232   1.00 41.18  ? 27   ARG C NE    1 
ATOM   3774  C  CZ    . ARG C  2  27   ? 76.791  -33.733 78.770   1.00 46.45  ? 27   ARG C CZ    1 
ATOM   3775  N  NH1   . ARG C  2  27   ? 77.329  -34.943 78.873   1.00 53.41  ? 27   ARG C NH1   1 
ATOM   3776  N  NH2   . ARG C  2  27   ? 75.598  -33.589 78.202   1.00 30.85  ? 27   ARG C NH2   1 
ATOM   3777  N  N     . ARG C  2  28   ? 75.038  -30.353 74.799   1.00 3.04   ? 28   ARG C N     1 
ATOM   3778  C  CA    . ARG C  2  28   ? 74.794  -31.345 73.771   1.00 3.22   ? 28   ARG C CA    1 
ATOM   3779  C  C     . ARG C  2  28   ? 75.002  -30.787 72.359   1.00 3.09   ? 28   ARG C C     1 
ATOM   3780  O  O     . ARG C  2  28   ? 75.517  -31.472 71.484   1.00 3.84   ? 28   ARG C O     1 
ATOM   3781  C  CB    . ARG C  2  28   ? 73.386  -31.925 73.941   1.00 7.11   ? 28   ARG C CB    1 
ATOM   3782  C  CG    . ARG C  2  28   ? 73.019  -33.026 72.955   1.00 24.50  ? 28   ARG C CG    1 
ATOM   3783  C  CD    . ARG C  2  28   ? 71.925  -33.911 73.531   1.00 37.11  ? 28   ARG C CD    1 
ATOM   3784  N  NE    . ARG C  2  28   ? 71.370  -34.828 72.537   1.00 57.07  ? 28   ARG C NE    1 
ATOM   3785  C  CZ    . ARG C  2  28   ? 71.926  -35.985 72.191   1.00 60.70  ? 28   ARG C CZ    1 
ATOM   3786  N  NH1   . ARG C  2  28   ? 73.069  -36.372 72.750   1.00 53.66  ? 28   ARG C NH1   1 
ATOM   3787  N  NH2   . ARG C  2  28   ? 71.340  -36.754 71.282   1.00 55.07  ? 28   ARG C NH2   1 
ATOM   3788  N  N     . ALA C  2  29   ? 74.609  -29.542 72.131   1.00 5.01   ? 29   ALA C N     1 
ATOM   3789  C  CA    . ALA C  2  29   ? 74.849  -28.931 70.825   1.00 3.84   ? 29   ALA C CA    1 
ATOM   3790  C  C     . ALA C  2  29   ? 76.343  -28.775 70.504   1.00 4.29   ? 29   ALA C C     1 
ATOM   3791  O  O     . ALA C  2  29   ? 76.768  -28.999 69.372   1.00 5.10   ? 29   ALA C O     1 
ATOM   3792  C  CB    . ALA C  2  29   ? 74.145  -27.596 70.728   1.00 2.33   ? 29   ALA C CB    1 
ATOM   3793  N  N     . LEU C  2  30   ? 77.136  -28.377 71.493   1.00 3.80   ? 30   LEU C N     1 
ATOM   3794  C  CA    . LEU C  2  30   ? 78.554  -28.132 71.252   1.00 3.36   ? 30   LEU C CA    1 
ATOM   3795  C  C     . LEU C  2  30   ? 79.434  -29.380 71.251   1.00 5.26   ? 30   LEU C C     1 
ATOM   3796  O  O     . LEU C  2  30   ? 80.344  -29.487 70.432   1.00 6.93   ? 30   LEU C O     1 
ATOM   3797  C  CB    . LEU C  2  30   ? 79.107  -27.086 72.220   1.00 4.08   ? 30   LEU C CB    1 
ATOM   3798  C  CG    . LEU C  2  30   ? 78.525  -25.681 72.062   1.00 2.92   ? 30   LEU C CG    1 
ATOM   3799  C  CD1   . LEU C  2  30   ? 79.427  -24.662 72.732   1.00 3.55   ? 30   LEU C CD1   1 
ATOM   3800  C  CD2   . LEU C  2  30   ? 78.305  -25.327 70.601   1.00 2.54   ? 30   LEU C CD2   1 
ATOM   3801  N  N     . GLN C  2  31   ? 79.170  -30.308 72.170   1.00 7.13   ? 31   GLN C N     1 
ATOM   3802  C  CA    . GLN C  2  31   ? 79.989  -31.519 72.320   1.00 8.59   ? 31   GLN C CA    1 
ATOM   3803  C  C     . GLN C  2  31   ? 81.478  -31.197 72.468   1.00 10.25  ? 31   GLN C C     1 
ATOM   3804  O  O     . GLN C  2  31   ? 82.327  -31.849 71.857   1.00 10.03  ? 31   GLN C O     1 
ATOM   3805  C  CB    . GLN C  2  31   ? 79.763  -32.499 71.157   1.00 6.08   ? 31   GLN C CB    1 
ATOM   3806  C  CG    . GLN C  2  31   ? 78.563  -33.421 71.345   1.00 7.00   ? 31   GLN C CG    1 
ATOM   3807  C  CD    . GLN C  2  31   ? 78.424  -34.455 70.239   1.00 10.94  ? 31   GLN C CD    1 
ATOM   3808  O  OE1   . GLN C  2  31   ? 78.231  -35.642 70.507   1.00 12.72  ? 31   GLN C OE1   1 
ATOM   3809  N  NE2   . GLN C  2  31   ? 78.507  -34.008 68.992   1.00 11.11  ? 31   GLN C NE2   1 
ATOM   3810  N  N     . ALA C  2  32   ? 81.784  -30.189 73.282   1.00 10.75  ? 32   ALA C N     1 
ATOM   3811  C  CA    . ALA C  2  32   ? 83.157  -29.720 73.452   1.00 11.37  ? 32   ALA C CA    1 
ATOM   3812  C  C     . ALA C  2  32   ? 83.976  -30.642 74.350   1.00 17.15  ? 32   ALA C C     1 
ATOM   3813  O  O     . ALA C  2  32   ? 85.196  -30.747 74.202   1.00 17.41  ? 32   ALA C O     1 
ATOM   3814  C  CB    . ALA C  2  32   ? 83.163  -28.309 74.003   1.00 11.34  ? 32   ALA C CB    1 
ATOM   3815  N  N     . ASP C  2  33   ? 83.286  -31.320 75.265   1.00 21.12  ? 33   ASP C N     1 
ATOM   3816  C  CA    . ASP C  2  33   ? 83.913  -32.196 76.257   1.00 22.04  ? 33   ASP C CA    1 
ATOM   3817  C  C     . ASP C  2  33   ? 84.089  -33.616 75.724   1.00 22.37  ? 33   ASP C C     1 
ATOM   3818  O  O     . ASP C  2  33   ? 84.443  -34.535 76.464   1.00 28.35  ? 33   ASP C O     1 
ATOM   3819  C  CB    . ASP C  2  33   ? 83.122  -32.207 77.573   1.00 29.99  ? 33   ASP C CB    1 
ATOM   3820  C  CG    . ASP C  2  33   ? 83.584  -31.130 78.548   1.00 51.22  ? 33   ASP C CG    1 
ATOM   3821  O  OD1   . ASP C  2  33   ? 83.845  -29.989 78.105   1.00 46.79  ? 33   ASP C OD1   1 
ATOM   3822  O  OD2   . ASP C  2  33   ? 83.695  -31.429 79.759   1.00 61.07  ? 33   ASP C OD2   1 
ATOM   3823  N  N     . VAL C  2  34   ? 83.831  -33.790 74.435   1.00 15.17  ? 34   VAL C N     1 
ATOM   3824  C  CA    . VAL C  2  34   ? 83.957  -35.088 73.814   1.00 11.44  ? 34   VAL C CA    1 
ATOM   3825  C  C     . VAL C  2  34   ? 85.076  -35.011 72.795   1.00 15.66  ? 34   VAL C C     1 
ATOM   3826  O  O     . VAL C  2  34   ? 85.196  -34.012 72.083   1.00 19.44  ? 34   VAL C O     1 
ATOM   3827  C  CB    . VAL C  2  34   ? 82.671  -35.406 73.045   1.00 12.78  ? 34   VAL C CB    1 
ATOM   3828  C  CG1   . VAL C  2  34   ? 82.769  -36.755 72.337   1.00 15.68  ? 34   VAL C CG1   1 
ATOM   3829  C  CG2   . VAL C  2  34   ? 81.473  -35.349 73.979   1.00 14.03  ? 34   VAL C CG2   1 
ATOM   3830  N  N     . PRO C  2  35   ? 85.902  -36.070 72.715   1.00 16.09  ? 35   PRO C N     1 
ATOM   3831  C  CA    . PRO C  2  35   ? 86.910  -36.170 71.657   1.00 13.57  ? 35   PRO C CA    1 
ATOM   3832  C  C     . PRO C  2  35   ? 86.265  -36.376 70.288   1.00 12.99  ? 35   PRO C C     1 
ATOM   3833  O  O     . PRO C  2  35   ? 85.360  -37.194 70.155   1.00 13.09  ? 35   PRO C O     1 
ATOM   3834  C  CB    . PRO C  2  35   ? 87.742  -37.387 72.075   1.00 12.94  ? 35   PRO C CB    1 
ATOM   3835  C  CG    . PRO C  2  35   ? 86.954  -38.076 73.125   1.00 11.53  ? 35   PRO C CG    1 
ATOM   3836  C  CD    . PRO C  2  35   ? 86.160  -37.025 73.802   1.00 13.29  ? 35   PRO C CD    1 
ATOM   3837  N  N     . PRO C  2  36   ? 86.747  -35.643 69.275   1.00 12.29  ? 36   PRO C N     1 
ATOM   3838  C  CA    . PRO C  2  36   ? 86.137  -35.534 67.947   1.00 13.45  ? 36   PRO C CA    1 
ATOM   3839  C  C     . PRO C  2  36   ? 85.699  -36.862 67.337   1.00 19.00  ? 36   PRO C C     1 
ATOM   3840  O  O     . PRO C  2  36   ? 84.709  -36.890 66.610   1.00 27.47  ? 36   PRO C O     1 
ATOM   3841  C  CB    . PRO C  2  36   ? 87.259  -34.925 67.111   1.00 12.08  ? 36   PRO C CB    1 
ATOM   3842  C  CG    . PRO C  2  36   ? 87.993  -34.069 68.074   1.00 15.58  ? 36   PRO C CG    1 
ATOM   3843  C  CD    . PRO C  2  36   ? 87.912  -34.751 69.413   1.00 12.26  ? 36   PRO C CD    1 
ATOM   3844  N  N     . GLU C  2  37   ? 86.409  -37.944 67.623   1.00 18.95  ? 37   GLU C N     1 
ATOM   3845  C  CA    . GLU C  2  37   ? 86.046  -39.226 67.038   1.00 25.94  ? 37   GLU C CA    1 
ATOM   3846  C  C     . GLU C  2  37   ? 84.872  -39.872 67.781   1.00 28.68  ? 37   GLU C C     1 
ATOM   3847  O  O     . GLU C  2  37   ? 84.179  -40.733 67.229   1.00 32.70  ? 37   GLU C O     1 
ATOM   3848  C  CB    . GLU C  2  37   ? 87.250  -40.173 66.983   1.00 22.55  ? 37   GLU C CB    1 
ATOM   3849  C  CG    . GLU C  2  37   ? 87.730  -40.667 68.339   1.00 26.44  ? 37   GLU C CG    1 
ATOM   3850  C  CD    . GLU C  2  37   ? 88.752  -39.747 68.981   1.00 30.01  ? 37   GLU C CD    1 
ATOM   3851  O  OE1   . GLU C  2  37   ? 89.249  -38.828 68.291   1.00 25.20  ? 37   GLU C OE1   1 
ATOM   3852  O  OE2   . GLU C  2  37   ? 89.058  -39.947 70.178   1.00 30.26  ? 37   GLU C OE2   1 
ATOM   3853  N  N     . LYS C  2  38   ? 84.650  -39.441 69.024   1.00 22.62  ? 38   LYS C N     1 
ATOM   3854  C  CA    . LYS C  2  38   ? 83.587  -39.993 69.874   1.00 23.02  ? 38   LYS C CA    1 
ATOM   3855  C  C     . LYS C  2  38   ? 82.280  -39.193 69.828   1.00 22.81  ? 38   LYS C C     1 
ATOM   3856  O  O     . LYS C  2  38   ? 81.336  -39.481 70.570   1.00 18.16  ? 38   LYS C O     1 
ATOM   3857  C  CB    . LYS C  2  38   ? 84.056  -40.115 71.324   1.00 16.08  ? 38   LYS C CB    1 
ATOM   3858  C  CG    . LYS C  2  38   ? 85.009  -41.258 71.591   1.00 17.68  ? 38   LYS C CG    1 
ATOM   3859  C  CD    . LYS C  2  38   ? 85.323  -41.323 73.073   1.00 19.20  ? 38   LYS C CD    1 
ATOM   3860  C  CE    . LYS C  2  38   ? 86.204  -42.500 73.428   1.00 24.35  ? 38   LYS C CE    1 
ATOM   3861  N  NZ    . LYS C  2  38   ? 86.559  -42.464 74.878   1.00 37.56  ? 38   LYS C NZ    1 
ATOM   3862  N  N     . ARG C  2  39   ? 82.234  -38.180 68.971   1.00 22.24  ? 39   ARG C N     1 
ATOM   3863  C  CA    . ARG C  2  39   ? 81.044  -37.349 68.850   1.00 18.91  ? 39   ARG C CA    1 
ATOM   3864  C  C     . ARG C  2  39   ? 79.938  -38.051 68.078   1.00 19.79  ? 39   ARG C C     1 
ATOM   3865  O  O     . ARG C  2  39   ? 80.208  -38.819 67.153   1.00 20.11  ? 39   ARG C O     1 
ATOM   3866  C  CB    . ARG C  2  39   ? 81.387  -36.022 68.174   1.00 14.65  ? 39   ARG C CB    1 
ATOM   3867  C  CG    . ARG C  2  39   ? 82.276  -35.138 69.012   1.00 12.22  ? 39   ARG C CG    1 
ATOM   3868  C  CD    . ARG C  2  39   ? 82.434  -33.775 68.389   1.00 9.74   ? 39   ARG C CD    1 
ATOM   3869  N  NE    . ARG C  2  39   ? 83.131  -32.874 69.295   1.00 8.70   ? 39   ARG C NE    1 
ATOM   3870  C  CZ    . ARG C  2  39   ? 84.238  -32.220 68.981   1.00 7.20   ? 39   ARG C CZ    1 
ATOM   3871  N  NH1   . ARG C  2  39   ? 84.766  -32.363 67.776   1.00 8.26   ? 39   ARG C NH1   1 
ATOM   3872  N  NH2   . ARG C  2  39   ? 84.808  -31.422 69.868   1.00 8.27   ? 39   ARG C NH2   1 
ATOM   3873  N  N     . GLU C  2  40   ? 78.692  -37.780 68.460   1.00 22.94  ? 40   GLU C N     1 
ATOM   3874  C  CA    . GLU C  2  40   ? 77.545  -38.292 67.722   1.00 21.26  ? 40   GLU C CA    1 
ATOM   3875  C  C     . GLU C  2  40   ? 77.151  -37.326 66.612   1.00 18.59  ? 40   GLU C C     1 
ATOM   3876  O  O     . GLU C  2  40   ? 77.711  -36.235 66.496   1.00 15.87  ? 40   GLU C O     1 
ATOM   3877  C  CB    . GLU C  2  40   ? 76.359  -38.518 68.654   1.00 17.13  ? 40   GLU C CB    1 
ATOM   3878  C  CG    . GLU C  2  40   ? 76.628  -39.517 69.750   1.00 27.65  ? 40   GLU C CG    1 
ATOM   3879  C  CD    . GLU C  2  40   ? 75.453  -39.664 70.692   1.00 51.65  ? 40   GLU C CD    1 
ATOM   3880  O  OE1   . GLU C  2  40   ? 74.324  -39.294 70.302   1.00 48.11  ? 40   GLU C OE1   1 
ATOM   3881  O  OE2   . GLU C  2  40   ? 75.660  -40.145 71.827   1.00 65.42  ? 40   GLU C OE2   1 
ATOM   3882  N  N     . ASN C  2  41   ? 76.148  -37.721 65.835   1.00 19.06  ? 41   ASN C N     1 
ATOM   3883  C  CA    . ASN C  2  41   ? 75.699  -36.970 64.666   1.00 16.60  ? 41   ASN C CA    1 
ATOM   3884  C  C     . ASN C  2  41   ? 74.655  -35.910 65.037   1.00 19.52  ? 41   ASN C C     1 
ATOM   3885  O  O     . ASN C  2  41   ? 73.955  -35.402 64.180   1.00 19.11  ? 41   ASN C O     1 
ATOM   3886  C  CB    . ASN C  2  41   ? 75.175  -37.905 63.567   1.00 19.03  ? 41   ASN C CB    1 
ATOM   3887  C  CG    . ASN C  2  41   ? 75.072  -37.215 62.208   1.00 24.46  ? 41   ASN C CG    1 
ATOM   3888  O  OD1   . ASN C  2  41   ? 75.806  -36.269 61.925   1.00 21.78  ? 41   ASN C OD1   1 
ATOM   3889  N  ND2   . ASN C  2  41   ? 74.152  -37.680 61.370   1.00 29.27  ? 41   ASN C ND2   1 
ATOM   3890  N  N     . VAL C  2  42   ? 74.475  -35.684 66.335   1.00 20.23  ? 42   VAL C N     1 
ATOM   3891  C  CA    . VAL C  2  42   ? 73.743  -34.528 66.855   1.00 15.33  ? 42   VAL C CA    1 
ATOM   3892  C  C     . VAL C  2  42   ? 74.537  -33.206 66.792   1.00 12.48  ? 42   VAL C C     1 
ATOM   3893  O  O     . VAL C  2  42   ? 75.752  -33.209 66.609   1.00 13.28  ? 42   VAL C O     1 
ATOM   3894  C  CB    . VAL C  2  42   ? 73.335  -34.773 68.303   1.00 13.53  ? 42   VAL C CB    1 
ATOM   3895  C  CG1   . VAL C  2  42   ? 72.782  -36.169 68.439   1.00 20.21  ? 42   VAL C CG1   1 
ATOM   3896  C  CG2   . VAL C  2  42   ? 74.531  -34.596 69.215   1.00 14.80  ? 42   VAL C CG2   1 
ATOM   3897  N  N     . GLY C  2  43   ? 73.838  -32.079 66.907   1.00 9.11   ? 43   GLY C N     1 
ATOM   3898  C  CA    . GLY C  2  43   ? 74.484  -30.794 67.133   1.00 6.99   ? 43   GLY C CA    1 
ATOM   3899  C  C     . GLY C  2  43   ? 75.206  -30.155 65.962   1.00 6.68   ? 43   GLY C C     1 
ATOM   3900  O  O     . GLY C  2  43   ? 74.838  -30.346 64.799   1.00 12.27  ? 43   GLY C O     1 
ATOM   3901  N  N     . ILE C  2  44   ? 76.241  -29.375 66.253   1.00 4.04   ? 44   ILE C N     1 
ATOM   3902  C  CA    . ILE C  2  44   ? 76.965  -28.741 65.162   1.00 6.69   ? 44   ILE C CA    1 
ATOM   3903  C  C     . ILE C  2  44   ? 77.752  -29.802 64.405   1.00 8.05   ? 44   ILE C C     1 
ATOM   3904  O  O     . ILE C  2  44   ? 78.137  -29.598 63.253   1.00 10.69  ? 44   ILE C O     1 
ATOM   3905  C  CB    . ILE C  2  44   ? 77.869  -27.562 65.608   1.00 6.44   ? 44   ILE C CB    1 
ATOM   3906  C  CG1   . ILE C  2  44   ? 79.101  -28.067 66.352   1.00 6.00   ? 44   ILE C CG1   1 
ATOM   3907  C  CG2   . ILE C  2  44   ? 77.083  -26.551 66.437   1.00 4.16   ? 44   ILE C CG2   1 
ATOM   3908  C  CD1   . ILE C  2  44   ? 80.004  -26.962 66.826   1.00 5.01   ? 44   ILE C CD1   1 
ATOM   3909  N  N     . GLN C  2  45   ? 77.967  -30.945 65.049   1.00 7.69   ? 45   GLN C N     1 
ATOM   3910  C  CA    . GLN C  2  45   ? 78.516  -32.097 64.352   1.00 8.57   ? 45   GLN C CA    1 
ATOM   3911  C  C     . GLN C  2  45   ? 77.557  -32.472 63.230   1.00 11.81  ? 45   GLN C C     1 
ATOM   3912  O  O     . GLN C  2  45   ? 77.974  -32.631 62.081   1.00 13.88  ? 45   GLN C O     1 
ATOM   3913  C  CB    . GLN C  2  45   ? 78.729  -33.280 65.298   1.00 10.28  ? 45   GLN C CB    1 
ATOM   3914  C  CG    . GLN C  2  45   ? 79.510  -34.438 64.680   1.00 10.38  ? 45   GLN C CG    1 
ATOM   3915  C  CD    . GLN C  2  45   ? 80.958  -34.085 64.392   1.00 10.81  ? 45   GLN C CD    1 
ATOM   3916  O  OE1   . GLN C  2  45   ? 81.641  -33.501 65.227   1.00 17.02  ? 45   GLN C OE1   1 
ATOM   3917  N  NE2   . GLN C  2  45   ? 81.430  -34.437 63.208   1.00 8.49   ? 45   GLN C NE2   1 
ATOM   3918  N  N     . ALA C  2  46   ? 76.271  -32.586 63.567   1.00 12.17  ? 46   ALA C N     1 
ATOM   3919  C  CA    . ALA C  2  46   ? 75.218  -32.792 62.570   1.00 11.92  ? 46   ALA C CA    1 
ATOM   3920  C  C     . ALA C  2  46   ? 75.291  -31.752 61.467   1.00 13.56  ? 46   ALA C C     1 
ATOM   3921  O  O     . ALA C  2  46   ? 75.126  -32.074 60.293   1.00 13.61  ? 46   ALA C O     1 
ATOM   3922  C  CB    . ALA C  2  46   ? 73.863  -32.725 63.213   1.00 16.75  ? 46   ALA C CB    1 
ATOM   3923  N  N     . ALA C  2  47   ? 75.516  -30.499 61.855   1.00 15.70  ? 47   ALA C N     1 
ATOM   3924  C  CA    . ALA C  2  47   ? 75.617  -29.418 60.871   1.00 16.86  ? 47   ALA C CA    1 
ATOM   3925  C  C     . ALA C  2  47   ? 76.726  -29.667 59.850   1.00 18.06  ? 47   ALA C C     1 
ATOM   3926  O  O     . ALA C  2  47   ? 76.516  -29.527 58.639   1.00 21.56  ? 47   ALA C O     1 
ATOM   3927  C  CB    . ALA C  2  47   ? 75.825  -28.086 61.560   1.00 12.08  ? 47   ALA C CB    1 
ATOM   3928  N  N     . PHE C  2  48   ? 77.904  -30.040 60.344   1.00 18.70  ? 48   PHE C N     1 
ATOM   3929  C  CA    . PHE C  2  48   ? 79.047  -30.291 59.467   1.00 17.20  ? 48   PHE C CA    1 
ATOM   3930  C  C     . PHE C  2  48   ? 78.829  -31.515 58.588   1.00 17.50  ? 48   PHE C C     1 
ATOM   3931  O  O     . PHE C  2  48   ? 79.081  -31.477 57.387   1.00 17.49  ? 48   PHE C O     1 
ATOM   3932  C  CB    . PHE C  2  48   ? 80.332  -30.456 60.275   1.00 11.77  ? 48   PHE C CB    1 
ATOM   3933  C  CG    . PHE C  2  48   ? 80.960  -29.161 60.689   1.00 8.15   ? 48   PHE C CG    1 
ATOM   3934  C  CD1   . PHE C  2  48   ? 81.113  -28.850 62.030   1.00 6.54   ? 48   PHE C CD1   1 
ATOM   3935  C  CD2   . PHE C  2  48   ? 81.401  -28.257 59.739   1.00 8.29   ? 48   PHE C CD2   1 
ATOM   3936  C  CE1   . PHE C  2  48   ? 81.695  -27.662 62.416   1.00 6.60   ? 48   PHE C CE1   1 
ATOM   3937  C  CE2   . PHE C  2  48   ? 81.985  -27.063 60.120   1.00 8.10   ? 48   PHE C CE2   1 
ATOM   3938  C  CZ    . PHE C  2  48   ? 82.131  -26.765 61.459   1.00 6.54   ? 48   PHE C CZ    1 
ATOM   3939  N  N     . ARG C  2  49   ? 78.362  -32.600 59.196   1.00 17.29  ? 49   ARG C N     1 
ATOM   3940  C  CA    . ARG C  2  49   ? 78.082  -33.822 58.454   1.00 20.60  ? 49   ARG C CA    1 
ATOM   3941  C  C     . ARG C  2  49   ? 77.029  -33.592 57.374   1.00 28.01  ? 49   ARG C C     1 
ATOM   3942  O  O     . ARG C  2  49   ? 77.053  -34.234 56.323   1.00 43.68  ? 49   ARG C O     1 
ATOM   3943  C  CB    . ARG C  2  49   ? 77.630  -34.937 59.395   1.00 16.72  ? 49   ARG C CB    1 
ATOM   3944  C  CG    . ARG C  2  49   ? 78.732  -35.477 60.285   1.00 22.34  ? 49   ARG C CG    1 
ATOM   3945  C  CD    . ARG C  2  49   ? 79.741  -36.303 59.508   1.00 22.80  ? 49   ARG C CD    1 
ATOM   3946  N  NE    . ARG C  2  49   ? 79.095  -37.419 58.828   1.00 37.05  ? 49   ARG C NE    1 
ATOM   3947  C  CZ    . ARG C  2  49   ? 78.887  -37.476 57.515   1.00 46.97  ? 49   ARG C CZ    1 
ATOM   3948  N  NH1   . ARG C  2  49   ? 79.290  -36.482 56.731   1.00 40.64  ? 49   ARG C NH1   1 
ATOM   3949  N  NH2   . ARG C  2  49   ? 78.283  -38.531 56.984   1.00 46.03  ? 49   ARG C NH2   1 
ATOM   3950  N  N     . GLU C  2  50   ? 76.106  -32.673 57.628   1.00 21.99  ? 50   GLU C N     1 
ATOM   3951  C  CA    . GLU C  2  50   ? 75.078  -32.370 56.643   1.00 24.87  ? 50   GLU C CA    1 
ATOM   3952  C  C     . GLU C  2  50   ? 75.605  -31.488 55.516   1.00 26.72  ? 50   GLU C C     1 
ATOM   3953  O  O     . GLU C  2  50   ? 75.274  -31.704 54.354   1.00 39.59  ? 50   GLU C O     1 
ATOM   3954  C  CB    . GLU C  2  50   ? 73.852  -31.733 57.299   1.00 29.49  ? 50   GLU C CB    1 
ATOM   3955  C  CG    . GLU C  2  50   ? 72.991  -32.714 58.078   1.00 33.85  ? 50   GLU C CG    1 
ATOM   3956  C  CD    . GLU C  2  50   ? 71.771  -32.055 58.689   1.00 49.34  ? 50   GLU C CD    1 
ATOM   3957  O  OE1   . GLU C  2  50   ? 71.220  -32.607 59.670   1.00 46.31  ? 50   GLU C OE1   1 
ATOM   3958  O  OE2   . GLU C  2  50   ? 71.362  -30.986 58.183   1.00 49.93  ? 50   GLU C OE2   1 
ATOM   3959  N  N     . THR C  2  51   ? 76.425  -30.497 55.852   1.00 22.38  ? 51   THR C N     1 
ATOM   3960  C  CA    . THR C  2  51   ? 76.937  -29.586 54.832   1.00 22.00  ? 51   THR C CA    1 
ATOM   3961  C  C     . THR C  2  51   ? 78.029  -30.228 53.962   1.00 27.81  ? 51   THR C C     1 
ATOM   3962  O  O     . THR C  2  51   ? 78.005  -30.113 52.736   1.00 30.07  ? 51   THR C O     1 
ATOM   3963  C  CB    . THR C  2  51   ? 77.441  -28.267 55.453   1.00 23.06  ? 51   THR C CB    1 
ATOM   3964  O  OG1   . THR C  2  51   ? 76.362  -27.621 56.141   1.00 25.47  ? 51   THR C OG1   1 
ATOM   3965  C  CG2   . THR C  2  51   ? 77.962  -27.333 54.383   1.00 18.78  ? 51   THR C CG2   1 
ATOM   3966  N  N     . PHE C  2  52   ? 78.985  -30.898 54.601   1.00 32.79  ? 52   PHE C N     1 
ATOM   3967  C  CA    . PHE C  2  52   ? 80.069  -31.586 53.892   1.00 30.84  ? 52   PHE C CA    1 
ATOM   3968  C  C     . PHE C  2  52   ? 79.736  -33.052 53.590   1.00 35.99  ? 52   PHE C C     1 
ATOM   3969  O  O     . PHE C  2  52   ? 78.952  -33.671 54.313   1.00 30.89  ? 52   PHE C O     1 
ATOM   3970  C  CB    . PHE C  2  52   ? 81.365  -31.494 54.703   1.00 27.12  ? 52   PHE C CB    1 
ATOM   3971  C  CG    . PHE C  2  52   ? 81.874  -30.093 54.872   1.00 21.94  ? 52   PHE C CG    1 
ATOM   3972  C  CD1   . PHE C  2  52   ? 82.801  -29.570 53.990   1.00 22.06  ? 52   PHE C CD1   1 
ATOM   3973  C  CD2   . PHE C  2  52   ? 81.421  -29.298 55.911   1.00 19.54  ? 52   PHE C CD2   1 
ATOM   3974  C  CE1   . PHE C  2  52   ? 83.272  -28.282 54.139   1.00 19.19  ? 52   PHE C CE1   1 
ATOM   3975  C  CE2   . PHE C  2  52   ? 81.886  -28.009 56.066   1.00 20.51  ? 52   PHE C CE2   1 
ATOM   3976  C  CZ    . PHE C  2  52   ? 82.815  -27.499 55.176   1.00 18.05  ? 52   PHE C CZ    1 
ATOM   3977  N  N     . PRO C  2  53   ? 80.355  -33.628 52.539   1.00 39.45  ? 53   PRO C N     1 
ATOM   3978  C  CA    . PRO C  2  53   ? 81.336  -33.046 51.608   1.00 33.12  ? 53   PRO C CA    1 
ATOM   3979  C  C     . PRO C  2  53   ? 80.742  -32.131 50.535   1.00 27.73  ? 53   PRO C C     1 
ATOM   3980  O  O     . PRO C  2  53   ? 79.606  -32.324 50.112   1.00 33.15  ? 53   PRO C O     1 
ATOM   3981  C  CB    . PRO C  2  53   ? 81.952  -34.280 50.952   1.00 29.69  ? 53   PRO C CB    1 
ATOM   3982  C  CG    . PRO C  2  53   ? 80.872  -35.281 50.989   1.00 24.65  ? 53   PRO C CG    1 
ATOM   3983  C  CD    . PRO C  2  53   ? 80.151  -35.064 52.278   1.00 25.50  ? 53   PRO C CD    1 
ATOM   3984  N  N     . ILE C  2  54   ? 81.533  -31.157 50.096   1.00 26.83  ? 54   ILE C N     1 
ATOM   3985  C  CA    . ILE C  2  54   ? 81.127  -30.205 49.065   1.00 36.49  ? 54   ILE C CA    1 
ATOM   3986  C  C     . ILE C  2  54   ? 81.731  -30.597 47.711   1.00 53.15  ? 54   ILE C C     1 
ATOM   3987  O  O     . ILE C  2  54   ? 82.953  -30.579 47.547   1.00 49.57  ? 54   ILE C O     1 
ATOM   3988  C  CB    . ILE C  2  54   ? 81.598  -28.787 49.426   1.00 27.46  ? 54   ILE C CB    1 
ATOM   3989  C  CG1   . ILE C  2  54   ? 81.072  -28.390 50.802   1.00 25.08  ? 54   ILE C CG1   1 
ATOM   3990  C  CG2   . ILE C  2  54   ? 81.162  -27.787 48.371   1.00 39.10  ? 54   ILE C CG2   1 
ATOM   3991  C  CD1   . ILE C  2  54   ? 81.544  -27.032 51.254   1.00 26.71  ? 54   ILE C CD1   1 
ATOM   3992  N  N     . GLU C  2  55   ? 80.882  -30.919 46.736   1.00 57.47  ? 55   GLU C N     1 
ATOM   3993  C  CA    . GLU C  2  55   ? 81.357  -31.543 45.498   1.00 49.04  ? 55   GLU C CA    1 
ATOM   3994  C  C     . GLU C  2  55   ? 81.242  -30.680 44.234   1.00 54.93  ? 55   GLU C C     1 
ATOM   3995  O  O     . GLU C  2  55   ? 80.738  -29.556 44.275   1.00 56.99  ? 55   GLU C O     1 
ATOM   3996  C  CB    . GLU C  2  55   ? 80.645  -32.882 45.282   1.00 45.06  ? 55   GLU C CB    1 
ATOM   3997  C  CG    . GLU C  2  55   ? 80.664  -33.791 46.500   1.00 41.74  ? 55   GLU C CG    1 
ATOM   3998  C  CD    . GLU C  2  55   ? 80.613  -35.267 46.135   1.00 61.95  ? 55   GLU C CD    1 
ATOM   3999  O  OE1   . GLU C  2  55   ? 80.263  -36.085 47.015   1.00 53.09  ? 55   GLU C OE1   1 
ATOM   4000  O  OE2   . GLU C  2  55   ? 80.933  -35.611 44.975   1.00 61.45  ? 55   GLU C OE2   1 
ATOM   4001  N  N     . GLU C  2  56   ? 81.713  -31.237 43.117   1.00 62.31  ? 56   GLU C N     1 
ATOM   4002  C  CA    . GLU C  2  56   ? 81.757  -30.552 41.821   1.00 63.92  ? 56   GLU C CA    1 
ATOM   4003  C  C     . GLU C  2  56   ? 82.493  -29.214 41.861   1.00 62.98  ? 56   GLU C C     1 
ATOM   4004  O  O     . GLU C  2  56   ? 81.872  -28.149 41.838   1.00 57.87  ? 56   GLU C O     1 
ATOM   4005  C  CB    . GLU C  2  56   ? 80.352  -30.374 41.237   1.00 67.65  ? 56   GLU C CB    1 
ATOM   4006  C  CG    . GLU C  2  56   ? 79.879  -31.550 40.400   1.00 71.56  ? 56   GLU C CG    1 
ATOM   4007  C  CD    . GLU C  2  56   ? 78.558  -31.273 39.712   1.00 83.37  ? 56   GLU C CD    1 
ATOM   4008  O  OE1   . GLU C  2  56   ? 78.520  -31.290 38.462   1.00 76.55  ? 56   GLU C OE1   1 
ATOM   4009  O  OE2   . GLU C  2  56   ? 77.558  -31.038 40.422   1.00 86.63  ? 56   GLU C OE2   1 
ATOM   4010  N  N     . GLY C  2  63   ? 89.875  -26.912 43.303   1.00 33.21  ? 63   GLY C N     1 
ATOM   4011  C  CA    . GLY C  2  63   ? 89.743  -28.262 43.814   1.00 40.97  ? 63   GLY C CA    1 
ATOM   4012  C  C     . GLY C  2  63   ? 88.460  -28.927 43.355   1.00 51.12  ? 63   GLY C C     1 
ATOM   4013  O  O     . GLY C  2  63   ? 87.586  -28.273 42.786   1.00 52.75  ? 63   GLY C O     1 
ATOM   4014  N  N     . LEU C  2  64   ? 88.342  -30.227 43.606   1.00 48.94  ? 64   LEU C N     1 
ATOM   4015  C  CA    . LEU C  2  64   ? 87.159  -30.979 43.200   1.00 53.85  ? 64   LEU C CA    1 
ATOM   4016  C  C     . LEU C  2  64   ? 86.220  -31.239 44.382   1.00 53.87  ? 64   LEU C C     1 
ATOM   4017  O  O     . LEU C  2  64   ? 85.081  -30.771 44.392   1.00 63.90  ? 64   LEU C O     1 
ATOM   4018  C  CB    . LEU C  2  64   ? 87.557  -32.297 42.525   1.00 59.84  ? 64   LEU C CB    1 
ATOM   4019  C  CG    . LEU C  2  64   ? 86.518  -32.922 41.590   1.00 52.71  ? 64   LEU C CG    1 
ATOM   4020  C  CD1   . LEU C  2  64   ? 86.283  -32.017 40.386   1.00 48.56  ? 64   LEU C CD1   1 
ATOM   4021  C  CD2   . LEU C  2  64   ? 86.956  -34.306 41.145   1.00 49.54  ? 64   LEU C CD2   1 
ATOM   4022  N  N     . VAL C  2  65   ? 86.699  -31.990 45.369   1.00 42.99  ? 65   VAL C N     1 
ATOM   4023  C  CA    . VAL C  2  65   ? 85.893  -32.341 46.535   1.00 36.55  ? 65   VAL C CA    1 
ATOM   4024  C  C     . VAL C  2  65   ? 86.507  -31.829 47.839   1.00 42.91  ? 65   VAL C C     1 
ATOM   4025  O  O     . VAL C  2  65   ? 87.677  -32.085 48.128   1.00 45.47  ? 65   VAL C O     1 
ATOM   4026  C  CB    . VAL C  2  65   ? 85.678  -33.868 46.623   1.00 33.53  ? 65   VAL C CB    1 
ATOM   4027  C  CG1   . VAL C  2  65   ? 85.252  -34.282 48.027   1.00 35.32  ? 65   VAL C CG1   1 
ATOM   4028  C  CG2   . VAL C  2  65   ? 84.660  -34.319 45.591   1.00 37.17  ? 65   VAL C CG2   1 
ATOM   4029  N  N     . LEU C  2  66   ? 85.709  -31.101 48.619   1.00 47.03  ? 66   LEU C N     1 
ATOM   4030  C  CA    . LEU C  2  66   ? 86.129  -30.607 49.932   1.00 37.68  ? 66   LEU C CA    1 
ATOM   4031  C  C     . LEU C  2  66   ? 85.410  -31.363 51.037   1.00 27.99  ? 66   LEU C C     1 
ATOM   4032  O  O     . LEU C  2  66   ? 84.185  -31.354 51.104   1.00 34.55  ? 66   LEU C O     1 
ATOM   4033  C  CB    . LEU C  2  66   ? 85.841  -29.112 50.061   1.00 30.33  ? 66   LEU C CB    1 
ATOM   4034  C  CG    . LEU C  2  66   ? 86.258  -28.467 51.380   1.00 25.20  ? 66   LEU C CG    1 
ATOM   4035  C  CD1   . LEU C  2  66   ? 87.649  -28.937 51.779   1.00 31.42  ? 66   LEU C CD1   1 
ATOM   4036  C  CD2   . LEU C  2  66   ? 86.215  -26.946 51.264   1.00 19.16  ? 66   LEU C CD2   1 
ATOM   4037  N  N     . ASP C  2  67   ? 86.167  -32.008 51.913   1.00 28.78  ? 67   ASP C N     1 
ATOM   4038  C  CA    . ASP C  2  67   ? 85.554  -32.871 52.917   1.00 32.26  ? 67   ASP C CA    1 
ATOM   4039  C  C     . ASP C  2  67   ? 85.832  -32.401 54.343   1.00 30.70  ? 67   ASP C C     1 
ATOM   4040  O  O     . ASP C  2  67   ? 86.772  -31.650 54.588   1.00 33.49  ? 67   ASP C O     1 
ATOM   4041  C  CB    . ASP C  2  67   ? 86.004  -34.321 52.730   1.00 33.74  ? 67   ASP C CB    1 
ATOM   4042  C  CG    . ASP C  2  67   ? 85.078  -35.309 53.418   1.00 52.95  ? 67   ASP C CG    1 
ATOM   4043  O  OD1   . ASP C  2  67   ? 83.873  -34.998 53.562   1.00 47.78  ? 67   ASP C OD1   1 
ATOM   4044  O  OD2   . ASP C  2  67   ? 85.554  -36.395 53.814   1.00 66.47  ? 67   ASP C OD2   1 
ATOM   4045  N  N     . PHE C  2  68   ? 84.992  -32.836 55.275   1.00 25.05  ? 68   PHE C N     1 
ATOM   4046  C  CA    . PHE C  2  68   ? 85.118  -32.446 56.671   1.00 20.81  ? 68   PHE C CA    1 
ATOM   4047  C  C     . PHE C  2  68   ? 85.537  -33.644 57.503   1.00 18.97  ? 68   PHE C C     1 
ATOM   4048  O  O     . PHE C  2  68   ? 84.969  -34.726 57.365   1.00 17.84  ? 68   PHE C O     1 
ATOM   4049  C  CB    . PHE C  2  68   ? 83.789  -31.880 57.180   1.00 20.19  ? 68   PHE C CB    1 
ATOM   4050  C  CG    . PHE C  2  68   ? 83.588  -32.019 58.666   1.00 15.50  ? 68   PHE C CG    1 
ATOM   4051  C  CD1   . PHE C  2  68   ? 84.140  -31.100 59.542   1.00 11.07  ? 68   PHE C CD1   1 
ATOM   4052  C  CD2   . PHE C  2  68   ? 82.832  -33.061 59.182   1.00 11.79  ? 68   PHE C CD2   1 
ATOM   4053  C  CE1   . PHE C  2  68   ? 83.953  -31.226 60.899   1.00 9.66   ? 68   PHE C CE1   1 
ATOM   4054  C  CE2   . PHE C  2  68   ? 82.642  -33.190 60.538   1.00 9.79   ? 68   PHE C CE2   1 
ATOM   4055  C  CZ    . PHE C  2  68   ? 83.201  -32.274 61.400   1.00 9.97   ? 68   PHE C CZ    1 
ATOM   4056  N  N     . LEU C  2  69   ? 86.527  -33.448 58.368   1.00 14.20  ? 69   LEU C N     1 
ATOM   4057  C  CA    . LEU C  2  69   ? 87.030  -34.532 59.202   1.00 14.14  ? 69   LEU C CA    1 
ATOM   4058  C  C     . LEU C  2  69   ? 86.497  -34.448 60.626   1.00 12.25  ? 69   LEU C C     1 
ATOM   4059  O  O     . LEU C  2  69   ? 85.819  -35.357 61.108   1.00 9.64   ? 69   LEU C O     1 
ATOM   4060  C  CB    . LEU C  2  69   ? 88.560  -34.536 59.211   1.00 18.61  ? 69   LEU C CB    1 
ATOM   4061  C  CG    . LEU C  2  69   ? 89.244  -34.757 57.861   1.00 21.37  ? 69   LEU C CG    1 
ATOM   4062  C  CD1   . LEU C  2  69   ? 90.748  -34.879 58.037   1.00 24.33  ? 69   LEU C CD1   1 
ATOM   4063  C  CD2   . LEU C  2  69   ? 88.672  -35.980 57.156   1.00 20.99  ? 69   LEU C CD2   1 
ATOM   4064  N  N     . GLU C  2  70   ? 86.847  -33.360 61.301   1.00 12.75  ? 70   GLU C N     1 
ATOM   4065  C  CA    . GLU C  2  70   ? 86.456  -33.129 62.684   1.00 12.58  ? 70   GLU C CA    1 
ATOM   4066  C  C     . GLU C  2  70   ? 86.517  -31.631 62.948   1.00 12.95  ? 70   GLU C C     1 
ATOM   4067  O  O     . GLU C  2  70   ? 87.112  -30.898 62.161   1.00 17.31  ? 70   GLU C O     1 
ATOM   4068  C  CB    . GLU C  2  70   ? 87.414  -33.857 63.621   1.00 13.57  ? 70   GLU C CB    1 
ATOM   4069  C  CG    . GLU C  2  70   ? 88.867  -33.459 63.435   1.00 16.81  ? 70   GLU C CG    1 
ATOM   4070  C  CD    . GLU C  2  70   ? 89.798  -34.183 64.390   1.00 33.67  ? 70   GLU C CD    1 
ATOM   4071  O  OE1   . GLU C  2  70   ? 90.866  -33.626 64.728   1.00 38.47  ? 70   GLU C OE1   1 
ATOM   4072  O  OE2   . GLU C  2  70   ? 89.465  -35.314 64.800   1.00 37.41  ? 70   GLU C OE2   1 
ATOM   4073  N  N     . TYR C  2  71   ? 85.897  -31.161 64.028   1.00 8.86   ? 71   TYR C N     1 
ATOM   4074  C  CA    . TYR C  2  71   ? 86.099  -29.770 64.436   1.00 7.92   ? 71   TYR C CA    1 
ATOM   4075  C  C     . TYR C  2  71   ? 86.687  -29.730 65.836   1.00 7.70   ? 71   TYR C C     1 
ATOM   4076  O  O     . TYR C  2  71   ? 86.836  -30.767 66.490   1.00 6.55   ? 71   TYR C O     1 
ATOM   4077  C  CB    . TYR C  2  71   ? 84.794  -28.959 64.391   1.00 5.81   ? 71   TYR C CB    1 
ATOM   4078  C  CG    . TYR C  2  71   ? 83.767  -29.371 65.426   1.00 5.61   ? 71   TYR C CG    1 
ATOM   4079  C  CD1   . TYR C  2  71   ? 83.832  -28.901 66.732   1.00 5.03   ? 71   TYR C CD1   1 
ATOM   4080  C  CD2   . TYR C  2  71   ? 82.728  -30.227 65.095   1.00 6.60   ? 71   TYR C CD2   1 
ATOM   4081  C  CE1   . TYR C  2  71   ? 82.905  -29.284 67.680   1.00 4.78   ? 71   TYR C CE1   1 
ATOM   4082  C  CE2   . TYR C  2  71   ? 81.793  -30.608 66.037   1.00 6.80   ? 71   TYR C CE2   1 
ATOM   4083  C  CZ    . TYR C  2  71   ? 81.888  -30.134 67.327   1.00 5.10   ? 71   TYR C CZ    1 
ATOM   4084  O  OH    . TYR C  2  71   ? 80.956  -30.511 68.264   1.00 5.42   ? 71   TYR C OH    1 
ATOM   4085  N  N     . ARG C  2  72   ? 87.004  -28.529 66.305   1.00 5.82   ? 72   ARG C N     1 
ATOM   4086  C  CA    . ARG C  2  72   ? 87.333  -28.358 67.711   1.00 6.96   ? 72   ARG C CA    1 
ATOM   4087  C  C     . ARG C  2  72   ? 87.038  -26.948 68.188   1.00 5.14   ? 72   ARG C C     1 
ATOM   4088  O  O     . ARG C  2  72   ? 87.062  -25.991 67.410   1.00 4.93   ? 72   ARG C O     1 
ATOM   4089  C  CB    . ARG C  2  72   ? 88.792  -28.728 68.002   1.00 6.76   ? 72   ARG C CB    1 
ATOM   4090  C  CG    . ARG C  2  72   ? 89.801  -27.788 67.406   1.00 4.09   ? 72   ARG C CG    1 
ATOM   4091  C  CD    . ARG C  2  72   ? 91.170  -27.940 68.040   1.00 2.05   ? 72   ARG C CD    1 
ATOM   4092  N  NE    . ARG C  2  72   ? 92.130  -27.112 67.323   1.00 3.95   ? 72   ARG C NE    1 
ATOM   4093  C  CZ    . ARG C  2  72   ? 92.524  -25.911 67.727   1.00 4.38   ? 72   ARG C CZ    1 
ATOM   4094  N  NH1   . ARG C  2  72   ? 92.067  -25.419 68.865   1.00 5.95   ? 72   ARG C NH1   1 
ATOM   4095  N  NH2   . ARG C  2  72   ? 93.386  -25.209 67.004   1.00 5.38   ? 72   ARG C NH2   1 
ATOM   4096  N  N     . LEU C  2  73   ? 86.761  -26.837 69.478   1.00 3.36   ? 73   LEU C N     1 
ATOM   4097  C  CA    . LEU C  2  73   ? 86.538  -25.551 70.102   1.00 4.51   ? 73   LEU C CA    1 
ATOM   4098  C  C     . LEU C  2  73   ? 87.717  -25.229 71.013   1.00 6.28   ? 73   LEU C C     1 
ATOM   4099  O  O     . LEU C  2  73   ? 88.049  -26.007 71.908   1.00 9.23   ? 73   LEU C O     1 
ATOM   4100  C  CB    . LEU C  2  73   ? 85.226  -25.563 70.896   1.00 6.86   ? 73   LEU C CB    1 
ATOM   4101  C  CG    . LEU C  2  73   ? 83.921  -25.640 70.092   1.00 4.60   ? 73   LEU C CG    1 
ATOM   4102  C  CD1   . LEU C  2  73   ? 82.751  -26.104 70.960   1.00 3.28   ? 73   LEU C CD1   1 
ATOM   4103  C  CD2   . LEU C  2  73   ? 83.615  -24.302 69.453   1.00 3.33   ? 73   LEU C CD2   1 
ATOM   4104  N  N     . GLY C  2  74   ? 88.349  -24.083 70.779   1.00 4.83   ? 74   GLY C N     1 
ATOM   4105  C  CA    . GLY C  2  74   ? 89.444  -23.637 71.619   1.00 6.68   ? 74   GLY C CA    1 
ATOM   4106  C  C     . GLY C  2  74   ? 88.982  -23.100 72.964   1.00 7.83   ? 74   GLY C C     1 
ATOM   4107  O  O     . GLY C  2  74   ? 87.828  -23.270 73.352   1.00 6.80   ? 74   GLY C O     1 
ATOM   4108  N  N     . GLU C  2  75   ? 89.896  -22.461 73.687   1.00 9.51   ? 75   GLU C N     1 
ATOM   4109  C  CA    . GLU C  2  75   ? 89.566  -21.830 74.958   1.00 9.40   ? 75   GLU C CA    1 
ATOM   4110  C  C     . GLU C  2  75   ? 89.108  -20.388 74.743   1.00 10.79  ? 75   GLU C C     1 
ATOM   4111  O  O     . GLU C  2  75   ? 89.542  -19.730 73.792   1.00 10.96  ? 75   GLU C O     1 
ATOM   4112  C  CB    . GLU C  2  75   ? 90.773  -21.862 75.894   1.00 10.26  ? 75   GLU C CB    1 
ATOM   4113  C  CG    . GLU C  2  75   ? 91.127  -23.244 76.400   1.00 15.37  ? 75   GLU C CG    1 
ATOM   4114  C  CD    . GLU C  2  75   ? 90.162  -23.747 77.456   1.00 27.60  ? 75   GLU C CD    1 
ATOM   4115  O  OE1   . GLU C  2  75   ? 89.322  -24.616 77.128   1.00 36.85  ? 75   GLU C OE1   1 
ATOM   4116  O  OE2   . GLU C  2  75   ? 90.250  -23.276 78.615   1.00 28.35  ? 75   GLU C OE2   1 
ATOM   4117  N  N     . PRO C  2  76   ? 88.220  -19.892 75.620   1.00 9.55   ? 76   PRO C N     1 
ATOM   4118  C  CA    . PRO C  2  76   ? 87.783  -18.498 75.503   1.00 8.97   ? 76   PRO C CA    1 
ATOM   4119  C  C     . PRO C  2  76   ? 88.959  -17.548 75.677   1.00 10.22  ? 76   PRO C C     1 
ATOM   4120  O  O     . PRO C  2  76   ? 89.673  -17.666 76.671   1.00 10.47  ? 76   PRO C O     1 
ATOM   4121  C  CB    . PRO C  2  76   ? 86.816  -18.337 76.675   1.00 8.21   ? 76   PRO C CB    1 
ATOM   4122  C  CG    . PRO C  2  76   ? 86.389  -19.709 77.015   1.00 6.45   ? 76   PRO C CG    1 
ATOM   4123  C  CD    . PRO C  2  76   ? 87.536  -20.601 76.712   1.00 7.28   ? 76   PRO C CD    1 
ATOM   4124  N  N     . PRO C  2  77   ? 89.151  -16.619 74.725   1.00 10.25  ? 77   PRO C N     1 
ATOM   4125  C  CA    . PRO C  2  77   ? 90.239  -15.636 74.742   1.00 10.63  ? 77   PRO C CA    1 
ATOM   4126  C  C     . PRO C  2  77   ? 90.182  -14.692 75.939   1.00 12.34  ? 77   PRO C C     1 
ATOM   4127  O  O     . PRO C  2  77   ? 91.220  -14.170 76.356   1.00 12.11  ? 77   PRO C O     1 
ATOM   4128  C  CB    . PRO C  2  77   ? 90.031  -14.854 73.436   1.00 9.34   ? 77   PRO C CB    1 
ATOM   4129  C  CG    . PRO C  2  77   ? 88.655  -15.176 72.994   1.00 10.66  ? 77   PRO C CG    1 
ATOM   4130  C  CD    . PRO C  2  77   ? 88.402  -16.568 73.462   1.00 9.15   ? 77   PRO C CD    1 
ATOM   4131  N  N     . PHE C  2  78   ? 88.986  -14.466 76.471   1.00 12.96  ? 78   PHE C N     1 
ATOM   4132  C  CA    . PHE C  2  78   ? 88.826  -13.628 77.655   1.00 13.09  ? 78   PHE C CA    1 
ATOM   4133  C  C     . PHE C  2  78   ? 87.812  -14.251 78.595   1.00 15.92  ? 78   PHE C C     1 
ATOM   4134  O  O     . PHE C  2  78   ? 86.842  -14.858 78.140   1.00 17.65  ? 78   PHE C O     1 
ATOM   4135  C  CB    . PHE C  2  78   ? 88.383  -12.224 77.256   1.00 14.24  ? 78   PHE C CB    1 
ATOM   4136  C  CG    . PHE C  2  78   ? 89.264  -11.592 76.227   1.00 15.45  ? 78   PHE C CG    1 
ATOM   4137  C  CD1   . PHE C  2  78   ? 89.016  -11.778 74.879   1.00 13.31  ? 78   PHE C CD1   1 
ATOM   4138  C  CD2   . PHE C  2  78   ? 90.354  -10.832 76.605   1.00 16.00  ? 78   PHE C CD2   1 
ATOM   4139  C  CE1   . PHE C  2  78   ? 89.833  -11.210 73.930   1.00 14.07  ? 78   PHE C CE1   1 
ATOM   4140  C  CE2   . PHE C  2  78   ? 91.170  -10.261 75.662   1.00 14.93  ? 78   PHE C CE2   1 
ATOM   4141  C  CZ    . PHE C  2  78   ? 90.911  -10.450 74.321   1.00 15.28  ? 78   PHE C CZ    1 
ATOM   4142  N  N     . PRO C  2  79   ? 88.033  -14.113 79.913   1.00 19.19  ? 79   PRO C N     1 
ATOM   4143  C  CA    . PRO C  2  79   ? 87.070  -14.642 80.885   1.00 16.76  ? 79   PRO C CA    1 
ATOM   4144  C  C     . PRO C  2  79   ? 85.782  -13.818 80.891   1.00 18.15  ? 79   PRO C C     1 
ATOM   4145  O  O     . PRO C  2  79   ? 85.702  -12.798 80.200   1.00 17.15  ? 79   PRO C O     1 
ATOM   4146  C  CB    . PRO C  2  79   ? 87.813  -14.512 82.216   1.00 14.88  ? 79   PRO C CB    1 
ATOM   4147  C  CG    . PRO C  2  79   ? 88.779  -13.398 82.003   1.00 16.14  ? 79   PRO C CG    1 
ATOM   4148  C  CD    . PRO C  2  79   ? 89.182  -13.457 80.562   1.00 18.80  ? 79   PRO C CD    1 
ATOM   4149  N  N     . GLN C  2  80   ? 84.794  -14.240 81.674   1.00 17.73  ? 80   GLN C N     1 
ATOM   4150  C  CA    . GLN C  2  80   ? 83.467  -13.632 81.605   1.00 16.73  ? 80   GLN C CA    1 
ATOM   4151  C  C     . GLN C  2  80   ? 83.431  -12.184 82.091   1.00 20.30  ? 80   GLN C C     1 
ATOM   4152  O  O     . GLN C  2  80   ? 82.924  -11.302 81.395   1.00 20.61  ? 80   GLN C O     1 
ATOM   4153  C  CB    . GLN C  2  80   ? 82.454  -14.470 82.379   1.00 11.94  ? 80   GLN C CB    1 
ATOM   4154  C  CG    . GLN C  2  80   ? 82.284  -15.871 81.845   1.00 9.60   ? 80   GLN C CG    1 
ATOM   4155  C  CD    . GLN C  2  80   ? 81.488  -16.749 82.791   1.00 15.09  ? 80   GLN C CD    1 
ATOM   4156  O  OE1   . GLN C  2  80   ? 80.839  -16.256 83.723   1.00 11.96  ? 80   GLN C OE1   1 
ATOM   4157  N  NE2   . GLN C  2  80   ? 81.541  -18.060 82.565   1.00 13.87  ? 80   GLN C NE2   1 
ATOM   4158  N  N     . ASP C  2  81   ? 83.960  -11.946 83.287   1.00 27.40  ? 81   ASP C N     1 
ATOM   4159  C  CA    . ASP C  2  81   ? 83.960  -10.606 83.862   1.00 27.34  ? 81   ASP C CA    1 
ATOM   4160  C  C     . ASP C  2  81   ? 84.650  -9.632  82.917   1.00 22.41  ? 81   ASP C C     1 
ATOM   4161  O  O     . ASP C  2  81   ? 84.182  -8.513  82.699   1.00 25.16  ? 81   ASP C O     1 
ATOM   4162  C  CB    . ASP C  2  81   ? 84.617  -10.606 85.246   1.00 42.98  ? 81   ASP C CB    1 
ATOM   4163  C  CG    . ASP C  2  81   ? 83.715  -11.213 86.327   1.00 67.76  ? 81   ASP C CG    1 
ATOM   4164  O  OD1   . ASP C  2  81   ? 82.471  -11.089 86.224   1.00 53.64  ? 81   ASP C OD1   1 
ATOM   4165  O  OD2   . ASP C  2  81   ? 84.250  -11.810 87.287   1.00 75.38  ? 81   ASP C OD2   1 
ATOM   4166  N  N     . GLU C  2  82   ? 85.746  -10.083 82.326   1.00 24.62  ? 82   GLU C N     1 
ATOM   4167  C  CA    . GLU C  2  82   ? 86.455  -9.276  81.347   1.00 28.73  ? 82   GLU C CA    1 
ATOM   4168  C  C     . GLU C  2  82   ? 85.589  -9.001  80.116   1.00 25.96  ? 82   GLU C C     1 
ATOM   4169  O  O     . GLU C  2  82   ? 85.635  -7.909  79.554   1.00 26.60  ? 82   GLU C O     1 
ATOM   4170  C  CB    . GLU C  2  82   ? 87.767  -9.951  80.946   1.00 25.81  ? 82   GLU C CB    1 
ATOM   4171  C  CG    . GLU C  2  82   ? 88.623  -9.115  80.012   1.00 34.75  ? 82   GLU C CG    1 
ATOM   4172  C  CD    . GLU C  2  82   ? 90.092  -9.470  80.102   1.00 45.39  ? 82   GLU C CD    1 
ATOM   4173  O  OE1   . GLU C  2  82   ? 90.484  -10.131 81.093   1.00 44.66  ? 82   GLU C OE1   1 
ATOM   4174  O  OE2   . GLU C  2  82   ? 90.852  -9.088  79.184   1.00 44.75  ? 82   GLU C OE2   1 
ATOM   4175  N  N     . CYS C  2  83   ? 84.796  -9.990  79.710   1.00 29.41  ? 83   CYS C N     1 
ATOM   4176  C  CA    . CYS C  2  83   ? 83.913  -9.851  78.549   1.00 25.39  ? 83   CYS C CA    1 
ATOM   4177  C  C     . CYS C  2  83   ? 82.839  -8.812  78.793   1.00 21.52  ? 83   CYS C C     1 
ATOM   4178  O  O     . CYS C  2  83   ? 82.494  -8.051  77.893   1.00 20.25  ? 83   CYS C O     1 
ATOM   4179  C  CB    . CYS C  2  83   ? 83.243  -11.182 78.201   1.00 19.83  ? 83   CYS C CB    1 
ATOM   4180  S  SG    . CYS C  2  83   ? 84.242  -12.281 77.198   1.00 19.33  ? 83   CYS C SG    1 
ATOM   4181  N  N     . ARG C  2  84   ? 82.303  -8.802  80.010   1.00 25.81  ? 84   ARG C N     1 
ATOM   4182  C  CA    . ARG C  2  84   ? 81.291  -7.825  80.396   1.00 26.50  ? 84   ARG C CA    1 
ATOM   4183  C  C     . ARG C  2  84   ? 81.902  -6.425  80.490   1.00 26.67  ? 84   ARG C C     1 
ATOM   4184  O  O     . ARG C  2  84   ? 81.298  -5.437  80.063   1.00 24.29  ? 84   ARG C O     1 
ATOM   4185  C  CB    . ARG C  2  84   ? 80.637  -8.225  81.721   1.00 19.21  ? 84   ARG C CB    1 
ATOM   4186  C  CG    . ARG C  2  84   ? 79.861  -9.534  81.656   1.00 14.31  ? 84   ARG C CG    1 
ATOM   4187  C  CD    . ARG C  2  84   ? 79.032  -9.740  82.909   1.00 12.46  ? 84   ARG C CD    1 
ATOM   4188  N  NE    . ARG C  2  84   ? 78.254  -10.977 82.883   1.00 12.49  ? 84   ARG C NE    1 
ATOM   4189  C  CZ    . ARG C  2  84   ? 78.592  -12.084 83.539   1.00 15.38  ? 84   ARG C CZ    1 
ATOM   4190  N  NH1   . ARG C  2  84   ? 79.698  -12.107 84.273   1.00 15.70  ? 84   ARG C NH1   1 
ATOM   4191  N  NH2   . ARG C  2  84   ? 77.827  -13.166 83.468   1.00 12.91  ? 84   ARG C NH2   1 
ATOM   4192  N  N     . GLU C  2  85   ? 83.109  -6.356  81.039   1.00 24.82  ? 85   GLU C N     1 
ATOM   4193  C  CA    . GLU C  2  85   ? 83.845  -5.105  81.126   1.00 25.76  ? 85   GLU C CA    1 
ATOM   4194  C  C     . GLU C  2  85   ? 84.003  -4.432  79.767   1.00 31.58  ? 85   GLU C C     1 
ATOM   4195  O  O     . GLU C  2  85   ? 83.590  -3.291  79.571   1.00 40.47  ? 85   GLU C O     1 
ATOM   4196  C  CB    . GLU C  2  85   ? 85.229  -5.367  81.720   1.00 30.02  ? 85   GLU C CB    1 
ATOM   4197  C  CG    . GLU C  2  85   ? 85.297  -5.185  83.219   1.00 39.54  ? 85   GLU C CG    1 
ATOM   4198  C  CD    . GLU C  2  85   ? 85.077  -3.739  83.619   1.00 55.16  ? 85   GLU C CD    1 
ATOM   4199  O  OE1   . GLU C  2  85   ? 84.505  -3.496  84.705   1.00 47.43  ? 85   GLU C OE1   1 
ATOM   4200  O  OE2   . GLU C  2  85   ? 85.478  -2.843  82.842   1.00 57.25  ? 85   GLU C OE2   1 
ATOM   4201  N  N     . LYS C  2  86   ? 84.582  -5.163  78.824   1.00 30.40  ? 86   LYS C N     1 
ATOM   4202  C  CA    . LYS C  2  86   ? 85.035  -4.595  77.560   1.00 30.60  ? 86   LYS C CA    1 
ATOM   4203  C  C     . LYS C  2  86   ? 83.993  -4.664  76.444   1.00 27.95  ? 86   LYS C C     1 
ATOM   4204  O  O     . LYS C  2  86   ? 84.302  -4.380  75.283   1.00 27.96  ? 86   LYS C O     1 
ATOM   4205  C  CB    . LYS C  2  86   ? 86.338  -5.265  77.112   1.00 29.79  ? 86   LYS C CB    1 
ATOM   4206  C  CG    . LYS C  2  86   ? 87.477  -5.163  78.124   1.00 31.60  ? 86   LYS C CG    1 
ATOM   4207  C  CD    . LYS C  2  86   ? 88.775  -5.695  77.533   1.00 43.20  ? 86   LYS C CD    1 
ATOM   4208  C  CE    . LYS C  2  86   ? 89.959  -5.459  78.455   1.00 44.27  ? 86   LYS C CE    1 
ATOM   4209  N  NZ    . LYS C  2  86   ? 91.242  -5.837  77.790   1.00 54.93  ? 86   LYS C NZ    1 
ATOM   4210  N  N     . ASP C  2  87   ? 82.777  -5.077  76.795   1.00 23.99  ? 87   ASP C N     1 
ATOM   4211  C  CA    . ASP C  2  87   ? 81.692  -5.231  75.821   1.00 26.42  ? 87   ASP C CA    1 
ATOM   4212  C  C     . ASP C  2  87   ? 82.040  -6.264  74.746   1.00 20.99  ? 87   ASP C C     1 
ATOM   4213  O  O     . ASP C  2  87   ? 81.800  -6.053  73.553   1.00 19.87  ? 87   ASP C O     1 
ATOM   4214  C  CB    . ASP C  2  87   ? 81.294  -3.883  75.191   1.00 38.16  ? 87   ASP C CB    1 
ATOM   4215  C  CG    . ASP C  2  87   ? 80.252  -3.125  76.017   1.00 48.61  ? 87   ASP C CG    1 
ATOM   4216  O  OD1   . ASP C  2  87   ? 80.433  -2.985  77.250   1.00 47.43  ? 87   ASP C OD1   1 
ATOM   4217  O  OD2   . ASP C  2  87   ? 79.243  -2.675  75.426   1.00 48.65  ? 87   ASP C OD2   1 
ATOM   4218  N  N     . LEU C  2  88   ? 82.611  -7.382  75.186   1.00 24.32  ? 88   LEU C N     1 
ATOM   4219  C  CA    . LEU C  2  88   ? 82.977  -8.475  74.292   1.00 20.42  ? 88   LEU C CA    1 
ATOM   4220  C  C     . LEU C  2  88   ? 81.956  -9.597  74.362   1.00 16.13  ? 88   LEU C C     1 
ATOM   4221  O  O     . LEU C  2  88   ? 81.029  -9.559  75.167   1.00 15.95  ? 88   LEU C O     1 
ATOM   4222  C  CB    . LEU C  2  88   ? 84.346  -9.026  74.677   1.00 14.61  ? 88   LEU C CB    1 
ATOM   4223  C  CG    . LEU C  2  88   ? 85.490  -8.033  74.522   1.00 16.12  ? 88   LEU C CG    1 
ATOM   4224  C  CD1   . LEU C  2  88   ? 86.743  -8.557  75.205   1.00 19.14  ? 88   LEU C CD1   1 
ATOM   4225  C  CD2   . LEU C  2  88   ? 85.733  -7.774  73.043   1.00 18.49  ? 88   LEU C CD2   1 
ATOM   4226  N  N     . THR C  2  89   ? 82.145  -10.612 73.531   1.00 12.00  ? 89   THR C N     1 
ATOM   4227  C  CA    . THR C  2  89   ? 81.274  -11.772 73.562   1.00 9.37   ? 89   THR C CA    1 
ATOM   4228  C  C     . THR C  2  89   ? 82.019  -12.951 74.168   1.00 7.33   ? 89   THR C C     1 
ATOM   4229  O  O     . THR C  2  89   ? 83.157  -13.227 73.793   1.00 6.77   ? 89   THR C O     1 
ATOM   4230  C  CB    . THR C  2  89   ? 80.763  -12.121 72.158   1.00 10.70  ? 89   THR C CB    1 
ATOM   4231  O  OG1   . THR C  2  89   ? 79.869  -11.089 71.714   1.00 12.70  ? 89   THR C OG1   1 
ATOM   4232  C  CG2   . THR C  2  89   ? 80.030  -13.466 72.160   1.00 6.92   ? 89   THR C CG2   1 
ATOM   4233  N  N     . TYR C  2  90   ? 81.389  -13.631 75.121   1.00 7.68   ? 90   TYR C N     1 
ATOM   4234  C  CA    . TYR C  2  90   ? 82.022  -14.790 75.724   1.00 7.28   ? 90   TYR C CA    1 
ATOM   4235  C  C     . TYR C  2  90   ? 81.840  -15.944 74.754   1.00 4.71   ? 90   TYR C C     1 
ATOM   4236  O  O     . TYR C  2  90   ? 80.729  -16.402 74.509   1.00 4.35   ? 90   TYR C O     1 
ATOM   4237  C  CB    . TYR C  2  90   ? 81.391  -15.099 77.082   1.00 7.20   ? 90   TYR C CB    1 
ATOM   4238  C  CG    . TYR C  2  90   ? 82.074  -16.217 77.844   1.00 8.84   ? 90   TYR C CG    1 
ATOM   4239  C  CD1   . TYR C  2  90   ? 83.410  -16.122 78.209   1.00 9.50   ? 90   TYR C CD1   1 
ATOM   4240  C  CD2   . TYR C  2  90   ? 81.376  -17.359 78.209   1.00 6.38   ? 90   TYR C CD2   1 
ATOM   4241  C  CE1   . TYR C  2  90   ? 84.035  -17.138 78.904   1.00 8.74   ? 90   TYR C CE1   1 
ATOM   4242  C  CE2   . TYR C  2  90   ? 81.988  -18.374 78.904   1.00 7.51   ? 90   TYR C CE2   1 
ATOM   4243  C  CZ    . TYR C  2  90   ? 83.319  -18.261 79.250   1.00 9.82   ? 90   TYR C CZ    1 
ATOM   4244  O  OH    . TYR C  2  90   ? 83.929  -19.280 79.947   1.00 11.91  ? 90   TYR C OH    1 
ATOM   4245  N  N     . GLN C  2  91   ? 82.957  -16.423 74.227   1.00 5.09   ? 91   GLN C N     1 
ATOM   4246  C  CA    . GLN C  2  91   ? 82.942  -17.285 73.060   1.00 4.47   ? 91   GLN C CA    1 
ATOM   4247  C  C     . GLN C  2  91   ? 84.238  -18.071 72.962   1.00 5.19   ? 91   GLN C C     1 
ATOM   4248  O  O     . GLN C  2  91   ? 85.242  -17.700 73.564   1.00 7.34   ? 91   GLN C O     1 
ATOM   4249  C  CB    . GLN C  2  91   ? 82.788  -16.428 71.810   1.00 5.21   ? 91   GLN C CB    1 
ATOM   4250  C  CG    . GLN C  2  91   ? 83.902  -15.402 71.658   1.00 6.59   ? 91   GLN C CG    1 
ATOM   4251  C  CD    . GLN C  2  91   ? 83.687  -14.468 70.487   1.00 5.40   ? 91   GLN C CD    1 
ATOM   4252  O  OE1   . GLN C  2  91   ? 82.668  -14.538 69.801   1.00 5.51   ? 91   GLN C OE1   1 
ATOM   4253  N  NE2   . GLN C  2  91   ? 84.656  -13.592 70.245   1.00 5.61   ? 91   GLN C NE2   1 
ATOM   4254  N  N     . ALA C  2  92   ? 84.217  -19.148 72.187   1.00 4.29   ? 92   ALA C N     1 
ATOM   4255  C  CA    . ALA C  2  92   ? 85.410  -19.953 71.961   1.00 5.87   ? 92   ALA C CA    1 
ATOM   4256  C  C     . ALA C  2  92   ? 85.665  -20.068 70.470   1.00 6.27   ? 92   ALA C C     1 
ATOM   4257  O  O     . ALA C  2  92   ? 84.719  -20.139 69.682   1.00 5.39   ? 92   ALA C O     1 
ATOM   4258  C  CB    . ALA C  2  92   ? 85.242  -21.334 72.575   1.00 6.95   ? 92   ALA C CB    1 
ATOM   4259  N  N     . PRO C  2  93   ? 86.946  -20.077 70.072   1.00 6.54   ? 93   PRO C N     1 
ATOM   4260  C  CA    . PRO C  2  93   ? 87.283  -20.213 68.651   1.00 6.47   ? 93   PRO C CA    1 
ATOM   4261  C  C     . PRO C  2  93   ? 86.850  -21.576 68.116   1.00 6.34   ? 93   PRO C C     1 
ATOM   4262  O  O     . PRO C  2  93   ? 86.920  -22.554 68.855   1.00 6.63   ? 93   PRO C O     1 
ATOM   4263  C  CB    . PRO C  2  93   ? 88.807  -20.085 68.640   1.00 6.18   ? 93   PRO C CB    1 
ATOM   4264  C  CG    . PRO C  2  93   ? 89.237  -20.410 70.035   1.00 5.67   ? 93   PRO C CG    1 
ATOM   4265  C  CD    . PRO C  2  93   ? 88.141  -19.919 70.916   1.00 5.49   ? 93   PRO C CD    1 
ATOM   4266  N  N     . LEU C  2  94   ? 86.386  -21.629 66.870   1.00 5.65   ? 94   LEU C N     1 
ATOM   4267  C  CA    . LEU C  2  94   ? 86.002  -22.889 66.241   1.00 4.74   ? 94   LEU C CA    1 
ATOM   4268  C  C     . LEU C  2  94   ? 86.888  -23.186 65.043   1.00 7.51   ? 94   LEU C C     1 
ATOM   4269  O  O     . LEU C  2  94   ? 86.978  -22.384 64.113   1.00 8.81   ? 94   LEU C O     1 
ATOM   4270  C  CB    . LEU C  2  94   ? 84.546  -22.852 65.782   1.00 5.39   ? 94   LEU C CB    1 
ATOM   4271  C  CG    . LEU C  2  94   ? 84.064  -24.084 65.007   1.00 4.84   ? 94   LEU C CG    1 
ATOM   4272  C  CD1   . LEU C  2  94   ? 83.971  -25.300 65.906   1.00 4.37   ? 94   LEU C CD1   1 
ATOM   4273  C  CD2   . LEU C  2  94   ? 82.728  -23.818 64.363   1.00 6.01   ? 94   LEU C CD2   1 
ATOM   4274  N  N     . TYR C  2  95   ? 87.541  -24.341 65.064   1.00 7.62   ? 95   TYR C N     1 
ATOM   4275  C  CA    . TYR C  2  95   ? 88.379  -24.754 63.948   1.00 6.69   ? 95   TYR C CA    1 
ATOM   4276  C  C     . TYR C  2  95   ? 87.773  -25.994 63.313   1.00 8.85   ? 95   TYR C C     1 
ATOM   4277  O  O     . TYR C  2  95   ? 87.094  -26.778 63.984   1.00 8.74   ? 95   TYR C O     1 
ATOM   4278  C  CB    . TYR C  2  95   ? 89.802  -25.053 64.424   1.00 5.31   ? 95   TYR C CB    1 
ATOM   4279  C  CG    . TYR C  2  95   ? 90.456  -23.916 65.175   1.00 6.23   ? 95   TYR C CG    1 
ATOM   4280  C  CD1   . TYR C  2  95   ? 90.203  -23.712 66.522   1.00 4.86   ? 95   TYR C CD1   1 
ATOM   4281  C  CD2   . TYR C  2  95   ? 91.328  -23.044 64.536   1.00 7.60   ? 95   TYR C CD2   1 
ATOM   4282  C  CE1   . TYR C  2  95   ? 90.798  -22.674 67.210   1.00 5.57   ? 95   TYR C CE1   1 
ATOM   4283  C  CE2   . TYR C  2  95   ? 91.929  -22.002 65.217   1.00 5.28   ? 95   TYR C CE2   1 
ATOM   4284  C  CZ    . TYR C  2  95   ? 91.662  -21.822 66.554   1.00 7.23   ? 95   TYR C CZ    1 
ATOM   4285  O  OH    . TYR C  2  95   ? 92.260  -20.786 67.239   1.00 12.45  ? 95   TYR C OH    1 
ATOM   4286  N  N     . ALA C  2  96   ? 88.011  -26.174 62.020   1.00 10.05  ? 96   ALA C N     1 
ATOM   4287  C  CA    . ALA C  2  96   ? 87.535  -27.369 61.336   1.00 9.45   ? 96   ALA C CA    1 
ATOM   4288  C  C     . ALA C  2  96   ? 88.626  -27.955 60.457   1.00 13.88  ? 96   ALA C C     1 
ATOM   4289  O  O     . ALA C  2  96   ? 89.196  -27.258 59.614   1.00 14.54  ? 96   ALA C O     1 
ATOM   4290  C  CB    . ALA C  2  96   ? 86.296  -27.055 60.507   1.00 10.03  ? 96   ALA C CB    1 
ATOM   4291  N  N     . ARG C  2  97   ? 88.928  -29.233 60.665   1.00 17.82  ? 97   ARG C N     1 
ATOM   4292  C  CA    . ARG C  2  97   ? 89.869  -29.931 59.798   1.00 16.60  ? 97   ARG C CA    1 
ATOM   4293  C  C     . ARG C  2  97   ? 89.168  -30.382 58.528   1.00 13.76  ? 97   ARG C C     1 
ATOM   4294  O  O     . ARG C  2  97   ? 88.244  -31.204 58.551   1.00 11.18  ? 97   ARG C O     1 
ATOM   4295  C  CB    . ARG C  2  97   ? 90.510  -31.119 60.518   1.00 19.13  ? 97   ARG C CB    1 
ATOM   4296  C  CG    . ARG C  2  97   ? 91.600  -30.716 61.501   1.00 26.30  ? 97   ARG C CG    1 
ATOM   4297  C  CD    . ARG C  2  97   ? 92.303  -31.923 62.105   1.00 39.39  ? 97   ARG C CD    1 
ATOM   4298  N  NE    . ARG C  2  97   ? 92.644  -32.930 61.100   1.00 44.53  ? 97   ARG C NE    1 
ATOM   4299  C  CZ    . ARG C  2  97   ? 93.309  -34.053 61.364   1.00 47.46  ? 97   ARG C CZ    1 
ATOM   4300  N  NH1   . ARG C  2  97   ? 93.569  -34.917 60.388   1.00 36.16  ? 97   ARG C NH1   1 
ATOM   4301  N  NH2   . ARG C  2  97   ? 93.716  -34.312 62.603   1.00 41.29  ? 97   ARG C NH2   1 
ATOM   4302  N  N     . LEU C  2  98   ? 89.636  -29.837 57.415   1.00 15.92  ? 98   LEU C N     1 
ATOM   4303  C  CA    . LEU C  2  98   ? 89.039  -30.097 56.121   1.00 22.26  ? 98   LEU C CA    1 
ATOM   4304  C  C     . LEU C  2  98   ? 90.108  -30.605 55.165   1.00 29.79  ? 98   LEU C C     1 
ATOM   4305  O  O     . LEU C  2  98   ? 91.221  -30.078 55.139   1.00 30.93  ? 98   LEU C O     1 
ATOM   4306  C  CB    . LEU C  2  98   ? 88.426  -28.812 55.561   1.00 18.02  ? 98   LEU C CB    1 
ATOM   4307  C  CG    . LEU C  2  98   ? 87.515  -27.981 56.466   1.00 13.11  ? 98   LEU C CG    1 
ATOM   4308  C  CD1   . LEU C  2  98   ? 87.001  -26.777 55.704   1.00 12.23  ? 98   LEU C CD1   1 
ATOM   4309  C  CD2   . LEU C  2  98   ? 86.360  -28.812 56.996   1.00 14.79  ? 98   LEU C CD2   1 
ATOM   4310  N  N     . GLN C  2  99   ? 89.782  -31.630 54.385   1.00 33.34  ? 99   GLN C N     1 
ATOM   4311  C  CA    . GLN C  2  99   ? 90.693  -32.069 53.334   1.00 35.26  ? 99   GLN C CA    1 
ATOM   4312  C  C     . GLN C  2  99   ? 90.107  -31.857 51.945   1.00 31.60  ? 99   GLN C C     1 
ATOM   4313  O  O     . GLN C  2  99   ? 89.077  -32.427 51.593   1.00 36.71  ? 99   GLN C O     1 
ATOM   4314  C  CB    . GLN C  2  99   ? 91.152  -33.521 53.537   1.00 37.76  ? 99   GLN C CB    1 
ATOM   4315  C  CG    . GLN C  2  99   ? 90.047  -34.558 53.596   1.00 35.45  ? 99   GLN C CG    1 
ATOM   4316  C  CD    . GLN C  2  99   ? 90.585  -35.967 53.779   1.00 44.33  ? 99   GLN C CD    1 
ATOM   4317  O  OE1   . GLN C  2  99   ? 89.901  -36.947 53.485   1.00 55.25  ? 99   GLN C OE1   1 
ATOM   4318  N  NE2   . GLN C  2  99   ? 91.816  -36.074 54.270   1.00 38.85  ? 99   GLN C NE2   1 
ATOM   4319  N  N     . LEU C  2  100  ? 90.767  -31.005 51.172   1.00 37.51  ? 100  LEU C N     1 
ATOM   4320  C  CA    . LEU C  2  100  ? 90.442  -30.813 49.767   1.00 44.67  ? 100  LEU C CA    1 
ATOM   4321  C  C     . LEU C  2  100  ? 91.027  -31.957 48.947   1.00 47.07  ? 100  LEU C C     1 
ATOM   4322  O  O     . LEU C  2  100  ? 92.241  -32.179 48.950   1.00 48.58  ? 100  LEU C O     1 
ATOM   4323  C  CB    . LEU C  2  100  ? 91.011  -29.487 49.272   1.00 39.73  ? 100  LEU C CB    1 
ATOM   4324  C  CG    . LEU C  2  100  ? 90.846  -29.232 47.777   1.00 38.89  ? 100  LEU C CG    1 
ATOM   4325  C  CD1   . LEU C  2  100  ? 89.382  -29.359 47.383   1.00 42.85  ? 100  LEU C CD1   1 
ATOM   4326  C  CD2   . LEU C  2  100  ? 91.392  -27.862 47.409   1.00 39.72  ? 100  LEU C CD2   1 
ATOM   4327  N  N     . ILE C  2  101  ? 90.160  -32.677 48.245   1.00 45.15  ? 101  ILE C N     1 
ATOM   4328  C  CA    . ILE C  2  101  ? 90.573  -33.852 47.493   1.00 46.06  ? 101  ILE C CA    1 
ATOM   4329  C  C     . ILE C  2  101  ? 90.278  -33.673 46.013   1.00 50.96  ? 101  ILE C C     1 
ATOM   4330  O  O     . ILE C  2  101  ? 89.203  -33.215 45.638   1.00 54.78  ? 101  ILE C O     1 
ATOM   4331  C  CB    . ILE C  2  101  ? 89.844  -35.125 47.983   1.00 49.07  ? 101  ILE C CB    1 
ATOM   4332  C  CG1   . ILE C  2  101  ? 89.939  -35.259 49.505   1.00 56.26  ? 101  ILE C CG1   1 
ATOM   4333  C  CG2   . ILE C  2  101  ? 90.406  -36.366 47.305   1.00 48.81  ? 101  ILE C CG2   1 
ATOM   4334  C  CD1   . ILE C  2  101  ? 89.263  -36.508 50.051   1.00 55.05  ? 101  ILE C CD1   1 
ATOM   4335  N  N     . HIS C  2  102  ? 91.242  -34.028 45.174   1.00 66.13  ? 102  HIS C N     1 
ATOM   4336  C  CA    . HIS C  2  102  ? 91.018  -34.070 43.739   0.50 64.86  ? 102  HIS C CA    1 
ATOM   4337  C  C     . HIS C  2  102  ? 91.087  -35.528 43.302   1.00 73.24  ? 102  HIS C C     1 
ATOM   4338  O  O     . HIS C  2  102  ? 92.150  -36.155 43.383   1.00 77.35  ? 102  HIS C O     1 
ATOM   4339  C  CB    . HIS C  2  102  ? 92.068  -33.231 43.011   0.50 60.87  ? 102  HIS C CB    1 
ATOM   4340  C  CG    . HIS C  2  102  ? 91.625  -32.739 41.669   0.50 61.55  ? 102  HIS C CG    1 
ATOM   4341  N  ND1   . HIS C  2  102  ? 90.715  -33.419 40.888   0.50 61.73  ? 102  HIS C ND1   1 
ATOM   4342  C  CD2   . HIS C  2  102  ? 91.958  -31.625 40.975   0.50 59.27  ? 102  HIS C CD2   1 
ATOM   4343  C  CE1   . HIS C  2  102  ? 90.513  -32.749 39.768   0.50 62.04  ? 102  HIS C CE1   1 
ATOM   4344  N  NE2   . HIS C  2  102  ? 91.257  -31.658 39.794   0.50 58.44  ? 102  HIS C NE2   1 
ATOM   4345  N  N     . LYS C  2  103  ? 89.949  -36.072 42.873   1.00 74.26  ? 103  LYS C N     1 
ATOM   4346  C  CA    . LYS C  2  103  ? 89.870  -37.471 42.456   1.00 80.07  ? 103  LYS C CA    1 
ATOM   4347  C  C     . LYS C  2  103  ? 90.613  -37.704 41.145   1.00 86.37  ? 103  LYS C C     1 
ATOM   4348  O  O     . LYS C  2  103  ? 91.197  -38.770 40.930   1.00 83.12  ? 103  LYS C O     1 
ATOM   4349  C  CB    . LYS C  2  103  ? 88.413  -37.914 42.310   1.00 74.03  ? 103  LYS C CB    1 
ATOM   4350  C  CG    . LYS C  2  103  ? 87.624  -37.901 43.605   1.00 70.12  ? 103  LYS C CG    1 
ATOM   4351  C  CD    . LYS C  2  103  ? 86.365  -37.052 43.469   1.00 78.84  ? 103  LYS C CD    1 
ATOM   4352  C  CE    . LYS C  2  103  ? 85.536  -37.446 42.248   1.00 72.89  ? 103  LYS C CE    1 
ATOM   4353  N  NZ    . LYS C  2  103  ? 84.436  -36.472 41.975   1.00 53.14  ? 103  LYS C NZ    1 
ATOM   4354  N  N     . ASP C  2  104  ? 90.582  -36.703 40.270   1.00 80.56  ? 104  ASP C N     1 
ATOM   4355  C  CA    . ASP C  2  104  ? 91.279  -36.780 38.993   1.00 82.60  ? 104  ASP C CA    1 
ATOM   4356  C  C     . ASP C  2  104  ? 92.792  -36.736 39.214   1.00 90.73  ? 104  ASP C C     1 
ATOM   4357  O  O     . ASP C  2  104  ? 93.522  -37.626 38.769   1.00 88.85  ? 104  ASP C O     1 
ATOM   4358  C  CB    . ASP C  2  104  ? 90.843  -35.630 38.078   1.00 75.83  ? 104  ASP C CB    1 
ATOM   4359  C  CG    . ASP C  2  104  ? 91.062  -35.935 36.607   1.00 76.34  ? 104  ASP C CG    1 
ATOM   4360  O  OD1   . ASP C  2  104  ? 90.756  -37.070 36.186   1.00 74.69  ? 104  ASP C OD1   1 
ATOM   4361  O  OD2   . ASP C  2  104  ? 91.540  -35.042 35.872   1.00 71.66  ? 104  ASP C OD2   1 
ATOM   4362  N  N     . THR C  2  105  ? 93.247  -35.705 39.923   1.00 90.77  ? 105  THR C N     1 
ATOM   4363  C  CA    . THR C  2  105  ? 94.668  -35.489 40.192   1.00 83.60  ? 105  THR C CA    1 
ATOM   4364  C  C     . THR C  2  105  ? 95.231  -36.536 41.155   1.00 83.78  ? 105  THR C C     1 
ATOM   4365  O  O     . THR C  2  105  ? 96.419  -36.865 41.114   1.00 80.15  ? 105  THR C O     1 
ATOM   4366  C  CB    . THR C  2  105  ? 94.909  -34.074 40.775   1.00 69.61  ? 105  THR C CB    1 
ATOM   4367  O  OG1   . THR C  2  105  ? 94.296  -33.096 39.927   1.00 72.88  ? 105  THR C OG1   1 
ATOM   4368  C  CG2   . THR C  2  105  ? 96.393  -33.773 40.885   1.00 62.10  ? 105  THR C CG2   1 
ATOM   4369  N  N     . GLY C  2  106  ? 94.365  -37.071 42.009   1.00 89.00  ? 106  GLY C N     1 
ATOM   4370  C  CA    . GLY C  2  106  ? 94.801  -37.949 43.078   1.00 89.95  ? 106  GLY C CA    1 
ATOM   4371  C  C     . GLY C  2  106  ? 95.419  -37.096 44.168   1.00 89.11  ? 106  GLY C C     1 
ATOM   4372  O  O     . GLY C  2  106  ? 96.254  -37.558 44.947   1.00 87.33  ? 106  GLY C O     1 
ATOM   4373  N  N     . LEU C  2  107  ? 94.986  -35.839 44.224   1.00 84.08  ? 107  LEU C N     1 
ATOM   4374  C  CA    . LEU C  2  107  ? 95.589  -34.861 45.124   1.00 73.27  ? 107  LEU C CA    1 
ATOM   4375  C  C     . LEU C  2  107  ? 94.855  -34.827 46.455   1.00 64.37  ? 107  LEU C C     1 
ATOM   4376  O  O     . LEU C  2  107  ? 93.639  -35.010 46.508   1.00 68.72  ? 107  LEU C O     1 
ATOM   4377  C  CB    . LEU C  2  107  ? 95.587  -33.465 44.489   1.00 77.07  ? 107  LEU C CB    1 
ATOM   4378  C  CG    . LEU C  2  107  ? 96.035  -32.295 45.376   1.00 69.54  ? 107  LEU C CG    1 
ATOM   4379  C  CD1   . LEU C  2  107  ? 97.497  -32.449 45.780   1.00 60.49  ? 107  LEU C CD1   1 
ATOM   4380  C  CD2   . LEU C  2  107  ? 95.798  -30.957 44.690   1.00 60.28  ? 107  LEU C CD2   1 
ATOM   4381  N  N     . ILE C  2  108  ? 95.607  -34.630 47.531   1.00 57.78  ? 108  ILE C N     1 
ATOM   4382  C  CA    . ILE C  2  108  ? 95.024  -34.454 48.852   1.00 53.21  ? 108  ILE C CA    1 
ATOM   4383  C  C     . ILE C  2  108  ? 95.725  -33.311 49.577   1.00 53.13  ? 108  ILE C C     1 
ATOM   4384  O  O     . ILE C  2  108  ? 96.949  -33.314 49.710   1.00 58.68  ? 108  ILE C O     1 
ATOM   4385  C  CB    . ILE C  2  108  ? 95.123  -35.739 49.706   1.00 44.95  ? 108  ILE C CB    1 
ATOM   4386  C  CG1   . ILE C  2  108  ? 94.172  -36.824 49.184   1.00 49.64  ? 108  ILE C CG1   1 
ATOM   4387  C  CG2   . ILE C  2  108  ? 94.801  -35.435 51.160   1.00 43.70  ? 108  ILE C CG2   1 
ATOM   4388  C  CD1   . ILE C  2  108  ? 94.752  -37.727 48.105   1.00 48.92  ? 108  ILE C CD1   1 
ATOM   4389  N  N     . LYS C  2  109  ? 94.951  -32.330 50.031   1.00 49.75  ? 109  LYS C N     1 
ATOM   4390  C  CA    . LYS C  2  109  ? 95.496  -31.250 50.855   1.00 48.47  ? 109  LYS C CA    1 
ATOM   4391  C  C     . LYS C  2  109  ? 94.637  -31.014 52.107   1.00 41.44  ? 109  LYS C C     1 
ATOM   4392  O  O     . LYS C  2  109  ? 93.476  -30.634 52.017   1.00 47.54  ? 109  LYS C O     1 
ATOM   4393  C  CB    . LYS C  2  109  ? 95.671  -29.969 50.027   1.00 43.97  ? 109  LYS C CB    1 
ATOM   4394  C  CG    . LYS C  2  109  ? 95.938  -28.707 50.838   1.00 48.42  ? 109  LYS C CG    1 
ATOM   4395  C  CD    . LYS C  2  109  ? 97.187  -28.820 51.705   1.00 55.95  ? 109  LYS C CD    1 
ATOM   4396  C  CE    . LYS C  2  109  ? 97.319  -27.614 52.637   1.00 46.09  ? 109  LYS C CE    1 
ATOM   4397  N  NZ    . LYS C  2  109  ? 98.403  -27.778 53.645   1.00 38.13  ? 109  LYS C NZ    1 
ATOM   4398  N  N     . GLU C  2  110  ? 95.229  -31.233 53.275   1.00 37.46  ? 110  GLU C N     1 
ATOM   4399  C  CA    . GLU C  2  110  ? 94.487  -31.252 54.531   1.00 31.50  ? 110  GLU C CA    1 
ATOM   4400  C  C     . GLU C  2  110  ? 94.897  -30.086 55.423   1.00 26.49  ? 110  GLU C C     1 
ATOM   4401  O  O     . GLU C  2  110  ? 96.081  -29.869 55.670   1.00 27.19  ? 110  GLU C O     1 
ATOM   4402  C  CB    . GLU C  2  110  ? 94.737  -32.589 55.232   1.00 35.15  ? 110  GLU C CB    1 
ATOM   4403  C  CG    . GLU C  2  110  ? 94.073  -32.777 56.580   1.00 36.93  ? 110  GLU C CG    1 
ATOM   4404  C  CD    . GLU C  2  110  ? 94.354  -34.160 57.162   1.00 45.27  ? 110  GLU C CD    1 
ATOM   4405  O  OE1   . GLU C  2  110  ? 94.476  -34.276 58.401   1.00 40.40  ? 110  GLU C OE1   1 
ATOM   4406  O  OE2   . GLU C  2  110  ? 94.455  -35.134 56.378   1.00 34.77  ? 110  GLU C OE2   1 
ATOM   4407  N  N     . ASP C  2  111  ? 93.915  -29.331 55.904   1.00 28.40  ? 111  ASP C N     1 
ATOM   4408  C  CA    . ASP C  2  111  ? 94.202  -28.139 56.700   1.00 28.36  ? 111  ASP C CA    1 
ATOM   4409  C  C     . ASP C  2  111  ? 93.134  -27.839 57.761   1.00 20.21  ? 111  ASP C C     1 
ATOM   4410  O  O     . ASP C  2  111  ? 91.948  -28.088 57.553   1.00 23.45  ? 111  ASP C O     1 
ATOM   4411  C  CB    . ASP C  2  111  ? 94.406  -26.928 55.780   1.00 25.74  ? 111  ASP C CB    1 
ATOM   4412  C  CG    . ASP C  2  111  ? 94.942  -25.715 56.520   1.00 36.84  ? 111  ASP C CG    1 
ATOM   4413  O  OD1   . ASP C  2  111  ? 94.741  -24.582 56.030   1.00 44.52  ? 111  ASP C OD1   1 
ATOM   4414  O  OD2   . ASP C  2  111  ? 95.563  -25.890 57.592   1.00 38.34  ? 111  ASP C OD2   1 
ATOM   4415  N  N     . GLU C  2  112  ? 93.569  -27.308 58.901   1.00 18.52  ? 112  GLU C N     1 
ATOM   4416  C  CA    . GLU C  2  112  ? 92.650  -26.875 59.949   1.00 14.91  ? 112  GLU C CA    1 
ATOM   4417  C  C     . GLU C  2  112  ? 92.353  -25.396 59.742   1.00 18.33  ? 112  GLU C C     1 
ATOM   4418  O  O     . GLU C  2  112  ? 93.238  -24.548 59.884   1.00 15.83  ? 112  GLU C O     1 
ATOM   4419  C  CB    . GLU C  2  112  ? 93.261  -27.099 61.335   1.00 11.15  ? 112  GLU C CB    1 
ATOM   4420  C  CG    . GLU C  2  112  ? 92.322  -26.811 62.501   1.00 12.18  ? 112  GLU C CG    1 
ATOM   4421  C  CD    . GLU C  2  112  ? 93.035  -26.779 63.859   1.00 16.88  ? 112  GLU C CD    1 
ATOM   4422  O  OE1   . GLU C  2  112  ? 93.935  -25.925 64.054   1.00 14.34  ? 112  GLU C OE1   1 
ATOM   4423  O  OE2   . GLU C  2  112  ? 92.689  -27.606 64.736   1.00 13.00  ? 112  GLU C OE2   1 
ATOM   4424  N  N     . VAL C  2  113  ? 91.104  -25.092 59.403   1.00 17.33  ? 113  VAL C N     1 
ATOM   4425  C  CA    . VAL C  2  113  ? 90.704  -23.720 59.108   1.00 16.18  ? 113  VAL C CA    1 
ATOM   4426  C  C     . VAL C  2  113  ? 89.968  -23.070 60.274   1.00 12.89  ? 113  VAL C C     1 
ATOM   4427  O  O     . VAL C  2  113  ? 89.274  -23.739 61.043   1.00 13.03  ? 113  VAL C O     1 
ATOM   4428  C  CB    . VAL C  2  113  ? 89.826  -23.644 57.854   1.00 15.09  ? 113  VAL C CB    1 
ATOM   4429  C  CG1   . VAL C  2  113  ? 90.635  -23.985 56.619   1.00 20.68  ? 113  VAL C CG1   1 
ATOM   4430  C  CG2   . VAL C  2  113  ? 88.646  -24.579 57.993   1.00 19.19  ? 113  VAL C CG2   1 
ATOM   4431  N  N     . PHE C  2  114  ? 90.146  -21.761 60.411   1.00 12.84  ? 114  PHE C N     1 
ATOM   4432  C  CA    . PHE C  2  114  ? 89.484  -21.005 61.462   1.00 12.05  ? 114  PHE C CA    1 
ATOM   4433  C  C     . PHE C  2  114  ? 88.148  -20.461 60.980   1.00 15.64  ? 114  PHE C C     1 
ATOM   4434  O  O     . PHE C  2  114  ? 88.101  -19.609 60.091   1.00 16.16  ? 114  PHE C O     1 
ATOM   4435  C  CB    . PHE C  2  114  ? 90.369  -19.855 61.921   1.00 10.94  ? 114  PHE C CB    1 
ATOM   4436  C  CG    . PHE C  2  114  ? 89.775  -19.044 63.028   1.00 14.45  ? 114  PHE C CG    1 
ATOM   4437  C  CD1   . PHE C  2  114  ? 89.485  -19.627 64.250   1.00 11.24  ? 114  PHE C CD1   1 
ATOM   4438  C  CD2   . PHE C  2  114  ? 89.514  -17.692 62.852   1.00 18.66  ? 114  PHE C CD2   1 
ATOM   4439  C  CE1   . PHE C  2  114  ? 88.940  -18.877 65.278   1.00 12.36  ? 114  PHE C CE1   1 
ATOM   4440  C  CE2   . PHE C  2  114  ? 88.973  -16.933 63.877   1.00 13.52  ? 114  PHE C CE2   1 
ATOM   4441  C  CZ    . PHE C  2  114  ? 88.685  -17.526 65.090   1.00 12.67  ? 114  PHE C CZ    1 
ATOM   4442  N  N     . LEU C  2  115  ? 87.071  -20.952 61.593   1.00 17.75  ? 115  LEU C N     1 
ATOM   4443  C  CA    . LEU C  2  115  ? 85.702  -20.599 61.220   1.00 13.36  ? 115  LEU C CA    1 
ATOM   4444  C  C     . LEU C  2  115  ? 85.138  -19.446 62.036   1.00 13.64  ? 115  LEU C C     1 
ATOM   4445  O  O     . LEU C  2  115  ? 83.967  -19.117 61.908   1.00 22.16  ? 115  LEU C O     1 
ATOM   4446  C  CB    . LEU C  2  115  ? 84.773  -21.806 61.350   1.00 8.32   ? 115  LEU C CB    1 
ATOM   4447  C  CG    . LEU C  2  115  ? 85.040  -22.927 60.355   1.00 9.62   ? 115  LEU C CG    1 
ATOM   4448  C  CD1   . LEU C  2  115  ? 83.999  -24.019 60.487   1.00 7.64   ? 115  LEU C CD1   1 
ATOM   4449  C  CD2   . LEU C  2  115  ? 85.054  -22.358 58.954   1.00 15.79  ? 115  LEU C CD2   1 
ATOM   4450  N  N     . GLY C  2  116  ? 85.960  -18.839 62.879   1.00 10.78  ? 116  GLY C N     1 
ATOM   4451  C  CA    . GLY C  2  116  ? 85.479  -17.781 63.744   1.00 11.84  ? 116  GLY C CA    1 
ATOM   4452  C  C     . GLY C  2  116  ? 85.175  -18.311 65.128   1.00 10.93  ? 116  GLY C C     1 
ATOM   4453  O  O     . GLY C  2  116  ? 85.657  -19.380 65.504   1.00 10.46  ? 116  GLY C O     1 
ATOM   4454  N  N     . HIS C  2  117  ? 84.369  -17.572 65.885   1.00 12.33  ? 117  HIS C N     1 
ATOM   4455  C  CA    . HIS C  2  117  ? 84.059  -17.936 67.267   1.00 7.36   ? 117  HIS C CA    1 
ATOM   4456  C  C     . HIS C  2  117  ? 82.595  -18.320 67.440   1.00 4.81   ? 117  HIS C C     1 
ATOM   4457  O  O     . HIS C  2  117  ? 81.748  -17.928 66.639   1.00 4.62   ? 117  HIS C O     1 
ATOM   4458  C  CB    . HIS C  2  117  ? 84.388  -16.783 68.209   1.00 5.45   ? 117  HIS C CB    1 
ATOM   4459  C  CG    . HIS C  2  117  ? 85.849  -16.482 68.314   1.00 6.75   ? 117  HIS C CG    1 
ATOM   4460  N  ND1   . HIS C  2  117  ? 86.585  -16.758 69.446   1.00 6.73   ? 117  HIS C ND1   1 
ATOM   4461  C  CD2   . HIS C  2  117  ? 86.710  -15.922 67.433   1.00 11.46  ? 117  HIS C CD2   1 
ATOM   4462  C  CE1   . HIS C  2  117  ? 87.838  -16.384 69.257   1.00 8.34   ? 117  HIS C CE1   1 
ATOM   4463  N  NE2   . HIS C  2  117  ? 87.941  -15.873 68.044   1.00 12.96  ? 117  HIS C NE2   1 
ATOM   4464  N  N     . ILE C  2  118  ? 82.314  -19.111 68.473   1.00 3.72   ? 118  ILE C N     1 
ATOM   4465  C  CA    . ILE C  2  118  ? 80.946  -19.463 68.833   1.00 2.94   ? 118  ILE C CA    1 
ATOM   4466  C  C     . ILE C  2  118  ? 80.702  -19.087 70.284   1.00 3.12   ? 118  ILE C C     1 
ATOM   4467  O  O     . ILE C  2  118  ? 81.538  -19.356 71.141   1.00 4.26   ? 118  ILE C O     1 
ATOM   4468  C  CB    . ILE C  2  118  ? 80.732  -20.969 68.688   1.00 2.21   ? 118  ILE C CB    1 
ATOM   4469  C  CG1   . ILE C  2  118  ? 80.430  -21.320 67.240   1.00 3.84   ? 118  ILE C CG1   1 
ATOM   4470  C  CG2   . ILE C  2  118  ? 79.597  -21.454 69.567   1.00 2.52   ? 118  ILE C CG2   1 
ATOM   4471  C  CD1   . ILE C  2  118  ? 80.205  -22.793 67.047   1.00 6.89   ? 118  ILE C CD1   1 
ATOM   4472  N  N     . PRO C  2  119  ? 79.538  -18.496 70.577   1.00 1.85   ? 119  PRO C N     1 
ATOM   4473  C  CA    . PRO C  2  119  ? 79.255  -18.065 71.943   1.00 2.10   ? 119  PRO C CA    1 
ATOM   4474  C  C     . PRO C  2  119  ? 79.115  -19.242 72.884   1.00 2.15   ? 119  PRO C C     1 
ATOM   4475  O  O     . PRO C  2  119  ? 78.537  -20.265 72.527   1.00 1.63   ? 119  PRO C O     1 
ATOM   4476  C  CB    . PRO C  2  119  ? 77.918  -17.343 71.807   1.00 1.83   ? 119  PRO C CB    1 
ATOM   4477  C  CG    . PRO C  2  119  ? 77.895  -16.886 70.424   1.00 2.48   ? 119  PRO C CG    1 
ATOM   4478  C  CD    . PRO C  2  119  ? 78.549  -17.970 69.632   1.00 2.50   ? 119  PRO C CD    1 
ATOM   4479  N  N     . LEU C  2  120  ? 79.656  -19.075 74.085   1.00 2.82   ? 120  LEU C N     1 
ATOM   4480  C  CA    . LEU C  2  120  ? 79.601  -20.089 75.119   1.00 2.60   ? 120  LEU C CA    1 
ATOM   4481  C  C     . LEU C  2  120  ? 78.552  -19.724 76.151   1.00 2.23   ? 120  LEU C C     1 
ATOM   4482  O  O     . LEU C  2  120  ? 78.435  -18.567 76.551   1.00 3.25   ? 120  LEU C O     1 
ATOM   4483  C  CB    . LEU C  2  120  ? 80.964  -20.224 75.806   1.00 2.79   ? 120  LEU C CB    1 
ATOM   4484  C  CG    . LEU C  2  120  ? 82.143  -20.680 74.950   1.00 2.19   ? 120  LEU C CG    1 
ATOM   4485  C  CD1   . LEU C  2  120  ? 83.357  -20.817 75.806   1.00 2.45   ? 120  LEU C CD1   1 
ATOM   4486  C  CD2   . LEU C  2  120  ? 81.833  -21.997 74.274   1.00 2.93   ? 120  LEU C CD2   1 
ATOM   4487  N  N     . MET C  2  121  ? 77.787  -20.720 76.571   1.00 2.24   ? 121  MET C N     1 
ATOM   4488  C  CA    . MET C  2  121  ? 76.858  -20.563 77.676   1.00 2.41   ? 121  MET C CA    1 
ATOM   4489  C  C     . MET C  2  121  ? 77.671  -20.530 78.964   1.00 2.96   ? 121  MET C C     1 
ATOM   4490  O  O     . MET C  2  121  ? 78.722  -21.162 79.057   1.00 2.74   ? 121  MET C O     1 
ATOM   4491  C  CB    . MET C  2  121  ? 75.860  -21.724 77.681   1.00 1.72   ? 121  MET C CB    1 
ATOM   4492  C  CG    . MET C  2  121  ? 74.917  -21.757 78.851   1.00 1.63   ? 121  MET C CG    1 
ATOM   4493  S  SD    . MET C  2  121  ? 73.595  -22.948 78.601   1.00 0.82   ? 121  MET C SD    1 
ATOM   4494  C  CE    . MET C  2  121  ? 72.748  -22.222 77.201   1.00 0.93   ? 121  MET C CE    1 
ATOM   4495  N  N     . THR C  2  122  ? 77.205  -19.772 79.948   1.00 3.79   ? 122  THR C N     1 
ATOM   4496  C  CA    . THR C  2  122  ? 77.911  -19.686 81.218   1.00 5.90   ? 122  THR C CA    1 
ATOM   4497  C  C     . THR C  2  122  ? 77.435  -20.770 82.169   1.00 5.68   ? 122  THR C C     1 
ATOM   4498  O  O     . THR C  2  122  ? 76.696  -21.668 81.780   1.00 4.66   ? 122  THR C O     1 
ATOM   4499  C  CB    . THR C  2  122  ? 77.730  -18.319 81.886   1.00 6.34   ? 122  THR C CB    1 
ATOM   4500  O  OG1   . THR C  2  122  ? 76.342  -18.114 82.172   1.00 7.58   ? 122  THR C OG1   1 
ATOM   4501  C  CG2   . THR C  2  122  ? 78.240  -17.210 80.978   1.00 4.05   ? 122  THR C CG2   1 
ATOM   4502  N  N     . GLU C  2  123  ? 77.863  -20.683 83.419   1.00 7.25   ? 123  GLU C N     1 
ATOM   4503  C  CA    . GLU C  2  123  ? 77.552  -21.724 84.377   1.00 10.08  ? 123  GLU C CA    1 
ATOM   4504  C  C     . GLU C  2  123  ? 76.063  -21.710 84.681   1.00 12.47  ? 123  GLU C C     1 
ATOM   4505  O  O     . GLU C  2  123  ? 75.474  -22.747 84.988   1.00 10.68  ? 123  GLU C O     1 
ATOM   4506  C  CB    . GLU C  2  123  ? 78.360  -21.514 85.655   1.00 22.71  ? 123  GLU C CB    1 
ATOM   4507  C  CG    . GLU C  2  123  ? 78.594  -22.767 86.486   1.00 36.03  ? 123  GLU C CG    1 
ATOM   4508  C  CD    . GLU C  2  123  ? 79.452  -22.492 87.713   1.00 40.77  ? 123  GLU C CD    1 
ATOM   4509  O  OE1   . GLU C  2  123  ? 80.155  -23.421 88.165   1.00 51.58  ? 123  GLU C OE1   1 
ATOM   4510  O  OE2   . GLU C  2  123  ? 79.421  -21.348 88.225   1.00 27.98  ? 123  GLU C OE2   1 
ATOM   4511  N  N     . ASP C  2  124  ? 75.455  -20.530 84.578   1.00 12.40  ? 124  ASP C N     1 
ATOM   4512  C  CA    . ASP C  2  124  ? 74.057  -20.364 84.970   1.00 10.64  ? 124  ASP C CA    1 
ATOM   4513  C  C     . ASP C  2  124  ? 73.048  -20.488 83.825   1.00 8.69   ? 124  ASP C C     1 
ATOM   4514  O  O     . ASP C  2  124  ? 71.850  -20.338 84.037   1.00 12.31  ? 124  ASP C O     1 
ATOM   4515  C  CB    . ASP C  2  124  ? 73.853  -19.053 85.737   1.00 12.52  ? 124  ASP C CB    1 
ATOM   4516  C  CG    . ASP C  2  124  ? 74.198  -17.826 84.911   1.00 18.85  ? 124  ASP C CG    1 
ATOM   4517  O  OD1   . ASP C  2  124  ? 75.388  -17.437 84.889   1.00 24.42  ? 124  ASP C OD1   1 
ATOM   4518  O  OD2   . ASP C  2  124  ? 73.278  -17.242 84.295   1.00 15.60  ? 124  ASP C OD2   1 
ATOM   4519  N  N     . GLY C  2  125  ? 73.521  -20.774 82.620   1.00 5.80   ? 125  GLY C N     1 
ATOM   4520  C  CA    . GLY C  2  125  ? 72.612  -21.026 81.516   1.00 3.75   ? 125  GLY C CA    1 
ATOM   4521  C  C     . GLY C  2  125  ? 72.384  -19.845 80.593   1.00 2.89   ? 125  GLY C C     1 
ATOM   4522  O  O     . GLY C  2  125  ? 71.446  -19.837 79.799   1.00 2.19   ? 125  GLY C O     1 
ATOM   4523  N  N     . SER C  2  126  ? 73.253  -18.848 80.682   1.00 4.38   ? 126  SER C N     1 
ATOM   4524  C  CA    . SER C  2  126  ? 73.090  -17.641 79.892   1.00 2.80   ? 126  SER C CA    1 
ATOM   4525  C  C     . SER C  2  126  ? 74.344  -17.328 79.107   1.00 2.95   ? 126  SER C C     1 
ATOM   4526  O  O     . SER C  2  126  ? 75.402  -17.912 79.337   1.00 3.26   ? 126  SER C O     1 
ATOM   4527  C  CB    . SER C  2  126  ? 72.734  -16.457 80.783   1.00 3.86   ? 126  SER C CB    1 
ATOM   4528  O  OG    . SER C  2  126  ? 73.788  -16.178 81.677   1.00 4.84   ? 126  SER C OG    1 
ATOM   4529  N  N     . PHE C  2  127  ? 74.208  -16.395 78.175   1.00 4.56   ? 127  PHE C N     1 
ATOM   4530  C  CA    . PHE C  2  127  ? 75.309  -15.966 77.324   1.00 4.26   ? 127  PHE C CA    1 
ATOM   4531  C  C     . PHE C  2  127  ? 75.688  -14.525 77.642   1.00 3.94   ? 127  PHE C C     1 
ATOM   4532  O  O     . PHE C  2  127  ? 74.914  -13.792 78.243   1.00 4.90   ? 127  PHE C O     1 
ATOM   4533  C  CB    . PHE C  2  127  ? 74.916  -16.079 75.852   1.00 3.29   ? 127  PHE C CB    1 
ATOM   4534  C  CG    . PHE C  2  127  ? 74.615  -17.480 75.414   1.00 2.46   ? 127  PHE C CG    1 
ATOM   4535  C  CD1   . PHE C  2  127  ? 73.362  -18.022 75.602   1.00 2.02   ? 127  PHE C CD1   1 
ATOM   4536  C  CD2   . PHE C  2  127  ? 75.591  -18.254 74.808   1.00 2.57   ? 127  PHE C CD2   1 
ATOM   4537  C  CE1   . PHE C  2  127  ? 73.088  -19.312 75.192   1.00 2.12   ? 127  PHE C CE1   1 
ATOM   4538  C  CE2   . PHE C  2  127  ? 75.323  -19.541 74.404   1.00 1.47   ? 127  PHE C CE2   1 
ATOM   4539  C  CZ    . PHE C  2  127  ? 74.070  -20.070 74.596   1.00 1.33   ? 127  PHE C CZ    1 
ATOM   4540  N  N     . ILE C  2  128  ? 76.911  -14.147 77.300   1.00 4.96   ? 128  ILE C N     1 
ATOM   4541  C  CA    . ILE C  2  128  ? 77.311  -12.753 77.338   1.00 4.35   ? 128  ILE C CA    1 
ATOM   4542  C  C     . ILE C  2  128  ? 77.581  -12.351 75.901   1.00 6.79   ? 128  ILE C C     1 
ATOM   4543  O  O     . ILE C  2  128  ? 78.586  -12.753 75.321   1.00 8.07   ? 128  ILE C O     1 
ATOM   4544  C  CB    . ILE C  2  128  ? 78.587  -12.572 78.161   1.00 5.58   ? 128  ILE C CB    1 
ATOM   4545  C  CG1   . ILE C  2  128  ? 78.376  -13.094 79.585   1.00 6.27   ? 128  ILE C CG1   1 
ATOM   4546  C  CG2   . ILE C  2  128  ? 79.003  -11.117 78.173   1.00 9.65   ? 128  ILE C CG2   1 
ATOM   4547  C  CD1   . ILE C  2  128  ? 79.649  -13.301 80.358   1.00 5.59   ? 128  ILE C CD1   1 
ATOM   4548  N  N     . ILE C  2  129  ? 76.680  -11.561 75.327   1.00 7.09   ? 129  ILE C N     1 
ATOM   4549  C  CA    . ILE C  2  129  ? 76.752  -11.213 73.913   1.00 6.97   ? 129  ILE C CA    1 
ATOM   4550  C  C     . ILE C  2  129  ? 76.974  -9.726  73.787   1.00 8.82   ? 129  ILE C C     1 
ATOM   4551  O  O     . ILE C  2  129  ? 76.078  -8.938  74.077   1.00 11.98  ? 129  ILE C O     1 
ATOM   4552  C  CB    . ILE C  2  129  ? 75.447  -11.572 73.175   1.00 7.74   ? 129  ILE C CB    1 
ATOM   4553  C  CG1   . ILE C  2  129  ? 75.143  -13.065 73.301   1.00 5.49   ? 129  ILE C CG1   1 
ATOM   4554  C  CG2   . ILE C  2  129  ? 75.531  -11.173 71.712   1.00 7.40   ? 129  ILE C CG2   1 
ATOM   4555  C  CD1   . ILE C  2  129  ? 76.096  -13.940 72.538   1.00 5.15   ? 129  ILE C CD1   1 
ATOM   4556  N  N     . ASN C  2  130  ? 78.167  -9.347  73.345   1.00 12.26  ? 130  ASN C N     1 
ATOM   4557  C  CA    . ASN C  2  130  ? 78.570  -7.942  73.302   1.00 14.77  ? 130  ASN C CA    1 
ATOM   4558  C  C     . ASN C  2  130  ? 78.435  -7.216  74.638   1.00 12.75  ? 130  ASN C C     1 
ATOM   4559  O  O     . ASN C  2  130  ? 78.076  -6.043  74.683   1.00 16.57  ? 130  ASN C O     1 
ATOM   4560  C  CB    . ASN C  2  130  ? 77.838  -7.196  72.191   1.00 11.11  ? 130  ASN C CB    1 
ATOM   4561  C  CG    . ASN C  2  130  ? 78.484  -7.404  70.849   1.00 17.55  ? 130  ASN C CG    1 
ATOM   4562  O  OD1   . ASN C  2  130  ? 79.702  -7.251  70.707   1.00 22.41  ? 130  ASN C OD1   1 
ATOM   4563  N  ND2   . ASN C  2  130  ? 77.684  -7.778  69.854   1.00 16.12  ? 130  ASN C ND2   1 
ATOM   4564  N  N     . GLY C  2  131  ? 78.719  -7.935  75.719   1.00 9.99   ? 131  GLY C N     1 
ATOM   4565  C  CA    . GLY C  2  131  ? 78.815  -7.347  77.037   1.00 11.24  ? 131  GLY C CA    1 
ATOM   4566  C  C     . GLY C  2  131  ? 77.569  -7.508  77.878   1.00 11.43  ? 131  GLY C C     1 
ATOM   4567  O  O     . GLY C  2  131  ? 77.630  -7.427  79.103   1.00 20.11  ? 131  GLY C O     1 
ATOM   4568  N  N     . ALA C  2  132  ? 76.434  -7.736  77.234   1.00 5.45   ? 132  ALA C N     1 
ATOM   4569  C  CA    . ALA C  2  132  ? 75.188  -7.868  77.972   1.00 6.04   ? 132  ALA C CA    1 
ATOM   4570  C  C     . ALA C  2  132  ? 74.812  -9.326  78.089   1.00 7.31   ? 132  ALA C C     1 
ATOM   4571  O  O     . ALA C  2  132  ? 75.046  -10.101 77.166   1.00 8.92   ? 132  ALA C O     1 
ATOM   4572  C  CB    . ALA C  2  132  ? 74.083  -7.103  77.284   1.00 11.65  ? 132  ALA C CB    1 
ATOM   4573  N  N     . ASP C  2  133  ? 74.227  -9.701  79.221   1.00 6.03   ? 133  ASP C N     1 
ATOM   4574  C  CA    . ASP C  2  133  ? 73.758  -11.063 79.406   1.00 4.53   ? 133  ASP C CA    1 
ATOM   4575  C  C     . ASP C  2  133  ? 72.462  -11.299 78.648   1.00 4.47   ? 133  ASP C C     1 
ATOM   4576  O  O     . ASP C  2  133  ? 71.521  -10.514 78.748   1.00 4.80   ? 133  ASP C O     1 
ATOM   4577  C  CB    . ASP C  2  133  ? 73.559  -11.379 80.887   1.00 9.71   ? 133  ASP C CB    1 
ATOM   4578  C  CG    . ASP C  2  133  ? 74.871  -11.615 81.621   1.00 21.21  ? 133  ASP C CG    1 
ATOM   4579  O  OD1   . ASP C  2  133  ? 75.835  -10.845 81.400   1.00 20.22  ? 133  ASP C OD1   1 
ATOM   4580  O  OD2   . ASP C  2  133  ? 74.937  -12.575 82.424   1.00 24.88  ? 133  ASP C OD2   1 
ATOM   4581  N  N     . ARG C  2  134  ? 72.422  -12.386 77.886   1.00 3.94   ? 134  ARG C N     1 
ATOM   4582  C  CA    . ARG C  2  134  ? 71.219  -12.780 77.170   1.00 3.28   ? 134  ARG C CA    1 
ATOM   4583  C  C     . ARG C  2  134  ? 70.812  -14.225 77.477   1.00 2.63   ? 134  ARG C C     1 
ATOM   4584  O  O     . ARG C  2  134  ? 71.633  -15.049 77.876   1.00 2.48   ? 134  ARG C O     1 
ATOM   4585  C  CB    . ARG C  2  134  ? 71.401  -12.586 75.666   1.00 3.81   ? 134  ARG C CB    1 
ATOM   4586  C  CG    . ARG C  2  134  ? 71.685  -11.158 75.257   1.00 4.24   ? 134  ARG C CG    1 
ATOM   4587  C  CD    . ARG C  2  134  ? 71.568  -10.963 73.748   1.00 4.92   ? 134  ARG C CD    1 
ATOM   4588  N  NE    . ARG C  2  134  ? 70.859  -9.723  73.442   1.00 4.33   ? 134  ARG C NE    1 
ATOM   4589  C  CZ    . ARG C  2  134  ? 69.613  -9.673  72.985   1.00 5.48   ? 134  ARG C CZ    1 
ATOM   4590  N  NH1   . ARG C  2  134  ? 68.951  -10.790 72.754   1.00 5.87   ? 134  ARG C NH1   1 
ATOM   4591  N  NH2   . ARG C  2  134  ? 69.029  -8.507  72.746   1.00 14.10  ? 134  ARG C NH2   1 
ATOM   4592  N  N     . VAL C  2  135  ? 69.530  -14.511 77.294   1.00 2.14   ? 135  VAL C N     1 
ATOM   4593  C  CA    . VAL C  2  135  ? 68.974  -15.834 77.505   1.00 1.58   ? 135  VAL C CA    1 
ATOM   4594  C  C     . VAL C  2  135  ? 68.312  -16.260 76.208   1.00 1.78   ? 135  VAL C C     1 
ATOM   4595  O  O     . VAL C  2  135  ? 67.592  -15.478 75.600   1.00 2.87   ? 135  VAL C O     1 
ATOM   4596  C  CB    . VAL C  2  135  ? 67.912  -15.804 78.620   1.00 1.52   ? 135  VAL C CB    1 
ATOM   4597  C  CG1   . VAL C  2  135  ? 67.056  -17.049 78.589   1.00 1.19   ? 135  VAL C CG1   1 
ATOM   4598  C  CG2   . VAL C  2  135  ? 68.569  -15.636 79.981   1.00 2.59   ? 135  VAL C CG2   1 
ATOM   4599  N  N     . ILE C  2  136  ? 68.569  -17.479 75.755   1.00 1.32   ? 136  ILE C N     1 
ATOM   4600  C  CA    . ILE C  2  136  ? 67.838  -17.979 74.605   1.00 1.36   ? 136  ILE C CA    1 
ATOM   4601  C  C     . ILE C  2  136  ? 66.608  -18.714 75.108   1.00 1.59   ? 136  ILE C C     1 
ATOM   4602  O  O     . ILE C  2  136  ? 66.711  -19.741 75.775   1.00 1.65   ? 136  ILE C O     1 
ATOM   4603  C  CB    . ILE C  2  136  ? 68.682  -18.907 73.730   1.00 1.38   ? 136  ILE C CB    1 
ATOM   4604  C  CG1   . ILE C  2  136  ? 69.952  -18.196 73.280   1.00 1.44   ? 136  ILE C CG1   1 
ATOM   4605  C  CG2   . ILE C  2  136  ? 67.887  -19.359 72.517   1.00 1.46   ? 136  ILE C CG2   1 
ATOM   4606  C  CD1   . ILE C  2  136  ? 69.690  -16.925 72.537   1.00 1.59   ? 136  ILE C CD1   1 
ATOM   4607  N  N     . VAL C  2  137  ? 65.443  -18.164 74.791   1.00 1.88   ? 137  VAL C N     1 
ATOM   4608  C  CA    . VAL C  2  137  ? 64.175  -18.693 75.258   1.00 1.27   ? 137  VAL C CA    1 
ATOM   4609  C  C     . VAL C  2  137  ? 63.761  -19.859 74.379   1.00 0.99   ? 137  VAL C C     1 
ATOM   4610  O  O     . VAL C  2  137  ? 63.845  -19.772 73.163   1.00 1.25   ? 137  VAL C O     1 
ATOM   4611  C  CB    . VAL C  2  137  ? 63.105  -17.591 75.230   1.00 1.07   ? 137  VAL C CB    1 
ATOM   4612  C  CG1   . VAL C  2  137  ? 61.737  -18.161 75.487   1.00 1.82   ? 137  VAL C CG1   1 
ATOM   4613  C  CG2   . VAL C  2  137  ? 63.427  -16.544 76.259   1.00 1.02   ? 137  VAL C CG2   1 
ATOM   4614  N  N     . SER C  2  138  ? 63.333  -20.956 74.991   1.00 1.08   ? 138  SER C N     1 
ATOM   4615  C  CA    . SER C  2  138  ? 62.947  -22.145 74.229   1.00 1.88   ? 138  SER C CA    1 
ATOM   4616  C  C     . SER C  2  138  ? 61.679  -21.903 73.422   1.00 1.55   ? 138  SER C C     1 
ATOM   4617  O  O     . SER C  2  138  ? 60.895  -21.022 73.739   1.00 1.98   ? 138  SER C O     1 
ATOM   4618  C  CB    . SER C  2  138  ? 62.752  -23.340 75.159   1.00 1.31   ? 138  SER C CB    1 
ATOM   4619  O  OG    . SER C  2  138  ? 63.793  -23.393 76.114   1.00 1.56   ? 138  SER C OG    1 
ATOM   4620  N  N     . GLN C  2  139  ? 61.468  -22.686 72.378   1.00 1.54   ? 139  GLN C N     1 
ATOM   4621  C  CA    . GLN C  2  139  ? 60.320  -22.432 71.524   1.00 2.94   ? 139  GLN C CA    1 
ATOM   4622  C  C     . GLN C  2  139  ? 59.412  -23.649 71.350   1.00 3.20   ? 139  GLN C C     1 
ATOM   4623  O  O     . GLN C  2  139  ? 59.832  -24.672 70.831   1.00 2.95   ? 139  GLN C O     1 
ATOM   4624  C  CB    . GLN C  2  139  ? 60.787  -21.923 70.161   1.00 2.71   ? 139  GLN C CB    1 
ATOM   4625  C  CG    . GLN C  2  139  ? 59.657  -21.620 69.215   1.00 3.80   ? 139  GLN C CG    1 
ATOM   4626  C  CD    . GLN C  2  139  ? 60.138  -21.284 67.828   1.00 9.12   ? 139  GLN C CD    1 
ATOM   4627  O  OE1   . GLN C  2  139  ? 61.202  -21.728 67.403   1.00 13.17  ? 139  GLN C OE1   1 
ATOM   4628  N  NE2   . GLN C  2  139  ? 59.355  -20.491 67.109   1.00 19.57  ? 139  GLN C NE2   1 
ATOM   4629  N  N     . ILE C  2  140  ? 58.158  -23.539 71.769   1.00 2.82   ? 140  ILE C N     1 
ATOM   4630  C  CA    . ILE C  2  140  ? 57.224  -24.632 71.530   1.00 3.24   ? 140  ILE C CA    1 
ATOM   4631  C  C     . ILE C  2  140  ? 56.686  -24.562 70.104   1.00 3.52   ? 140  ILE C C     1 
ATOM   4632  O  O     . ILE C  2  140  ? 56.489  -23.471 69.560   1.00 4.84   ? 140  ILE C O     1 
ATOM   4633  C  CB    . ILE C  2  140  ? 56.073  -24.643 72.558   1.00 3.32   ? 140  ILE C CB    1 
ATOM   4634  C  CG1   . ILE C  2  140  ? 55.236  -25.920 72.426   1.00 1.89   ? 140  ILE C CG1   1 
ATOM   4635  C  CG2   . ILE C  2  140  ? 55.224  -23.383 72.434   1.00 3.79   ? 140  ILE C CG2   1 
ATOM   4636  C  CD1   . ILE C  2  140  ? 54.390  -26.220 73.645   1.00 1.72   ? 140  ILE C CD1   1 
ATOM   4637  N  N     . HIS C  2  141  ? 56.486  -25.719 69.481   1.00 2.74   ? 141  HIS C N     1 
ATOM   4638  C  CA    . HIS C  2  141  ? 55.890  -25.742 68.149   1.00 3.04   ? 141  HIS C CA    1 
ATOM   4639  C  C     . HIS C  2  141  ? 55.299  -27.094 67.807   1.00 3.28   ? 141  HIS C C     1 
ATOM   4640  O  O     . HIS C  2  141  ? 55.349  -28.018 68.604   1.00 3.45   ? 141  HIS C O     1 
ATOM   4641  C  CB    . HIS C  2  141  ? 56.906  -25.336 67.084   1.00 3.84   ? 141  HIS C CB    1 
ATOM   4642  C  CG    . HIS C  2  141  ? 57.958  -26.368 66.821   1.00 4.03   ? 141  HIS C CG    1 
ATOM   4643  N  ND1   . HIS C  2  141  ? 58.449  -26.620 65.559   1.00 4.55   ? 141  HIS C ND1   1 
ATOM   4644  C  CD2   . HIS C  2  141  ? 58.621  -27.200 67.658   1.00 4.06   ? 141  HIS C CD2   1 
ATOM   4645  C  CE1   . HIS C  2  141  ? 59.367  -27.568 65.628   1.00 4.47   ? 141  HIS C CE1   1 
ATOM   4646  N  NE2   . HIS C  2  141  ? 59.493  -27.934 66.890   1.00 4.28   ? 141  HIS C NE2   1 
ATOM   4647  N  N     . ARG C  2  142  ? 54.728  -27.201 66.615   1.00 5.16   ? 142  ARG C N     1 
ATOM   4648  C  CA    . ARG C  2  142  ? 54.175  -28.467 66.159   1.00 5.13   ? 142  ARG C CA    1 
ATOM   4649  C  C     . ARG C  2  142  ? 55.310  -29.411 65.858   1.00 6.74   ? 142  ARG C C     1 
ATOM   4650  O  O     . ARG C  2  142  ? 56.210  -29.085 65.079   1.00 10.07  ? 142  ARG C O     1 
ATOM   4651  C  CB    . ARG C  2  142  ? 53.338  -28.283 64.899   1.00 6.39   ? 142  ARG C CB    1 
ATOM   4652  C  CG    . ARG C  2  142  ? 52.190  -27.316 65.053   1.00 11.01  ? 142  ARG C CG    1 
ATOM   4653  C  CD    . ARG C  2  142  ? 51.198  -27.515 63.938   1.00 19.19  ? 142  ARG C CD    1 
ATOM   4654  N  NE    . ARG C  2  142  ? 50.614  -28.846 64.006   1.00 26.04  ? 142  ARG C NE    1 
ATOM   4655  C  CZ    . ARG C  2  142  ? 49.858  -29.377 63.055   1.00 20.62  ? 142  ARG C CZ    1 
ATOM   4656  N  NH1   . ARG C  2  142  ? 49.595  -28.686 61.952   1.00 18.20  ? 142  ARG C NH1   1 
ATOM   4657  N  NH2   . ARG C  2  142  ? 49.373  -30.600 63.211   1.00 19.00  ? 142  ARG C NH2   1 
ATOM   4658  N  N     . SER C  2  143  ? 55.275  -30.579 66.484   1.00 6.17   ? 143  SER C N     1 
ATOM   4659  C  CA    . SER C  2  143  ? 56.259  -31.602 66.205   1.00 6.53   ? 143  SER C CA    1 
ATOM   4660  C  C     . SER C  2  143  ? 56.128  -31.995 64.754   1.00 6.78   ? 143  SER C C     1 
ATOM   4661  O  O     . SER C  2  143  ? 55.021  -32.087 64.233   1.00 9.18   ? 143  SER C O     1 
ATOM   4662  C  CB    . SER C  2  143  ? 56.011  -32.827 67.077   1.00 8.76   ? 143  SER C CB    1 
ATOM   4663  O  OG    . SER C  2  143  ? 56.696  -33.950 66.554   1.00 13.13  ? 143  SER C OG    1 
ATOM   4664  N  N     . PRO C  2  144  ? 57.259  -32.204 64.084   1.00 5.47   ? 144  PRO C N     1 
ATOM   4665  C  CA    . PRO C  2  144  ? 57.189  -32.834 62.771   1.00 8.15   ? 144  PRO C CA    1 
ATOM   4666  C  C     . PRO C  2  144  ? 56.529  -34.205 62.902   1.00 10.71  ? 144  PRO C C     1 
ATOM   4667  O  O     . PRO C  2  144  ? 56.473  -34.755 64.001   1.00 10.75  ? 144  PRO C O     1 
ATOM   4668  C  CB    . PRO C  2  144  ? 58.660  -32.979 62.384   1.00 9.18   ? 144  PRO C CB    1 
ATOM   4669  C  CG    . PRO C  2  144  ? 59.336  -31.886 63.095   1.00 8.41   ? 144  PRO C CG    1 
ATOM   4670  C  CD    . PRO C  2  144  ? 58.607  -31.707 64.392   1.00 7.19   ? 144  PRO C CD    1 
ATOM   4671  N  N     . GLY C  2  145  ? 56.008  -34.732 61.803   1.00 9.56   ? 145  GLY C N     1 
ATOM   4672  C  CA    . GLY C  2  145  ? 55.354  -36.020 61.807   1.00 9.79   ? 145  GLY C CA    1 
ATOM   4673  C  C     . GLY C  2  145  ? 54.241  -36.051 60.785   1.00 12.78  ? 145  GLY C C     1 
ATOM   4674  O  O     . GLY C  2  145  ? 54.172  -35.200 59.898   1.00 11.69  ? 145  GLY C O     1 
ATOM   4675  N  N     . VAL C  2  146  ? 53.366  -37.040 60.916   1.00 16.09  ? 146  VAL C N     1 
ATOM   4676  C  CA    . VAL C  2  146  ? 52.237  -37.198 60.014   1.00 14.03  ? 146  VAL C CA    1 
ATOM   4677  C  C     . VAL C  2  146  ? 50.954  -37.151 60.826   1.00 12.85  ? 146  VAL C C     1 
ATOM   4678  O  O     . VAL C  2  146  ? 50.768  -37.942 61.751   1.00 13.25  ? 146  VAL C O     1 
ATOM   4679  C  CB    . VAL C  2  146  ? 52.318  -38.527 59.240   1.00 17.28  ? 146  VAL C CB    1 
ATOM   4680  C  CG1   . VAL C  2  146  ? 51.013  -38.800 58.513   1.00 18.15  ? 146  VAL C CG1   1 
ATOM   4681  C  CG2   . VAL C  2  146  ? 53.494  -38.509 58.268   1.00 11.03  ? 146  VAL C CG2   1 
ATOM   4682  N  N     . TYR C  2  147  ? 50.078  -36.215 60.477   1.00 13.32  ? 147  TYR C N     1 
ATOM   4683  C  CA    . TYR C  2  147  ? 48.889  -35.935 61.267   1.00 12.89  ? 147  TYR C CA    1 
ATOM   4684  C  C     . TYR C  2  147  ? 47.665  -36.120 60.419   1.00 10.42  ? 147  TYR C C     1 
ATOM   4685  O  O     . TYR C  2  147  ? 47.749  -36.090 59.205   1.00 11.30  ? 147  TYR C O     1 
ATOM   4686  C  CB    . TYR C  2  147  ? 48.928  -34.495 61.782   1.00 16.58  ? 147  TYR C CB    1 
ATOM   4687  C  CG    . TYR C  2  147  ? 50.075  -34.231 62.724   1.00 13.44  ? 147  TYR C CG    1 
ATOM   4688  C  CD1   . TYR C  2  147  ? 51.322  -33.857 62.237   1.00 9.52   ? 147  TYR C CD1   1 
ATOM   4689  C  CD2   . TYR C  2  147  ? 49.917  -34.380 64.098   1.00 10.12  ? 147  TYR C CD2   1 
ATOM   4690  C  CE1   . TYR C  2  147  ? 52.377  -33.630 63.090   1.00 10.45  ? 147  TYR C CE1   1 
ATOM   4691  C  CE2   . TYR C  2  147  ? 50.965  -34.154 64.963   1.00 10.74  ? 147  TYR C CE2   1 
ATOM   4692  C  CZ    . TYR C  2  147  ? 52.196  -33.776 64.454   1.00 14.17  ? 147  TYR C CZ    1 
ATOM   4693  O  OH    . TYR C  2  147  ? 53.252  -33.545 65.312   1.00 14.58  ? 147  TYR C OH    1 
ATOM   4694  N  N     . PHE C  2  148  ? 46.526  -36.332 61.061   1.00 11.36  ? 148  PHE C N     1 
ATOM   4695  C  CA    . PHE C  2  148  ? 45.265  -36.414 60.341   1.00 14.23  ? 148  PHE C CA    1 
ATOM   4696  C  C     . PHE C  2  148  ? 44.210  -35.591 61.065   1.00 17.96  ? 148  PHE C C     1 
ATOM   4697  O  O     . PHE C  2  148  ? 43.846  -35.889 62.204   1.00 20.42  ? 148  PHE C O     1 
ATOM   4698  C  CB    . PHE C  2  148  ? 44.813  -37.870 60.194   1.00 14.77  ? 148  PHE C CB    1 
ATOM   4699  C  CG    . PHE C  2  148  ? 45.841  -38.761 59.553   1.00 19.46  ? 148  PHE C CG    1 
ATOM   4700  C  CD1   . PHE C  2  148  ? 46.854  -39.337 60.314   1.00 17.33  ? 148  PHE C CD1   1 
ATOM   4701  C  CD2   . PHE C  2  148  ? 45.801  -39.022 58.194   1.00 17.63  ? 148  PHE C CD2   1 
ATOM   4702  C  CE1   . PHE C  2  148  ? 47.806  -40.146 59.729   1.00 13.64  ? 148  PHE C CE1   1 
ATOM   4703  C  CE2   . PHE C  2  148  ? 46.750  -39.836 57.604   1.00 17.65  ? 148  PHE C CE2   1 
ATOM   4704  C  CZ    . PHE C  2  148  ? 47.753  -40.396 58.373   1.00 17.56  ? 148  PHE C CZ    1 
ATOM   4705  N  N     . THR C  2  149  ? 43.720  -34.552 60.400   1.00 18.12  ? 149  THR C N     1 
ATOM   4706  C  CA    . THR C  2  149  ? 42.712  -33.685 60.998   1.00 22.40  ? 149  THR C CA    1 
ATOM   4707  C  C     . THR C  2  149  ? 41.413  -33.746 60.196   1.00 25.29  ? 149  THR C C     1 
ATOM   4708  O  O     . THR C  2  149  ? 41.430  -34.071 59.011   1.00 23.02  ? 149  THR C O     1 
ATOM   4709  C  CB    . THR C  2  149  ? 43.215  -32.226 61.100   1.00 20.23  ? 149  THR C CB    1 
ATOM   4710  O  OG1   . THR C  2  149  ? 43.619  -31.761 59.805   1.00 16.65  ? 149  THR C OG1   1 
ATOM   4711  C  CG2   . THR C  2  149  ? 44.395  -32.139 62.054   1.00 14.59  ? 149  THR C CG2   1 
ATOM   4712  N  N     . PRO C  2  150  ? 40.276  -33.458 60.843   1.00 25.26  ? 150  PRO C N     1 
ATOM   4713  C  CA    . PRO C  2  150  ? 39.021  -33.420 60.088   1.00 24.74  ? 150  PRO C CA    1 
ATOM   4714  C  C     . PRO C  2  150  ? 39.006  -32.257 59.103   1.00 37.31  ? 150  PRO C C     1 
ATOM   4715  O  O     . PRO C  2  150  ? 39.452  -31.162 59.448   1.00 41.62  ? 150  PRO C O     1 
ATOM   4716  C  CB    . PRO C  2  150  ? 37.968  -33.192 61.173   1.00 22.01  ? 150  PRO C CB    1 
ATOM   4717  C  CG    . PRO C  2  150  ? 38.608  -33.650 62.435   1.00 28.98  ? 150  PRO C CG    1 
ATOM   4718  C  CD    . PRO C  2  150  ? 40.055  -33.306 62.290   1.00 27.51  ? 150  PRO C CD    1 
ATOM   4719  N  N     . ASP C  2  151  ? 38.519  -32.502 57.889   1.00 43.10  ? 151  ASP C N     1 
ATOM   4720  C  CA    . ASP C  2  151  ? 38.301  -31.440 56.911   1.00 42.15  ? 151  ASP C CA    1 
ATOM   4721  C  C     . ASP C  2  151  ? 37.150  -30.577 57.421   1.00 46.76  ? 151  ASP C C     1 
ATOM   4722  O  O     . ASP C  2  151  ? 36.034  -31.070 57.604   1.00 49.59  ? 151  ASP C O     1 
ATOM   4723  C  CB    . ASP C  2  151  ? 37.961  -32.045 55.542   1.00 42.95  ? 151  ASP C CB    1 
ATOM   4724  C  CG    . ASP C  2  151  ? 38.005  -31.025 54.409   1.00 50.32  ? 151  ASP C CG    1 
ATOM   4725  O  OD1   . ASP C  2  151  ? 37.688  -29.840 54.641   1.00 52.47  ? 151  ASP C OD1   1 
ATOM   4726  O  OD2   . ASP C  2  151  ? 38.351  -31.419 53.273   1.00 49.82  ? 151  ASP C OD2   1 
ATOM   4727  N  N     . PRO C  2  152  ? 37.420  -29.285 57.667   1.00 46.04  ? 152  PRO C N     1 
ATOM   4728  C  CA    . PRO C  2  152  ? 36.407  -28.397 58.252   1.00 48.74  ? 152  PRO C CA    1 
ATOM   4729  C  C     . PRO C  2  152  ? 35.242  -28.188 57.290   1.00 52.61  ? 152  PRO C C     1 
ATOM   4730  O  O     . PRO C  2  152  ? 34.103  -27.991 57.715   1.00 44.49  ? 152  PRO C O     1 
ATOM   4731  C  CB    . PRO C  2  152  ? 37.167  -27.078 58.452   1.00 47.69  ? 152  PRO C CB    1 
ATOM   4732  C  CG    . PRO C  2  152  ? 38.627  -27.425 58.302   1.00 43.96  ? 152  PRO C CG    1 
ATOM   4733  C  CD    . PRO C  2  152  ? 38.668  -28.570 57.355   1.00 38.63  ? 152  PRO C CD    1 
ATOM   4734  N  N     . ALA C  2  153  ? 35.541  -28.248 55.997   1.00 57.33  ? 153  ALA C N     1 
ATOM   4735  C  CA    . ALA C  2  153  ? 34.548  -28.024 54.954   1.00 58.84  ? 153  ALA C CA    1 
ATOM   4736  C  C     . ALA C  2  153  ? 33.594  -29.202 54.783   1.00 52.18  ? 153  ALA C C     1 
ATOM   4737  O  O     . ALA C  2  153  ? 32.383  -29.017 54.671   1.00 65.85  ? 153  ALA C O     1 
ATOM   4738  C  CB    . ALA C  2  153  ? 35.238  -27.708 53.628   1.00 53.20  ? 153  ALA C CB    1 
ATOM   4739  N  N     . ARG C  2  154  ? 34.138  -30.412 54.761   1.00 43.98  ? 154  ARG C N     1 
ATOM   4740  C  CA    . ARG C  2  154  ? 33.341  -31.586 54.429   1.00 47.62  ? 154  ARG C CA    1 
ATOM   4741  C  C     . ARG C  2  154  ? 33.379  -32.650 55.525   1.00 43.42  ? 154  ARG C C     1 
ATOM   4742  O  O     . ARG C  2  154  ? 34.140  -33.609 55.420   1.00 45.75  ? 154  ARG C O     1 
ATOM   4743  C  CB    . ARG C  2  154  ? 33.835  -32.183 53.107   1.00 55.54  ? 154  ARG C CB    1 
ATOM   4744  C  CG    . ARG C  2  154  ? 33.809  -31.210 51.929   1.00 52.86  ? 154  ARG C CG    1 
ATOM   4745  C  CD    . ARG C  2  154  ? 34.969  -31.438 50.959   1.00 50.70  ? 154  ARG C CD    1 
ATOM   4746  N  NE    . ARG C  2  154  ? 35.204  -32.852 50.662   1.00 59.75  ? 154  ARG C NE    1 
ATOM   4747  C  CZ    . ARG C  2  154  ? 34.485  -33.576 49.807   1.00 61.84  ? 154  ARG C CZ    1 
ATOM   4748  N  NH1   . ARG C  2  154  ? 33.463  -33.028 49.163   1.00 70.00  ? 154  ARG C NH1   1 
ATOM   4749  N  NH2   . ARG C  2  154  ? 34.781  -34.854 49.601   1.00 51.08  ? 154  ARG C NH2   1 
ATOM   4750  N  N     . PRO C  2  155  ? 32.558  -32.483 56.579   1.00 46.88  ? 155  PRO C N     1 
ATOM   4751  C  CA    . PRO C  2  155  ? 32.491  -33.456 57.679   1.00 50.85  ? 155  PRO C CA    1 
ATOM   4752  C  C     . PRO C  2  155  ? 32.288  -34.884 57.177   1.00 46.71  ? 155  PRO C C     1 
ATOM   4753  O  O     . PRO C  2  155  ? 31.424  -35.128 56.336   1.00 45.96  ? 155  PRO C O     1 
ATOM   4754  C  CB    . PRO C  2  155  ? 31.270  -32.990 58.473   1.00 38.74  ? 155  PRO C CB    1 
ATOM   4755  C  CG    . PRO C  2  155  ? 31.260  -31.515 58.271   1.00 38.65  ? 155  PRO C CG    1 
ATOM   4756  C  CD    . PRO C  2  155  ? 31.720  -31.300 56.848   1.00 46.34  ? 155  PRO C CD    1 
ATOM   4757  N  N     . GLY C  2  156  ? 33.088  -35.811 57.693   1.00 44.71  ? 156  GLY C N     1 
ATOM   4758  C  CA    . GLY C  2  156  ? 33.116  -37.167 57.177   1.00 42.11  ? 156  GLY C CA    1 
ATOM   4759  C  C     . GLY C  2  156  ? 34.318  -37.393 56.275   1.00 48.94  ? 156  GLY C C     1 
ATOM   4760  O  O     . GLY C  2  156  ? 34.575  -38.519 55.841   1.00 48.44  ? 156  GLY C O     1 
ATOM   4761  N  N     . ARG C  2  157  ? 35.047  -36.315 55.985   1.00 42.15  ? 157  ARG C N     1 
ATOM   4762  C  CA    . ARG C  2  157  ? 36.273  -36.389 55.190   1.00 37.43  ? 157  ARG C CA    1 
ATOM   4763  C  C     . ARG C  2  157  ? 37.447  -35.824 55.976   1.00 37.46  ? 157  ARG C C     1 
ATOM   4764  O  O     . ARG C  2  157  ? 37.253  -35.053 56.919   1.00 34.67  ? 157  ARG C O     1 
ATOM   4765  C  CB    . ARG C  2  157  ? 36.116  -35.648 53.861   1.00 38.81  ? 157  ARG C CB    1 
ATOM   4766  C  CG    . ARG C  2  157  ? 35.109  -36.286 52.923   1.00 44.55  ? 157  ARG C CG    1 
ATOM   4767  C  CD    . ARG C  2  157  ? 35.404  -37.766 52.733   1.00 47.64  ? 157  ARG C CD    1 
ATOM   4768  N  NE    . ARG C  2  157  ? 34.443  -38.410 51.844   1.00 46.51  ? 157  ARG C NE    1 
ATOM   4769  C  CZ    . ARG C  2  157  ? 34.543  -38.418 50.517   1.00 62.74  ? 157  ARG C CZ    1 
ATOM   4770  N  NH1   . ARG C  2  157  ? 35.563  -37.813 49.919   1.00 48.84  ? 157  ARG C NH1   1 
ATOM   4771  N  NH2   . ARG C  2  157  ? 33.621  -39.029 49.786   1.00 81.15  ? 157  ARG C NH2   1 
ATOM   4772  N  N     . TYR C  2  158  ? 38.662  -36.204 55.585   1.00 34.15  ? 158  TYR C N     1 
ATOM   4773  C  CA    . TYR C  2  158  ? 39.850  -35.874 56.372   1.00 26.60  ? 158  TYR C CA    1 
ATOM   4774  C  C     . TYR C  2  158  ? 41.007  -35.305 55.549   1.00 26.63  ? 158  TYR C C     1 
ATOM   4775  O  O     . TYR C  2  158  ? 41.045  -35.440 54.323   1.00 31.61  ? 158  TYR C O     1 
ATOM   4776  C  CB    . TYR C  2  158  ? 40.315  -37.104 57.169   1.00 26.33  ? 158  TYR C CB    1 
ATOM   4777  C  CG    . TYR C  2  158  ? 39.268  -37.618 58.136   1.00 30.09  ? 158  TYR C CG    1 
ATOM   4778  C  CD1   . TYR C  2  158  ? 39.147  -37.078 59.409   1.00 28.48  ? 158  TYR C CD1   1 
ATOM   4779  C  CD2   . TYR C  2  158  ? 38.387  -38.632 57.769   1.00 29.60  ? 158  TYR C CD2   1 
ATOM   4780  C  CE1   . TYR C  2  158  ? 38.186  -37.533 60.290   1.00 29.69  ? 158  TYR C CE1   1 
ATOM   4781  C  CE2   . TYR C  2  158  ? 37.420  -39.093 58.646   1.00 25.72  ? 158  TYR C CE2   1 
ATOM   4782  C  CZ    . TYR C  2  158  ? 37.326  -38.539 59.906   1.00 30.00  ? 158  TYR C CZ    1 
ATOM   4783  O  OH    . TYR C  2  158  ? 36.371  -38.984 60.792   1.00 40.78  ? 158  TYR C OH    1 
ATOM   4784  N  N     . ILE C  2  159  ? 41.937  -34.656 56.245   1.00 23.98  ? 159  ILE C N     1 
ATOM   4785  C  CA    . ILE C  2  159  ? 43.172  -34.155 55.657   1.00 19.01  ? 159  ILE C CA    1 
ATOM   4786  C  C     . ILE C  2  159  ? 44.356  -34.817 56.335   1.00 18.07  ? 159  ILE C C     1 
ATOM   4787  O  O     . ILE C  2  159  ? 44.484  -34.776 57.561   1.00 23.89  ? 159  ILE C O     1 
ATOM   4788  C  CB    . ILE C  2  159  ? 43.347  -32.650 55.897   1.00 19.45  ? 159  ILE C CB    1 
ATOM   4789  C  CG1   . ILE C  2  159  ? 42.153  -31.863 55.358   1.00 29.01  ? 159  ILE C CG1   1 
ATOM   4790  C  CG2   . ILE C  2  159  ? 44.652  -32.169 55.284   1.00 16.07  ? 159  ILE C CG2   1 
ATOM   4791  C  CD1   . ILE C  2  159  ? 42.180  -31.668 53.870   1.00 37.51  ? 159  ILE C CD1   1 
ATOM   4792  N  N     . ALA C  2  160  ? 45.226  -35.426 55.546   1.00 16.57  ? 160  ALA C N     1 
ATOM   4793  C  CA    . ALA C  2  160  ? 46.482  -35.922 56.075   1.00 18.01  ? 160  ALA C CA    1 
ATOM   4794  C  C     . ALA C  2  160  ? 47.533  -34.851 55.849   1.00 16.10  ? 160  ALA C C     1 
ATOM   4795  O  O     . ALA C  2  160  ? 47.614  -34.273 54.772   1.00 17.40  ? 160  ALA C O     1 
ATOM   4796  C  CB    . ALA C  2  160  ? 46.878  -37.213 55.389   1.00 20.23  ? 160  ALA C CB    1 
ATOM   4797  N  N     . SER C  2  161  ? 48.335  -34.577 56.866   1.00 14.95  ? 161  SER C N     1 
ATOM   4798  C  CA    . SER C  2  161  ? 49.362  -33.557 56.753   1.00 17.99  ? 161  SER C CA    1 
ATOM   4799  C  C     . SER C  2  161  ? 50.732  -34.124 57.096   1.00 14.79  ? 161  SER C C     1 
ATOM   4800  O  O     . SER C  2  161  ? 50.912  -34.760 58.130   1.00 16.21  ? 161  SER C O     1 
ATOM   4801  C  CB    . SER C  2  161  ? 49.030  -32.371 57.658   1.00 19.96  ? 161  SER C CB    1 
ATOM   4802  O  OG    . SER C  2  161  ? 47.712  -31.912 57.413   1.00 20.91  ? 161  SER C OG    1 
ATOM   4803  N  N     . ILE C  2  162  ? 51.694  -33.894 56.212   1.00 12.90  ? 162  ILE C N     1 
ATOM   4804  C  CA    . ILE C  2  162  ? 53.063  -34.315 56.449   1.00 13.69  ? 162  ILE C CA    1 
ATOM   4805  C  C     . ILE C  2  162  ? 53.932  -33.102 56.757   1.00 13.54  ? 162  ILE C C     1 
ATOM   4806  O  O     . ILE C  2  162  ? 54.177  -32.257 55.896   1.00 13.75  ? 162  ILE C O     1 
ATOM   4807  C  CB    . ILE C  2  162  ? 53.619  -35.092 55.252   1.00 15.04  ? 162  ILE C CB    1 
ATOM   4808  C  CG1   . ILE C  2  162  ? 52.839  -36.400 55.081   1.00 14.20  ? 162  ILE C CG1   1 
ATOM   4809  C  CG2   . ILE C  2  162  ? 55.107  -35.354 55.436   1.00 12.50  ? 162  ILE C CG2   1 
ATOM   4810  C  CD1   . ILE C  2  162  ? 53.211  -37.196 53.839   1.00 15.73  ? 162  ILE C CD1   1 
ATOM   4811  N  N     . ILE C  2  163  ? 54.374  -33.016 58.005   1.00 12.31  ? 163  ILE C N     1 
ATOM   4812  C  CA    . ILE C  2  163  ? 55.094  -31.849 58.492   1.00 15.18  ? 163  ILE C CA    1 
ATOM   4813  C  C     . ILE C  2  163  ? 56.538  -32.174 58.867   1.00 11.29  ? 163  ILE C C     1 
ATOM   4814  O  O     . ILE C  2  163  ? 56.780  -33.045 59.683   1.00 7.67   ? 163  ILE C O     1 
ATOM   4815  C  CB    . ILE C  2  163  ? 54.364  -31.222 59.696   1.00 18.36  ? 163  ILE C CB    1 
ATOM   4816  C  CG1   . ILE C  2  163  ? 52.926  -30.857 59.311   1.00 13.60  ? 163  ILE C CG1   1 
ATOM   4817  C  CG2   . ILE C  2  163  ? 55.120  -30.000 60.210   1.00 18.12  ? 163  ILE C CG2   1 
ATOM   4818  C  CD1   . ILE C  2  163  ? 52.095  -30.364 60.470   1.00 13.84  ? 163  ILE C CD1   1 
ATOM   4819  N  N     . PRO C  2  164  ? 57.506  -31.504 58.230   1.00 10.56  ? 164  PRO C N     1 
ATOM   4820  C  CA    . PRO C  2  164  ? 58.922  -31.631 58.575   1.00 13.16  ? 164  PRO C CA    1 
ATOM   4821  C  C     . PRO C  2  164  ? 59.333  -30.557 59.582   1.00 16.69  ? 164  PRO C C     1 
ATOM   4822  O  O     . PRO C  2  164  ? 58.474  -29.804 60.042   1.00 18.65  ? 164  PRO C O     1 
ATOM   4823  C  CB    . PRO C  2  164  ? 59.605  -31.379 57.241   1.00 16.62  ? 164  PRO C CB    1 
ATOM   4824  C  CG    . PRO C  2  164  ? 58.737  -30.356 56.613   1.00 18.47  ? 164  PRO C CG    1 
ATOM   4825  C  CD    . PRO C  2  164  ? 57.318  -30.642 57.054   1.00 14.30  ? 164  PRO C CD    1 
ATOM   4826  N  N     . LEU C  2  165  ? 60.618  -30.494 59.925   1.00 14.68  ? 165  LEU C N     1 
ATOM   4827  C  CA    . LEU C  2  165  ? 61.124  -29.427 60.786   1.00 15.13  ? 165  LEU C CA    1 
ATOM   4828  C  C     . LEU C  2  165  ? 61.003  -28.074 60.077   1.00 19.56  ? 165  LEU C C     1 
ATOM   4829  O  O     . LEU C  2  165  ? 60.910  -28.018 58.846   1.00 16.85  ? 165  LEU C O     1 
ATOM   4830  C  CB    . LEU C  2  165  ? 62.584  -29.686 61.174   1.00 15.67  ? 165  LEU C CB    1 
ATOM   4831  C  CG    . LEU C  2  165  ? 62.970  -30.944 61.951   1.00 15.25  ? 165  LEU C CG    1 
ATOM   4832  C  CD1   . LEU C  2  165  ? 64.432  -31.249 61.702   1.00 19.97  ? 165  LEU C CD1   1 
ATOM   4833  C  CD2   . LEU C  2  165  ? 62.720  -30.778 63.437   1.00 9.67   ? 165  LEU C CD2   1 
ATOM   4834  N  N     . PRO C  2  166  ? 60.981  -26.976 60.853   1.00 20.84  ? 166  PRO C N     1 
ATOM   4835  C  CA    . PRO C  2  166  ? 60.917  -25.628 60.284   1.00 17.43  ? 166  PRO C CA    1 
ATOM   4836  C  C     . PRO C  2  166  ? 62.061  -25.340 59.317   1.00 21.92  ? 166  PRO C C     1 
ATOM   4837  O  O     . PRO C  2  166  ? 63.221  -25.642 59.615   1.00 23.87  ? 166  PRO C O     1 
ATOM   4838  C  CB    . PRO C  2  166  ? 61.034  -24.735 61.517   1.00 16.20  ? 166  PRO C CB    1 
ATOM   4839  C  CG    . PRO C  2  166  ? 60.415  -25.529 62.592   1.00 13.46  ? 166  PRO C CG    1 
ATOM   4840  C  CD    . PRO C  2  166  ? 60.827  -26.949 62.319   1.00 17.50  ? 166  PRO C CD    1 
ATOM   4841  N  N     . LYS C  2  167  ? 61.707  -24.772 58.166   1.00 16.16  ? 167  LYS C N     1 
ATOM   4842  C  CA    . LYS C  2  167  ? 62.642  -24.434 57.093   1.00 21.31  ? 167  LYS C CA    1 
ATOM   4843  C  C     . LYS C  2  167  ? 63.376  -25.675 56.576   1.00 22.88  ? 167  LYS C C     1 
ATOM   4844  O  O     . LYS C  2  167  ? 64.400  -25.576 55.898   1.00 23.97  ? 167  LYS C O     1 
ATOM   4845  C  CB    . LYS C  2  167  ? 63.648  -23.374 57.575   1.00 24.26  ? 167  LYS C CB    1 
ATOM   4846  C  CG    . LYS C  2  167  ? 63.057  -21.984 57.849   1.00 16.58  ? 167  LYS C CG    1 
ATOM   4847  C  CD    . LYS C  2  167  ? 63.240  -21.055 56.651   1.00 27.78  ? 167  LYS C CD    1 
ATOM   4848  C  CE    . LYS C  2  167  ? 62.992  -19.586 57.010   1.00 44.20  ? 167  LYS C CE    1 
ATOM   4849  N  NZ    . LYS C  2  167  ? 63.277  -18.652 55.866   1.00 28.01  ? 167  LYS C NZ    1 
ATOM   4850  N  N     . ARG C  2  168  ? 62.812  -26.839 56.885   1.00 25.91  ? 168  ARG C N     1 
ATOM   4851  C  CA    . ARG C  2  168  ? 63.311  -28.145 56.444   1.00 22.77  ? 168  ARG C CA    1 
ATOM   4852  C  C     . ARG C  2  168  ? 62.567  -28.756 55.258   1.00 22.57  ? 168  ARG C C     1 
ATOM   4853  O  O     . ARG C  2  168  ? 62.634  -29.960 55.037   1.00 22.00  ? 168  ARG C O     1 
ATOM   4854  C  CB    . ARG C  2  168  ? 63.499  -29.119 57.603   1.00 26.04  ? 168  ARG C CB    1 
ATOM   4855  C  CG    . ARG C  2  168  ? 64.584  -28.672 58.583   1.00 28.22  ? 168  ARG C CG    1 
ATOM   4856  C  CD    . ARG C  2  168  ? 65.975  -29.152 58.194   1.00 31.33  ? 168  ARG C CD    1 
ATOM   4857  N  NE    . ARG C  2  168  ? 66.562  -28.405 57.088   1.00 31.94  ? 168  ARG C NE    1 
ATOM   4858  C  CZ    . ARG C  2  168  ? 67.816  -28.561 56.674   1.00 41.79  ? 168  ARG C CZ    1 
ATOM   4859  N  NH1   . ARG C  2  168  ? 68.608  -29.438 57.279   1.00 46.59  ? 168  ARG C NH1   1 
ATOM   4860  N  NH2   . ARG C  2  168  ? 68.279  -27.844 55.659   1.00 37.53  ? 168  ARG C NH2   1 
ATOM   4861  N  N     . GLY C  2  169  ? 61.790  -27.937 54.557   1.00 25.25  ? 169  GLY C N     1 
ATOM   4862  C  CA    . GLY C  2  169  ? 61.015  -28.405 53.423   1.00 23.43  ? 169  GLY C CA    1 
ATOM   4863  C  C     . GLY C  2  169  ? 59.509  -28.344 53.578   1.00 21.09  ? 169  GLY C C     1 
ATOM   4864  O  O     . GLY C  2  169  ? 58.998  -28.074 54.662   1.00 26.63  ? 169  GLY C O     1 
ATOM   4865  N  N     . PRO C  2  170  ? 58.791  -28.566 52.468   1.00 15.56  ? 170  PRO C N     1 
ATOM   4866  C  CA    . PRO C  2  170  ? 57.385  -28.199 52.298   1.00 17.87  ? 170  PRO C CA    1 
ATOM   4867  C  C     . PRO C  2  170  ? 56.431  -29.031 53.128   1.00 20.16  ? 170  PRO C C     1 
ATOM   4868  O  O     . PRO C  2  170  ? 56.654  -30.227 53.317   1.00 20.16  ? 170  PRO C O     1 
ATOM   4869  C  CB    . PRO C  2  170  ? 57.139  -28.489 50.821   1.00 21.77  ? 170  PRO C CB    1 
ATOM   4870  C  CG    . PRO C  2  170  ? 58.046  -29.626 50.529   1.00 23.46  ? 170  PRO C CG    1 
ATOM   4871  C  CD    . PRO C  2  170  ? 59.288  -29.358 51.331   1.00 20.29  ? 170  PRO C CD    1 
ATOM   4872  N  N     . TRP C  2  171  ? 55.377  -28.391 53.622   1.00 18.72  ? 171  TRP C N     1 
ATOM   4873  C  CA    . TRP C  2  171  ? 54.261  -29.118 54.194   1.00 20.01  ? 171  TRP C CA    1 
ATOM   4874  C  C     . TRP C  2  171  ? 53.503  -29.734 53.033   1.00 23.33  ? 171  TRP C C     1 
ATOM   4875  O  O     . TRP C  2  171  ? 53.318  -29.092 51.997   1.00 29.18  ? 171  TRP C O     1 
ATOM   4876  C  CB    . TRP C  2  171  ? 53.335  -28.189 54.977   1.00 19.81  ? 171  TRP C CB    1 
ATOM   4877  C  CG    . TRP C  2  171  ? 53.886  -27.740 56.283   1.00 21.69  ? 171  TRP C CG    1 
ATOM   4878  C  CD1   . TRP C  2  171  ? 55.198  -27.510 56.587   1.00 23.17  ? 171  TRP C CD1   1 
ATOM   4879  C  CD2   . TRP C  2  171  ? 53.143  -27.472 57.478   1.00 23.01  ? 171  TRP C CD2   1 
ATOM   4880  N  NE1   . TRP C  2  171  ? 55.316  -27.110 57.898   1.00 27.30  ? 171  TRP C NE1   1 
ATOM   4881  C  CE2   . TRP C  2  171  ? 54.070  -27.078 58.467   1.00 27.61  ? 171  TRP C CE2   1 
ATOM   4882  C  CE3   . TRP C  2  171  ? 51.785  -27.523 57.807   1.00 22.57  ? 171  TRP C CE3   1 
ATOM   4883  C  CZ2   . TRP C  2  171  ? 53.680  -26.738 59.766   1.00 24.13  ? 171  TRP C CZ2   1 
ATOM   4884  C  CZ3   . TRP C  2  171  ? 51.399  -27.187 59.098   1.00 25.57  ? 171  TRP C CZ3   1 
ATOM   4885  C  CH2   . TRP C  2  171  ? 52.345  -26.800 60.061   1.00 27.70  ? 171  TRP C CH2   1 
ATOM   4886  N  N     . ILE C  2  172  ? 53.072  -30.978 53.197   1.00 18.70  ? 172  ILE C N     1 
ATOM   4887  C  CA    . ILE C  2  172  ? 52.349  -31.661 52.138   1.00 18.11  ? 172  ILE C CA    1 
ATOM   4888  C  C     . ILE C  2  172  ? 50.985  -32.075 52.632   1.00 15.87  ? 172  ILE C C     1 
ATOM   4889  O  O     . ILE C  2  172  ? 50.857  -32.609 53.728   1.00 16.32  ? 172  ILE C O     1 
ATOM   4890  C  CB    . ILE C  2  172  ? 53.115  -32.892 51.644   1.00 18.60  ? 172  ILE C CB    1 
ATOM   4891  C  CG1   . ILE C  2  172  ? 54.463  -32.460 51.071   1.00 20.72  ? 172  ILE C CG1   1 
ATOM   4892  C  CG2   . ILE C  2  172  ? 52.310  -33.636 50.594   1.00 20.38  ? 172  ILE C CG2   1 
ATOM   4893  C  CD1   . ILE C  2  172  ? 55.207  -33.560 50.402   1.00 18.93  ? 172  ILE C CD1   1 
ATOM   4894  N  N     . ASP C  2  173  ? 49.954  -31.814 51.839   1.00 22.39  ? 173  ASP C N     1 
ATOM   4895  C  CA    . ASP C  2  173  ? 48.621  -32.232 52.259   1.00 20.58  ? 173  ASP C CA    1 
ATOM   4896  C  C     . ASP C  2  173  ? 47.975  -33.249 51.330   1.00 25.94  ? 173  ASP C C     1 
ATOM   4897  O  O     . ASP C  2  173  ? 47.911  -33.059 50.121   1.00 26.23  ? 173  ASP C O     1 
ATOM   4898  C  CB    . ASP C  2  173  ? 47.708  -31.029 52.486   1.00 21.29  ? 173  ASP C CB    1 
ATOM   4899  C  CG    . ASP C  2  173  ? 47.729  -30.556 53.925   1.00 33.03  ? 173  ASP C CG    1 
ATOM   4900  O  OD1   . ASP C  2  173  ? 48.667  -30.939 54.660   1.00 28.32  ? 173  ASP C OD1   1 
ATOM   4901  O  OD2   . ASP C  2  173  ? 46.809  -29.809 54.326   1.00 46.47  ? 173  ASP C OD2   1 
ATOM   4902  N  N     . LEU C  2  174  ? 47.509  -34.342 51.920   1.00 25.29  ? 174  LEU C N     1 
ATOM   4903  C  CA    . LEU C  2  174  ? 46.818  -35.391 51.191   1.00 24.41  ? 174  LEU C CA    1 
ATOM   4904  C  C     . LEU C  2  174  ? 45.332  -35.297 51.501   1.00 26.47  ? 174  LEU C C     1 
ATOM   4905  O  O     . LEU C  2  174  ? 44.922  -35.402 52.655   1.00 31.69  ? 174  LEU C O     1 
ATOM   4906  C  CB    . LEU C  2  174  ? 47.357  -36.759 51.598   1.00 15.35  ? 174  LEU C CB    1 
ATOM   4907  C  CG    . LEU C  2  174  ? 48.581  -37.295 50.857   1.00 14.90  ? 174  LEU C CG    1 
ATOM   4908  C  CD1   . LEU C  2  174  ? 49.700  -36.274 50.735   1.00 14.33  ? 174  LEU C CD1   1 
ATOM   4909  C  CD2   . LEU C  2  174  ? 49.074  -38.546 51.552   1.00 25.39  ? 174  LEU C CD2   1 
ATOM   4910  N  N     . GLU C  2  175  ? 44.526  -35.085 50.471   1.00 32.11  ? 175  GLU C N     1 
ATOM   4911  C  CA    . GLU C  2  175  ? 43.098  -34.878 50.664   1.00 36.26  ? 175  GLU C CA    1 
ATOM   4912  C  C     . GLU C  2  175  ? 42.342  -35.812 49.736   1.00 40.55  ? 175  GLU C C     1 
ATOM   4913  O  O     . GLU C  2  175  ? 42.904  -36.283 48.754   1.00 42.63  ? 175  GLU C O     1 
ATOM   4914  C  CB    . GLU C  2  175  ? 42.762  -33.420 50.347   1.00 41.34  ? 175  GLU C CB    1 
ATOM   4915  C  CG    . GLU C  2  175  ? 41.331  -32.999 50.625   1.00 49.88  ? 175  GLU C CG    1 
ATOM   4916  C  CD    . GLU C  2  175  ? 41.176  -31.491 50.646   1.00 53.04  ? 175  GLU C CD    1 
ATOM   4917  O  OE1   . GLU C  2  175  ? 42.212  -30.795 50.743   1.00 49.36  ? 175  GLU C OE1   1 
ATOM   4918  O  OE2   . GLU C  2  175  ? 40.026  -31.006 50.572   1.00 57.69  ? 175  GLU C OE2   1 
ATOM   4919  N  N     . VAL C  2  176  ? 41.084  -36.111 50.046   1.00 42.53  ? 176  VAL C N     1 
ATOM   4920  C  CA    . VAL C  2  176  ? 40.233  -36.760 49.051   1.00 46.26  ? 176  VAL C CA    1 
ATOM   4921  C  C     . VAL C  2  176  ? 39.213  -35.749 48.532   1.00 49.53  ? 176  VAL C C     1 
ATOM   4922  O  O     . VAL C  2  176  ? 38.260  -35.396 49.230   1.00 55.06  ? 176  VAL C O     1 
ATOM   4923  C  CB    . VAL C  2  176  ? 39.526  -38.017 49.598   1.00 37.53  ? 176  VAL C CB    1 
ATOM   4924  C  CG1   . VAL C  2  176  ? 38.596  -38.590 48.549   1.00 42.80  ? 176  VAL C CG1   1 
ATOM   4925  C  CG2   . VAL C  2  176  ? 40.544  -39.066 50.017   1.00 28.63  ? 176  VAL C CG2   1 
ATOM   4926  N  N     . GLU C  2  177  ? 39.418  -35.305 47.295   1.00 46.48  ? 177  GLU C N     1 
ATOM   4927  C  CA    . GLU C  2  177  ? 38.648  -34.212 46.706   1.00 50.44  ? 177  GLU C CA    1 
ATOM   4928  C  C     . GLU C  2  177  ? 37.190  -34.626 46.483   1.00 55.58  ? 177  GLU C C     1 
ATOM   4929  O  O     . GLU C  2  177  ? 36.896  -35.818 46.405   1.00 58.56  ? 177  GLU C O     1 
ATOM   4930  C  CB    . GLU C  2  177  ? 39.305  -33.781 45.387   1.00 50.32  ? 177  GLU C CB    1 
ATOM   4931  C  CG    . GLU C  2  177  ? 39.483  -32.272 45.208   1.00 56.98  ? 177  GLU C CG    1 
ATOM   4932  C  CD    . GLU C  2  177  ? 40.130  -31.600 46.408   1.00 60.23  ? 177  GLU C CD    1 
ATOM   4933  O  OE1   . GLU C  2  177  ? 39.564  -30.603 46.911   1.00 54.99  ? 177  GLU C OE1   1 
ATOM   4934  O  OE2   . GLU C  2  177  ? 41.208  -32.062 46.843   1.00 55.57  ? 177  GLU C OE2   1 
ATOM   4935  N  N     . PRO C  2  178  ? 36.269  -33.645 46.410   1.00 55.83  ? 178  PRO C N     1 
ATOM   4936  C  CA    . PRO C  2  178  ? 34.862  -33.928 46.104   1.00 54.95  ? 178  PRO C CA    1 
ATOM   4937  C  C     . PRO C  2  178  ? 34.689  -34.818 44.874   1.00 56.39  ? 178  PRO C C     1 
ATOM   4938  O  O     . PRO C  2  178  ? 33.863  -35.736 44.895   1.00 48.89  ? 178  PRO C O     1 
ATOM   4939  C  CB    . PRO C  2  178  ? 34.293  -32.539 45.818   1.00 59.43  ? 178  PRO C CB    1 
ATOM   4940  C  CG    . PRO C  2  178  ? 35.084  -31.640 46.689   1.00 56.93  ? 178  PRO C CG    1 
ATOM   4941  C  CD    . PRO C  2  178  ? 36.467  -32.230 46.780   1.00 56.18  ? 178  PRO C CD    1 
ATOM   4942  N  N     . ASN C  2  179  ? 35.469  -34.557 43.828   1.00 52.22  ? 179  ASN C N     1 
ATOM   4943  C  CA    . ASN C  2  179  ? 35.392  -35.339 42.596   1.00 47.34  ? 179  ASN C CA    1 
ATOM   4944  C  C     . ASN C  2  179  ? 35.859  -36.790 42.751   1.00 45.61  ? 179  ASN C C     1 
ATOM   4945  O  O     . ASN C  2  179  ? 35.687  -37.604 41.847   1.00 48.17  ? 179  ASN C O     1 
ATOM   4946  C  CB    . ASN C  2  179  ? 36.125  -34.632 41.442   1.00 52.80  ? 179  ASN C CB    1 
ATOM   4947  C  CG    . ASN C  2  179  ? 37.620  -34.466 41.692   1.00 51.51  ? 179  ASN C CG    1 
ATOM   4948  O  OD1   . ASN C  2  179  ? 38.327  -35.427 41.995   1.00 49.79  ? 179  ASN C OD1   1 
ATOM   4949  N  ND2   . ASN C  2  179  ? 38.108  -33.236 41.551   1.00 37.89  ? 179  ASN C ND2   1 
ATOM   4950  N  N     . GLY C  2  180  ? 36.450  -37.106 43.899   1.00 47.07  ? 180  GLY C N     1 
ATOM   4951  C  CA    . GLY C  2  180  ? 36.848  -38.468 44.203   1.00 45.94  ? 180  GLY C CA    1 
ATOM   4952  C  C     . GLY C  2  180  ? 38.338  -38.738 44.109   1.00 51.10  ? 180  GLY C C     1 
ATOM   4953  O  O     . GLY C  2  180  ? 38.823  -39.724 44.663   1.00 51.57  ? 180  GLY C O     1 
ATOM   4954  N  N     . VAL C  2  181  ? 39.067  -37.862 43.420   1.00 56.26  ? 181  VAL C N     1 
ATOM   4955  C  CA    . VAL C  2  181  ? 40.513  -38.029 43.233   1.00 56.11  ? 181  VAL C CA    1 
ATOM   4956  C  C     . VAL C  2  181  ? 41.307  -37.478 44.421   1.00 51.64  ? 181  VAL C C     1 
ATOM   4957  O  O     . VAL C  2  181  ? 41.041  -36.373 44.896   1.00 49.23  ? 181  VAL C O     1 
ATOM   4958  C  CB    . VAL C  2  181  ? 40.998  -37.362 41.916   1.00 47.86  ? 181  VAL C CB    1 
ATOM   4959  C  CG1   . VAL C  2  181  ? 42.515  -37.208 41.902   1.00 48.17  ? 181  VAL C CG1   1 
ATOM   4960  C  CG2   . VAL C  2  181  ? 40.528  -38.162 40.710   1.00 46.74  ? 181  VAL C CG2   1 
ATOM   4961  N  N     . VAL C  2  182  ? 42.275  -38.252 44.905   1.00 48.69  ? 182  VAL C N     1 
ATOM   4962  C  CA    . VAL C  2  182  ? 43.090  -37.795 46.025   1.00 45.79  ? 182  VAL C CA    1 
ATOM   4963  C  C     . VAL C  2  182  ? 44.126  -36.763 45.566   1.00 44.20  ? 182  VAL C C     1 
ATOM   4964  O  O     . VAL C  2  182  ? 44.894  -36.993 44.625   1.00 41.23  ? 182  VAL C O     1 
ATOM   4965  C  CB    . VAL C  2  182  ? 43.714  -38.969 46.841   1.00 41.34  ? 182  VAL C CB    1 
ATOM   4966  C  CG1   . VAL C  2  182  ? 42.655  -40.024 47.130   1.00 41.09  ? 182  VAL C CG1   1 
ATOM   4967  C  CG2   . VAL C  2  182  ? 44.888  -39.596 46.114   1.00 40.73  ? 182  VAL C CG2   1 
ATOM   4968  N  N     . SER C  2  183  ? 44.109  -35.607 46.223   1.00 44.90  ? 183  SER C N     1 
ATOM   4969  C  CA    . SER C  2  183  ? 44.923  -34.469 45.817   1.00 35.87  ? 183  SER C CA    1 
ATOM   4970  C  C     . SER C  2  183  ? 46.041  -34.189 46.806   1.00 37.41  ? 183  SER C C     1 
ATOM   4971  O  O     . SER C  2  183  ? 45.808  -34.067 48.014   1.00 45.73  ? 183  SER C O     1 
ATOM   4972  C  CB    . SER C  2  183  ? 44.056  -33.219 45.684   1.00 38.13  ? 183  SER C CB    1 
ATOM   4973  O  OG    . SER C  2  183  ? 43.641  -32.754 46.957   1.00 39.46  ? 183  SER C OG    1 
ATOM   4974  N  N     . MET C  2  184  ? 47.253  -34.087 46.273   1.00 35.79  ? 184  MET C N     1 
ATOM   4975  C  CA    . MET C  2  184  ? 48.426  -33.687 47.034   1.00 35.18  ? 184  MET C CA    1 
ATOM   4976  C  C     . MET C  2  184  ? 48.664  -32.195 46.842   1.00 35.45  ? 184  MET C C     1 
ATOM   4977  O  O     . MET C  2  184  ? 48.586  -31.688 45.717   1.00 34.58  ? 184  MET C O     1 
ATOM   4978  C  CB    . MET C  2  184  ? 49.643  -34.480 46.566   1.00 29.23  ? 184  MET C CB    1 
ATOM   4979  C  CG    . MET C  2  184  ? 50.967  -34.094 47.205   1.00 29.14  ? 184  MET C CG    1 
ATOM   4980  S  SD    . MET C  2  184  ? 52.146  -35.430 46.936   1.00 41.81  ? 184  MET C SD    1 
ATOM   4981  C  CE    . MET C  2  184  ? 53.718  -34.672 47.301   1.00 22.57  ? 184  MET C CE    1 
ATOM   4982  N  N     . LYS C  2  185  ? 48.932  -31.499 47.946   1.00 34.09  ? 185  LYS C N     1 
ATOM   4983  C  CA    . LYS C  2  185  ? 49.222  -30.068 47.929   1.00 31.52  ? 185  LYS C CA    1 
ATOM   4984  C  C     . LYS C  2  185  ? 50.639  -29.800 48.424   1.00 27.82  ? 185  LYS C C     1 
ATOM   4985  O  O     . LYS C  2  185  ? 50.989  -30.126 49.570   1.00 27.15  ? 185  LYS C O     1 
ATOM   4986  C  CB    . LYS C  2  185  ? 48.219  -29.290 48.784   1.00 27.82  ? 185  LYS C CB    1 
ATOM   4987  C  CG    . LYS C  2  185  ? 48.337  -27.779 48.636   1.00 29.85  ? 185  LYS C CG    1 
ATOM   4988  C  CD    . LYS C  2  185  ? 47.861  -27.052 49.886   1.00 37.80  ? 185  LYS C CD    1 
ATOM   4989  C  CE    . LYS C  2  185  ? 46.402  -27.352 50.192   1.00 41.11  ? 185  LYS C CE    1 
ATOM   4990  N  NZ    . LYS C  2  185  ? 45.486  -26.827 49.143   1.00 38.40  ? 185  LYS C NZ    1 
ATOM   4991  N  N     . VAL C  2  186  ? 51.445  -29.223 47.536   1.00 29.03  ? 186  VAL C N     1 
ATOM   4992  C  CA    . VAL C  2  186  ? 52.835  -28.884 47.807   1.00 34.79  ? 186  VAL C CA    1 
ATOM   4993  C  C     . VAL C  2  186  ? 53.132  -27.501 47.245   1.00 45.45  ? 186  VAL C C     1 
ATOM   4994  O  O     . VAL C  2  186  ? 52.900  -27.254 46.059   1.00 52.10  ? 186  VAL C O     1 
ATOM   4995  C  CB    . VAL C  2  186  ? 53.786  -29.861 47.106   1.00 31.20  ? 186  VAL C CB    1 
ATOM   4996  C  CG1   . VAL C  2  186  ? 55.230  -29.529 47.444   1.00 30.54  ? 186  VAL C CG1   1 
ATOM   4997  C  CG2   . VAL C  2  186  ? 53.462  -31.273 47.495   1.00 32.38  ? 186  VAL C CG2   1 
ATOM   4998  N  N     . ASN C  2  187  ? 53.656  -26.610 48.086   1.00 40.75  ? 187  ASN C N     1 
ATOM   4999  C  CA    . ASN C  2  187  ? 53.964  -25.239 47.673   1.00 42.82  ? 187  ASN C CA    1 
ATOM   5000  C  C     . ASN C  2  187  ? 52.758  -24.551 47.042   1.00 43.31  ? 187  ASN C C     1 
ATOM   5001  O  O     . ASN C  2  187  ? 52.877  -23.860 46.028   1.00 39.04  ? 187  ASN C O     1 
ATOM   5002  C  CB    . ASN C  2  187  ? 55.166  -25.204 46.724   1.00 39.99  ? 187  ASN C CB    1 
ATOM   5003  C  CG    . ASN C  2  187  ? 56.447  -25.693 47.385   1.00 45.30  ? 187  ASN C CG    1 
ATOM   5004  O  OD1   . ASN C  2  187  ? 57.100  -26.618 46.897   1.00 46.37  ? 187  ASN C OD1   1 
ATOM   5005  N  ND2   . ASN C  2  187  ? 56.810  -25.072 48.504   1.00 36.87  ? 187  ASN C ND2   1 
ATOM   5006  N  N     . LYS C  2  188  ? 51.600  -24.765 47.659   1.00 44.98  ? 188  LYS C N     1 
ATOM   5007  C  CA    . LYS C  2  188  ? 50.326  -24.243 47.177   1.00 48.62  ? 188  LYS C CA    1 
ATOM   5008  C  C     . LYS C  2  188  ? 50.014  -24.638 45.731   1.00 43.79  ? 188  LYS C C     1 
ATOM   5009  O  O     . LYS C  2  188  ? 49.459  -23.850 44.969   1.00 52.64  ? 188  LYS C O     1 
ATOM   5010  C  CB    . LYS C  2  188  ? 50.238  -22.724 47.377   1.00 58.50  ? 188  LYS C CB    1 
ATOM   5011  C  CG    . LYS C  2  188  ? 50.185  -22.301 48.844   1.00 57.27  ? 188  LYS C CG    1 
ATOM   5012  C  CD    . LYS C  2  188  ? 49.865  -20.817 49.004   1.00 54.97  ? 188  LYS C CD    1 
ATOM   5013  C  CE    . LYS C  2  188  ? 50.985  -19.934 48.477   1.00 65.52  ? 188  LYS C CE    1 
ATOM   5014  N  NZ    . LYS C  2  188  ? 52.250  -20.106 49.245   1.00 59.29  ? 188  LYS C NZ    1 
ATOM   5015  N  N     . ARG C  2  189  ? 50.380  -25.861 45.362   1.00 41.14  ? 189  ARG C N     1 
ATOM   5016  C  CA    . ARG C  2  189  ? 49.949  -26.442 44.095   1.00 41.92  ? 189  ARG C CA    1 
ATOM   5017  C  C     . ARG C  2  189  ? 49.331  -27.815 44.330   1.00 35.97  ? 189  ARG C C     1 
ATOM   5018  O  O     . ARG C  2  189  ? 50.024  -28.748 44.727   1.00 41.27  ? 189  ARG C O     1 
ATOM   5019  C  CB    . ARG C  2  189  ? 51.124  -26.586 43.129   1.00 45.92  ? 189  ARG C CB    1 
ATOM   5020  C  CG    . ARG C  2  189  ? 51.645  -25.290 42.544   1.00 46.33  ? 189  ARG C CG    1 
ATOM   5021  C  CD    . ARG C  2  189  ? 52.649  -25.582 41.438   1.00 51.82  ? 189  ARG C CD    1 
ATOM   5022  N  NE    . ARG C  2  189  ? 53.349  -24.381 40.993   1.00 69.48  ? 189  ARG C NE    1 
ATOM   5023  C  CZ    . ARG C  2  189  ? 52.975  -23.631 39.960   1.00 66.73  ? 189  ARG C CZ    1 
ATOM   5024  N  NH1   . ARG C  2  189  ? 51.899  -23.959 39.254   1.00 61.32  ? 189  ARG C NH1   1 
ATOM   5025  N  NH2   . ARG C  2  189  ? 53.680  -22.554 39.634   1.00 61.73  ? 189  ARG C NH2   1 
ATOM   5026  N  N     . LYS C  2  190  ? 48.031  -27.938 44.088   1.00 34.91  ? 190  LYS C N     1 
ATOM   5027  C  CA    . LYS C  2  190  ? 47.369  -29.236 44.147   1.00 33.06  ? 190  LYS C CA    1 
ATOM   5028  C  C     . LYS C  2  190  ? 47.679  -30.029 42.882   1.00 37.77  ? 190  LYS C C     1 
ATOM   5029  O  O     . LYS C  2  190  ? 48.008  -29.444 41.848   1.00 38.33  ? 190  LYS C O     1 
ATOM   5030  C  CB    . LYS C  2  190  ? 45.852  -29.080 44.294   1.00 26.06  ? 190  LYS C CB    1 
ATOM   5031  C  CG    . LYS C  2  190  ? 45.344  -28.977 45.720   1.00 26.51  ? 190  LYS C CG    1 
ATOM   5032  C  CD    . LYS C  2  190  ? 43.831  -29.184 45.760   1.00 36.85  ? 190  LYS C CD    1 
ATOM   5033  C  CE    . LYS C  2  190  ? 43.265  -29.142 47.179   1.00 41.32  ? 190  LYS C CE    1 
ATOM   5034  N  NZ    . LYS C  2  190  ? 43.094  -27.756 47.704   1.00 27.96  ? 190  LYS C NZ    1 
ATOM   5035  N  N     . PHE C  2  191  ? 47.559  -31.353 42.973   1.00 33.81  ? 191  PHE C N     1 
ATOM   5036  C  CA    . PHE C  2  191  ? 47.706  -32.246 41.820   1.00 30.56  ? 191  PHE C CA    1 
ATOM   5037  C  C     . PHE C  2  191  ? 47.410  -33.674 42.255   1.00 37.12  ? 191  PHE C C     1 
ATOM   5038  O  O     . PHE C  2  191  ? 47.534  -33.990 43.431   1.00 43.87  ? 191  PHE C O     1 
ATOM   5039  C  CB    . PHE C  2  191  ? 49.114  -32.161 41.225   1.00 33.98  ? 191  PHE C CB    1 
ATOM   5040  C  CG    . PHE C  2  191  ? 50.182  -32.736 42.101   1.00 34.64  ? 191  PHE C CG    1 
ATOM   5041  C  CD1   . PHE C  2  191  ? 50.569  -34.058 41.969   1.00 37.09  ? 191  PHE C CD1   1 
ATOM   5042  C  CD2   . PHE C  2  191  ? 50.817  -31.949 43.043   1.00 39.38  ? 191  PHE C CD2   1 
ATOM   5043  C  CE1   . PHE C  2  191  ? 51.556  -34.589 42.775   1.00 41.41  ? 191  PHE C CE1   1 
ATOM   5044  C  CE2   . PHE C  2  191  ? 51.810  -32.474 43.849   1.00 44.29  ? 191  PHE C CE2   1 
ATOM   5045  C  CZ    . PHE C  2  191  ? 52.180  -33.795 43.713   1.00 41.70  ? 191  PHE C CZ    1 
ATOM   5046  N  N     . PRO C  2  192  ? 47.008  -34.545 41.313   1.00 41.36  ? 192  PRO C N     1 
ATOM   5047  C  CA    . PRO C  2  192  ? 46.687  -35.929 41.691   1.00 44.06  ? 192  PRO C CA    1 
ATOM   5048  C  C     . PRO C  2  192  ? 47.874  -36.689 42.287   1.00 34.99  ? 192  PRO C C     1 
ATOM   5049  O  O     . PRO C  2  192  ? 48.945  -36.747 41.687   1.00 33.89  ? 192  PRO C O     1 
ATOM   5050  C  CB    . PRO C  2  192  ? 46.271  -36.565 40.361   1.00 40.66  ? 192  PRO C CB    1 
ATOM   5051  C  CG    . PRO C  2  192  ? 46.880  -35.687 39.309   1.00 36.61  ? 192  PRO C CG    1 
ATOM   5052  C  CD    . PRO C  2  192  ? 46.798  -34.310 39.875   1.00 39.11  ? 192  PRO C CD    1 
ATOM   5053  N  N     . LEU C  2  193  ? 47.660  -37.290 43.452   1.00 31.19  ? 193  LEU C N     1 
ATOM   5054  C  CA    . LEU C  2  193  ? 48.714  -38.002 44.162   1.00 34.24  ? 193  LEU C CA    1 
ATOM   5055  C  C     . LEU C  2  193  ? 49.210  -39.178 43.324   1.00 39.39  ? 193  LEU C C     1 
ATOM   5056  O  O     . LEU C  2  193  ? 50.377  -39.585 43.407   1.00 36.13  ? 193  LEU C O     1 
ATOM   5057  C  CB    . LEU C  2  193  ? 48.187  -38.475 45.521   1.00 29.68  ? 193  LEU C CB    1 
ATOM   5058  C  CG    . LEU C  2  193  ? 49.061  -39.378 46.397   1.00 30.24  ? 193  LEU C CG    1 
ATOM   5059  C  CD1   . LEU C  2  193  ? 50.374  -38.696 46.755   1.00 29.33  ? 193  LEU C CD1   1 
ATOM   5060  C  CD2   . LEU C  2  193  ? 48.308  -39.801 47.652   1.00 23.68  ? 193  LEU C CD2   1 
ATOM   5061  N  N     . VAL C  2  194  ? 48.302  -39.695 42.501   1.00 46.65  ? 194  VAL C N     1 
ATOM   5062  C  CA    . VAL C  2  194  ? 48.552  -40.835 41.630   1.00 39.69  ? 194  VAL C CA    1 
ATOM   5063  C  C     . VAL C  2  194  ? 49.838  -40.672 40.832   1.00 39.34  ? 194  VAL C C     1 
ATOM   5064  O  O     . VAL C  2  194  ? 50.593  -41.624 40.662   1.00 40.76  ? 194  VAL C O     1 
ATOM   5065  C  CB    . VAL C  2  194  ? 47.395  -41.009 40.630   1.00 44.39  ? 194  VAL C CB    1 
ATOM   5066  C  CG1   . VAL C  2  194  ? 47.312  -42.452 40.161   1.00 53.64  ? 194  VAL C CG1   1 
ATOM   5067  C  CG2   . VAL C  2  194  ? 46.074  -40.556 41.256   1.00 40.12  ? 194  VAL C CG2   1 
ATOM   5068  N  N     . LEU C  2  195  ? 50.074  -39.455 40.352   1.00 36.66  ? 195  LEU C N     1 
ATOM   5069  C  CA    . LEU C  2  195  ? 51.231  -39.142 39.519   1.00 35.64  ? 195  LEU C CA    1 
ATOM   5070  C  C     . LEU C  2  195  ? 52.552  -39.366 40.263   1.00 41.34  ? 195  LEU C C     1 
ATOM   5071  O  O     . LEU C  2  195  ? 53.460  -40.047 39.765   1.00 37.49  ? 195  LEU C O     1 
ATOM   5072  C  CB    . LEU C  2  195  ? 51.127  -37.695 39.035   1.00 33.79  ? 195  LEU C CB    1 
ATOM   5073  C  CG    . LEU C  2  195  ? 52.056  -37.200 37.931   1.00 43.89  ? 195  LEU C CG    1 
ATOM   5074  C  CD1   . LEU C  2  195  ? 51.917  -38.052 36.682   1.00 49.94  ? 195  LEU C CD1   1 
ATOM   5075  C  CD2   . LEU C  2  195  ? 51.742  -35.747 37.621   1.00 50.36  ? 195  LEU C CD2   1 
ATOM   5076  N  N     . LEU C  2  196  ? 52.650  -38.792 41.460   1.00 45.25  ? 196  LEU C N     1 
ATOM   5077  C  CA    . LEU C  2  196  ? 53.810  -39.000 42.318   1.00 36.97  ? 196  LEU C CA    1 
ATOM   5078  C  C     . LEU C  2  196  ? 53.954  -40.475 42.666   1.00 37.95  ? 196  LEU C C     1 
ATOM   5079  O  O     . LEU C  2  196  ? 55.065  -41.007 42.699   1.00 40.18  ? 196  LEU C O     1 
ATOM   5080  C  CB    . LEU C  2  196  ? 53.691  -38.182 43.601   1.00 33.62  ? 196  LEU C CB    1 
ATOM   5081  C  CG    . LEU C  2  196  ? 54.653  -38.630 44.704   1.00 32.26  ? 196  LEU C CG    1 
ATOM   5082  C  CD1   . LEU C  2  196  ? 56.086  -38.208 44.394   1.00 24.22  ? 196  LEU C CD1   1 
ATOM   5083  C  CD2   . LEU C  2  196  ? 54.208  -38.123 46.060   1.00 27.21  ? 196  LEU C CD2   1 
ATOM   5084  N  N     . LEU C  2  197  ? 52.827  -41.131 42.929   1.00 40.86  ? 197  LEU C N     1 
ATOM   5085  C  CA    . LEU C  2  197  ? 52.835  -42.566 43.199   1.00 40.26  ? 197  LEU C CA    1 
ATOM   5086  C  C     . LEU C  2  197  ? 53.456  -43.351 42.042   1.00 40.84  ? 197  LEU C C     1 
ATOM   5087  O  O     . LEU C  2  197  ? 54.205  -44.302 42.260   1.00 40.85  ? 197  LEU C O     1 
ATOM   5088  C  CB    . LEU C  2  197  ? 51.424  -43.071 43.498   1.00 33.73  ? 197  LEU C CB    1 
ATOM   5089  C  CG    . LEU C  2  197  ? 50.885  -42.653 44.863   1.00 29.21  ? 197  LEU C CG    1 
ATOM   5090  C  CD1   . LEU C  2  197  ? 49.492  -43.215 45.096   1.00 33.54  ? 197  LEU C CD1   1 
ATOM   5091  C  CD2   . LEU C  2  197  ? 51.839  -43.101 45.954   1.00 24.82  ? 197  LEU C CD2   1 
ATOM   5092  N  N     . ARG C  2  198  ? 53.153  -42.935 40.816   1.00 37.61  ? 198  ARG C N     1 
ATOM   5093  C  CA    . ARG C  2  198  ? 53.731  -43.556 39.635   1.00 36.79  ? 198  ARG C CA    1 
ATOM   5094  C  C     . ARG C  2  198  ? 55.229  -43.282 39.569   1.00 42.32  ? 198  ARG C C     1 
ATOM   5095  O  O     . ARG C  2  198  ? 56.015  -44.175 39.250   1.00 48.27  ? 198  ARG C O     1 
ATOM   5096  C  CB    . ARG C  2  198  ? 53.041  -43.056 38.366   1.00 38.97  ? 198  ARG C CB    1 
ATOM   5097  C  CG    . ARG C  2  198  ? 53.431  -43.820 37.103   1.00 57.45  ? 198  ARG C CG    1 
ATOM   5098  C  CD    . ARG C  2  198  ? 52.943  -45.270 37.138   1.00 64.92  ? 198  ARG C CD    1 
ATOM   5099  N  NE    . ARG C  2  198  ? 53.374  -46.026 35.961   1.00 72.63  ? 198  ARG C NE    1 
ATOM   5100  C  CZ    . ARG C  2  198  ? 53.970  -47.215 36.006   1.00 74.51  ? 198  ARG C CZ    1 
ATOM   5101  N  NH1   . ARG C  2  198  ? 54.326  -47.824 34.881   1.00 75.10  ? 198  ARG C NH1   1 
ATOM   5102  N  NH2   . ARG C  2  198  ? 54.209  -47.802 37.173   1.00 68.59  ? 198  ARG C NH2   1 
ATOM   5103  N  N     . VAL C  2  199  ? 55.627  -42.051 39.877   1.00 40.56  ? 199  VAL C N     1 
ATOM   5104  C  CA    . VAL C  2  199  ? 57.048  -41.710 39.910   1.00 38.63  ? 199  VAL C CA    1 
ATOM   5105  C  C     . VAL C  2  199  ? 57.803  -42.591 40.910   1.00 39.94  ? 199  VAL C C     1 
ATOM   5106  O  O     . VAL C  2  199  ? 58.961  -42.946 40.692   1.00 44.59  ? 199  VAL C O     1 
ATOM   5107  C  CB    . VAL C  2  199  ? 57.271  -40.220 40.255   1.00 39.29  ? 199  VAL C CB    1 
ATOM   5108  C  CG1   . VAL C  2  199  ? 58.757  -39.877 40.241   1.00 32.23  ? 199  VAL C CG1   1 
ATOM   5109  C  CG2   . VAL C  2  199  ? 56.507  -39.333 39.288   1.00 37.42  ? 199  VAL C CG2   1 
ATOM   5110  N  N     . LEU C  2  200  ? 57.126  -42.962 41.994   1.00 42.38  ? 200  LEU C N     1 
ATOM   5111  C  CA    . LEU C  2  200  ? 57.729  -43.773 43.051   1.00 45.36  ? 200  LEU C CA    1 
ATOM   5112  C  C     . LEU C  2  200  ? 57.893  -45.250 42.674   1.00 51.60  ? 200  LEU C C     1 
ATOM   5113  O  O     . LEU C  2  200  ? 58.467  -46.032 43.438   1.00 56.15  ? 200  LEU C O     1 
ATOM   5114  C  CB    . LEU C  2  200  ? 56.930  -43.644 44.353   1.00 44.78  ? 200  LEU C CB    1 
ATOM   5115  C  CG    . LEU C  2  200  ? 56.950  -42.278 45.042   1.00 37.39  ? 200  LEU C CG    1 
ATOM   5116  C  CD1   . LEU C  2  200  ? 56.023  -42.282 46.239   1.00 36.37  ? 200  LEU C CD1   1 
ATOM   5117  C  CD2   . LEU C  2  200  ? 58.361  -41.905 45.466   1.00 41.87  ? 200  LEU C CD2   1 
ATOM   5118  N  N     . GLY C  2  201  ? 57.375  -45.632 41.510   1.00 50.89  ? 201  GLY C N     1 
ATOM   5119  C  CA    . GLY C  2  201  ? 57.538  -46.990 41.019   1.00 50.66  ? 201  GLY C CA    1 
ATOM   5120  C  C     . GLY C  2  201  ? 56.348  -47.890 41.296   1.00 51.33  ? 201  GLY C C     1 
ATOM   5121  O  O     . GLY C  2  201  ? 56.443  -49.113 41.196   1.00 54.00  ? 201  GLY C O     1 
ATOM   5122  N  N     . TYR C  2  202  ? 55.223  -47.282 41.651   1.00 50.76  ? 202  TYR C N     1 
ATOM   5123  C  CA    . TYR C  2  202  ? 54.004  -48.031 41.930   1.00 54.62  ? 202  TYR C CA    1 
ATOM   5124  C  C     . TYR C  2  202  ? 53.234  -48.378 40.660   1.00 63.46  ? 202  TYR C C     1 
ATOM   5125  O  O     . TYR C  2  202  ? 53.224  -47.614 39.693   1.00 57.71  ? 202  TYR C O     1 
ATOM   5126  C  CB    . TYR C  2  202  ? 53.101  -47.249 42.886   1.00 53.39  ? 202  TYR C CB    1 
ATOM   5127  C  CG    . TYR C  2  202  ? 53.525  -47.329 44.332   1.00 45.14  ? 202  TYR C CG    1 
ATOM   5128  C  CD1   . TYR C  2  202  ? 54.141  -48.466 44.831   1.00 49.32  ? 202  TYR C CD1   1 
ATOM   5129  C  CD2   . TYR C  2  202  ? 53.308  -46.267 45.196   1.00 38.07  ? 202  TYR C CD2   1 
ATOM   5130  C  CE1   . TYR C  2  202  ? 54.525  -48.545 46.150   1.00 50.39  ? 202  TYR C CE1   1 
ATOM   5131  C  CE2   . TYR C  2  202  ? 53.691  -46.334 46.516   1.00 37.64  ? 202  TYR C CE2   1 
ATOM   5132  C  CZ    . TYR C  2  202  ? 54.299  -47.476 46.989   1.00 43.51  ? 202  TYR C CZ    1 
ATOM   5133  O  OH    . TYR C  2  202  ? 54.683  -47.552 48.307   1.00 40.32  ? 202  TYR C OH    1 
ATOM   5134  N  N     . ASP C  2  203  ? 52.585  -49.537 40.674   1.00 66.82  ? 203  ASP C N     1 
ATOM   5135  C  CA    . ASP C  2  203  ? 51.743  -49.951 39.562   1.00 68.07  ? 203  ASP C CA    1 
ATOM   5136  C  C     . ASP C  2  203  ? 50.318  -50.155 40.061   1.00 68.00  ? 203  ASP C C     1 
ATOM   5137  O  O     . ASP C  2  203  ? 50.094  -50.309 41.261   1.00 68.29  ? 203  ASP C O     1 
ATOM   5138  C  CB    . ASP C  2  203  ? 52.285  -51.226 38.915   1.00 67.69  ? 203  ASP C CB    1 
ATOM   5139  C  CG    . ASP C  2  203  ? 51.801  -51.403 37.487   1.00 82.42  ? 203  ASP C CG    1 
ATOM   5140  O  OD1   . ASP C  2  203  ? 52.650  -51.442 36.569   1.00 85.42  ? 203  ASP C OD1   1 
ATOM   5141  O  OD2   . ASP C  2  203  ? 50.572  -51.504 37.282   1.00 82.98  ? 203  ASP C OD2   1 
ATOM   5142  N  N     . GLN C  2  204  ? 49.362  -50.145 39.137   1.00 69.32  ? 204  GLN C N     1 
ATOM   5143  C  CA    . GLN C  2  204  ? 47.939  -50.199 39.473   1.00 64.34  ? 204  GLN C CA    1 
ATOM   5144  C  C     . GLN C  2  204  ? 47.547  -51.415 40.316   1.00 67.67  ? 204  GLN C C     1 
ATOM   5145  O  O     . GLN C  2  204  ? 46.649  -51.331 41.161   1.00 63.84  ? 204  GLN C O     1 
ATOM   5146  C  CB    . GLN C  2  204  ? 47.100  -50.150 38.196   1.00 65.41  ? 204  GLN C CB    1 
ATOM   5147  C  CG    . GLN C  2  204  ? 45.606  -50.079 38.430   1.00 56.38  ? 204  GLN C CG    1 
ATOM   5148  C  CD    . GLN C  2  204  ? 44.827  -49.960 37.137   1.00 68.07  ? 204  GLN C CD    1 
ATOM   5149  O  OE1   . GLN C  2  204  ? 45.408  -49.849 36.056   1.00 67.80  ? 204  GLN C OE1   1 
ATOM   5150  N  NE2   . GLN C  2  204  ? 43.502  -49.985 37.239   1.00 70.45  ? 204  GLN C NE2   1 
ATOM   5151  N  N     . GLU C  2  205  ? 48.222  -52.540 40.092   1.00 67.89  ? 205  GLU C N     1 
ATOM   5152  C  CA    . GLU C  2  205  ? 47.928  -53.757 40.841   1.00 62.45  ? 205  GLU C CA    1 
ATOM   5153  C  C     . GLU C  2  205  ? 48.386  -53.659 42.291   1.00 63.97  ? 205  GLU C C     1 
ATOM   5154  O  O     . GLU C  2  205  ? 47.716  -54.165 43.187   1.00 68.33  ? 205  GLU C O     1 
ATOM   5155  C  CB    . GLU C  2  205  ? 48.554  -54.988 40.180   1.00 74.12  ? 205  GLU C CB    1 
ATOM   5156  C  CG    . GLU C  2  205  ? 48.234  -56.290 40.913   1.00 86.39  ? 205  GLU C CG    1 
ATOM   5157  C  CD    . GLU C  2  205  ? 48.824  -57.520 40.244   1.00 106.59 ? 205  GLU C CD    1 
ATOM   5158  O  OE1   . GLU C  2  205  ? 49.115  -57.464 39.030   1.00 108.52 ? 205  GLU C OE1   1 
ATOM   5159  O  OE2   . GLU C  2  205  ? 48.994  -58.547 40.939   1.00 101.03 ? 205  GLU C OE2   1 
ATOM   5160  N  N     . THR C  2  206  ? 49.528  -53.014 42.517   1.00 64.47  ? 206  THR C N     1 
ATOM   5161  C  CA    . THR C  2  206  ? 50.056  -52.840 43.868   1.00 60.34  ? 206  THR C CA    1 
ATOM   5162  C  C     . THR C  2  206  ? 49.122  -51.956 44.699   1.00 58.07  ? 206  THR C C     1 
ATOM   5163  O  O     . THR C  2  206  ? 48.818  -52.255 45.861   1.00 58.42  ? 206  THR C O     1 
ATOM   5164  C  CB    . THR C  2  206  ? 51.471  -52.225 43.842   1.00 56.27  ? 206  THR C CB    1 
ATOM   5165  O  OG1   . THR C  2  206  ? 52.227  -52.806 42.771   1.00 65.59  ? 206  THR C OG1   1 
ATOM   5166  C  CG2   . THR C  2  206  ? 52.191  -52.470 45.159   1.00 46.81  ? 206  THR C CG2   1 
ATOM   5167  N  N     . LEU C  2  207  ? 48.655  -50.874 44.087   1.00 56.72  ? 207  LEU C N     1 
ATOM   5168  C  CA    . LEU C  2  207  ? 47.730  -49.966 44.749   1.00 58.10  ? 207  LEU C CA    1 
ATOM   5169  C  C     . LEU C  2  207  ? 46.370  -50.622 44.958   1.00 55.67  ? 207  LEU C C     1 
ATOM   5170  O  O     . LEU C  2  207  ? 45.719  -50.390 45.973   1.00 56.60  ? 207  LEU C O     1 
ATOM   5171  C  CB    . LEU C  2  207  ? 47.583  -48.661 43.962   1.00 57.17  ? 207  LEU C CB    1 
ATOM   5172  C  CG    . LEU C  2  207  ? 48.858  -47.836 43.760   1.00 52.63  ? 207  LEU C CG    1 
ATOM   5173  C  CD1   . LEU C  2  207  ? 48.511  -46.472 43.192   1.00 53.68  ? 207  LEU C CD1   1 
ATOM   5174  C  CD2   . LEU C  2  207  ? 49.660  -47.698 45.052   1.00 43.46  ? 207  LEU C CD2   1 
ATOM   5175  N  N     . ALA C  2  208  ? 45.942  -51.439 44.000   1.00 66.42  ? 208  ALA C N     1 
ATOM   5176  C  CA    . ALA C  2  208  ? 44.701  -52.195 44.159   1.00 66.44  ? 208  ALA C CA    1 
ATOM   5177  C  C     . ALA C  2  208  ? 44.815  -53.195 45.316   1.00 64.61  ? 208  ALA C C     1 
ATOM   5178  O  O     . ALA C  2  208  ? 43.847  -53.429 46.042   1.00 53.52  ? 208  ALA C O     1 
ATOM   5179  C  CB    . ALA C  2  208  ? 44.328  -52.902 42.863   1.00 55.50  ? 208  ALA C CB    1 
ATOM   5180  N  N     . ARG C  2  209  ? 46.004  -53.777 45.478   1.00 60.80  ? 209  ARG C N     1 
ATOM   5181  C  CA    . ARG C  2  209  ? 46.297  -54.670 46.594   1.00 53.23  ? 209  ARG C CA    1 
ATOM   5182  C  C     . ARG C  2  209  ? 46.173  -53.933 47.917   1.00 68.18  ? 209  ARG C C     1 
ATOM   5183  O  O     . ARG C  2  209  ? 45.383  -54.313 48.785   1.00 67.83  ? 209  ARG C O     1 
ATOM   5184  C  CB    . ARG C  2  209  ? 47.730  -55.194 46.499   1.00 56.60  ? 209  ARG C CB    1 
ATOM   5185  C  CG    . ARG C  2  209  ? 47.979  -56.332 45.528   1.00 63.17  ? 209  ARG C CG    1 
ATOM   5186  C  CD    . ARG C  2  209  ? 49.479  -56.588 45.443   1.00 64.80  ? 209  ARG C CD    1 
ATOM   5187  N  NE    . ARG C  2  209  ? 50.129  -56.304 46.724   1.00 68.10  ? 209  ARG C NE    1 
ATOM   5188  C  CZ    . ARG C  2  209  ? 51.382  -55.876 46.859   1.00 61.91  ? 209  ARG C CZ    1 
ATOM   5189  N  NH1   . ARG C  2  209  ? 52.143  -55.678 45.791   1.00 54.72  ? 209  ARG C NH1   1 
ATOM   5190  N  NH2   . ARG C  2  209  ? 51.875  -55.644 48.069   1.00 63.10  ? 209  ARG C NH2   1 
ATOM   5191  N  N     . GLU C  2  210  ? 46.966  -52.873 48.063   1.00 69.47  ? 210  GLU C N     1 
ATOM   5192  C  CA    . GLU C  2  210  ? 47.083  -52.174 49.340   1.00 57.24  ? 210  GLU C CA    1 
ATOM   5193  C  C     . GLU C  2  210  ? 45.840  -51.371 49.732   1.00 57.12  ? 210  GLU C C     1 
ATOM   5194  O  O     . GLU C  2  210  ? 45.294  -51.554 50.823   1.00 59.60  ? 210  GLU C O     1 
ATOM   5195  C  CB    . GLU C  2  210  ? 48.323  -51.277 49.343   1.00 52.14  ? 210  GLU C CB    1 
ATOM   5196  C  CG    . GLU C  2  210  ? 49.422  -51.738 50.295   1.00 63.76  ? 210  GLU C CG    1 
ATOM   5197  C  CD    . GLU C  2  210  ? 50.068  -53.050 49.876   1.00 63.44  ? 210  GLU C CD    1 
ATOM   5198  O  OE1   . GLU C  2  210  ? 50.314  -53.238 48.665   1.00 57.04  ? 210  GLU C OE1   1 
ATOM   5199  O  OE2   . GLU C  2  210  ? 50.332  -53.894 50.760   1.00 62.33  ? 210  GLU C OE2   1 
ATOM   5200  N  N     . LEU C  2  211  ? 45.391  -50.491 48.843   1.00 54.83  ? 211  LEU C N     1 
ATOM   5201  C  CA    . LEU C  2  211  ? 44.293  -49.578 49.168   1.00 53.89  ? 211  LEU C CA    1 
ATOM   5202  C  C     . LEU C  2  211  ? 42.924  -50.101 48.736   1.00 55.71  ? 211  LEU C C     1 
ATOM   5203  O  O     . LEU C  2  211  ? 41.913  -49.412 48.891   1.00 49.77  ? 211  LEU C O     1 
ATOM   5204  C  CB    . LEU C  2  211  ? 44.533  -48.184 48.570   1.00 51.56  ? 211  LEU C CB    1 
ATOM   5205  C  CG    . LEU C  2  211  ? 45.711  -47.332 49.061   1.00 39.58  ? 211  LEU C CG    1 
ATOM   5206  C  CD1   . LEU C  2  211  ? 46.282  -47.826 50.393   1.00 36.13  ? 211  LEU C CD1   1 
ATOM   5207  C  CD2   . LEU C  2  211  ? 46.798  -47.247 48.002   1.00 39.46  ? 211  LEU C CD2   1 
ATOM   5208  N  N     . GLY C  2  212  ? 42.898  -51.313 48.190   1.00 64.68  ? 212  GLY C N     1 
ATOM   5209  C  CA    . GLY C  2  212  ? 41.657  -51.921 47.744   1.00 58.28  ? 212  GLY C CA    1 
ATOM   5210  C  C     . GLY C  2  212  ? 40.740  -52.280 48.897   1.00 58.00  ? 212  GLY C C     1 
ATOM   5211  O  O     . GLY C  2  212  ? 39.514  -52.241 48.764   1.00 55.99  ? 212  GLY C O     1 
ATOM   5212  N  N     . ALA C  2  213  ? 41.341  -52.614 50.036   1.00 50.56  ? 213  ALA C N     1 
ATOM   5213  C  CA    . ALA C  2  213  ? 40.595  -53.019 51.223   1.00 51.69  ? 213  ALA C CA    1 
ATOM   5214  C  C     . ALA C  2  213  ? 39.554  -51.980 51.656   1.00 49.40  ? 213  ALA C C     1 
ATOM   5215  O  O     . ALA C  2  213  ? 38.576  -52.312 52.327   1.00 52.21  ? 213  ALA C O     1 
ATOM   5216  C  CB    . ALA C  2  213  ? 41.557  -53.324 52.367   1.00 49.29  ? 213  ALA C CB    1 
ATOM   5217  N  N     . TYR C  2  214  ? 39.765  -50.728 51.260   1.00 55.83  ? 214  TYR C N     1 
ATOM   5218  C  CA    . TYR C  2  214  ? 38.890  -49.627 51.656   1.00 55.71  ? 214  TYR C CA    1 
ATOM   5219  C  C     . TYR C  2  214  ? 38.011  -49.204 50.482   1.00 60.30  ? 214  TYR C C     1 
ATOM   5220  O  O     . TYR C  2  214  ? 38.492  -48.659 49.485   1.00 55.40  ? 214  TYR C O     1 
ATOM   5221  C  CB    . TYR C  2  214  ? 39.728  -48.470 52.210   1.00 38.58  ? 214  TYR C CB    1 
ATOM   5222  C  CG    . TYR C  2  214  ? 40.817  -48.979 53.128   1.00 37.57  ? 214  TYR C CG    1 
ATOM   5223  C  CD1   . TYR C  2  214  ? 40.557  -49.233 54.468   1.00 36.66  ? 214  TYR C CD1   1 
ATOM   5224  C  CD2   . TYR C  2  214  ? 42.094  -49.253 52.643   1.00 41.23  ? 214  TYR C CD2   1 
ATOM   5225  C  CE1   . TYR C  2  214  ? 41.544  -49.726 55.306   1.00 41.07  ? 214  TYR C CE1   1 
ATOM   5226  C  CE2   . TYR C  2  214  ? 43.088  -49.746 53.474   1.00 39.15  ? 214  TYR C CE2   1 
ATOM   5227  C  CZ    . TYR C  2  214  ? 42.808  -49.980 54.805   1.00 41.16  ? 214  TYR C CZ    1 
ATOM   5228  O  OH    . TYR C  2  214  ? 43.792  -50.468 55.639   1.00 40.80  ? 214  TYR C OH    1 
ATOM   5229  N  N     . GLY C  2  215  ? 36.717  -49.474 50.622   1.00 63.69  ? 215  GLY C N     1 
ATOM   5230  C  CA    . GLY C  2  215  ? 35.777  -49.414 49.520   1.00 65.14  ? 215  GLY C CA    1 
ATOM   5231  C  C     . GLY C  2  215  ? 35.666  -48.094 48.789   1.00 65.82  ? 215  GLY C C     1 
ATOM   5232  O  O     . GLY C  2  215  ? 35.524  -47.041 49.408   1.00 68.80  ? 215  GLY C O     1 
ATOM   5233  N  N     . GLU C  2  216  ? 35.776  -48.171 47.464   1.00 64.20  ? 216  GLU C N     1 
ATOM   5234  C  CA    . GLU C  2  216  ? 35.483  -47.068 46.540   1.00 74.66  ? 216  GLU C CA    1 
ATOM   5235  C  C     . GLU C  2  216  ? 36.515  -45.934 46.517   1.00 71.49  ? 216  GLU C C     1 
ATOM   5236  O  O     . GLU C  2  216  ? 36.532  -45.123 45.587   1.00 75.29  ? 216  GLU C O     1 
ATOM   5237  C  CB    . GLU C  2  216  ? 34.072  -46.505 46.770   1.00 73.43  ? 216  GLU C CB    1 
ATOM   5238  C  CG    . GLU C  2  216  ? 34.040  -45.163 47.499   1.00 74.16  ? 216  GLU C CG    1 
ATOM   5239  C  CD    . GLU C  2  216  ? 32.634  -44.647 47.713   1.00 81.76  ? 216  GLU C CD    1 
ATOM   5240  O  OE1   . GLU C  2  216  ? 31.692  -45.243 47.150   1.00 90.49  ? 216  GLU C OE1   1 
ATOM   5241  O  OE2   . GLU C  2  216  ? 32.470  -43.646 48.443   1.00 78.15  ? 216  GLU C OE2   1 
ATOM   5242  N  N     . LEU C  2  217  ? 37.381  -45.889 47.523   1.00 63.31  ? 217  LEU C N     1 
ATOM   5243  C  CA    . LEU C  2  217  ? 38.389  -44.839 47.607   1.00 58.23  ? 217  LEU C CA    1 
ATOM   5244  C  C     . LEU C  2  217  ? 39.460  -45.042 46.542   1.00 57.86  ? 217  LEU C C     1 
ATOM   5245  O  O     . LEU C  2  217  ? 39.782  -44.128 45.762   1.00 59.68  ? 217  LEU C O     1 
ATOM   5246  C  CB    . LEU C  2  217  ? 39.025  -44.822 49.001   1.00 55.19  ? 217  LEU C CB    1 
ATOM   5247  C  CG    . LEU C  2  217  ? 38.411  -43.902 50.065   1.00 46.52  ? 217  LEU C CG    1 
ATOM   5248  C  CD1   . LEU C  2  217  ? 37.095  -43.295 49.606   1.00 50.34  ? 217  LEU C CD1   1 
ATOM   5249  C  CD2   . LEU C  2  217  ? 38.238  -44.628 51.396   1.00 37.50  ? 217  LEU C CD2   1 
ATOM   5250  N  N     . VAL C  2  218  ? 39.999  -46.256 46.505   1.00 51.26  ? 218  VAL C N     1 
ATOM   5251  C  CA    . VAL C  2  218  ? 41.051  -46.603 45.560   1.00 55.74  ? 218  VAL C CA    1 
ATOM   5252  C  C     . VAL C  2  218  ? 40.569  -46.411 44.116   1.00 58.05  ? 218  VAL C C     1 
ATOM   5253  O  O     . VAL C  2  218  ? 41.366  -46.155 43.212   1.00 54.85  ? 218  VAL C O     1 
ATOM   5254  C  CB    . VAL C  2  218  ? 41.566  -48.043 45.803   1.00 53.02  ? 218  VAL C CB    1 
ATOM   5255  C  CG1   . VAL C  2  218  ? 40.451  -49.053 45.586   1.00 62.77  ? 218  VAL C CG1   1 
ATOM   5256  C  CG2   . VAL C  2  218  ? 42.779  -48.349 44.929   1.00 49.81  ? 218  VAL C CG2   1 
ATOM   5257  N  N     . GLN C  2  219  ? 39.259  -46.514 43.909   1.00 67.33  ? 219  GLN C N     1 
ATOM   5258  C  CA    . GLN C  2  219  ? 38.676  -46.219 42.601   1.00 72.74  ? 219  GLN C CA    1 
ATOM   5259  C  C     . GLN C  2  219  ? 38.865  -44.748 42.243   1.00 67.61  ? 219  GLN C C     1 
ATOM   5260  O  O     . GLN C  2  219  ? 39.079  -44.402 41.079   1.00 63.62  ? 219  GLN C O     1 
ATOM   5261  C  CB    . GLN C  2  219  ? 37.194  -46.611 42.548   1.00 69.42  ? 219  GLN C CB    1 
ATOM   5262  C  CG    . GLN C  2  219  ? 36.965  -48.097 42.305   1.00 77.11  ? 219  GLN C CG    1 
ATOM   5263  C  CD    . GLN C  2  219  ? 37.597  -48.573 41.005   1.00 84.67  ? 219  GLN C CD    1 
ATOM   5264  O  OE1   . GLN C  2  219  ? 38.190  -49.652 40.944   1.00 74.18  ? 219  GLN C OE1   1 
ATOM   5265  N  NE2   . GLN C  2  219  ? 37.473  -47.764 39.958   1.00 81.39  ? 219  GLN C NE2   1 
ATOM   5266  N  N     . GLY C  2  220  ? 38.797  -43.891 43.257   1.00 65.24  ? 220  GLY C N     1 
ATOM   5267  C  CA    . GLY C  2  220  ? 39.084  -42.480 43.080   1.00 63.62  ? 220  GLY C CA    1 
ATOM   5268  C  C     . GLY C  2  220  ? 40.571  -42.254 42.889   1.00 61.81  ? 220  GLY C C     1 
ATOM   5269  O  O     . GLY C  2  220  ? 40.996  -41.248 42.317   1.00 56.69  ? 220  GLY C O     1 
ATOM   5270  N  N     . LEU C  2  221  ? 41.367  -43.196 43.385   1.00 64.24  ? 221  LEU C N     1 
ATOM   5271  C  CA    . LEU C  2  221  ? 42.817  -43.150 43.202   1.00 57.23  ? 221  LEU C CA    1 
ATOM   5272  C  C     . LEU C  2  221  ? 43.227  -43.631 41.806   1.00 58.90  ? 221  LEU C C     1 
ATOM   5273  O  O     . LEU C  2  221  ? 44.348  -43.387 41.356   1.00 51.84  ? 221  LEU C O     1 
ATOM   5274  C  CB    . LEU C  2  221  ? 43.494  -44.006 44.275   1.00 48.94  ? 221  LEU C CB    1 
ATOM   5275  C  CG    . LEU C  2  221  ? 45.014  -44.147 44.276   1.00 45.85  ? 221  LEU C CG    1 
ATOM   5276  C  CD1   . LEU C  2  221  ? 45.677  -42.810 44.550   1.00 46.14  ? 221  LEU C CD1   1 
ATOM   5277  C  CD2   . LEU C  2  221  ? 45.443  -45.186 45.298   1.00 49.99  ? 221  LEU C CD2   1 
ATOM   5278  N  N     . MET C  2  222  ? 42.307  -44.300 41.116   1.00 67.22  ? 222  MET C N     1 
ATOM   5279  C  CA    . MET C  2  222  ? 42.634  -44.973 39.859   1.00 64.41  ? 222  MET C CA    1 
ATOM   5280  C  C     . MET C  2  222  ? 42.537  -44.072 38.627   1.00 67.02  ? 222  MET C C     1 
ATOM   5281  O  O     . MET C  2  222  ? 41.476  -43.523 38.318   1.00 64.58  ? 222  MET C O     1 
ATOM   5282  C  CB    . MET C  2  222  ? 41.765  -46.221 39.680   1.00 57.03  ? 222  MET C CB    1 
ATOM   5283  C  CG    . MET C  2  222  ? 42.522  -47.441 39.166   1.00 61.12  ? 222  MET C CG    1 
ATOM   5284  S  SD    . MET C  2  222  ? 43.181  -48.522 40.463   1.00 84.83  ? 222  MET C SD    1 
ATOM   5285  C  CE    . MET C  2  222  ? 44.643  -47.634 40.996   1.00 66.30  ? 222  MET C CE    1 
ATOM   5286  N  N     . ASP C  2  223  ? 43.658  -43.928 37.927   1.00 68.72  ? 223  ASP C N     1 
ATOM   5287  C  CA    . ASP C  2  223  ? 43.713  -43.114 36.717   1.00 75.40  ? 223  ASP C CA    1 
ATOM   5288  C  C     . ASP C  2  223  ? 44.492  -43.838 35.614   1.00 80.44  ? 223  ASP C C     1 
ATOM   5289  O  O     . ASP C  2  223  ? 45.667  -44.164 35.778   1.00 77.03  ? 223  ASP C O     1 
ATOM   5290  C  CB    . ASP C  2  223  ? 44.332  -41.745 37.020   1.00 67.04  ? 223  ASP C CB    1 
ATOM   5291  C  CG    . ASP C  2  223  ? 44.396  -40.847 35.800   1.00 69.22  ? 223  ASP C CG    1 
ATOM   5292  O  OD1   . ASP C  2  223  ? 45.405  -40.911 35.068   1.00 67.91  ? 223  ASP C OD1   1 
ATOM   5293  O  OD2   . ASP C  2  223  ? 43.441  -40.074 35.572   1.00 76.99  ? 223  ASP C OD2   1 
ATOM   5294  N  N     . GLU C  2  224  ? 43.819  -44.088 34.495   1.00 79.95  ? 224  GLU C N     1 
ATOM   5295  C  CA    . GLU C  2  224  ? 44.398  -44.796 33.352   1.00 76.39  ? 224  GLU C CA    1 
ATOM   5296  C  C     . GLU C  2  224  ? 45.685  -44.169 32.795   1.00 73.68  ? 224  GLU C C     1 
ATOM   5297  O  O     . GLU C  2  224  ? 46.745  -44.804 32.789   1.00 68.71  ? 224  GLU C O     1 
ATOM   5298  C  CB    . GLU C  2  224  ? 43.352  -44.986 32.241   1.00 87.96  ? 224  GLU C CB    1 
ATOM   5299  C  CG    . GLU C  2  224  ? 42.610  -43.718 31.802   1.00 91.80  ? 224  GLU C CG    1 
ATOM   5300  C  CD    . GLU C  2  224  ? 41.567  -43.249 32.804   1.00 88.53  ? 224  GLU C CD    1 
ATOM   5301  O  OE1   . GLU C  2  224  ? 41.138  -42.079 32.706   1.00 90.02  ? 224  GLU C OE1   1 
ATOM   5302  O  OE2   . GLU C  2  224  ? 41.179  -44.045 33.687   1.00 84.68  ? 224  GLU C OE2   1 
ATOM   5303  N  N     . SER C  2  225  ? 45.571  -42.932 32.317   1.00 69.31  ? 225  SER C N     1 
ATOM   5304  C  CA    . SER C  2  225  ? 46.678  -42.200 31.706   1.00 62.91  ? 225  SER C CA    1 
ATOM   5305  C  C     . SER C  2  225  ? 47.963  -42.225 32.532   1.00 65.55  ? 225  SER C C     1 
ATOM   5306  O  O     . SER C  2  225  ? 49.059  -42.317 31.980   1.00 63.74  ? 225  SER C O     1 
ATOM   5307  C  CB    . SER C  2  225  ? 46.254  -40.756 31.433   1.00 60.04  ? 225  SER C CB    1 
ATOM   5308  O  OG    . SER C  2  225  ? 45.414  -40.271 32.468   1.00 61.39  ? 225  SER C OG    1 
ATOM   5309  N  N     . VAL C  2  226  ? 47.822  -42.142 33.852   1.00 67.37  ? 226  VAL C N     1 
ATOM   5310  C  CA    . VAL C  2  226  ? 48.972  -42.159 34.753   1.00 66.56  ? 226  VAL C CA    1 
ATOM   5311  C  C     . VAL C  2  226  ? 49.736  -43.485 34.723   1.00 69.75  ? 226  VAL C C     1 
ATOM   5312  O  O     . VAL C  2  226  ? 50.964  -43.496 34.600   1.00 70.84  ? 226  VAL C O     1 
ATOM   5313  C  CB    . VAL C  2  226  ? 48.564  -41.814 36.200   1.00 62.78  ? 226  VAL C CB    1 
ATOM   5314  C  CG1   . VAL C  2  226  ? 49.662  -42.211 37.182   1.00 59.42  ? 226  VAL C CG1   1 
ATOM   5315  C  CG2   . VAL C  2  226  ? 48.242  -40.334 36.318   1.00 55.48  ? 226  VAL C CG2   1 
ATOM   5316  N  N     . PHE C  2  227  ? 49.020  -44.600 34.832   1.00 62.06  ? 227  PHE C N     1 
ATOM   5317  C  CA    . PHE C  2  227  ? 49.669  -45.908 34.783   1.00 68.37  ? 227  PHE C CA    1 
ATOM   5318  C  C     . PHE C  2  227  ? 50.121  -46.262 33.370   1.00 72.67  ? 227  PHE C C     1 
ATOM   5319  O  O     . PHE C  2  227  ? 50.995  -47.113 33.184   1.00 62.91  ? 227  PHE C O     1 
ATOM   5320  C  CB    . PHE C  2  227  ? 48.757  -46.996 35.343   1.00 68.61  ? 227  PHE C CB    1 
ATOM   5321  C  CG    . PHE C  2  227  ? 48.416  -46.801 36.782   1.00 67.16  ? 227  PHE C CG    1 
ATOM   5322  C  CD1   . PHE C  2  227  ? 49.345  -47.085 37.769   1.00 65.84  ? 227  PHE C CD1   1 
ATOM   5323  C  CD2   . PHE C  2  227  ? 47.173  -46.321 37.151   1.00 66.90  ? 227  PHE C CD2   1 
ATOM   5324  C  CE1   . PHE C  2  227  ? 49.038  -46.896 39.097   1.00 66.04  ? 227  PHE C CE1   1 
ATOM   5325  C  CE2   . PHE C  2  227  ? 46.855  -46.129 38.477   1.00 65.92  ? 227  PHE C CE2   1 
ATOM   5326  C  CZ    . PHE C  2  227  ? 47.787  -46.418 39.454   1.00 73.37  ? 227  PHE C CZ    1 
ATOM   5327  N  N     . ALA C  2  228  ? 49.522  -45.605 32.380   1.00 70.33  ? 228  ALA C N     1 
ATOM   5328  C  CA    . ALA C  2  228  ? 49.938  -45.769 30.994   1.00 64.31  ? 228  ALA C CA    1 
ATOM   5329  C  C     . ALA C  2  228  ? 51.403  -45.375 30.821   1.00 68.95  ? 228  ALA C C     1 
ATOM   5330  O  O     . ALA C  2  228  ? 52.190  -46.119 30.235   1.00 70.66  ? 228  ALA C O     1 
ATOM   5331  C  CB    . ALA C  2  228  ? 49.053  -44.945 30.073   1.00 65.27  ? 228  ALA C CB    1 
ATOM   5332  N  N     . MET C  2  229  ? 51.765  -44.208 31.350   1.00 71.95  ? 229  MET C N     1 
ATOM   5333  C  CA    . MET C  2  229  ? 53.124  -43.690 31.216   1.00 68.85  ? 229  MET C CA    1 
ATOM   5334  C  C     . MET C  2  229  ? 54.114  -44.287 32.217   1.00 67.03  ? 229  MET C C     1 
ATOM   5335  O  O     . MET C  2  229  ? 53.763  -44.593 33.357   1.00 66.86  ? 229  MET C O     1 
ATOM   5336  C  CB    . MET C  2  229  ? 53.134  -42.160 31.306   1.00 70.65  ? 229  MET C CB    1 
ATOM   5337  C  CG    . MET C  2  229  ? 52.192  -41.575 32.349   1.00 67.59  ? 229  MET C CG    1 
ATOM   5338  S  SD    . MET C  2  229  ? 52.236  -39.770 32.370   1.00 67.15  ? 229  MET C SD    1 
ATOM   5339  C  CE    . MET C  2  229  ? 50.604  -39.374 33.000   1.00 52.62  ? 229  MET C CE    1 
ATOM   5340  N  N     . ARG C  2  230  ? 55.355  -44.442 31.769   1.00 69.43  ? 230  ARG C N     1 
ATOM   5341  C  CA    . ARG C  2  230  ? 56.441  -44.961 32.594   1.00 75.22  ? 230  ARG C CA    1 
ATOM   5342  C  C     . ARG C  2  230  ? 56.750  -43.990 33.738   1.00 76.78  ? 230  ARG C C     1 
ATOM   5343  O  O     . ARG C  2  230  ? 56.352  -42.825 33.678   1.00 76.63  ? 230  ARG C O     1 
ATOM   5344  C  CB    . ARG C  2  230  ? 57.683  -45.169 31.718   1.00 75.74  ? 230  ARG C CB    1 
ATOM   5345  C  CG    . ARG C  2  230  ? 57.444  -46.070 30.513   1.00 71.01  ? 230  ARG C CG    1 
ATOM   5346  C  CD    . ARG C  2  230  ? 58.667  -46.157 29.607   1.00 78.20  ? 230  ARG C CD    1 
ATOM   5347  N  NE    . ARG C  2  230  ? 58.833  -44.967 28.776   1.00 85.51  ? 230  ARG C NE    1 
ATOM   5348  C  CZ    . ARG C  2  230  ? 59.844  -44.110 28.885   1.00 87.95  ? 230  ARG C CZ    1 
ATOM   5349  N  NH1   . ARG C  2  230  ? 59.910  -43.055 28.082   1.00 81.95  ? 230  ARG C NH1   1 
ATOM   5350  N  NH2   . ARG C  2  230  ? 60.793  -44.309 29.792   1.00 83.79  ? 230  ARG C NH2   1 
ATOM   5351  N  N     . PRO C  2  231  ? 57.444  -44.468 34.791   1.00 71.61  ? 231  PRO C N     1 
ATOM   5352  C  CA    . PRO C  2  231  ? 57.858  -43.582 35.888   1.00 66.74  ? 231  PRO C CA    1 
ATOM   5353  C  C     . PRO C  2  231  ? 58.631  -42.349 35.411   1.00 68.56  ? 231  PRO C C     1 
ATOM   5354  O  O     . PRO C  2  231  ? 58.486  -41.280 36.002   1.00 67.04  ? 231  PRO C O     1 
ATOM   5355  C  CB    . PRO C  2  231  ? 58.760  -44.482 36.735   1.00 63.45  ? 231  PRO C CB    1 
ATOM   5356  C  CG    . PRO C  2  231  ? 58.212  -45.842 36.521   1.00 61.79  ? 231  PRO C CG    1 
ATOM   5357  C  CD    . PRO C  2  231  ? 57.753  -45.879 35.086   1.00 66.87  ? 231  PRO C CD    1 
ATOM   5358  N  N     . GLU C  2  232  ? 59.432  -42.497 34.360   1.00 68.13  ? 232  GLU C N     1 
ATOM   5359  C  CA    . GLU C  2  232  ? 60.152  -41.369 33.774   1.00 67.11  ? 232  GLU C CA    1 
ATOM   5360  C  C     . GLU C  2  232  ? 59.184  -40.303 33.270   1.00 65.89  ? 232  GLU C C     1 
ATOM   5361  O  O     . GLU C  2  232  ? 59.287  -39.124 33.634   1.00 67.41  ? 232  GLU C O     1 
ATOM   5362  C  CB    . GLU C  2  232  ? 61.043  -41.839 32.618   1.00 77.58  ? 232  GLU C CB    1 
ATOM   5363  C  CG    . GLU C  2  232  ? 62.365  -42.469 33.039   1.00 83.00  ? 232  GLU C CG    1 
ATOM   5364  C  CD    . GLU C  2  232  ? 62.196  -43.799 33.756   1.00 91.64  ? 232  GLU C CD    1 
ATOM   5365  O  OE1   . GLU C  2  232  ? 61.158  -44.467 33.555   1.00 85.14  ? 232  GLU C OE1   1 
ATOM   5366  O  OE2   . GLU C  2  232  ? 63.106  -44.174 34.525   1.00 92.89  ? 232  GLU C OE2   1 
ATOM   5367  N  N     . GLU C  2  233  ? 58.244  -40.732 32.431   1.00 65.69  ? 233  GLU C N     1 
ATOM   5368  C  CA    . GLU C  2  233  ? 57.268  -39.832 31.824   1.00 68.52  ? 233  GLU C CA    1 
ATOM   5369  C  C     . GLU C  2  233  ? 56.396  -39.150 32.873   1.00 69.47  ? 233  GLU C C     1 
ATOM   5370  O  O     . GLU C  2  233  ? 56.069  -37.967 32.747   1.00 64.75  ? 233  GLU C O     1 
ATOM   5371  C  CB    . GLU C  2  233  ? 56.392  -40.586 30.824   1.00 68.81  ? 233  GLU C CB    1 
ATOM   5372  C  CG    . GLU C  2  233  ? 57.169  -41.259 29.708   1.00 73.55  ? 233  GLU C CG    1 
ATOM   5373  C  CD    . GLU C  2  233  ? 56.277  -41.726 28.574   1.00 81.85  ? 233  GLU C CD    1 
ATOM   5374  O  OE1   . GLU C  2  233  ? 55.037  -41.658 28.719   1.00 74.70  ? 233  GLU C OE1   1 
ATOM   5375  O  OE2   . GLU C  2  233  ? 56.820  -42.157 27.534   1.00 91.58  ? 233  GLU C OE2   1 
ATOM   5376  N  N     . ALA C  2  234  ? 56.026  -39.902 33.906   1.00 72.65  ? 234  ALA C N     1 
ATOM   5377  C  CA    . ALA C  2  234  ? 55.230  -39.366 35.006   1.00 63.85  ? 234  ALA C CA    1 
ATOM   5378  C  C     . ALA C  2  234  ? 56.042  -38.370 35.833   1.00 63.38  ? 234  ALA C C     1 
ATOM   5379  O  O     . ALA C  2  234  ? 55.498  -37.401 36.365   1.00 63.90  ? 234  ALA C O     1 
ATOM   5380  C  CB    . ALA C  2  234  ? 54.707  -40.493 35.881   1.00 59.09  ? 234  ALA C CB    1 
ATOM   5381  N  N     . LEU C  2  235  ? 57.345  -38.616 35.934   1.00 59.09  ? 235  LEU C N     1 
ATOM   5382  C  CA    . LEU C  2  235  ? 58.252  -37.695 36.610   1.00 54.01  ? 235  LEU C CA    1 
ATOM   5383  C  C     . LEU C  2  235  ? 58.332  -36.360 35.877   1.00 56.03  ? 235  LEU C C     1 
ATOM   5384  O  O     . LEU C  2  235  ? 58.207  -35.298 36.491   1.00 58.85  ? 235  LEU C O     1 
ATOM   5385  C  CB    . LEU C  2  235  ? 59.646  -38.307 36.731   1.00 51.80  ? 235  LEU C CB    1 
ATOM   5386  C  CG    . LEU C  2  235  ? 60.731  -37.412 37.330   1.00 45.86  ? 235  LEU C CG    1 
ATOM   5387  C  CD1   . LEU C  2  235  ? 60.345  -36.972 38.724   1.00 55.96  ? 235  LEU C CD1   1 
ATOM   5388  C  CD2   . LEU C  2  235  ? 62.051  -38.144 37.359   1.00 45.95  ? 235  LEU C CD2   1 
ATOM   5389  N  N     . ILE C  2  236  ? 58.541  -36.417 34.564   1.00 57.74  ? 236  ILE C N     1 
ATOM   5390  C  CA    . ILE C  2  236  ? 58.605  -35.198 33.759   1.00 54.00  ? 236  ILE C CA    1 
ATOM   5391  C  C     . ILE C  2  236  ? 57.256  -34.466 33.742   1.00 52.18  ? 236  ILE C C     1 
ATOM   5392  O  O     . ILE C  2  236  ? 57.207  -33.234 33.768   1.00 56.01  ? 236  ILE C O     1 
ATOM   5393  C  CB    . ILE C  2  236  ? 59.092  -35.484 32.320   1.00 53.61  ? 236  ILE C CB    1 
ATOM   5394  C  CG1   . ILE C  2  236  ? 60.447  -36.193 32.349   1.00 52.98  ? 236  ILE C CG1   1 
ATOM   5395  C  CG2   . ILE C  2  236  ? 59.202  -34.198 31.524   1.00 50.54  ? 236  ILE C CG2   1 
ATOM   5396  C  CD1   . ILE C  2  236  ? 60.987  -36.531 30.977   1.00 61.38  ? 236  ILE C CD1   1 
ATOM   5397  N  N     . ARG C  2  237  ? 56.167  -35.227 33.719   1.00 48.98  ? 237  ARG C N     1 
ATOM   5398  C  CA    . ARG C  2  237  ? 54.826  -34.647 33.778   1.00 53.32  ? 237  ARG C CA    1 
ATOM   5399  C  C     . ARG C  2  237  ? 54.605  -33.905 35.098   1.00 56.24  ? 237  ARG C C     1 
ATOM   5400  O  O     . ARG C  2  237  ? 54.106  -32.772 35.117   1.00 62.35  ? 237  ARG C O     1 
ATOM   5401  C  CB    . ARG C  2  237  ? 53.770  -35.739 33.586   1.00 60.96  ? 237  ARG C CB    1 
ATOM   5402  C  CG    . ARG C  2  237  ? 52.348  -35.340 33.955   1.00 63.93  ? 237  ARG C CG    1 
ATOM   5403  C  CD    . ARG C  2  237  ? 51.707  -34.417 32.930   1.00 66.39  ? 237  ARG C CD    1 
ATOM   5404  N  NE    . ARG C  2  237  ? 50.316  -34.129 33.278   1.00 82.24  ? 237  ARG C NE    1 
ATOM   5405  C  CZ    . ARG C  2  237  ? 49.549  -33.247 32.645   1.00 82.78  ? 237  ARG C CZ    1 
ATOM   5406  N  NH1   . ARG C  2  237  ? 48.297  -33.055 33.037   1.00 64.58  ? 237  ARG C NH1   1 
ATOM   5407  N  NH2   . ARG C  2  237  ? 50.034  -32.554 31.624   1.00 93.04  ? 237  ARG C NH2   1 
ATOM   5408  N  N     . LEU C  2  238  ? 54.989  -34.546 36.198   1.00 53.76  ? 238  LEU C N     1 
ATOM   5409  C  CA    . LEU C  2  238  ? 54.904  -33.928 37.519   1.00 53.84  ? 238  LEU C CA    1 
ATOM   5410  C  C     . LEU C  2  238  ? 55.738  -32.650 37.582   1.00 48.15  ? 238  LEU C C     1 
ATOM   5411  O  O     . LEU C  2  238  ? 55.284  -31.630 38.098   1.00 49.81  ? 238  LEU C O     1 
ATOM   5412  C  CB    . LEU C  2  238  ? 55.348  -34.914 38.606   1.00 57.15  ? 238  LEU C CB    1 
ATOM   5413  C  CG    . LEU C  2  238  ? 55.325  -34.447 40.067   1.00 53.73  ? 238  LEU C CG    1 
ATOM   5414  C  CD1   . LEU C  2  238  ? 53.959  -33.888 40.448   1.00 39.32  ? 238  LEU C CD1   1 
ATOM   5415  C  CD2   . LEU C  2  238  ? 55.723  -35.583 41.003   1.00 38.39  ? 238  LEU C CD2   1 
ATOM   5416  N  N     . PHE C  2  239  ? 56.953  -32.712 37.045   1.00 47.83  ? 239  PHE C N     1 
ATOM   5417  C  CA    . PHE C  2  239  ? 57.837  -31.551 37.007   1.00 44.68  ? 239  PHE C CA    1 
ATOM   5418  C  C     . PHE C  2  239  ? 57.239  -30.403 36.200   1.00 48.72  ? 239  PHE C C     1 
ATOM   5419  O  O     . PHE C  2  239  ? 57.442  -29.238 36.535   1.00 50.43  ? 239  PHE C O     1 
ATOM   5420  C  CB    . PHE C  2  239  ? 59.200  -31.934 36.436   1.00 42.15  ? 239  PHE C CB    1 
ATOM   5421  C  CG    . PHE C  2  239  ? 60.175  -30.794 36.368   1.00 40.48  ? 239  PHE C CG    1 
ATOM   5422  C  CD1   . PHE C  2  239  ? 60.355  -30.086 35.193   1.00 45.53  ? 239  PHE C CD1   1 
ATOM   5423  C  CD2   . PHE C  2  239  ? 60.919  -30.436 37.478   1.00 43.74  ? 239  PHE C CD2   1 
ATOM   5424  C  CE1   . PHE C  2  239  ? 61.256  -29.040 35.129   1.00 49.43  ? 239  PHE C CE1   1 
ATOM   5425  C  CE2   . PHE C  2  239  ? 61.825  -29.393 37.420   1.00 43.42  ? 239  PHE C CE2   1 
ATOM   5426  C  CZ    . PHE C  2  239  ? 61.993  -28.694 36.245   1.00 46.65  ? 239  PHE C CZ    1 
ATOM   5427  N  N     . THR C  2  240  ? 56.512  -30.729 35.134   1.00 52.20  ? 240  THR C N     1 
ATOM   5428  C  CA    . THR C  2  240  ? 55.823  -29.702 34.353   1.00 55.76  ? 240  THR C CA    1 
ATOM   5429  C  C     . THR C  2  240  ? 54.586  -29.170 35.078   1.00 57.92  ? 240  THR C C     1 
ATOM   5430  O  O     . THR C  2  240  ? 54.119  -28.065 34.794   1.00 55.10  ? 240  THR C O     1 
ATOM   5431  C  CB    . THR C  2  240  ? 55.408  -30.208 32.958   1.00 55.35  ? 240  THR C CB    1 
ATOM   5432  O  OG1   . THR C  2  240  ? 54.536  -31.337 33.091   1.00 65.84  ? 240  THR C OG1   1 
ATOM   5433  C  CG2   . THR C  2  240  ? 56.625  -30.606 32.157   1.00 54.31  ? 240  THR C CG2   1 
ATOM   5434  N  N     . LEU C  2  241  ? 54.049  -29.958 36.006   1.00 57.30  ? 241  LEU C N     1 
ATOM   5435  C  CA    . LEU C  2  241  ? 52.937  -29.488 36.829   1.00 59.55  ? 241  LEU C CA    1 
ATOM   5436  C  C     . LEU C  2  241  ? 53.401  -28.549 37.947   1.00 58.94  ? 241  LEU C C     1 
ATOM   5437  O  O     . LEU C  2  241  ? 52.712  -27.583 38.284   1.00 55.46  ? 241  LEU C O     1 
ATOM   5438  C  CB    . LEU C  2  241  ? 52.150  -30.664 37.414   1.00 50.23  ? 241  LEU C CB    1 
ATOM   5439  C  CG    . LEU C  2  241  ? 51.228  -31.399 36.442   1.00 61.00  ? 241  LEU C CG    1 
ATOM   5440  C  CD1   . LEU C  2  241  ? 50.345  -32.390 37.187   1.00 61.83  ? 241  LEU C CD1   1 
ATOM   5441  C  CD2   . LEU C  2  241  ? 50.385  -30.413 35.643   1.00 60.35  ? 241  LEU C CD2   1 
ATOM   5442  N  N     . LEU C  2  242  ? 54.561  -28.850 38.526   1.00 57.53  ? 242  LEU C N     1 
ATOM   5443  C  CA    . LEU C  2  242  ? 55.118  -28.045 39.613   1.00 58.29  ? 242  LEU C CA    1 
ATOM   5444  C  C     . LEU C  2  242  ? 55.845  -26.798 39.116   1.00 57.96  ? 242  LEU C C     1 
ATOM   5445  O  O     . LEU C  2  242  ? 55.897  -25.780 39.809   1.00 56.73  ? 242  LEU C O     1 
ATOM   5446  C  CB    . LEU C  2  242  ? 56.070  -28.883 40.472   1.00 50.80  ? 242  LEU C CB    1 
ATOM   5447  C  CG    . LEU C  2  242  ? 55.491  -30.122 41.157   1.00 47.89  ? 242  LEU C CG    1 
ATOM   5448  C  CD1   . LEU C  2  242  ? 56.556  -30.809 41.993   1.00 42.67  ? 242  LEU C CD1   1 
ATOM   5449  C  CD2   . LEU C  2  242  ? 54.288  -29.755 42.010   1.00 47.11  ? 242  LEU C CD2   1 
ATOM   5450  N  N     . ARG C  2  243  ? 56.414  -26.886 37.919   1.00 56.54  ? 243  ARG C N     1 
ATOM   5451  C  CA    . ARG C  2  243  ? 57.245  -25.813 37.386   1.00 53.38  ? 243  ARG C CA    1 
ATOM   5452  C  C     . ARG C  2  243  ? 56.845  -25.427 35.966   1.00 54.94  ? 243  ARG C C     1 
ATOM   5453  O  O     . ARG C  2  243  ? 57.482  -25.853 35.001   1.00 57.85  ? 243  ARG C O     1 
ATOM   5454  C  CB    . ARG C  2  243  ? 58.715  -26.235 37.402   1.00 52.59  ? 243  ARG C CB    1 
ATOM   5455  C  CG    . ARG C  2  243  ? 59.227  -26.687 38.761   1.00 50.63  ? 243  ARG C CG    1 
ATOM   5456  C  CD    . ARG C  2  243  ? 59.765  -25.521 39.567   1.00 54.39  ? 243  ARG C CD    1 
ATOM   5457  N  NE    . ARG C  2  243  ? 60.846  -24.835 38.864   1.00 58.69  ? 243  ARG C NE    1 
ATOM   5458  C  CZ    . ARG C  2  243  ? 61.640  -23.926 39.420   1.00 53.38  ? 243  ARG C CZ    1 
ATOM   5459  N  NH1   . ARG C  2  243  ? 62.596  -23.348 38.705   1.00 43.11  ? 243  ARG C NH1   1 
ATOM   5460  N  NH2   . ARG C  2  243  ? 61.475  -23.594 40.693   1.00 53.62  ? 243  ARG C NH2   1 
ATOM   5461  N  N     . PRO C  2  244  ? 55.779  -24.626 35.831   1.00 52.21  ? 244  PRO C N     1 
ATOM   5462  C  CA    . PRO C  2  244  ? 55.394  -24.109 34.514   1.00 59.06  ? 244  PRO C CA    1 
ATOM   5463  C  C     . PRO C  2  244  ? 56.452  -23.156 33.960   1.00 62.94  ? 244  PRO C C     1 
ATOM   5464  O  O     . PRO C  2  244  ? 56.945  -22.287 34.678   1.00 53.70  ? 244  PRO C O     1 
ATOM   5465  C  CB    . PRO C  2  244  ? 54.096  -23.346 34.804   1.00 60.22  ? 244  PRO C CB    1 
ATOM   5466  C  CG    . PRO C  2  244  ? 53.579  -23.937 36.077   1.00 58.24  ? 244  PRO C CG    1 
ATOM   5467  C  CD    . PRO C  2  244  ? 54.802  -24.268 36.871   1.00 57.68  ? 244  PRO C CD    1 
ATOM   5468  N  N     . GLY C  2  245  ? 56.796  -23.333 32.689   1.00 70.78  ? 245  GLY C N     1 
ATOM   5469  C  CA    . GLY C  2  245  ? 57.761  -22.476 32.022   1.00 70.39  ? 245  GLY C CA    1 
ATOM   5470  C  C     . GLY C  2  245  ? 59.190  -22.979 32.112   1.00 72.35  ? 245  GLY C C     1 
ATOM   5471  O  O     . GLY C  2  245  ? 60.024  -22.651 31.267   1.00 71.34  ? 245  GLY C O     1 
ATOM   5472  N  N     . ASP C  2  246  ? 59.473  -23.788 33.128   1.00 65.22  ? 246  ASP C N     1 
ATOM   5473  C  CA    . ASP C  2  246  ? 60.781  -24.414 33.252   1.00 61.23  ? 246  ASP C CA    1 
ATOM   5474  C  C     . ASP C  2  246  ? 60.846  -25.544 32.234   1.00 62.99  ? 246  ASP C C     1 
ATOM   5475  O  O     . ASP C  2  246  ? 59.946  -26.386 32.189   1.00 62.87  ? 246  ASP C O     1 
ATOM   5476  C  CB    . ASP C  2  246  ? 60.978  -24.963 34.667   1.00 65.22  ? 246  ASP C CB    1 
ATOM   5477  C  CG    . ASP C  2  246  ? 62.344  -24.627 35.244   1.00 65.50  ? 246  ASP C CG    1 
ATOM   5478  O  OD1   . ASP C  2  246  ? 63.302  -25.404 35.025   1.00 54.63  ? 246  ASP C OD1   1 
ATOM   5479  O  OD2   . ASP C  2  246  ? 62.455  -23.586 35.928   1.00 65.02  ? 246  ASP C OD2   1 
ATOM   5480  N  N     . PRO C  2  247  ? 61.900  -25.564 31.401   1.00 64.79  ? 247  PRO C N     1 
ATOM   5481  C  CA    . PRO C  2  247  ? 62.012  -26.593 30.359   1.00 68.04  ? 247  PRO C CA    1 
ATOM   5482  C  C     . PRO C  2  247  ? 62.080  -27.995 30.963   1.00 62.35  ? 247  PRO C C     1 
ATOM   5483  O  O     . PRO C  2  247  ? 62.921  -28.252 31.827   1.00 63.28  ? 247  PRO C O     1 
ATOM   5484  C  CB    . PRO C  2  247  ? 63.327  -26.238 29.653   1.00 62.11  ? 247  PRO C CB    1 
ATOM   5485  C  CG    . PRO C  2  247  ? 64.100  -25.441 30.655   1.00 57.28  ? 247  PRO C CG    1 
ATOM   5486  C  CD    . PRO C  2  247  ? 63.071  -24.671 31.429   1.00 59.66  ? 247  PRO C CD    1 
ATOM   5487  N  N     . PRO C  2  248  ? 61.210  -28.902 30.494   1.00 60.13  ? 248  PRO C N     1 
ATOM   5488  C  CA    . PRO C  2  248  ? 61.012  -30.214 31.122   1.00 59.29  ? 248  PRO C CA    1 
ATOM   5489  C  C     . PRO C  2  248  ? 62.135  -31.218 30.867   1.00 61.23  ? 248  PRO C C     1 
ATOM   5490  O  O     . PRO C  2  248  ? 61.849  -32.340 30.449   1.00 66.43  ? 248  PRO C O     1 
ATOM   5491  C  CB    . PRO C  2  248  ? 59.717  -30.722 30.469   1.00 58.00  ? 248  PRO C CB    1 
ATOM   5492  C  CG    . PRO C  2  248  ? 59.097  -29.522 29.805   1.00 61.68  ? 248  PRO C CG    1 
ATOM   5493  C  CD    . PRO C  2  248  ? 60.245  -28.661 29.410   1.00 66.13  ? 248  PRO C CD    1 
ATOM   5494  N  N     . LYS C  2  249  ? 63.383  -30.841 31.129   1.00 50.95  ? 249  LYS C N     1 
ATOM   5495  C  CA    . LYS C  2  249  ? 64.479  -31.794 31.002   1.00 54.34  ? 249  LYS C CA    1 
ATOM   5496  C  C     . LYS C  2  249  ? 64.365  -32.821 32.123   1.00 60.05  ? 249  LYS C C     1 
ATOM   5497  O  O     . LYS C  2  249  ? 63.848  -32.512 33.195   1.00 61.89  ? 249  LYS C O     1 
ATOM   5498  C  CB    . LYS C  2  249  ? 65.834  -31.089 31.042   1.00 62.82  ? 249  LYS C CB    1 
ATOM   5499  C  CG    . LYS C  2  249  ? 66.977  -31.957 30.538   1.00 67.11  ? 249  LYS C CG    1 
ATOM   5500  C  CD    . LYS C  2  249  ? 68.221  -31.141 30.232   1.00 68.42  ? 249  LYS C CD    1 
ATOM   5501  C  CE    . LYS C  2  249  ? 69.274  -32.002 29.556   1.00 52.15  ? 249  LYS C CE    1 
ATOM   5502  N  NZ    . LYS C  2  249  ? 70.468  -31.210 29.162   1.00 42.57  ? 249  LYS C NZ    1 
ATOM   5503  N  N     . ARG C  2  250  ? 64.836  -34.041 31.876   1.00 62.59  ? 250  ARG C N     1 
ATOM   5504  C  CA    . ARG C  2  250  ? 64.618  -35.139 32.818   1.00 60.75  ? 250  ARG C CA    1 
ATOM   5505  C  C     . ARG C  2  250  ? 65.553  -35.148 34.036   1.00 60.65  ? 250  ARG C C     1 
ATOM   5506  O  O     . ARG C  2  250  ? 65.107  -35.428 35.147   1.00 60.67  ? 250  ARG C O     1 
ATOM   5507  C  CB    . ARG C  2  250  ? 64.652  -36.495 32.106   1.00 71.47  ? 250  ARG C CB    1 
ATOM   5508  C  CG    . ARG C  2  250  ? 63.927  -37.594 32.868   1.00 65.29  ? 250  ARG C CG    1 
ATOM   5509  C  CD    . ARG C  2  250  ? 64.268  -38.970 32.328   1.00 67.80  ? 250  ARG C CD    1 
ATOM   5510  N  NE    . ARG C  2  250  ? 64.495  -39.914 33.416   1.00 79.16  ? 250  ARG C NE    1 
ATOM   5511  C  CZ    . ARG C  2  250  ? 65.632  -40.001 34.100   1.00 81.16  ? 250  ARG C CZ    1 
ATOM   5512  N  NH1   . ARG C  2  250  ? 66.649  -39.198 33.806   1.00 63.75  ? 250  ARG C NH1   1 
ATOM   5513  N  NH2   . ARG C  2  250  ? 65.753  -40.889 35.081   1.00 72.19  ? 250  ARG C NH2   1 
ATOM   5514  N  N     . ASP C  2  251  ? 66.837  -34.854 33.835   1.00 60.27  ? 251  ASP C N     1 
ATOM   5515  C  CA    . ASP C  2  251  ? 67.777  -34.781 34.960   1.00 59.70  ? 251  ASP C CA    1 
ATOM   5516  C  C     . ASP C  2  251  ? 67.503  -33.561 35.856   1.00 63.30  ? 251  ASP C C     1 
ATOM   5517  O  O     . ASP C  2  251  ? 67.765  -33.585 37.067   1.00 51.70  ? 251  ASP C O     1 
ATOM   5518  C  CB    . ASP C  2  251  ? 69.237  -34.811 34.480   1.00 53.39  ? 251  ASP C CB    1 
ATOM   5519  C  CG    . ASP C  2  251  ? 69.487  -33.902 33.289   1.00 66.53  ? 251  ASP C CG    1 
ATOM   5520  O  OD1   . ASP C  2  251  ? 68.698  -33.953 32.322   1.00 71.08  ? 251  ASP C OD1   1 
ATOM   5521  O  OD2   . ASP C  2  251  ? 70.475  -33.137 33.318   1.00 62.88  ? 251  ASP C OD2   1 
ATOM   5522  N  N     . LYS C  2  252  ? 66.964  -32.506 35.243   1.00 70.38  ? 252  LYS C N     1 
ATOM   5523  C  CA    . LYS C  2  252  ? 66.503  -31.313 35.948   1.00 53.61  ? 252  LYS C CA    1 
ATOM   5524  C  C     . LYS C  2  252  ? 65.360  -31.699 36.885   1.00 48.86  ? 252  LYS C C     1 
ATOM   5525  O  O     . LYS C  2  252  ? 65.348  -31.338 38.069   1.00 46.45  ? 252  LYS C O     1 
ATOM   5526  C  CB    . LYS C  2  252  ? 66.011  -30.282 34.929   1.00 46.05  ? 252  LYS C CB    1 
ATOM   5527  C  CG    . LYS C  2  252  ? 66.236  -28.831 35.318   1.00 57.91  ? 252  LYS C CG    1 
ATOM   5528  C  CD    . LYS C  2  252  ? 65.761  -27.889 34.212   1.00 59.35  ? 252  LYS C CD    1 
ATOM   5529  C  CE    . LYS C  2  252  ? 66.297  -26.470 34.400   1.00 61.17  ? 252  LYS C CE    1 
ATOM   5530  N  NZ    . LYS C  2  252  ? 67.786  -26.385 34.272   1.00 32.04  ? 252  LYS C NZ    1 
ATOM   5531  N  N     . ALA C  2  253  ? 64.408  -32.449 36.336   1.00 44.43  ? 253  ALA C N     1 
ATOM   5532  C  CA    . ALA C  2  253  ? 63.257  -32.952 37.077   1.00 42.90  ? 253  ALA C CA    1 
ATOM   5533  C  C     . ALA C  2  253  ? 63.660  -33.894 38.209   1.00 50.19  ? 253  ALA C C     1 
ATOM   5534  O  O     . ALA C  2  253  ? 63.112  -33.816 39.315   1.00 50.05  ? 253  ALA C O     1 
ATOM   5535  C  CB    . ALA C  2  253  ? 62.294  -33.650 36.134   1.00 46.06  ? 253  ALA C CB    1 
ATOM   5536  N  N     . VAL C  2  254  ? 64.605  -34.789 37.925   1.00 48.18  ? 254  VAL C N     1 
ATOM   5537  C  CA    . VAL C  2  254  ? 65.131  -35.704 38.935   1.00 51.40  ? 254  VAL C CA    1 
ATOM   5538  C  C     . VAL C  2  254  ? 65.769  -34.932 40.085   1.00 50.45  ? 254  VAL C C     1 
ATOM   5539  O  O     . VAL C  2  254  ? 65.483  -35.198 41.251   1.00 46.29  ? 254  VAL C O     1 
ATOM   5540  C  CB    . VAL C  2  254  ? 66.185  -36.671 38.353   1.00 52.84  ? 254  VAL C CB    1 
ATOM   5541  C  CG1   . VAL C  2  254  ? 66.899  -37.422 39.474   1.00 44.39  ? 254  VAL C CG1   1 
ATOM   5542  C  CG2   . VAL C  2  254  ? 65.545  -37.641 37.382   1.00 55.36  ? 254  VAL C CG2   1 
ATOM   5543  N  N     . ALA C  2  255  ? 66.632  -33.976 39.746   1.00 49.37  ? 255  ALA C N     1 
ATOM   5544  C  CA    . ALA C  2  255  ? 67.290  -33.149 40.752   1.00 45.44  ? 255  ALA C CA    1 
ATOM   5545  C  C     . ALA C  2  255  ? 66.266  -32.432 41.627   1.00 45.03  ? 255  ALA C C     1 
ATOM   5546  O  O     . ALA C  2  255  ? 66.360  -32.459 42.859   1.00 39.57  ? 255  ALA C O     1 
ATOM   5547  C  CB    . ALA C  2  255  ? 68.219  -32.145 40.087   1.00 49.98  ? 255  ALA C CB    1 
ATOM   5548  N  N     . TYR C  2  256  ? 65.283  -31.805 40.983   1.00 47.96  ? 256  TYR C N     1 
ATOM   5549  C  CA    . TYR C  2  256  ? 64.263  -31.049 41.705   1.00 41.34  ? 256  TYR C CA    1 
ATOM   5550  C  C     . TYR C  2  256  ? 63.431  -31.916 42.640   1.00 43.25  ? 256  TYR C C     1 
ATOM   5551  O  O     . TYR C  2  256  ? 63.342  -31.631 43.832   1.00 47.47  ? 256  TYR C O     1 
ATOM   5552  C  CB    . TYR C  2  256  ? 63.342  -30.298 40.743   1.00 41.58  ? 256  TYR C CB    1 
ATOM   5553  C  CG    . TYR C  2  256  ? 62.210  -29.572 41.441   1.00 46.84  ? 256  TYR C CG    1 
ATOM   5554  C  CD1   . TYR C  2  256  ? 62.449  -28.418 42.174   1.00 52.33  ? 256  TYR C CD1   1 
ATOM   5555  C  CD2   . TYR C  2  256  ? 60.902  -30.042 41.367   1.00 46.56  ? 256  TYR C CD2   1 
ATOM   5556  C  CE1   . TYR C  2  256  ? 61.421  -27.750 42.815   1.00 53.76  ? 256  TYR C CE1   1 
ATOM   5557  C  CE2   . TYR C  2  256  ? 59.867  -29.381 42.003   1.00 41.89  ? 256  TYR C CE2   1 
ATOM   5558  C  CZ    . TYR C  2  256  ? 60.133  -28.235 42.726   1.00 52.42  ? 256  TYR C CZ    1 
ATOM   5559  O  OH    . TYR C  2  256  ? 59.112  -27.568 43.366   1.00 64.03  ? 256  TYR C OH    1 
ATOM   5560  N  N     . VAL C  2  257  ? 62.816  -32.964 42.097   1.00 44.51  ? 257  VAL C N     1 
ATOM   5561  C  CA    . VAL C  2  257  ? 61.947  -33.827 42.896   1.00 41.23  ? 257  VAL C CA    1 
ATOM   5562  C  C     . VAL C  2  257  ? 62.735  -34.513 44.008   1.00 40.72  ? 257  VAL C C     1 
ATOM   5563  O  O     . VAL C  2  257  ? 62.215  -34.732 45.100   1.00 42.03  ? 257  VAL C O     1 
ATOM   5564  C  CB    . VAL C  2  257  ? 61.207  -34.862 42.022   1.00 39.64  ? 257  VAL C CB    1 
ATOM   5565  C  CG1   . VAL C  2  257  ? 60.336  -35.768 42.875   1.00 28.73  ? 257  VAL C CG1   1 
ATOM   5566  C  CG2   . VAL C  2  257  ? 60.356  -34.149 40.988   1.00 47.00  ? 257  VAL C CG2   1 
ATOM   5567  N  N     . TYR C  2  258  ? 63.997  -34.829 43.731   1.00 46.04  ? 258  TYR C N     1 
ATOM   5568  C  CA    . TYR C  2  258  ? 64.895  -35.365 44.750   1.00 43.98  ? 258  TYR C CA    1 
ATOM   5569  C  C     . TYR C  2  258  ? 65.064  -34.356 45.880   1.00 46.57  ? 258  TYR C C     1 
ATOM   5570  O  O     . TYR C  2  258  ? 64.975  -34.703 47.059   1.00 44.19  ? 258  TYR C O     1 
ATOM   5571  C  CB    . TYR C  2  258  ? 66.258  -35.709 44.140   1.00 40.33  ? 258  TYR C CB    1 
ATOM   5572  C  CG    . TYR C  2  258  ? 67.302  -36.172 45.131   1.00 39.19  ? 258  TYR C CG    1 
ATOM   5573  C  CD1   . TYR C  2  258  ? 68.289  -35.305 45.581   1.00 39.59  ? 258  TYR C CD1   1 
ATOM   5574  C  CD2   . TYR C  2  258  ? 67.310  -37.479 45.607   1.00 42.36  ? 258  TYR C CD2   1 
ATOM   5575  C  CE1   . TYR C  2  258  ? 69.250  -35.723 46.480   1.00 39.18  ? 258  TYR C CE1   1 
ATOM   5576  C  CE2   . TYR C  2  258  ? 68.266  -37.904 46.511   1.00 39.79  ? 258  TYR C CE2   1 
ATOM   5577  C  CZ    . TYR C  2  258  ? 69.233  -37.020 46.944   1.00 39.63  ? 258  TYR C CZ    1 
ATOM   5578  O  OH    . TYR C  2  258  ? 70.194  -37.428 47.838   1.00 42.04  ? 258  TYR C OH    1 
ATOM   5579  N  N     . GLY C  2  259  ? 65.305  -33.102 45.517   1.00 51.23  ? 259  GLY C N     1 
ATOM   5580  C  CA    . GLY C  2  259  ? 65.442  -32.057 46.513   1.00 52.62  ? 259  GLY C CA    1 
ATOM   5581  C  C     . GLY C  2  259  ? 64.173  -31.878 47.327   1.00 47.01  ? 259  GLY C C     1 
ATOM   5582  O  O     . GLY C  2  259  ? 64.213  -31.609 48.526   1.00 43.42  ? 259  GLY C O     1 
ATOM   5583  N  N     . LEU C  2  260  ? 63.037  -32.036 46.663   1.00 42.95  ? 260  LEU C N     1 
ATOM   5584  C  CA    . LEU C  2  260  ? 61.749  -31.827 47.297   1.00 42.49  ? 260  LEU C CA    1 
ATOM   5585  C  C     . LEU C  2  260  ? 61.405  -32.927 48.298   1.00 35.27  ? 260  LEU C C     1 
ATOM   5586  O  O     . LEU C  2  260  ? 61.110  -32.655 49.460   1.00 33.44  ? 260  LEU C O     1 
ATOM   5587  C  CB    . LEU C  2  260  ? 60.668  -31.771 46.219   1.00 45.77  ? 260  LEU C CB    1 
ATOM   5588  C  CG    . LEU C  2  260  ? 59.366  -31.052 46.561   1.00 48.43  ? 260  LEU C CG    1 
ATOM   5589  C  CD1   . LEU C  2  260  ? 59.589  -29.541 46.601   1.00 43.02  ? 260  LEU C CD1   1 
ATOM   5590  C  CD2   . LEU C  2  260  ? 58.275  -31.426 45.562   1.00 37.16  ? 260  LEU C CD2   1 
ATOM   5591  N  N     . ILE C  2  261  ? 61.403  -34.166 47.823   1.00 37.50  ? 261  ILE C N     1 
ATOM   5592  C  CA    . ILE C  2  261  ? 60.953  -35.294 48.630   1.00 30.79  ? 261  ILE C CA    1 
ATOM   5593  C  C     . ILE C  2  261  ? 62.031  -36.206 49.249   1.00 34.29  ? 261  ILE C C     1 
ATOM   5594  O  O     . ILE C  2  261  ? 61.730  -37.028 50.118   1.00 36.26  ? 261  ILE C O     1 
ATOM   5595  C  CB    . ILE C  2  261  ? 59.943  -36.126 47.799   1.00 30.26  ? 261  ILE C CB    1 
ATOM   5596  C  CG1   . ILE C  2  261  ? 58.600  -36.158 48.512   1.00 29.46  ? 261  ILE C CG1   1 
ATOM   5597  C  CG2   . ILE C  2  261  ? 60.485  -37.508 47.433   1.00 29.83  ? 261  ILE C CG2   1 
ATOM   5598  C  CD1   . ILE C  2  261  ? 58.060  -34.772 48.749   1.00 26.50  ? 261  ILE C CD1   1 
ATOM   5599  N  N     . ALA C  2  262  ? 63.287  -36.008 48.861   1.00 33.59  ? 262  ALA C N     1 
ATOM   5600  C  CA    . ALA C  2  262  ? 64.324  -37.024 49.078   1.00 32.95  ? 262  ALA C CA    1 
ATOM   5601  C  C     . ALA C  2  262  ? 65.597  -36.525 49.756   1.00 41.08  ? 262  ALA C C     1 
ATOM   5602  O  O     . ALA C  2  262  ? 66.023  -37.083 50.764   1.00 44.10  ? 262  ALA C O     1 
ATOM   5603  C  CB    . ALA C  2  262  ? 64.651  -37.752 47.787   1.00 39.14  ? 262  ALA C CB    1 
ATOM   5604  N  N     . ASP C  2  263  ? 66.237  -35.530 49.146   1.00 43.46  ? 263  ASP C N     1 
ATOM   5605  C  CA    . ASP C  2  263  ? 67.517  -34.995 49.614   1.00 41.69  ? 263  ASP C CA    1 
ATOM   5606  C  C     . ASP C  2  263  ? 67.479  -34.657 51.106   1.00 37.91  ? 263  ASP C C     1 
ATOM   5607  O  O     . ASP C  2  263  ? 66.691  -33.822 51.538   1.00 43.39  ? 263  ASP C O     1 
ATOM   5608  C  CB    . ASP C  2  263  ? 67.831  -33.724 48.813   1.00 40.87  ? 263  ASP C CB    1 
ATOM   5609  C  CG    . ASP C  2  263  ? 69.228  -33.186 49.069   1.00 46.36  ? 263  ASP C CG    1 
ATOM   5610  O  OD1   . ASP C  2  263  ? 70.100  -33.952 49.532   1.00 45.84  ? 263  ASP C OD1   1 
ATOM   5611  O  OD2   . ASP C  2  263  ? 69.456  -31.989 48.786   1.00 46.05  ? 263  ASP C OD2   1 
ATOM   5612  N  N     . PRO C  2  264  ? 68.345  -35.309 51.897   1.00 38.25  ? 264  PRO C N     1 
ATOM   5613  C  CA    . PRO C  2  264  ? 68.413  -35.100 53.351   1.00 40.10  ? 264  PRO C CA    1 
ATOM   5614  C  C     . PRO C  2  264  ? 68.957  -33.725 53.743   1.00 45.76  ? 264  PRO C C     1 
ATOM   5615  O  O     . PRO C  2  264  ? 68.803  -33.309 54.893   1.00 48.16  ? 264  PRO C O     1 
ATOM   5616  C  CB    . PRO C  2  264  ? 69.355  -36.213 53.827   1.00 35.97  ? 264  PRO C CB    1 
ATOM   5617  C  CG    . PRO C  2  264  ? 70.139  -36.594 52.620   1.00 43.48  ? 264  PRO C CG    1 
ATOM   5618  C  CD    . PRO C  2  264  ? 69.219  -36.409 51.456   1.00 39.50  ? 264  PRO C CD    1 
ATOM   5619  N  N     . ARG C  2  265  ? 69.595  -33.040 52.798   1.00 42.34  ? 265  ARG C N     1 
ATOM   5620  C  CA    . ARG C  2  265  ? 70.129  -31.705 53.044   1.00 43.14  ? 265  ARG C CA    1 
ATOM   5621  C  C     . ARG C  2  265  ? 69.077  -30.637 52.757   1.00 39.44  ? 265  ARG C C     1 
ATOM   5622  O  O     . ARG C  2  265  ? 69.254  -29.466 53.097   1.00 42.10  ? 265  ARG C O     1 
ATOM   5623  C  CB    . ARG C  2  265  ? 71.379  -31.467 52.190   1.00 48.27  ? 265  ARG C CB    1 
ATOM   5624  C  CG    . ARG C  2  265  ? 72.515  -32.446 52.476   1.00 51.64  ? 265  ARG C CG    1 
ATOM   5625  C  CD    . ARG C  2  265  ? 73.225  -32.871 51.195   1.00 56.25  ? 265  ARG C CD    1 
ATOM   5626  N  NE    . ARG C  2  265  ? 74.561  -32.292 51.072   1.00 46.08  ? 265  ARG C NE    1 
ATOM   5627  C  CZ    . ARG C  2  265  ? 75.681  -32.907 51.440   1.00 41.23  ? 265  ARG C CZ    1 
ATOM   5628  N  NH1   . ARG C  2  265  ? 75.638  -34.128 51.963   1.00 34.91  ? 265  ARG C NH1   1 
ATOM   5629  N  NH2   . ARG C  2  265  ? 76.849  -32.300 51.286   1.00 36.02  ? 265  ARG C NH2   1 
ATOM   5630  N  N     . ARG C  2  266  ? 67.983  -31.053 52.129   1.00 33.51  ? 266  ARG C N     1 
ATOM   5631  C  CA    . ARG C  2  266  ? 66.866  -30.159 51.835   1.00 37.69  ? 266  ARG C CA    1 
ATOM   5632  C  C     . ARG C  2  266  ? 65.659  -30.492 52.710   1.00 33.68  ? 266  ARG C C     1 
ATOM   5633  O  O     . ARG C  2  266  ? 65.167  -29.640 53.449   1.00 34.91  ? 266  ARG C O     1 
ATOM   5634  C  CB    . ARG C  2  266  ? 66.500  -30.182 50.346   1.00 40.99  ? 266  ARG C CB    1 
ATOM   5635  C  CG    . ARG C  2  266  ? 67.390  -29.299 49.472   1.00 47.24  ? 266  ARG C CG    1 
ATOM   5636  C  CD    . ARG C  2  266  ? 66.882  -29.208 48.030   1.00 54.32  ? 266  ARG C CD    1 
ATOM   5637  N  NE    . ARG C  2  266  ? 65.530  -28.652 47.937   1.00 60.00  ? 266  ARG C NE    1 
ATOM   5638  C  CZ    . ARG C  2  266  ? 64.850  -28.502 46.799   1.00 64.76  ? 266  ARG C CZ    1 
ATOM   5639  N  NH1   . ARG C  2  266  ? 63.627  -27.988 46.817   1.00 62.64  ? 266  ARG C NH1   1 
ATOM   5640  N  NH2   . ARG C  2  266  ? 65.388  -28.865 45.641   1.00 56.24  ? 266  ARG C NH2   1 
ATOM   5641  N  N     . TYR C  2  267  ? 65.168  -31.722 52.587   1.00 33.82  ? 267  TYR C N     1 
ATOM   5642  C  CA    . TYR C  2  267  ? 64.057  -32.211 53.398   1.00 29.13  ? 267  TYR C CA    1 
ATOM   5643  C  C     . TYR C  2  267  ? 64.525  -32.939 54.661   1.00 27.20  ? 267  TYR C C     1 
ATOM   5644  O  O     . TYR C  2  267  ? 65.313  -33.881 54.585   1.00 30.00  ? 267  TYR C O     1 
ATOM   5645  C  CB    . TYR C  2  267  ? 63.181  -33.153 52.574   1.00 24.13  ? 267  TYR C CB    1 
ATOM   5646  C  CG    . TYR C  2  267  ? 61.852  -33.464 53.215   1.00 20.32  ? 267  TYR C CG    1 
ATOM   5647  C  CD1   . TYR C  2  267  ? 60.701  -32.812 52.806   1.00 23.32  ? 267  TYR C CD1   1 
ATOM   5648  C  CD2   . TYR C  2  267  ? 61.746  -34.407 54.226   1.00 20.66  ? 267  TYR C CD2   1 
ATOM   5649  C  CE1   . TYR C  2  267  ? 59.483  -33.087 53.382   1.00 19.90  ? 267  TYR C CE1   1 
ATOM   5650  C  CE2   . TYR C  2  267  ? 60.531  -34.688 54.810   1.00 19.16  ? 267  TYR C CE2   1 
ATOM   5651  C  CZ    . TYR C  2  267  ? 59.404  -34.022 54.384   1.00 15.93  ? 267  TYR C CZ    1 
ATOM   5652  O  OH    . TYR C  2  267  ? 58.185  -34.294 54.954   1.00 18.27  ? 267  TYR C OH    1 
ATOM   5653  N  N     . ASP C  2  268  ? 64.048  -32.494 55.820   1.00 24.45  ? 268  ASP C N     1 
ATOM   5654  C  CA    . ASP C  2  268  ? 64.325  -33.205 57.066   1.00 26.16  ? 268  ASP C CA    1 
ATOM   5655  C  C     . ASP C  2  268  ? 63.131  -33.288 58.036   1.00 26.19  ? 268  ASP C C     1 
ATOM   5656  O  O     . ASP C  2  268  ? 62.638  -32.263 58.516   1.00 19.69  ? 268  ASP C O     1 
ATOM   5657  C  CB    . ASP C  2  268  ? 65.536  -32.580 57.766   1.00 26.70  ? 268  ASP C CB    1 
ATOM   5658  C  CG    . ASP C  2  268  ? 66.174  -33.509 58.778   1.00 30.29  ? 268  ASP C CG    1 
ATOM   5659  O  OD1   . ASP C  2  268  ? 65.935  -34.733 58.697   1.00 32.50  ? 268  ASP C OD1   1 
ATOM   5660  O  OD2   . ASP C  2  268  ? 66.925  -33.017 59.645   1.00 28.41  ? 268  ASP C OD2   1 
ATOM   5661  N  N     . LEU C  2  269  ? 62.678  -34.505 58.332   1.00 26.60  ? 269  LEU C N     1 
ATOM   5662  C  CA    . LEU C  2  269  ? 61.814  -34.723 59.487   1.00 18.46  ? 269  LEU C CA    1 
ATOM   5663  C  C     . LEU C  2  269  ? 62.746  -34.673 60.678   1.00 22.23  ? 269  LEU C C     1 
ATOM   5664  O  O     . LEU C  2  269  ? 63.949  -34.889 60.535   1.00 25.82  ? 269  LEU C O     1 
ATOM   5665  C  CB    . LEU C  2  269  ? 61.136  -36.093 59.437   1.00 14.70  ? 269  LEU C CB    1 
ATOM   5666  C  CG    . LEU C  2  269  ? 60.168  -36.388 58.291   1.00 17.61  ? 269  LEU C CG    1 
ATOM   5667  C  CD1   . LEU C  2  269  ? 59.566  -37.779 58.429   1.00 14.19  ? 269  LEU C CD1   1 
ATOM   5668  C  CD2   . LEU C  2  269  ? 59.075  -35.340 58.229   1.00 16.91  ? 269  LEU C CD2   1 
ATOM   5669  N  N     . GLY C  2  270  ? 62.223  -34.387 61.858   1.00 19.24  ? 270  GLY C N     1 
ATOM   5670  C  CA    . GLY C  2  270  ? 63.073  -34.471 63.028   1.00 26.54  ? 270  GLY C CA    1 
ATOM   5671  C  C     . GLY C  2  270  ? 63.428  -35.923 63.304   1.00 27.29  ? 270  GLY C C     1 
ATOM   5672  O  O     . GLY C  2  270  ? 62.987  -36.830 62.596   1.00 24.72  ? 270  GLY C O     1 
ATOM   5673  N  N     . GLU C  2  271  ? 64.236  -36.162 64.329   1.00 30.04  ? 271  GLU C N     1 
ATOM   5674  C  CA    . GLU C  2  271  ? 64.321  -37.509 64.860   1.00 30.92  ? 271  GLU C CA    1 
ATOM   5675  C  C     . GLU C  2  271  ? 62.956  -37.719 65.506   1.00 27.63  ? 271  GLU C C     1 
ATOM   5676  O  O     . GLU C  2  271  ? 62.398  -38.825 65.510   1.00 30.66  ? 271  GLU C O     1 
ATOM   5677  C  CB    . GLU C  2  271  ? 65.457  -37.630 65.879   1.00 31.37  ? 271  GLU C CB    1 
ATOM   5678  C  CG    . GLU C  2  271  ? 66.037  -39.044 66.009   1.00 38.51  ? 271  GLU C CG    1 
ATOM   5679  C  CD    . GLU C  2  271  ? 66.667  -39.553 64.712   1.00 45.86  ? 271  GLU C CD    1 
ATOM   5680  O  OE1   . GLU C  2  271  ? 67.353  -38.766 64.022   1.00 42.04  ? 271  GLU C OE1   1 
ATOM   5681  O  OE2   . GLU C  2  271  ? 66.474  -40.743 64.380   1.00 45.84  ? 271  GLU C OE2   1 
ATOM   5682  N  N     . ALA C  2  272  ? 62.418  -36.615 66.018   1.00 19.76  ? 272  ALA C N     1 
ATOM   5683  C  CA    . ALA C  2  272  ? 61.075  -36.561 66.573   1.00 24.47  ? 272  ALA C CA    1 
ATOM   5684  C  C     . ALA C  2  272  ? 60.001  -36.876 65.531   1.00 18.29  ? 272  ALA C C     1 
ATOM   5685  O  O     . ALA C  2  272  ? 59.093  -37.669 65.779   1.00 13.62  ? 272  ALA C O     1 
ATOM   5686  C  CB    . ALA C  2  272  ? 60.833  -35.191 67.178   1.00 22.13  ? 272  ALA C CB    1 
ATOM   5687  N  N     . GLY C  2  273  ? 60.105  -36.241 64.369   1.00 18.55  ? 273  GLY C N     1 
ATOM   5688  C  CA    . GLY C  2  273  ? 59.169  -36.480 63.284   1.00 19.51  ? 273  GLY C CA    1 
ATOM   5689  C  C     . GLY C  2  273  ? 59.252  -37.900 62.755   1.00 26.29  ? 273  GLY C C     1 
ATOM   5690  O  O     . GLY C  2  273  ? 58.234  -38.521 62.450   1.00 19.87  ? 273  GLY C O     1 
ATOM   5691  N  N     . ARG C  2  274  ? 60.478  -38.407 62.643   1.00 29.15  ? 274  ARG C N     1 
ATOM   5692  C  CA    . ARG C  2  274  ? 60.722  -39.783 62.237   1.00 22.37  ? 274  ARG C CA    1 
ATOM   5693  C  C     . ARG C  2  274  ? 60.021  -40.747 63.187   1.00 25.84  ? 274  ARG C C     1 
ATOM   5694  O  O     . ARG C  2  274  ? 59.192  -41.562 62.761   1.00 26.13  ? 274  ARG C O     1 
ATOM   5695  C  CB    . ARG C  2  274  ? 62.226  -40.051 62.221   1.00 28.56  ? 274  ARG C CB    1 
ATOM   5696  C  CG    . ARG C  2  274  ? 62.629  -41.500 61.992   1.00 31.98  ? 274  ARG C CG    1 
ATOM   5697  C  CD    . ARG C  2  274  ? 64.095  -41.677 62.344   1.00 34.61  ? 274  ARG C CD    1 
ATOM   5698  N  NE    . ARG C  2  274  ? 64.517  -43.070 62.321   1.00 44.16  ? 274  ARG C NE    1 
ATOM   5699  C  CZ    . ARG C  2  274  ? 65.189  -43.623 61.318   1.00 56.80  ? 274  ARG C CZ    1 
ATOM   5700  N  NH1   . ARG C  2  274  ? 65.513  -42.897 60.256   1.00 56.44  ? 274  ARG C NH1   1 
ATOM   5701  N  NH2   . ARG C  2  274  ? 65.539  -44.900 61.377   1.00 61.54  ? 274  ARG C NH2   1 
ATOM   5702  N  N     . TYR C  2  275  ? 60.343  -40.640 64.475   1.00 23.91  ? 275  TYR C N     1 
ATOM   5703  C  CA    . TYR C  2  275  ? 59.700  -41.476 65.484   1.00 27.45  ? 275  TYR C CA    1 
ATOM   5704  C  C     . TYR C  2  275  ? 58.173  -41.381 65.427   1.00 28.53  ? 275  TYR C C     1 
ATOM   5705  O  O     . TYR C  2  275  ? 57.480  -42.392 65.488   1.00 29.94  ? 275  TYR C O     1 
ATOM   5706  C  CB    . TYR C  2  275  ? 60.190  -41.135 66.898   1.00 28.79  ? 275  TYR C CB    1 
ATOM   5707  C  CG    . TYR C  2  275  ? 59.385  -41.833 67.980   1.00 47.24  ? 275  TYR C CG    1 
ATOM   5708  C  CD1   . TYR C  2  275  ? 59.670  -43.146 68.349   1.00 56.22  ? 275  TYR C CD1   1 
ATOM   5709  C  CD2   . TYR C  2  275  ? 58.325  -41.188 68.620   1.00 50.77  ? 275  TYR C CD2   1 
ATOM   5710  C  CE1   . TYR C  2  275  ? 58.926  -43.797 69.329   1.00 63.79  ? 275  TYR C CE1   1 
ATOM   5711  C  CE2   . TYR C  2  275  ? 57.574  -41.831 69.600   1.00 57.33  ? 275  TYR C CE2   1 
ATOM   5712  C  CZ    . TYR C  2  275  ? 57.880  -43.135 69.950   1.00 65.82  ? 275  TYR C CZ    1 
ATOM   5713  O  OH    . TYR C  2  275  ? 57.142  -43.780 70.920   1.00 60.33  ? 275  TYR C OH    1 
ATOM   5714  N  N     . LYS C  2  276  ? 57.656  -40.163 65.310   1.00 28.06  ? 276  LYS C N     1 
ATOM   5715  C  CA    . LYS C  2  276  ? 56.213  -39.944 65.340   1.00 25.37  ? 276  LYS C CA    1 
ATOM   5716  C  C     . LYS C  2  276  ? 55.496  -40.543 64.129   1.00 27.63  ? 276  LYS C C     1 
ATOM   5717  O  O     . LYS C  2  276  ? 54.443  -41.170 64.267   1.00 27.21  ? 276  LYS C O     1 
ATOM   5718  C  CB    . LYS C  2  276  ? 55.907  -38.452 65.468   1.00 24.56  ? 276  LYS C CB    1 
ATOM   5719  C  CG    . LYS C  2  276  ? 56.082  -37.900 66.881   1.00 21.45  ? 276  LYS C CG    1 
ATOM   5720  C  CD    . LYS C  2  276  ? 54.919  -38.293 67.782   1.00 21.01  ? 276  LYS C CD    1 
ATOM   5721  C  CE    . LYS C  2  276  ? 53.811  -37.245 67.747   1.00 15.24  ? 276  LYS C CE    1 
ATOM   5722  N  NZ    . LYS C  2  276  ? 53.319  -36.922 66.375   1.00 12.51  ? 276  LYS C NZ    1 
ATOM   5723  N  N     . ALA C  2  277  ? 56.070  -40.349 62.946   1.00 27.33  ? 277  ALA C N     1 
ATOM   5724  C  CA    . ALA C  2  277  ? 55.533  -40.940 61.726   1.00 23.70  ? 277  ALA C CA    1 
ATOM   5725  C  C     . ALA C  2  277  ? 55.554  -42.462 61.820   1.00 25.37  ? 277  ALA C C     1 
ATOM   5726  O  O     . ALA C  2  277  ? 54.570  -43.128 61.479   1.00 22.41  ? 277  ALA C O     1 
ATOM   5727  C  CB    . ALA C  2  277  ? 56.321  -40.472 60.516   1.00 17.60  ? 277  ALA C CB    1 
ATOM   5728  N  N     . GLU C  2  278  ? 56.679  -43.006 62.285   1.00 26.72  ? 278  GLU C N     1 
ATOM   5729  C  CA    . GLU C  2  278  ? 56.803  -44.448 62.468   1.00 26.82  ? 278  GLU C CA    1 
ATOM   5730  C  C     . GLU C  2  278  ? 55.720  -44.977 63.404   1.00 28.32  ? 278  GLU C C     1 
ATOM   5731  O  O     . GLU C  2  278  ? 55.049  -45.960 63.097   1.00 27.61  ? 278  GLU C O     1 
ATOM   5732  C  CB    . GLU C  2  278  ? 58.190  -44.818 63.005   1.00 21.97  ? 278  GLU C CB    1 
ATOM   5733  C  CG    . GLU C  2  278  ? 59.271  -44.919 61.941   1.00 28.60  ? 278  GLU C CG    1 
ATOM   5734  C  CD    . GLU C  2  278  ? 60.656  -45.142 62.528   1.00 38.63  ? 278  GLU C CD    1 
ATOM   5735  O  OE1   . GLU C  2  278  ? 60.767  -45.234 63.769   1.00 42.29  ? 278  GLU C OE1   1 
ATOM   5736  O  OE2   . GLU C  2  278  ? 61.635  -45.220 61.751   1.00 35.02  ? 278  GLU C OE2   1 
ATOM   5737  N  N     . GLU C  2  279  ? 55.540  -44.300 64.534   1.00 27.01  ? 279  GLU C N     1 
ATOM   5738  C  CA    . GLU C  2  279  ? 54.659  -44.790 65.585   1.00 27.24  ? 279  GLU C CA    1 
ATOM   5739  C  C     . GLU C  2  279  ? 53.191  -44.669 65.197   1.00 27.08  ? 279  GLU C C     1 
ATOM   5740  O  O     . GLU C  2  279  ? 52.370  -45.498 65.584   1.00 26.15  ? 279  GLU C O     1 
ATOM   5741  C  CB    . GLU C  2  279  ? 54.928  -44.046 66.895   1.00 35.79  ? 279  GLU C CB    1 
ATOM   5742  C  CG    . GLU C  2  279  ? 54.469  -44.796 68.139   1.00 58.55  ? 279  GLU C CG    1 
ATOM   5743  C  CD    . GLU C  2  279  ? 55.252  -46.083 68.374   1.00 67.81  ? 279  GLU C CD    1 
ATOM   5744  O  OE1   . GLU C  2  279  ? 54.691  -47.019 68.986   1.00 66.16  ? 279  GLU C OE1   1 
ATOM   5745  O  OE2   . GLU C  2  279  ? 56.429  -46.156 67.955   1.00 54.64  ? 279  GLU C OE2   1 
ATOM   5746  N  N     . LYS C  2  280  ? 52.868  -43.631 64.435   1.00 28.45  ? 280  LYS C N     1 
ATOM   5747  C  CA    . LYS C  2  280  ? 51.495  -43.401 63.997   1.00 21.49  ? 280  LYS C CA    1 
ATOM   5748  C  C     . LYS C  2  280  ? 51.107  -44.344 62.872   1.00 23.62  ? 280  LYS C C     1 
ATOM   5749  O  O     . LYS C  2  280  ? 50.056  -44.983 62.916   1.00 23.60  ? 280  LYS C O     1 
ATOM   5750  C  CB    . LYS C  2  280  ? 51.324  -41.956 63.529   1.00 22.93  ? 280  LYS C CB    1 
ATOM   5751  C  CG    . LYS C  2  280  ? 49.945  -41.630 62.974   1.00 22.62  ? 280  LYS C CG    1 
ATOM   5752  C  CD    . LYS C  2  280  ? 48.929  -41.370 64.077   1.00 15.17  ? 280  LYS C CD    1 
ATOM   5753  C  CE    . LYS C  2  280  ? 47.621  -40.863 63.492   1.00 18.70  ? 280  LYS C CE    1 
ATOM   5754  N  NZ    . LYS C  2  280  ? 46.609  -40.547 64.541   1.00 28.26  ? 280  LYS C NZ    1 
ATOM   5755  N  N     . LEU C  2  281  ? 51.968  -44.424 61.862   1.00 31.74  ? 281  LEU C N     1 
ATOM   5756  C  CA    . LEU C  2  281  ? 51.679  -45.206 60.664   1.00 31.37  ? 281  LEU C CA    1 
ATOM   5757  C  C     . LEU C  2  281  ? 52.003  -46.688 60.842   1.00 34.99  ? 281  LEU C C     1 
ATOM   5758  O  O     . LEU C  2  281  ? 51.651  -47.512 59.993   1.00 33.50  ? 281  LEU C O     1 
ATOM   5759  C  CB    . LEU C  2  281  ? 52.448  -44.638 59.472   1.00 23.50  ? 281  LEU C CB    1 
ATOM   5760  C  CG    . LEU C  2  281  ? 52.036  -43.222 59.077   1.00 19.01  ? 281  LEU C CG    1 
ATOM   5761  C  CD1   . LEU C  2  281  ? 52.954  -42.674 58.003   1.00 20.60  ? 281  LEU C CD1   1 
ATOM   5762  C  CD2   . LEU C  2  281  ? 50.593  -43.215 58.609   1.00 18.83  ? 281  LEU C CD2   1 
ATOM   5763  N  N     . GLY C  2  282  ? 52.667  -47.016 61.949   1.00 33.74  ? 282  GLY C N     1 
ATOM   5764  C  CA    . GLY C  2  282  ? 53.100  -48.376 62.215   1.00 29.25  ? 282  GLY C CA    1 
ATOM   5765  C  C     . GLY C  2  282  ? 54.020  -48.882 61.122   1.00 29.92  ? 282  GLY C C     1 
ATOM   5766  O  O     . GLY C  2  282  ? 53.758  -49.915 60.507   1.00 32.29  ? 282  GLY C O     1 
ATOM   5767  N  N     . ILE C  2  283  ? 55.083  -48.132 60.853   1.00 29.66  ? 283  ILE C N     1 
ATOM   5768  C  CA    . ILE C  2  283  ? 56.051  -48.507 59.828   1.00 30.24  ? 283  ILE C CA    1 
ATOM   5769  C  C     . ILE C  2  283  ? 57.466  -48.236 60.325   1.00 34.39  ? 283  ILE C C     1 
ATOM   5770  O  O     . ILE C  2  283  ? 57.661  -47.781 61.456   1.00 36.32  ? 283  ILE C O     1 
ATOM   5771  C  CB    . ILE C  2  283  ? 55.828  -47.738 58.499   1.00 32.01  ? 283  ILE C CB    1 
ATOM   5772  C  CG1   . ILE C  2  283  ? 56.293  -46.281 58.622   1.00 26.66  ? 283  ILE C CG1   1 
ATOM   5773  C  CG2   . ILE C  2  283  ? 54.367  -47.822 58.048   1.00 28.44  ? 283  ILE C CG2   1 
ATOM   5774  C  CD1   . ILE C  2  283  ? 56.125  -45.476 57.349   1.00 19.49  ? 283  ILE C CD1   1 
ATOM   5775  N  N     . ARG C  2  284  ? 58.452  -48.522 59.480   1.00 31.26  ? 284  ARG C N     1 
ATOM   5776  C  CA    . ARG C  2  284  ? 59.842  -48.256 59.822   1.00 32.42  ? 284  ARG C CA    1 
ATOM   5777  C  C     . ARG C  2  284  ? 60.478  -47.352 58.774   1.00 32.12  ? 284  ARG C C     1 
ATOM   5778  O  O     . ARG C  2  284  ? 60.437  -47.644 57.579   1.00 32.24  ? 284  ARG C O     1 
ATOM   5779  C  CB    . ARG C  2  284  ? 60.628  -49.563 59.962   1.00 35.23  ? 284  ARG C CB    1 
ATOM   5780  C  CG    . ARG C  2  284  ? 61.380  -49.699 61.279   1.00 38.50  ? 284  ARG C CG    1 
ATOM   5781  C  CD    . ARG C  2  284  ? 62.668  -48.882 61.289   1.00 47.64  ? 284  ARG C CD    1 
ATOM   5782  N  NE    . ARG C  2  284  ? 62.937  -48.303 62.607   1.00 71.59  ? 284  ARG C NE    1 
ATOM   5783  C  CZ    . ARG C  2  284  ? 64.094  -47.752 62.968   1.00 73.22  ? 284  ARG C CZ    1 
ATOM   5784  N  NH1   . ARG C  2  284  ? 64.239  -47.245 64.189   1.00 55.16  ? 284  ARG C NH1   1 
ATOM   5785  N  NH2   . ARG C  2  284  ? 65.111  -47.712 62.114   1.00 73.87  ? 284  ARG C NH2   1 
ATOM   5786  N  N     . LEU C  2  285  ? 61.050  -46.243 59.230   1.00 39.01  ? 285  LEU C N     1 
ATOM   5787  C  CA    . LEU C  2  285  ? 61.711  -45.294 58.343   1.00 43.20  ? 285  LEU C CA    1 
ATOM   5788  C  C     . LEU C  2  285  ? 63.203  -45.599 58.267   1.00 42.88  ? 285  LEU C C     1 
ATOM   5789  O  O     . LEU C  2  285  ? 63.875  -45.700 59.297   1.00 40.80  ? 285  LEU C O     1 
ATOM   5790  C  CB    . LEU C  2  285  ? 61.492  -43.856 58.835   1.00 45.60  ? 285  LEU C CB    1 
ATOM   5791  C  CG    . LEU C  2  285  ? 60.393  -42.983 58.214   1.00 31.69  ? 285  LEU C CG    1 
ATOM   5792  C  CD1   . LEU C  2  285  ? 60.896  -42.266 56.962   1.00 34.29  ? 285  LEU C CD1   1 
ATOM   5793  C  CD2   . LEU C  2  285  ? 59.157  -43.804 57.900   1.00 22.43  ? 285  LEU C CD2   1 
ATOM   5794  N  N     . SER C  2  286  ? 63.712  -45.767 57.049   1.00 43.20  ? 286  SER C N     1 
ATOM   5795  C  CA    . SER C  2  286  ? 65.143  -45.963 56.841   1.00 50.80  ? 286  SER C CA    1 
ATOM   5796  C  C     . SER C  2  286  ? 65.911  -44.690 57.182   1.00 48.59  ? 286  SER C C     1 
ATOM   5797  O  O     . SER C  2  286  ? 66.803  -44.690 58.030   1.00 42.35  ? 286  SER C O     1 
ATOM   5798  C  CB    . SER C  2  286  ? 65.420  -46.361 55.389   1.00 50.67  ? 286  SER C CB    1 
ATOM   5799  O  OG    . SER C  2  286  ? 65.064  -45.319 54.496   1.00 44.68  ? 286  SER C OG    1 
ATOM   5800  N  N     . GLY C  2  287  ? 65.557  -43.605 56.503   1.00 53.26  ? 287  GLY C N     1 
ATOM   5801  C  CA    . GLY C  2  287  ? 66.110  -42.300 56.800   1.00 48.58  ? 287  GLY C CA    1 
ATOM   5802  C  C     . GLY C  2  287  ? 65.086  -41.371 57.421   1.00 47.48  ? 287  GLY C C     1 
ATOM   5803  O  O     . GLY C  2  287  ? 64.045  -41.801 57.915   1.00 45.57  ? 287  GLY C O     1 
ATOM   5804  N  N     . ARG C  2  288  ? 65.398  -40.082 57.397   1.00 44.91  ? 288  ARG C N     1 
ATOM   5805  C  CA    . ARG C  2  288  ? 64.495  -39.036 57.867   1.00 32.98  ? 288  ARG C CA    1 
ATOM   5806  C  C     . ARG C  2  288  ? 63.647  -38.369 56.773   1.00 33.39  ? 288  ARG C C     1 
ATOM   5807  O  O     . ARG C  2  288  ? 63.068  -37.307 56.994   1.00 34.21  ? 288  ARG C O     1 
ATOM   5808  C  CB    . ARG C  2  288  ? 65.228  -38.019 58.738   1.00 28.20  ? 288  ARG C CB    1 
ATOM   5809  C  CG    . ARG C  2  288  ? 65.578  -38.575 60.112   1.00 28.94  ? 288  ARG C CG    1 
ATOM   5810  C  CD    . ARG C  2  288  ? 65.884  -37.464 61.089   1.00 30.06  ? 288  ARG C CD    1 
ATOM   5811  N  NE    . ARG C  2  288  ? 66.872  -36.538 60.545   1.00 34.54  ? 288  ARG C NE    1 
ATOM   5812  C  CZ    . ARG C  2  288  ? 68.132  -36.463 60.957   1.00 31.68  ? 288  ARG C CZ    1 
ATOM   5813  N  NH1   . ARG C  2  288  ? 68.560  -37.253 61.934   1.00 29.71  ? 288  ARG C NH1   1 
ATOM   5814  N  NH2   . ARG C  2  288  ? 68.960  -35.588 60.399   1.00 28.57  ? 288  ARG C NH2   1 
ATOM   5815  N  N     . THR C  2  289  ? 63.633  -38.956 55.580   1.00 36.67  ? 289  THR C N     1 
ATOM   5816  C  CA    . THR C  2  289  ? 62.966  -38.341 54.429   1.00 39.77  ? 289  THR C CA    1 
ATOM   5817  C  C     . THR C  2  289  ? 61.781  -39.147 53.880   1.00 33.84  ? 289  THR C C     1 
ATOM   5818  O  O     . THR C  2  289  ? 61.636  -40.332 54.173   1.00 36.38  ? 289  THR C O     1 
ATOM   5819  C  CB    . THR C  2  289  ? 63.962  -38.095 53.297   1.00 41.15  ? 289  THR C CB    1 
ATOM   5820  O  OG1   . THR C  2  289  ? 64.479  -39.351 52.840   1.00 43.73  ? 289  THR C OG1   1 
ATOM   5821  C  CG2   . THR C  2  289  ? 65.107  -37.234 53.799   1.00 45.48  ? 289  THR C CG2   1 
ATOM   5822  N  N     . LEU C  2  290  ? 60.927  -38.476 53.105   1.00 28.80  ? 290  LEU C N     1 
ATOM   5823  C  CA    . LEU C  2  290  ? 59.695  -39.071 52.574   1.00 31.64  ? 290  LEU C CA    1 
ATOM   5824  C  C     . LEU C  2  290  ? 59.920  -40.211 51.582   1.00 36.77  ? 290  LEU C C     1 
ATOM   5825  O  O     . LEU C  2  290  ? 59.127  -41.154 51.511   1.00 30.47  ? 290  LEU C O     1 
ATOM   5826  C  CB    . LEU C  2  290  ? 58.828  -37.997 51.917   1.00 24.55  ? 290  LEU C CB    1 
ATOM   5827  C  CG    . LEU C  2  290  ? 58.388  -36.862 52.834   1.00 18.63  ? 290  LEU C CG    1 
ATOM   5828  C  CD1   . LEU C  2  290  ? 57.370  -35.983 52.143   1.00 14.73  ? 290  LEU C CD1   1 
ATOM   5829  C  CD2   . LEU C  2  290  ? 57.826  -37.416 54.123   1.00 17.93  ? 290  LEU C CD2   1 
ATOM   5830  N  N     . ALA C  2  291  ? 60.991  -40.107 50.803   1.00 40.22  ? 291  ALA C N     1 
ATOM   5831  C  CA    . ALA C  2  291  ? 61.361  -41.160 49.869   1.00 39.24  ? 291  ALA C CA    1 
ATOM   5832  C  C     . ALA C  2  291  ? 62.872  -41.165 49.670   1.00 49.06  ? 291  ALA C C     1 
ATOM   5833  O  O     . ALA C  2  291  ? 63.579  -40.318 50.220   1.00 46.84  ? 291  ALA C O     1 
ATOM   5834  C  CB    . ALA C  2  291  ? 60.647  -40.971 48.548   1.00 36.52  ? 291  ALA C CB    1 
ATOM   5835  N  N     . ARG C  2  292  ? 63.363  -42.114 48.877   1.00 57.49  ? 292  ARG C N     1 
ATOM   5836  C  CA    . ARG C  2  292  ? 64.799  -42.253 48.651   1.00 53.15  ? 292  ARG C CA    1 
ATOM   5837  C  C     . ARG C  2  292  ? 65.152  -42.284 47.171   1.00 53.53  ? 292  ARG C C     1 
ATOM   5838  O  O     . ARG C  2  292  ? 64.288  -42.481 46.316   1.00 50.41  ? 292  ARG C O     1 
ATOM   5839  C  CB    . ARG C  2  292  ? 65.324  -43.534 49.296   1.00 48.96  ? 292  ARG C CB    1 
ATOM   5840  C  CG    . ARG C  2  292  ? 65.197  -43.591 50.798   1.00 52.54  ? 292  ARG C CG    1 
ATOM   5841  C  CD    . ARG C  2  292  ? 65.802  -44.882 51.315   1.00 60.75  ? 292  ARG C CD    1 
ATOM   5842  N  NE    . ARG C  2  292  ? 65.258  -46.042 50.614   1.00 71.38  ? 292  ARG C NE    1 
ATOM   5843  C  CZ    . ARG C  2  292  ? 65.631  -47.297 50.841   1.00 79.87  ? 292  ARG C CZ    1 
ATOM   5844  N  NH1   . ARG C  2  292  ? 66.558  -47.562 51.754   1.00 73.46  ? 292  ARG C NH1   1 
ATOM   5845  N  NH2   . ARG C  2  292  ? 65.078  -48.288 50.154   1.00 80.94  ? 292  ARG C NH2   1 
ATOM   5846  N  N     . PHE C  2  293  ? 66.432  -42.084 46.881   1.00 53.91  ? 293  PHE C N     1 
ATOM   5847  C  CA    . PHE C  2  293  ? 66.953  -42.304 45.543   1.00 57.17  ? 293  PHE C CA    1 
ATOM   5848  C  C     . PHE C  2  293  ? 67.926  -43.476 45.595   1.00 67.70  ? 293  PHE C C     1 
ATOM   5849  O  O     . PHE C  2  293  ? 69.020  -43.363 46.152   1.00 64.94  ? 293  PHE C O     1 
ATOM   5850  C  CB    . PHE C  2  293  ? 67.655  -41.051 45.026   1.00 56.84  ? 293  PHE C CB    1 
ATOM   5851  C  CG    . PHE C  2  293  ? 67.948  -41.085 43.554   1.00 62.47  ? 293  PHE C CG    1 
ATOM   5852  C  CD1   . PHE C  2  293  ? 66.983  -40.707 42.634   1.00 59.53  ? 293  PHE C CD1   1 
ATOM   5853  C  CD2   . PHE C  2  293  ? 69.189  -41.491 43.089   1.00 64.19  ? 293  PHE C CD2   1 
ATOM   5854  C  CE1   . PHE C  2  293  ? 67.247  -40.734 41.281   1.00 53.95  ? 293  PHE C CE1   1 
ATOM   5855  C  CE2   . PHE C  2  293  ? 69.460  -41.521 41.736   1.00 58.92  ? 293  PHE C CE2   1 
ATOM   5856  C  CZ    . PHE C  2  293  ? 68.487  -41.141 40.831   1.00 58.16  ? 293  PHE C CZ    1 
ATOM   5857  N  N     . GLU C  2  294  ? 67.521  -44.602 45.015   1.00 78.71  ? 294  GLU C N     1 
ATOM   5858  C  CA    . GLU C  2  294  ? 68.328  -45.817 45.056   1.00 84.11  ? 294  GLU C CA    1 
ATOM   5859  C  C     . GLU C  2  294  ? 68.333  -46.528 43.703   1.00 89.87  ? 294  GLU C C     1 
ATOM   5860  O  O     . GLU C  2  294  ? 67.274  -46.794 43.128   1.00 86.98  ? 294  GLU C O     1 
ATOM   5861  C  CB    . GLU C  2  294  ? 67.818  -46.757 46.153   1.00 79.80  ? 294  GLU C CB    1 
ATOM   5862  C  CG    . GLU C  2  294  ? 68.702  -47.969 46.403   1.00 88.84  ? 294  GLU C CG    1 
ATOM   5863  C  CD    . GLU C  2  294  ? 68.195  -48.837 47.542   1.00 90.82  ? 294  GLU C CD    1 
ATOM   5864  O  OE1   . GLU C  2  294  ? 68.773  -49.921 47.769   1.00 91.44  ? 294  GLU C OE1   1 
ATOM   5865  O  OE2   . GLU C  2  294  ? 67.219  -48.434 48.210   1.00 84.96  ? 294  GLU C OE2   1 
ATOM   5866  N  N     . ASP C  2  295  ? 69.535  -46.825 43.208   1.00 88.79  ? 295  ASP C N     1 
ATOM   5867  C  CA    . ASP C  2  295  ? 69.732  -47.488 41.916   1.00 81.19  ? 295  ASP C CA    1 
ATOM   5868  C  C     . ASP C  2  295  ? 69.149  -46.693 40.751   1.00 75.31  ? 295  ASP C C     1 
ATOM   5869  O  O     . ASP C  2  295  ? 68.712  -47.267 39.753   1.00 74.83  ? 295  ASP C O     1 
ATOM   5870  C  CB    . ASP C  2  295  ? 69.161  -48.910 41.929   1.00 78.81  ? 295  ASP C CB    1 
ATOM   5871  C  CG    . ASP C  2  295  ? 69.673  -49.731 43.094   1.00 82.67  ? 295  ASP C CG    1 
ATOM   5872  O  OD1   . ASP C  2  295  ? 68.865  -50.459 43.709   1.00 82.35  ? 295  ASP C OD1   1 
ATOM   5873  O  OD2   . ASP C  2  295  ? 70.882  -49.646 43.398   1.00 89.53  ? 295  ASP C OD2   1 
ATOM   5874  N  N     . GLY C  2  296  ? 69.141  -45.370 40.887   1.00 67.55  ? 296  GLY C N     1 
ATOM   5875  C  CA    . GLY C  2  296  ? 68.707  -44.497 39.813   1.00 69.53  ? 296  GLY C CA    1 
ATOM   5876  C  C     . GLY C  2  296  ? 67.225  -44.167 39.801   1.00 65.89  ? 296  GLY C C     1 
ATOM   5877  O  O     . GLY C  2  296  ? 66.757  -43.445 38.919   1.00 53.22  ? 296  GLY C O     1 
ATOM   5878  N  N     . GLU C  2  297  ? 66.481  -44.685 40.773   1.00 69.82  ? 297  GLU C N     1 
ATOM   5879  C  CA    . GLU C  2  297  ? 65.043  -44.428 40.833   1.00 76.49  ? 297  GLU C CA    1 
ATOM   5880  C  C     . GLU C  2  297  ? 64.551  -44.043 42.231   1.00 70.11  ? 297  GLU C C     1 
ATOM   5881  O  O     . GLU C  2  297  ? 65.234  -44.276 43.231   1.00 62.39  ? 297  GLU C O     1 
ATOM   5882  C  CB    . GLU C  2  297  ? 64.254  -45.630 40.298   1.00 78.51  ? 297  GLU C CB    1 
ATOM   5883  C  CG    . GLU C  2  297  ? 64.502  -46.934 41.046   1.00 75.85  ? 297  GLU C CG    1 
ATOM   5884  C  CD    . GLU C  2  297  ? 63.613  -48.066 40.561   1.00 68.04  ? 297  GLU C CD    1 
ATOM   5885  O  OE1   . GLU C  2  297  ? 63.392  -49.022 41.335   1.00 71.85  ? 297  GLU C OE1   1 
ATOM   5886  O  OE2   . GLU C  2  297  ? 63.136  -48.002 39.408   1.00 54.88  ? 297  GLU C OE2   1 
ATOM   5887  N  N     . PHE C  2  298  ? 63.360  -43.452 42.287   1.00 68.05  ? 298  PHE C N     1 
ATOM   5888  C  CA    . PHE C  2  298  ? 62.752  -43.056 43.553   1.00 61.73  ? 298  PHE C CA    1 
ATOM   5889  C  C     . PHE C  2  298  ? 62.028  -44.218 44.219   1.00 53.15  ? 298  PHE C C     1 
ATOM   5890  O  O     . PHE C  2  298  ? 61.316  -44.971 43.558   1.00 55.70  ? 298  PHE C O     1 
ATOM   5891  C  CB    . PHE C  2  298  ? 61.784  -41.891 43.346   1.00 56.21  ? 298  PHE C CB    1 
ATOM   5892  C  CG    . PHE C  2  298  ? 62.461  -40.591 43.026   1.00 55.95  ? 298  PHE C CG    1 
ATOM   5893  C  CD1   . PHE C  2  298  ? 62.321  -40.009 41.777   1.00 55.32  ? 298  PHE C CD1   1 
ATOM   5894  C  CD2   . PHE C  2  298  ? 63.243  -39.952 43.975   1.00 55.92  ? 298  PHE C CD2   1 
ATOM   5895  C  CE1   . PHE C  2  298  ? 62.945  -38.808 41.483   1.00 58.66  ? 298  PHE C CE1   1 
ATOM   5896  C  CE2   . PHE C  2  298  ? 63.872  -38.753 43.688   1.00 50.56  ? 298  PHE C CE2   1 
ATOM   5897  C  CZ    . PHE C  2  298  ? 63.722  -38.180 42.440   1.00 50.70  ? 298  PHE C CZ    1 
ATOM   5898  N  N     . LYS C  2  299  ? 62.209  -44.355 45.529   1.00 56.66  ? 299  LYS C N     1 
ATOM   5899  C  CA    . LYS C  2  299  ? 61.589  -45.447 46.276   1.00 61.38  ? 299  LYS C CA    1 
ATOM   5900  C  C     . LYS C  2  299  ? 60.883  -44.948 47.543   1.00 51.21  ? 299  LYS C C     1 
ATOM   5901  O  O     . LYS C  2  299  ? 61.493  -44.290 48.388   1.00 46.44  ? 299  LYS C O     1 
ATOM   5902  C  CB    . LYS C  2  299  ? 62.632  -46.517 46.611   1.00 69.20  ? 299  LYS C CB    1 
ATOM   5903  C  CG    . LYS C  2  299  ? 62.068  -47.930 46.688   1.00 91.00  ? 299  LYS C CG    1 
ATOM   5904  C  CD    . LYS C  2  299  ? 63.154  -48.981 46.489   1.00 102.42 ? 299  LYS C CD    1 
ATOM   5905  C  CE    . LYS C  2  299  ? 63.758  -48.904 45.092   1.00 91.71  ? 299  LYS C CE    1 
ATOM   5906  N  NZ    . LYS C  2  299  ? 64.825  -49.925 44.889   1.00 89.59  ? 299  LYS C NZ    1 
ATOM   5907  N  N     . ASP C  2  300  ? 59.599  -45.281 47.668   1.00 43.75  ? 300  ASP C N     1 
ATOM   5908  C  CA    . ASP C  2  300  ? 58.739  -44.717 48.713   1.00 42.48  ? 300  ASP C CA    1 
ATOM   5909  C  C     . ASP C  2  300  ? 59.038  -45.184 50.144   1.00 40.99  ? 300  ASP C C     1 
ATOM   5910  O  O     . ASP C  2  300  ? 59.471  -46.313 50.374   1.00 42.83  ? 300  ASP C O     1 
ATOM   5911  C  CB    . ASP C  2  300  ? 57.257  -44.959 48.382   1.00 39.43  ? 300  ASP C CB    1 
ATOM   5912  C  CG    . ASP C  2  300  ? 56.317  -44.323 49.398   1.00 33.25  ? 300  ASP C CG    1 
ATOM   5913  O  OD1   . ASP C  2  300  ? 55.632  -45.061 50.135   1.00 29.98  ? 300  ASP C OD1   1 
ATOM   5914  O  OD2   . ASP C  2  300  ? 56.274  -43.078 49.474   1.00 38.26  ? 300  ASP C OD2   1 
ATOM   5915  N  N     . GLU C  2  301  ? 58.791  -44.286 51.093   1.00 46.33  ? 301  GLU C N     1 
ATOM   5916  C  CA    . GLU C  2  301  ? 58.930  -44.549 52.523   1.00 40.00  ? 301  GLU C CA    1 
ATOM   5917  C  C     . GLU C  2  301  ? 57.638  -44.159 53.253   1.00 37.32  ? 301  GLU C C     1 
ATOM   5918  O  O     . GLU C  2  301  ? 57.014  -44.977 53.927   1.00 39.43  ? 301  GLU C O     1 
ATOM   5919  C  CB    . GLU C  2  301  ? 60.128  -43.793 53.100   1.00 33.54  ? 301  GLU C CB    1 
ATOM   5920  C  CG    . GLU C  2  301  ? 61.472  -44.212 52.518   1.00 37.90  ? 301  GLU C CG    1 
ATOM   5921  C  CD    . GLU C  2  301  ? 62.120  -45.357 53.283   1.00 47.48  ? 301  GLU C CD    1 
ATOM   5922  O  OE1   . GLU C  2  301  ? 61.909  -45.454 54.511   1.00 45.37  ? 301  GLU C OE1   1 
ATOM   5923  O  OE2   . GLU C  2  301  ? 62.846  -46.158 52.656   1.00 47.63  ? 301  GLU C OE2   1 
ATOM   5924  N  N     . VAL C  2  302  ? 57.272  -42.888 53.132   1.00 32.36  ? 302  VAL C N     1 
ATOM   5925  C  CA    . VAL C  2  302  ? 56.140  -42.294 53.849   1.00 32.97  ? 302  VAL C CA    1 
ATOM   5926  C  C     . VAL C  2  302  ? 54.766  -42.365 53.150   1.00 29.97  ? 302  VAL C C     1 
ATOM   5927  O  O     . VAL C  2  302  ? 53.777  -42.773 53.761   1.00 27.03  ? 302  VAL C O     1 
ATOM   5928  C  CB    . VAL C  2  302  ? 56.452  -40.865 54.327   1.00 27.46  ? 302  VAL C CB    1 
ATOM   5929  C  CG1   . VAL C  2  302  ? 55.320  -40.343 55.196   1.00 19.15  ? 302  VAL C CG1   1 
ATOM   5930  C  CG2   . VAL C  2  302  ? 57.753  -40.861 55.106   1.00 29.13  ? 302  VAL C CG2   1 
ATOM   5931  N  N     . PHE C  2  303  ? 54.698  -41.870 51.914   1.00 24.46  ? 303  PHE C N     1 
ATOM   5932  C  CA    . PHE C  2  303  ? 53.428  -41.657 51.201   1.00 25.28  ? 303  PHE C CA    1 
ATOM   5933  C  C     . PHE C  2  303  ? 52.377  -42.774 51.215   1.00 30.93  ? 303  PHE C C     1 
ATOM   5934  O  O     . PHE C  2  303  ? 51.204  -42.504 51.484   1.00 28.11  ? 303  PHE C O     1 
ATOM   5935  C  CB    . PHE C  2  303  ? 53.697  -41.231 49.758   1.00 21.76  ? 303  PHE C CB    1 
ATOM   5936  C  CG    . PHE C  2  303  ? 54.289  -39.867 49.645   1.00 21.29  ? 303  PHE C CG    1 
ATOM   5937  C  CD1   . PHE C  2  303  ? 55.658  -39.696 49.628   1.00 18.41  ? 303  PHE C CD1   1 
ATOM   5938  C  CD2   . PHE C  2  303  ? 53.472  -38.749 49.584   1.00 22.39  ? 303  PHE C CD2   1 
ATOM   5939  C  CE1   . PHE C  2  303  ? 56.202  -38.438 49.537   1.00 21.82  ? 303  PHE C CE1   1 
ATOM   5940  C  CE2   . PHE C  2  303  ? 54.009  -37.487 49.492   1.00 15.95  ? 303  PHE C CE2   1 
ATOM   5941  C  CZ    . PHE C  2  303  ? 55.375  -37.329 49.466   1.00 19.50  ? 303  PHE C CZ    1 
ATOM   5942  N  N     . LEU C  2  304  ? 52.768  -44.010 50.912   1.00 31.96  ? 304  LEU C N     1 
ATOM   5943  C  CA    . LEU C  2  304  ? 51.791  -45.106 50.903   1.00 30.04  ? 304  LEU C CA    1 
ATOM   5944  C  C     . LEU C  2  304  ? 51.200  -45.428 52.286   1.00 24.83  ? 304  LEU C C     1 
ATOM   5945  O  O     . LEU C  2  304  ? 49.983  -45.564 52.403   1.00 21.89  ? 304  LEU C O     1 
ATOM   5946  C  CB    . LEU C  2  304  ? 52.325  -46.370 50.207   1.00 37.47  ? 304  LEU C CB    1 
ATOM   5947  C  CG    . LEU C  2  304  ? 51.285  -47.469 49.939   1.00 39.32  ? 304  LEU C CG    1 
ATOM   5948  C  CD1   . LEU C  2  304  ? 50.300  -47.044 48.855   1.00 38.10  ? 304  LEU C CD1   1 
ATOM   5949  C  CD2   . LEU C  2  304  ? 51.945  -48.787 49.573   1.00 40.69  ? 304  LEU C CD2   1 
ATOM   5950  N  N     . PRO C  2  305  ? 52.049  -45.559 53.330   1.00 25.08  ? 305  PRO C N     1 
ATOM   5951  C  CA    . PRO C  2  305  ? 51.496  -45.707 54.684   1.00 28.02  ? 305  PRO C CA    1 
ATOM   5952  C  C     . PRO C  2  305  ? 50.538  -44.574 55.061   1.00 24.94  ? 305  PRO C C     1 
ATOM   5953  O  O     . PRO C  2  305  ? 49.511  -44.804 55.714   1.00 23.22  ? 305  PRO C O     1 
ATOM   5954  C  CB    . PRO C  2  305  ? 52.743  -45.644 55.570   1.00 22.53  ? 305  PRO C CB    1 
ATOM   5955  C  CG    . PRO C  2  305  ? 53.817  -46.192 54.728   1.00 18.66  ? 305  PRO C CG    1 
ATOM   5956  C  CD    . PRO C  2  305  ? 53.511  -45.773 53.321   1.00 21.49  ? 305  PRO C CD    1 
ATOM   5957  N  N     . THR C  2  306  ? 50.881  -43.361 54.642   1.00 23.19  ? 306  THR C N     1 
ATOM   5958  C  CA    . THR C  2  306  ? 50.084  -42.182 54.949   1.00 23.51  ? 306  THR C CA    1 
ATOM   5959  C  C     . THR C  2  306  ? 48.717  -42.243 54.271   1.00 25.41  ? 306  THR C C     1 
ATOM   5960  O  O     . THR C  2  306  ? 47.684  -42.075 54.925   1.00 21.98  ? 306  THR C O     1 
ATOM   5961  C  CB    . THR C  2  306  ? 50.814  -40.899 54.519   1.00 21.96  ? 306  THR C CB    1 
ATOM   5962  O  OG1   . THR C  2  306  ? 52.112  -40.865 55.126   1.00 19.41  ? 306  THR C OG1   1 
ATOM   5963  C  CG2   . THR C  2  306  ? 50.025  -39.674 54.937   1.00 16.33  ? 306  THR C CG2   1 
ATOM   5964  N  N     . LEU C  2  307  ? 48.725  -42.487 52.961   1.00 27.37  ? 307  LEU C N     1 
ATOM   5965  C  CA    . LEU C  2  307  ? 47.501  -42.600 52.165   1.00 29.98  ? 307  LEU C CA    1 
ATOM   5966  C  C     . LEU C  2  307  ? 46.629  -43.741 52.680   1.00 27.43  ? 307  LEU C C     1 
ATOM   5967  O  O     . LEU C  2  307  ? 45.394  -43.657 52.693   1.00 24.39  ? 307  LEU C O     1 
ATOM   5968  C  CB    . LEU C  2  307  ? 47.856  -42.819 50.690   1.00 27.91  ? 307  LEU C CB    1 
ATOM   5969  C  CG    . LEU C  2  307  ? 46.752  -43.207 49.702   1.00 28.14  ? 307  LEU C CG    1 
ATOM   5970  C  CD1   . LEU C  2  307  ? 45.624  -42.197 49.700   1.00 26.22  ? 307  LEU C CD1   1 
ATOM   5971  C  CD2   . LEU C  2  307  ? 47.334  -43.353 48.307   1.00 31.27  ? 307  LEU C CD2   1 
ATOM   5972  N  N     . ARG C  2  308  ? 47.296  -44.804 53.113   1.00 27.27  ? 308  ARG C N     1 
ATOM   5973  C  CA    . ARG C  2  308  ? 46.636  -45.956 53.700   1.00 28.53  ? 308  ARG C CA    1 
ATOM   5974  C  C     . ARG C  2  308  ? 45.872  -45.516 54.942   1.00 22.06  ? 308  ARG C C     1 
ATOM   5975  O  O     . ARG C  2  308  ? 44.659  -45.724 55.031   1.00 23.99  ? 308  ARG C O     1 
ATOM   5976  C  CB    . ARG C  2  308  ? 47.678  -47.028 54.046   1.00 29.72  ? 308  ARG C CB    1 
ATOM   5977  C  CG    . ARG C  2  308  ? 47.151  -48.455 54.097   1.00 32.48  ? 308  ARG C CG    1 
ATOM   5978  C  CD    . ARG C  2  308  ? 46.484  -48.756 55.427   1.00 29.65  ? 308  ARG C CD    1 
ATOM   5979  N  NE    . ARG C  2  308  ? 47.387  -48.524 56.550   1.00 37.65  ? 308  ARG C NE    1 
ATOM   5980  C  CZ    . ARG C  2  308  ? 46.984  -48.235 57.783   1.00 38.95  ? 308  ARG C CZ    1 
ATOM   5981  N  NH1   . ARG C  2  308  ? 45.686  -48.138 58.046   1.00 32.61  ? 308  ARG C NH1   1 
ATOM   5982  N  NH2   . ARG C  2  308  ? 47.874  -48.036 58.751   1.00 37.75  ? 308  ARG C NH2   1 
ATOM   5983  N  N     . TYR C  2  309  ? 46.581  -44.898 55.886   1.00 18.95  ? 309  TYR C N     1 
ATOM   5984  C  CA    . TYR C  2  309  ? 45.964  -44.452 57.133   1.00 19.45  ? 309  TYR C CA    1 
ATOM   5985  C  C     . TYR C  2  309  ? 44.805  -43.511 56.836   1.00 22.25  ? 309  TYR C C     1 
ATOM   5986  O  O     . TYR C  2  309  ? 43.751  -43.608 57.457   1.00 22.03  ? 309  TYR C O     1 
ATOM   5987  C  CB    . TYR C  2  309  ? 46.988  -43.767 58.051   1.00 18.91  ? 309  TYR C CB    1 
ATOM   5988  C  CG    . TYR C  2  309  ? 46.559  -43.647 59.510   1.00 18.01  ? 309  TYR C CG    1 
ATOM   5989  C  CD1   . TYR C  2  309  ? 47.271  -44.285 60.521   1.00 18.61  ? 309  TYR C CD1   1 
ATOM   5990  C  CD2   . TYR C  2  309  ? 45.447  -42.894 59.875   1.00 19.90  ? 309  TYR C CD2   1 
ATOM   5991  C  CE1   . TYR C  2  309  ? 46.883  -44.178 61.853   1.00 19.12  ? 309  TYR C CE1   1 
ATOM   5992  C  CE2   . TYR C  2  309  ? 45.051  -42.783 61.202   1.00 19.97  ? 309  TYR C CE2   1 
ATOM   5993  C  CZ    . TYR C  2  309  ? 45.770  -43.425 62.185   1.00 19.63  ? 309  TYR C CZ    1 
ATOM   5994  O  OH    . TYR C  2  309  ? 45.372  -43.311 63.499   1.00 15.92  ? 309  TYR C OH    1 
ATOM   5995  N  N     . LEU C  2  310  ? 45.009  -42.605 55.883   1.00 22.09  ? 310  LEU C N     1 
ATOM   5996  C  CA    . LEU C  2  310  ? 43.979  -41.651 55.486   1.00 19.42  ? 310  LEU C CA    1 
ATOM   5997  C  C     . LEU C  2  310  ? 42.705  -42.368 55.053   1.00 22.91  ? 310  LEU C C     1 
ATOM   5998  O  O     . LEU C  2  310  ? 41.611  -42.084 55.557   1.00 20.47  ? 310  LEU C O     1 
ATOM   5999  C  CB    . LEU C  2  310  ? 44.491  -40.759 54.352   1.00 19.65  ? 310  LEU C CB    1 
ATOM   6000  C  CG    . LEU C  2  310  ? 43.464  -39.881 53.626   1.00 19.99  ? 310  LEU C CG    1 
ATOM   6001  C  CD1   . LEU C  2  310  ? 42.757  -38.918 54.577   1.00 15.02  ? 310  LEU C CD1   1 
ATOM   6002  C  CD2   . LEU C  2  310  ? 44.122  -39.124 52.487   1.00 19.10  ? 310  LEU C CD2   1 
ATOM   6003  N  N     . PHE C  2  311  ? 42.860  -43.302 54.117   1.00 27.12  ? 311  PHE C N     1 
ATOM   6004  C  CA    . PHE C  2  311  ? 41.733  -44.078 53.615   1.00 27.55  ? 311  PHE C CA    1 
ATOM   6005  C  C     . PHE C  2  311  ? 41.018  -44.815 54.744   1.00 32.21  ? 311  PHE C C     1 
ATOM   6006  O  O     . PHE C  2  311  ? 39.793  -44.743 54.865   1.00 34.02  ? 311  PHE C O     1 
ATOM   6007  C  CB    . PHE C  2  311  ? 42.195  -45.068 52.544   1.00 30.66  ? 311  PHE C CB    1 
ATOM   6008  C  CG    . PHE C  2  311  ? 42.305  -44.471 51.168   1.00 37.20  ? 311  PHE C CG    1 
ATOM   6009  C  CD1   . PHE C  2  311  ? 41.826  -43.196 50.907   1.00 37.88  ? 311  PHE C CD1   1 
ATOM   6010  C  CD2   . PHE C  2  311  ? 42.877  -45.191 50.130   1.00 36.08  ? 311  PHE C CD2   1 
ATOM   6011  C  CE1   . PHE C  2  311  ? 41.922  -42.647 49.642   1.00 36.43  ? 311  PHE C CE1   1 
ATOM   6012  C  CE2   . PHE C  2  311  ? 42.976  -44.648 48.864   1.00 40.42  ? 311  PHE C CE2   1 
ATOM   6013  C  CZ    . PHE C  2  311  ? 42.497  -43.375 48.620   1.00 40.31  ? 311  PHE C CZ    1 
ATOM   6014  N  N     . ALA C  2  312  ? 41.791  -45.512 55.572   1.00 29.56  ? 312  ALA C N     1 
ATOM   6015  C  CA    . ALA C  2  312  ? 41.237  -46.277 56.686   1.00 28.90  ? 312  ALA C CA    1 
ATOM   6016  C  C     . ALA C  2  312  ? 40.449  -45.396 57.661   1.00 28.53  ? 312  ALA C C     1 
ATOM   6017  O  O     . ALA C  2  312  ? 39.403  -45.794 58.171   1.00 29.23  ? 312  ALA C O     1 
ATOM   6018  C  CB    . ALA C  2  312  ? 42.346  -47.013 57.410   1.00 27.19  ? 312  ALA C CB    1 
ATOM   6019  N  N     . LEU C  2  313  ? 40.963  -44.200 57.914   1.00 29.17  ? 313  LEU C N     1 
ATOM   6020  C  CA    . LEU C  2  313  ? 40.286  -43.234 58.766   1.00 29.84  ? 313  LEU C CA    1 
ATOM   6021  C  C     . LEU C  2  313  ? 38.960  -42.809 58.135   1.00 29.07  ? 313  LEU C C     1 
ATOM   6022  O  O     . LEU C  2  313  ? 37.921  -42.779 58.803   1.00 26.17  ? 313  LEU C O     1 
ATOM   6023  C  CB    . LEU C  2  313  ? 41.186  -42.017 58.989   1.00 24.91  ? 313  LEU C CB    1 
ATOM   6024  C  CG    . LEU C  2  313  ? 40.628  -40.807 59.738   1.00 20.41  ? 313  LEU C CG    1 
ATOM   6025  C  CD1   . LEU C  2  313  ? 40.313  -41.136 61.188   1.00 17.02  ? 313  LEU C CD1   1 
ATOM   6026  C  CD2   . LEU C  2  313  ? 41.616  -39.664 59.646   1.00 24.48  ? 313  LEU C CD2   1 
ATOM   6027  N  N     . THR C  2  314  ? 39.002  -42.488 56.845   1.00 27.90  ? 314  THR C N     1 
ATOM   6028  C  CA    . THR C  2  314  ? 37.798  -42.079 56.126   1.00 33.42  ? 314  THR C CA    1 
ATOM   6029  C  C     . THR C  2  314  ? 36.729  -43.175 56.162   1.00 35.26  ? 314  THR C C     1 
ATOM   6030  O  O     . THR C  2  314  ? 35.538  -42.894 56.317   1.00 35.09  ? 314  THR C O     1 
ATOM   6031  C  CB    . THR C  2  314  ? 38.106  -41.714 54.659   1.00 28.20  ? 314  THR C CB    1 
ATOM   6032  O  OG1   . THR C  2  314  ? 39.300  -40.925 54.597   1.00 26.07  ? 314  THR C OG1   1 
ATOM   6033  C  CG2   . THR C  2  314  ? 36.957  -40.930 54.053   1.00 27.44  ? 314  THR C CG2   1 
ATOM   6034  N  N     . ALA C  2  315  ? 37.167  -44.424 56.041   1.00 35.23  ? 315  ALA C N     1 
ATOM   6035  C  CA    . ALA C  2  315  ? 36.253  -45.562 56.001   1.00 41.10  ? 315  ALA C CA    1 
ATOM   6036  C  C     . ALA C  2  315  ? 35.704  -45.947 57.379   1.00 35.47  ? 315  ALA C C     1 
ATOM   6037  O  O     . ALA C  2  315  ? 34.793  -46.769 57.485   1.00 34.03  ? 315  ALA C O     1 
ATOM   6038  C  CB    . ALA C  2  315  ? 36.929  -46.759 55.341   1.00 39.66  ? 315  ALA C CB    1 
ATOM   6039  N  N     . GLY C  2  316  ? 36.254  -45.350 58.430   1.00 33.56  ? 316  GLY C N     1 
ATOM   6040  C  CA    . GLY C  2  316  ? 35.791  -45.631 59.777   1.00 38.02  ? 316  GLY C CA    1 
ATOM   6041  C  C     . GLY C  2  316  ? 36.383  -46.912 60.329   1.00 34.42  ? 316  GLY C C     1 
ATOM   6042  O  O     . GLY C  2  316  ? 35.847  -47.501 61.272   1.00 34.60  ? 316  GLY C O     1 
ATOM   6043  N  N     . VAL C  2  317  ? 37.489  -47.342 59.727   1.00 30.00  ? 317  VAL C N     1 
ATOM   6044  C  CA    . VAL C  2  317  ? 38.209  -48.534 60.163   1.00 28.56  ? 317  VAL C CA    1 
ATOM   6045  C  C     . VAL C  2  317  ? 38.786  -48.313 61.559   1.00 35.50  ? 317  VAL C C     1 
ATOM   6046  O  O     . VAL C  2  317  ? 39.412  -47.281 61.816   1.00 32.30  ? 317  VAL C O     1 
ATOM   6047  C  CB    . VAL C  2  317  ? 39.337  -48.895 59.169   1.00 31.39  ? 317  VAL C CB    1 
ATOM   6048  C  CG1   . VAL C  2  317  ? 40.182  -50.043 59.692   1.00 27.90  ? 317  VAL C CG1   1 
ATOM   6049  C  CG2   . VAL C  2  317  ? 38.748  -49.243 57.805   1.00 34.55  ? 317  VAL C CG2   1 
ATOM   6050  N  N     . PRO C  2  318  ? 38.554  -49.275 62.470   1.00 35.64  ? 318  PRO C N     1 
ATOM   6051  C  CA    . PRO C  2  318  ? 38.989  -49.197 63.869   1.00 40.14  ? 318  PRO C CA    1 
ATOM   6052  C  C     . PRO C  2  318  ? 40.500  -49.040 64.021   1.00 37.18  ? 318  PRO C C     1 
ATOM   6053  O  O     . PRO C  2  318  ? 41.256  -49.523 63.178   1.00 33.68  ? 318  PRO C O     1 
ATOM   6054  C  CB    . PRO C  2  318  ? 38.549  -50.547 64.439   1.00 30.84  ? 318  PRO C CB    1 
ATOM   6055  C  CG    . PRO C  2  318  ? 37.427  -50.962 63.587   1.00 32.63  ? 318  PRO C CG    1 
ATOM   6056  C  CD    . PRO C  2  318  ? 37.769  -50.493 62.215   1.00 28.90  ? 318  PRO C CD    1 
ATOM   6057  N  N     . GLY C  2  319  ? 40.929  -48.370 65.087   1.00 35.51  ? 319  GLY C N     1 
ATOM   6058  C  CA    . GLY C  2  319  ? 42.345  -48.194 65.355   1.00 39.56  ? 319  GLY C CA    1 
ATOM   6059  C  C     . GLY C  2  319  ? 42.946  -47.093 64.506   1.00 42.95  ? 319  GLY C C     1 
ATOM   6060  O  O     . GLY C  2  319  ? 44.161  -47.046 64.280   1.00 37.82  ? 319  GLY C O     1 
ATOM   6061  N  N     . HIS C  2  320  ? 42.077  -46.213 64.021   1.00 39.71  ? 320  HIS C N     1 
ATOM   6062  C  CA    . HIS C  2  320  ? 42.496  -45.047 63.258   1.00 29.67  ? 320  HIS C CA    1 
ATOM   6063  C  C     . HIS C  2  320  ? 41.731  -43.838 63.765   1.00 27.40  ? 320  HIS C C     1 
ATOM   6064  O  O     . HIS C  2  320  ? 40.502  -43.815 63.732   1.00 26.85  ? 320  HIS C O     1 
ATOM   6065  C  CB    . HIS C  2  320  ? 42.249  -45.266 61.766   1.00 29.78  ? 320  HIS C CB    1 
ATOM   6066  C  CG    . HIS C  2  320  ? 42.957  -46.462 61.213   1.00 32.19  ? 320  HIS C CG    1 
ATOM   6067  N  ND1   . HIS C  2  320  ? 42.293  -47.521 60.631   1.00 33.70  ? 320  HIS C ND1   1 
ATOM   6068  C  CD2   . HIS C  2  320  ? 44.274  -46.776 61.173   1.00 28.69  ? 320  HIS C CD2   1 
ATOM   6069  C  CE1   . HIS C  2  320  ? 43.172  -48.430 60.248   1.00 36.02  ? 320  HIS C CE1   1 
ATOM   6070  N  NE2   . HIS C  2  320  ? 44.381  -48.002 60.565   1.00 31.03  ? 320  HIS C NE2   1 
ATOM   6071  N  N     . GLU C  2  321  ? 42.459  -42.839 64.252   1.00 31.08  ? 321  GLU C N     1 
ATOM   6072  C  CA    . GLU C  2  321  ? 41.826  -41.676 64.861   1.00 31.35  ? 321  GLU C CA    1 
ATOM   6073  C  C     . GLU C  2  321  ? 42.501  -40.378 64.435   1.00 27.35  ? 321  GLU C C     1 
ATOM   6074  O  O     . GLU C  2  321  ? 43.639  -40.383 63.961   1.00 23.31  ? 321  GLU C O     1 
ATOM   6075  C  CB    . GLU C  2  321  ? 41.825  -41.805 66.388   1.00 26.92  ? 321  GLU C CB    1 
ATOM   6076  C  CG    . GLU C  2  321  ? 43.208  -41.986 66.999   1.00 34.64  ? 321  GLU C CG    1 
ATOM   6077  C  CD    . GLU C  2  321  ? 43.155  -42.276 68.490   1.00 53.05  ? 321  GLU C CD    1 
ATOM   6078  O  OE1   . GLU C  2  321  ? 42.096  -42.744 68.962   1.00 59.54  ? 321  GLU C OE1   1 
ATOM   6079  O  OE2   . GLU C  2  321  ? 44.168  -42.034 69.189   1.00 44.20  ? 321  GLU C OE2   1 
ATOM   6080  N  N     . VAL C  2  322  ? 41.789  -39.269 64.605   1.00 30.11  ? 322  VAL C N     1 
ATOM   6081  C  CA    . VAL C  2  322  ? 42.329  -37.957 64.277   1.00 24.93  ? 322  VAL C CA    1 
ATOM   6082  C  C     . VAL C  2  322  ? 43.358  -37.557 65.324   1.00 22.38  ? 322  VAL C C     1 
ATOM   6083  O  O     . VAL C  2  322  ? 43.564  -38.269 66.309   1.00 19.63  ? 322  VAL C O     1 
ATOM   6084  C  CB    . VAL C  2  322  ? 41.219  -36.887 64.223   1.00 23.76  ? 322  VAL C CB    1 
ATOM   6085  C  CG1   . VAL C  2  322  ? 40.311  -37.123 63.035   1.00 21.96  ? 322  VAL C CG1   1 
ATOM   6086  C  CG2   . VAL C  2  322  ? 40.411  -36.899 65.510   1.00 31.38  ? 322  VAL C CG2   1 
ATOM   6087  N  N     . ASP C  2  323  ? 43.991  -36.407 65.125   1.00 19.27  ? 323  ASP C N     1 
ATOM   6088  C  CA    . ASP C  2  323  ? 45.036  -35.977 66.042   1.00 15.47  ? 323  ASP C CA    1 
ATOM   6089  C  C     . ASP C  2  323  ? 44.751  -34.651 66.717   1.00 13.39  ? 323  ASP C C     1 
ATOM   6090  O  O     . ASP C  2  323  ? 44.322  -33.691 66.078   1.00 14.81  ? 323  ASP C O     1 
ATOM   6091  C  CB    . ASP C  2  323  ? 46.386  -35.917 65.337   1.00 14.96  ? 323  ASP C CB    1 
ATOM   6092  C  CG    . ASP C  2  323  ? 46.991  -37.287 65.134   1.00 23.16  ? 323  ASP C CG    1 
ATOM   6093  O  OD1   . ASP C  2  323  ? 47.307  -37.947 66.151   1.00 20.89  ? 323  ASP C OD1   1 
ATOM   6094  O  OD2   . ASP C  2  323  ? 47.159  -37.696 63.962   1.00 22.67  ? 323  ASP C OD2   1 
ATOM   6095  N  N     . ASP C  2  324  ? 44.993  -34.615 68.022   1.00 11.96  ? 324  ASP C N     1 
ATOM   6096  C  CA    . ASP C  2  324  ? 44.951  -33.376 68.774   1.00 10.38  ? 324  ASP C CA    1 
ATOM   6097  C  C     . ASP C  2  324  ? 46.282  -32.706 68.504   1.00 10.85  ? 324  ASP C C     1 
ATOM   6098  O  O     . ASP C  2  324  ? 47.327  -33.237 68.870   1.00 10.97  ? 324  ASP C O     1 
ATOM   6099  C  CB    . ASP C  2  324  ? 44.841  -33.697 70.261   1.00 10.46  ? 324  ASP C CB    1 
ATOM   6100  C  CG    . ASP C  2  324  ? 44.324  -32.532 71.084   1.00 16.23  ? 324  ASP C CG    1 
ATOM   6101  O  OD1   . ASP C  2  324  ? 44.574  -31.364 70.706   1.00 19.54  ? 324  ASP C OD1   1 
ATOM   6102  O  OD2   . ASP C  2  324  ? 43.667  -32.793 72.120   1.00 14.79  ? 324  ASP C OD2   1 
ATOM   6103  N  N     . ILE C  2  325  ? 46.263  -31.539 67.877   1.00 9.95   ? 325  ILE C N     1 
ATOM   6104  C  CA    . ILE C  2  325  ? 47.520  -30.895 67.535   1.00 10.42  ? 325  ILE C CA    1 
ATOM   6105  C  C     . ILE C  2  325  ? 48.039  -30.109 68.730   1.00 9.53   ? 325  ILE C C     1 
ATOM   6106  O  O     . ILE C  2  325  ? 49.184  -29.669 68.745   1.00 9.06   ? 325  ILE C O     1 
ATOM   6107  C  CB    . ILE C  2  325  ? 47.393  -29.978 66.305   1.00 12.52  ? 325  ILE C CB    1 
ATOM   6108  C  CG1   . ILE C  2  325  ? 46.731  -28.658 66.682   1.00 13.99  ? 325  ILE C CG1   1 
ATOM   6109  C  CG2   . ILE C  2  325  ? 46.621  -30.671 65.195   1.00 10.55  ? 325  ILE C CG2   1 
ATOM   6110  C  CD1   . ILE C  2  325  ? 46.819  -27.626 65.590   1.00 22.38  ? 325  ILE C CD1   1 
ATOM   6111  N  N     . ASP C  2  326  ? 47.184  -29.930 69.729   1.00 9.18   ? 326  ASP C N     1 
ATOM   6112  C  CA    . ASP C  2  326  ? 47.574  -29.241 70.951   1.00 10.60  ? 326  ASP C CA    1 
ATOM   6113  C  C     . ASP C  2  326  ? 47.956  -30.193 72.080   1.00 11.74  ? 326  ASP C C     1 
ATOM   6114  O  O     . ASP C  2  326  ? 48.272  -29.761 73.191   1.00 12.90  ? 326  ASP C O     1 
ATOM   6115  C  CB    . ASP C  2  326  ? 46.475  -28.282 71.386   1.00 14.58  ? 326  ASP C CB    1 
ATOM   6116  C  CG    . ASP C  2  326  ? 46.252  -27.187 70.375   1.00 22.49  ? 326  ASP C CG    1 
ATOM   6117  O  OD1   . ASP C  2  326  ? 47.254  -26.552 69.966   1.00 17.30  ? 326  ASP C OD1   1 
ATOM   6118  O  OD2   . ASP C  2  326  ? 45.085  -26.983 69.969   1.00 32.06  ? 326  ASP C OD2   1 
ATOM   6119  N  N     . HIS C  2  327  ? 47.912  -31.490 71.791   1.00 11.71  ? 327  HIS C N     1 
ATOM   6120  C  CA    . HIS C  2  327  ? 48.423  -32.500 72.704   1.00 6.38   ? 327  HIS C CA    1 
ATOM   6121  C  C     . HIS C  2  327  ? 49.916  -32.243 72.844   1.00 4.77   ? 327  HIS C C     1 
ATOM   6122  O  O     . HIS C  2  327  ? 50.592  -31.945 71.864   1.00 4.65   ? 327  HIS C O     1 
ATOM   6123  C  CB    . HIS C  2  327  ? 48.170  -33.894 72.122   1.00 6.48   ? 327  HIS C CB    1 
ATOM   6124  C  CG    . HIS C  2  327  ? 48.129  -34.987 73.145   1.00 5.49   ? 327  HIS C CG    1 
ATOM   6125  N  ND1   . HIS C  2  327  ? 49.246  -35.701 73.519   1.00 5.52   ? 327  HIS C ND1   1 
ATOM   6126  C  CD2   . HIS C  2  327  ? 47.100  -35.494 73.866   1.00 5.59   ? 327  HIS C CD2   1 
ATOM   6127  C  CE1   . HIS C  2  327  ? 48.910  -36.594 74.433   1.00 6.94   ? 327  HIS C CE1   1 
ATOM   6128  N  NE2   . HIS C  2  327  ? 47.613  -36.488 74.662   1.00 6.30   ? 327  HIS C NE2   1 
ATOM   6129  N  N     . LEU C  2  328  ? 50.445  -32.379 74.051   1.00 5.09   ? 328  LEU C N     1 
ATOM   6130  C  CA    . LEU C  2  328  ? 51.860  -32.095 74.277   1.00 4.76   ? 328  LEU C CA    1 
ATOM   6131  C  C     . LEU C  2  328  ? 52.718  -33.265 73.811   1.00 4.23   ? 328  LEU C C     1 
ATOM   6132  O  O     . LEU C  2  328  ? 53.931  -33.283 74.009   1.00 4.06   ? 328  LEU C O     1 
ATOM   6133  C  CB    . LEU C  2  328  ? 52.146  -31.743 75.737   1.00 3.50   ? 328  LEU C CB    1 
ATOM   6134  C  CG    . LEU C  2  328  ? 51.822  -30.297 76.109   1.00 2.60   ? 328  LEU C CG    1 
ATOM   6135  C  CD1   . LEU C  2  328  ? 52.284  -30.005 77.517   1.00 2.65   ? 328  LEU C CD1   1 
ATOM   6136  C  CD2   . LEU C  2  328  ? 52.465  -29.338 75.130   1.00 1.90   ? 328  LEU C CD2   1 
ATOM   6137  N  N     . GLY C  2  329  ? 52.059  -34.264 73.236   1.00 4.73   ? 329  GLY C N     1 
ATOM   6138  C  CA    . GLY C  2  329  ? 52.736  -35.286 72.468   1.00 5.21   ? 329  GLY C CA    1 
ATOM   6139  C  C     . GLY C  2  329  ? 52.922  -34.841 71.027   1.00 6.74   ? 329  GLY C C     1 
ATOM   6140  O  O     . GLY C  2  329  ? 53.772  -35.359 70.318   1.00 10.11  ? 329  GLY C O     1 
ATOM   6141  N  N     . ASN C  2  330  ? 52.093  -33.910 70.567   1.00 6.72   ? 330  ASN C N     1 
ATOM   6142  C  CA    . ASN C  2  330  ? 52.268  -33.352 69.231   1.00 5.35   ? 330  ASN C CA    1 
ATOM   6143  C  C     . ASN C  2  330  ? 52.944  -31.988 69.184   1.00 4.40   ? 330  ASN C C     1 
ATOM   6144  O  O     . ASN C  2  330  ? 53.195  -31.459 68.108   1.00 5.30   ? 330  ASN C O     1 
ATOM   6145  C  CB    . ASN C  2  330  ? 50.936  -33.315 68.499   1.00 7.27   ? 330  ASN C CB    1 
ATOM   6146  C  CG    . ASN C  2  330  ? 50.346  -34.686 68.325   1.00 8.07   ? 330  ASN C CG    1 
ATOM   6147  O  OD1   . ASN C  2  330  ? 51.010  -35.595 67.833   1.00 15.88  ? 330  ASN C OD1   1 
ATOM   6148  N  ND2   . ASN C  2  330  ? 49.102  -34.856 68.747   1.00 9.06   ? 330  ASN C ND2   1 
ATOM   6149  N  N     . ARG C  2  331  ? 53.233  -31.420 70.350   1.00 4.28   ? 331  ARG C N     1 
ATOM   6150  C  CA    . ARG C  2  331  ? 53.960  -30.156 70.423   1.00 3.05   ? 331  ARG C CA    1 
ATOM   6151  C  C     . ARG C  2  331  ? 55.276  -30.374 71.144   1.00 2.09   ? 331  ARG C C     1 
ATOM   6152  O  O     . ARG C  2  331  ? 55.309  -30.996 72.196   1.00 2.52   ? 331  ARG C O     1 
ATOM   6153  C  CB    . ARG C  2  331  ? 53.150  -29.094 71.163   1.00 3.04   ? 331  ARG C CB    1 
ATOM   6154  C  CG    . ARG C  2  331  ? 51.838  -28.715 70.513   1.00 3.56   ? 331  ARG C CG    1 
ATOM   6155  C  CD    . ARG C  2  331  ? 51.119  -27.657 71.337   1.00 4.39   ? 331  ARG C CD    1 
ATOM   6156  N  NE    . ARG C  2  331  ? 51.689  -26.326 71.134   1.00 4.71   ? 331  ARG C NE    1 
ATOM   6157  C  CZ    . ARG C  2  331  ? 51.523  -25.300 71.963   1.00 3.00   ? 331  ARG C CZ    1 
ATOM   6158  N  NH1   . ARG C  2  331  ? 50.811  -25.448 73.069   1.00 2.59   ? 331  ARG C NH1   1 
ATOM   6159  N  NH2   . ARG C  2  331  ? 52.076  -24.128 71.688   1.00 3.44   ? 331  ARG C NH2   1 
ATOM   6160  N  N     . ARG C  2  332  ? 56.360  -29.858 70.585   1.00 1.95   ? 332  ARG C N     1 
ATOM   6161  C  CA    . ARG C  2  332  ? 57.676  -30.098 71.155   1.00 2.32   ? 332  ARG C CA    1 
ATOM   6162  C  C     . ARG C  2  332  ? 58.439  -28.807 71.391   1.00 2.05   ? 332  ARG C C     1 
ATOM   6163  O  O     . ARG C  2  332  ? 58.170  -27.791 70.747   1.00 3.16   ? 332  ARG C O     1 
ATOM   6164  C  CB    . ARG C  2  332  ? 58.488  -31.022 70.248   1.00 2.84   ? 332  ARG C CB    1 
ATOM   6165  C  CG    . ARG C  2  332  ? 58.703  -30.469 68.856   1.00 3.17   ? 332  ARG C CG    1 
ATOM   6166  C  CD    . ARG C  2  332  ? 59.517  -31.415 68.009   1.00 3.02   ? 332  ARG C CD    1 
ATOM   6167  N  NE    . ARG C  2  332  ? 60.826  -31.685 68.596   1.00 2.70   ? 332  ARG C NE    1 
ATOM   6168  C  CZ    . ARG C  2  332  ? 61.939  -31.030 68.285   1.00 2.62   ? 332  ARG C CZ    1 
ATOM   6169  N  NH1   . ARG C  2  332  ? 61.911  -30.053 67.391   1.00 2.87   ? 332  ARG C NH1   1 
ATOM   6170  N  NH2   . ARG C  2  332  ? 63.081  -31.354 68.869   1.00 2.77   ? 332  ARG C NH2   1 
ATOM   6171  N  N     . ILE C  2  333  ? 59.395  -28.867 72.314   1.00 1.85   ? 333  ILE C N     1 
ATOM   6172  C  CA    . ILE C  2  333  ? 60.219  -27.722 72.691   1.00 1.99   ? 333  ILE C CA    1 
ATOM   6173  C  C     . ILE C  2  333  ? 61.524  -27.701 71.911   1.00 1.93   ? 333  ILE C C     1 
ATOM   6174  O  O     . ILE C  2  333  ? 62.196  -28.721 71.796   1.00 1.78   ? 333  ILE C O     1 
ATOM   6175  C  CB    . ILE C  2  333  ? 60.578  -27.787 74.180   1.00 1.91   ? 333  ILE C CB    1 
ATOM   6176  C  CG1   . ILE C  2  333  ? 59.316  -27.766 75.033   1.00 1.67   ? 333  ILE C CG1   1 
ATOM   6177  C  CG2   . ILE C  2  333  ? 61.489  -26.646 74.567   1.00 2.09   ? 333  ILE C CG2   1 
ATOM   6178  C  CD1   . ILE C  2  333  ? 58.487  -26.541 74.845   1.00 1.91   ? 333  ILE C CD1   1 
ATOM   6179  N  N     . ARG C  2  334  ? 61.879  -26.538 71.374   1.00 1.72   ? 334  ARG C N     1 
ATOM   6180  C  CA    . ARG C  2  334  ? 63.163  -26.356 70.714   1.00 1.79   ? 334  ARG C CA    1 
ATOM   6181  C  C     . ARG C  2  334  ? 64.034  -25.509 71.607   1.00 1.90   ? 334  ARG C C     1 
ATOM   6182  O  O     . ARG C  2  334  ? 63.824  -24.304 71.738   1.00 2.32   ? 334  ARG C O     1 
ATOM   6183  C  CB    . ARG C  2  334  ? 62.995  -25.663 69.372   1.00 1.79   ? 334  ARG C CB    1 
ATOM   6184  C  CG    . ARG C  2  334  ? 61.907  -26.262 68.527   1.00 4.09   ? 334  ARG C CG    1 
ATOM   6185  C  CD    . ARG C  2  334  ? 61.779  -25.527 67.222   1.00 4.68   ? 334  ARG C CD    1 
ATOM   6186  N  NE    . ARG C  2  334  ? 62.834  -25.897 66.293   1.00 4.75   ? 334  ARG C NE    1 
ATOM   6187  C  CZ    . ARG C  2  334  ? 63.305  -25.081 65.362   1.00 9.40   ? 334  ARG C CZ    1 
ATOM   6188  N  NH1   . ARG C  2  334  ? 62.817  -23.849 65.259   1.00 9.94   ? 334  ARG C NH1   1 
ATOM   6189  N  NH2   . ARG C  2  334  ? 64.265  -25.493 64.545   1.00 11.59  ? 334  ARG C NH2   1 
ATOM   6190  N  N     . THR C  2  335  ? 65.027  -26.148 72.207   1.00 1.64   ? 335  THR C N     1 
ATOM   6191  C  CA    . THR C  2  335  ? 65.868  -25.503 73.190   1.00 1.41   ? 335  THR C CA    1 
ATOM   6192  C  C     . THR C  2  335  ? 66.997  -24.775 72.485   1.00 1.24   ? 335  THR C C     1 
ATOM   6193  O  O     . THR C  2  335  ? 67.060  -24.787 71.261   1.00 1.20   ? 335  THR C O     1 
ATOM   6194  C  CB    . THR C  2  335  ? 66.412  -26.529 74.190   1.00 2.36   ? 335  THR C CB    1 
ATOM   6195  O  OG1   . THR C  2  335  ? 66.809  -27.713 73.488   1.00 4.14   ? 335  THR C OG1   1 
ATOM   6196  C  CG2   . THR C  2  335  ? 65.341  -26.909 75.192   1.00 2.49   ? 335  THR C CG2   1 
ATOM   6197  N  N     . VAL C  2  336  ? 67.871  -24.141 73.264   1.00 1.13   ? 336  VAL C N     1 
ATOM   6198  C  CA    . VAL C  2  336  ? 68.967  -23.326 72.746   1.00 0.97   ? 336  VAL C CA    1 
ATOM   6199  C  C     . VAL C  2  336  ? 69.817  -24.062 71.749   1.00 1.87   ? 336  VAL C C     1 
ATOM   6200  O  O     . VAL C  2  336  ? 70.166  -23.527 70.696   1.00 2.05   ? 336  VAL C O     1 
ATOM   6201  C  CB    . VAL C  2  336  ? 69.934  -22.970 73.841   1.00 0.83   ? 336  VAL C CB    1 
ATOM   6202  C  CG1   . VAL C  2  336  ? 70.763  -21.772 73.421   1.00 0.78   ? 336  VAL C CG1   1 
ATOM   6203  C  CG2   . VAL C  2  336  ? 69.190  -22.722 75.113   1.00 1.76   ? 336  VAL C CG2   1 
ATOM   6204  N  N     . GLY C  2  337  ? 70.185  -25.284 72.116   1.00 1.97   ? 337  GLY C N     1 
ATOM   6205  C  CA    . GLY C  2  337  ? 71.008  -26.122 71.274   1.00 1.73   ? 337  GLY C CA    1 
ATOM   6206  C  C     . GLY C  2  337  ? 70.436  -26.268 69.884   1.00 2.05   ? 337  GLY C C     1 
ATOM   6207  O  O     . GLY C  2  337  ? 71.128  -26.016 68.907   1.00 2.53   ? 337  GLY C O     1 
ATOM   6208  N  N     . GLU C  2  338  ? 69.166  -26.652 69.801   1.00 1.80   ? 338  GLU C N     1 
ATOM   6209  C  CA    . GLU C  2  338  ? 68.495  -26.842 68.520   1.00 1.75   ? 338  GLU C CA    1 
ATOM   6210  C  C     . GLU C  2  338  ? 68.435  -25.562 67.682   1.00 3.03   ? 338  GLU C C     1 
ATOM   6211  O  O     . GLU C  2  338  ? 68.656  -25.599 66.471   1.00 5.34   ? 338  GLU C O     1 
ATOM   6212  C  CB    . GLU C  2  338  ? 67.092  -27.405 68.739   1.00 1.68   ? 338  GLU C CB    1 
ATOM   6213  C  CG    . GLU C  2  338  ? 66.346  -27.729 67.457   1.00 2.98   ? 338  GLU C CG    1 
ATOM   6214  C  CD    . GLU C  2  338  ? 65.064  -28.519 67.703   1.00 5.26   ? 338  GLU C CD    1 
ATOM   6215  O  OE1   . GLU C  2  338  ? 64.873  -29.029 68.836   1.00 3.30   ? 338  GLU C OE1   1 
ATOM   6216  O  OE2   . GLU C  2  338  ? 64.248  -28.628 66.757   1.00 5.33   ? 338  GLU C OE2   1 
ATOM   6217  N  N     . LEU C  2  339  ? 68.145  -24.437 68.332   1.00 2.66   ? 339  LEU C N     1 
ATOM   6218  C  CA    . LEU C  2  339  ? 68.017  -23.150 67.656   1.00 2.25   ? 339  LEU C CA    1 
ATOM   6219  C  C     . LEU C  2  339  ? 69.354  -22.667 67.102   1.00 4.08   ? 339  LEU C C     1 
ATOM   6220  O  O     . LEU C  2  339  ? 69.491  -22.378 65.897   1.00 10.88  ? 339  LEU C O     1 
ATOM   6221  C  CB    . LEU C  2  339  ? 67.428  -22.115 68.614   1.00 2.86   ? 339  LEU C CB    1 
ATOM   6222  C  CG    . LEU C  2  339  ? 66.071  -22.490 69.235   1.00 2.99   ? 339  LEU C CG    1 
ATOM   6223  C  CD1   . LEU C  2  339  ? 65.678  -21.549 70.374   1.00 1.47   ? 339  LEU C CD1   1 
ATOM   6224  C  CD2   . LEU C  2  339  ? 64.965  -22.560 68.176   1.00 2.42   ? 339  LEU C CD2   1 
ATOM   6225  N  N     . MET C  2  340  ? 70.347  -22.593 67.978   1.00 3.47   ? 340  MET C N     1 
ATOM   6226  C  CA    . MET C  2  340  ? 71.693  -22.224 67.562   1.00 4.42   ? 340  MET C CA    1 
ATOM   6227  C  C     . MET C  2  340  ? 72.212  -23.162 66.471   1.00 4.44   ? 340  MET C C     1 
ATOM   6228  O  O     . MET C  2  340  ? 72.865  -22.723 65.537   1.00 5.24   ? 340  MET C O     1 
ATOM   6229  C  CB    . MET C  2  340  ? 72.644  -22.214 68.763   1.00 3.38   ? 340  MET C CB    1 
ATOM   6230  C  CG    . MET C  2  340  ? 74.024  -21.643 68.469   1.00 4.18   ? 340  MET C CG    1 
ATOM   6231  S  SD    . MET C  2  340  ? 75.145  -22.784 67.624   1.00 10.22  ? 340  MET C SD    1 
ATOM   6232  C  CE    . MET C  2  340  ? 75.305  -24.071 68.866   1.00 3.79   ? 340  MET C CE    1 
ATOM   6233  N  N     . THR C  2  341  ? 71.923  -24.453 66.596   1.00 5.34   ? 341  THR C N     1 
ATOM   6234  C  CA    . THR C  2  341  ? 72.395  -25.427 65.621   1.00 5.59   ? 341  THR C CA    1 
ATOM   6235  C  C     . THR C  2  341  ? 71.723  -25.161 64.293   1.00 9.50   ? 341  THR C C     1 
ATOM   6236  O  O     . THR C  2  341  ? 72.334  -25.332 63.242   1.00 13.12  ? 341  THR C O     1 
ATOM   6237  C  CB    . THR C  2  341  ? 72.102  -26.875 66.052   1.00 4.43   ? 341  THR C CB    1 
ATOM   6238  O  OG1   . THR C  2  341  ? 72.746  -27.138 67.301   1.00 5.16   ? 341  THR C OG1   1 
ATOM   6239  C  CG2   . THR C  2  341  ? 72.622  -27.860 65.027   1.00 6.11   ? 341  THR C CG2   1 
ATOM   6240  N  N     . ASP C  2  342  ? 70.466  -24.734 64.340   1.00 8.07   ? 342  ASP C N     1 
ATOM   6241  C  CA    . ASP C  2  342  ? 69.746  -24.405 63.119   1.00 7.74   ? 342  ASP C CA    1 
ATOM   6242  C  C     . ASP C  2  342  ? 70.425  -23.223 62.411   1.00 7.22   ? 342  ASP C C     1 
ATOM   6243  O  O     . ASP C  2  342  ? 70.687  -23.268 61.200   1.00 8.66   ? 342  ASP C O     1 
ATOM   6244  C  CB    . ASP C  2  342  ? 68.270  -24.125 63.423   1.00 8.02   ? 342  ASP C CB    1 
ATOM   6245  C  CG    . ASP C  2  342  ? 67.341  -24.629 62.326   1.00 25.87  ? 342  ASP C CG    1 
ATOM   6246  O  OD1   . ASP C  2  342  ? 67.801  -25.416 61.468   1.00 27.71  ? 342  ASP C OD1   1 
ATOM   6247  O  OD2   . ASP C  2  342  ? 66.146  -24.247 62.324   1.00 33.08  ? 342  ASP C OD2   1 
ATOM   6248  N  N     . GLN C  2  343  ? 70.752  -22.180 63.164   1.00 6.50   ? 343  GLN C N     1 
ATOM   6249  C  CA    . GLN C  2  343  ? 71.440  -21.048 62.542   1.00 7.25   ? 343  GLN C CA    1 
ATOM   6250  C  C     . GLN C  2  343  ? 72.849  -21.389 62.060   1.00 10.51  ? 343  GLN C C     1 
ATOM   6251  O  O     . GLN C  2  343  ? 73.326  -20.854 61.050   1.00 13.23  ? 343  GLN C O     1 
ATOM   6252  C  CB    . GLN C  2  343  ? 71.461  -19.841 63.470   1.00 6.81   ? 343  GLN C CB    1 
ATOM   6253  C  CG    . GLN C  2  343  ? 70.105  -19.209 63.586   1.00 8.21   ? 343  GLN C CG    1 
ATOM   6254  C  CD    . GLN C  2  343  ? 69.433  -19.085 62.241   1.00 10.95  ? 343  GLN C CD    1 
ATOM   6255  O  OE1   . GLN C  2  343  ? 68.453  -19.774 61.957   1.00 9.71   ? 343  GLN C OE1   1 
ATOM   6256  N  NE2   . GLN C  2  343  ? 69.964  -18.211 61.394   1.00 13.81  ? 343  GLN C NE2   1 
ATOM   6257  N  N     . PHE C  2  344  ? 73.507  -22.286 62.783   1.00 9.14   ? 344  PHE C N     1 
ATOM   6258  C  CA    . PHE C  2  344  ? 74.814  -22.779 62.392   1.00 8.33   ? 344  PHE C CA    1 
ATOM   6259  C  C     . PHE C  2  344  ? 74.675  -23.475 61.043   1.00 9.55   ? 344  PHE C C     1 
ATOM   6260  O  O     . PHE C  2  344  ? 75.486  -23.283 60.139   1.00 11.70  ? 344  PHE C O     1 
ATOM   6261  C  CB    . PHE C  2  344  ? 75.347  -23.749 63.451   1.00 9.58   ? 344  PHE C CB    1 
ATOM   6262  C  CG    . PHE C  2  344  ? 76.817  -24.051 63.319   1.00 8.99   ? 344  PHE C CG    1 
ATOM   6263  C  CD1   . PHE C  2  344  ? 77.267  -24.987 62.404   1.00 8.12   ? 344  PHE C CD1   1 
ATOM   6264  C  CD2   . PHE C  2  344  ? 77.743  -23.405 64.114   1.00 7.35   ? 344  PHE C CD2   1 
ATOM   6265  C  CE1   . PHE C  2  344  ? 78.609  -25.262 62.275   1.00 7.95   ? 344  PHE C CE1   1 
ATOM   6266  C  CE2   . PHE C  2  344  ? 79.088  -23.682 63.989   1.00 7.35   ? 344  PHE C CE2   1 
ATOM   6267  C  CZ    . PHE C  2  344  ? 79.522  -24.609 63.070   1.00 6.67   ? 344  PHE C CZ    1 
ATOM   6268  N  N     . ARG C  2  345  ? 73.621  -24.270 60.913   1.00 9.30   ? 345  ARG C N     1 
ATOM   6269  C  CA    . ARG C  2  345  ? 73.358  -25.017 59.696   1.00 10.89  ? 345  ARG C CA    1 
ATOM   6270  C  C     . ARG C  2  345  ? 73.158  -24.057 58.524   1.00 12.18  ? 345  ARG C C     1 
ATOM   6271  O  O     . ARG C  2  345  ? 73.690  -24.272 57.429   1.00 13.95  ? 345  ARG C O     1 
ATOM   6272  C  CB    . ARG C  2  345  ? 72.144  -25.920 59.897   1.00 7.63   ? 345  ARG C CB    1 
ATOM   6273  C  CG    . ARG C  2  345  ? 71.916  -26.919 58.795   1.00 14.13  ? 345  ARG C CG    1 
ATOM   6274  C  CD    . ARG C  2  345  ? 70.910  -27.976 59.228   1.00 32.64  ? 345  ARG C CD    1 
ATOM   6275  N  NE    . ARG C  2  345  ? 71.474  -28.923 60.195   1.00 46.21  ? 345  ARG C NE    1 
ATOM   6276  C  CZ    . ARG C  2  345  ? 71.177  -28.953 61.495   1.00 42.08  ? 345  ARG C CZ    1 
ATOM   6277  N  NH1   . ARG C  2  345  ? 70.308  -28.085 62.004   1.00 37.46  ? 345  ARG C NH1   1 
ATOM   6278  N  NH2   . ARG C  2  345  ? 71.743  -29.858 62.291   1.00 18.36  ? 345  ARG C NH2   1 
ATOM   6279  N  N     . VAL C  2  346  ? 72.417  -22.980 58.765   1.00 10.26  ? 346  VAL C N     1 
ATOM   6280  C  CA    . VAL C  2  346  ? 72.249  -21.950 57.738   1.00 13.33  ? 346  VAL C CA    1 
ATOM   6281  C  C     . VAL C  2  346  ? 73.577  -21.293 57.311   1.00 17.83  ? 346  VAL C C     1 
ATOM   6282  O  O     . VAL C  2  346  ? 73.942  -21.308 56.121   1.00 21.47  ? 346  VAL C O     1 
ATOM   6283  C  CB    . VAL C  2  346  ? 71.243  -20.867 58.181   1.00 11.96  ? 346  VAL C CB    1 
ATOM   6284  C  CG1   . VAL C  2  346  ? 71.372  -19.625 57.319   1.00 11.84  ? 346  VAL C CG1   1 
ATOM   6285  C  CG2   . VAL C  2  346  ? 69.833  -21.414 58.123   1.00 10.34  ? 346  VAL C CG2   1 
ATOM   6286  N  N     . GLY C  2  347  ? 74.301  -20.726 58.275   1.00 14.33  ? 347  GLY C N     1 
ATOM   6287  C  CA    . GLY C  2  347  ? 75.569  -20.080 57.977   1.00 14.00  ? 347  GLY C CA    1 
ATOM   6288  C  C     . GLY C  2  347  ? 76.548  -20.992 57.266   1.00 15.15  ? 347  GLY C C     1 
ATOM   6289  O  O     . GLY C  2  347  ? 77.341  -20.550 56.431   1.00 19.90  ? 347  GLY C O     1 
ATOM   6290  N  N     . LEU C  2  348  ? 76.472  -22.279 57.588   1.00 14.97  ? 348  LEU C N     1 
ATOM   6291  C  CA    . LEU C  2  348  ? 77.346  -23.280 56.991   1.00 20.08  ? 348  LEU C CA    1 
ATOM   6292  C  C     . LEU C  2  348  ? 76.938  -23.577 55.550   1.00 20.06  ? 348  LEU C C     1 
ATOM   6293  O  O     . LEU C  2  348  ? 77.784  -23.783 54.681   1.00 17.91  ? 348  LEU C O     1 
ATOM   6294  C  CB    . LEU C  2  348  ? 77.322  -24.564 57.825   1.00 20.91  ? 348  LEU C CB    1 
ATOM   6295  C  CG    . LEU C  2  348  ? 78.624  -25.356 57.962   1.00 17.51  ? 348  LEU C CG    1 
ATOM   6296  C  CD1   . LEU C  2  348  ? 79.747  -24.445 58.448   1.00 9.40   ? 348  LEU C CD1   1 
ATOM   6297  C  CD2   . LEU C  2  348  ? 78.421  -26.553 58.900   1.00 12.11  ? 348  LEU C CD2   1 
ATOM   6298  N  N     . ALA C  2  349  ? 75.634  -23.607 55.299   1.00 23.81  ? 349  ALA C N     1 
ATOM   6299  C  CA    . ALA C  2  349  ? 75.156  -23.790 53.934   1.00 23.47  ? 349  ALA C CA    1 
ATOM   6300  C  C     . ALA C  2  349  ? 75.585  -22.618 53.050   1.00 21.15  ? 349  ALA C C     1 
ATOM   6301  O  O     . ALA C  2  349  ? 75.950  -22.808 51.885   1.00 24.49  ? 349  ALA C O     1 
ATOM   6302  C  CB    . ALA C  2  349  ? 73.648  -23.963 53.914   1.00 21.02  ? 349  ALA C CB    1 
ATOM   6303  N  N     . ARG C  2  350  ? 75.549  -21.408 53.604   1.00 20.01  ? 350  ARG C N     1 
ATOM   6304  C  CA    . ARG C  2  350  ? 76.008  -20.234 52.857   1.00 23.15  ? 350  ARG C CA    1 
ATOM   6305  C  C     . ARG C  2  350  ? 77.519  -20.276 52.610   1.00 30.99  ? 350  ARG C C     1 
ATOM   6306  O  O     . ARG C  2  350  ? 78.000  -19.955 51.509   1.00 36.19  ? 350  ARG C O     1 
ATOM   6307  C  CB    . ARG C  2  350  ? 75.638  -18.945 53.587   1.00 21.83  ? 350  ARG C CB    1 
ATOM   6308  C  CG    . ARG C  2  350  ? 74.148  -18.747 53.796   1.00 23.68  ? 350  ARG C CG    1 
ATOM   6309  C  CD    . ARG C  2  350  ? 73.907  -17.503 54.634   1.00 29.25  ? 350  ARG C CD    1 
ATOM   6310  N  NE    . ARG C  2  350  ? 72.517  -17.349 55.048   1.00 21.55  ? 350  ARG C NE    1 
ATOM   6311  C  CZ    . ARG C  2  350  ? 72.130  -16.539 56.027   1.00 28.41  ? 350  ARG C CZ    1 
ATOM   6312  N  NH1   . ARG C  2  350  ? 73.034  -15.826 56.693   1.00 26.93  ? 350  ARG C NH1   1 
ATOM   6313  N  NH2   . ARG C  2  350  ? 70.845  -16.452 56.350   1.00 30.32  ? 350  ARG C NH2   1 
ATOM   6314  N  N     . LEU C  2  351  ? 78.266  -20.668 53.639   1.00 27.27  ? 351  LEU C N     1 
ATOM   6315  C  CA    . LEU C  2  351  ? 79.702  -20.861 53.494   1.00 22.93  ? 351  LEU C CA    1 
ATOM   6316  C  C     . LEU C  2  351  ? 79.980  -21.875 52.397   1.00 24.93  ? 351  LEU C C     1 
ATOM   6317  O  O     . LEU C  2  351  ? 80.947  -21.737 51.654   1.00 32.53  ? 351  LEU C O     1 
ATOM   6318  C  CB    . LEU C  2  351  ? 80.314  -21.335 54.811   1.00 25.57  ? 351  LEU C CB    1 
ATOM   6319  C  CG    . LEU C  2  351  ? 81.774  -21.795 54.812   1.00 22.54  ? 351  LEU C CG    1 
ATOM   6320  C  CD1   . LEU C  2  351  ? 82.434  -21.384 56.112   1.00 25.61  ? 351  LEU C CD1   1 
ATOM   6321  C  CD2   . LEU C  2  351  ? 81.886  -23.305 54.628   1.00 18.67  ? 351  LEU C CD2   1 
ATOM   6322  N  N     . ALA C  2  352  ? 79.127  -22.890 52.305   1.00 22.28  ? 352  ALA C N     1 
ATOM   6323  C  CA    . ALA C  2  352  ? 79.280  -23.950 51.312   1.00 29.66  ? 352  ALA C CA    1 
ATOM   6324  C  C     . ALA C  2  352  ? 78.976  -23.469 49.893   1.00 37.78  ? 352  ALA C C     1 
ATOM   6325  O  O     . ALA C  2  352  ? 79.627  -23.892 48.930   1.00 44.35  ? 352  ALA C O     1 
ATOM   6326  C  CB    . ALA C  2  352  ? 78.410  -25.138 51.666   1.00 25.65  ? 352  ALA C CB    1 
ATOM   6327  N  N     . ARG C  2  353  ? 77.978  -22.598 49.761   1.00 38.39  ? 353  ARG C N     1 
ATOM   6328  C  CA    . ARG C  2  353  ? 77.709  -21.968 48.474   1.00 37.67  ? 353  ARG C CA    1 
ATOM   6329  C  C     . ARG C  2  353  ? 78.945  -21.173 48.053   1.00 37.78  ? 353  ARG C C     1 
ATOM   6330  O  O     . ARG C  2  353  ? 79.360  -21.220 46.892   1.00 42.44  ? 353  ARG C O     1 
ATOM   6331  C  CB    . ARG C  2  353  ? 76.475  -21.063 48.550   1.00 39.40  ? 353  ARG C CB    1 
ATOM   6332  C  CG    . ARG C  2  353  ? 76.095  -20.427 47.221   1.00 47.14  ? 353  ARG C CG    1 
ATOM   6333  C  CD    . ARG C  2  353  ? 75.890  -18.922 47.352   1.00 52.88  ? 353  ARG C CD    1 
ATOM   6334  N  NE    . ARG C  2  353  ? 75.987  -18.251 46.056   1.00 64.56  ? 353  ARG C NE    1 
ATOM   6335  C  CZ    . ARG C  2  353  ? 75.906  -16.934 45.879   1.00 54.21  ? 353  ARG C CZ    1 
ATOM   6336  N  NH1   . ARG C  2  353  ? 75.721  -16.130 46.919   1.00 43.69  ? 353  ARG C NH1   1 
ATOM   6337  N  NH2   . ARG C  2  353  ? 76.009  -16.421 44.657   1.00 40.36  ? 353  ARG C NH2   1 
ATOM   6338  N  N     . GLY C  2  354  ? 79.541  -20.461 49.007   1.00 36.52  ? 354  GLY C N     1 
ATOM   6339  C  CA    . GLY C  2  354  ? 80.791  -19.760 48.753   1.00 38.86  ? 354  GLY C CA    1 
ATOM   6340  C  C     . GLY C  2  354  ? 81.929  -20.681 48.332   1.00 40.67  ? 354  GLY C C     1 
ATOM   6341  O  O     . GLY C  2  354  ? 82.741  -20.334 47.466   1.00 36.89  ? 354  GLY C O     1 
ATOM   6342  N  N     . VAL C  2  355  ? 81.990  -21.858 48.950   1.00 41.20  ? 355  VAL C N     1 
ATOM   6343  C  CA    . VAL C  2  355  ? 83.001  -22.857 48.613   1.00 39.15  ? 355  VAL C CA    1 
ATOM   6344  C  C     . VAL C  2  355  ? 82.856  -23.294 47.166   1.00 44.64  ? 355  VAL C C     1 
ATOM   6345  O  O     . VAL C  2  355  ? 83.792  -23.152 46.380   1.00 55.55  ? 355  VAL C O     1 
ATOM   6346  C  CB    . VAL C  2  355  ? 82.904  -24.111 49.514   1.00 33.77  ? 355  VAL C CB    1 
ATOM   6347  C  CG1   . VAL C  2  355  ? 83.695  -25.263 48.918   1.00 32.93  ? 355  VAL C CG1   1 
ATOM   6348  C  CG2   . VAL C  2  355  ? 83.389  -23.803 50.917   1.00 33.97  ? 355  VAL C CG2   1 
ATOM   6349  N  N     . ARG C  2  356  ? 81.677  -23.811 46.819   1.00 45.77  ? 356  ARG C N     1 
ATOM   6350  C  CA    . ARG C  2  356  ? 81.412  -24.272 45.458   1.00 41.58  ? 356  ARG C CA    1 
ATOM   6351  C  C     . ARG C  2  356  ? 81.673  -23.173 44.432   1.00 42.52  ? 356  ARG C C     1 
ATOM   6352  O  O     . ARG C  2  356  ? 82.277  -23.418 43.387   1.00 41.74  ? 356  ARG C O     1 
ATOM   6353  C  CB    . ARG C  2  356  ? 79.979  -24.795 45.327   1.00 41.87  ? 356  ARG C CB    1 
ATOM   6354  C  CG    . ARG C  2  356  ? 79.880  -26.315 45.227   1.00 49.82  ? 356  ARG C CG    1 
ATOM   6355  C  CD    . ARG C  2  356  ? 78.440  -26.781 45.051   1.00 49.80  ? 356  ARG C CD    1 
ATOM   6356  N  NE    . ARG C  2  356  ? 77.607  -26.419 46.195   1.00 63.10  ? 356  ARG C NE    1 
ATOM   6357  C  CZ    . ARG C  2  356  ? 77.383  -27.211 47.241   1.00 57.19  ? 356  ARG C CZ    1 
ATOM   6358  N  NH1   . ARG C  2  356  ? 76.612  -26.789 48.238   1.00 37.34  ? 356  ARG C NH1   1 
ATOM   6359  N  NH2   . ARG C  2  356  ? 77.927  -28.424 47.291   1.00 44.11  ? 356  ARG C NH2   1 
ATOM   6360  N  N     . GLU C  2  357  ? 81.228  -21.959 44.749   1.00 45.07  ? 357  GLU C N     1 
ATOM   6361  C  CA    . GLU C  2  357  ? 81.440  -20.805 43.880   1.00 43.75  ? 357  GLU C CA    1 
ATOM   6362  C  C     . GLU C  2  357  ? 82.926  -20.513 43.662   1.00 54.74  ? 357  GLU C C     1 
ATOM   6363  O  O     . GLU C  2  357  ? 83.344  -20.165 42.556   1.00 61.65  ? 357  GLU C O     1 
ATOM   6364  C  CB    . GLU C  2  357  ? 80.735  -19.574 44.460   1.00 56.17  ? 357  GLU C CB    1 
ATOM   6365  C  CG    . GLU C  2  357  ? 80.921  -18.286 43.663   1.00 69.61  ? 357  GLU C CG    1 
ATOM   6366  C  CD    . GLU C  2  357  ? 80.043  -17.152 44.176   1.00 72.35  ? 357  GLU C CD    1 
ATOM   6367  O  OE1   . GLU C  2  357  ? 80.541  -16.319 44.966   1.00 64.36  ? 357  GLU C OE1   1 
ATOM   6368  O  OE2   . GLU C  2  357  ? 78.854  -17.098 43.787   1.00 71.67  ? 357  GLU C OE2   1 
ATOM   6369  N  N     . ARG C  2  358  ? 83.722  -20.662 44.717   1.00 60.06  ? 358  ARG C N     1 
ATOM   6370  C  CA    . ARG C  2  358  ? 85.156  -20.389 44.637   1.00 54.74  ? 358  ARG C CA    1 
ATOM   6371  C  C     . ARG C  2  358  ? 85.925  -21.522 43.966   1.00 49.68  ? 358  ARG C C     1 
ATOM   6372  O  O     . ARG C  2  358  ? 87.042  -21.323 43.491   1.00 53.12  ? 358  ARG C O     1 
ATOM   6373  C  CB    . ARG C  2  358  ? 85.725  -20.151 46.034   1.00 49.18  ? 358  ARG C CB    1 
ATOM   6374  C  CG    . ARG C  2  358  ? 86.819  -19.101 46.103   1.00 38.37  ? 358  ARG C CG    1 
ATOM   6375  C  CD    . ARG C  2  358  ? 86.449  -18.056 47.136   1.00 42.19  ? 358  ARG C CD    1 
ATOM   6376  N  NE    . ARG C  2  358  ? 85.471  -18.586 48.084   1.00 44.16  ? 358  ARG C NE    1 
ATOM   6377  C  CZ    . ARG C  2  358  ? 84.835  -17.854 48.993   1.00 46.07  ? 358  ARG C CZ    1 
ATOM   6378  N  NH1   . ARG C  2  358  ? 85.076  -16.553 49.082   1.00 47.20  ? 358  ARG C NH1   1 
ATOM   6379  N  NH2   . ARG C  2  358  ? 83.960  -18.424 49.813   1.00 42.52  ? 358  ARG C NH2   1 
ATOM   6380  N  N     . MET C  2  359  ? 85.327  -22.709 43.935   1.00 47.09  ? 359  MET C N     1 
ATOM   6381  C  CA    . MET C  2  359  ? 86.005  -23.889 43.403   1.00 52.75  ? 359  MET C CA    1 
ATOM   6382  C  C     . MET C  2  359  ? 86.314  -23.818 41.908   1.00 62.80  ? 359  MET C C     1 
ATOM   6383  O  O     . MET C  2  359  ? 87.278  -24.427 41.442   1.00 68.43  ? 359  MET C O     1 
ATOM   6384  C  CB    . MET C  2  359  ? 85.213  -25.164 43.713   1.00 51.87  ? 359  MET C CB    1 
ATOM   6385  C  CG    . MET C  2  359  ? 85.288  -25.589 45.169   1.00 53.70  ? 359  MET C CG    1 
ATOM   6386  S  SD    . MET C  2  359  ? 85.215  -27.373 45.415   1.00 57.63  ? 359  MET C SD    1 
ATOM   6387  C  CE    . MET C  2  359  ? 83.640  -27.747 44.659   1.00 58.12  ? 359  MET C CE    1 
ATOM   6388  N  N     . LEU C  2  360  ? 85.506  -23.076 41.160   1.00 62.84  ? 360  LEU C N     1 
ATOM   6389  C  CA    . LEU C  2  360  ? 85.640  -23.056 39.703   1.00 58.14  ? 360  LEU C CA    1 
ATOM   6390  C  C     . LEU C  2  360  ? 86.773  -22.156 39.197   1.00 57.05  ? 360  LEU C C     1 
ATOM   6391  O  O     . LEU C  2  360  ? 87.383  -22.436 38.164   1.00 50.34  ? 360  LEU C O     1 
ATOM   6392  C  CB    . LEU C  2  360  ? 84.306  -22.699 39.045   1.00 51.17  ? 360  LEU C CB    1 
ATOM   6393  C  CG    . LEU C  2  360  ? 83.325  -23.858 38.821   1.00 53.34  ? 360  LEU C CG    1 
ATOM   6394  C  CD1   . LEU C  2  360  ? 83.596  -25.063 39.729   1.00 43.83  ? 360  LEU C CD1   1 
ATOM   6395  C  CD2   . LEU C  2  360  ? 81.883  -23.376 38.965   1.00 49.96  ? 360  LEU C CD2   1 
ATOM   6396  N  N     . MET C  2  361  ? 87.058  -21.084 39.930   1.00 63.62  ? 361  MET C N     1 
ATOM   6397  C  CA    . MET C  2  361  ? 88.181  -20.210 39.596   1.00 65.12  ? 361  MET C CA    1 
ATOM   6398  C  C     . MET C  2  361  ? 89.519  -20.880 39.909   1.00 53.34  ? 361  MET C C     1 
ATOM   6399  O  O     . MET C  2  361  ? 90.533  -20.210 40.112   1.00 43.24  ? 361  MET C O     1 
ATOM   6400  C  CB    . MET C  2  361  ? 88.069  -18.873 40.337   1.00 71.69  ? 361  MET C CB    1 
ATOM   6401  C  CG    . MET C  2  361  ? 86.997  -17.939 39.792   1.00 66.54  ? 361  MET C CG    1 
ATOM   6402  S  SD    . MET C  2  361  ? 85.335  -18.628 39.907   1.00 78.74  ? 361  MET C SD    1 
ATOM   6403  C  CE    . MET C  2  361  ? 84.411  -17.435 38.941   1.00 62.97  ? 361  MET C CE    1 
ATOM   6404  N  N     . SER C  2  366  ? 96.605  -25.275 42.880   1.00 52.96  ? 366  SER C N     1 
ATOM   6405  C  CA    . SER C  2  366  ? 97.007  -24.150 43.720   1.00 61.83  ? 366  SER C CA    1 
ATOM   6406  C  C     . SER C  2  366  ? 95.903  -23.760 44.704   1.00 66.95  ? 366  SER C C     1 
ATOM   6407  O  O     . SER C  2  366  ? 95.811  -22.606 45.130   1.00 67.15  ? 366  SER C O     1 
ATOM   6408  C  CB    . SER C  2  366  ? 97.412  -22.947 42.857   1.00 57.46  ? 366  SER C CB    1 
ATOM   6409  O  OG    . SER C  2  366  ? 96.406  -22.615 41.913   1.00 54.21  ? 366  SER C OG    1 
ATOM   6410  N  N     . LEU C  2  367  ? 95.074  -24.734 45.070   1.00 56.46  ? 367  LEU C N     1 
ATOM   6411  C  CA    . LEU C  2  367  ? 93.938  -24.481 45.949   1.00 50.69  ? 367  LEU C CA    1 
ATOM   6412  C  C     . LEU C  2  367  ? 94.011  -25.309 47.225   1.00 52.82  ? 367  LEU C C     1 
ATOM   6413  O  O     . LEU C  2  367  ? 94.214  -26.522 47.179   1.00 52.77  ? 367  LEU C O     1 
ATOM   6414  C  CB    . LEU C  2  367  ? 92.625  -24.763 45.212   1.00 45.08  ? 367  LEU C CB    1 
ATOM   6415  C  CG    . LEU C  2  367  ? 91.634  -23.600 45.153   1.00 48.44  ? 367  LEU C CG    1 
ATOM   6416  C  CD1   . LEU C  2  367  ? 92.371  -22.271 45.025   1.00 56.80  ? 367  LEU C CD1   1 
ATOM   6417  C  CD2   . LEU C  2  367  ? 90.666  -23.783 43.996   1.00 37.89  ? 367  LEU C CD2   1 
ATOM   6418  N  N     . THR C  2  368  ? 93.835  -24.647 48.364   1.00 52.36  ? 368  THR C N     1 
ATOM   6419  C  CA    . THR C  2  368  ? 93.846  -25.328 49.651   1.00 47.81  ? 368  THR C CA    1 
ATOM   6420  C  C     . THR C  2  368  ? 92.474  -25.143 50.288   1.00 44.49  ? 368  THR C C     1 
ATOM   6421  O  O     . THR C  2  368  ? 91.630  -24.439 49.733   1.00 48.49  ? 368  THR C O     1 
ATOM   6422  C  CB    . THR C  2  368  ? 94.936  -24.738 50.589   1.00 51.72  ? 368  THR C CB    1 
ATOM   6423  O  OG1   . THR C  2  368  ? 94.676  -23.349 50.828   1.00 51.40  ? 368  THR C OG1   1 
ATOM   6424  C  CG2   . THR C  2  368  ? 96.320  -24.899 49.986   1.00 48.38  ? 368  THR C CG2   1 
ATOM   6425  N  N     . PRO C  2  369  ? 92.235  -25.779 51.447   1.00 41.53  ? 369  PRO C N     1 
ATOM   6426  C  CA    . PRO C  2  369  ? 90.979  -25.491 52.142   1.00 35.54  ? 369  PRO C CA    1 
ATOM   6427  C  C     . PRO C  2  369  ? 90.846  -24.032 52.568   1.00 34.94  ? 369  PRO C C     1 
ATOM   6428  O  O     . PRO C  2  369  ? 89.772  -23.464 52.399   1.00 40.60  ? 369  PRO C O     1 
ATOM   6429  C  CB    . PRO C  2  369  ? 91.053  -26.401 53.365   1.00 35.91  ? 369  PRO C CB    1 
ATOM   6430  C  CG    . PRO C  2  369  ? 91.807  -27.584 52.871   1.00 38.80  ? 369  PRO C CG    1 
ATOM   6431  C  CD    . PRO C  2  369  ? 92.848  -27.030 51.936   1.00 40.02  ? 369  PRO C CD    1 
ATOM   6432  N  N     . ALA C  2  370  ? 91.911  -23.432 53.091   1.00 36.21  ? 370  ALA C N     1 
ATOM   6433  C  CA    . ALA C  2  370  ? 91.844  -22.051 53.573   1.00 36.29  ? 370  ALA C CA    1 
ATOM   6434  C  C     . ALA C  2  370  ? 91.526  -21.047 52.462   1.00 36.07  ? 370  ALA C C     1 
ATOM   6435  O  O     . ALA C  2  370  ? 91.064  -19.939 52.729   1.00 34.91  ? 370  ALA C O     1 
ATOM   6436  C  CB    . ALA C  2  370  ? 93.135  -21.671 54.282   1.00 37.64  ? 370  ALA C CB    1 
ATOM   6437  N  N     . LYS C  2  371  ? 91.795  -21.436 51.220   1.00 37.54  ? 371  LYS C N     1 
ATOM   6438  C  CA    . LYS C  2  371  ? 91.471  -20.606 50.066   1.00 39.99  ? 371  LYS C CA    1 
ATOM   6439  C  C     . LYS C  2  371  ? 90.004  -20.740 49.652   1.00 38.89  ? 371  LYS C C     1 
ATOM   6440  O  O     . LYS C  2  371  ? 89.366  -19.759 49.276   1.00 39.15  ? 371  LYS C O     1 
ATOM   6441  C  CB    . LYS C  2  371  ? 92.399  -20.939 48.895   1.00 49.55  ? 371  LYS C CB    1 
ATOM   6442  C  CG    . LYS C  2  371  ? 93.868  -20.713 49.215   1.00 57.96  ? 371  LYS C CG    1 
ATOM   6443  C  CD    . LYS C  2  371  ? 94.753  -20.817 47.985   1.00 56.45  ? 371  LYS C CD    1 
ATOM   6444  C  CE    . LYS C  2  371  ? 96.181  -20.407 48.324   1.00 63.26  ? 371  LYS C CE    1 
ATOM   6445  N  NZ    . LYS C  2  371  ? 97.014  -20.159 47.113   1.00 67.98  ? 371  LYS C NZ    1 
ATOM   6446  N  N     . LEU C  2  372  ? 89.481  -21.960 49.726   1.00 33.89  ? 372  LEU C N     1 
ATOM   6447  C  CA    . LEU C  2  372  ? 88.094  -22.243 49.367   1.00 31.97  ? 372  LEU C CA    1 
ATOM   6448  C  C     . LEU C  2  372  ? 87.069  -21.699 50.373   1.00 41.07  ? 372  LEU C C     1 
ATOM   6449  O  O     . LEU C  2  372  ? 85.911  -21.457 50.024   1.00 42.44  ? 372  LEU C O     1 
ATOM   6450  C  CB    . LEU C  2  372  ? 87.891  -23.752 49.210   1.00 28.51  ? 372  LEU C CB    1 
ATOM   6451  C  CG    . LEU C  2  372  ? 88.493  -24.415 47.975   1.00 34.79  ? 372  LEU C CG    1 
ATOM   6452  C  CD1   . LEU C  2  372  ? 88.218  -25.918 47.960   1.00 25.29  ? 372  LEU C CD1   1 
ATOM   6453  C  CD2   . LEU C  2  372  ? 87.939  -23.750 46.728   1.00 45.15  ? 372  LEU C CD2   1 
ATOM   6454  N  N     . VAL C  2  373  ? 87.492  -21.508 51.619   1.00 35.95  ? 373  VAL C N     1 
ATOM   6455  C  CA    . VAL C  2  373  ? 86.550  -21.244 52.702   1.00 27.77  ? 373  VAL C CA    1 
ATOM   6456  C  C     . VAL C  2  373  ? 86.579  -19.815 53.247   1.00 29.67  ? 373  VAL C C     1 
ATOM   6457  O  O     . VAL C  2  373  ? 87.603  -19.338 53.736   1.00 31.71  ? 373  VAL C O     1 
ATOM   6458  C  CB    . VAL C  2  373  ? 86.734  -22.258 53.859   1.00 21.96  ? 373  VAL C CB    1 
ATOM   6459  C  CG1   . VAL C  2  373  ? 86.053  -21.769 55.126   1.00 23.59  ? 373  VAL C CG1   1 
ATOM   6460  C  CG2   . VAL C  2  373  ? 86.198  -23.620 53.452   1.00 18.79  ? 373  VAL C CG2   1 
ATOM   6461  N  N     . ASN C  2  374  ? 85.439  -19.139 53.140   1.00 29.78  ? 374  ASN C N     1 
ATOM   6462  C  CA    . ASN C  2  374  ? 85.216  -17.871 53.819   1.00 24.77  ? 374  ASN C CA    1 
ATOM   6463  C  C     . ASN C  2  374  ? 84.208  -18.116 54.936   1.00 26.58  ? 374  ASN C C     1 
ATOM   6464  O  O     . ASN C  2  374  ? 83.112  -18.618 54.692   1.00 26.01  ? 374  ASN C O     1 
ATOM   6465  C  CB    . ASN C  2  374  ? 84.686  -16.822 52.840   1.00 23.84  ? 374  ASN C CB    1 
ATOM   6466  C  CG    . ASN C  2  374  ? 84.673  -15.419 53.431   1.00 33.78  ? 374  ASN C CG    1 
ATOM   6467  O  OD1   . ASN C  2  374  ? 84.672  -15.245 54.649   1.00 41.10  ? 374  ASN C OD1   1 
ATOM   6468  N  ND2   . ASN C  2  374  ? 84.659  -14.409 52.564   1.00 31.85  ? 374  ASN C ND2   1 
ATOM   6469  N  N     . SER C  2  375  ? 84.582  -17.782 56.163   1.00 25.34  ? 375  SER C N     1 
ATOM   6470  C  CA    . SER C  2  375  ? 83.725  -18.059 57.308   1.00 22.25  ? 375  SER C CA    1 
ATOM   6471  C  C     . SER C  2  375  ? 82.854  -16.866 57.692   1.00 30.03  ? 375  SER C C     1 
ATOM   6472  O  O     . SER C  2  375  ? 82.121  -16.920 58.684   1.00 30.48  ? 375  SER C O     1 
ATOM   6473  C  CB    . SER C  2  375  ? 84.554  -18.516 58.511   1.00 22.94  ? 375  SER C CB    1 
ATOM   6474  O  OG    . SER C  2  375  ? 85.335  -17.456 59.037   1.00 23.93  ? 375  SER C OG    1 
ATOM   6475  N  N     . ARG C  2  376  ? 82.941  -15.789 56.918   1.00 32.35  ? 376  ARG C N     1 
ATOM   6476  C  CA    . ARG C  2  376  ? 82.124  -14.603 57.179   1.00 26.98  ? 376  ARG C CA    1 
ATOM   6477  C  C     . ARG C  2  376  ? 80.610  -14.866 57.228   1.00 19.04  ? 376  ARG C C     1 
ATOM   6478  O  O     . ARG C  2  376  ? 79.957  -14.402 58.155   1.00 19.01  ? 376  ARG C O     1 
ATOM   6479  C  CB    . ARG C  2  376  ? 82.471  -13.451 56.228   1.00 30.59  ? 376  ARG C CB    1 
ATOM   6480  C  CG    . ARG C  2  376  ? 83.449  -12.435 56.815   1.00 33.27  ? 376  ARG C CG    1 
ATOM   6481  C  CD    . ARG C  2  376  ? 84.727  -13.097 57.313   1.00 33.04  ? 376  ARG C CD    1 
ATOM   6482  N  NE    . ARG C  2  376  ? 85.749  -12.117 57.683   1.00 39.83  ? 376  ARG C NE    1 
ATOM   6483  C  CZ    . ARG C  2  376  ? 86.041  -11.763 58.932   1.00 35.65  ? 376  ARG C CZ    1 
ATOM   6484  N  NH1   . ARG C  2  376  ? 85.391  -12.310 59.951   1.00 37.37  ? 376  ARG C NH1   1 
ATOM   6485  N  NH2   . ARG C  2  376  ? 86.989  -10.865 59.165   1.00 31.95  ? 376  ARG C NH2   1 
ATOM   6486  N  N     . PRO C  2  377  ? 80.048  -15.610 56.248   1.00 17.10  ? 377  PRO C N     1 
ATOM   6487  C  CA    . PRO C  2  377  ? 78.616  -15.934 56.341   1.00 21.71  ? 377  PRO C CA    1 
ATOM   6488  C  C     . PRO C  2  377  ? 78.216  -16.764 57.566   1.00 19.53  ? 377  PRO C C     1 
ATOM   6489  O  O     . PRO C  2  377  ? 77.103  -16.582 58.069   1.00 19.93  ? 377  PRO C O     1 
ATOM   6490  C  CB    . PRO C  2  377  ? 78.342  -16.726 55.050   1.00 18.99  ? 377  PRO C CB    1 
ATOM   6491  C  CG    . PRO C  2  377  ? 79.671  -17.145 54.556   1.00 20.37  ? 377  PRO C CG    1 
ATOM   6492  C  CD    . PRO C  2  377  ? 80.602  -16.046 54.956   1.00 19.50  ? 377  PRO C CD    1 
ATOM   6493  N  N     . LEU C  2  378  ? 79.095  -17.654 58.025   1.00 20.28  ? 378  LEU C N     1 
ATOM   6494  C  CA    . LEU C  2  378  ? 78.843  -18.468 59.217   1.00 14.36  ? 378  LEU C CA    1 
ATOM   6495  C  C     . LEU C  2  378  ? 78.878  -17.614 60.479   1.00 12.30  ? 378  LEU C C     1 
ATOM   6496  O  O     . LEU C  2  378  ? 77.952  -17.648 61.299   1.00 11.52  ? 378  LEU C O     1 
ATOM   6497  C  CB    . LEU C  2  378  ? 79.877  -19.588 59.323   1.00 14.52  ? 378  LEU C CB    1 
ATOM   6498  C  CG    . LEU C  2  378  ? 79.860  -20.449 60.589   1.00 14.77  ? 378  LEU C CG    1 
ATOM   6499  C  CD1   . LEU C  2  378  ? 78.568  -21.243 60.703   1.00 12.68  ? 378  LEU C CD1   1 
ATOM   6500  C  CD2   . LEU C  2  378  ? 81.063  -21.377 60.629   1.00 10.15  ? 378  LEU C CD2   1 
ATOM   6501  N  N     . GLU C  2  379  ? 79.957  -16.851 60.627   1.00 14.89  ? 379  GLU C N     1 
ATOM   6502  C  CA    . GLU C  2  379  ? 80.080  -15.886 61.711   1.00 18.87  ? 379  GLU C CA    1 
ATOM   6503  C  C     . GLU C  2  379  ? 78.858  -14.976 61.737   1.00 16.56  ? 379  GLU C C     1 
ATOM   6504  O  O     . GLU C  2  379  ? 78.351  -14.631 62.802   1.00 16.41  ? 379  GLU C O     1 
ATOM   6505  C  CB    . GLU C  2  379  ? 81.345  -15.037 61.538   1.00 26.30  ? 379  GLU C CB    1 
ATOM   6506  C  CG    . GLU C  2  379  ? 82.654  -15.803 61.670   1.00 27.42  ? 379  GLU C CG    1 
ATOM   6507  C  CD    . GLU C  2  379  ? 83.886  -14.925 61.456   1.00 38.30  ? 379  GLU C CD    1 
ATOM   6508  O  OE1   . GLU C  2  379  ? 84.242  -14.670 60.282   1.00 33.63  ? 379  GLU C OE1   1 
ATOM   6509  O  OE2   . GLU C  2  379  ? 84.503  -14.498 62.461   1.00 38.99  ? 379  GLU C OE2   1 
ATOM   6510  N  N     . ALA C  2  380  ? 78.387  -14.602 60.553   1.00 15.22  ? 380  ALA C N     1 
ATOM   6511  C  CA    . ALA C  2  380  ? 77.229  -13.727 60.420   1.00 17.34  ? 380  ALA C CA    1 
ATOM   6512  C  C     . ALA C  2  380  ? 75.921  -14.395 60.852   1.00 16.79  ? 380  ALA C C     1 
ATOM   6513  O  O     . ALA C  2  380  ? 75.106  -13.769 61.515   1.00 17.86  ? 380  ALA C O     1 
ATOM   6514  C  CB    . ALA C  2  380  ? 77.116  -13.201 59.002   1.00 18.65  ? 380  ALA C CB    1 
ATOM   6515  N  N     . ALA C  2  381  ? 75.714  -15.654 60.474   1.00 14.54  ? 381  ALA C N     1 
ATOM   6516  C  CA    . ALA C  2  381  ? 74.526  -16.383 60.920   1.00 11.51  ? 381  ALA C CA    1 
ATOM   6517  C  C     . ALA C  2  381  ? 74.492  -16.529 62.438   1.00 12.15  ? 381  ALA C C     1 
ATOM   6518  O  O     . ALA C  2  381  ? 73.434  -16.379 63.063   1.00 12.61  ? 381  ALA C O     1 
ATOM   6519  C  CB    . ALA C  2  381  ? 74.449  -17.743 60.265   1.00 9.19   ? 381  ALA C CB    1 
ATOM   6520  N  N     . ILE C  2  382  ? 75.650  -16.822 63.028   1.00 12.97  ? 382  ILE C N     1 
ATOM   6521  C  CA    . ILE C  2  382  ? 75.722  -17.005 64.476   1.00 8.99   ? 382  ILE C CA    1 
ATOM   6522  C  C     . ILE C  2  382  ? 75.507  -15.679 65.199   1.00 7.19   ? 382  ILE C C     1 
ATOM   6523  O  O     . ILE C  2  382  ? 74.714  -15.582 66.146   1.00 5.77   ? 382  ILE C O     1 
ATOM   6524  C  CB    . ILE C  2  382  ? 77.068  -17.624 64.910   1.00 8.16   ? 382  ILE C CB    1 
ATOM   6525  C  CG1   . ILE C  2  382  ? 77.321  -18.928 64.165   1.00 8.51   ? 382  ILE C CG1   1 
ATOM   6526  C  CG2   . ILE C  2  382  ? 77.065  -17.915 66.395   1.00 6.26   ? 382  ILE C CG2   1 
ATOM   6527  C  CD1   . ILE C  2  382  ? 76.231  -19.949 64.383   1.00 12.95  ? 382  ILE C CD1   1 
ATOM   6528  N  N     . ARG C  2  383  ? 76.214  -14.657 64.735   1.00 9.61   ? 383  ARG C N     1 
ATOM   6529  C  CA    . ARG C  2  383  ? 76.127  -13.331 65.331   1.00 16.30  ? 383  ARG C CA    1 
ATOM   6530  C  C     . ARG C  2  383  ? 74.701  -12.803 65.229   1.00 13.63  ? 383  ARG C C     1 
ATOM   6531  O  O     . ARG C  2  383  ? 74.176  -12.229 66.174   1.00 9.75   ? 383  ARG C O     1 
ATOM   6532  C  CB    . ARG C  2  383  ? 77.113  -12.375 64.652   1.00 16.10  ? 383  ARG C CB    1 
ATOM   6533  C  CG    . ARG C  2  383  ? 77.025  -10.932 65.116   1.00 20.26  ? 383  ARG C CG    1 
ATOM   6534  C  CD    . ARG C  2  383  ? 78.127  -10.081 64.492   1.00 29.18  ? 383  ARG C CD    1 
ATOM   6535  N  NE    . ARG C  2  383  ? 78.408  -10.468 63.109   1.00 45.52  ? 383  ARG C NE    1 
ATOM   6536  C  CZ    . ARG C  2  383  ? 79.560  -10.997 62.696   1.00 47.46  ? 383  ARG C CZ    1 
ATOM   6537  N  NH1   . ARG C  2  383  ? 80.550  -11.196 63.561   1.00 40.92  ? 383  ARG C NH1   1 
ATOM   6538  N  NH2   . ARG C  2  383  ? 79.725  -11.323 61.418   1.00 33.20  ? 383  ARG C NH2   1 
ATOM   6539  N  N     . GLU C  2  384  ? 74.075  -13.024 64.078   1.00 14.79  ? 384  GLU C N     1 
ATOM   6540  C  CA    . GLU C  2  384  ? 72.703  -12.588 63.851   1.00 14.81  ? 384  GLU C CA    1 
ATOM   6541  C  C     . GLU C  2  384  ? 71.716  -13.313 64.765   1.00 12.17  ? 384  GLU C C     1 
ATOM   6542  O  O     . GLU C  2  384  ? 70.845  -12.674 65.354   1.00 20.42  ? 384  GLU C O     1 
ATOM   6543  C  CB    . GLU C  2  384  ? 72.322  -12.720 62.367   1.00 15.70  ? 384  GLU C CB    1 
ATOM   6544  C  CG    . GLU C  2  384  ? 70.955  -13.332 62.097   1.00 27.23  ? 384  GLU C CG    1 
ATOM   6545  C  CD    . GLU C  2  384  ? 71.040  -14.739 61.499   1.00 30.74  ? 384  GLU C CD    1 
ATOM   6546  O  OE1   . GLU C  2  384  ? 71.296  -14.851 60.272   1.00 26.84  ? 384  GLU C OE1   1 
ATOM   6547  O  OE2   . GLU C  2  384  ? 70.845  -15.726 62.254   1.00 19.33  ? 384  GLU C OE2   1 
ATOM   6548  N  N     . PHE C  2  385  ? 71.855  -14.633 64.898   1.00 11.41  ? 385  PHE C N     1 
ATOM   6549  C  CA    . PHE C  2  385  ? 71.017  -15.375 65.838   1.00 6.53   ? 385  PHE C CA    1 
ATOM   6550  C  C     . PHE C  2  385  ? 71.141  -14.809 67.239   1.00 5.75   ? 385  PHE C C     1 
ATOM   6551  O  O     . PHE C  2  385  ? 70.148  -14.440 67.847   1.00 5.62   ? 385  PHE C O     1 
ATOM   6552  C  CB    . PHE C  2  385  ? 71.386  -16.851 65.868   1.00 4.98   ? 385  PHE C CB    1 
ATOM   6553  C  CG    . PHE C  2  385  ? 70.669  -17.637 66.931   1.00 3.30   ? 385  PHE C CG    1 
ATOM   6554  C  CD1   . PHE C  2  385  ? 69.337  -17.975 66.785   1.00 4.26   ? 385  PHE C CD1   1 
ATOM   6555  C  CD2   . PHE C  2  385  ? 71.332  -18.055 68.070   1.00 3.80   ? 385  PHE C CD2   1 
ATOM   6556  C  CE1   . PHE C  2  385  ? 68.675  -18.712 67.758   1.00 4.13   ? 385  PHE C CE1   1 
ATOM   6557  C  CE2   . PHE C  2  385  ? 70.679  -18.794 69.047   1.00 3.25   ? 385  PHE C CE2   1 
ATOM   6558  C  CZ    . PHE C  2  385  ? 69.349  -19.122 68.889   1.00 3.01   ? 385  PHE C CZ    1 
ATOM   6559  N  N     . PHE C  2  386  ? 72.364  -14.724 67.749   1.00 6.04   ? 386  PHE C N     1 
ATOM   6560  C  CA    . PHE C  2  386  ? 72.536  -14.288 69.129   1.00 4.54   ? 386  PHE C CA    1 
ATOM   6561  C  C     . PHE C  2  386  ? 72.167  -12.825 69.396   1.00 7.68   ? 386  PHE C C     1 
ATOM   6562  O  O     . PHE C  2  386  ? 71.556  -12.521 70.423   1.00 7.10   ? 386  PHE C O     1 
ATOM   6563  C  CB    . PHE C  2  386  ? 73.937  -14.617 69.642   1.00 3.34   ? 386  PHE C CB    1 
ATOM   6564  C  CG    . PHE C  2  386  ? 74.087  -16.035 70.085   1.00 3.12   ? 386  PHE C CG    1 
ATOM   6565  C  CD1   . PHE C  2  386  ? 74.576  -16.997 69.222   1.00 3.72   ? 386  PHE C CD1   1 
ATOM   6566  C  CD2   . PHE C  2  386  ? 73.711  -16.419 71.360   1.00 3.41   ? 386  PHE C CD2   1 
ATOM   6567  C  CE1   . PHE C  2  386  ? 74.703  -18.318 69.628   1.00 2.90   ? 386  PHE C CE1   1 
ATOM   6568  C  CE2   . PHE C  2  386  ? 73.834  -17.740 71.770   1.00 2.48   ? 386  PHE C CE2   1 
ATOM   6569  C  CZ    . PHE C  2  386  ? 74.330  -18.688 70.900   1.00 1.84   ? 386  PHE C CZ    1 
ATOM   6570  N  N     . SER C  2  387  ? 72.564  -11.922 68.503   1.00 10.30  ? 387  SER C N     1 
ATOM   6571  C  CA    . SER C  2  387  ? 72.247  -10.503 68.664   1.00 11.04  ? 387  SER C CA    1 
ATOM   6572  C  C     . SER C  2  387  ? 70.801  -10.135 68.358   1.00 17.46  ? 387  SER C C     1 
ATOM   6573  O  O     . SER C  2  387  ? 70.100  -9.571  69.200   1.00 24.18  ? 387  SER C O     1 
ATOM   6574  C  CB    . SER C  2  387  ? 73.161  -9.631  67.797   1.00 12.02  ? 387  SER C CB    1 
ATOM   6575  O  OG    . SER C  2  387  ? 74.473  -9.559  68.327   1.00 16.16  ? 387  SER C OG    1 
ATOM   6576  N  N     . ARG C  2  388  ? 70.359  -10.433 67.143   1.00 12.33  ? 388  ARG C N     1 
ATOM   6577  C  CA    . ARG C  2  388  ? 69.099  -9.867  66.678   1.00 12.90  ? 388  ARG C CA    1 
ATOM   6578  C  C     . ARG C  2  388  ? 67.849  -10.741 66.697   1.00 18.23  ? 388  ARG C C     1 
ATOM   6579  O  O     . ARG C  2  388  ? 66.772  -10.272 66.327   1.00 33.68  ? 388  ARG C O     1 
ATOM   6580  C  CB    . ARG C  2  388  ? 69.282  -9.153  65.339   1.00 21.79  ? 388  ARG C CB    1 
ATOM   6581  C  CG    . ARG C  2  388  ? 69.922  -7.776  65.498   1.00 23.88  ? 388  ARG C CG    1 
ATOM   6582  C  CD    . ARG C  2  388  ? 70.473  -7.233  64.181   1.00 42.38  ? 388  ARG C CD    1 
ATOM   6583  N  NE    . ARG C  2  388  ? 71.528  -8.075  63.613   1.00 44.55  ? 388  ARG C NE    1 
ATOM   6584  C  CZ    . ARG C  2  388  ? 72.779  -8.134  64.070   1.00 45.18  ? 388  ARG C CZ    1 
ATOM   6585  N  NH1   . ARG C  2  388  ? 73.147  -7.410  65.123   1.00 40.63  ? 388  ARG C NH1   1 
ATOM   6586  N  NH2   . ARG C  2  388  ? 73.664  -8.930  63.480   1.00 36.34  ? 388  ARG C NH2   1 
ATOM   6587  N  N     . SER C  2  389  ? 67.965  -11.993 67.125   1.00 11.68  ? 389  SER C N     1 
ATOM   6588  C  CA    . SER C  2  389  ? 66.781  -12.851 67.157   1.00 9.27   ? 389  SER C CA    1 
ATOM   6589  C  C     . SER C  2  389  ? 65.748  -12.396 68.193   1.00 10.25  ? 389  SER C C     1 
ATOM   6590  O  O     . SER C  2  389  ? 66.060  -11.667 69.136   1.00 10.14  ? 389  SER C O     1 
ATOM   6591  C  CB    . SER C  2  389  ? 67.151  -14.313 67.390   1.00 6.90   ? 389  SER C CB    1 
ATOM   6592  O  OG    . SER C  2  389  ? 65.997  -15.137 67.362   1.00 9.60   ? 389  SER C OG    1 
ATOM   6593  N  N     . GLN C  2  390  ? 64.509  -12.821 67.991   1.00 11.31  ? 390  GLN C N     1 
ATOM   6594  C  CA    . GLN C  2  390  ? 63.433  -12.525 68.920   1.00 10.83  ? 390  GLN C CA    1 
ATOM   6595  C  C     . GLN C  2  390  ? 63.528  -13.445 70.123   1.00 8.57   ? 390  GLN C C     1 
ATOM   6596  O  O     . GLN C  2  390  ? 63.205  -13.052 71.246   1.00 10.01  ? 390  GLN C O     1 
ATOM   6597  C  CB    . GLN C  2  390  ? 62.082  -12.714 68.228   1.00 20.60  ? 390  GLN C CB    1 
ATOM   6598  C  CG    . GLN C  2  390  ? 60.879  -12.576 69.145   1.00 30.85  ? 390  GLN C CG    1 
ATOM   6599  C  CD    . GLN C  2  390  ? 59.572  -12.529 68.378   1.00 39.02  ? 390  GLN C CD    1 
ATOM   6600  O  OE1   . GLN C  2  390  ? 58.539  -12.107 68.912   1.00 31.08  ? 390  GLN C OE1   1 
ATOM   6601  N  NE2   . GLN C  2  390  ? 59.609  -12.959 67.115   1.00 30.75  ? 390  GLN C NE2   1 
ATOM   6602  N  N     . LEU C  2  391  ? 63.971  -14.676 69.876   1.00 7.18   ? 391  LEU C N     1 
ATOM   6603  C  CA    . LEU C  2  391  ? 64.097  -15.675 70.926   1.00 4.34   ? 391  LEU C CA    1 
ATOM   6604  C  C     . LEU C  2  391  ? 65.332  -15.395 71.762   1.00 3.96   ? 391  LEU C C     1 
ATOM   6605  O  O     . LEU C  2  391  ? 65.473  -15.928 72.861   1.00 3.29   ? 391  LEU C O     1 
ATOM   6606  C  CB    . LEU C  2  391  ? 64.142  -17.095 70.346   1.00 4.08   ? 391  LEU C CB    1 
ATOM   6607  C  CG    . LEU C  2  391  ? 62.794  -17.737 69.980   1.00 6.55   ? 391  LEU C CG    1 
ATOM   6608  C  CD1   . LEU C  2  391  ? 62.962  -19.127 69.397   1.00 4.91   ? 391  LEU C CD1   1 
ATOM   6609  C  CD2   . LEU C  2  391  ? 61.869  -17.799 71.179   1.00 5.42   ? 391  LEU C CD2   1 
ATOM   6610  N  N     . SER C  2  392  ? 66.217  -14.540 71.256   1.00 3.88   ? 392  SER C N     1 
ATOM   6611  C  CA    . SER C  2  392  ? 67.379  -14.146 72.034   1.00 3.63   ? 392  SER C CA    1 
ATOM   6612  C  C     . SER C  2  392  ? 66.976  -12.918 72.804   1.00 4.60   ? 392  SER C C     1 
ATOM   6613  O  O     . SER C  2  392  ? 66.816  -11.837 72.236   1.00 6.30   ? 392  SER C O     1 
ATOM   6614  C  CB    . SER C  2  392  ? 68.566  -13.808 71.133   1.00 4.59   ? 392  SER C CB    1 
ATOM   6615  O  OG    . SER C  2  392  ? 69.748  -13.611 71.898   1.00 3.91   ? 392  SER C OG    1 
ATOM   6616  N  N     . GLN C  2  393  ? 66.841  -13.069 74.111   1.00 3.78   ? 393  GLN C N     1 
ATOM   6617  C  CA    . GLN C  2  393  ? 66.283  -11.994 74.904   1.00 3.53   ? 393  GLN C CA    1 
ATOM   6618  C  C     . GLN C  2  393  ? 67.307  -11.425 75.863   1.00 4.49   ? 393  GLN C C     1 
ATOM   6619  O  O     . GLN C  2  393  ? 68.089  -12.161 76.463   1.00 3.65   ? 393  GLN C O     1 
ATOM   6620  C  CB    . GLN C  2  393  ? 65.033  -12.469 75.646   1.00 2.20   ? 393  GLN C CB    1 
ATOM   6621  C  CG    . GLN C  2  393  ? 63.920  -12.927 74.716   1.00 1.88   ? 393  GLN C CG    1 
ATOM   6622  C  CD    . GLN C  2  393  ? 62.656  -13.294 75.465   1.00 2.68   ? 393  GLN C CD    1 
ATOM   6623  O  OE1   . GLN C  2  393  ? 62.610  -13.244 76.700   1.00 1.98   ? 393  GLN C OE1   1 
ATOM   6624  N  NE2   . GLN C  2  393  ? 61.617  -13.671 74.723   1.00 3.10   ? 393  GLN C NE2   1 
ATOM   6625  N  N     . PHE C  2  394  ? 67.311  -10.100 75.966   1.00 5.60   ? 394  PHE C N     1 
ATOM   6626  C  CA    . PHE C  2  394  ? 68.097  -9.396  76.962   1.00 4.37   ? 394  PHE C CA    1 
ATOM   6627  C  C     . PHE C  2  394  ? 67.664  -9.959  78.326   1.00 4.64   ? 394  PHE C C     1 
ATOM   6628  O  O     . PHE C  2  394  ? 66.487  -9.924  78.688   1.00 5.50   ? 394  PHE C O     1 
ATOM   6629  C  CB    . PHE C  2  394  ? 67.785  -7.907  76.822   1.00 4.73   ? 394  PHE C CB    1 
ATOM   6630  C  CG    . PHE C  2  394  ? 68.636  -7.015  77.661   1.00 6.57   ? 394  PHE C CG    1 
ATOM   6631  C  CD1   . PHE C  2  394  ? 68.088  -6.339  78.746   1.00 6.09   ? 394  PHE C CD1   1 
ATOM   6632  C  CD2   . PHE C  2  394  ? 69.973  -6.827  77.358   1.00 8.54   ? 394  PHE C CD2   1 
ATOM   6633  C  CE1   . PHE C  2  394  ? 68.857  -5.502  79.525   1.00 6.05   ? 394  PHE C CE1   1 
ATOM   6634  C  CE2   . PHE C  2  394  ? 70.757  -5.993  78.136   1.00 16.59  ? 394  PHE C CE2   1 
ATOM   6635  C  CZ    . PHE C  2  394  ? 70.195  -5.326  79.223   1.00 14.73  ? 394  PHE C CZ    1 
ATOM   6636  N  N     . LYS C  2  395  ? 68.619  -10.485 79.078   1.00 3.51   ? 395  LYS C N     1 
ATOM   6637  C  CA    . LYS C  2  395  ? 68.298  -11.331 80.224   1.00 3.38   ? 395  LYS C CA    1 
ATOM   6638  C  C     . LYS C  2  395  ? 67.666  -10.558 81.373   1.00 4.10   ? 395  LYS C C     1 
ATOM   6639  O  O     . LYS C  2  395  ? 68.100  -9.454  81.692   1.00 5.07   ? 395  LYS C O     1 
ATOM   6640  C  CB    . LYS C  2  395  ? 69.567  -12.051 80.687   1.00 4.04   ? 395  LYS C CB    1 
ATOM   6641  C  CG    . LYS C  2  395  ? 69.481  -12.788 82.008   1.00 4.14   ? 395  LYS C CG    1 
ATOM   6642  C  CD    . LYS C  2  395  ? 70.819  -13.445 82.306   1.00 6.29   ? 395  LYS C CD    1 
ATOM   6643  C  CE    . LYS C  2  395  ? 70.953  -13.850 83.756   1.00 7.79   ? 395  LYS C CE    1 
ATOM   6644  N  NZ    . LYS C  2  395  ? 72.347  -14.260 84.057   1.00 7.95   ? 395  LYS C NZ    1 
ATOM   6645  N  N     . ASP C  2  396  ? 66.659  -11.144 82.014   1.00 4.36   ? 396  ASP C N     1 
ATOM   6646  C  CA    . ASP C  2  396  ? 66.042  -10.480 83.149   1.00 3.93   ? 396  ASP C CA    1 
ATOM   6647  C  C     . ASP C  2  396  ? 66.765  -10.947 84.404   1.00 3.96   ? 396  ASP C C     1 
ATOM   6648  O  O     . ASP C  2  396  ? 66.484  -12.005 84.948   1.00 3.10   ? 396  ASP C O     1 
ATOM   6649  C  CB    . ASP C  2  396  ? 64.565  -10.881 83.220   1.00 3.61   ? 396  ASP C CB    1 
ATOM   6650  C  CG    . ASP C  2  396  ? 63.808  -10.179 84.345   1.00 11.06  ? 396  ASP C CG    1 
ATOM   6651  O  OD1   . ASP C  2  396  ? 64.445  -9.673  85.298   1.00 10.79  ? 396  ASP C OD1   1 
ATOM   6652  O  OD2   . ASP C  2  396  ? 62.556  -10.140 84.282   1.00 18.40  ? 396  ASP C OD2   1 
ATOM   6653  N  N     . GLU C  2  397  ? 67.670  -10.101 84.875   1.00 6.04   ? 397  GLU C N     1 
ATOM   6654  C  CA    . GLU C  2  397  ? 68.421  -10.314 86.109   1.00 4.71   ? 397  GLU C CA    1 
ATOM   6655  C  C     . GLU C  2  397  ? 67.990  -9.516  87.353   1.00 5.44   ? 397  GLU C C     1 
ATOM   6656  O  O     . GLU C  2  397  ? 68.779  -9.379  88.289   1.00 11.61  ? 397  GLU C O     1 
ATOM   6657  C  CB    . GLU C  2  397  ? 69.947  -10.401 85.908   1.00 5.54   ? 397  GLU C CB    1 
ATOM   6658  C  CG    . GLU C  2  397  ? 70.601  -9.327  85.065   1.00 12.45  ? 397  GLU C CG    1 
ATOM   6659  C  CD    . GLU C  2  397  ? 72.110  -9.542  84.950   1.00 15.73  ? 397  GLU C CD    1 
ATOM   6660  O  OE1   . GLU C  2  397  ? 72.556  -10.698 85.124   1.00 21.33  ? 397  GLU C OE1   1 
ATOM   6661  O  OE2   . GLU C  2  397  ? 72.849  -8.563  84.697   1.00 13.23  ? 397  GLU C OE2   1 
ATOM   6662  N  N     . THR C  2  398  ? 66.795  -8.927  87.324   1.00 3.72   ? 398  THR C N     1 
ATOM   6663  C  CA    . THR C  2  398  ? 66.320  -8.068  88.414   1.00 3.45   ? 398  THR C CA    1 
ATOM   6664  C  C     . THR C  2  398  ? 66.677  -8.638  89.787   1.00 3.18   ? 398  THR C C     1 
ATOM   6665  O  O     . THR C  2  398  ? 67.428  -8.024  90.542   1.00 3.50   ? 398  THR C O     1 
ATOM   6666  C  CB    . THR C  2  398  ? 64.802  -7.895  88.364   1.00 2.74   ? 398  THR C CB    1 
ATOM   6667  O  OG1   . THR C  2  398  ? 64.403  -7.476  87.056   1.00 4.07   ? 398  THR C OG1   1 
ATOM   6668  C  CG2   . THR C  2  398  ? 64.370  -6.861  89.364   1.00 3.08   ? 398  THR C CG2   1 
ATOM   6669  N  N     . ASN C  2  399  ? 66.133  -9.808  90.103   1.00 3.19   ? 399  ASN C N     1 
ATOM   6670  C  CA    . ASN C  2  399  ? 66.629  -10.607 91.216   1.00 2.23   ? 399  ASN C CA    1 
ATOM   6671  C  C     . ASN C  2  399  ? 67.126  -11.952 90.657   1.00 2.55   ? 399  ASN C C     1 
ATOM   6672  O  O     . ASN C  2  399  ? 67.046  -12.171 89.451   1.00 2.60   ? 399  ASN C O     1 
ATOM   6673  C  CB    . ASN C  2  399  ? 65.537  -10.777 92.272   1.00 1.44   ? 399  ASN C CB    1 
ATOM   6674  C  CG    . ASN C  2  399  ? 64.335  -11.521 91.755   1.00 1.66   ? 399  ASN C CG    1 
ATOM   6675  O  OD1   . ASN C  2  399  ? 64.422  -12.683 91.375   1.00 1.67   ? 399  ASN C OD1   1 
ATOM   6676  N  ND2   . ASN C  2  399  ? 63.193  -10.859 91.760   1.00 2.29   ? 399  ASN C ND2   1 
ATOM   6677  N  N     . PRO C  2  400  ? 67.664  -12.851 91.507   1.00 2.90   ? 400  PRO C N     1 
ATOM   6678  C  CA    . PRO C  2  400  ? 68.115  -14.117 90.908   1.00 2.27   ? 400  PRO C CA    1 
ATOM   6679  C  C     . PRO C  2  400  ? 66.982  -14.992 90.363   1.00 1.77   ? 400  PRO C C     1 
ATOM   6680  O  O     . PRO C  2  400  ? 67.142  -15.666 89.329   1.00 1.93   ? 400  PRO C O     1 
ATOM   6681  C  CB    . PRO C  2  400  ? 68.812  -14.817 92.073   1.00 2.77   ? 400  PRO C CB    1 
ATOM   6682  C  CG    . PRO C  2  400  ? 69.261  -13.710 92.960   1.00 3.04   ? 400  PRO C CG    1 
ATOM   6683  C  CD    . PRO C  2  400  ? 68.170  -12.696 92.885   1.00 2.34   ? 400  PRO C CD    1 
ATOM   6684  N  N     . LEU C  2  401  ? 65.846  -14.974 91.053   1.00 1.77   ? 401  LEU C N     1 
ATOM   6685  C  CA    . LEU C  2  401  ? 64.685  -15.743 90.618   1.00 1.82   ? 401  LEU C CA    1 
ATOM   6686  C  C     . LEU C  2  401  ? 64.220  -15.314 89.232   1.00 2.18   ? 401  LEU C C     1 
ATOM   6687  O  O     . LEU C  2  401  ? 63.818  -16.152 88.433   1.00 2.86   ? 401  LEU C O     1 
ATOM   6688  C  CB    . LEU C  2  401  ? 63.542  -15.649 91.628   1.00 1.29   ? 401  LEU C CB    1 
ATOM   6689  C  CG    . LEU C  2  401  ? 62.179  -16.193 91.204   1.00 0.85   ? 401  LEU C CG    1 
ATOM   6690  C  CD1   . LEU C  2  401  ? 62.254  -17.652 90.812   1.00 1.37   ? 401  LEU C CD1   1 
ATOM   6691  C  CD2   . LEU C  2  401  ? 61.195  -16.006 92.326   1.00 0.94   ? 401  LEU C CD2   1 
ATOM   6692  N  N     . SER C  2  402  ? 64.293  -14.021 88.932   1.00 2.11   ? 402  SER C N     1 
ATOM   6693  C  CA    . SER C  2  402  ? 63.909  -13.540 87.605   1.00 1.89   ? 402  SER C CA    1 
ATOM   6694  C  C     . SER C  2  402  ? 64.735  -14.176 86.482   1.00 1.88   ? 402  SER C C     1 
ATOM   6695  O  O     . SER C  2  402  ? 64.192  -14.549 85.443   1.00 2.17   ? 402  SER C O     1 
ATOM   6696  C  CB    . SER C  2  402  ? 63.968  -12.018 87.541   1.00 2.23   ? 402  SER C CB    1 
ATOM   6697  O  OG    . SER C  2  402  ? 65.027  -11.524 88.332   1.00 2.61   ? 402  SER C OG    1 
ATOM   6698  N  N     . SER C  2  403  ? 66.039  -14.314 86.700   1.00 1.89   ? 403  SER C N     1 
ATOM   6699  C  CA    . SER C  2  403  ? 66.907  -15.004 85.748   1.00 2.21   ? 403  SER C CA    1 
ATOM   6700  C  C     . SER C  2  403  ? 66.528  -16.471 85.640   1.00 2.49   ? 403  SER C C     1 
ATOM   6701  O  O     . SER C  2  403  ? 66.397  -17.013 84.528   1.00 2.69   ? 403  SER C O     1 
ATOM   6702  C  CB    . SER C  2  403  ? 68.370  -14.895 86.166   1.00 2.91   ? 403  SER C CB    1 
ATOM   6703  O  OG    . SER C  2  403  ? 68.730  -13.546 86.382   1.00 5.66   ? 403  SER C OG    1 
ATOM   6704  N  N     . LEU C  2  404  ? 66.356  -17.114 86.796   1.00 2.34   ? 404  LEU C N     1 
ATOM   6705  C  CA    . LEU C  2  404  ? 65.951  -18.517 86.802   1.00 2.22   ? 404  LEU C CA    1 
ATOM   6706  C  C     . LEU C  2  404  ? 64.690  -18.734 85.962   1.00 2.38   ? 404  LEU C C     1 
ATOM   6707  O  O     . LEU C  2  404  ? 64.657  -19.605 85.087   1.00 2.07   ? 404  LEU C O     1 
ATOM   6708  C  CB    . LEU C  2  404  ? 65.732  -19.021 88.225   1.00 2.38   ? 404  LEU C CB    1 
ATOM   6709  C  CG    . LEU C  2  404  ? 65.436  -20.515 88.345   1.00 2.08   ? 404  LEU C CG    1 
ATOM   6710  C  CD1   . LEU C  2  404  ? 66.627  -21.324 87.892   1.00 3.20   ? 404  LEU C CD1   1 
ATOM   6711  C  CD2   . LEU C  2  404  ? 65.075  -20.867 89.770   1.00 3.39   ? 404  LEU C CD2   1 
ATOM   6712  N  N     . ARG C  2  405  ? 63.668  -17.918 86.203   1.00 2.17   ? 405  ARG C N     1 
ATOM   6713  C  CA    . ARG C  2  405  ? 62.432  -18.013 85.439   1.00 2.31   ? 405  ARG C CA    1 
ATOM   6714  C  C     . ARG C  2  405  ? 62.626  -17.706 83.958   1.00 2.08   ? 405  ARG C C     1 
ATOM   6715  O  O     . ARG C  2  405  ? 61.961  -18.293 83.102   1.00 1.69   ? 405  ARG C O     1 
ATOM   6716  C  CB    . ARG C  2  405  ? 61.356  -17.084 85.989   1.00 2.27   ? 405  ARG C CB    1 
ATOM   6717  C  CG    . ARG C  2  405  ? 60.022  -17.346 85.304   1.00 6.51   ? 405  ARG C CG    1 
ATOM   6718  C  CD    . ARG C  2  405  ? 59.012  -16.257 85.519   1.00 4.95   ? 405  ARG C CD    1 
ATOM   6719  N  NE    . ARG C  2  405  ? 59.180  -15.162 84.576   1.00 4.14   ? 405  ARG C NE    1 
ATOM   6720  C  CZ    . ARG C  2  405  ? 58.234  -14.267 84.326   1.00 6.00   ? 405  ARG C CZ    1 
ATOM   6721  N  NH1   . ARG C  2  405  ? 57.059  -14.364 84.935   1.00 4.20   ? 405  ARG C NH1   1 
ATOM   6722  N  NH2   . ARG C  2  405  ? 58.456  -13.286 83.464   1.00 10.78  ? 405  ARG C NH2   1 
ATOM   6723  N  N     . HIS C  2  406  ? 63.517  -16.766 83.664   1.00 1.64   ? 406  HIS C N     1 
ATOM   6724  C  CA    . HIS C  2  406  ? 63.738  -16.373 82.290   1.00 1.28   ? 406  HIS C CA    1 
ATOM   6725  C  C     . HIS C  2  406  ? 64.227  -17.570 81.515   1.00 1.22   ? 406  HIS C C     1 
ATOM   6726  O  O     . HIS C  2  406  ? 63.727  -17.853 80.430   1.00 1.03   ? 406  HIS C O     1 
ATOM   6727  C  CB    . HIS C  2  406  ? 64.750  -15.239 82.194   1.00 1.61   ? 406  HIS C CB    1 
ATOM   6728  C  CG    . HIS C  2  406  ? 64.705  -14.510 80.888   1.00 1.57   ? 406  HIS C CG    1 
ATOM   6729  N  ND1   . HIS C  2  406  ? 65.488  -13.409 80.621   1.00 2.03   ? 406  HIS C ND1   1 
ATOM   6730  C  CD2   . HIS C  2  406  ? 63.961  -14.719 79.777   1.00 1.22   ? 406  HIS C CD2   1 
ATOM   6731  C  CE1   . HIS C  2  406  ? 65.232  -12.974 79.401   1.00 2.28   ? 406  HIS C CE1   1 
ATOM   6732  N  NE2   . HIS C  2  406  ? 64.309  -13.753 78.866   1.00 1.37   ? 406  HIS C NE2   1 
ATOM   6733  N  N     . LYS C  2  407  ? 65.189  -18.289 82.088   1.00 1.95   ? 407  LYS C N     1 
ATOM   6734  C  CA    . LYS C  2  407  ? 65.765  -19.448 81.397   1.00 1.58   ? 407  LYS C CA    1 
ATOM   6735  C  C     . LYS C  2  407  ? 64.752  -20.559 81.149   1.00 1.07   ? 407  LYS C C     1 
ATOM   6736  O  O     . LYS C  2  407  ? 64.883  -21.312 80.192   1.00 1.02   ? 407  LYS C O     1 
ATOM   6737  C  CB    . LYS C  2  407  ? 66.976  -20.001 82.148   1.00 1.09   ? 407  LYS C CB    1 
ATOM   6738  C  CG    . LYS C  2  407  ? 68.207  -19.135 82.039   1.00 1.08   ? 407  LYS C CG    1 
ATOM   6739  C  CD    . LYS C  2  407  ? 68.870  -18.967 83.383   1.00 2.04   ? 407  LYS C CD    1 
ATOM   6740  C  CE    . LYS C  2  407  ? 69.996  -17.956 83.316   1.00 4.27   ? 407  LYS C CE    1 
ATOM   6741  N  NZ    . LYS C  2  407  ? 70.517  -17.637 84.679   1.00 8.65   ? 407  LYS C NZ    1 
ATOM   6742  N  N     . ARG C  2  408  ? 63.740  -20.643 82.004   1.00 1.06   ? 408  ARG C N     1 
ATOM   6743  C  CA    . ARG C  2  408  ? 62.728  -21.695 81.924   1.00 0.92   ? 408  ARG C CA    1 
ATOM   6744  C  C     . ARG C  2  408  ? 61.492  -21.315 81.105   1.00 1.60   ? 408  ARG C C     1 
ATOM   6745  O  O     . ARG C  2  408  ? 60.473  -21.996 81.165   1.00 1.77   ? 408  ARG C O     1 
ATOM   6746  C  CB    . ARG C  2  408  ? 62.346  -22.186 83.314   1.00 0.83   ? 408  ARG C CB    1 
ATOM   6747  C  CG    . ARG C  2  408  ? 63.494  -22.875 84.005   1.00 0.85   ? 408  ARG C CG    1 
ATOM   6748  C  CD    . ARG C  2  408  ? 63.233  -23.083 85.478   1.00 1.41   ? 408  ARG C CD    1 
ATOM   6749  N  NE    . ARG C  2  408  ? 62.105  -23.976 85.718   1.00 1.85   ? 408  ARG C NE    1 
ATOM   6750  C  CZ    . ARG C  2  408  ? 62.178  -25.297 85.635   1.00 1.04   ? 408  ARG C CZ    1 
ATOM   6751  N  NH1   . ARG C  2  408  ? 61.111  -26.039 85.870   1.00 0.90   ? 408  ARG C NH1   1 
ATOM   6752  N  NH2   . ARG C  2  408  ? 63.322  -25.873 85.311   1.00 1.42   ? 408  ARG C NH2   1 
ATOM   6753  N  N     . ARG C  2  409  ? 61.566  -20.186 80.403   1.00 2.44   ? 409  ARG C N     1 
ATOM   6754  C  CA    . ARG C  2  409  ? 60.470  -19.709 79.559   1.00 1.89   ? 409  ARG C CA    1 
ATOM   6755  C  C     . ARG C  2  409  ? 60.265  -20.524 78.286   1.00 1.20   ? 409  ARG C C     1 
ATOM   6756  O  O     . ARG C  2  409  ? 61.215  -20.960 77.652   1.00 0.88   ? 409  ARG C O     1 
ATOM   6757  C  CB    . ARG C  2  409  ? 60.695  -18.245 79.175   1.00 2.12   ? 409  ARG C CB    1 
ATOM   6758  C  CG    . ARG C  2  409  ? 59.509  -17.354 79.468   1.00 2.65   ? 409  ARG C CG    1 
ATOM   6759  C  CD    . ARG C  2  409  ? 59.343  -17.184 80.974   1.00 8.34   ? 409  ARG C CD    1 
ATOM   6760  N  NE    . ARG C  2  409  ? 58.037  -17.615 81.480   1.00 9.34   ? 409  ARG C NE    1 
ATOM   6761  C  CZ    . ARG C  2  409  ? 56.952  -16.839 81.532   1.00 9.96   ? 409  ARG C CZ    1 
ATOM   6762  N  NH1   . ARG C  2  409  ? 56.997  -15.581 81.092   1.00 7.76   ? 409  ARG C NH1   1 
ATOM   6763  N  NH2   . ARG C  2  409  ? 55.813  -17.321 82.022   1.00 7.93   ? 409  ARG C NH2   1 
ATOM   6764  N  N     . ILE C  2  410  ? 59.003  -20.693 77.913   1.00 1.70   ? 410  ILE C N     1 
ATOM   6765  C  CA    . ILE C  2  410  ? 58.619  -21.379 76.690   1.00 1.81   ? 410  ILE C CA    1 
ATOM   6766  C  C     . ILE C  2  410  ? 57.794  -20.442 75.811   1.00 2.31   ? 410  ILE C C     1 
ATOM   6767  O  O     . ILE C  2  410  ? 56.715  -20.013 76.194   1.00 2.75   ? 410  ILE C O     1 
ATOM   6768  C  CB    . ILE C  2  410  ? 57.780  -22.623 77.008   1.00 2.02   ? 410  ILE C CB    1 
ATOM   6769  C  CG1   . ILE C  2  410  ? 58.632  -23.677 77.701   1.00 1.83   ? 410  ILE C CG1   1 
ATOM   6770  C  CG2   . ILE C  2  410  ? 57.180  -23.209 75.748   1.00 2.72   ? 410  ILE C CG2   1 
ATOM   6771  C  CD1   . ILE C  2  410  ? 57.841  -24.887 78.125   1.00 2.77   ? 410  ILE C CD1   1 
ATOM   6772  N  N     . SER C  2  411  ? 58.300  -20.131 74.626   1.00 2.73   ? 411  SER C N     1 
ATOM   6773  C  CA    . SER C  2  411  ? 57.659  -19.151 73.758   1.00 3.43   ? 411  SER C CA    1 
ATOM   6774  C  C     . SER C  2  411  ? 57.036  -19.822 72.543   1.00 4.43   ? 411  SER C C     1 
ATOM   6775  O  O     . SER C  2  411  ? 57.681  -20.620 71.867   1.00 3.59   ? 411  SER C O     1 
ATOM   6776  C  CB    . SER C  2  411  ? 58.682  -18.095 73.316   1.00 3.99   ? 411  SER C CB    1 
ATOM   6777  O  OG    . SER C  2  411  ? 58.111  -17.131 72.449   1.00 5.72   ? 411  SER C OG    1 
ATOM   6778  N  N     . ALA C  2  412  ? 55.776  -19.501 72.271   1.00 5.28   ? 412  ALA C N     1 
ATOM   6779  C  CA    . ALA C  2  412  ? 55.101  -20.022 71.090   1.00 6.64   ? 412  ALA C CA    1 
ATOM   6780  C  C     . ALA C  2  412  ? 55.393  -19.107 69.911   1.00 15.45  ? 412  ALA C C     1 
ATOM   6781  O  O     . ALA C  2  412  ? 55.010  -19.383 68.770   1.00 18.76  ? 412  ALA C O     1 
ATOM   6782  C  CB    . ALA C  2  412  ? 53.616  -20.111 71.334   1.00 8.70   ? 412  ALA C CB    1 
ATOM   6783  N  N     . LEU C  2  413  ? 56.088  -18.016 70.221   1.00 15.37  ? 413  LEU C N     1 
ATOM   6784  C  CA    . LEU C  2  413  ? 56.412  -16.955 69.279   1.00 15.27  ? 413  LEU C CA    1 
ATOM   6785  C  C     . LEU C  2  413  ? 57.752  -17.202 68.605   1.00 20.35  ? 413  LEU C C     1 
ATOM   6786  O  O     . LEU C  2  413  ? 58.283  -18.308 68.662   1.00 18.54  ? 413  LEU C O     1 
ATOM   6787  C  CB    . LEU C  2  413  ? 56.442  -15.624 70.018   1.00 12.25  ? 413  LEU C CB    1 
ATOM   6788  C  CG    . LEU C  2  413  ? 55.122  -15.333 70.722   1.00 11.04  ? 413  LEU C CG    1 
ATOM   6789  C  CD1   . LEU C  2  413  ? 55.258  -14.152 71.671   1.00 10.43  ? 413  LEU C CD1   1 
ATOM   6790  C  CD2   . LEU C  2  413  ? 54.034  -15.094 69.679   1.00 12.99  ? 413  LEU C CD2   1 
ATOM   6791  N  N     . GLY C  2  414  ? 58.274  -16.177 67.936   1.00 26.94  ? 414  GLY C N     1 
ATOM   6792  C  CA    . GLY C  2  414  ? 59.607  -16.238 67.360   1.00 27.08  ? 414  GLY C CA    1 
ATOM   6793  C  C     . GLY C  2  414  ? 59.655  -16.750 65.930   1.00 33.06  ? 414  GLY C C     1 
ATOM   6794  O  O     . GLY C  2  414  ? 58.631  -17.147 65.364   1.00 28.51  ? 414  GLY C O     1 
ATOM   6795  N  N     . PRO C  2  415  ? 60.856  -16.735 65.330   1.00 34.23  ? 415  PRO C N     1 
ATOM   6796  C  CA    . PRO C  2  415  ? 61.053  -17.231 63.963   1.00 27.24  ? 415  PRO C CA    1 
ATOM   6797  C  C     . PRO C  2  415  ? 60.730  -18.720 63.861   1.00 30.65  ? 415  PRO C C     1 
ATOM   6798  O  O     . PRO C  2  415  ? 61.208  -19.504 64.683   1.00 38.38  ? 415  PRO C O     1 
ATOM   6799  C  CB    . PRO C  2  415  ? 62.549  -16.990 63.717   1.00 25.74  ? 415  PRO C CB    1 
ATOM   6800  C  CG    . PRO C  2  415  ? 62.927  -15.900 64.679   1.00 28.59  ? 415  PRO C CG    1 
ATOM   6801  C  CD    . PRO C  2  415  ? 62.089  -16.157 65.895   1.00 28.40  ? 415  PRO C CD    1 
ATOM   6802  N  N     . GLY C  2  416  ? 59.934  -19.104 62.867   1.00 24.54  ? 416  GLY C N     1 
ATOM   6803  C  CA    . GLY C  2  416  ? 59.547  -20.495 62.704   1.00 27.55  ? 416  GLY C CA    1 
ATOM   6804  C  C     . GLY C  2  416  ? 58.424  -20.875 63.651   1.00 32.40  ? 416  GLY C C     1 
ATOM   6805  O  O     . GLY C  2  416  ? 58.263  -22.041 64.029   1.00 24.85  ? 416  GLY C O     1 
ATOM   6806  N  N     . GLY C  2  417  ? 57.635  -19.878 64.030   1.00 29.00  ? 417  GLY C N     1 
ATOM   6807  C  CA    . GLY C  2  417  ? 56.552  -20.078 64.969   1.00 30.70  ? 417  GLY C CA    1 
ATOM   6808  C  C     . GLY C  2  417  ? 55.453  -19.061 64.758   1.00 35.10  ? 417  GLY C C     1 
ATOM   6809  O  O     . GLY C  2  417  ? 55.517  -18.249 63.835   1.00 44.32  ? 417  GLY C O     1 
ATOM   6810  N  N     . LEU C  2  418  ? 54.445  -19.108 65.621   1.00 36.42  ? 418  LEU C N     1 
ATOM   6811  C  CA    . LEU C  2  418  ? 53.268  -18.256 65.499   1.00 42.21  ? 418  LEU C CA    1 
ATOM   6812  C  C     . LEU C  2  418  ? 53.590  -16.767 65.592   1.00 48.49  ? 418  LEU C C     1 
ATOM   6813  O  O     . LEU C  2  418  ? 54.571  -16.363 66.218   1.00 38.98  ? 418  LEU C O     1 
ATOM   6814  C  CB    . LEU C  2  418  ? 52.239  -18.620 66.573   1.00 36.95  ? 418  LEU C CB    1 
ATOM   6815  C  CG    . LEU C  2  418  ? 51.736  -20.063 66.590   1.00 35.83  ? 418  LEU C CG    1 
ATOM   6816  C  CD1   . LEU C  2  418  ? 51.176  -20.408 67.961   1.00 31.48  ? 418  LEU C CD1   1 
ATOM   6817  C  CD2   . LEU C  2  418  ? 50.690  -20.285 65.509   1.00 28.76  ? 418  LEU C CD2   1 
ATOM   6818  N  N     . THR C  2  419  ? 52.755  -15.961 64.945   1.00 63.88  ? 419  THR C N     1 
ATOM   6819  C  CA    . THR C  2  419  ? 52.788  -14.517 65.109   1.00 66.32  ? 419  THR C CA    1 
ATOM   6820  C  C     . THR C  2  419  ? 51.591  -14.148 65.973   1.00 66.56  ? 419  THR C C     1 
ATOM   6821  O  O     . THR C  2  419  ? 50.565  -14.832 65.944   1.00 65.78  ? 419  THR C O     1 
ATOM   6822  C  CB    . THR C  2  419  ? 52.686  -13.771 63.759   1.00 69.77  ? 419  THR C CB    1 
ATOM   6823  O  OG1   . THR C  2  419  ? 53.469  -14.444 62.764   1.00 62.20  ? 419  THR C OG1   1 
ATOM   6824  C  CG2   . THR C  2  419  ? 53.162  -12.326 63.901   1.00 62.52  ? 419  THR C CG2   1 
ATOM   6825  N  N     . ARG C  2  420  ? 51.731  -13.087 66.758   1.00 67.38  ? 420  ARG C N     1 
ATOM   6826  C  CA    . ARG C  2  420  ? 50.647  -12.621 67.609   1.00 56.06  ? 420  ARG C CA    1 
ATOM   6827  C  C     . ARG C  2  420  ? 49.448  -12.249 66.746   1.00 71.30  ? 420  ARG C C     1 
ATOM   6828  O  O     . ARG C  2  420  ? 49.612  -11.850 65.590   1.00 77.19  ? 420  ARG C O     1 
ATOM   6829  C  CB    . ARG C  2  420  ? 51.109  -11.417 68.421   1.00 49.62  ? 420  ARG C CB    1 
ATOM   6830  C  CG    . ARG C  2  420  ? 50.491  -11.314 69.797   1.00 45.55  ? 420  ARG C CG    1 
ATOM   6831  C  CD    . ARG C  2  420  ? 51.144  -10.187 70.569   1.00 43.60  ? 420  ARG C CD    1 
ATOM   6832  N  NE    . ARG C  2  420  ? 52.597  -10.337 70.613   1.00 46.63  ? 420  ARG C NE    1 
ATOM   6833  C  CZ    . ARG C  2  420  ? 53.444  -9.337  70.844   1.00 61.93  ? 420  ARG C CZ    1 
ATOM   6834  N  NH1   . ARG C  2  420  ? 54.753  -9.562  70.868   1.00 55.00  ? 420  ARG C NH1   1 
ATOM   6835  N  NH2   . ARG C  2  420  ? 52.983  -8.109  71.047   1.00 60.92  ? 420  ARG C NH2   1 
ATOM   6836  N  N     . GLU C  2  421  ? 48.251  -12.402 67.313   1.00 69.98  ? 421  GLU C N     1 
ATOM   6837  C  CA    . GLU C  2  421  ? 46.970  -12.169 66.627   1.00 78.55  ? 421  GLU C CA    1 
ATOM   6838  C  C     . GLU C  2  421  ? 46.646  -13.234 65.573   1.00 79.63  ? 421  GLU C C     1 
ATOM   6839  O  O     . GLU C  2  421  ? 45.517  -13.308 65.082   1.00 78.63  ? 421  GLU C O     1 
ATOM   6840  C  CB    . GLU C  2  421  ? 46.899  -10.768 65.999   1.00 76.66  ? 421  GLU C CB    1 
ATOM   6841  C  CG    . GLU C  2  421  ? 47.398  -9.646  66.892   1.00 77.71  ? 421  GLU C CG    1 
ATOM   6842  C  CD    . GLU C  2  421  ? 48.320  -8.694  66.154   1.00 79.31  ? 421  GLU C CD    1 
ATOM   6843  O  OE1   . GLU C  2  421  ? 49.367  -8.318  66.723   1.00 69.53  ? 421  GLU C OE1   1 
ATOM   6844  O  OE2   . GLU C  2  421  ? 47.996  -8.325  65.004   1.00 82.13  ? 421  GLU C OE2   1 
ATOM   6845  N  N     . ARG C  2  422  ? 47.639  -14.045 65.222   1.00 77.01  ? 422  ARG C N     1 
ATOM   6846  C  CA    . ARG C  2  422  ? 47.429  -15.179 64.330   1.00 78.72  ? 422  ARG C CA    1 
ATOM   6847  C  C     . ARG C  2  422  ? 47.275  -16.440 65.173   1.00 77.95  ? 422  ARG C C     1 
ATOM   6848  O  O     . ARG C  2  422  ? 47.129  -17.548 64.653   1.00 72.65  ? 422  ARG C O     1 
ATOM   6849  C  CB    . ARG C  2  422  ? 48.591  -15.322 63.348   1.00 77.58  ? 422  ARG C CB    1 
ATOM   6850  C  CG    . ARG C  2  422  ? 49.247  -13.999 62.968   1.00 82.01  ? 422  ARG C CG    1 
ATOM   6851  C  CD    . ARG C  2  422  ? 48.284  -13.014 62.312   1.00 78.31  ? 422  ARG C CD    1 
ATOM   6852  N  NE    . ARG C  2  422  ? 48.844  -11.664 62.298   1.00 79.11  ? 422  ARG C NE    1 
ATOM   6853  C  CZ    . ARG C  2  422  ? 49.608  -11.178 61.324   1.00 79.10  ? 422  ARG C CZ    1 
ATOM   6854  N  NH1   . ARG C  2  422  ? 49.901  -11.930 60.270   1.00 79.10  ? 422  ARG C NH1   1 
ATOM   6855  N  NH2   . ARG C  2  422  ? 50.077  -9.938  61.402   1.00 60.29  ? 422  ARG C NH2   1 
ATOM   6856  N  N     . ALA C  2  423  ? 47.326  -16.250 66.487   1.00 67.56  ? 423  ALA C N     1 
ATOM   6857  C  CA    . ALA C  2  423  ? 47.144  -17.333 67.437   1.00 51.22  ? 423  ALA C CA    1 
ATOM   6858  C  C     . ALA C  2  423  ? 45.770  -17.226 68.093   1.00 50.28  ? 423  ALA C C     1 
ATOM   6859  O  O     . ALA C  2  423  ? 45.507  -16.293 68.857   1.00 53.68  ? 423  ALA C O     1 
ATOM   6860  C  CB    . ALA C  2  423  ? 48.237  -17.289 68.487   1.00 41.66  ? 423  ALA C CB    1 
ATOM   6861  N  N     . GLY C  2  424  ? 44.896  -18.181 67.790   1.00 48.77  ? 424  GLY C N     1 
ATOM   6862  C  CA    . GLY C  2  424  ? 43.552  -18.191 68.344   1.00 49.36  ? 424  GLY C CA    1 
ATOM   6863  C  C     . GLY C  2  424  ? 43.528  -18.710 69.768   1.00 39.92  ? 424  GLY C C     1 
ATOM   6864  O  O     . GLY C  2  424  ? 44.560  -18.752 70.435   1.00 33.70  ? 424  GLY C O     1 
ATOM   6865  N  N     . PHE C  2  425  ? 42.350  -19.112 70.236   1.00 41.46  ? 425  PHE C N     1 
ATOM   6866  C  CA    . PHE C  2  425  ? 42.222  -19.673 71.578   1.00 31.74  ? 425  PHE C CA    1 
ATOM   6867  C  C     . PHE C  2  425  ? 42.935  -21.018 71.675   1.00 24.79  ? 425  PHE C C     1 
ATOM   6868  O  O     . PHE C  2  425  ? 43.349  -21.431 72.757   1.00 25.99  ? 425  PHE C O     1 
ATOM   6869  C  CB    . PHE C  2  425  ? 40.750  -19.863 71.957   1.00 35.83  ? 425  PHE C CB    1 
ATOM   6870  C  CG    . PHE C  2  425  ? 39.915  -18.626 71.808   1.00 40.90  ? 425  PHE C CG    1 
ATOM   6871  C  CD1   . PHE C  2  425  ? 40.440  -17.375 72.085   1.00 39.15  ? 425  PHE C CD1   1 
ATOM   6872  C  CD2   . PHE C  2  425  ? 38.599  -18.718 71.386   1.00 49.92  ? 425  PHE C CD2   1 
ATOM   6873  C  CE1   . PHE C  2  425  ? 39.665  -16.240 71.943   1.00 39.52  ? 425  PHE C CE1   1 
ATOM   6874  C  CE2   . PHE C  2  425  ? 37.819  -17.585 71.243   1.00 57.94  ? 425  PHE C CE2   1 
ATOM   6875  C  CZ    . PHE C  2  425  ? 38.353  -16.345 71.520   1.00 48.10  ? 425  PHE C CZ    1 
ATOM   6876  N  N     . ASP C  2  426  ? 43.071  -21.694 70.538   1.00 28.35  ? 426  ASP C N     1 
ATOM   6877  C  CA    . ASP C  2  426  ? 43.576  -23.064 70.502   1.00 22.67  ? 426  ASP C CA    1 
ATOM   6878  C  C     . ASP C  2  426  ? 44.923  -23.242 71.195   1.00 15.11  ? 426  ASP C C     1 
ATOM   6879  O  O     . ASP C  2  426  ? 45.062  -24.079 72.081   1.00 14.64  ? 426  ASP C O     1 
ATOM   6880  C  CB    . ASP C  2  426  ? 43.648  -23.571 69.058   1.00 34.56  ? 426  ASP C CB    1 
ATOM   6881  C  CG    . ASP C  2  426  ? 42.273  -23.847 68.466   1.00 44.94  ? 426  ASP C CG    1 
ATOM   6882  O  OD1   . ASP C  2  426  ? 41.350  -24.172 69.245   1.00 39.85  ? 426  ASP C OD1   1 
ATOM   6883  O  OD2   . ASP C  2  426  ? 42.115  -23.744 67.227   1.00 45.48  ? 426  ASP C OD2   1 
ATOM   6884  N  N     . VAL C  2  427  ? 45.910  -22.450 70.798   1.00 14.10  ? 427  VAL C N     1 
ATOM   6885  C  CA    . VAL C  2  427  ? 47.255  -22.600 71.340   1.00 9.89   ? 427  VAL C CA    1 
ATOM   6886  C  C     . VAL C  2  427  ? 47.479  -21.836 72.643   1.00 9.86   ? 427  VAL C C     1 
ATOM   6887  O  O     . VAL C  2  427  ? 48.459  -22.082 73.345   1.00 7.46   ? 427  VAL C O     1 
ATOM   6888  C  CB    . VAL C  2  427  ? 48.311  -22.172 70.314   1.00 10.59  ? 427  VAL C CB    1 
ATOM   6889  C  CG1   . VAL C  2  427  ? 48.124  -22.958 69.030   1.00 22.74  ? 427  VAL C CG1   1 
ATOM   6890  C  CG2   . VAL C  2  427  ? 48.214  -20.680 70.041   1.00 12.68  ? 427  VAL C CG2   1 
ATOM   6891  N  N     . ARG C  2  428  ? 46.579  -20.908 72.960   1.00 12.29  ? 428  ARG C N     1 
ATOM   6892  C  CA    . ARG C  2  428  ? 46.700  -20.114 74.181   1.00 6.92   ? 428  ARG C CA    1 
ATOM   6893  C  C     . ARG C  2  428  ? 46.097  -20.862 75.349   1.00 5.20   ? 428  ARG C C     1 
ATOM   6894  O  O     . ARG C  2  428  ? 46.344  -20.530 76.500   1.00 4.28   ? 428  ARG C O     1 
ATOM   6895  C  CB    . ARG C  2  428  ? 46.005  -18.765 74.027   1.00 6.17   ? 428  ARG C CB    1 
ATOM   6896  C  CG    . ARG C  2  428  ? 46.489  -17.961 72.849   1.00 9.39   ? 428  ARG C CG    1 
ATOM   6897  C  CD    . ARG C  2  428  ? 45.708  -16.672 72.730   1.00 12.50  ? 428  ARG C CD    1 
ATOM   6898  N  NE    . ARG C  2  428  ? 46.533  -15.514 73.050   1.00 9.77   ? 428  ARG C NE    1 
ATOM   6899  C  CZ    . ARG C  2  428  ? 46.992  -14.657 72.146   1.00 11.16  ? 428  ARG C CZ    1 
ATOM   6900  N  NH1   . ARG C  2  428  ? 46.695  -14.817 70.863   1.00 17.43  ? 428  ARG C NH1   1 
ATOM   6901  N  NH2   . ARG C  2  428  ? 47.741  -13.634 72.528   1.00 11.17  ? 428  ARG C NH2   1 
ATOM   6902  N  N     . ASP C  2  429  ? 45.321  -21.892 75.034   1.00 6.08   ? 429  ASP C N     1 
ATOM   6903  C  CA    . ASP C  2  429  ? 44.616  -22.681 76.035   1.00 6.86   ? 429  ASP C CA    1 
ATOM   6904  C  C     . ASP C  2  429  ? 45.547  -23.469 76.949   1.00 5.39   ? 429  ASP C C     1 
ATOM   6905  O  O     . ASP C  2  429  ? 46.709  -23.716 76.623   1.00 4.10   ? 429  ASP C O     1 
ATOM   6906  C  CB    . ASP C  2  429  ? 43.666  -23.658 75.343   1.00 9.29   ? 429  ASP C CB    1 
ATOM   6907  C  CG    . ASP C  2  429  ? 42.224  -23.217 75.415   1.00 20.29  ? 429  ASP C CG    1 
ATOM   6908  O  OD1   . ASP C  2  429  ? 41.760  -22.914 76.538   1.00 26.59  ? 429  ASP C OD1   1 
ATOM   6909  O  OD2   . ASP C  2  429  ? 41.558  -23.172 74.354   1.00 17.76  ? 429  ASP C OD2   1 
ATOM   6910  N  N     . VAL C  2  430  ? 45.020  -23.862 78.102   1.00 4.20   ? 430  VAL C N     1 
ATOM   6911  C  CA    . VAL C  2  430  ? 45.696  -24.832 78.937   1.00 3.60   ? 430  VAL C CA    1 
ATOM   6912  C  C     . VAL C  2  430  ? 45.162  -26.178 78.482   1.00 5.09   ? 430  VAL C C     1 
ATOM   6913  O  O     . VAL C  2  430  ? 43.991  -26.481 78.682   1.00 7.28   ? 430  VAL C O     1 
ATOM   6914  C  CB    . VAL C  2  430  ? 45.339  -24.638 80.419   1.00 2.81   ? 430  VAL C CB    1 
ATOM   6915  C  CG1   . VAL C  2  430  ? 45.946  -25.731 81.264   1.00 3.20   ? 430  VAL C CG1   1 
ATOM   6916  C  CG2   . VAL C  2  430  ? 45.814  -23.300 80.896   1.00 3.05   ? 430  VAL C CG2   1 
ATOM   6917  N  N     . HIS C  2  431  ? 46.011  -26.975 77.844   1.00 4.71   ? 431  HIS C N     1 
ATOM   6918  C  CA    . HIS C  2  431  ? 45.607  -28.301 77.403   1.00 4.63   ? 431  HIS C CA    1 
ATOM   6919  C  C     . HIS C  2  431  ? 45.679  -29.240 78.595   1.00 4.88   ? 431  HIS C C     1 
ATOM   6920  O  O     . HIS C  2  431  ? 46.453  -28.995 79.521   1.00 5.20   ? 431  HIS C O     1 
ATOM   6921  C  CB    . HIS C  2  431  ? 46.508  -28.801 76.275   1.00 4.91   ? 431  HIS C CB    1 
ATOM   6922  C  CG    . HIS C  2  431  ? 45.920  -29.936 75.493   1.00 6.69   ? 431  HIS C CG    1 
ATOM   6923  N  ND1   . HIS C  2  431  ? 46.264  -31.252 75.715   1.00 4.99   ? 431  HIS C ND1   1 
ATOM   6924  C  CD2   . HIS C  2  431  ? 45.010  -29.948 74.492   1.00 7.43   ? 431  HIS C CD2   1 
ATOM   6925  C  CE1   . HIS C  2  431  ? 45.592  -32.025 74.883   1.00 5.67   ? 431  HIS C CE1   1 
ATOM   6926  N  NE2   . HIS C  2  431  ? 44.824  -31.259 74.130   1.00 6.88   ? 431  HIS C NE2   1 
ATOM   6927  N  N     . ARG C  2  432  ? 44.881  -30.306 78.582   1.00 4.02   ? 432  ARG C N     1 
ATOM   6928  C  CA    . ARG C  2  432  ? 44.876  -31.249 79.696   1.00 3.36   ? 432  ARG C CA    1 
ATOM   6929  C  C     . ARG C  2  432  ? 46.253  -31.859 79.897   1.00 2.75   ? 432  ARG C C     1 
ATOM   6930  O  O     . ARG C  2  432  ? 46.611  -32.247 81.000   1.00 4.16   ? 432  ARG C O     1 
ATOM   6931  C  CB    . ARG C  2  432  ? 43.853  -32.359 79.474   1.00 4.68   ? 432  ARG C CB    1 
ATOM   6932  C  CG    . ARG C  2  432  ? 44.178  -33.269 78.306   1.00 5.29   ? 432  ARG C CG    1 
ATOM   6933  C  CD    . ARG C  2  432  ? 43.274  -34.478 78.285   1.00 5.42   ? 432  ARG C CD    1 
ATOM   6934  N  NE    . ARG C  2  432  ? 43.504  -35.311 77.109   1.00 6.16   ? 432  ARG C NE    1 
ATOM   6935  C  CZ    . ARG C  2  432  ? 44.453  -36.239 77.028   1.00 7.14   ? 432  ARG C CZ    1 
ATOM   6936  N  NH1   . ARG C  2  432  ? 45.268  -36.445 78.055   1.00 8.14   ? 432  ARG C NH1   1 
ATOM   6937  N  NH2   . ARG C  2  432  ? 44.591  -36.953 75.920   1.00 6.40   ? 432  ARG C NH2   1 
ATOM   6938  N  N     . THR C  2  433  ? 47.032  -31.911 78.825   1.00 3.02   ? 433  THR C N     1 
ATOM   6939  C  CA    . THR C  2  433  ? 48.339  -32.544 78.849   1.00 2.50   ? 433  THR C CA    1 
ATOM   6940  C  C     . THR C  2  433  ? 49.416  -31.604 79.372   1.00 2.15   ? 433  THR C C     1 
ATOM   6941  O  O     . THR C  2  433  ? 50.590  -31.949 79.394   1.00 2.59   ? 433  THR C O     1 
ATOM   6942  C  CB    . THR C  2  433  ? 48.735  -33.063 77.453   1.00 3.45   ? 433  THR C CB    1 
ATOM   6943  O  OG1   . THR C  2  433  ? 48.797  -31.971 76.527   1.00 4.18   ? 433  THR C OG1   1 
ATOM   6944  C  CG2   . THR C  2  433  ? 47.718  -34.075 76.963   1.00 3.90   ? 433  THR C CG2   1 
ATOM   6945  N  N     . HIS C  2  434  ? 49.016  -30.407 79.776   1.00 2.27   ? 434  HIS C N     1 
ATOM   6946  C  CA    . HIS C  2  434  ? 49.950  -29.469 80.378   1.00 2.18   ? 434  HIS C CA    1 
ATOM   6947  C  C     . HIS C  2  434  ? 50.284  -29.892 81.800   1.00 2.17   ? 434  HIS C C     1 
ATOM   6948  O  O     . HIS C  2  434  ? 51.284  -29.451 82.371   1.00 2.31   ? 434  HIS C O     1 
ATOM   6949  C  CB    . HIS C  2  434  ? 49.366  -28.059 80.385   1.00 2.28   ? 434  HIS C CB    1 
ATOM   6950  C  CG    . HIS C  2  434  ? 49.414  -27.386 79.055   1.00 2.06   ? 434  HIS C CG    1 
ATOM   6951  N  ND1   . HIS C  2  434  ? 49.414  -26.017 78.914   1.00 1.93   ? 434  HIS C ND1   1 
ATOM   6952  C  CD2   . HIS C  2  434  ? 49.473  -27.894 77.803   1.00 2.62   ? 434  HIS C CD2   1 
ATOM   6953  C  CE1   . HIS C  2  434  ? 49.471  -25.710 77.632   1.00 2.11   ? 434  HIS C CE1   1 
ATOM   6954  N  NE2   . HIS C  2  434  ? 49.507  -26.830 76.936   1.00 2.01   ? 434  HIS C NE2   1 
ATOM   6955  N  N     . TYR C  2  435  ? 49.447  -30.755 82.363   1.00 1.67   ? 435  TYR C N     1 
ATOM   6956  C  CA    . TYR C  2  435  ? 49.593  -31.172 83.748   1.00 1.89   ? 435  TYR C CA    1 
ATOM   6957  C  C     . TYR C  2  435  ? 50.990  -31.752 83.985   1.00 2.28   ? 435  TYR C C     1 
ATOM   6958  O  O     . TYR C  2  435  ? 51.392  -32.723 83.346   1.00 3.69   ? 435  TYR C O     1 
ATOM   6959  C  CB    . TYR C  2  435  ? 48.518  -32.213 84.051   1.00 1.99   ? 435  TYR C CB    1 
ATOM   6960  C  CG    . TYR C  2  435  ? 48.415  -32.657 85.489   1.00 2.78   ? 435  TYR C CG    1 
ATOM   6961  C  CD1   . TYR C  2  435  ? 47.358  -32.242 86.280   1.00 2.81   ? 435  TYR C CD1   1 
ATOM   6962  C  CD2   . TYR C  2  435  ? 49.354  -33.518 86.047   1.00 3.70   ? 435  TYR C CD2   1 
ATOM   6963  C  CE1   . TYR C  2  435  ? 47.247  -32.655 87.584   1.00 3.29   ? 435  TYR C CE1   1 
ATOM   6964  C  CE2   . TYR C  2  435  ? 49.253  -33.932 87.349   1.00 3.53   ? 435  TYR C CE2   1 
ATOM   6965  C  CZ    . TYR C  2  435  ? 48.196  -33.498 88.113   1.00 4.36   ? 435  TYR C CZ    1 
ATOM   6966  O  OH    . TYR C  2  435  ? 48.082  -33.907 89.417   1.00 9.71   ? 435  TYR C OH    1 
ATOM   6967  N  N     . GLY C  2  436  ? 51.724  -31.165 84.920   1.00 1.88   ? 436  GLY C N     1 
ATOM   6968  C  CA    . GLY C  2  436  ? 53.071  -31.621 85.210   1.00 2.50   ? 436  GLY C CA    1 
ATOM   6969  C  C     . GLY C  2  436  ? 54.133  -31.252 84.187   1.00 2.28   ? 436  GLY C C     1 
ATOM   6970  O  O     . GLY C  2  436  ? 55.302  -31.612 84.348   1.00 1.62   ? 436  GLY C O     1 
ATOM   6971  N  N     . ARG C  2  437  ? 53.736  -30.530 83.143   1.00 1.79   ? 437  ARG C N     1 
ATOM   6972  C  CA    . ARG C  2  437  ? 54.650  -30.169 82.059   1.00 1.87   ? 437  ARG C CA    1 
ATOM   6973  C  C     . ARG C  2  437  ? 54.815  -28.661 81.907   1.00 2.49   ? 437  ARG C C     1 
ATOM   6974  O  O     . ARG C  2  437  ? 55.923  -28.133 81.976   1.00 2.67   ? 437  ARG C O     1 
ATOM   6975  C  CB    . ARG C  2  437  ? 54.200  -30.783 80.739   1.00 1.88   ? 437  ARG C CB    1 
ATOM   6976  C  CG    . ARG C  2  437  ? 54.509  -32.243 80.634   1.00 2.10   ? 437  ARG C CG    1 
ATOM   6977  C  CD    . ARG C  2  437  ? 53.795  -32.870 79.474   1.00 2.36   ? 437  ARG C CD    1 
ATOM   6978  N  NE    . ARG C  2  437  ? 53.911  -34.322 79.519   1.00 3.86   ? 437  ARG C NE    1 
ATOM   6979  C  CZ    . ARG C  2  437  ? 53.135  -35.102 80.264   1.00 4.77   ? 437  ARG C CZ    1 
ATOM   6980  N  NH1   . ARG C  2  437  ? 52.196  -34.567 81.029   1.00 5.52   ? 437  ARG C NH1   1 
ATOM   6981  N  NH2   . ARG C  2  437  ? 53.300  -36.412 80.252   1.00 5.46   ? 437  ARG C NH2   1 
ATOM   6982  N  N     . ILE C  2  438  ? 53.712  -27.977 81.636   1.00 2.72   ? 438  ILE C N     1 
ATOM   6983  C  CA    . ILE C  2  438  ? 53.734  -26.530 81.513   1.00 1.83   ? 438  ILE C CA    1 
ATOM   6984  C  C     . ILE C  2  438  ? 52.815  -25.933 82.559   1.00 1.23   ? 438  ILE C C     1 
ATOM   6985  O  O     . ILE C  2  438  ? 51.693  -26.388 82.718   1.00 1.53   ? 438  ILE C O     1 
ATOM   6986  C  CB    . ILE C  2  438  ? 53.267  -26.100 80.128   1.00 1.64   ? 438  ILE C CB    1 
ATOM   6987  C  CG1   . ILE C  2  438  ? 54.113  -26.785 79.056   1.00 1.94   ? 438  ILE C CG1   1 
ATOM   6988  C  CG2   . ILE C  2  438  ? 53.381  -24.613 79.992   1.00 2.03   ? 438  ILE C CG2   1 
ATOM   6989  C  CD1   . ILE C  2  438  ? 53.722  -26.425 77.638   1.00 2.65   ? 438  ILE C CD1   1 
ATOM   6990  N  N     . CYS C  2  439  ? 53.284  -24.916 83.274   1.00 1.11   ? 439  CYS C N     1 
ATOM   6991  C  CA    . CYS C  2  439  ? 52.494  -24.333 84.359   1.00 1.04   ? 439  CYS C CA    1 
ATOM   6992  C  C     . CYS C  2  439  ? 51.222  -23.630 83.879   1.00 1.14   ? 439  CYS C C     1 
ATOM   6993  O  O     . CYS C  2  439  ? 51.290  -22.708 83.070   1.00 1.56   ? 439  CYS C O     1 
ATOM   6994  C  CB    . CYS C  2  439  ? 53.337  -23.369 85.183   1.00 0.88   ? 439  CYS C CB    1 
ATOM   6995  S  SG    . CYS C  2  439  ? 52.404  -22.555 86.489   1.00 0.66   ? 439  CYS C SG    1 
ATOM   6996  N  N     . PRO C  2  440  ? 50.058  -24.058 84.399   1.00 0.83   ? 440  PRO C N     1 
ATOM   6997  C  CA    . PRO C  2  440  ? 48.743  -23.538 84.020   1.00 0.96   ? 440  PRO C CA    1 
ATOM   6998  C  C     . PRO C  2  440  ? 48.540  -22.113 84.514   1.00 0.94   ? 440  PRO C C     1 
ATOM   6999  O  O     . PRO C  2  440  ? 47.644  -21.417 84.049   1.00 1.32   ? 440  PRO C O     1 
ATOM   7000  C  CB    . PRO C  2  440  ? 47.788  -24.477 84.752   1.00 0.84   ? 440  PRO C CB    1 
ATOM   7001  C  CG    . PRO C  2  440  ? 48.526  -24.862 85.964   1.00 0.60   ? 440  PRO C CG    1 
ATOM   7002  C  CD    . PRO C  2  440  ? 49.958  -24.990 85.535   1.00 0.85   ? 440  PRO C CD    1 
ATOM   7003  N  N     . VAL C  2  441  ? 49.365  -21.696 85.464   1.00 0.93   ? 441  VAL C N     1 
ATOM   7004  C  CA    . VAL C  2  441  ? 49.244  -20.382 86.079   1.00 0.95   ? 441  VAL C CA    1 
ATOM   7005  C  C     . VAL C  2  441  ? 50.154  -19.346 85.435   1.00 1.34   ? 441  VAL C C     1 
ATOM   7006  O  O     . VAL C  2  441  ? 49.678  -18.333 84.932   1.00 1.69   ? 441  VAL C O     1 
ATOM   7007  C  CB    . VAL C  2  441  ? 49.486  -20.417 87.597   1.00 0.68   ? 441  VAL C CB    1 
ATOM   7008  C  CG1   . VAL C  2  441  ? 49.632  -19.017 88.127   1.00 0.54   ? 441  VAL C CG1   1 
ATOM   7009  C  CG2   . VAL C  2  441  ? 48.337  -21.110 88.292   1.00 0.78   ? 441  VAL C CG2   1 
ATOM   7010  N  N     . GLU C  2  442  ? 51.463  -19.583 85.455   1.00 1.42   ? 442  GLU C N     1 
ATOM   7011  C  CA    . GLU C  2  442  ? 52.377  -18.505 85.131   1.00 1.86   ? 442  GLU C CA    1 
ATOM   7012  C  C     . GLU C  2  442  ? 52.409  -18.293 83.626   1.00 2.87   ? 442  GLU C C     1 
ATOM   7013  O  O     . GLU C  2  442  ? 52.966  -19.087 82.870   1.00 4.07   ? 442  GLU C O     1 
ATOM   7014  C  CB    . GLU C  2  442  ? 53.773  -18.877 85.622   1.00 1.60   ? 442  GLU C CB    1 
ATOM   7015  C  CG    . GLU C  2  442  ? 54.716  -17.716 85.754   1.00 2.99   ? 442  GLU C CG    1 
ATOM   7016  C  CD    . GLU C  2  442  ? 56.160  -18.141 85.609   1.00 5.28   ? 442  GLU C CD    1 
ATOM   7017  O  OE1   . GLU C  2  442  ? 56.767  -18.589 86.607   1.00 4.13   ? 442  GLU C OE1   1 
ATOM   7018  O  OE2   . GLU C  2  442  ? 56.684  -18.036 84.481   1.00 7.34   ? 442  GLU C OE2   1 
ATOM   7019  N  N     . THR C  2  443  ? 51.812  -17.179 83.222   1.00 3.46   ? 443  THR C N     1 
ATOM   7020  C  CA    . THR C  2  443  ? 51.751  -16.725 81.841   1.00 2.93   ? 443  THR C CA    1 
ATOM   7021  C  C     . THR C  2  443  ? 51.617  -15.199 81.926   1.00 3.06   ? 443  THR C C     1 
ATOM   7022  O  O     . THR C  2  443  ? 51.184  -14.679 82.952   1.00 2.87   ? 443  THR C O     1 
ATOM   7023  C  CB    . THR C  2  443  ? 50.579  -17.413 81.081   1.00 2.04   ? 443  THR C CB    1 
ATOM   7024  O  OG1   . THR C  2  443  ? 50.442  -16.875 79.761   1.00 2.00   ? 443  THR C OG1   1 
ATOM   7025  C  CG2   . THR C  2  443  ? 49.274  -17.255 81.827   1.00 1.97   ? 443  THR C CG2   1 
ATOM   7026  N  N     . PRO C  2  444  ? 52.013  -14.471 80.878   1.00 2.60   ? 444  PRO C N     1 
ATOM   7027  C  CA    . PRO C  2  444  ? 51.780  -13.028 80.921   1.00 2.05   ? 444  PRO C CA    1 
ATOM   7028  C  C     . PRO C  2  444  ? 50.297  -12.707 80.827   1.00 3.28   ? 444  PRO C C     1 
ATOM   7029  O  O     . PRO C  2  444  ? 49.591  -13.366 80.078   1.00 4.09   ? 444  PRO C O     1 
ATOM   7030  C  CB    . PRO C  2  444  ? 52.462  -12.536 79.650   1.00 2.76   ? 444  PRO C CB    1 
ATOM   7031  C  CG    . PRO C  2  444  ? 53.423  -13.590 79.285   1.00 2.42   ? 444  PRO C CG    1 
ATOM   7032  C  CD    . PRO C  2  444  ? 52.813  -14.866 79.711   1.00 2.74   ? 444  PRO C CD    1 
ATOM   7033  N  N     . GLU C  2  445  ? 49.823  -11.711 81.569   1.00 6.48   ? 445  GLU C N     1 
ATOM   7034  C  CA    . GLU C  2  445  ? 48.467  -11.200 81.358   1.00 6.71   ? 445  GLU C CA    1 
ATOM   7035  C  C     . GLU C  2  445  ? 48.473  -10.233 80.172   1.00 8.38   ? 445  GLU C C     1 
ATOM   7036  O  O     . GLU C  2  445  ? 49.464  -9.533  79.933   1.00 10.31  ? 445  GLU C O     1 
ATOM   7037  C  CB    . GLU C  2  445  ? 47.920  -10.527 82.619   1.00 6.30   ? 445  GLU C CB    1 
ATOM   7038  C  CG    . GLU C  2  445  ? 48.942  -9.699  83.399   1.00 17.71  ? 445  GLU C CG    1 
ATOM   7039  C  CD    . GLU C  2  445  ? 48.324  -8.964  84.591   1.00 29.17  ? 445  GLU C CD    1 
ATOM   7040  O  OE1   . GLU C  2  445  ? 47.098  -8.717  84.575   1.00 28.81  ? 445  GLU C OE1   1 
ATOM   7041  O  OE2   . GLU C  2  445  ? 49.064  -8.634  85.547   1.00 32.65  ? 445  GLU C OE2   1 
ATOM   7042  N  N     . GLY C  2  446  ? 47.384  -10.197 79.416   1.00 3.94   ? 446  GLY C N     1 
ATOM   7043  C  CA    . GLY C  2  446  ? 47.356  -9.355  78.236   1.00 4.40   ? 446  GLY C CA    1 
ATOM   7044  C  C     . GLY C  2  446  ? 47.635  -10.081 76.937   1.00 5.53   ? 446  GLY C C     1 
ATOM   7045  O  O     . GLY C  2  446  ? 47.471  -11.291 76.851   1.00 8.36   ? 446  GLY C O     1 
ATOM   7046  N  N     . ALA C  2  447  ? 48.048  -9.331  75.921   1.00 6.45   ? 447  ALA C N     1 
ATOM   7047  C  CA    . ALA C  2  447  ? 48.131  -9.831  74.548   1.00 5.37   ? 447  ALA C CA    1 
ATOM   7048  C  C     . ALA C  2  447  ? 48.974  -11.089 74.352   1.00 5.10   ? 447  ALA C C     1 
ATOM   7049  O  O     . ALA C  2  447  ? 48.781  -11.826 73.390   1.00 7.51   ? 447  ALA C O     1 
ATOM   7050  C  CB    . ALA C  2  447  ? 48.608  -8.721  73.616   1.00 7.14   ? 447  ALA C CB    1 
ATOM   7051  N  N     . ASN C  2  448  ? 49.917  -11.331 75.251   1.00 6.31   ? 448  ASN C N     1 
ATOM   7052  C  CA    . ASN C  2  448  ? 50.743  -12.533 75.163   1.00 7.37   ? 448  ASN C CA    1 
ATOM   7053  C  C     . ASN C  2  448  ? 50.230  -13.726 75.972   1.00 5.78   ? 448  ASN C C     1 
ATOM   7054  O  O     . ASN C  2  448  ? 50.919  -14.737 76.072   1.00 5.14   ? 448  ASN C O     1 
ATOM   7055  C  CB    . ASN C  2  448  ? 52.193  -12.236 75.550   1.00 7.63   ? 448  ASN C CB    1 
ATOM   7056  C  CG    . ASN C  2  448  ? 52.977  -11.606 74.426   1.00 14.05  ? 448  ASN C CG    1 
ATOM   7057  O  OD1   . ASN C  2  448  ? 52.576  -11.659 73.261   1.00 14.90  ? 448  ASN C OD1   1 
ATOM   7058  N  ND2   . ASN C  2  448  ? 54.111  -11.009 74.765   1.00 21.51  ? 448  ASN C ND2   1 
ATOM   7059  N  N     . ILE C  2  449  ? 49.044  -13.603 76.567   1.00 4.79   ? 449  ILE C N     1 
ATOM   7060  C  CA    . ILE C  2  449  ? 48.527  -14.665 77.423   1.00 4.02   ? 449  ILE C CA    1 
ATOM   7061  C  C     . ILE C  2  449  ? 48.470  -16.005 76.696   1.00 4.66   ? 449  ILE C C     1 
ATOM   7062  O  O     . ILE C  2  449  ? 47.924  -16.110 75.600   1.00 5.84   ? 449  ILE C O     1 
ATOM   7063  C  CB    . ILE C  2  449  ? 47.150  -14.316 78.055   1.00 4.75   ? 449  ILE C CB    1 
ATOM   7064  C  CG1   . ILE C  2  449  ? 46.756  -15.378 79.082   1.00 4.65   ? 449  ILE C CG1   1 
ATOM   7065  C  CG2   . ILE C  2  449  ? 46.067  -14.176 76.994   1.00 4.61   ? 449  ILE C CG2   1 
ATOM   7066  C  CD1   . ILE C  2  449  ? 45.620  -14.969 79.984   1.00 3.73   ? 449  ILE C CD1   1 
ATOM   7067  N  N     . GLY C  2  450  ? 49.086  -17.016 77.299   1.00 3.91   ? 450  GLY C N     1 
ATOM   7068  C  CA    . GLY C  2  450  ? 49.104  -18.346 76.724   1.00 4.51   ? 450  GLY C CA    1 
ATOM   7069  C  C     . GLY C  2  450  ? 50.168  -18.579 75.666   1.00 5.19   ? 450  GLY C C     1 
ATOM   7070  O  O     . GLY C  2  450  ? 50.464  -19.725 75.342   1.00 7.12   ? 450  GLY C O     1 
ATOM   7071  N  N     . LEU C  2  451  ? 50.722  -17.508 75.101   1.00 5.54   ? 451  LEU C N     1 
ATOM   7072  C  CA    . LEU C  2  451  ? 51.823  -17.635 74.136   1.00 5.84   ? 451  LEU C CA    1 
ATOM   7073  C  C     . LEU C  2  451  ? 53.210  -17.771 74.773   1.00 4.49   ? 451  LEU C C     1 
ATOM   7074  O  O     . LEU C  2  451  ? 54.103  -18.416 74.220   1.00 5.02   ? 451  LEU C O     1 
ATOM   7075  C  CB    . LEU C  2  451  ? 51.800  -16.500 73.120   1.00 5.47   ? 451  LEU C CB    1 
ATOM   7076  C  CG    . LEU C  2  451  ? 50.524  -16.468 72.288   1.00 5.63   ? 451  LEU C CG    1 
ATOM   7077  C  CD1   . LEU C  2  451  ? 50.757  -15.629 71.062   1.00 9.59   ? 451  LEU C CD1   1 
ATOM   7078  C  CD2   . LEU C  2  451  ? 50.084  -17.870 71.910   1.00 6.40   ? 451  LEU C CD2   1 
ATOM   7079  N  N     . ILE C  2  452  ? 53.390  -17.135 75.922   1.00 2.97   ? 452  ILE C N     1 
ATOM   7080  C  CA    . ILE C  2  452  ? 54.580  -17.336 76.728   1.00 3.26   ? 452  ILE C CA    1 
ATOM   7081  C  C     . ILE C  2  452  ? 54.161  -18.117 77.959   1.00 3.96   ? 452  ILE C C     1 
ATOM   7082  O  O     . ILE C  2  452  ? 53.199  -17.752 78.630   1.00 5.01   ? 452  ILE C O     1 
ATOM   7083  C  CB    . ILE C  2  452  ? 55.199  -16.010 77.189   1.00 2.72   ? 452  ILE C CB    1 
ATOM   7084  C  CG1   . ILE C  2  452  ? 55.372  -15.055 76.009   1.00 3.30   ? 452  ILE C CG1   1 
ATOM   7085  C  CG2   . ILE C  2  452  ? 56.515  -16.264 77.890   1.00 2.79   ? 452  ILE C CG2   1 
ATOM   7086  C  CD1   . ILE C  2  452  ? 56.286  -15.577 74.941   1.00 4.87   ? 452  ILE C CD1   1 
ATOM   7087  N  N     . THR C  2  453  ? 54.873  -19.197 78.252   1.00 4.02   ? 453  THR C N     1 
ATOM   7088  C  CA    . THR C  2  453  ? 54.529  -20.055 79.378   1.00 4.20   ? 453  THR C CA    1 
ATOM   7089  C  C     . THR C  2  453  ? 55.784  -20.456 80.135   1.00 3.03   ? 453  THR C C     1 
ATOM   7090  O  O     . THR C  2  453  ? 56.885  -20.058 79.771   1.00 3.19   ? 453  THR C O     1 
ATOM   7091  C  CB    . THR C  2  453  ? 53.818  -21.326 78.905   1.00 5.72   ? 453  THR C CB    1 
ATOM   7092  O  OG1   . THR C  2  453  ? 54.600  -21.943 77.876   1.00 7.94   ? 453  THR C OG1   1 
ATOM   7093  C  CG2   . THR C  2  453  ? 52.424  -21.010 78.355   1.00 4.81   ? 453  THR C CG2   1 
ATOM   7094  N  N     . SER C  2  454  ? 55.629  -21.243 81.190   1.00 2.61   ? 454  SER C N     1 
ATOM   7095  C  CA    . SER C  2  454  ? 56.800  -21.668 81.935   1.00 2.29   ? 454  SER C CA    1 
ATOM   7096  C  C     . SER C  2  454  ? 56.841  -23.168 82.183   1.00 2.25   ? 454  SER C C     1 
ATOM   7097  O  O     . SER C  2  454  ? 55.816  -23.802 82.442   1.00 2.14   ? 454  SER C O     1 
ATOM   7098  C  CB    . SER C  2  454  ? 56.921  -20.903 83.247   1.00 2.93   ? 454  SER C CB    1 
ATOM   7099  O  OG    . SER C  2  454  ? 58.263  -20.489 83.458   1.00 4.58   ? 454  SER C OG    1 
ATOM   7100  N  N     . LEU C  2  455  ? 58.047  -23.718 82.090   1.00 1.76   ? 455  LEU C N     1 
ATOM   7101  C  CA    . LEU C  2  455  ? 58.299  -25.124 82.342   1.00 1.10   ? 455  LEU C CA    1 
ATOM   7102  C  C     . LEU C  2  455  ? 57.947  -25.452 83.778   1.00 0.85   ? 455  LEU C C     1 
ATOM   7103  O  O     . LEU C  2  455  ? 58.331  -24.728 84.694   1.00 0.94   ? 455  LEU C O     1 
ATOM   7104  C  CB    . LEU C  2  455  ? 59.775  -25.413 82.108   1.00 1.28   ? 455  LEU C CB    1 
ATOM   7105  C  CG    . LEU C  2  455  ? 60.245  -26.862 82.157   1.00 1.64   ? 455  LEU C CG    1 
ATOM   7106  C  CD1   . LEU C  2  455  ? 59.663  -27.645 80.980   1.00 1.70   ? 455  LEU C CD1   1 
ATOM   7107  C  CD2   . LEU C  2  455  ? 61.762  -26.901 82.147   1.00 1.18   ? 455  LEU C CD2   1 
ATOM   7108  N  N     . ALA C  2  456  ? 57.215  -26.540 83.973   1.00 0.73   ? 456  ALA C N     1 
ATOM   7109  C  CA    . ALA C  2  456  ? 56.809  -26.958 85.307   1.00 0.78   ? 456  ALA C CA    1 
ATOM   7110  C  C     . ALA C  2  456  ? 58.004  -27.443 86.130   1.00 1.09   ? 456  ALA C C     1 
ATOM   7111  O  O     . ALA C  2  456  ? 59.025  -27.843 85.578   1.00 1.38   ? 456  ALA C O     1 
ATOM   7112  C  CB    . ALA C  2  456  ? 55.742  -28.024 85.221   1.00 0.99   ? 456  ALA C CB    1 
ATOM   7113  N  N     . ALA C  2  457  ? 57.869  -27.407 87.450   1.00 1.05   ? 457  ALA C N     1 
ATOM   7114  C  CA    . ALA C  2  457  ? 59.009  -27.592 88.342   1.00 1.22   ? 457  ALA C CA    1 
ATOM   7115  C  C     . ALA C  2  457  ? 59.746  -28.929 88.178   1.00 2.10   ? 457  ALA C C     1 
ATOM   7116  O  O     . ALA C  2  457  ? 60.980  -28.969 88.178   1.00 1.55   ? 457  ALA C O     1 
ATOM   7117  C  CB    . ALA C  2  457  ? 58.583  -27.376 89.783   1.00 1.07   ? 457  ALA C CB    1 
ATOM   7118  N  N     . TYR C  2  458  ? 58.990  -30.018 88.044   1.00 3.46   ? 458  TYR C N     1 
ATOM   7119  C  CA    . TYR C  2  458  ? 59.588  -31.347 87.900   1.00 3.52   ? 458  TYR C CA    1 
ATOM   7120  C  C     . TYR C  2  458  ? 59.759  -31.782 86.448   1.00 3.03   ? 458  TYR C C     1 
ATOM   7121  O  O     . TYR C  2  458  ? 60.362  -32.818 86.183   1.00 4.53   ? 458  TYR C O     1 
ATOM   7122  C  CB    . TYR C  2  458  ? 58.759  -32.397 88.641   1.00 4.25   ? 458  TYR C CB    1 
ATOM   7123  C  CG    . TYR C  2  458  ? 59.094  -32.531 90.103   1.00 4.55   ? 458  TYR C CG    1 
ATOM   7124  C  CD1   . TYR C  2  458  ? 58.308  -31.926 91.078   1.00 3.73   ? 458  TYR C CD1   1 
ATOM   7125  C  CD2   . TYR C  2  458  ? 60.197  -33.269 90.513   1.00 6.93   ? 458  TYR C CD2   1 
ATOM   7126  C  CE1   . TYR C  2  458  ? 58.616  -32.051 92.421   1.00 4.76   ? 458  TYR C CE1   1 
ATOM   7127  C  CE2   . TYR C  2  458  ? 60.515  -33.400 91.853   1.00 6.06   ? 458  TYR C CE2   1 
ATOM   7128  C  CZ    . TYR C  2  458  ? 59.722  -32.790 92.799   1.00 6.76   ? 458  TYR C CZ    1 
ATOM   7129  O  OH    . TYR C  2  458  ? 60.042  -32.920 94.127   1.00 11.99  ? 458  TYR C OH    1 
ATOM   7130  N  N     . ALA C  2  459  ? 59.245  -30.986 85.516   1.00 1.71   ? 459  ALA C N     1 
ATOM   7131  C  CA    . ALA C  2  459  ? 59.274  -31.338 84.099   1.00 1.77   ? 459  ALA C CA    1 
ATOM   7132  C  C     . ALA C  2  459  ? 60.674  -31.376 83.474   1.00 2.14   ? 459  ALA C C     1 
ATOM   7133  O  O     . ALA C  2  459  ? 61.571  -30.631 83.875   1.00 1.80   ? 459  ALA C O     1 
ATOM   7134  C  CB    . ALA C  2  459  ? 58.380  -30.400 83.315   1.00 1.67   ? 459  ALA C CB    1 
ATOM   7135  N  N     . ARG C  2  460  ? 60.840  -32.248 82.479   1.00 2.27   ? 460  ARG C N     1 
ATOM   7136  C  CA    . ARG C  2  460  ? 62.076  -32.333 81.706   1.00 2.37   ? 460  ARG C CA    1 
ATOM   7137  C  C     . ARG C  2  460  ? 61.791  -32.428 80.223   1.00 2.73   ? 460  ARG C C     1 
ATOM   7138  O  O     . ARG C  2  460  ? 60.884  -33.141 79.801   1.00 3.23   ? 460  ARG C O     1 
ATOM   7139  C  CB    . ARG C  2  460  ? 62.870  -33.571 82.087   1.00 4.72   ? 460  ARG C CB    1 
ATOM   7140  C  CG    . ARG C  2  460  ? 63.408  -33.583 83.484   1.00 8.87   ? 460  ARG C CG    1 
ATOM   7141  C  CD    . ARG C  2  460  ? 64.617  -34.492 83.530   1.00 19.59  ? 460  ARG C CD    1 
ATOM   7142  N  NE    . ARG C  2  460  ? 65.023  -34.781 84.898   1.00 37.83  ? 460  ARG C NE    1 
ATOM   7143  C  CZ    . ARG C  2  460  ? 66.199  -35.302 85.224   1.00 36.55  ? 460  ARG C CZ    1 
ATOM   7144  N  NH1   . ARG C  2  460  ? 67.082  -35.577 84.272   1.00 33.35  ? 460  ARG C NH1   1 
ATOM   7145  N  NH2   . ARG C  2  460  ? 66.490  -35.537 86.499   1.00 39.37  ? 460  ARG C NH2   1 
ATOM   7146  N  N     . VAL C  2  461  ? 62.579  -31.723 79.427   1.00 3.01   ? 461  VAL C N     1 
ATOM   7147  C  CA    . VAL C  2  461  ? 62.494  -31.860 77.983   1.00 4.23   ? 461  VAL C CA    1 
ATOM   7148  C  C     . VAL C  2  461  ? 63.431  -32.974 77.542   1.00 6.57   ? 461  VAL C C     1 
ATOM   7149  O  O     . VAL C  2  461  ? 64.641  -32.904 77.790   1.00 7.98   ? 461  VAL C O     1 
ATOM   7150  C  CB    . VAL C  2  461  ? 62.922  -30.575 77.276   1.00 3.58   ? 461  VAL C CB    1 
ATOM   7151  C  CG1   . VAL C  2  461  ? 62.769  -30.738 75.767   1.00 2.96   ? 461  VAL C CG1   1 
ATOM   7152  C  CG2   . VAL C  2  461  ? 62.116  -29.393 77.797   1.00 2.92   ? 461  VAL C CG2   1 
ATOM   7153  N  N     . ASP C  2  462  ? 62.884  -33.993 76.883   1.00 4.60   ? 462  ASP C N     1 
ATOM   7154  C  CA    . ASP C  2  462  ? 63.689  -35.150 76.505   1.00 5.53   ? 462  ASP C CA    1 
ATOM   7155  C  C     . ASP C  2  462  ? 64.495  -34.983 75.207   1.00 7.80   ? 462  ASP C C     1 
ATOM   7156  O  O     . ASP C  2  462  ? 64.539  -33.898 74.622   1.00 7.91   ? 462  ASP C O     1 
ATOM   7157  C  CB    . ASP C  2  462  ? 62.844  -36.424 76.479   1.00 4.64   ? 462  ASP C CB    1 
ATOM   7158  C  CG    . ASP C  2  462  ? 61.821  -36.439 75.358   1.00 7.38   ? 462  ASP C CG    1 
ATOM   7159  O  OD1   . ASP C  2  462  ? 62.067  -35.852 74.283   1.00 6.13   ? 462  ASP C OD1   1 
ATOM   7160  O  OD2   . ASP C  2  462  ? 60.759  -37.075 75.550   1.00 13.22  ? 462  ASP C OD2   1 
ATOM   7161  N  N     . GLU C  2  463  ? 65.116  -36.073 74.761   1.00 9.74   ? 463  GLU C N     1 
ATOM   7162  C  CA    . GLU C  2  463  ? 66.033  -36.031 73.626   1.00 11.11  ? 463  GLU C CA    1 
ATOM   7163  C  C     . GLU C  2  463  ? 65.302  -35.682 72.343   1.00 8.00   ? 463  GLU C C     1 
ATOM   7164  O  O     . GLU C  2  463  ? 65.885  -35.118 71.419   1.00 9.66   ? 463  GLU C O     1 
ATOM   7165  C  CB    . GLU C  2  463  ? 66.769  -37.366 73.470   1.00 19.58  ? 463  GLU C CB    1 
ATOM   7166  C  CG    . GLU C  2  463  ? 67.453  -37.855 74.749   1.00 37.31  ? 463  GLU C CG    1 
ATOM   7167  C  CD    . GLU C  2  463  ? 68.477  -38.957 74.495   1.00 64.29  ? 463  GLU C CD    1 
ATOM   7168  O  OE1   . GLU C  2  463  ? 68.761  -39.737 75.433   1.00 51.51  ? 463  GLU C OE1   1 
ATOM   7169  O  OE2   . GLU C  2  463  ? 69.006  -39.035 73.362   1.00 64.37  ? 463  GLU C OE2   1 
ATOM   7170  N  N     . LEU C  2  464  ? 64.019  -36.015 72.298   1.00 7.66   ? 464  LEU C N     1 
ATOM   7171  C  CA    . LEU C  2  464  ? 63.202  -35.752 71.123   1.00 8.04   ? 464  LEU C CA    1 
ATOM   7172  C  C     . LEU C  2  464  ? 62.508  -34.390 71.185   1.00 7.70   ? 464  LEU C C     1 
ATOM   7173  O  O     . LEU C  2  464  ? 61.872  -33.963 70.221   1.00 6.78   ? 464  LEU C O     1 
ATOM   7174  C  CB    . LEU C  2  464  ? 62.179  -36.869 70.934   1.00 7.80   ? 464  LEU C CB    1 
ATOM   7175  C  CG    . LEU C  2  464  ? 62.504  -37.850 69.809   1.00 9.42   ? 464  LEU C CG    1 
ATOM   7176  C  CD1   . LEU C  2  464  ? 63.951  -38.288 69.900   1.00 11.81  ? 464  LEU C CD1   1 
ATOM   7177  C  CD2   . LEU C  2  464  ? 61.559  -39.044 69.833   1.00 11.97  ? 464  LEU C CD2   1 
ATOM   7178  N  N     . GLY C  2  465  ? 62.631  -33.717 72.326   1.00 7.96   ? 465  GLY C N     1 
ATOM   7179  C  CA    . GLY C  2  465  ? 62.060  -32.393 72.503   1.00 5.96   ? 465  GLY C CA    1 
ATOM   7180  C  C     . GLY C  2  465  ? 60.667  -32.350 73.109   1.00 4.04   ? 465  GLY C C     1 
ATOM   7181  O  O     . GLY C  2  465  ? 60.009  -31.315 73.067   1.00 3.90   ? 465  GLY C O     1 
ATOM   7182  N  N     . PHE C  2  466  ? 60.217  -33.469 73.665   1.00 3.32   ? 466  PHE C N     1 
ATOM   7183  C  CA    . PHE C  2  466  ? 58.923  -33.538 74.330   1.00 2.75   ? 466  PHE C CA    1 
ATOM   7184  C  C     . PHE C  2  466  ? 59.090  -33.329 75.832   1.00 3.52   ? 466  PHE C C     1 
ATOM   7185  O  O     . PHE C  2  466  ? 60.112  -33.693 76.407   1.00 5.47   ? 466  PHE C O     1 
ATOM   7186  C  CB    . PHE C  2  466  ? 58.239  -34.874 74.036   1.00 3.90   ? 466  PHE C CB    1 
ATOM   7187  C  CG    . PHE C  2  466  ? 58.019  -35.128 72.574   1.00 4.65   ? 466  PHE C CG    1 
ATOM   7188  C  CD1   . PHE C  2  466  ? 58.954  -35.825 71.828   1.00 7.79   ? 466  PHE C CD1   1 
ATOM   7189  C  CD2   . PHE C  2  466  ? 56.888  -34.659 71.938   1.00 4.33   ? 466  PHE C CD2   1 
ATOM   7190  C  CE1   . PHE C  2  466  ? 58.761  -36.055 70.474   1.00 6.64   ? 466  PHE C CE1   1 
ATOM   7191  C  CE2   . PHE C  2  466  ? 56.695  -34.881 70.588   1.00 5.84   ? 466  PHE C CE2   1 
ATOM   7192  C  CZ    . PHE C  2  466  ? 57.630  -35.585 69.856   1.00 6.37   ? 466  PHE C CZ    1 
ATOM   7193  N  N     . ILE C  2  467  ? 58.111  -32.704 76.470   1.00 3.11   ? 467  ILE C N     1 
ATOM   7194  C  CA    . ILE C  2  467  ? 58.224  -32.430 77.897   1.00 3.18   ? 467  ILE C CA    1 
ATOM   7195  C  C     . ILE C  2  467  ? 57.725  -33.623 78.708   1.00 3.14   ? 467  ILE C C     1 
ATOM   7196  O  O     . ILE C  2  467  ? 56.624  -34.130 78.474   1.00 2.66   ? 467  ILE C O     1 
ATOM   7197  C  CB    . ILE C  2  467  ? 57.462  -31.147 78.293   1.00 1.99   ? 467  ILE C CB    1 
ATOM   7198  C  CG1   . ILE C  2  467  ? 57.865  -29.996 77.378   1.00 1.56   ? 467  ILE C CG1   1 
ATOM   7199  C  CG2   . ILE C  2  467  ? 57.733  -30.777 79.737   1.00 1.53   ? 467  ILE C CG2   1 
ATOM   7200  C  CD1   . ILE C  2  467  ? 57.023  -28.767 77.557   1.00 1.67   ? 467  ILE C CD1   1 
ATOM   7201  N  N     . ARG C  2  468  ? 58.544  -34.075 79.654   1.00 2.68   ? 468  ARG C N     1 
ATOM   7202  C  CA    . ARG C  2  468  ? 58.190  -35.233 80.462   1.00 2.99   ? 468  ARG C CA    1 
ATOM   7203  C  C     . ARG C  2  468  ? 58.017  -34.887 81.928   1.00 2.85   ? 468  ARG C C     1 
ATOM   7204  O  O     . ARG C  2  468  ? 58.744  -34.059 82.469   1.00 2.48   ? 468  ARG C O     1 
ATOM   7205  C  CB    . ARG C  2  468  ? 59.225  -36.345 80.303   1.00 2.75   ? 468  ARG C CB    1 
ATOM   7206  C  CG    . ARG C  2  468  ? 59.255  -36.951 78.922   1.00 3.81   ? 468  ARG C CG    1 
ATOM   7207  C  CD    . ARG C  2  468  ? 60.517  -37.760 78.704   1.00 6.13   ? 468  ARG C CD    1 
ATOM   7208  N  NE    . ARG C  2  468  ? 60.282  -39.194 78.821   1.00 8.02   ? 468  ARG C NE    1 
ATOM   7209  C  CZ    . ARG C  2  468  ? 60.562  -40.077 77.868   1.00 8.12   ? 468  ARG C CZ    1 
ATOM   7210  N  NH1   . ARG C  2  468  ? 61.096  -39.682 76.721   1.00 5.44   ? 468  ARG C NH1   1 
ATOM   7211  N  NH2   . ARG C  2  468  ? 60.311  -41.361 78.068   1.00 20.29  ? 468  ARG C NH2   1 
ATOM   7212  N  N     . THR C  2  469  ? 57.046  -35.536 82.562   1.00 3.03   ? 469  THR C N     1 
ATOM   7213  C  CA    . THR C  2  469  ? 56.794  -35.370 83.985   1.00 3.50   ? 469  THR C CA    1 
ATOM   7214  C  C     . THR C  2  469  ? 56.951  -36.720 84.669   1.00 4.18   ? 469  THR C C     1 
ATOM   7215  O  O     . THR C  2  469  ? 56.587  -37.748 84.104   1.00 4.41   ? 469  THR C O     1 
ATOM   7216  C  CB    . THR C  2  469  ? 55.370  -34.822 84.248   1.00 4.50   ? 469  THR C CB    1 
ATOM   7217  O  OG1   . THR C  2  469  ? 55.049  -34.942 85.637   1.00 4.45   ? 469  THR C OG1   1 
ATOM   7218  C  CG2   . THR C  2  469  ? 54.330  -35.588 83.438   1.00 4.80   ? 469  THR C CG2   1 
ATOM   7219  N  N     . PRO C  2  470  ? 57.510  -36.721 85.887   1.00 4.07   ? 470  PRO C N     1 
ATOM   7220  C  CA    . PRO C  2  470  ? 57.751  -37.948 86.644   1.00 4.61   ? 470  PRO C CA    1 
ATOM   7221  C  C     . PRO C  2  470  ? 56.503  -38.519 87.317   1.00 4.92   ? 470  PRO C C     1 
ATOM   7222  O  O     . PRO C  2  470  ? 55.635  -37.779 87.760   1.00 5.91   ? 470  PRO C O     1 
ATOM   7223  C  CB    . PRO C  2  470  ? 58.755  -37.494 87.698   1.00 4.11   ? 470  PRO C CB    1 
ATOM   7224  C  CG    . PRO C  2  470  ? 58.387  -36.094 87.950   1.00 5.10   ? 470  PRO C CG    1 
ATOM   7225  C  CD    . PRO C  2  470  ? 57.984  -35.535 86.617   1.00 5.01   ? 470  PRO C CD    1 
ATOM   7226  N  N     . TYR C  2  471  ? 56.434  -39.841 87.396   1.00 5.00   ? 471  TYR C N     1 
ATOM   7227  C  CA    . TYR C  2  471  ? 55.410  -40.517 88.171   1.00 6.10   ? 471  TYR C CA    1 
ATOM   7228  C  C     . TYR C  2  471  ? 56.014  -41.700 88.912   1.00 8.59   ? 471  TYR C C     1 
ATOM   7229  O  O     . TYR C  2  471  ? 57.093  -42.176 88.572   1.00 7.46   ? 471  TYR C O     1 
ATOM   7230  C  CB    . TYR C  2  471  ? 54.275  -40.994 87.278   1.00 7.41   ? 471  TYR C CB    1 
ATOM   7231  C  CG    . TYR C  2  471  ? 53.468  -39.878 86.664   1.00 8.28   ? 471  TYR C CG    1 
ATOM   7232  C  CD1   . TYR C  2  471  ? 53.643  -39.518 85.334   1.00 6.79   ? 471  TYR C CD1   1 
ATOM   7233  C  CD2   . TYR C  2  471  ? 52.525  -39.184 87.415   1.00 7.62   ? 471  TYR C CD2   1 
ATOM   7234  C  CE1   . TYR C  2  471  ? 52.896  -38.501 84.765   1.00 9.36   ? 471  TYR C CE1   1 
ATOM   7235  C  CE2   . TYR C  2  471  ? 51.777  -38.163 86.858   1.00 7.47   ? 471  TYR C CE2   1 
ATOM   7236  C  CZ    . TYR C  2  471  ? 51.966  -37.823 85.533   1.00 8.65   ? 471  TYR C CZ    1 
ATOM   7237  O  OH    . TYR C  2  471  ? 51.225  -36.806 84.970   1.00 6.16   ? 471  TYR C OH    1 
ATOM   7238  N  N     . ARG C  2  472  ? 55.303  -42.164 89.929   1.00 9.21   ? 472  ARG C N     1 
ATOM   7239  C  CA    . ARG C  2  472  ? 55.748  -43.264 90.756   1.00 8.09   ? 472  ARG C CA    1 
ATOM   7240  C  C     . ARG C  2  472  ? 55.042  -44.525 90.324   1.00 14.47  ? 472  ARG C C     1 
ATOM   7241  O  O     . ARG C  2  472  ? 53.826  -44.524 90.155   1.00 16.22  ? 472  ARG C O     1 
ATOM   7242  C  CB    . ARG C  2  472  ? 55.391  -42.980 92.201   1.00 9.51   ? 472  ARG C CB    1 
ATOM   7243  C  CG    . ARG C  2  472  ? 56.026  -41.729 92.724   1.00 13.84  ? 472  ARG C CG    1 
ATOM   7244  C  CD    . ARG C  2  472  ? 56.499  -41.960 94.132   1.00 24.06  ? 472  ARG C CD    1 
ATOM   7245  N  NE    . ARG C  2  472  ? 55.504  -41.574 95.124   1.00 27.01  ? 472  ARG C NE    1 
ATOM   7246  C  CZ    . ARG C  2  472  ? 55.429  -42.108 96.337   1.00 33.34  ? 472  ARG C CZ    1 
ATOM   7247  N  NH1   . ARG C  2  472  ? 56.278  -43.063 96.690   1.00 28.04  ? 472  ARG C NH1   1 
ATOM   7248  N  NH2   . ARG C  2  472  ? 54.501  -41.699 97.190   1.00 41.47  ? 472  ARG C NH2   1 
ATOM   7249  N  N     . ARG C  2  473  ? 55.799  -45.602 90.145   1.00 17.68  ? 473  ARG C N     1 
ATOM   7250  C  CA    . ARG C  2  473  ? 55.206  -46.875 89.765   1.00 15.13  ? 473  ARG C CA    1 
ATOM   7251  C  C     . ARG C  2  473  ? 54.395  -47.406 90.929   1.00 13.75  ? 473  ARG C C     1 
ATOM   7252  O  O     . ARG C  2  473  ? 54.891  -47.487 92.051   1.00 14.61  ? 473  ARG C O     1 
ATOM   7253  C  CB    . ARG C  2  473  ? 56.291  -47.883 89.393   1.00 19.00  ? 473  ARG C CB    1 
ATOM   7254  C  CG    . ARG C  2  473  ? 55.759  -49.267 89.047   1.00 21.87  ? 473  ARG C CG    1 
ATOM   7255  C  CD    . ARG C  2  473  ? 55.614  -49.457 87.546   1.00 14.07  ? 473  ARG C CD    1 
ATOM   7256  N  NE    . ARG C  2  473  ? 56.890  -49.260 86.868   1.00 10.75  ? 473  ARG C NE    1 
ATOM   7257  C  CZ    . ARG C  2  473  ? 57.029  -49.188 85.549   1.00 18.17  ? 473  ARG C CZ    1 
ATOM   7258  N  NH1   . ARG C  2  473  ? 55.965  -49.302 84.760   1.00 15.55  ? 473  ARG C NH1   1 
ATOM   7259  N  NH2   . ARG C  2  473  ? 58.233  -48.999 85.017   1.00 15.52  ? 473  ARG C NH2   1 
ATOM   7260  N  N     . VAL C  2  474  ? 53.141  -47.749 90.667   1.00 13.84  ? 474  VAL C N     1 
ATOM   7261  C  CA    . VAL C  2  474  ? 52.307  -48.367 91.689   1.00 16.26  ? 474  VAL C CA    1 
ATOM   7262  C  C     . VAL C  2  474  ? 51.950  -49.780 91.252   1.00 26.16  ? 474  VAL C C     1 
ATOM   7263  O  O     . VAL C  2  474  ? 51.267  -49.975 90.243   1.00 23.84  ? 474  VAL C O     1 
ATOM   7264  C  CB    . VAL C  2  474  ? 51.017  -47.572 91.951   1.00 11.61  ? 474  VAL C CB    1 
ATOM   7265  C  CG1   . VAL C  2  474  ? 50.288  -48.134 93.156   1.00 13.99  ? 474  VAL C CG1   1 
ATOM   7266  C  CG2   . VAL C  2  474  ? 51.342  -46.122 92.186   1.00 16.22  ? 474  VAL C CG2   1 
ATOM   7267  N  N     . VAL C  2  475  ? 52.432  -50.766 92.004   1.00 34.86  ? 475  VAL C N     1 
ATOM   7268  C  CA    . VAL C  2  475  ? 52.146  -52.163 91.695   1.00 31.71  ? 475  VAL C CA    1 
ATOM   7269  C  C     . VAL C  2  475  ? 51.269  -52.784 92.770   1.00 22.91  ? 475  VAL C C     1 
ATOM   7270  O  O     . VAL C  2  475  ? 51.699  -52.954 93.911   1.00 18.66  ? 475  VAL C O     1 
ATOM   7271  C  CB    . VAL C  2  475  ? 53.432  -52.989 91.532   1.00 26.08  ? 475  VAL C CB    1 
ATOM   7272  C  CG1   . VAL C  2  475  ? 53.093  -54.460 91.414   1.00 31.22  ? 475  VAL C CG1   1 
ATOM   7273  C  CG2   . VAL C  2  475  ? 54.209  -52.516 90.310   1.00 21.88  ? 475  VAL C CG2   1 
ATOM   7274  N  N     . GLY C  2  476  ? 50.031  -53.094 92.393   1.00 21.19  ? 476  GLY C N     1 
ATOM   7275  C  CA    . GLY C  2  476  ? 49.086  -53.723 93.294   1.00 21.14  ? 476  GLY C CA    1 
ATOM   7276  C  C     . GLY C  2  476  ? 48.894  -52.950 94.581   1.00 25.50  ? 476  GLY C C     1 
ATOM   7277  O  O     . GLY C  2  476  ? 49.105  -53.487 95.669   1.00 30.81  ? 476  GLY C O     1 
ATOM   7278  N  N     . GLY C  2  477  ? 48.527  -51.677 94.460   1.00 25.97  ? 477  GLY C N     1 
ATOM   7279  C  CA    . GLY C  2  477  ? 48.276  -50.845 95.626   1.00 27.06  ? 477  GLY C CA    1 
ATOM   7280  C  C     . GLY C  2  477  ? 49.501  -50.544 96.478   1.00 26.65  ? 477  GLY C C     1 
ATOM   7281  O  O     . GLY C  2  477  ? 49.383  -49.954 97.552   1.00 29.42  ? 477  GLY C O     1 
ATOM   7282  N  N     . VAL C  2  478  ? 50.674  -50.956 96.005   1.00 23.82  ? 478  VAL C N     1 
ATOM   7283  C  CA    . VAL C  2  478  ? 51.932  -50.652 96.679   1.00 22.37  ? 478  VAL C CA    1 
ATOM   7284  C  C     . VAL C  2  478  ? 52.690  -49.619 95.859   1.00 24.03  ? 478  VAL C C     1 
ATOM   7285  O  O     . VAL C  2  478  ? 52.985  -49.840 94.683   1.00 24.02  ? 478  VAL C O     1 
ATOM   7286  C  CB    . VAL C  2  478  ? 52.807  -51.914 96.854   1.00 23.84  ? 478  VAL C CB    1 
ATOM   7287  C  CG1   . VAL C  2  478  ? 54.241  -51.543 97.206   1.00 13.73  ? 478  VAL C CG1   1 
ATOM   7288  C  CG2   . VAL C  2  478  ? 52.212  -52.829 97.908   1.00 30.36  ? 478  VAL C CG2   1 
ATOM   7289  N  N     . VAL C  2  479  ? 53.004  -48.489 96.481   1.00 22.85  ? 479  VAL C N     1 
ATOM   7290  C  CA    . VAL C  2  479  ? 53.665  -47.407 95.772   1.00 19.59  ? 479  VAL C CA    1 
ATOM   7291  C  C     . VAL C  2  479  ? 55.167  -47.541 95.916   1.00 18.18  ? 479  VAL C C     1 
ATOM   7292  O  O     . VAL C  2  479  ? 55.714  -47.351 96.998   1.00 20.60  ? 479  VAL C O     1 
ATOM   7293  C  CB    . VAL C  2  479  ? 53.257  -46.038 96.332   1.00 19.00  ? 479  VAL C CB    1 
ATOM   7294  C  CG1   . VAL C  2  479  ? 53.774  -44.940 95.426   1.00 22.07  ? 479  VAL C CG1   1 
ATOM   7295  C  CG2   . VAL C  2  479  ? 51.748  -45.947 96.484   1.00 14.01  ? 479  VAL C CG2   1 
ATOM   7296  N  N     . THR C  2  480  ? 55.838  -47.852 94.817   1.00 18.81  ? 480  THR C N     1 
ATOM   7297  C  CA    . THR C  2  480  ? 57.282  -48.012 94.849   1.00 26.49  ? 480  THR C CA    1 
ATOM   7298  C  C     . THR C  2  480  ? 57.954  -46.645 94.844   1.00 33.84  ? 480  THR C C     1 
ATOM   7299  O  O     . THR C  2  480  ? 57.283  -45.612 94.776   1.00 29.40  ? 480  THR C O     1 
ATOM   7300  C  CB    . THR C  2  480  ? 57.788  -48.827 93.639   1.00 26.16  ? 480  THR C CB    1 
ATOM   7301  O  OG1   . THR C  2  480  ? 57.608  -48.069 92.435   1.00 25.71  ? 480  THR C OG1   1 
ATOM   7302  C  CG2   . THR C  2  480  ? 57.031  -50.147 93.526   1.00 26.02  ? 480  THR C CG2   1 
ATOM   7303  N  N     . ASP C  2  481  ? 59.279  -46.639 94.948   1.00 33.07  ? 481  ASP C N     1 
ATOM   7304  C  CA    . ASP C  2  481  ? 60.045  -45.414 94.779   1.00 26.80  ? 481  ASP C CA    1 
ATOM   7305  C  C     . ASP C  2  481  ? 60.634  -45.326 93.375   1.00 32.33  ? 481  ASP C C     1 
ATOM   7306  O  O     . ASP C  2  481  ? 61.399  -44.406 93.075   1.00 30.83  ? 481  ASP C O     1 
ATOM   7307  C  CB    . ASP C  2  481  ? 61.112  -45.253 95.868   1.00 33.90  ? 481  ASP C CB    1 
ATOM   7308  C  CG    . ASP C  2  481  ? 60.505  -45.004 97.247   1.00 48.07  ? 481  ASP C CG    1 
ATOM   7309  O  OD1   . ASP C  2  481  ? 59.263  -44.894 97.339   1.00 47.53  ? 481  ASP C OD1   1 
ATOM   7310  O  OD2   . ASP C  2  481  ? 61.265  -44.907 98.239   1.00 50.35  ? 481  ASP C OD2   1 
ATOM   7311  N  N     . GLU C  2  482  ? 60.292  -46.299 92.526   1.00 27.30  ? 482  GLU C N     1 
ATOM   7312  C  CA    . GLU C  2  482  ? 60.679  -46.249 91.114   1.00 22.80  ? 482  GLU C CA    1 
ATOM   7313  C  C     . GLU C  2  482  ? 59.927  -45.144 90.380   1.00 21.36  ? 482  GLU C C     1 
ATOM   7314  O  O     . GLU C  2  482  ? 58.692  -45.134 90.347   1.00 17.21  ? 482  GLU C O     1 
ATOM   7315  C  CB    . GLU C  2  482  ? 60.391  -47.571 90.410   1.00 17.54  ? 482  GLU C CB    1 
ATOM   7316  C  CG    . GLU C  2  482  ? 60.612  -47.489 88.905   1.00 17.21  ? 482  GLU C CG    1 
ATOM   7317  C  CD    . GLU C  2  482  ? 59.850  -48.549 88.127   1.00 27.94  ? 482  GLU C CD    1 
ATOM   7318  O  OE1   . GLU C  2  482  ? 59.953  -48.555 86.876   1.00 18.27  ? 482  GLU C OE1   1 
ATOM   7319  O  OE2   . GLU C  2  482  ? 59.147  -49.369 88.764   1.00 28.64  ? 482  GLU C OE2   1 
ATOM   7320  N  N     . VAL C  2  483  ? 60.679  -44.235 89.764   1.00 17.13  ? 483  VAL C N     1 
ATOM   7321  C  CA    . VAL C  2  483  ? 60.094  -43.069 89.115   1.00 12.32  ? 483  VAL C CA    1 
ATOM   7322  C  C     . VAL C  2  483  ? 60.311  -43.065 87.602   1.00 10.69  ? 483  VAL C C     1 
ATOM   7323  O  O     . VAL C  2  483  ? 61.441  -42.970 87.117   1.00 9.82   ? 483  VAL C O     1 
ATOM   7324  C  CB    . VAL C  2  483  ? 60.638  -41.757 89.712   1.00 11.12  ? 483  VAL C CB    1 
ATOM   7325  C  CG1   . VAL C  2  483  ? 59.861  -40.578 89.178   1.00 7.52   ? 483  VAL C CG1   1 
ATOM   7326  C  CG2   . VAL C  2  483  ? 60.567  -41.795 91.226   1.00 16.85  ? 483  VAL C CG2   1 
ATOM   7327  N  N     . VAL C  2  484  ? 59.208  -43.158 86.868   1.00 7.97   ? 484  VAL C N     1 
ATOM   7328  C  CA    . VAL C  2  484  ? 59.227  -43.125 85.415   1.00 7.70   ? 484  VAL C CA    1 
ATOM   7329  C  C     . VAL C  2  484  ? 58.895  -41.726 84.896   1.00 6.91   ? 484  VAL C C     1 
ATOM   7330  O  O     . VAL C  2  484  ? 57.899  -41.145 85.304   1.00 5.84   ? 484  VAL C O     1 
ATOM   7331  C  CB    . VAL C  2  484  ? 58.193  -44.111 84.857   1.00 6.05   ? 484  VAL C CB    1 
ATOM   7332  C  CG1   . VAL C  2  484  ? 58.070  -43.976 83.347   1.00 7.42   ? 484  VAL C CG1   1 
ATOM   7333  C  CG2   . VAL C  2  484  ? 58.566  -45.519 85.243   1.00 9.77   ? 484  VAL C CG2   1 
ATOM   7334  N  N     . TYR C  2  485  ? 59.723  -41.189 84.002   1.00 5.46   ? 485  TYR C N     1 
ATOM   7335  C  CA    . TYR C  2  485  ? 59.424  -39.913 83.351   1.00 4.63   ? 485  TYR C CA    1 
ATOM   7336  C  C     . TYR C  2  485  ? 58.665  -40.121 82.036   1.00 5.21   ? 485  TYR C C     1 
ATOM   7337  O  O     . TYR C  2  485  ? 59.202  -40.681 81.084   1.00 7.16   ? 485  TYR C O     1 
ATOM   7338  C  CB    . TYR C  2  485  ? 60.711  -39.130 83.093   1.00 3.13   ? 485  TYR C CB    1 
ATOM   7339  C  CG    . TYR C  2  485  ? 61.088  -38.184 84.202   1.00 3.42   ? 485  TYR C CG    1 
ATOM   7340  C  CD1   . TYR C  2  485  ? 61.871  -38.602 85.264   1.00 4.93   ? 485  TYR C CD1   1 
ATOM   7341  C  CD2   . TYR C  2  485  ? 60.657  -36.867 84.187   1.00 5.82   ? 485  TYR C CD2   1 
ATOM   7342  C  CE1   . TYR C  2  485  ? 62.217  -37.731 86.285   1.00 7.25   ? 485  TYR C CE1   1 
ATOM   7343  C  CE2   . TYR C  2  485  ? 60.997  -35.987 85.199   1.00 5.69   ? 485  TYR C CE2   1 
ATOM   7344  C  CZ    . TYR C  2  485  ? 61.774  -36.424 86.247   1.00 8.43   ? 485  TYR C CZ    1 
ATOM   7345  O  OH    . TYR C  2  485  ? 62.110  -35.546 87.254   1.00 9.05   ? 485  TYR C OH    1 
ATOM   7346  N  N     . MET C  2  486  ? 57.424  -39.654 81.970   1.00 4.61   ? 486  MET C N     1 
ATOM   7347  C  CA    . MET C  2  486  ? 56.590  -39.939 80.803   1.00 6.56   ? 486  MET C CA    1 
ATOM   7348  C  C     . MET C  2  486  ? 56.298  -38.736 79.912   1.00 6.25   ? 486  MET C C     1 
ATOM   7349  O  O     . MET C  2  486  ? 56.172  -37.612 80.394   1.00 6.60   ? 486  MET C O     1 
ATOM   7350  C  CB    . MET C  2  486  ? 55.264  -40.551 81.245   1.00 7.92   ? 486  MET C CB    1 
ATOM   7351  C  CG    . MET C  2  486  ? 55.417  -41.786 82.091   1.00 10.28  ? 486  MET C CG    1 
ATOM   7352  S  SD    . MET C  2  486  ? 53.832  -42.561 82.419   1.00 11.93  ? 486  MET C SD    1 
ATOM   7353  C  CE    . MET C  2  486  ? 54.008  -42.800 84.176   1.00 8.63   ? 486  MET C CE    1 
ATOM   7354  N  N     . THR C  2  487  ? 56.179  -38.982 78.609   1.00 4.80   ? 487  THR C N     1 
ATOM   7355  C  CA    . THR C  2  487  ? 55.640  -37.984 77.706   1.00 3.89   ? 487  THR C CA    1 
ATOM   7356  C  C     . THR C  2  487  ? 54.128  -38.056 77.798   1.00 4.53   ? 487  THR C C     1 
ATOM   7357  O  O     . THR C  2  487  ? 53.585  -38.919 78.480   1.00 5.35   ? 487  THR C O     1 
ATOM   7358  C  CB    . THR C  2  487  ? 56.047  -38.241 76.258   1.00 3.69   ? 487  THR C CB    1 
ATOM   7359  O  OG1   . THR C  2  487  ? 55.357  -39.396 75.770   1.00 3.99   ? 487  THR C OG1   1 
ATOM   7360  C  CG2   . THR C  2  487  ? 57.549  -38.449 76.154   1.00 3.42   ? 487  THR C CG2   1 
ATOM   7361  N  N     . ALA C  2  488  ? 53.441  -37.166 77.097   1.00 4.52   ? 488  ALA C N     1 
ATOM   7362  C  CA    . ALA C  2  488  ? 51.993  -37.078 77.231   1.00 6.70   ? 488  ALA C CA    1 
ATOM   7363  C  C     . ALA C  2  488  ? 51.302  -38.298 76.636   1.00 6.53   ? 488  ALA C C     1 
ATOM   7364  O  O     . ALA C  2  488  ? 50.320  -38.808 77.192   1.00 6.74   ? 488  ALA C O     1 
ATOM   7365  C  CB    . ALA C  2  488  ? 51.473  -35.795 76.595   1.00 5.96   ? 488  ALA C CB    1 
ATOM   7366  N  N     . THR C  2  489  ? 51.830  -38.772 75.513   1.00 7.04   ? 489  THR C N     1 
ATOM   7367  C  CA    . THR C  2  489  ? 51.263  -39.938 74.849   1.00 7.99   ? 489  THR C CA    1 
ATOM   7368  C  C     . THR C  2  489  ? 51.443  -41.192 75.695   1.00 10.46  ? 489  THR C C     1 
ATOM   7369  O  O     . THR C  2  489  ? 50.527  -42.009 75.795   1.00 13.20  ? 489  THR C O     1 
ATOM   7370  C  CB    . THR C  2  489  ? 51.872  -40.172 73.470   1.00 6.24   ? 489  THR C CB    1 
ATOM   7371  O  OG1   . THR C  2  489  ? 52.381  -38.937 72.953   1.00 9.38   ? 489  THR C OG1   1 
ATOM   7372  C  CG2   . THR C  2  489  ? 50.810  -40.711 72.533   1.00 8.27   ? 489  THR C CG2   1 
ATOM   7373  N  N     . GLU C  2  490  ? 52.616  -41.337 76.307   1.00 9.49   ? 490  GLU C N     1 
ATOM   7374  C  CA    . GLU C  2  490  ? 52.856  -42.438 77.233   1.00 9.83   ? 490  GLU C CA    1 
ATOM   7375  C  C     . GLU C  2  490  ? 51.933  -42.333 78.438   1.00 10.16  ? 490  GLU C C     1 
ATOM   7376  O  O     . GLU C  2  490  ? 51.299  -43.305 78.821   1.00 12.94  ? 490  GLU C O     1 
ATOM   7377  C  CB    . GLU C  2  490  ? 54.316  -42.472 77.684   1.00 9.74   ? 490  GLU C CB    1 
ATOM   7378  C  CG    . GLU C  2  490  ? 55.080  -43.708 77.212   1.00 21.19  ? 490  GLU C CG    1 
ATOM   7379  C  CD    . GLU C  2  490  ? 54.787  -44.946 78.046   1.00 27.37  ? 490  GLU C CD    1 
ATOM   7380  O  OE1   . GLU C  2  490  ? 54.395  -45.981 77.458   1.00 25.55  ? 490  GLU C OE1   1 
ATOM   7381  O  OE2   . GLU C  2  490  ? 54.965  -44.885 79.287   1.00 20.89  ? 490  GLU C OE2   1 
ATOM   7382  N  N     . GLU C  2  491  ? 51.847  -41.144 79.022   1.00 10.25  ? 491  GLU C N     1 
ATOM   7383  C  CA    . GLU C  2  491  ? 50.991  -40.920 80.180   1.00 9.40   ? 491  GLU C CA    1 
ATOM   7384  C  C     . GLU C  2  491  ? 49.527  -41.236 79.870   1.00 9.12   ? 491  GLU C C     1 
ATOM   7385  O  O     . GLU C  2  491  ? 48.751  -41.566 80.763   1.00 7.92   ? 491  GLU C O     1 
ATOM   7386  C  CB    . GLU C  2  491  ? 51.132  -39.478 80.663   1.00 8.67   ? 491  GLU C CB    1 
ATOM   7387  C  CG    . GLU C  2  491  ? 50.208  -39.098 81.807   1.00 9.24   ? 491  GLU C CG    1 
ATOM   7388  C  CD    . GLU C  2  491  ? 50.194  -37.603 82.076   1.00 12.39  ? 491  GLU C CD    1 
ATOM   7389  O  OE1   . GLU C  2  491  ? 49.109  -37.068 82.389   1.00 14.14  ? 491  GLU C OE1   1 
ATOM   7390  O  OE2   . GLU C  2  491  ? 51.264  -36.962 81.979   1.00 11.08  ? 491  GLU C OE2   1 
ATOM   7391  N  N     . ASP C  2  492  ? 49.151  -41.151 78.598   1.00 9.13   ? 492  ASP C N     1 
ATOM   7392  C  CA    . ASP C  2  492  ? 47.759  -41.397 78.216   1.00 11.82  ? 492  ASP C CA    1 
ATOM   7393  C  C     . ASP C  2  492  ? 47.290  -42.838 78.433   1.00 16.32  ? 492  ASP C C     1 
ATOM   7394  O  O     . ASP C  2  492  ? 46.103  -43.134 78.283   1.00 17.46  ? 492  ASP C O     1 
ATOM   7395  C  CB    . ASP C  2  492  ? 47.508  -40.984 76.761   1.00 13.01  ? 492  ASP C CB    1 
ATOM   7396  C  CG    . ASP C  2  492  ? 46.845  -39.620 76.644   1.00 12.17  ? 492  ASP C CG    1 
ATOM   7397  O  OD1   . ASP C  2  492  ? 46.382  -39.283 75.537   1.00 11.64  ? 492  ASP C OD1   1 
ATOM   7398  O  OD2   . ASP C  2  492  ? 46.780  -38.888 77.655   1.00 12.07  ? 492  ASP C OD2   1 
ATOM   7399  N  N     . ARG C  2  493  ? 48.217  -43.735 78.762   1.00 17.79  ? 493  ARG C N     1 
ATOM   7400  C  CA    . ARG C  2  493  ? 47.887  -45.151 78.902   1.00 12.13  ? 493  ARG C CA    1 
ATOM   7401  C  C     . ARG C  2  493  ? 47.440  -45.553 80.297   1.00 11.91  ? 493  ARG C C     1 
ATOM   7402  O  O     . ARG C  2  493  ? 46.859  -46.623 80.479   1.00 16.05  ? 493  ARG C O     1 
ATOM   7403  C  CB    . ARG C  2  493  ? 49.091  -46.007 78.528   1.00 12.01  ? 493  ARG C CB    1 
ATOM   7404  C  CG    . ARG C  2  493  ? 49.779  -45.577 77.261   1.00 17.68  ? 493  ARG C CG    1 
ATOM   7405  C  CD    . ARG C  2  493  ? 50.911  -46.514 76.946   1.00 20.94  ? 493  ARG C CD    1 
ATOM   7406  N  NE    . ARG C  2  493  ? 50.412  -47.769 76.399   1.00 23.70  ? 493  ARG C NE    1 
ATOM   7407  C  CZ    . ARG C  2  493  ? 51.146  -48.866 76.269   1.00 28.72  ? 493  ARG C CZ    1 
ATOM   7408  N  NH1   . ARG C  2  493  ? 52.418  -48.866 76.662   1.00 28.34  ? 493  ARG C NH1   1 
ATOM   7409  N  NH2   . ARG C  2  493  ? 50.605  -49.962 75.752   1.00 30.67  ? 493  ARG C NH2   1 
ATOM   7410  N  N     . TYR C  2  494  ? 47.692  -44.700 81.280   1.00 12.23  ? 494  TYR C N     1 
ATOM   7411  C  CA    . TYR C  2  494  ? 47.604  -45.142 82.668   1.00 12.12  ? 494  TYR C CA    1 
ATOM   7412  C  C     . TYR C  2  494  ? 46.578  -44.418 83.525   1.00 12.99  ? 494  TYR C C     1 
ATOM   7413  O  O     . TYR C  2  494  ? 46.207  -43.271 83.266   1.00 13.03  ? 494  TYR C O     1 
ATOM   7414  C  CB    . TYR C  2  494  ? 48.985  -45.088 83.329   1.00 11.19  ? 494  TYR C CB    1 
ATOM   7415  C  CG    . TYR C  2  494  ? 50.046  -45.746 82.480   1.00 16.64  ? 494  TYR C CG    1 
ATOM   7416  C  CD1   . TYR C  2  494  ? 50.199  -47.127 82.469   1.00 15.11  ? 494  TYR C CD1   1 
ATOM   7417  C  CD2   . TYR C  2  494  ? 50.875  -44.992 81.665   1.00 18.26  ? 494  TYR C CD2   1 
ATOM   7418  C  CE1   . TYR C  2  494  ? 51.156  -47.737 81.679   1.00 15.64  ? 494  TYR C CE1   1 
ATOM   7419  C  CE2   . TYR C  2  494  ? 51.839  -45.596 80.871   1.00 25.22  ? 494  TYR C CE2   1 
ATOM   7420  C  CZ    . TYR C  2  494  ? 51.975  -46.967 80.881   1.00 20.78  ? 494  TYR C CZ    1 
ATOM   7421  O  OH    . TYR C  2  494  ? 52.932  -47.565 80.087   1.00 21.75  ? 494  TYR C OH    1 
ATOM   7422  N  N     . THR C  2  495  ? 46.109  -45.128 84.540   1.00 10.00  ? 495  THR C N     1 
ATOM   7423  C  CA    . THR C  2  495  ? 45.360  -44.526 85.613   1.00 8.09   ? 495  THR C CA    1 
ATOM   7424  C  C     . THR C  2  495  ? 46.391  -44.024 86.609   1.00 10.69  ? 495  THR C C     1 
ATOM   7425  O  O     . THR C  2  495  ? 47.210  -44.803 87.100   1.00 8.14   ? 495  THR C O     1 
ATOM   7426  C  CB    . THR C  2  495  ? 44.483  -45.557 86.280   1.00 8.95   ? 495  THR C CB    1 
ATOM   7427  O  OG1   . THR C  2  495  ? 43.634  -46.151 85.293   1.00 13.49  ? 495  THR C OG1   1 
ATOM   7428  C  CG2   . THR C  2  495  ? 43.643  -44.911 87.363   1.00 12.78  ? 495  THR C CG2   1 
ATOM   7429  N  N     . ILE C  2  496  ? 46.375  -42.722 86.886   1.00 10.43  ? 496  ILE C N     1 
ATOM   7430  C  CA    . ILE C  2  496  ? 47.390  -42.136 87.758   1.00 8.60   ? 496  ILE C CA    1 
ATOM   7431  C  C     . ILE C  2  496  ? 46.783  -41.472 88.987   1.00 11.06  ? 496  ILE C C     1 
ATOM   7432  O  O     . ILE C  2  496  ? 46.024  -40.514 88.875   1.00 13.21  ? 496  ILE C O     1 
ATOM   7433  C  CB    . ILE C  2  496  ? 48.254  -41.115 87.003   1.00 8.64   ? 496  ILE C CB    1 
ATOM   7434  C  CG1   . ILE C  2  496  ? 48.666  -41.685 85.642   1.00 8.90   ? 496  ILE C CG1   1 
ATOM   7435  C  CG2   . ILE C  2  496  ? 49.454  -40.707 87.848   1.00 5.64   ? 496  ILE C CG2   1 
ATOM   7436  C  CD1   . ILE C  2  496  ? 49.650  -40.837 84.891   1.00 8.97   ? 496  ILE C CD1   1 
ATOM   7437  N  N     . ALA C  2  497  ? 47.134  -41.976 90.162   1.00 9.12   ? 497  ALA C N     1 
ATOM   7438  C  CA    . ALA C  2  497  ? 46.564  -41.470 91.400   1.00 9.60   ? 497  ALA C CA    1 
ATOM   7439  C  C     . ALA C  2  497  ? 47.168  -40.127 91.763   1.00 10.17  ? 497  ALA C C     1 
ATOM   7440  O  O     . ALA C  2  497  ? 48.303  -39.832 91.394   1.00 10.06  ? 497  ALA C O     1 
ATOM   7441  C  CB    . ALA C  2  497  ? 46.792  -42.463 92.522   1.00 14.09  ? 497  ALA C CB    1 
ATOM   7442  N  N     . GLN C  2  498  ? 46.406  -39.321 92.493   1.00 9.69   ? 498  GLN C N     1 
ATOM   7443  C  CA    . GLN C  2  498  ? 46.897  -38.047 93.003   1.00 10.90  ? 498  GLN C CA    1 
ATOM   7444  C  C     . GLN C  2  498  ? 47.926  -38.260 94.114   1.00 11.86  ? 498  GLN C C     1 
ATOM   7445  O  O     . GLN C  2  498  ? 47.891  -39.277 94.798   1.00 15.47  ? 498  GLN C O     1 
ATOM   7446  C  CB    . GLN C  2  498  ? 45.725  -37.219 93.514   1.00 11.47  ? 498  GLN C CB    1 
ATOM   7447  C  CG    . GLN C  2  498  ? 44.824  -36.705 92.407   1.00 10.32  ? 498  GLN C CG    1 
ATOM   7448  C  CD    . GLN C  2  498  ? 45.485  -35.601 91.609   1.00 12.12  ? 498  GLN C CD    1 
ATOM   7449  O  OE1   . GLN C  2  498  ? 46.228  -34.784 92.160   1.00 12.05  ? 498  GLN C OE1   1 
ATOM   7450  N  NE2   . GLN C  2  498  ? 45.228  -35.573 90.305   1.00 10.51  ? 498  GLN C NE2   1 
ATOM   7451  N  N     . ALA C  2  499  ? 48.832  -37.301 94.292   1.00 9.23   ? 499  ALA C N     1 
ATOM   7452  C  CA    . ALA C  2  499  ? 49.941  -37.440 95.243   1.00 9.45   ? 499  ALA C CA    1 
ATOM   7453  C  C     . ALA C  2  499  ? 49.528  -37.461 96.722   1.00 14.93  ? 499  ALA C C     1 
ATOM   7454  O  O     . ALA C  2  499  ? 50.254  -37.981 97.577   1.00 12.95  ? 499  ALA C O     1 
ATOM   7455  C  CB    . ALA C  2  499  ? 50.967  -36.350 95.008   1.00 9.58   ? 499  ALA C CB    1 
ATOM   7456  N  N     . ASN C  2  500  ? 48.365  -36.890 97.020   1.00 15.96  ? 500  ASN C N     1 
ATOM   7457  C  CA    . ASN C  2  500  ? 47.878  -36.817 98.393   1.00 13.12  ? 500  ASN C CA    1 
ATOM   7458  C  C     . ASN C  2  500  ? 47.019  -38.019 98.771   1.00 17.83  ? 500  ASN C C     1 
ATOM   7459  O  O     . ASN C  2  500  ? 46.391  -38.031 99.829   1.00 23.40  ? 500  ASN C O     1 
ATOM   7460  C  CB    . ASN C  2  500  ? 47.111  -35.519 98.637   1.00 12.26  ? 500  ASN C CB    1 
ATOM   7461  C  CG    . ASN C  2  500  ? 45.712  -35.551 98.053   1.00 15.03  ? 500  ASN C CG    1 
ATOM   7462  O  OD1   . ASN C  2  500  ? 45.472  -36.163 97.013   1.00 17.20  ? 500  ASN C OD1   1 
ATOM   7463  N  ND2   . ASN C  2  500  ? 44.778  -34.892 98.726   1.00 19.88  ? 500  ASN C ND2   1 
ATOM   7464  N  N     . THR C  2  501  ? 46.953  -39.001 97.876   1.00 15.91  ? 501  THR C N     1 
ATOM   7465  C  CA    . THR C  2  501  ? 46.344  -40.288 98.182   1.00 15.90  ? 501  THR C CA    1 
ATOM   7466  C  C     . THR C  2  501  ? 46.979  -40.829 99.460   1.00 17.91  ? 501  THR C C     1 
ATOM   7467  O  O     . THR C  2  501  ? 48.208  -40.899 99.558   1.00 18.43  ? 501  THR C O     1 
ATOM   7468  C  CB    . THR C  2  501  ? 46.583  -41.306 97.041   1.00 17.99  ? 501  THR C CB    1 
ATOM   7469  O  OG1   . THR C  2  501  ? 46.113  -40.769 95.797   1.00 18.48  ? 501  THR C OG1   1 
ATOM   7470  C  CG2   . THR C  2  501  ? 45.878  -42.628 97.329   1.00 18.37  ? 501  THR C CG2   1 
ATOM   7471  N  N     . PRO C  2  502  ? 46.146  -41.191 100.452  1.00 17.80  ? 502  PRO C N     1 
ATOM   7472  C  CA    . PRO C  2  502  ? 46.618  -41.665 101.761  1.00 19.53  ? 502  PRO C CA    1 
ATOM   7473  C  C     . PRO C  2  502  ? 47.435  -42.950 101.678  1.00 21.21  ? 502  PRO C C     1 
ATOM   7474  O  O     . PRO C  2  502  ? 47.021  -43.922 101.050  1.00 23.23  ? 502  PRO C O     1 
ATOM   7475  C  CB    . PRO C  2  502  ? 45.319  -41.931 102.530  1.00 13.69  ? 502  PRO C CB    1 
ATOM   7476  C  CG    . PRO C  2  502  ? 44.297  -41.101 101.847  1.00 15.55  ? 502  PRO C CG    1 
ATOM   7477  C  CD    . PRO C  2  502  ? 44.677  -41.105 100.402  1.00 16.39  ? 502  PRO C CD    1 
ATOM   7478  N  N     . LEU C  2  503  ? 48.591  -42.952 102.323  1.00 22.38  ? 503  LEU C N     1 
ATOM   7479  C  CA    . LEU C  2  503  ? 49.414  -44.145 102.374  1.00 25.83  ? 503  LEU C CA    1 
ATOM   7480  C  C     . LEU C  2  503  ? 49.715  -44.529 103.819  1.00 37.60  ? 503  LEU C C     1 
ATOM   7481  O  O     . LEU C  2  503  ? 50.004  -43.669 104.654  1.00 41.28  ? 503  LEU C O     1 
ATOM   7482  C  CB    . LEU C  2  503  ? 50.732  -43.922 101.629  1.00 18.60  ? 503  LEU C CB    1 
ATOM   7483  C  CG    . LEU C  2  503  ? 50.692  -43.383 100.202  1.00 16.03  ? 503  LEU C CG    1 
ATOM   7484  C  CD1   . LEU C  2  503  ? 52.105  -43.209 99.689   1.00 18.03  ? 503  LEU C CD1   1 
ATOM   7485  C  CD2   . LEU C  2  503  ? 49.899  -44.288 99.282   1.00 17.65  ? 503  LEU C CD2   1 
ATOM   7486  N  N     . GLU C  2  504  ? 49.632  -45.822 104.113  1.00 38.33  ? 504  GLU C N     1 
ATOM   7487  C  CA    . GLU C  2  504  ? 50.245  -46.362 105.317  1.00 35.19  ? 504  GLU C CA    1 
ATOM   7488  C  C     . GLU C  2  504  ? 51.537  -47.022 104.850  1.00 31.89  ? 504  GLU C C     1 
ATOM   7489  O  O     . GLU C  2  504  ? 51.507  -48.036 104.156  1.00 34.31  ? 504  GLU C O     1 
ATOM   7490  C  CB    . GLU C  2  504  ? 49.314  -47.366 105.999  1.00 36.39  ? 504  GLU C CB    1 
ATOM   7491  C  CG    . GLU C  2  504  ? 48.563  -48.277 105.031  1.00 49.19  ? 504  GLU C CG    1 
ATOM   7492  C  CD    . GLU C  2  504  ? 47.500  -49.127 105.711  1.00 69.96  ? 504  GLU C CD    1 
ATOM   7493  O  OE1   . GLU C  2  504  ? 47.268  -48.934 106.925  1.00 79.66  ? 504  GLU C OE1   1 
ATOM   7494  O  OE2   . GLU C  2  504  ? 46.893  -49.985 105.028  1.00 61.25  ? 504  GLU C OE2   1 
ATOM   7495  N  N     . GLY C  2  505  ? 52.674  -46.427 105.198  1.00 25.09  ? 505  GLY C N     1 
ATOM   7496  C  CA    . GLY C  2  505  ? 53.935  -46.865 104.629  1.00 29.23  ? 505  GLY C CA    1 
ATOM   7497  C  C     . GLY C  2  505  ? 53.956  -46.612 103.131  1.00 29.29  ? 505  GLY C C     1 
ATOM   7498  O  O     . GLY C  2  505  ? 53.764  -45.484 102.688  1.00 34.22  ? 505  GLY C O     1 
ATOM   7499  N  N     . ASN C  2  506  ? 54.199  -47.660 102.350  1.00 28.71  ? 506  ASN C N     1 
ATOM   7500  C  CA    . ASN C  2  506  ? 54.197  -47.561 100.892  1.00 22.56  ? 506  ASN C CA    1 
ATOM   7501  C  C     . ASN C  2  506  ? 52.880  -47.983 100.231  1.00 23.93  ? 506  ASN C C     1 
ATOM   7502  O  O     . ASN C  2  506  ? 52.779  -48.017 99.006   1.00 22.87  ? 506  ASN C O     1 
ATOM   7503  C  CB    . ASN C  2  506  ? 55.353  -48.374 100.306  1.00 29.53  ? 506  ASN C CB    1 
ATOM   7504  C  CG    . ASN C  2  506  ? 56.714  -47.840 100.720  1.00 50.22  ? 506  ASN C CG    1 
ATOM   7505  O  OD1   . ASN C  2  506  ? 57.378  -47.132 99.960   1.00 52.27  ? 506  ASN C OD1   1 
ATOM   7506  N  ND2   . ASN C  2  506  ? 57.136  -48.178 101.934  1.00 58.91  ? 506  ASN C ND2   1 
ATOM   7507  N  N     . ARG C  2  507  ? 51.878  -48.315 101.040  1.00 27.53  ? 507  ARG C N     1 
ATOM   7508  C  CA    . ARG C  2  507  ? 50.644  -48.914 100.526  1.00 30.01  ? 507  ARG C CA    1 
ATOM   7509  C  C     . ARG C  2  507  ? 49.463  -47.951 100.540  1.00 23.52  ? 507  ARG C C     1 
ATOM   7510  O  O     . ARG C  2  507  ? 49.301  -47.177 101.479  1.00 25.91  ? 507  ARG C O     1 
ATOM   7511  C  CB    . ARG C  2  507  ? 50.293  -50.180 101.327  1.00 39.42  ? 507  ARG C CB    1 
ATOM   7512  C  CG    . ARG C  2  507  ? 49.009  -50.889 100.885  1.00 41.77  ? 507  ARG C CG    1 
ATOM   7513  C  CD    . ARG C  2  507  ? 48.764  -52.189 101.655  1.00 47.00  ? 507  ARG C CD    1 
ATOM   7514  N  NE    . ARG C  2  507  ? 49.833  -53.169 101.462  1.00 59.72  ? 507  ARG C NE    1 
ATOM   7515  C  CZ    . ARG C  2  507  ? 49.966  -53.942 100.384  1.00 54.99  ? 507  ARG C CZ    1 
ATOM   7516  N  NH1   . ARG C  2  507  ? 49.102  -53.853 99.379   1.00 40.43  ? 507  ARG C NH1   1 
ATOM   7517  N  NH2   . ARG C  2  507  ? 50.975  -54.802 100.307  1.00 49.01  ? 507  ARG C NH2   1 
ATOM   7518  N  N     . ILE C  2  508  ? 48.632  -48.013 99.504   1.00 21.41  ? 508  ILE C N     1 
ATOM   7519  C  CA    . ILE C  2  508  ? 47.455  -47.153 99.430   1.00 26.79  ? 508  ILE C CA    1 
ATOM   7520  C  C     . ILE C  2  508  ? 46.456  -47.513 100.526  1.00 26.00  ? 508  ILE C C     1 
ATOM   7521  O  O     . ILE C  2  508  ? 46.023  -48.658 100.641  1.00 23.96  ? 508  ILE C O     1 
ATOM   7522  C  CB    . ILE C  2  508  ? 46.775  -47.228 98.045   1.00 22.39  ? 508  ILE C CB    1 
ATOM   7523  C  CG1   . ILE C  2  508  ? 47.759  -46.829 96.950   1.00 14.82  ? 508  ILE C CG1   1 
ATOM   7524  C  CG2   . ILE C  2  508  ? 45.549  -46.325 97.990   1.00 23.04  ? 508  ILE C CG2   1 
ATOM   7525  C  CD1   . ILE C  2  508  ? 47.134  -46.774 95.577   1.00 22.65  ? 508  ILE C CD1   1 
ATOM   7526  N  N     . ALA C  2  509  ? 46.093  -46.516 101.325  1.00 33.61  ? 509  ALA C N     1 
ATOM   7527  C  CA    . ALA C  2  509  ? 45.273  -46.730 102.511  1.00 32.54  ? 509  ALA C CA    1 
ATOM   7528  C  C     . ALA C  2  509  ? 43.788  -46.455 102.297  1.00 31.25  ? 509  ALA C C     1 
ATOM   7529  O  O     . ALA C  2  509  ? 42.998  -46.566 103.232  1.00 44.20  ? 509  ALA C O     1 
ATOM   7530  C  CB    . ALA C  2  509  ? 45.803  -45.895 103.668  1.00 36.10  ? 509  ALA C CB    1 
ATOM   7531  N  N     . ALA C  2  510  ? 43.406  -46.086 101.080  1.00 26.38  ? 510  ALA C N     1 
ATOM   7532  C  CA    . ALA C  2  510  ? 42.007  -45.767 100.798  1.00 33.94  ? 510  ALA C CA    1 
ATOM   7533  C  C     . ALA C  2  510  ? 41.404  -46.727 99.774   1.00 35.39  ? 510  ALA C C     1 
ATOM   7534  O  O     . ALA C  2  510  ? 42.089  -47.155 98.851   1.00 36.47  ? 510  ALA C O     1 
ATOM   7535  C  CB    . ALA C  2  510  ? 41.883  -44.331 100.320  1.00 28.91  ? 510  ALA C CB    1 
ATOM   7536  N  N     . GLU C  2  511  ? 40.126  -47.068 99.931   1.00 32.67  ? 511  GLU C N     1 
ATOM   7537  C  CA    . GLU C  2  511  ? 39.480  -47.968 98.974   1.00 34.19  ? 511  GLU C CA    1 
ATOM   7538  C  C     . GLU C  2  511  ? 38.880  -47.229 97.778   1.00 32.67  ? 511  GLU C C     1 
ATOM   7539  O  O     . GLU C  2  511  ? 38.425  -47.846 96.814   1.00 31.61  ? 511  GLU C O     1 
ATOM   7540  C  CB    . GLU C  2  511  ? 38.447  -48.879 99.650   1.00 37.48  ? 511  GLU C CB    1 
ATOM   7541  C  CG    . GLU C  2  511  ? 38.980  -50.289 99.966   1.00 49.90  ? 511  GLU C CG    1 
ATOM   7542  C  CD    . GLU C  2  511  ? 39.519  -51.034 98.730   1.00 61.93  ? 511  GLU C CD    1 
ATOM   7543  O  OE1   . GLU C  2  511  ? 40.520  -51.778 98.865   1.00 50.54  ? 511  GLU C OE1   1 
ATOM   7544  O  OE2   . GLU C  2  511  ? 38.941  -50.886 97.627   1.00 50.82  ? 511  GLU C OE2   1 
ATOM   7545  N  N     . ARG C  2  512  ? 38.891  -45.902 97.848   1.00 34.24  ? 512  ARG C N     1 
ATOM   7546  C  CA    . ARG C  2  512  ? 38.551  -45.070 96.701   1.00 26.97  ? 512  ARG C CA    1 
ATOM   7547  C  C     . ARG C  2  512  ? 39.629  -44.001 96.530   1.00 25.50  ? 512  ARG C C     1 
ATOM   7548  O  O     . ARG C  2  512  ? 39.852  -43.183 97.424   1.00 27.10  ? 512  ARG C O     1 
ATOM   7549  C  CB    . ARG C  2  512  ? 37.170  -44.433 96.874   1.00 24.73  ? 512  ARG C CB    1 
ATOM   7550  C  CG    . ARG C  2  512  ? 36.031  -45.441 96.908   1.00 30.05  ? 512  ARG C CG    1 
ATOM   7551  C  CD    . ARG C  2  512  ? 34.707  -44.800 97.313   1.00 33.69  ? 512  ARG C CD    1 
ATOM   7552  N  NE    . ARG C  2  512  ? 34.083  -44.060 96.217   1.00 48.44  ? 512  ARG C NE    1 
ATOM   7553  C  CZ    . ARG C  2  512  ? 34.126  -42.737 96.082   1.00 53.92  ? 512  ARG C CZ    1 
ATOM   7554  N  NH1   . ARG C  2  512  ? 34.767  -41.996 96.980   1.00 58.66  ? 512  ARG C NH1   1 
ATOM   7555  N  NH2   . ARG C  2  512  ? 33.527  -42.153 95.050   1.00 36.80  ? 512  ARG C NH2   1 
ATOM   7556  N  N     . VAL C  2  513  ? 40.305  -44.023 95.385   1.00 19.72  ? 513  VAL C N     1 
ATOM   7557  C  CA    . VAL C  2  513  ? 41.387  -43.078 95.123   1.00 20.06  ? 513  VAL C CA    1 
ATOM   7558  C  C     . VAL C  2  513  ? 41.103  -42.189 93.906   1.00 19.75  ? 513  VAL C C     1 
ATOM   7559  O  O     . VAL C  2  513  ? 40.627  -42.666 92.868   1.00 14.58  ? 513  VAL C O     1 
ATOM   7560  C  CB    . VAL C  2  513  ? 42.739  -43.808 94.965   1.00 19.61  ? 513  VAL C CB    1 
ATOM   7561  C  CG1   . VAL C  2  513  ? 42.562  -45.061 94.145   1.00 19.80  ? 513  VAL C CG1   1 
ATOM   7562  C  CG2   . VAL C  2  513  ? 43.777  -42.901 94.324   1.00 19.82  ? 513  VAL C CG2   1 
ATOM   7563  N  N     . VAL C  2  514  ? 41.380  -40.892 94.055   1.00 20.83  ? 514  VAL C N     1 
ATOM   7564  C  CA    . VAL C  2  514  ? 41.180  -39.920 92.983   1.00 14.04  ? 514  VAL C CA    1 
ATOM   7565  C  C     . VAL C  2  514  ? 42.323  -40.000 91.991   1.00 12.50  ? 514  VAL C C     1 
ATOM   7566  O  O     . VAL C  2  514  ? 43.490  -39.878 92.372   1.00 14.69  ? 514  VAL C O     1 
ATOM   7567  C  CB    . VAL C  2  514  ? 41.131  -38.489 93.528   1.00 10.13  ? 514  VAL C CB    1 
ATOM   7568  C  CG1   . VAL C  2  514  ? 40.866  -37.510 92.402   1.00 8.76   ? 514  VAL C CG1   1 
ATOM   7569  C  CG2   . VAL C  2  514  ? 40.072  -38.369 94.606   1.00 9.98   ? 514  VAL C CG2   1 
ATOM   7570  N  N     . ALA C  2  515  ? 41.989  -40.193 90.718   1.00 9.81   ? 515  ALA C N     1 
ATOM   7571  C  CA    . ALA C  2  515  ? 43.008  -40.417 89.697   1.00 11.71  ? 515  ALA C CA    1 
ATOM   7572  C  C     . ALA C  2  515  ? 42.714  -39.727 88.361   1.00 8.91   ? 515  ALA C C     1 
ATOM   7573  O  O     . ALA C  2  515  ? 41.681  -39.079 88.195   1.00 8.27   ? 515  ALA C O     1 
ATOM   7574  C  CB    . ALA C  2  515  ? 43.216  -41.919 89.487   1.00 10.25  ? 515  ALA C CB    1 
ATOM   7575  N  N     . ARG C  2  516  ? 43.633  -39.884 87.413   1.00 5.96   ? 516  ARG C N     1 
ATOM   7576  C  CA    . ARG C  2  516  ? 43.462  -39.363 86.066   1.00 7.99   ? 516  ARG C CA    1 
ATOM   7577  C  C     . ARG C  2  516  ? 43.659  -40.455 85.024   1.00 9.30   ? 516  ARG C C     1 
ATOM   7578  O  O     . ARG C  2  516  ? 44.674  -41.158 85.040   1.00 13.42  ? 516  ARG C O     1 
ATOM   7579  C  CB    . ARG C  2  516  ? 44.464  -38.241 85.787   1.00 9.11   ? 516  ARG C CB    1 
ATOM   7580  C  CG    . ARG C  2  516  ? 44.085  -36.884 86.331   1.00 6.26   ? 516  ARG C CG    1 
ATOM   7581  C  CD    . ARG C  2  516  ? 45.180  -35.888 86.038   1.00 4.44   ? 516  ARG C CD    1 
ATOM   7582  N  NE    . ARG C  2  516  ? 46.468  -36.339 86.552   1.00 6.02   ? 516  ARG C NE    1 
ATOM   7583  C  CZ    . ARG C  2  516  ? 47.570  -36.479 85.818   1.00 6.33   ? 516  ARG C CZ    1 
ATOM   7584  N  NH1   . ARG C  2  516  ? 47.552  -36.192 84.525   1.00 5.18   ? 516  ARG C NH1   1 
ATOM   7585  N  NH2   . ARG C  2  516  ? 48.699  -36.896 86.382   1.00 6.76   ? 516  ARG C NH2   1 
ATOM   7586  N  N     . ARG C  2  517  ? 42.681  -40.592 84.131   1.00 9.24   ? 517  ARG C N     1 
ATOM   7587  C  CA    . ARG C  2  517  ? 42.812  -41.408 82.925   1.00 10.76  ? 517  ARG C CA    1 
ATOM   7588  C  C     . ARG C  2  517  ? 42.616  -40.491 81.734   1.00 10.83  ? 517  ARG C C     1 
ATOM   7589  O  O     . ARG C  2  517  ? 41.514  -39.973 81.531   1.00 13.24  ? 517  ARG C O     1 
ATOM   7590  C  CB    . ARG C  2  517  ? 41.742  -42.499 82.870   1.00 14.22  ? 517  ARG C CB    1 
ATOM   7591  C  CG    . ARG C  2  517  ? 42.053  -43.772 83.632   1.00 17.20  ? 517  ARG C CG    1 
ATOM   7592  C  CD    . ARG C  2  517  ? 40.820  -44.678 83.659   1.00 28.81  ? 517  ARG C CD    1 
ATOM   7593  N  NE    . ARG C  2  517  ? 40.955  -45.783 84.608   1.00 32.62  ? 517  ARG C NE    1 
ATOM   7594  C  CZ    . ARG C  2  517  ? 39.936  -46.347 85.252   1.00 29.00  ? 517  ARG C CZ    1 
ATOM   7595  N  NH1   . ARG C  2  517  ? 38.696  -45.912 85.055   1.00 22.32  ? 517  ARG C NH1   1 
ATOM   7596  N  NH2   . ARG C  2  517  ? 40.161  -47.344 86.098   1.00 31.42  ? 517  ARG C NH2   1 
ATOM   7597  N  N     . LYS C  2  518  ? 43.672  -40.308 80.944   1.00 7.89   ? 518  LYS C N     1 
ATOM   7598  C  CA    . LYS C  2  518  ? 43.667  -39.340 79.850   1.00 8.45   ? 518  LYS C CA    1 
ATOM   7599  C  C     . LYS C  2  518  ? 43.141  -37.993 80.338   1.00 10.86  ? 518  LYS C C     1 
ATOM   7600  O  O     . LYS C  2  518  ? 42.256  -37.398 79.729   1.00 9.11   ? 518  LYS C O     1 
ATOM   7601  C  CB    . LYS C  2  518  ? 42.856  -39.847 78.653   1.00 8.61   ? 518  LYS C CB    1 
ATOM   7602  C  CG    . LYS C  2  518  ? 43.580  -40.888 77.802   1.00 12.82  ? 518  LYS C CG    1 
ATOM   7603  C  CD    . LYS C  2  518  ? 42.761  -41.283 76.573   1.00 19.39  ? 518  LYS C CD    1 
ATOM   7604  C  CE    . LYS C  2  518  ? 43.485  -42.309 75.700   1.00 25.37  ? 518  LYS C CE    1 
ATOM   7605  N  NZ    . LYS C  2  518  ? 43.653  -43.637 76.371   1.00 24.52  ? 518  LYS C NZ    1 
ATOM   7606  N  N     . GLY C  2  519  ? 43.651  -37.559 81.487   1.00 13.54  ? 519  GLY C N     1 
ATOM   7607  C  CA    . GLY C  2  519  ? 43.361  -36.245 82.025   1.00 10.91  ? 519  GLY C CA    1 
ATOM   7608  C  C     . GLY C  2  519  ? 42.023  -36.177 82.731   1.00 13.22  ? 519  GLY C C     1 
ATOM   7609  O  O     . GLY C  2  519  ? 41.797  -35.295 83.564   1.00 13.21  ? 519  GLY C O     1 
ATOM   7610  N  N     . GLU C  2  520  ? 41.147  -37.127 82.421   1.00 12.55  ? 520  GLU C N     1 
ATOM   7611  C  CA    . GLU C  2  520  ? 39.817  -37.154 83.010   1.00 15.46  ? 520  GLU C CA    1 
ATOM   7612  C  C     . GLU C  2  520  ? 39.891  -37.623 84.458   1.00 14.36  ? 520  GLU C C     1 
ATOM   7613  O  O     . GLU C  2  520  ? 40.485  -38.664 84.739   1.00 10.57  ? 520  GLU C O     1 
ATOM   7614  C  CB    . GLU C  2  520  ? 38.898  -38.070 82.209   1.00 14.36  ? 520  GLU C CB    1 
ATOM   7615  C  CG    . GLU C  2  520  ? 37.449  -37.607 82.177   1.00 25.58  ? 520  GLU C CG    1 
ATOM   7616  C  CD    . GLU C  2  520  ? 37.260  -36.331 81.360   1.00 41.26  ? 520  GLU C CD    1 
ATOM   7617  O  OE1   . GLU C  2  520  ? 36.280  -35.592 81.616   1.00 40.37  ? 520  GLU C OE1   1 
ATOM   7618  O  OE2   . GLU C  2  520  ? 38.090  -36.069 80.459   1.00 31.23  ? 520  GLU C OE2   1 
ATOM   7619  N  N     . PRO C  2  521  ? 39.309  -36.841 85.387   1.00 15.43  ? 521  PRO C N     1 
ATOM   7620  C  CA    . PRO C  2  521  ? 39.272  -37.209 86.807   1.00 12.84  ? 521  PRO C CA    1 
ATOM   7621  C  C     . PRO C  2  521  ? 38.357  -38.411 87.030   1.00 12.04  ? 521  PRO C C     1 
ATOM   7622  O  O     . PRO C  2  521  ? 37.223  -38.416 86.552   1.00 10.03  ? 521  PRO C O     1 
ATOM   7623  C  CB    . PRO C  2  521  ? 38.672  -35.966 87.480   1.00 10.28  ? 521  PRO C CB    1 
ATOM   7624  C  CG    . PRO C  2  521  ? 38.705  -34.886 86.453   1.00 9.38   ? 521  PRO C CG    1 
ATOM   7625  C  CD    . PRO C  2  521  ? 38.600  -35.577 85.136   1.00 13.30  ? 521  PRO C CD    1 
ATOM   7626  N  N     . VAL C  2  522  ? 38.834  -39.410 87.761   1.00 10.07  ? 522  VAL C N     1 
ATOM   7627  C  CA    . VAL C  2  522  ? 38.049  -40.621 87.950   1.00 14.81  ? 522  VAL C CA    1 
ATOM   7628  C  C     . VAL C  2  522  ? 38.336  -41.288 89.304   1.00 15.16  ? 522  VAL C C     1 
ATOM   7629  O  O     . VAL C  2  522  ? 39.462  -41.243 89.802   1.00 14.41  ? 522  VAL C O     1 
ATOM   7630  C  CB    . VAL C  2  522  ? 38.258  -41.600 86.766   1.00 10.91  ? 522  VAL C CB    1 
ATOM   7631  C  CG1   . VAL C  2  522  ? 39.689  -42.092 86.723   1.00 9.69   ? 522  VAL C CG1   1 
ATOM   7632  C  CG2   . VAL C  2  522  ? 37.273  -42.759 86.839   1.00 19.80  ? 522  VAL C CG2   1 
ATOM   7633  N  N     . ILE C  2  523  ? 37.309  -41.880 89.910   1.00 12.73  ? 523  ILE C N     1 
ATOM   7634  C  CA    . ILE C  2  523  ? 37.471  -42.524 91.211   1.00 15.60  ? 523  ILE C CA    1 
ATOM   7635  C  C     . ILE C  2  523  ? 37.683  -44.026 91.037   1.00 14.47  ? 523  ILE C C     1 
ATOM   7636  O  O     . ILE C  2  523  ? 36.823  -44.725 90.493   1.00 17.36  ? 523  ILE C O     1 
ATOM   7637  C  CB    . ILE C  2  523  ? 36.257  -42.267 92.132   1.00 17.77  ? 523  ILE C CB    1 
ATOM   7638  C  CG1   . ILE C  2  523  ? 35.888  -40.781 92.135   1.00 13.69  ? 523  ILE C CG1   1 
ATOM   7639  C  CG2   . ILE C  2  523  ? 36.545  -42.759 93.542   1.00 16.08  ? 523  ILE C CG2   1 
ATOM   7640  C  CD1   . ILE C  2  523  ? 37.014  -39.865 92.570   1.00 10.76  ? 523  ILE C CD1   1 
ATOM   7641  N  N     . VAL C  2  524  ? 38.827  -44.522 91.497   1.00 12.17  ? 524  VAL C N     1 
ATOM   7642  C  CA    . VAL C  2  524  ? 39.212  -45.904 91.223   1.00 12.69  ? 524  VAL C CA    1 
ATOM   7643  C  C     . VAL C  2  524  ? 39.587  -46.667 92.485   1.00 16.75  ? 524  VAL C C     1 
ATOM   7644  O  O     . VAL C  2  524  ? 39.426  -46.164 93.598   1.00 24.44  ? 524  VAL C O     1 
ATOM   7645  C  CB    . VAL C  2  524  ? 40.380  -45.982 90.212   1.00 14.81  ? 524  VAL C CB    1 
ATOM   7646  C  CG1   . VAL C  2  524  ? 39.935  -45.497 88.837   1.00 12.14  ? 524  VAL C CG1   1 
ATOM   7647  C  CG2   . VAL C  2  524  ? 41.576  -45.176 90.706   1.00 14.53  ? 524  VAL C CG2   1 
ATOM   7648  N  N     . SER C  2  525  ? 40.086  -47.885 92.303   1.00 16.10  ? 525  SER C N     1 
ATOM   7649  C  CA    . SER C  2  525  ? 40.516  -48.714 93.422   1.00 17.93  ? 525  SER C CA    1 
ATOM   7650  C  C     . SER C  2  525  ? 42.033  -48.886 93.368   1.00 17.28  ? 525  SER C C     1 
ATOM   7651  O  O     . SER C  2  525  ? 42.624  -48.792 92.294   1.00 20.56  ? 525  SER C O     1 
ATOM   7652  C  CB    . SER C  2  525  ? 39.825  -50.074 93.346   1.00 19.93  ? 525  SER C CB    1 
ATOM   7653  O  OG    . SER C  2  525  ? 39.688  -50.644 94.636   1.00 37.10  ? 525  SER C OG    1 
ATOM   7654  N  N     . PRO C  2  526  ? 42.676  -49.124 94.522   1.00 13.41  ? 526  PRO C N     1 
ATOM   7655  C  CA    . PRO C  2  526  ? 44.138  -49.296 94.554   1.00 17.06  ? 526  PRO C CA    1 
ATOM   7656  C  C     . PRO C  2  526  ? 44.639  -50.391 93.616   1.00 22.01  ? 526  PRO C C     1 
ATOM   7657  O  O     . PRO C  2  526  ? 45.819  -50.401 93.242   1.00 19.16  ? 526  PRO C O     1 
ATOM   7658  C  CB    . PRO C  2  526  ? 44.408  -49.688 96.004   1.00 14.94  ? 526  PRO C CB    1 
ATOM   7659  C  CG    . PRO C  2  526  ? 43.328  -49.016 96.756   1.00 21.42  ? 526  PRO C CG    1 
ATOM   7660  C  CD    . PRO C  2  526  ? 42.106  -49.047 95.877   1.00 16.42  ? 526  PRO C CD    1 
ATOM   7661  N  N     . GLU C  2  527  ? 43.744  -51.305 93.249   1.00 22.83  ? 527  GLU C N     1 
ATOM   7662  C  CA    . GLU C  2  527  ? 44.058  -52.361 92.297   1.00 18.17  ? 527  GLU C CA    1 
ATOM   7663  C  C     . GLU C  2  527  ? 44.133  -51.809 90.879   1.00 17.43  ? 527  GLU C C     1 
ATOM   7664  O  O     . GLU C  2  527  ? 44.761  -52.409 90.010   1.00 21.41  ? 527  GLU C O     1 
ATOM   7665  C  CB    . GLU C  2  527  ? 43.021  -53.486 92.375   1.00 19.14  ? 527  GLU C CB    1 
ATOM   7666  C  CG    . GLU C  2  527  ? 43.155  -54.383 93.610   1.00 37.22  ? 527  GLU C CG    1 
ATOM   7667  C  CD    . GLU C  2  527  ? 42.506  -53.800 94.864   1.00 37.93  ? 527  GLU C CD    1 
ATOM   7668  O  OE1   . GLU C  2  527  ? 41.360  -53.309 94.771   1.00 36.24  ? 527  GLU C OE1   1 
ATOM   7669  O  OE2   . GLU C  2  527  ? 43.141  -53.840 95.944   1.00 34.12  ? 527  GLU C OE2   1 
ATOM   7670  N  N     . GLU C  2  528  ? 43.494  -50.662 90.655   1.00 15.11  ? 528  GLU C N     1 
ATOM   7671  C  CA    . GLU C  2  528  ? 43.486  -50.013 89.344   1.00 14.82  ? 528  GLU C CA    1 
ATOM   7672  C  C     . GLU C  2  528  ? 44.557  -48.930 89.171   1.00 11.36  ? 528  GLU C C     1 
ATOM   7673  O  O     . GLU C  2  528  ? 44.661  -48.333 88.100   1.00 8.76   ? 528  GLU C O     1 
ATOM   7674  C  CB    . GLU C  2  528  ? 42.113  -49.399 89.065   1.00 15.28  ? 528  GLU C CB    1 
ATOM   7675  C  CG    . GLU C  2  528  ? 41.055  -50.380 88.617   1.00 16.14  ? 528  GLU C CG    1 
ATOM   7676  C  CD    . GLU C  2  528  ? 39.679  -49.747 88.540   1.00 22.61  ? 528  GLU C CD    1 
ATOM   7677  O  OE1   . GLU C  2  528  ? 39.172  -49.312 89.600   1.00 22.73  ? 528  GLU C OE1   1 
ATOM   7678  O  OE2   . GLU C  2  528  ? 39.109  -49.677 87.426   1.00 19.92  ? 528  GLU C OE2   1 
ATOM   7679  N  N     . VAL C  2  529  ? 45.352  -48.680 90.208   1.00 10.51  ? 529  VAL C N     1 
ATOM   7680  C  CA    . VAL C  2  529  ? 46.300  -47.569 90.175   1.00 10.34  ? 529  VAL C CA    1 
ATOM   7681  C  C     . VAL C  2  529  ? 47.654  -48.027 89.651   1.00 9.63   ? 529  VAL C C     1 
ATOM   7682  O  O     . VAL C  2  529  ? 48.365  -48.777 90.310   1.00 17.96  ? 529  VAL C O     1 
ATOM   7683  C  CB    . VAL C  2  529  ? 46.478  -46.932 91.579   1.00 10.71  ? 529  VAL C CB    1 
ATOM   7684  C  CG1   . VAL C  2  529  ? 47.665  -45.993 91.599   1.00 7.99   ? 529  VAL C CG1   1 
ATOM   7685  C  CG2   . VAL C  2  529  ? 45.217  -46.205 92.005   1.00 9.99   ? 529  VAL C CG2   1 
ATOM   7686  N  N     . GLU C  2  530  ? 47.989  -47.585 88.446   1.00 8.15   ? 530  GLU C N     1 
ATOM   7687  C  CA    . GLU C  2  530  ? 49.255  -47.920 87.807   1.00 9.22   ? 530  GLU C CA    1 
ATOM   7688  C  C     . GLU C  2  530  ? 50.401  -46.997 88.231   1.00 12.25  ? 530  GLU C C     1 
ATOM   7689  O  O     . GLU C  2  530  ? 51.531  -47.442 88.448   1.00 14.57  ? 530  GLU C O     1 
ATOM   7690  C  CB    . GLU C  2  530  ? 49.075  -47.922 86.290   1.00 10.57  ? 530  GLU C CB    1 
ATOM   7691  C  CG    . GLU C  2  530  ? 47.623  -48.139 85.888   1.00 10.59  ? 530  GLU C CG    1 
ATOM   7692  C  CD    . GLU C  2  530  ? 47.461  -48.582 84.454   1.00 12.75  ? 530  GLU C CD    1 
ATOM   7693  O  OE1   . GLU C  2  530  ? 46.454  -48.199 83.815   1.00 13.36  ? 530  GLU C OE1   1 
ATOM   7694  O  OE2   . GLU C  2  530  ? 48.335  -49.329 83.970   1.00 20.89  ? 530  GLU C OE2   1 
ATOM   7695  N  N     . PHE C  2  531  ? 50.102  -45.707 88.333   1.00 11.78  ? 531  PHE C N     1 
ATOM   7696  C  CA    . PHE C  2  531  ? 51.097  -44.714 88.718   1.00 9.46   ? 531  PHE C CA    1 
ATOM   7697  C  C     . PHE C  2  531  ? 50.530  -43.708 89.721   1.00 9.37   ? 531  PHE C C     1 
ATOM   7698  O  O     . PHE C  2  531  ? 49.322  -43.659 89.945   1.00 10.25  ? 531  PHE C O     1 
ATOM   7699  C  CB    . PHE C  2  531  ? 51.618  -43.972 87.489   1.00 9.85   ? 531  PHE C CB    1 
ATOM   7700  C  CG    . PHE C  2  531  ? 52.509  -44.795 86.604   1.00 11.59  ? 531  PHE C CG    1 
ATOM   7701  C  CD1   . PHE C  2  531  ? 52.018  -45.351 85.427   1.00 11.54  ? 531  PHE C CD1   1 
ATOM   7702  C  CD2   . PHE C  2  531  ? 53.845  -44.992 86.933   1.00 10.57  ? 531  PHE C CD2   1 
ATOM   7703  C  CE1   . PHE C  2  531  ? 52.842  -46.097 84.592   1.00 9.33   ? 531  PHE C CE1   1 
ATOM   7704  C  CE2   . PHE C  2  531  ? 54.676  -45.740 86.106   1.00 9.58   ? 531  PHE C CE2   1 
ATOM   7705  C  CZ    . PHE C  2  531  ? 54.173  -46.293 84.934   1.00 8.55   ? 531  PHE C CZ    1 
ATOM   7706  N  N     . MET C  2  532  ? 51.405  -42.906 90.323   1.00 9.52   ? 532  MET C N     1 
ATOM   7707  C  CA    . MET C  2  532  ? 50.975  -41.859 91.254   1.00 9.80   ? 532  MET C CA    1 
ATOM   7708  C  C     . MET C  2  532  ? 51.835  -40.598 91.106   1.00 7.77   ? 532  MET C C     1 
ATOM   7709  O  O     . MET C  2  532  ? 53.023  -40.685 90.820   1.00 8.00   ? 532  MET C O     1 
ATOM   7710  C  CB    . MET C  2  532  ? 51.036  -42.388 92.686   1.00 9.65   ? 532  MET C CB    1 
ATOM   7711  C  CG    . MET C  2  532  ? 50.434  -41.491 93.751   1.00 10.35  ? 532  MET C CG    1 
ATOM   7712  S  SD    . MET C  2  532  ? 50.809  -42.169 95.381   1.00 15.07  ? 532  MET C SD    1 
ATOM   7713  C  CE    . MET C  2  532  ? 50.026  -41.002 96.480   1.00 17.68  ? 532  MET C CE    1 
ATOM   7714  N  N     . ASP C  2  533  ? 51.232  -39.428 91.289   1.00 7.04   ? 533  ASP C N     1 
ATOM   7715  C  CA    . ASP C  2  533  ? 51.965  -38.167 91.197   1.00 6.51   ? 533  ASP C CA    1 
ATOM   7716  C  C     . ASP C  2  533  ? 53.128  -38.118 92.177   1.00 7.01   ? 533  ASP C C     1 
ATOM   7717  O  O     . ASP C  2  533  ? 53.041  -38.649 93.279   1.00 12.21  ? 533  ASP C O     1 
ATOM   7718  C  CB    . ASP C  2  533  ? 51.035  -36.991 91.486   1.00 8.49   ? 533  ASP C CB    1 
ATOM   7719  C  CG    . ASP C  2  533  ? 50.139  -36.651 90.318   1.00 11.07  ? 533  ASP C CG    1 
ATOM   7720  O  OD1   . ASP C  2  533  ? 49.808  -37.559 89.527   1.00 14.34  ? 533  ASP C OD1   1 
ATOM   7721  O  OD2   . ASP C  2  533  ? 49.763  -35.466 90.193   1.00 13.37  ? 533  ASP C OD2   1 
ATOM   7722  N  N     . VAL C  2  534  ? 54.217  -37.473 91.782   1.00 5.68   ? 534  VAL C N     1 
ATOM   7723  C  CA    . VAL C  2  534  ? 55.361  -37.330 92.667   1.00 4.49   ? 534  VAL C CA    1 
ATOM   7724  C  C     . VAL C  2  534  ? 55.056  -36.334 93.773   1.00 5.51   ? 534  VAL C C     1 
ATOM   7725  O  O     . VAL C  2  534  ? 55.458  -36.522 94.922   1.00 10.12  ? 534  VAL C O     1 
ATOM   7726  C  CB    . VAL C  2  534  ? 56.597  -36.865 91.896   1.00 4.74   ? 534  VAL C CB    1 
ATOM   7727  C  CG1   . VAL C  2  534  ? 57.706  -36.462 92.850   1.00 5.27   ? 534  VAL C CG1   1 
ATOM   7728  C  CG2   . VAL C  2  534  ? 57.065  -37.962 90.951   1.00 6.57   ? 534  VAL C CG2   1 
ATOM   7729  N  N     . SER C  2  535  ? 54.298  -35.299 93.423   1.00 6.13   ? 535  SER C N     1 
ATOM   7730  C  CA    . SER C  2  535  ? 54.070  -34.156 94.301   1.00 4.65   ? 535  SER C CA    1 
ATOM   7731  C  C     . SER C  2  535  ? 53.103  -33.220 93.609   1.00 4.19   ? 535  SER C C     1 
ATOM   7732  O  O     . SER C  2  535  ? 52.927  -33.314 92.400   1.00 6.18   ? 535  SER C O     1 
ATOM   7733  C  CB    . SER C  2  535  ? 55.388  -33.416 94.533   1.00 4.57   ? 535  SER C CB    1 
ATOM   7734  O  OG    . SER C  2  535  ? 55.225  -32.343 95.439   1.00 3.86   ? 535  SER C OG    1 
ATOM   7735  N  N     . PRO C  2  536  ? 52.434  -32.338 94.370   1.00 4.75   ? 536  PRO C N     1 
ATOM   7736  C  CA    . PRO C  2  536  ? 51.700  -31.258 93.700   1.00 3.18   ? 536  PRO C CA    1 
ATOM   7737  C  C     . PRO C  2  536  ? 52.647  -30.211 93.088   1.00 2.56   ? 536  PRO C C     1 
ATOM   7738  O  O     . PRO C  2  536  ? 52.274  -29.537 92.124   1.00 2.44   ? 536  PRO C O     1 
ATOM   7739  C  CB    . PRO C  2  536  ? 50.840  -30.664 94.819   1.00 2.83   ? 536  PRO C CB    1 
ATOM   7740  C  CG    . PRO C  2  536  ? 51.472  -31.122 96.095   1.00 2.99   ? 536  PRO C CG    1 
ATOM   7741  C  CD    . PRO C  2  536  ? 52.113  -32.431 95.806   1.00 4.59   ? 536  PRO C CD    1 
ATOM   7742  N  N     . LYS C  2  537  ? 53.866  -30.109 93.615   1.00 1.72   ? 537  LYS C N     1 
ATOM   7743  C  CA    . LYS C  2  537  ? 54.844  -29.153 93.122   1.00 1.42   ? 537  LYS C CA    1 
ATOM   7744  C  C     . LYS C  2  537  ? 55.006  -29.282 91.620   1.00 2.30   ? 537  LYS C C     1 
ATOM   7745  O  O     . LYS C  2  537  ? 55.298  -28.303 90.929   1.00 1.96   ? 537  LYS C O     1 
ATOM   7746  C  CB    . LYS C  2  537  ? 56.210  -29.399 93.760   1.00 1.70   ? 537  LYS C CB    1 
ATOM   7747  C  CG    . LYS C  2  537  ? 56.255  -29.347 95.266   1.00 3.57   ? 537  LYS C CG    1 
ATOM   7748  C  CD    . LYS C  2  537  ? 57.707  -29.401 95.756   1.00 8.07   ? 537  LYS C CD    1 
ATOM   7749  C  CE    . LYS C  2  537  ? 57.816  -29.634 97.263   1.00 14.22  ? 537  LYS C CE    1 
ATOM   7750  N  NZ    . LYS C  2  537  ? 57.273  -28.519 98.102   1.00 16.87  ? 537  LYS C NZ    1 
ATOM   7751  N  N     . GLN C  2  538  ? 54.795  -30.494 91.113   1.00 2.78   ? 538  GLN C N     1 
ATOM   7752  C  CA    . GLN C  2  538  ? 55.078  -30.792 89.714   1.00 3.09   ? 538  GLN C CA    1 
ATOM   7753  C  C     . GLN C  2  538  ? 54.088  -30.169 88.732   1.00 2.67   ? 538  GLN C C     1 
ATOM   7754  O  O     . GLN C  2  538  ? 54.360  -30.115 87.537   1.00 2.54   ? 538  GLN C O     1 
ATOM   7755  C  CB    . GLN C  2  538  ? 55.171  -32.304 89.479   1.00 3.10   ? 538  GLN C CB    1 
ATOM   7756  C  CG    . GLN C  2  538  ? 53.832  -33.012 89.379   1.00 3.36   ? 538  GLN C CG    1 
ATOM   7757  C  CD    . GLN C  2  538  ? 53.983  -34.496 89.127   1.00 4.13   ? 538  GLN C CD    1 
ATOM   7758  O  OE1   . GLN C  2  538  ? 54.341  -35.260 90.022   1.00 4.42   ? 538  GLN C OE1   1 
ATOM   7759  N  NE2   . GLN C  2  538  ? 53.715  -34.911 87.899   1.00 4.83   ? 538  GLN C NE2   1 
ATOM   7760  N  N     . VAL C  2  539  ? 52.949  -29.699 89.229   1.00 1.69   ? 539  VAL C N     1 
ATOM   7761  C  CA    . VAL C  2  539  ? 51.932  -29.141 88.342   1.00 1.78   ? 539  VAL C CA    1 
ATOM   7762  C  C     . VAL C  2  539  ? 52.202  -27.665 88.039   1.00 1.48   ? 539  VAL C C     1 
ATOM   7763  O  O     . VAL C  2  539  ? 51.666  -27.105 87.084   1.00 1.01   ? 539  VAL C O     1 
ATOM   7764  C  CB    . VAL C  2  539  ? 50.505  -29.359 88.915   1.00 1.84   ? 539  VAL C CB    1 
ATOM   7765  C  CG1   . VAL C  2  539  ? 49.443  -28.823 87.971   1.00 1.40   ? 539  VAL C CG1   1 
ATOM   7766  C  CG2   . VAL C  2  539  ? 50.276  -30.837 89.165   1.00 2.84   ? 539  VAL C CG2   1 
ATOM   7767  N  N     . PHE C  2  540  ? 53.078  -27.051 88.824   1.00 1.51   ? 540  PHE C N     1 
ATOM   7768  C  CA    . PHE C  2  540  ? 53.264  -25.612 88.743   1.00 1.04   ? 540  PHE C CA    1 
ATOM   7769  C  C     . PHE C  2  540  ? 54.702  -25.231 88.464   1.00 0.98   ? 540  PHE C C     1 
ATOM   7770  O  O     . PHE C  2  540  ? 55.612  -26.042 88.629   1.00 1.25   ? 540  PHE C O     1 
ATOM   7771  C  CB    . PHE C  2  540  ? 52.765  -24.945 90.026   1.00 0.74   ? 540  PHE C CB    1 
ATOM   7772  C  CG    . PHE C  2  540  ? 51.334  -25.264 90.343   1.00 0.92   ? 540  PHE C CG    1 
ATOM   7773  C  CD1   . PHE C  2  540  ? 51.016  -26.245 91.266   1.00 1.14   ? 540  PHE C CD1   1 
ATOM   7774  C  CD2   . PHE C  2  540  ? 50.305  -24.607 89.689   1.00 1.04   ? 540  PHE C CD2   1 
ATOM   7775  C  CE1   . PHE C  2  540  ? 49.699  -26.548 91.546   1.00 1.38   ? 540  PHE C CE1   1 
ATOM   7776  C  CE2   . PHE C  2  540  ? 48.984  -24.906 89.963   1.00 0.91   ? 540  PHE C CE2   1 
ATOM   7777  C  CZ    . PHE C  2  540  ? 48.681  -25.877 90.894   1.00 1.20   ? 540  PHE C CZ    1 
ATOM   7778  N  N     . SER C  2  541  ? 54.892  -23.985 88.041   1.00 0.88   ? 541  SER C N     1 
ATOM   7779  C  CA    . SER C  2  541  ? 56.206  -23.455 87.722   1.00 0.76   ? 541  SER C CA    1 
ATOM   7780  C  C     . SER C  2  541  ? 56.973  -23.266 89.001   1.00 0.80   ? 541  SER C C     1 
ATOM   7781  O  O     . SER C  2  541  ? 56.457  -23.543 90.080   1.00 1.16   ? 541  SER C O     1 
ATOM   7782  C  CB    . SER C  2  541  ? 56.071  -22.104 87.031   1.00 1.23   ? 541  SER C CB    1 
ATOM   7783  O  OG    . SER C  2  541  ? 55.350  -21.200 87.845   1.00 1.16   ? 541  SER C OG    1 
ATOM   7784  N  N     . VAL C  2  542  ? 58.204  -22.786 88.883   1.00 0.86   ? 542  VAL C N     1 
ATOM   7785  C  CA    . VAL C  2  542  ? 59.026  -22.530 90.058   1.00 0.91   ? 542  VAL C CA    1 
ATOM   7786  C  C     . VAL C  2  542  ? 58.457  -21.345 90.837   1.00 1.07   ? 542  VAL C C     1 
ATOM   7787  O  O     . VAL C  2  542  ? 58.336  -21.394 92.057   1.00 0.91   ? 542  VAL C O     1 
ATOM   7788  C  CB    . VAL C  2  542  ? 60.502  -22.289 89.678   1.00 0.76   ? 542  VAL C CB    1 
ATOM   7789  C  CG1   . VAL C  2  542  ? 61.294  -21.803 90.865   1.00 0.76   ? 542  VAL C CG1   1 
ATOM   7790  C  CG2   . VAL C  2  542  ? 61.115  -23.556 89.115   1.00 0.89   ? 542  VAL C CG2   1 
ATOM   7791  N  N     . ASN C  2  543  ? 58.074  -20.293 90.120   1.00 1.30   ? 543  ASN C N     1 
ATOM   7792  C  CA    . ASN C  2  543  ? 57.511  -19.109 90.758   1.00 1.05   ? 543  ASN C CA    1 
ATOM   7793  C  C     . ASN C  2  543  ? 56.213  -19.389 91.471   1.00 0.68   ? 543  ASN C C     1 
ATOM   7794  O  O     . ASN C  2  543  ? 56.052  -19.023 92.627   1.00 0.68   ? 543  ASN C O     1 
ATOM   7795  C  CB    . ASN C  2  543  ? 57.300  -18.000 89.740   1.00 1.26   ? 543  ASN C CB    1 
ATOM   7796  C  CG    . ASN C  2  543  ? 58.594  -17.456 89.222   1.00 1.61   ? 543  ASN C CG    1 
ATOM   7797  O  OD1   . ASN C  2  543  ? 59.211  -18.035 88.333   1.00 2.83   ? 543  ASN C OD1   1 
ATOM   7798  N  ND2   . ASN C  2  543  ? 59.032  -16.350 89.794   1.00 1.26   ? 543  ASN C ND2   1 
ATOM   7799  N  N     . THR C  2  544  ? 55.291  -20.036 90.770   1.00 0.64   ? 544  THR C N     1 
ATOM   7800  C  CA    . THR C  2  544  ? 54.009  -20.408 91.346   1.00 0.77   ? 544  THR C CA    1 
ATOM   7801  C  C     . THR C  2  544  ? 54.206  -21.284 92.579   1.00 1.52   ? 544  THR C C     1 
ATOM   7802  O  O     . THR C  2  544  ? 53.376  -21.284 93.497   1.00 1.74   ? 544  THR C O     1 
ATOM   7803  C  CB    . THR C  2  544  ? 53.152  -21.164 90.340   1.00 0.56   ? 544  THR C CB    1 
ATOM   7804  O  OG1   . THR C  2  544  ? 53.126  -20.436 89.116   1.00 0.70   ? 544  THR C OG1   1 
ATOM   7805  C  CG2   . THR C  2  544  ? 51.740  -21.310 90.848   1.00 0.58   ? 544  THR C CG2   1 
ATOM   7806  N  N     . ASN C  2  545  ? 55.314  -22.019 92.607   1.00 1.08   ? 545  ASN C N     1 
ATOM   7807  C  CA    . ASN C  2  545  ? 55.614  -22.875 93.744   1.00 1.10   ? 545  ASN C CA    1 
ATOM   7808  C  C     . ASN C  2  545  ? 56.109  -22.146 94.988   1.00 1.95   ? 545  ASN C C     1 
ATOM   7809  O  O     . ASN C  2  545  ? 56.258  -22.757 96.041   1.00 3.78   ? 545  ASN C O     1 
ATOM   7810  C  CB    . ASN C  2  545  ? 56.598  -23.965 93.349   1.00 1.27   ? 545  ASN C CB    1 
ATOM   7811  C  CG    . ASN C  2  545  ? 55.904  -25.232 92.954   1.00 1.66   ? 545  ASN C CG    1 
ATOM   7812  O  OD1   . ASN C  2  545  ? 55.252  -25.871 93.778   1.00 2.20   ? 545  ASN C OD1   1 
ATOM   7813  N  ND2   . ASN C  2  545  ? 56.021  -25.604 91.689   1.00 1.75   ? 545  ASN C ND2   1 
ATOM   7814  N  N     . LEU C  2  546  ? 56.363  -20.849 94.870   1.00 1.52   ? 546  LEU C N     1 
ATOM   7815  C  CA    . LEU C  2  546  ? 56.801  -20.058 96.008   1.00 0.98   ? 546  LEU C CA    1 
ATOM   7816  C  C     . LEU C  2  546  ? 55.641  -19.369 96.723   1.00 1.01   ? 546  LEU C C     1 
ATOM   7817  O  O     . LEU C  2  546  ? 55.859  -18.616 97.662   1.00 1.05   ? 546  LEU C O     1 
ATOM   7818  C  CB    . LEU C  2  546  ? 57.839  -19.033 95.569   1.00 1.06   ? 546  LEU C CB    1 
ATOM   7819  C  CG    . LEU C  2  546  ? 59.160  -19.655 95.130   1.00 1.45   ? 546  LEU C CG    1 
ATOM   7820  C  CD1   . LEU C  2  546  ? 60.016  -18.658 94.375   1.00 0.94   ? 546  LEU C CD1   1 
ATOM   7821  C  CD2   . LEU C  2  546  ? 59.901  -20.181 96.339   1.00 2.27   ? 546  LEU C CD2   1 
ATOM   7822  N  N     . ILE C  2  547  ? 54.414  -19.629 96.279   1.00 0.98   ? 547  ILE C N     1 
ATOM   7823  C  CA    . ILE C  2  547  ? 53.226  -19.041 96.897   1.00 0.89   ? 547  ILE C CA    1 
ATOM   7824  C  C     . ILE C  2  547  ? 52.604  -19.951 97.953   1.00 1.16   ? 547  ILE C C     1 
ATOM   7825  O  O     . ILE C  2  547  ? 51.960  -20.942 97.623   1.00 1.74   ? 547  ILE C O     1 
ATOM   7826  C  CB    . ILE C  2  547  ? 52.124  -18.779 95.854   1.00 0.75   ? 547  ILE C CB    1 
ATOM   7827  C  CG1   . ILE C  2  547  ? 52.637  -17.906 94.716   1.00 0.55   ? 547  ILE C CG1   1 
ATOM   7828  C  CG2   . ILE C  2  547  ? 50.916  -18.140 96.510   1.00 0.68   ? 547  ILE C CG2   1 
ATOM   7829  C  CD1   . ILE C  2  547  ? 51.609  -17.693 93.639   1.00 0.49   ? 547  ILE C CD1   1 
ATOM   7830  N  N     . PRO C  2  548  ? 52.767  -19.607 99.232   1.00 1.11   ? 548  PRO C N     1 
ATOM   7831  C  CA    . PRO C  2  548  ? 52.107  -20.413 100.263  1.00 0.98   ? 548  PRO C CA    1 
ATOM   7832  C  C     . PRO C  2  548  ? 50.596  -20.307 100.167  1.00 1.00   ? 548  PRO C C     1 
ATOM   7833  O  O     . PRO C  2  548  ? 50.090  -19.321 99.651   1.00 1.10   ? 548  PRO C O     1 
ATOM   7834  C  CB    . PRO C  2  548  ? 52.606  -19.793 101.571  1.00 1.44   ? 548  PRO C CB    1 
ATOM   7835  C  CG    . PRO C  2  548  ? 53.142  -18.447 101.191  1.00 1.45   ? 548  PRO C CG    1 
ATOM   7836  C  CD    . PRO C  2  548  ? 53.643  -18.572 99.801   1.00 0.99   ? 548  PRO C CD    1 
ATOM   7837  N  N     . PHE C  2  549  ? 49.895  -21.333 100.633  1.00 1.80   ? 549  PHE C N     1 
ATOM   7838  C  CA    . PHE C  2  549  ? 48.433  -21.370 100.618  1.00 1.70   ? 549  PHE C CA    1 
ATOM   7839  C  C     . PHE C  2  549  ? 47.846  -21.130 99.231   1.00 1.54   ? 549  PHE C C     1 
ATOM   7840  O  O     . PHE C  2  549  ? 46.709  -20.680 99.104   1.00 1.46   ? 549  PHE C O     1 
ATOM   7841  C  CB    . PHE C  2  549  ? 47.862  -20.359 101.602  1.00 1.22   ? 549  PHE C CB    1 
ATOM   7842  C  CG    . PHE C  2  549  ? 48.446  -20.461 102.970  1.00 1.26   ? 549  PHE C CG    1 
ATOM   7843  C  CD1   . PHE C  2  549  ? 48.005  -21.429 103.854  1.00 2.23   ? 549  PHE C CD1   1 
ATOM   7844  C  CD2   . PHE C  2  549  ? 49.434  -19.587 103.381  1.00 1.65   ? 549  PHE C CD2   1 
ATOM   7845  C  CE1   . PHE C  2  549  ? 48.548  -21.525 105.130  1.00 3.46   ? 549  PHE C CE1   1 
ATOM   7846  C  CE2   . PHE C  2  549  ? 49.976  -19.672 104.654  1.00 2.34   ? 549  PHE C CE2   1 
ATOM   7847  C  CZ    . PHE C  2  549  ? 49.533  -20.640 105.529  1.00 2.30   ? 549  PHE C CZ    1 
ATOM   7848  N  N     . LEU C  2  550  ? 48.618  -21.465 98.202   1.00 1.39   ? 550  LEU C N     1 
ATOM   7849  C  CA    . LEU C  2  550  ? 48.212  -21.256 96.821   1.00 1.19   ? 550  LEU C CA    1 
ATOM   7850  C  C     . LEU C  2  550  ? 46.851  -21.881 96.527   1.00 1.57   ? 550  LEU C C     1 
ATOM   7851  O  O     . LEU C  2  550  ? 46.106  -21.382 95.690   1.00 1.96   ? 550  LEU C O     1 
ATOM   7852  C  CB    . LEU C  2  550  ? 49.269  -21.814 95.873   1.00 1.09   ? 550  LEU C CB    1 
ATOM   7853  C  CG    . LEU C  2  550  ? 48.860  -21.958 94.409   1.00 1.40   ? 550  LEU C CG    1 
ATOM   7854  C  CD1   . LEU C  2  550  ? 48.708  -20.594 93.768   1.00 1.24   ? 550  LEU C CD1   1 
ATOM   7855  C  CD2   . LEU C  2  550  ? 49.860  -22.814 93.646   1.00 1.59   ? 550  LEU C CD2   1 
ATOM   7856  N  N     . GLU C  2  551  ? 46.519  -22.959 97.231   1.00 1.89   ? 551  GLU C N     1 
ATOM   7857  C  CA    . GLU C  2  551  ? 45.225  -23.613 97.051   1.00 2.05   ? 551  GLU C CA    1 
ATOM   7858  C  C     . GLU C  2  551  ? 44.060  -22.707 97.448   1.00 3.04   ? 551  GLU C C     1 
ATOM   7859  O  O     . GLU C  2  551  ? 42.922  -22.928 97.030   1.00 3.22   ? 551  GLU C O     1 
ATOM   7860  C  CB    . GLU C  2  551  ? 45.157  -24.930 97.827   1.00 2.48   ? 551  GLU C CB    1 
ATOM   7861  C  CG    . GLU C  2  551  ? 45.367  -24.806 99.327   1.00 3.20   ? 551  GLU C CG    1 
ATOM   7862  C  CD    . GLU C  2  551  ? 46.829  -24.866 99.729   1.00 3.18   ? 551  GLU C CD    1 
ATOM   7863  O  OE1   . GLU C  2  551  ? 47.119  -25.226 100.891  1.00 3.81   ? 551  GLU C OE1   1 
ATOM   7864  O  OE2   . GLU C  2  551  ? 47.692  -24.555 98.884   1.00 3.12   ? 551  GLU C OE2   1 
ATOM   7865  N  N     . HIS C  2  552  ? 44.346  -21.686 98.253   1.00 3.15   ? 552  HIS C N     1 
ATOM   7866  C  CA    . HIS C  2  552  ? 43.314  -20.751 98.687   1.00 2.62   ? 552  HIS C CA    1 
ATOM   7867  C  C     . HIS C  2  552  ? 43.261  -19.488 97.819   1.00 1.59   ? 552  HIS C C     1 
ATOM   7868  O  O     . HIS C  2  552  ? 42.483  -18.583 98.100   1.00 1.55   ? 552  HIS C O     1 
ATOM   7869  C  CB    . HIS C  2  552  ? 43.505  -20.369 100.158  1.00 2.38   ? 552  HIS C CB    1 
ATOM   7870  C  CG    . HIS C  2  552  ? 43.585  -21.540 101.092  1.00 3.16   ? 552  HIS C CG    1 
ATOM   7871  N  ND1   . HIS C  2  552  ? 42.467  -22.160 101.609  1.00 3.85   ? 552  HIS C ND1   1 
ATOM   7872  C  CD2   . HIS C  2  552  ? 44.652  -22.183 101.625  1.00 2.51   ? 552  HIS C CD2   1 
ATOM   7873  C  CE1   . HIS C  2  552  ? 42.841  -23.140 102.413  1.00 3.73   ? 552  HIS C CE1   1 
ATOM   7874  N  NE2   . HIS C  2  552  ? 44.161  -23.174 102.443  1.00 3.25   ? 552  HIS C NE2   1 
ATOM   7875  N  N     . ASP C  2  553  ? 44.091  -19.429 96.779   1.00 1.29   ? 553  ASP C N     1 
ATOM   7876  C  CA    . ASP C  2  553  ? 44.150  -18.263 95.893   1.00 0.96   ? 553  ASP C CA    1 
ATOM   7877  C  C     . ASP C  2  553  ? 43.545  -18.521 94.526   1.00 0.85   ? 553  ASP C C     1 
ATOM   7878  O  O     . ASP C  2  553  ? 43.904  -19.488 93.860   1.00 1.15   ? 553  ASP C O     1 
ATOM   7879  C  CB    . ASP C  2  553  ? 45.596  -17.817 95.683   1.00 0.63   ? 553  ASP C CB    1 
ATOM   7880  C  CG    . ASP C  2  553  ? 46.212  -17.260 96.928   1.00 0.73   ? 553  ASP C CG    1 
ATOM   7881  O  OD1   . ASP C  2  553  ? 47.447  -17.352 97.073   1.00 0.71   ? 553  ASP C OD1   1 
ATOM   7882  O  OD2   . ASP C  2  553  ? 45.458  -16.730 97.769   1.00 0.98   ? 553  ASP C OD2   1 
ATOM   7883  N  N     . ASP C  2  554  ? 42.651  -17.640 94.095   1.00 0.70   ? 554  ASP C N     1 
ATOM   7884  C  CA    . ASP C  2  554  ? 42.109  -17.719 92.747   1.00 0.79   ? 554  ASP C CA    1 
ATOM   7885  C  C     . ASP C  2  554  ? 43.227  -17.615 91.727   1.00 0.80   ? 554  ASP C C     1 
ATOM   7886  O  O     . ASP C  2  554  ? 44.172  -16.853 91.903   1.00 0.64   ? 554  ASP C O     1 
ATOM   7887  C  CB    . ASP C  2  554  ? 41.077  -16.622 92.499   1.00 1.25   ? 554  ASP C CB    1 
ATOM   7888  C  CG    . ASP C  2  554  ? 40.474  -16.693 91.103   1.00 2.35   ? 554  ASP C CG    1 
ATOM   7889  O  OD1   . ASP C  2  554  ? 39.561  -17.524 90.891   1.00 4.04   ? 554  ASP C OD1   1 
ATOM   7890  O  OD2   . ASP C  2  554  ? 40.907  -15.919 90.216   1.00 1.69   ? 554  ASP C OD2   1 
ATOM   7891  N  N     . ALA C  2  555  ? 43.103  -18.389 90.656   1.00 1.23   ? 555  ALA C N     1 
ATOM   7892  C  CA    . ALA C  2  555  ? 44.162  -18.521 89.664   1.00 0.98   ? 555  ALA C CA    1 
ATOM   7893  C  C     . ALA C  2  555  ? 44.619  -17.189 89.089   1.00 0.85   ? 555  ALA C C     1 
ATOM   7894  O  O     . ALA C  2  555  ? 45.812  -16.974 88.902   1.00 0.83   ? 555  ALA C O     1 
ATOM   7895  C  CB    . ALA C  2  555  ? 43.723  -19.452 88.556   1.00 1.13   ? 555  ALA C CB    1 
ATOM   7896  N  N     . ASN C  2  556  ? 43.672  -16.294 88.823   1.00 1.23   ? 556  ASN C N     1 
ATOM   7897  C  CA    . ASN C  2  556  ? 43.993  -15.006 88.211   1.00 1.17   ? 556  ASN C CA    1 
ATOM   7898  C  C     . ASN C  2  556  ? 44.928  -14.140 89.046   1.00 0.62   ? 556  ASN C C     1 
ATOM   7899  O  O     . ASN C  2  556  ? 45.805  -13.484 88.506   1.00 0.77   ? 556  ASN C O     1 
ATOM   7900  C  CB    . ASN C  2  556  ? 42.725  -14.227 87.878   1.00 1.45   ? 556  ASN C CB    1 
ATOM   7901  C  CG    . ASN C  2  556  ? 41.819  -14.974 86.933   1.00 2.21   ? 556  ASN C CG    1 
ATOM   7902  O  OD1   . ASN C  2  556  ? 42.047  -14.998 85.721   1.00 2.84   ? 556  ASN C OD1   1 
ATOM   7903  N  ND2   . ASN C  2  556  ? 40.772  -15.587 87.480   1.00 3.16   ? 556  ASN C ND2   1 
ATOM   7904  N  N     . ARG C  2  557  ? 44.741  -14.129 90.357   1.00 0.44   ? 557  ARG C N     1 
ATOM   7905  C  CA    . ARG C  2  557  ? 45.636  -13.370 91.217   1.00 0.62   ? 557  ARG C CA    1 
ATOM   7906  C  C     . ARG C  2  557  ? 46.946  -14.116 91.486   1.00 0.70   ? 557  ARG C C     1 
ATOM   7907  O  O     . ARG C  2  557  ? 48.012  -13.495 91.606   1.00 0.64   ? 557  ARG C O     1 
ATOM   7908  C  CB    . ARG C  2  557  ? 44.939  -12.980 92.522   1.00 0.79   ? 557  ARG C CB    1 
ATOM   7909  C  CG    . ARG C  2  557  ? 43.991  -11.801 92.375   1.00 0.66   ? 557  ARG C CG    1 
ATOM   7910  C  CD    . ARG C  2  557  ? 44.739  -10.484 92.253   1.00 0.65   ? 557  ARG C CD    1 
ATOM   7911  N  NE    . ARG C  2  557  ? 43.993  -9.517  91.454   1.00 0.86   ? 557  ARG C NE    1 
ATOM   7912  C  CZ    . ARG C  2  557  ? 44.238  -8.211  91.424   1.00 0.86   ? 557  ARG C CZ    1 
ATOM   7913  N  NH1   . ARG C  2  557  ? 45.212  -7.691  92.156   1.00 0.53   ? 557  ARG C NH1   1 
ATOM   7914  N  NH2   . ARG C  2  557  ? 43.496  -7.424  90.659   1.00 1.58   ? 557  ARG C NH2   1 
ATOM   7915  N  N     . ALA C  2  558  ? 46.859  -15.443 91.579   1.00 0.70   ? 558  ALA C N     1 
ATOM   7916  C  CA    . ALA C  2  558  ? 48.039  -16.295 91.720   1.00 0.47   ? 558  ALA C CA    1 
ATOM   7917  C  C     . ALA C  2  558  ? 48.989  -16.041 90.572   1.00 0.58   ? 558  ALA C C     1 
ATOM   7918  O  O     . ALA C  2  558  ? 50.200  -16.036 90.762   1.00 0.76   ? 558  ALA C O     1 
ATOM   7919  C  CB    . ALA C  2  558  ? 47.648  -17.752 91.745   1.00 0.58   ? 558  ALA C CB    1 
ATOM   7920  N  N     . LEU C  2  559  ? 48.430  -15.840 89.380   1.00 0.52   ? 559  LEU C N     1 
ATOM   7921  C  CA    . LEU C  2  559  ? 49.203  -15.459 88.207   1.00 0.50   ? 559  LEU C CA    1 
ATOM   7922  C  C     . LEU C  2  559  ? 49.992  -14.194 88.499   1.00 0.68   ? 559  LEU C C     1 
ATOM   7923  O  O     . LEU C  2  559  ? 51.185  -14.112 88.228   1.00 0.98   ? 559  LEU C O     1 
ATOM   7924  C  CB    . LEU C  2  559  ? 48.267  -15.232 87.023   1.00 0.47   ? 559  LEU C CB    1 
ATOM   7925  C  CG    . LEU C  2  559  ? 48.839  -14.898 85.648   1.00 0.54   ? 559  LEU C CG    1 
ATOM   7926  C  CD1   . LEU C  2  559  ? 47.837  -15.311 84.611   1.00 0.68   ? 559  LEU C CD1   1 
ATOM   7927  C  CD2   . LEU C  2  559  ? 49.125  -13.424 85.506   1.00 1.35   ? 559  LEU C CD2   1 
ATOM   7928  N  N     . MET C  2  560  ? 49.313  -13.202 89.052   1.00 0.58   ? 560  MET C N     1 
ATOM   7929  C  CA    . MET C  2  560  ? 49.944  -11.931 89.327   1.00 0.60   ? 560  MET C CA    1 
ATOM   7930  C  C     . MET C  2  560  ? 51.065  -12.057 90.344   1.00 0.74   ? 560  MET C C     1 
ATOM   7931  O  O     . MET C  2  560  ? 52.100  -11.429 90.193   1.00 1.04   ? 560  MET C O     1 
ATOM   7932  C  CB    . MET C  2  560  ? 48.910  -10.917 89.802   1.00 0.93   ? 560  MET C CB    1 
ATOM   7933  C  CG    . MET C  2  560  ? 48.144  -10.259 88.675   1.00 3.05   ? 560  MET C CG    1 
ATOM   7934  S  SD    . MET C  2  560  ? 46.604  -9.500  89.215   1.00 0.70   ? 560  MET C SD    1 
ATOM   7935  C  CE    . MET C  2  560  ? 45.931  -8.999  87.639   1.00 4.98   ? 560  MET C CE    1 
ATOM   7936  N  N     . GLY C  2  561  ? 50.868  -12.856 91.384   1.00 0.50   ? 561  GLY C N     1 
ATOM   7937  C  CA    . GLY C  2  561  ? 51.889  -12.971 92.413   1.00 0.51   ? 561  GLY C CA    1 
ATOM   7938  C  C     . GLY C  2  561  ? 53.093  -13.699 91.863   1.00 0.71   ? 561  GLY C C     1 
ATOM   7939  O  O     . GLY C  2  561  ? 54.259  -13.302 92.046   1.00 1.03   ? 561  GLY C O     1 
ATOM   7940  N  N     . SER C  2  562  ? 52.778  -14.778 91.161   1.00 0.65   ? 562  SER C N     1 
ATOM   7941  C  CA    . SER C  2  562  ? 53.755  -15.586 90.466   1.00 0.75   ? 562  SER C CA    1 
ATOM   7942  C  C     . SER C  2  562  ? 54.656  -14.711 89.593   1.00 0.98   ? 562  SER C C     1 
ATOM   7943  O  O     . SER C  2  562  ? 55.876  -14.768 89.710   1.00 1.20   ? 562  SER C O     1 
ATOM   7944  C  CB    . SER C  2  562  ? 53.021  -16.635 89.627   1.00 0.92   ? 562  SER C CB    1 
ATOM   7945  O  OG    . SER C  2  562  ? 53.911  -17.415 88.859   1.00 2.20   ? 562  SER C OG    1 
ATOM   7946  N  N     . ASN C  2  563  ? 54.054  -13.885 88.741   1.00 0.97   ? 563  ASN C N     1 
ATOM   7947  C  CA    . ASN C  2  563  ? 54.823  -13.004 87.866   1.00 1.12   ? 563  ASN C CA    1 
ATOM   7948  C  C     . ASN C  2  563  ? 55.555  -11.892 88.615   1.00 1.16   ? 563  ASN C C     1 
ATOM   7949  O  O     . ASN C  2  563  ? 56.685  -11.548 88.292   1.00 1.28   ? 563  ASN C O     1 
ATOM   7950  C  CB    . ASN C  2  563  ? 53.926  -12.391 86.785   1.00 1.44   ? 563  ASN C CB    1 
ATOM   7951  C  CG    . ASN C  2  563  ? 53.552  -13.384 85.689   1.00 3.47   ? 563  ASN C CG    1 
ATOM   7952  O  OD1   . ASN C  2  563  ? 54.255  -14.373 85.448   1.00 4.44   ? 563  ASN C OD1   1 
ATOM   7953  N  ND2   . ASN C  2  563  ? 52.442  -13.112 85.007   1.00 3.23   ? 563  ASN C ND2   1 
ATOM   7954  N  N     . MET C  2  564  ? 54.909  -11.325 89.618   1.00 0.98   ? 564  MET C N     1 
ATOM   7955  C  CA    . MET C  2  564  ? 55.470  -10.169 90.287   1.00 1.22   ? 564  MET C CA    1 
ATOM   7956  C  C     . MET C  2  564  ? 56.686  -10.514 91.119   1.00 1.73   ? 564  MET C C     1 
ATOM   7957  O  O     . MET C  2  564  ? 57.526  -9.648  91.386   1.00 1.88   ? 564  MET C O     1 
ATOM   7958  C  CB    . MET C  2  564  ? 54.419  -9.465  91.128   1.00 1.00   ? 564  MET C CB    1 
ATOM   7959  C  CG    . MET C  2  564  ? 53.485  -8.645  90.287   1.00 1.64   ? 564  MET C CG    1 
ATOM   7960  S  SD    . MET C  2  564  ? 52.391  -7.668  91.298   1.00 6.36   ? 564  MET C SD    1 
ATOM   7961  C  CE    . MET C  2  564  ? 51.549  -8.950  92.227   1.00 1.28   ? 564  MET C CE    1 
ATOM   7962  N  N     . GLN C  2  565  ? 56.793  -11.773 91.531   1.00 1.56   ? 565  GLN C N     1 
ATOM   7963  C  CA    . GLN C  2  565  ? 58.012  -12.193 92.215   1.00 1.30   ? 565  GLN C CA    1 
ATOM   7964  C  C     . GLN C  2  565  ? 59.267  -11.954 91.367   1.00 1.37   ? 565  GLN C C     1 
ATOM   7965  O  O     . GLN C  2  565  ? 60.326  -11.644 91.897   1.00 1.66   ? 565  GLN C O     1 
ATOM   7966  C  CB    . GLN C  2  565  ? 57.929  -13.649 92.649   1.00 1.03   ? 565  GLN C CB    1 
ATOM   7967  C  CG    . GLN C  2  565  ? 57.247  -13.834 93.967   1.00 0.80   ? 565  GLN C CG    1 
ATOM   7968  C  CD    . GLN C  2  565  ? 57.174  -15.282 94.360   1.00 0.96   ? 565  GLN C CD    1 
ATOM   7969  O  OE1   . GLN C  2  565  ? 57.731  -15.690 95.382   1.00 1.29   ? 565  GLN C OE1   1 
ATOM   7970  N  NE2   . GLN C  2  565  ? 56.489  -16.078 93.547   1.00 0.84   ? 565  GLN C NE2   1 
ATOM   7971  N  N     . THR C  2  566  ? 59.154  -12.075 90.053   1.00 1.18   ? 566  THR C N     1 
ATOM   7972  C  CA    . THR C  2  566  ? 60.315  -11.852 89.206   1.00 1.37   ? 566  THR C CA    1 
ATOM   7973  C  C     . THR C  2  566  ? 60.625  -10.369 89.050   1.00 1.56   ? 566  THR C C     1 
ATOM   7974  O  O     . THR C  2  566  ? 61.630  -10.003 88.456   1.00 2.02   ? 566  THR C O     1 
ATOM   7975  C  CB    . THR C  2  566  ? 60.138  -12.488 87.822   1.00 1.77   ? 566  THR C CB    1 
ATOM   7976  O  OG1   . THR C  2  566  ? 59.441  -11.588 86.955   1.00 5.21   ? 566  THR C OG1   1 
ATOM   7977  C  CG2   . THR C  2  566  ? 59.350  -13.758 87.941   1.00 1.95   ? 566  THR C CG2   1 
ATOM   7978  N  N     . GLN C  2  567  ? 59.739  -9.518  89.556   1.00 1.96   ? 567  GLN C N     1 
ATOM   7979  C  CA    . GLN C  2  567  ? 59.945  -8.077  89.499   1.00 2.02   ? 567  GLN C CA    1 
ATOM   7980  C  C     . GLN C  2  567  ? 60.486  -7.508  90.794   1.00 1.55   ? 567  GLN C C     1 
ATOM   7981  O  O     . GLN C  2  567  ? 60.708  -6.307  90.887   1.00 1.49   ? 567  GLN C O     1 
ATOM   7982  C  CB    . GLN C  2  567  ? 58.647  -7.362  89.146   1.00 3.05   ? 567  GLN C CB    1 
ATOM   7983  C  CG    . GLN C  2  567  ? 58.040  -7.824  87.852   1.00 6.03   ? 567  GLN C CG    1 
ATOM   7984  C  CD    . GLN C  2  567  ? 56.657  -7.263  87.633   1.00 9.50   ? 567  GLN C CD    1 
ATOM   7985  O  OE1   . GLN C  2  567  ? 56.268  -6.274  88.253   1.00 10.23  ? 567  GLN C OE1   1 
ATOM   7986  N  NE2   . GLN C  2  567  ? 55.897  -7.899  86.752   1.00 22.13  ? 567  GLN C NE2   1 
ATOM   7987  N  N     . ALA C  2  568  ? 60.673  -8.359  91.798   1.00 1.84   ? 568  ALA C N     1 
ATOM   7988  C  CA    . ALA C  2  568  ? 61.139  -7.905  93.111   1.00 1.08   ? 568  ALA C CA    1 
ATOM   7989  C  C     . ALA C  2  568  ? 62.558  -7.345  93.065   1.00 1.15   ? 568  ALA C C     1 
ATOM   7990  O  O     . ALA C  2  568  ? 63.436  -7.888  92.395   1.00 1.29   ? 568  ALA C O     1 
ATOM   7991  C  CB    . ALA C  2  568  ? 61.038  -9.021  94.133   1.00 0.66   ? 568  ALA C CB    1 
ATOM   7992  N  N     . VAL C  2  569  ? 62.774  -6.248  93.779   1.00 1.09   ? 569  VAL C N     1 
ATOM   7993  C  CA    . VAL C  2  569  ? 64.089  -5.635  93.850   1.00 1.04   ? 569  VAL C CA    1 
ATOM   7994  C  C     . VAL C  2  569  ? 64.850  -6.175  95.053   1.00 1.30   ? 569  VAL C C     1 
ATOM   7995  O  O     . VAL C  2  569  ? 64.289  -6.275  96.142   1.00 1.68   ? 569  VAL C O     1 
ATOM   7996  C  CB    . VAL C  2  569  ? 63.971  -4.110  93.953   1.00 0.90   ? 569  VAL C CB    1 
ATOM   7997  C  CG1   . VAL C  2  569  ? 65.283  -3.509  94.335   1.00 1.34   ? 569  VAL C CG1   1 
ATOM   7998  C  CG2   . VAL C  2  569  ? 63.516  -3.537  92.633   1.00 1.98   ? 569  VAL C CG2   1 
ATOM   7999  N  N     . PRO C  2  570  ? 66.124  -6.556  94.858   1.00 1.38   ? 570  PRO C N     1 
ATOM   8000  C  CA    . PRO C  2  570  ? 66.973  -6.968  95.982   1.00 1.62   ? 570  PRO C CA    1 
ATOM   8001  C  C     . PRO C  2  570  ? 67.143  -5.847  96.999   1.00 1.66   ? 570  PRO C C     1 
ATOM   8002  O  O     . PRO C  2  570  ? 67.518  -4.728  96.640   1.00 1.89   ? 570  PRO C O     1 
ATOM   8003  C  CB    . PRO C  2  570  ? 68.316  -7.263  95.315   1.00 1.63   ? 570  PRO C CB    1 
ATOM   8004  C  CG    . PRO C  2  570  ? 67.965  -7.617  93.921   1.00 2.07   ? 570  PRO C CG    1 
ATOM   8005  C  CD    . PRO C  2  570  ? 66.794  -6.756  93.562   1.00 2.02   ? 570  PRO C CD    1 
ATOM   8006  N  N     . LEU C  2  571  ? 66.893  -6.159  98.263   1.00 1.20   ? 571  LEU C N     1 
ATOM   8007  C  CA    . LEU C  2  571  ? 66.920  -5.159  99.317   1.00 1.53   ? 571  LEU C CA    1 
ATOM   8008  C  C     . LEU C  2  571  ? 68.185  -5.334  100.134  1.00 2.15   ? 571  LEU C C     1 
ATOM   8009  O  O     . LEU C  2  571  ? 68.708  -6.445  100.210  1.00 3.67   ? 571  LEU C O     1 
ATOM   8010  C  CB    . LEU C  2  571  ? 65.705  -5.326  100.212  1.00 1.52   ? 571  LEU C CB    1 
ATOM   8011  C  CG    . LEU C  2  571  ? 64.391  -5.344  99.451   1.00 0.94   ? 571  LEU C CG    1 
ATOM   8012  C  CD1   . LEU C  2  571  ? 63.261  -5.673  100.396  1.00 0.90   ? 571  LEU C CD1   1 
ATOM   8013  C  CD2   . LEU C  2  571  ? 64.185  -4.002  98.793   1.00 0.85   ? 571  LEU C CD2   1 
ATOM   8014  N  N     . ILE C  2  572  ? 68.699  -4.246  100.707  1.00 1.72   ? 572  ILE C N     1 
ATOM   8015  C  CA    . ILE C  2  572  ? 69.916  -4.321  101.522  1.00 2.30   ? 572  ILE C CA    1 
ATOM   8016  C  C     . ILE C  2  572  ? 69.682  -5.090  102.832  1.00 2.58   ? 572  ILE C C     1 
ATOM   8017  O  O     . ILE C  2  572  ? 70.584  -5.738  103.364  1.00 3.22   ? 572  ILE C O     1 
ATOM   8018  C  CB    . ILE C  2  572  ? 70.528  -2.916  101.792  1.00 1.42   ? 572  ILE C CB    1 
ATOM   8019  C  CG1   . ILE C  2  572  ? 69.719  -2.142  102.836  1.00 1.99   ? 572  ILE C CG1   1 
ATOM   8020  C  CG2   . ILE C  2  572  ? 70.623  -2.130  100.505  1.00 1.68   ? 572  ILE C CG2   1 
ATOM   8021  C  CD1   . ILE C  2  572  ? 70.131  -0.698  102.988  1.00 2.01   ? 572  ILE C CD1   1 
ATOM   8022  N  N     . ARG C  2  573  ? 68.472  -4.977  103.359  1.00 1.71   ? 573  ARG C N     1 
ATOM   8023  C  CA    . ARG C  2  573  ? 68.049  -5.710  104.544  1.00 2.06   ? 573  ARG C CA    1 
ATOM   8024  C  C     . ARG C  2  573  ? 67.182  -6.956  104.309  1.00 2.08   ? 573  ARG C C     1 
ATOM   8025  O  O     . ARG C  2  573  ? 66.503  -7.416  105.229  1.00 1.87   ? 573  ARG C O     1 
ATOM   8026  C  CB    . ARG C  2  573  ? 67.516  -4.781  105.634  1.00 3.13   ? 573  ARG C CB    1 
ATOM   8027  C  CG    . ARG C  2  573  ? 68.601  -3.849  106.150  1.00 3.19   ? 573  ARG C CG    1 
ATOM   8028  C  CD    . ARG C  2  573  ? 68.264  -3.260  107.503  1.00 7.77   ? 573  ARG C CD    1 
ATOM   8029  N  NE    . ARG C  2  573  ? 68.318  -4.244  108.581  1.00 9.68   ? 573  ARG C NE    1 
ATOM   8030  C  CZ    . ARG C  2  573  ? 67.894  -4.003  109.819  1.00 14.78  ? 573  ARG C CZ    1 
ATOM   8031  N  NH1   . ARG C  2  573  ? 67.389  -2.814  110.125  1.00 9.71   ? 573  ARG C NH1   1 
ATOM   8032  N  NH2   . ARG C  2  573  ? 67.964  -4.947  110.753  1.00 21.44  ? 573  ARG C NH2   1 
ATOM   8033  N  N     . ALA C  2  574  ? 67.151  -7.440  103.067  1.00 1.82   ? 574  ALA C N     1 
ATOM   8034  C  CA    . ALA C  2  574  ? 66.185  -8.454  102.615  1.00 1.71   ? 574  ALA C CA    1 
ATOM   8035  C  C     . ALA C  2  574  ? 66.039  -9.700  103.495  1.00 1.44   ? 574  ALA C C     1 
ATOM   8036  O  O     . ALA C  2  574  ? 67.012  -10.192 104.066  1.00 2.12   ? 574  ALA C O     1 
ATOM   8037  C  CB    . ALA C  2  574  ? 66.507  -8.872  101.183  1.00 1.50   ? 574  ALA C CB    1 
ATOM   8038  N  N     . GLN C  2  575  ? 64.805  -10.194 103.594  1.00 1.24   ? 575  GLN C N     1 
ATOM   8039  C  CA    . GLN C  2  575  ? 64.472  -11.339 104.439  1.00 2.19   ? 575  GLN C CA    1 
ATOM   8040  C  C     . GLN C  2  575  ? 63.740  -12.456 103.699  1.00 2.22   ? 575  GLN C C     1 
ATOM   8041  O  O     . GLN C  2  575  ? 63.005  -12.199 102.754  1.00 2.55   ? 575  GLN C O     1 
ATOM   8042  C  CB    . GLN C  2  575  ? 63.541  -10.894 105.553  1.00 2.26   ? 575  GLN C CB    1 
ATOM   8043  C  CG    . GLN C  2  575  ? 64.060  -9.829  106.453  1.00 1.84   ? 575  GLN C CG    1 
ATOM   8044  C  CD    . GLN C  2  575  ? 62.998  -9.402  107.416  1.00 2.34   ? 575  GLN C CD    1 
ATOM   8045  O  OE1   . GLN C  2  575  ? 62.076  -8.684  107.048  1.00 2.77   ? 575  GLN C OE1   1 
ATOM   8046  N  NE2   . GLN C  2  575  ? 63.089  -9.876  108.653  1.00 9.94   ? 575  GLN C NE2   1 
ATOM   8047  N  N     . ALA C  2  576  ? 63.919  -13.695 104.143  1.00 2.52   ? 576  ALA C N     1 
ATOM   8048  C  CA    . ALA C  2  576  ? 63.102  -14.797 103.643  1.00 3.07   ? 576  ALA C CA    1 
ATOM   8049  C  C     . ALA C  2  576  ? 61.727  -14.713 104.298  1.00 3.34   ? 576  ALA C C     1 
ATOM   8050  O  O     . ALA C  2  576  ? 61.607  -14.194 105.410  1.00 2.97   ? 576  ALA C O     1 
ATOM   8051  C  CB    . ALA C  2  576  ? 63.762  -16.133 103.951  1.00 5.03   ? 576  ALA C CB    1 
ATOM   8052  N  N     . PRO C  2  577  ? 60.683  -15.217 103.615  1.00 2.38   ? 577  PRO C N     1 
ATOM   8053  C  CA    . PRO C  2  577  ? 59.311  -15.106 104.132  1.00 2.39   ? 577  PRO C CA    1 
ATOM   8054  C  C     . PRO C  2  577  ? 59.153  -15.819 105.464  1.00 3.01   ? 577  PRO C C     1 
ATOM   8055  O  O     . PRO C  2  577  ? 59.868  -16.783 105.711  1.00 4.39   ? 577  PRO C O     1 
ATOM   8056  C  CB    . PRO C  2  577  ? 58.470  -15.824 103.069  1.00 1.76   ? 577  PRO C CB    1 
ATOM   8057  C  CG    . PRO C  2  577  ? 59.304  -15.845 101.853  1.00 1.79   ? 577  PRO C CG    1 
ATOM   8058  C  CD    . PRO C  2  577  ? 60.726  -15.911 102.318  1.00 2.29   ? 577  PRO C CD    1 
ATOM   8059  N  N     . VAL C  2  578  ? 58.244  -15.348 106.311  1.00 3.85   ? 578  VAL C N     1 
ATOM   8060  C  CA    . VAL C  2  578  ? 57.951  -16.035 107.563  1.00 3.58   ? 578  VAL C CA    1 
ATOM   8061  C  C     . VAL C  2  578  ? 57.286  -17.352 107.222  1.00 3.57   ? 578  VAL C C     1 
ATOM   8062  O  O     . VAL C  2  578  ? 57.556  -18.378 107.838  1.00 5.00   ? 578  VAL C O     1 
ATOM   8063  C  CB    . VAL C  2  578  ? 57.048  -15.198 108.487  1.00 2.43   ? 578  VAL C CB    1 
ATOM   8064  C  CG1   . VAL C  2  578  ? 56.426  -16.068 109.568  1.00 3.14   ? 578  VAL C CG1   1 
ATOM   8065  C  CG2   . VAL C  2  578  ? 57.851  -14.079 109.115  1.00 2.05   ? 578  VAL C CG2   1 
ATOM   8066  N  N     . VAL C  2  579  ? 56.426  -17.313 106.212  1.00 3.94   ? 579  VAL C N     1 
ATOM   8067  C  CA    . VAL C  2  579  ? 55.807  -18.517 105.679  1.00 3.45   ? 579  VAL C CA    1 
ATOM   8068  C  C     . VAL C  2  579  ? 56.421  -18.832 104.322  1.00 3.68   ? 579  VAL C C     1 
ATOM   8069  O  O     . VAL C  2  579  ? 56.274  -18.059 103.377  1.00 4.35   ? 579  VAL C O     1 
ATOM   8070  C  CB    . VAL C  2  579  ? 54.296  -18.339 105.517  1.00 1.97   ? 579  VAL C CB    1 
ATOM   8071  C  CG1   . VAL C  2  579  ? 53.658  -19.645 105.085  1.00 3.57   ? 579  VAL C CG1   1 
ATOM   8072  C  CG2   . VAL C  2  579  ? 53.692  -17.864 106.813  1.00 2.14   ? 579  VAL C CG2   1 
ATOM   8073  N  N     . MET C  2  580  ? 57.107  -19.969 104.230  1.00 4.56   ? 580  MET C N     1 
ATOM   8074  C  CA    . MET C  2  580  ? 57.785  -20.371 103.003  1.00 3.84   ? 580  MET C CA    1 
ATOM   8075  C  C     . MET C  2  580  ? 57.145  -21.628 102.468  1.00 4.48   ? 580  MET C C     1 
ATOM   8076  O  O     . MET C  2  580  ? 56.481  -22.348 103.208  1.00 5.50   ? 580  MET C O     1 
ATOM   8077  C  CB    . MET C  2  580  ? 59.252  -20.653 103.280  1.00 3.73   ? 580  MET C CB    1 
ATOM   8078  C  CG    . MET C  2  580  ? 60.075  -19.430 103.562  1.00 3.99   ? 580  MET C CG    1 
ATOM   8079  S  SD    . MET C  2  580  ? 61.751  -19.879 104.041  1.00 10.95  ? 580  MET C SD    1 
ATOM   8080  C  CE    . MET C  2  580  ? 61.440  -20.862 105.504  1.00 7.31   ? 580  MET C CE    1 
ATOM   8081  N  N     . THR C  2  581  ? 57.307  -21.883 101.176  1.00 4.91   ? 581  THR C N     1 
ATOM   8082  C  CA    . THR C  2  581  ? 56.808  -23.134 100.605  1.00 8.19   ? 581  THR C CA    1 
ATOM   8083  C  C     . THR C  2  581  ? 57.834  -24.268 100.662  1.00 7.76   ? 581  THR C C     1 
ATOM   8084  O  O     . THR C  2  581  ? 57.477  -25.441 100.516  1.00 8.10   ? 581  THR C O     1 
ATOM   8085  C  CB    . THR C  2  581  ? 56.354  -22.961 99.141   1.00 5.06   ? 581  THR C CB    1 
ATOM   8086  O  OG1   . THR C  2  581  ? 57.391  -22.319 98.391   1.00 4.54   ? 581  THR C OG1   1 
ATOM   8087  C  CG2   . THR C  2  581  ? 55.090  -22.130 99.060   1.00 2.87   ? 581  THR C CG2   1 
ATOM   8088  N  N     . GLY C  2  582  ? 59.098  -23.920 100.891  1.00 6.17   ? 582  GLY C N     1 
ATOM   8089  C  CA    . GLY C  2  582  ? 60.156  -24.913 100.920  1.00 7.06   ? 582  GLY C CA    1 
ATOM   8090  C  C     . GLY C  2  582  ? 61.075  -24.932 99.704   1.00 11.13  ? 582  GLY C C     1 
ATOM   8091  O  O     . GLY C  2  582  ? 62.100  -25.618 99.710   1.00 15.46  ? 582  GLY C O     1 
ATOM   8092  N  N     . LEU C  2  583  ? 60.728  -24.188 98.658   1.00 6.44   ? 583  LEU C N     1 
ATOM   8093  C  CA    . LEU C  2  583  ? 61.609  -24.090 97.497   1.00 5.23   ? 583  LEU C CA    1 
ATOM   8094  C  C     . LEU C  2  583  ? 62.619  -22.947 97.602   1.00 6.45   ? 583  LEU C C     1 
ATOM   8095  O  O     . LEU C  2  583  ? 63.462  -22.775 96.724   1.00 7.65   ? 583  LEU C O     1 
ATOM   8096  C  CB    . LEU C  2  583  ? 60.797  -23.909 96.222   1.00 5.45   ? 583  LEU C CB    1 
ATOM   8097  C  CG    . LEU C  2  583  ? 60.620  -25.149 95.363   1.00 6.30   ? 583  LEU C CG    1 
ATOM   8098  C  CD1   . LEU C  2  583  ? 59.800  -26.196 96.115   1.00 8.71   ? 583  LEU C CD1   1 
ATOM   8099  C  CD2   . LEU C  2  583  ? 59.979  -24.759 94.046   1.00 2.26   ? 583  LEU C CD2   1 
ATOM   8100  N  N     . GLU C  2  584  ? 62.530  -22.166 98.670   1.00 5.59   ? 584  GLU C N     1 
ATOM   8101  C  CA    . GLU C  2  584  ? 63.326  -20.954 98.784   1.00 4.63   ? 584  GLU C CA    1 
ATOM   8102  C  C     . GLU C  2  584  ? 64.833  -21.198 98.724   1.00 6.37   ? 584  GLU C C     1 
ATOM   8103  O  O     . GLU C  2  584  ? 65.565  -20.359 98.212   1.00 9.24   ? 584  GLU C O     1 
ATOM   8104  C  CB    . GLU C  2  584  ? 62.952  -20.173 100.048  1.00 6.13   ? 584  GLU C CB    1 
ATOM   8105  C  CG    . GLU C  2  584  ? 61.561  -19.545 100.022  1.00 3.36   ? 584  GLU C CG    1 
ATOM   8106  C  CD    . GLU C  2  584  ? 60.440  -20.562 100.198  1.00 6.80   ? 584  GLU C CD    1 
ATOM   8107  O  OE1   . GLU C  2  584  ? 59.264  -20.185 100.020  1.00 6.62   ? 584  GLU C OE1   1 
ATOM   8108  O  OE2   . GLU C  2  584  ? 60.724  -21.735 100.530  1.00 7.32   ? 584  GLU C OE2   1 
ATOM   8109  N  N     . GLU C  2  585  ? 65.299  -22.335 99.239   1.00 8.57   ? 585  GLU C N     1 
ATOM   8110  C  CA    . GLU C  2  585  ? 66.734  -22.644 99.223   1.00 7.55   ? 585  GLU C CA    1 
ATOM   8111  C  C     . GLU C  2  585  ? 67.219  -23.163 97.866   1.00 7.40   ? 585  GLU C C     1 
ATOM   8112  O  O     . GLU C  2  585  ? 68.276  -22.749 97.375   1.00 9.26   ? 585  GLU C O     1 
ATOM   8113  C  CB    . GLU C  2  585  ? 67.097  -23.647 100.324  1.00 8.22   ? 585  GLU C CB    1 
ATOM   8114  C  CG    . GLU C  2  585  ? 66.994  -23.094 101.744  1.00 14.37  ? 585  GLU C CG    1 
ATOM   8115  C  CD    . GLU C  2  585  ? 67.067  -24.180 102.824  1.00 25.77  ? 585  GLU C CD    1 
ATOM   8116  O  OE1   . GLU C  2  585  ? 65.999  -24.632 103.301  1.00 23.95  ? 585  GLU C OE1   1 
ATOM   8117  O  OE2   . GLU C  2  585  ? 68.192  -24.571 103.210  1.00 31.94  ? 585  GLU C OE2   1 
ATOM   8118  N  N     . ARG C  2  586  ? 66.446  -24.065 97.265   1.00 6.22   ? 586  ARG C N     1 
ATOM   8119  C  CA    . ARG C  2  586  ? 66.825  -24.663 95.986   1.00 6.15   ? 586  ARG C CA    1 
ATOM   8120  C  C     . ARG C  2  586  ? 66.949  -23.597 94.911   1.00 6.62   ? 586  ARG C C     1 
ATOM   8121  O  O     . ARG C  2  586  ? 67.779  -23.702 94.012   1.00 6.64   ? 586  ARG C O     1 
ATOM   8122  C  CB    . ARG C  2  586  ? 65.808  -25.719 95.537   1.00 6.75   ? 586  ARG C CB    1 
ATOM   8123  C  CG    . ARG C  2  586  ? 66.162  -27.161 95.892   1.00 6.06   ? 586  ARG C CG    1 
ATOM   8124  C  CD    . ARG C  2  586  ? 67.532  -27.575 95.365   1.00 4.23   ? 586  ARG C CD    1 
ATOM   8125  N  NE    . ARG C  2  586  ? 67.611  -27.605 93.907   1.00 3.30   ? 586  ARG C NE    1 
ATOM   8126  C  CZ    . ARG C  2  586  ? 67.167  -28.604 93.153   1.00 3.92   ? 586  ARG C CZ    1 
ATOM   8127  N  NH1   . ARG C  2  586  ? 66.586  -29.654 93.713   1.00 3.43   ? 586  ARG C NH1   1 
ATOM   8128  N  NH2   . ARG C  2  586  ? 67.292  -28.548 91.836   1.00 5.08   ? 586  ARG C NH2   1 
ATOM   8129  N  N     . VAL C  2  587  ? 66.108  -22.575 95.008   1.00 7.77   ? 587  VAL C N     1 
ATOM   8130  C  CA    . VAL C  2  587  ? 66.150  -21.471 94.064   1.00 6.85   ? 587  VAL C CA    1 
ATOM   8131  C  C     . VAL C  2  587  ? 67.481  -20.721 94.158   1.00 6.79   ? 587  VAL C C     1 
ATOM   8132  O  O     . VAL C  2  587  ? 68.156  -20.526 93.154   1.00 6.32   ? 587  VAL C O     1 
ATOM   8133  C  CB    . VAL C  2  587  ? 64.967  -20.513 94.270   1.00 4.73   ? 587  VAL C CB    1 
ATOM   8134  C  CG1   . VAL C  2  587  ? 65.174  -19.235 93.468   1.00 4.52   ? 587  VAL C CG1   1 
ATOM   8135  C  CG2   . VAL C  2  587  ? 63.662  -21.201 93.883   1.00 2.43   ? 587  VAL C CG2   1 
ATOM   8136  N  N     . VAL C  2  588  ? 67.866  -20.324 95.366   1.00 4.99   ? 588  VAL C N     1 
ATOM   8137  C  CA    . VAL C  2  588  ? 69.134  -19.634 95.559   1.00 6.72   ? 588  VAL C CA    1 
ATOM   8138  C  C     . VAL C  2  588  ? 70.298  -20.506 95.088   1.00 10.28  ? 588  VAL C C     1 
ATOM   8139  O  O     . VAL C  2  588  ? 71.267  -20.013 94.498   1.00 12.27  ? 588  VAL C O     1 
ATOM   8140  C  CB    . VAL C  2  588  ? 69.346  -19.233 97.034   1.00 7.02   ? 588  VAL C CB    1 
ATOM   8141  C  CG1   . VAL C  2  588  ? 70.565  -18.341 97.179   1.00 9.98   ? 588  VAL C CG1   1 
ATOM   8142  C  CG2   . VAL C  2  588  ? 68.132  -18.515 97.555   1.00 4.86   ? 588  VAL C CG2   1 
ATOM   8143  N  N     . ARG C  2  589  ? 70.194  -21.808 95.333   1.00 10.35  ? 589  ARG C N     1 
ATOM   8144  C  CA    . ARG C  2  589  ? 71.258  -22.721 94.925   1.00 10.27  ? 589  ARG C CA    1 
ATOM   8145  C  C     . ARG C  2  589  ? 71.392  -22.829 93.400   1.00 11.11  ? 589  ARG C C     1 
ATOM   8146  O  O     . ARG C  2  589  ? 72.484  -22.667 92.857   1.00 12.86  ? 589  ARG C O     1 
ATOM   8147  C  CB    . ARG C  2  589  ? 71.068  -24.107 95.549   1.00 7.84   ? 589  ARG C CB    1 
ATOM   8148  C  CG    . ARG C  2  589  ? 72.288  -25.006 95.419   1.00 9.04   ? 589  ARG C CG    1 
ATOM   8149  C  CD    . ARG C  2  589  ? 72.162  -26.280 96.243   1.00 11.40  ? 589  ARG C CD    1 
ATOM   8150  N  NE    . ARG C  2  589  ? 72.452  -26.071 97.662   1.00 12.60  ? 589  ARG C NE    1 
ATOM   8151  C  CZ    . ARG C  2  589  ? 73.674  -26.090 98.190   1.00 14.51  ? 589  ARG C CZ    1 
ATOM   8152  N  NH1   . ARG C  2  589  ? 74.736  -26.297 97.418   1.00 15.34  ? 589  ARG C NH1   1 
ATOM   8153  N  NH2   . ARG C  2  589  ? 73.838  -25.894 99.491   1.00 15.00  ? 589  ARG C NH2   1 
ATOM   8154  N  N     . ASP C  2  590  ? 70.284  -23.094 92.716   1.00 8.33   ? 590  ASP C N     1 
ATOM   8155  C  CA    . ASP C  2  590  ? 70.314  -23.303 91.274   1.00 8.51   ? 590  ASP C CA    1 
ATOM   8156  C  C     . ASP C  2  590  ? 70.513  -22.011 90.484   1.00 12.99  ? 590  ASP C C     1 
ATOM   8157  O  O     . ASP C  2  590  ? 71.015  -22.032 89.355   1.00 15.13  ? 590  ASP C O     1 
ATOM   8158  C  CB    . ASP C  2  590  ? 69.044  -24.014 90.806   1.00 7.65   ? 590  ASP C CB    1 
ATOM   8159  C  CG    . ASP C  2  590  ? 69.003  -25.464 91.231   1.00 8.05   ? 590  ASP C CG    1 
ATOM   8160  O  OD1   . ASP C  2  590  ? 69.454  -25.759 92.357   1.00 7.99   ? 590  ASP C OD1   1 
ATOM   8161  O  OD2   . ASP C  2  590  ? 68.531  -26.309 90.434   1.00 8.37   ? 590  ASP C OD2   1 
ATOM   8162  N  N     . SER C  2  591  ? 70.124  -20.887 91.073   1.00 11.52  ? 591  SER C N     1 
ATOM   8163  C  CA    . SER C  2  591  ? 70.276  -19.602 90.401   1.00 14.66  ? 591  SER C CA    1 
ATOM   8164  C  C     . SER C  2  591  ? 71.714  -19.130 90.475   1.00 15.42  ? 591  SER C C     1 
ATOM   8165  O  O     . SER C  2  591  ? 72.057  -18.100 89.898   1.00 20.28  ? 591  SER C O     1 
ATOM   8166  C  CB    . SER C  2  591  ? 69.384  -18.540 91.035   1.00 17.56  ? 591  SER C CB    1 
ATOM   8167  O  OG    . SER C  2  591  ? 69.973  -18.054 92.232   1.00 22.77  ? 591  SER C OG    1 
ATOM   8168  N  N     . LEU C  2  592  ? 72.537  -19.867 91.217   1.00 14.24  ? 592  LEU C N     1 
ATOM   8169  C  CA    . LEU C  2  592  ? 73.950  -19.536 91.380   1.00 19.12  ? 592  LEU C CA    1 
ATOM   8170  C  C     . LEU C  2  592  ? 74.131  -18.134 91.955   1.00 18.87  ? 592  LEU C C     1 
ATOM   8171  O  O     . LEU C  2  592  ? 75.117  -17.447 91.675   1.00 14.05  ? 592  LEU C O     1 
ATOM   8172  C  CB    . LEU C  2  592  ? 74.705  -19.706 90.059   1.00 15.13  ? 592  LEU C CB    1 
ATOM   8173  C  CG    . LEU C  2  592  ? 75.143  -21.143 89.775   1.00 16.00  ? 592  LEU C CG    1 
ATOM   8174  C  CD1   . LEU C  2  592  ? 75.424  -21.358 88.299   1.00 18.63  ? 592  LEU C CD1   1 
ATOM   8175  C  CD2   . LEU C  2  592  ? 76.377  -21.469 90.605   1.00 22.98  ? 592  LEU C CD2   1 
ATOM   8176  N  N     . ALA C  2  593  ? 73.167  -17.725 92.772   1.00 18.90  ? 593  ALA C N     1 
ATOM   8177  C  CA    . ALA C  2  593  ? 73.213  -16.422 93.410   1.00 25.92  ? 593  ALA C CA    1 
ATOM   8178  C  C     . ALA C  2  593  ? 74.263  -16.470 94.507   1.00 29.60  ? 593  ALA C C     1 
ATOM   8179  O  O     . ALA C  2  593  ? 75.293  -15.785 94.430   1.00 19.58  ? 593  ALA C O     1 
ATOM   8180  C  CB    . ALA C  2  593  ? 71.849  -16.073 93.999   1.00 20.21  ? 593  ALA C CB    1 
ATOM   8181  N  N     . ALA C  2  594  ? 73.992  -17.295 95.518   1.00 23.12  ? 594  ALA C N     1 
ATOM   8182  C  CA    . ALA C  2  594  ? 74.883  -17.461 96.657   1.00 15.30  ? 594  ALA C CA    1 
ATOM   8183  C  C     . ALA C  2  594  ? 76.126  -18.264 96.291   1.00 14.60  ? 594  ALA C C     1 
ATOM   8184  O  O     . ALA C  2  594  ? 76.269  -18.738 95.167   1.00 17.94  ? 594  ALA C O     1 
ATOM   8185  C  CB    . ALA C  2  594  ? 74.145  -18.131 97.799   1.00 12.42  ? 594  ALA C CB    1 
ATOM   8186  N  N     . LEU C  2  595  ? 77.015  -18.424 97.263   1.00 16.20  ? 595  LEU C N     1 
ATOM   8187  C  CA    . LEU C  2  595  ? 78.275  -19.123 97.067   1.00 12.20  ? 595  LEU C CA    1 
ATOM   8188  C  C     . LEU C  2  595  ? 78.421  -20.257 98.083   1.00 12.10  ? 595  LEU C C     1 
ATOM   8189  O  O     . LEU C  2  595  ? 78.232  -20.053 99.277   1.00 13.36  ? 595  LEU C O     1 
ATOM   8190  C  CB    . LEU C  2  595  ? 79.423  -18.137 97.220   1.00 11.44  ? 595  LEU C CB    1 
ATOM   8191  C  CG    . LEU C  2  595  ? 80.812  -18.747 97.129   1.00 16.08  ? 595  LEU C CG    1 
ATOM   8192  C  CD1   . LEU C  2  595  ? 81.058  -19.272 95.723   1.00 20.03  ? 595  LEU C CD1   1 
ATOM   8193  C  CD2   . LEU C  2  595  ? 81.845  -17.715 97.521   1.00 19.18  ? 595  LEU C CD2   1 
ATOM   8194  N  N     . TYR C  2  596  ? 78.766  -21.451 97.615   1.00 15.57  ? 596  TYR C N     1 
ATOM   8195  C  CA    . TYR C  2  596  ? 78.834  -22.611 98.503   1.00 16.72  ? 596  TYR C CA    1 
ATOM   8196  C  C     . TYR C  2  596  ? 80.232  -23.256 98.613   1.00 24.04  ? 596  TYR C C     1 
ATOM   8197  O  O     . TYR C  2  596  ? 81.088  -23.080 97.740   1.00 26.81  ? 596  TYR C O     1 
ATOM   8198  C  CB    . TYR C  2  596  ? 77.793  -23.646 98.078   1.00 15.31  ? 596  TYR C CB    1 
ATOM   8199  C  CG    . TYR C  2  596  ? 76.378  -23.112 98.064   1.00 14.04  ? 596  TYR C CG    1 
ATOM   8200  C  CD1   . TYR C  2  596  ? 75.820  -22.604 96.900   1.00 19.21  ? 596  TYR C CD1   1 
ATOM   8201  C  CD2   . TYR C  2  596  ? 75.597  -23.117 99.215   1.00 15.53  ? 596  TYR C CD2   1 
ATOM   8202  C  CE1   . TYR C  2  596  ? 74.518  -22.112 96.880   1.00 17.80  ? 596  TYR C CE1   1 
ATOM   8203  C  CE2   . TYR C  2  596  ? 74.296  -22.629 99.207   1.00 12.73  ? 596  TYR C CE2   1 
ATOM   8204  C  CZ    . TYR C  2  596  ? 73.763  -22.127 98.035   1.00 14.49  ? 596  TYR C CZ    1 
ATOM   8205  O  OH    . TYR C  2  596  ? 72.473  -21.639 98.011   1.00 13.18  ? 596  TYR C OH    1 
ATOM   8206  N  N     . ALA C  2  597  ? 80.453  -23.997 99.699   1.00 26.14  ? 597  ALA C N     1 
ATOM   8207  C  CA    . ALA C  2  597  ? 81.722  -24.690 99.935   1.00 26.63  ? 597  ALA C CA    1 
ATOM   8208  C  C     . ALA C  2  597  ? 81.809  -25.977 99.119   1.00 29.94  ? 597  ALA C C     1 
ATOM   8209  O  O     . ALA C  2  597  ? 80.974  -26.869 99.277   1.00 31.38  ? 597  ALA C O     1 
ATOM   8210  C  CB    . ALA C  2  597  ? 81.885  -24.995 101.416  1.00 21.91  ? 597  ALA C CB    1 
ATOM   8211  N  N     . GLU C  2  598  ? 82.832  -26.075 98.269   1.00 30.10  ? 598  GLU C N     1 
ATOM   8212  C  CA    . GLU C  2  598  ? 82.956  -27.173 97.307   1.00 32.58  ? 598  GLU C CA    1 
ATOM   8213  C  C     . GLU C  2  598  ? 83.182  -28.547 97.933   1.00 41.66  ? 598  GLU C C     1 
ATOM   8214  O  O     . GLU C  2  598  ? 82.573  -29.531 97.512   1.00 41.11  ? 598  GLU C O     1 
ATOM   8215  C  CB    . GLU C  2  598  ? 84.065  -26.886 96.296   1.00 44.42  ? 598  GLU C CB    1 
ATOM   8216  C  CG    . GLU C  2  598  ? 84.293  -28.026 95.314   1.00 61.50  ? 598  GLU C CG    1 
ATOM   8217  C  CD    . GLU C  2  598  ? 85.383  -27.719 94.310   1.00 75.95  ? 598  GLU C CD    1 
ATOM   8218  O  OE1   . GLU C  2  598  ? 85.673  -26.521 94.102   1.00 84.54  ? 598  GLU C OE1   1 
ATOM   8219  O  OE2   . GLU C  2  598  ? 85.950  -28.675 93.736   1.00 74.08  ? 598  GLU C OE2   1 
ATOM   8220  N  N     . GLU C  2  599  ? 84.077  -28.613 98.915   1.00 45.80  ? 599  GLU C N     1 
ATOM   8221  C  CA    . GLU C  2  599  ? 84.294  -29.835 99.687   1.00 44.48  ? 599  GLU C CA    1 
ATOM   8222  C  C     . GLU C  2  599  ? 84.271  -29.472 101.169  1.00 37.50  ? 599  GLU C C     1 
ATOM   8223  O  O     . GLU C  2  599  ? 84.105  -28.304 101.515  1.00 35.74  ? 599  GLU C O     1 
ATOM   8224  C  CB    . GLU C  2  599  ? 85.628  -30.487 99.303   1.00 47.06  ? 599  GLU C CB    1 
ATOM   8225  C  CG    . GLU C  2  599  ? 85.732  -31.978 99.635   1.00 61.52  ? 599  GLU C CG    1 
ATOM   8226  C  CD    . GLU C  2  599  ? 84.755  -32.838 98.843   1.00 65.54  ? 599  GLU C CD    1 
ATOM   8227  O  OE1   . GLU C  2  599  ? 84.532  -32.549 97.645   1.00 56.82  ? 599  GLU C OE1   1 
ATOM   8228  O  OE2   . GLU C  2  599  ? 84.210  -33.806 99.420   1.00 62.70  ? 599  GLU C OE2   1 
ATOM   8229  N  N     . ASP C  2  600  ? 84.421  -30.457 102.047  1.00 37.11  ? 600  ASP C N     1 
ATOM   8230  C  CA    . ASP C  2  600  ? 84.502  -30.165 103.474  1.00 38.99  ? 600  ASP C CA    1 
ATOM   8231  C  C     . ASP C  2  600  ? 85.785  -29.395 103.723  1.00 34.66  ? 600  ASP C C     1 
ATOM   8232  O  O     . ASP C  2  600  ? 86.740  -29.523 102.963  1.00 37.27  ? 600  ASP C O     1 
ATOM   8233  C  CB    . ASP C  2  600  ? 84.484  -31.450 104.297  1.00 46.10  ? 600  ASP C CB    1 
ATOM   8234  C  CG    . ASP C  2  600  ? 83.219  -32.259 104.087  1.00 51.68  ? 600  ASP C CG    1 
ATOM   8235  O  OD1   . ASP C  2  600  ? 83.168  -33.041 103.114  1.00 60.88  ? 600  ASP C OD1   1 
ATOM   8236  O  OD2   . ASP C  2  600  ? 82.277  -32.116 104.897  1.00 51.17  ? 600  ASP C OD2   1 
ATOM   8237  N  N     . GLY C  2  601  ? 85.816  -28.586 104.773  1.00 27.48  ? 601  GLY C N     1 
ATOM   8238  C  CA    . GLY C  2  601  ? 87.002  -27.793 105.032  1.00 32.59  ? 601  GLY C CA    1 
ATOM   8239  C  C     . GLY C  2  601  ? 86.893  -26.820 106.186  1.00 33.78  ? 601  GLY C C     1 
ATOM   8240  O  O     . GLY C  2  601  ? 85.977  -26.899 107.007  1.00 33.94  ? 601  GLY C O     1 
ATOM   8241  N  N     . GLU C  2  602  ? 87.850  -25.901 106.247  1.00 30.68  ? 602  GLU C N     1 
ATOM   8242  C  CA    . GLU C  2  602  ? 87.888  -24.894 107.295  1.00 32.42  ? 602  GLU C CA    1 
ATOM   8243  C  C     . GLU C  2  602  ? 88.151  -23.521 106.681  1.00 31.92  ? 602  GLU C C     1 
ATOM   8244  O  O     . GLU C  2  602  ? 88.961  -23.381 105.760  1.00 27.06  ? 602  GLU C O     1 
ATOM   8245  C  CB    . GLU C  2  602  ? 88.958  -25.242 108.336  1.00 33.60  ? 602  GLU C CB    1 
ATOM   8246  C  CG    . GLU C  2  602  ? 88.977  -24.330 109.561  1.00 39.32  ? 602  GLU C CG    1 
ATOM   8247  C  CD    . GLU C  2  602  ? 90.022  -24.743 110.586  1.00 48.94  ? 602  GLU C CD    1 
ATOM   8248  O  OE1   . GLU C  2  602  ? 90.559  -25.864 110.462  1.00 65.07  ? 602  GLU C OE1   1 
ATOM   8249  O  OE2   . GLU C  2  602  ? 90.309  -23.951 111.513  1.00 42.48  ? 602  GLU C OE2   1 
ATOM   8250  N  N     . VAL C  2  603  ? 87.462  -22.508 107.194  1.00 31.98  ? 603  VAL C N     1 
ATOM   8251  C  CA    . VAL C  2  603  ? 87.568  -21.175 106.624  1.00 31.82  ? 603  VAL C CA    1 
ATOM   8252  C  C     . VAL C  2  603  ? 88.842  -20.487 107.108  1.00 26.45  ? 603  VAL C C     1 
ATOM   8253  O  O     . VAL C  2  603  ? 89.005  -20.198 108.295  1.00 23.24  ? 603  VAL C O     1 
ATOM   8254  C  CB    . VAL C  2  603  ? 86.331  -20.320 106.989  1.00 28.85  ? 603  VAL C CB    1 
ATOM   8255  C  CG1   . VAL C  2  603  ? 86.555  -18.878 106.606  1.00 27.33  ? 603  VAL C CG1   1 
ATOM   8256  C  CG2   . VAL C  2  603  ? 85.080  -20.868 106.305  1.00 22.60  ? 603  VAL C CG2   1 
ATOM   8257  N  N     . ALA C  2  604  ? 89.736  -20.218 106.166  1.00 25.31  ? 604  ALA C N     1 
ATOM   8258  C  CA    . ALA C  2  604  ? 91.016  -19.599 106.468  1.00 24.25  ? 604  ALA C CA    1 
ATOM   8259  C  C     . ALA C  2  604  ? 90.900  -18.092 106.631  1.00 21.99  ? 604  ALA C C     1 
ATOM   8260  O  O     . ALA C  2  604  ? 91.379  -17.517 107.604  1.00 26.21  ? 604  ALA C O     1 
ATOM   8261  C  CB    . ALA C  2  604  ? 92.023  -19.936 105.377  1.00 30.09  ? 604  ALA C CB    1 
ATOM   8262  N  N     . LYS C  2  605  ? 90.241  -17.458 105.673  1.00 27.37  ? 605  LYS C N     1 
ATOM   8263  C  CA    . LYS C  2  605  ? 90.171  -16.007 105.632  1.00 29.06  ? 605  LYS C CA    1 
ATOM   8264  C  C     . LYS C  2  605  ? 88.765  -15.555 105.265  1.00 28.38  ? 605  LYS C C     1 
ATOM   8265  O  O     . LYS C  2  605  ? 88.087  -16.219 104.487  1.00 30.06  ? 605  LYS C O     1 
ATOM   8266  C  CB    . LYS C  2  605  ? 91.163  -15.472 104.599  1.00 29.13  ? 605  LYS C CB    1 
ATOM   8267  C  CG    . LYS C  2  605  ? 92.618  -15.608 104.998  1.00 30.38  ? 605  LYS C CG    1 
ATOM   8268  C  CD    . LYS C  2  605  ? 93.527  -15.007 103.935  1.00 34.66  ? 605  LYS C CD    1 
ATOM   8269  C  CE    . LYS C  2  605  ? 94.992  -15.099 104.340  1.00 37.14  ? 605  LYS C CE    1 
ATOM   8270  N  NZ    . LYS C  2  605  ? 95.867  -14.294 103.441  1.00 46.01  ? 605  LYS C NZ    1 
ATOM   8271  N  N     . VAL C  2  606  ? 88.319  -14.441 105.841  1.00 26.85  ? 606  VAL C N     1 
ATOM   8272  C  CA    . VAL C  2  606  ? 87.072  -13.809 105.414  1.00 23.18  ? 606  VAL C CA    1 
ATOM   8273  C  C     . VAL C  2  606  ? 87.213  -12.296 105.294  1.00 26.50  ? 606  VAL C C     1 
ATOM   8274  O  O     . VAL C  2  606  ? 87.537  -11.603 106.256  1.00 24.69  ? 606  VAL C O     1 
ATOM   8275  C  CB    . VAL C  2  606  ? 85.879  -14.132 106.333  1.00 24.23  ? 606  VAL C CB    1 
ATOM   8276  C  CG1   . VAL C  2  606  ? 84.681  -13.275 105.954  1.00 25.06  ? 606  VAL C CG1   1 
ATOM   8277  C  CG2   . VAL C  2  606  ? 85.511  -15.586 106.233  1.00 23.27  ? 606  VAL C CG2   1 
ATOM   8278  N  N     . ASP C  2  607  ? 86.949  -11.799 104.095  1.00 34.83  ? 607  ASP C N     1 
ATOM   8279  C  CA    . ASP C  2  607  ? 87.048  -10.386 103.792  1.00 26.06  ? 607  ASP C CA    1 
ATOM   8280  C  C     . ASP C  2  607  ? 85.724  -9.973  103.161  1.00 28.73  ? 607  ASP C C     1 
ATOM   8281  O  O     . ASP C  2  607  ? 84.927  -10.828 102.766  1.00 26.57  ? 607  ASP C O     1 
ATOM   8282  C  CB    . ASP C  2  607  ? 88.195  -10.159 102.804  1.00 26.21  ? 607  ASP C CB    1 
ATOM   8283  C  CG    . ASP C  2  607  ? 88.805  -8.786  102.930  1.00 35.99  ? 607  ASP C CG    1 
ATOM   8284  O  OD1   . ASP C  2  607  ? 88.597  -8.158  103.990  1.00 35.30  ? 607  ASP C OD1   1 
ATOM   8285  O  OD2   . ASP C  2  607  ? 89.494  -8.339  101.980  1.00 37.44  ? 607  ASP C OD2   1 
ATOM   8286  N  N     . GLY C  2  608  ? 85.478  -8.670  103.080  1.00 30.45  ? 608  GLY C N     1 
ATOM   8287  C  CA    . GLY C  2  608  ? 84.320  -8.173  102.363  1.00 21.37  ? 608  GLY C CA    1 
ATOM   8288  C  C     . GLY C  2  608  ? 84.439  -8.528  100.894  1.00 19.89  ? 608  GLY C C     1 
ATOM   8289  O  O     . GLY C  2  608  ? 83.450  -8.835  100.234  1.00 21.99  ? 608  GLY C O     1 
ATOM   8290  N  N     . ASN C  2  609  ? 85.663  -8.470  100.384  1.00 18.71  ? 609  ASN C N     1 
ATOM   8291  C  CA    . ASN C  2  609  ? 85.944  -8.786  98.990   1.00 16.76  ? 609  ASN C CA    1 
ATOM   8292  C  C     . ASN C  2  609  ? 86.125  -10.261 98.646   1.00 21.07  ? 609  ASN C C     1 
ATOM   8293  O  O     . ASN C  2  609  ? 85.844  -10.679 97.521   1.00 17.28  ? 609  ASN C O     1 
ATOM   8294  C  CB    . ASN C  2  609  ? 87.167  -8.011  98.540   1.00 13.51  ? 609  ASN C CB    1 
ATOM   8295  C  CG    . ASN C  2  609  ? 86.982  -6.540  98.691   1.00 16.05  ? 609  ASN C CG    1 
ATOM   8296  O  OD1   . ASN C  2  609  ? 85.995  -5.981  98.215   1.00 19.13  ? 609  ASN C OD1   1 
ATOM   8297  N  ND2   . ASN C  2  609  ? 87.912  -5.892  99.380   1.00 22.66  ? 609  ASN C ND2   1 
ATOM   8298  N  N     . ARG C  2  610  ? 86.624  -11.042 99.600   1.00 20.50  ? 610  ARG C N     1 
ATOM   8299  C  CA    . ARG C  2  610  ? 87.056  -12.399 99.297   1.00 17.33  ? 610  ARG C CA    1 
ATOM   8300  C  C     . ARG C  2  610  ? 86.924  -13.326 100.494  1.00 22.43  ? 610  ARG C C     1 
ATOM   8301  O  O     . ARG C  2  610  ? 87.052  -12.895 101.633  1.00 26.29  ? 610  ARG C O     1 
ATOM   8302  C  CB    . ARG C  2  610  ? 88.508  -12.370 98.812   1.00 22.93  ? 610  ARG C CB    1 
ATOM   8303  C  CG    . ARG C  2  610  ? 89.423  -13.428 99.422   1.00 30.51  ? 610  ARG C CG    1 
ATOM   8304  C  CD    . ARG C  2  610  ? 90.647  -12.818 100.106  1.00 28.32  ? 610  ARG C CD    1 
ATOM   8305  N  NE    . ARG C  2  610  ? 90.373  -12.392 101.477  1.00 27.35  ? 610  ARG C NE    1 
ATOM   8306  C  CZ    . ARG C  2  610  ? 91.314  -12.054 102.353  1.00 32.51  ? 610  ARG C CZ    1 
ATOM   8307  N  NH1   . ARG C  2  610  ? 90.982  -11.680 103.582  1.00 26.64  ? 610  ARG C NH1   1 
ATOM   8308  N  NH2   . ARG C  2  610  ? 92.593  -12.095 102.001  1.00 35.25  ? 610  ARG C NH2   1 
ATOM   8309  N  N     . ILE C  2  611  ? 86.656  -14.600 100.230  1.00 23.33  ? 611  ILE C N     1 
ATOM   8310  C  CA    . ILE C  2  611  ? 86.722  -15.621 101.265  1.00 19.93  ? 611  ILE C CA    1 
ATOM   8311  C  C     . ILE C  2  611  ? 87.774  -16.640 100.840  1.00 25.00  ? 611  ILE C C     1 
ATOM   8312  O  O     . ILE C  2  611  ? 87.852  -16.990 99.669   1.00 25.95  ? 611  ILE C O     1 
ATOM   8313  C  CB    . ILE C  2  611  ? 85.362  -16.325 101.455  1.00 19.89  ? 611  ILE C CB    1 
ATOM   8314  C  CG1   . ILE C  2  611  ? 84.282  -15.319 101.858  1.00 20.59  ? 611  ILE C CG1   1 
ATOM   8315  C  CG2   . ILE C  2  611  ? 85.455  -17.429 102.500  1.00 19.38  ? 611  ILE C CG2   1 
ATOM   8316  C  CD1   . ILE C  2  611  ? 82.876  -15.909 101.897  1.00 16.02  ? 611  ILE C CD1   1 
ATOM   8317  N  N     . VAL C  2  612  ? 88.596  -17.099 101.780  1.00 30.73  ? 612  VAL C N     1 
ATOM   8318  C  CA    . VAL C  2  612  ? 89.588  -18.134 101.491  1.00 28.20  ? 612  VAL C CA    1 
ATOM   8319  C  C     . VAL C  2  612  ? 89.363  -19.363 102.366  1.00 30.59  ? 612  VAL C C     1 
ATOM   8320  O  O     . VAL C  2  612  ? 89.309  -19.260 103.591  1.00 32.83  ? 612  VAL C O     1 
ATOM   8321  C  CB    . VAL C  2  612  ? 91.023  -17.628 101.694  1.00 27.34  ? 612  VAL C CB    1 
ATOM   8322  C  CG1   . VAL C  2  612  ? 92.004  -18.775 101.562  1.00 32.08  ? 612  VAL C CG1   1 
ATOM   8323  C  CG2   . VAL C  2  612  ? 91.345  -16.524 100.696  1.00 32.59  ? 612  VAL C CG2   1 
ATOM   8324  N  N     . VAL C  2  613  ? 89.229  -20.523 101.729  1.00 34.37  ? 613  VAL C N     1 
ATOM   8325  C  CA    . VAL C  2  613  ? 88.937  -21.763 102.436  1.00 34.04  ? 613  VAL C CA    1 
ATOM   8326  C  C     . VAL C  2  613  ? 89.993  -22.828 102.173  1.00 39.68  ? 613  VAL C C     1 
ATOM   8327  O  O     . VAL C  2  613  ? 90.355  -23.085 101.023  1.00 40.67  ? 613  VAL C O     1 
ATOM   8328  C  CB    . VAL C  2  613  ? 87.579  -22.340 102.005  1.00 32.77  ? 613  VAL C CB    1 
ATOM   8329  C  CG1   . VAL C  2  613  ? 87.235  -23.569 102.834  1.00 32.15  ? 613  VAL C CG1   1 
ATOM   8330  C  CG2   . VAL C  2  613  ? 86.496  -21.287 102.125  1.00 32.82  ? 613  VAL C CG2   1 
ATOM   8331  N  N     . ARG C  2  614  ? 90.480  -23.445 103.244  1.00 37.68  ? 614  ARG C N     1 
ATOM   8332  C  CA    . ARG C  2  614  ? 91.355  -24.605 103.131  1.00 43.77  ? 614  ARG C CA    1 
ATOM   8333  C  C     . ARG C  2  614  ? 90.520  -25.873 103.215  1.00 39.30  ? 614  ARG C C     1 
ATOM   8334  O  O     . ARG C  2  614  ? 89.793  -26.076 104.187  1.00 42.92  ? 614  ARG C O     1 
ATOM   8335  C  CB    . ARG C  2  614  ? 92.397  -24.603 104.250  1.00 55.13  ? 614  ARG C CB    1 
ATOM   8336  C  CG    . ARG C  2  614  ? 93.187  -25.900 104.361  1.00 54.54  ? 614  ARG C CG    1 
ATOM   8337  C  CD    . ARG C  2  614  ? 94.274  -25.806 105.424  1.00 59.61  ? 614  ARG C CD    1 
ATOM   8338  N  NE    . ARG C  2  614  ? 95.147  -24.654 105.210  1.00 64.28  ? 614  ARG C NE    1 
ATOM   8339  C  CZ    . ARG C  2  614  ? 96.112  -24.603 104.296  1.00 64.97  ? 614  ARG C CZ    1 
ATOM   8340  N  NH1   . ARG C  2  614  ? 96.854  -23.511 104.175  1.00 66.53  ? 614  ARG C NH1   1 
ATOM   8341  N  NH2   . ARG C  2  614  ? 96.333  -25.641 103.498  1.00 57.44  ? 614  ARG C NH2   1 
ATOM   8342  N  N     . TYR C  2  615  ? 90.617  -26.727 102.203  1.00 36.37  ? 615  TYR C N     1 
ATOM   8343  C  CA    . TYR C  2  615  ? 89.828  -27.957 102.195  1.00 48.57  ? 615  TYR C CA    1 
ATOM   8344  C  C     . TYR C  2  615  ? 90.585  -29.138 102.816  1.00 52.02  ? 615  TYR C C     1 
ATOM   8345  O  O     . TYR C  2  615  ? 91.708  -28.978 103.295  1.00 52.36  ? 615  TYR C O     1 
ATOM   8346  C  CB    . TYR C  2  615  ? 89.322  -28.280 100.778  1.00 51.74  ? 615  TYR C CB    1 
ATOM   8347  C  CG    . TYR C  2  615  ? 88.277  -27.301 100.271  1.00 45.86  ? 615  TYR C CG    1 
ATOM   8348  C  CD1   . TYR C  2  615  ? 88.530  -26.478 99.179   1.00 44.20  ? 615  TYR C CD1   1 
ATOM   8349  C  CD2   . TYR C  2  615  ? 87.042  -27.187 100.902  1.00 43.93  ? 615  TYR C CD2   1 
ATOM   8350  C  CE1   . TYR C  2  615  ? 87.574  -25.576 98.723   1.00 42.67  ? 615  TYR C CE1   1 
ATOM   8351  C  CE2   . TYR C  2  615  ? 86.085  -26.288 100.454  1.00 38.54  ? 615  TYR C CE2   1 
ATOM   8352  C  CZ    . TYR C  2  615  ? 86.355  -25.487 99.366   1.00 39.26  ? 615  TYR C CZ    1 
ATOM   8353  O  OH    . TYR C  2  615  ? 85.401  -24.596 98.929   1.00 28.88  ? 615  TYR C OH    1 
ATOM   8354  N  N     . GLU C  2  616  ? 89.951  -30.311 102.822  1.00 57.52  ? 616  GLU C N     1 
ATOM   8355  C  CA    . GLU C  2  616  ? 90.541  -31.525 103.387  1.00 61.37  ? 616  GLU C CA    1 
ATOM   8356  C  C     . GLU C  2  616  ? 91.873  -31.829 102.717  1.00 65.57  ? 616  GLU C C     1 
ATOM   8357  O  O     . GLU C  2  616  ? 92.886  -32.057 103.383  1.00 60.81  ? 616  GLU C O     1 
ATOM   8358  C  CB    . GLU C  2  616  ? 89.604  -32.722 103.187  1.00 59.91  ? 616  GLU C CB    1 
ATOM   8359  C  CG    . GLU C  2  616  ? 88.157  -32.499 103.606  1.00 58.43  ? 616  GLU C CG    1 
ATOM   8360  C  CD    . GLU C  2  616  ? 87.930  -32.678 105.098  1.00 64.81  ? 616  GLU C CD    1 
ATOM   8361  O  OE1   . GLU C  2  616  ? 88.571  -31.957 105.896  1.00 65.77  ? 616  GLU C OE1   1 
ATOM   8362  O  OE2   . GLU C  2  616  ? 87.104  -33.541 105.472  1.00 64.01  ? 616  GLU C OE2   1 
ATOM   8363  N  N     . ASP C  2  617  ? 91.850  -31.815 101.387  1.00 65.47  ? 617  ASP C N     1 
ATOM   8364  C  CA    . ASP C  2  617  ? 93.016  -32.104 100.561  1.00 61.41  ? 617  ASP C CA    1 
ATOM   8365  C  C     . ASP C  2  617  ? 94.223  -31.251 100.943  1.00 59.95  ? 617  ASP C C     1 
ATOM   8366  O  O     . ASP C  2  617  ? 95.367  -31.686 100.807  1.00 63.67  ? 617  ASP C O     1 
ATOM   8367  C  CB    . ASP C  2  617  ? 92.662  -31.904 99.085   1.00 67.47  ? 617  ASP C CB    1 
ATOM   8368  C  CG    . ASP C  2  617  ? 91.376  -31.111 98.896   1.00 70.14  ? 617  ASP C CG    1 
ATOM   8369  O  OD1   . ASP C  2  617  ? 90.287  -31.730 98.849   1.00 66.45  ? 617  ASP C OD1   1 
ATOM   8370  O  OD2   . ASP C  2  617  ? 91.452  -29.868 98.804   1.00 58.19  ? 617  ASP C OD2   1 
ATOM   8371  N  N     . GLY C  2  618  ? 93.961  -30.046 101.438  1.00 59.95  ? 618  GLY C N     1 
ATOM   8372  C  CA    . GLY C  2  618  ? 95.017  -29.154 101.877  1.00 58.25  ? 618  GLY C CA    1 
ATOM   8373  C  C     . GLY C  2  618  ? 95.233  -27.962 100.965  1.00 57.05  ? 618  GLY C C     1 
ATOM   8374  O  O     . GLY C  2  618  ? 95.925  -27.011 101.335  1.00 53.13  ? 618  GLY C O     1 
ATOM   8375  N  N     . ARG C  2  619  ? 94.643  -28.002 99.772   1.00 58.11  ? 619  ARG C N     1 
ATOM   8376  C  CA    . ARG C  2  619  ? 94.763  -26.882 98.842   1.00 59.76  ? 619  ARG C CA    1 
ATOM   8377  C  C     . ARG C  2  619  ? 93.966  -25.675 99.336   1.00 53.44  ? 619  ARG C C     1 
ATOM   8378  O  O     . ARG C  2  619  ? 92.875  -25.815 99.896   1.00 48.00  ? 619  ARG C O     1 
ATOM   8379  C  CB    . ARG C  2  619  ? 94.338  -27.282 97.424   1.00 54.27  ? 619  ARG C CB    1 
ATOM   8380  C  CG    . ARG C  2  619  ? 92.869  -27.608 97.281   1.00 51.24  ? 619  ARG C CG    1 
ATOM   8381  C  CD    . ARG C  2  619  ? 92.568  -28.243 95.940   1.00 48.93  ? 619  ARG C CD    1 
ATOM   8382  N  NE    . ARG C  2  619  ? 91.224  -28.814 95.909   1.00 61.05  ? 619  ARG C NE    1 
ATOM   8383  C  CZ    . ARG C  2  619  ? 90.160  -28.197 95.403   1.00 62.01  ? 619  ARG C CZ    1 
ATOM   8384  N  NH1   . ARG C  2  619  ? 88.973  -28.792 95.419   1.00 46.84  ? 619  ARG C NH1   1 
ATOM   8385  N  NH2   . ARG C  2  619  ? 90.285  -26.987 94.875   1.00 63.55  ? 619  ARG C NH2   1 
ATOM   8386  N  N     . LEU C  2  620  ? 94.522  -24.487 99.125   1.00 52.76  ? 620  LEU C N     1 
ATOM   8387  C  CA    . LEU C  2  620  ? 93.917  -23.265 99.627   1.00 46.67  ? 620  LEU C CA    1 
ATOM   8388  C  C     . LEU C  2  620  ? 93.166  -22.571 98.497   1.00 46.22  ? 620  LEU C C     1 
ATOM   8389  O  O     . LEU C  2  620  ? 93.778  -22.014 97.583   1.00 41.02  ? 620  LEU C O     1 
ATOM   8390  C  CB    . LEU C  2  620  ? 95.005  -22.346 100.185  1.00 38.87  ? 620  LEU C CB    1 
ATOM   8391  C  CG    . LEU C  2  620  ? 94.578  -21.246 101.152  1.00 41.95  ? 620  LEU C CG    1 
ATOM   8392  C  CD1   . LEU C  2  620  ? 94.025  -21.846 102.431  1.00 43.16  ? 620  LEU C CD1   1 
ATOM   8393  C  CD2   . LEU C  2  620  ? 95.743  -20.321 101.453  1.00 45.63  ? 620  LEU C CD2   1 
ATOM   8394  N  N     . VAL C  2  621  ? 91.837  -22.597 98.573   1.00 46.52  ? 621  VAL C N     1 
ATOM   8395  C  CA    . VAL C  2  621  ? 90.994  -22.063 97.504   1.00 42.30  ? 621  VAL C CA    1 
ATOM   8396  C  C     . VAL C  2  621  ? 90.469  -20.670 97.830   1.00 37.63  ? 621  VAL C C     1 
ATOM   8397  O  O     . VAL C  2  621  ? 89.988  -20.419 98.936   1.00 36.15  ? 621  VAL C O     1 
ATOM   8398  C  CB    . VAL C  2  621  ? 89.809  -22.995 97.200   1.00 35.36  ? 621  VAL C CB    1 
ATOM   8399  C  CG1   . VAL C  2  621  ? 89.001  -22.460 96.027   1.00 30.82  ? 621  VAL C CG1   1 
ATOM   8400  C  CG2   . VAL C  2  621  ? 90.310  -24.395 96.903   1.00 43.51  ? 621  VAL C CG2   1 
ATOM   8401  N  N     . GLU C  2  622  ? 90.565  -19.768 96.859   1.00 31.22  ? 622  GLU C N     1 
ATOM   8402  C  CA    . GLU C  2  622  ? 90.150  -18.386 97.058   1.00 33.50  ? 622  GLU C CA    1 
ATOM   8403  C  C     . GLU C  2  622  ? 88.914  -18.040 96.233   1.00 31.96  ? 622  GLU C C     1 
ATOM   8404  O  O     . GLU C  2  622  ? 88.964  -18.007 95.005   1.00 36.80  ? 622  GLU C O     1 
ATOM   8405  C  CB    . GLU C  2  622  ? 91.298  -17.433 96.719   1.00 30.42  ? 622  GLU C CB    1 
ATOM   8406  C  CG    . GLU C  2  622  ? 90.973  -15.964 96.908   1.00 30.96  ? 622  GLU C CG    1 
ATOM   8407  C  CD    . GLU C  2  622  ? 92.219  -15.100 96.920   1.00 42.15  ? 622  GLU C CD    1 
ATOM   8408  O  OE1   . GLU C  2  622  ? 92.093  -13.868 97.091   1.00 36.83  ? 622  GLU C OE1   1 
ATOM   8409  O  OE2   . GLU C  2  622  ? 93.328  -15.656 96.763   1.00 49.14  ? 622  GLU C OE2   1 
ATOM   8410  N  N     . TYR C  2  623  ? 87.806  -17.791 96.923   1.00 27.98  ? 623  TYR C N     1 
ATOM   8411  C  CA    . TYR C  2  623  ? 86.572  -17.351 96.286   1.00 22.09  ? 623  TYR C CA    1 
ATOM   8412  C  C     . TYR C  2  623  ? 86.428  -15.837 96.361   1.00 21.71  ? 623  TYR C C     1 
ATOM   8413  O  O     . TYR C  2  623  ? 86.168  -15.286 97.433   1.00 22.61  ? 623  TYR C O     1 
ATOM   8414  C  CB    . TYR C  2  623  ? 85.373  -18.009 96.961   1.00 17.92  ? 623  TYR C CB    1 
ATOM   8415  C  CG    . TYR C  2  623  ? 85.386  -19.513 96.874   1.00 22.33  ? 623  TYR C CG    1 
ATOM   8416  C  CD1   . TYR C  2  623  ? 85.206  -20.155 95.656   1.00 25.03  ? 623  TYR C CD1   1 
ATOM   8417  C  CD2   . TYR C  2  623  ? 85.576  -20.293 98.007   1.00 24.28  ? 623  TYR C CD2   1 
ATOM   8418  C  CE1   . TYR C  2  623  ? 85.215  -21.534 95.565   1.00 29.50  ? 623  TYR C CE1   1 
ATOM   8419  C  CE2   . TYR C  2  623  ? 85.584  -21.677 97.928   1.00 28.39  ? 623  TYR C CE2   1 
ATOM   8420  C  CZ    . TYR C  2  623  ? 85.402  -22.292 96.702   1.00 35.05  ? 623  TYR C CZ    1 
ATOM   8421  O  OH    . TYR C  2  623  ? 85.411  -23.666 96.606   1.00 44.31  ? 623  TYR C OH    1 
ATOM   8422  N  N     . PRO C  2  624  ? 86.602  -15.154 95.221   1.00 18.92  ? 624  PRO C N     1 
ATOM   8423  C  CA    . PRO C  2  624  ? 86.362  -13.710 95.181   1.00 21.22  ? 624  PRO C CA    1 
ATOM   8424  C  C     . PRO C  2  624  ? 84.862  -13.443 95.195   1.00 19.41  ? 624  PRO C C     1 
ATOM   8425  O  O     . PRO C  2  624  ? 84.092  -14.254 94.678   1.00 15.85  ? 624  PRO C O     1 
ATOM   8426  C  CB    . PRO C  2  624  ? 86.965  -13.299 93.839   1.00 16.05  ? 624  PRO C CB    1 
ATOM   8427  C  CG    . PRO C  2  624  ? 86.806  -14.509 92.988   1.00 18.42  ? 624  PRO C CG    1 
ATOM   8428  C  CD    . PRO C  2  624  ? 87.000  -15.685 93.907   1.00 17.16  ? 624  PRO C CD    1 
ATOM   8429  N  N     . LEU C  2  625  ? 84.450  -12.330 95.790   1.00 18.32  ? 625  LEU C N     1 
ATOM   8430  C  CA    . LEU C  2  625  ? 83.032  -12.012 95.885   1.00 14.02  ? 625  LEU C CA    1 
ATOM   8431  C  C     . LEU C  2  625  ? 82.675  -10.858 94.966   1.00 15.38  ? 625  LEU C C     1 
ATOM   8432  O  O     . LEU C  2  625  ? 83.376  -9.846  94.920   1.00 16.82  ? 625  LEU C O     1 
ATOM   8433  C  CB    . LEU C  2  625  ? 82.644  -11.683 97.328   1.00 13.36  ? 625  LEU C CB    1 
ATOM   8434  C  CG    . LEU C  2  625  ? 82.835  -12.810 98.344   1.00 13.06  ? 625  LEU C CG    1 
ATOM   8435  C  CD1   . LEU C  2  625  ? 82.463  -12.361 99.751   1.00 13.50  ? 625  LEU C CD1   1 
ATOM   8436  C  CD2   . LEU C  2  625  ? 82.030  -14.032 97.938   1.00 13.20  ? 625  LEU C CD2   1 
ATOM   8437  N  N     . ARG C  2  626  ? 81.588  -11.030 94.223   1.00 17.23  ? 626  ARG C N     1 
ATOM   8438  C  CA    . ARG C  2  626  ? 81.047  -9.977  93.374   1.00 20.83  ? 626  ARG C CA    1 
ATOM   8439  C  C     . ARG C  2  626  ? 80.423  -8.899  94.257   1.00 20.04  ? 626  ARG C C     1 
ATOM   8440  O  O     . ARG C  2  626  ? 79.530  -9.184  95.058   1.00 16.22  ? 626  ARG C O     1 
ATOM   8441  C  CB    . ARG C  2  626  ? 80.009  -10.587 92.434   1.00 25.99  ? 626  ARG C CB    1 
ATOM   8442  C  CG    . ARG C  2  626  ? 79.063  -9.619  91.773   1.00 26.16  ? 626  ARG C CG    1 
ATOM   8443  C  CD    . ARG C  2  626  ? 78.243  -10.324 90.693   1.00 33.88  ? 626  ARG C CD    1 
ATOM   8444  N  NE    . ARG C  2  626  ? 79.077  -10.760 89.573   1.00 44.83  ? 626  ARG C NE    1 
ATOM   8445  C  CZ    . ARG C  2  626  ? 79.532  -12.000 89.411   1.00 47.33  ? 626  ARG C CZ    1 
ATOM   8446  N  NH1   . ARG C  2  626  ? 79.228  -12.942 90.297   1.00 39.49  ? 626  ARG C NH1   1 
ATOM   8447  N  NH2   . ARG C  2  626  ? 80.291  -12.297 88.363   1.00 43.69  ? 626  ARG C NH2   1 
ATOM   8448  N  N     . ARG C  2  627  ? 80.896  -7.664  94.113   1.00 17.21  ? 627  ARG C N     1 
ATOM   8449  C  CA    . ARG C  2  627  ? 80.525  -6.601  95.045   1.00 14.84  ? 627  ARG C CA    1 
ATOM   8450  C  C     . ARG C  2  627  ? 80.009  -5.334  94.370   1.00 17.18  ? 627  ARG C C     1 
ATOM   8451  O  O     . ARG C  2  627  ? 80.745  -4.661  93.650   1.00 27.50  ? 627  ARG C O     1 
ATOM   8452  C  CB    . ARG C  2  627  ? 81.704  -6.268  95.957   1.00 13.46  ? 627  ARG C CB    1 
ATOM   8453  C  CG    . ARG C  2  627  ? 81.750  -7.092  97.222   1.00 11.46  ? 627  ARG C CG    1 
ATOM   8454  C  CD    . ARG C  2  627  ? 80.490  -6.874  98.025   1.00 13.68  ? 627  ARG C CD    1 
ATOM   8455  N  NE    . ARG C  2  627  ? 80.630  -7.349  99.394   1.00 16.30  ? 627  ARG C NE    1 
ATOM   8456  C  CZ    . ARG C  2  627  ? 79.708  -7.187  100.337  1.00 20.37  ? 627  ARG C CZ    1 
ATOM   8457  N  NH1   . ARG C  2  627  ? 78.572  -6.562  100.058  1.00 19.77  ? 627  ARG C NH1   1 
ATOM   8458  N  NH2   . ARG C  2  627  ? 79.921  -7.652  101.560  1.00 21.46  ? 627  ARG C NH2   1 
ATOM   8459  N  N     . PHE C  2  628  ? 78.743  -5.017  94.628   1.00 15.19  ? 628  PHE C N     1 
ATOM   8460  C  CA    . PHE C  2  628  ? 78.045  -3.884  94.022   1.00 14.57  ? 628  PHE C CA    1 
ATOM   8461  C  C     . PHE C  2  628  ? 78.164  -3.852  92.500   1.00 18.01  ? 628  PHE C C     1 
ATOM   8462  O  O     . PHE C  2  628  ? 78.574  -2.849  91.918   1.00 21.48  ? 628  PHE C O     1 
ATOM   8463  C  CB    . PHE C  2  628  ? 78.516  -2.572  94.636   1.00 13.44  ? 628  PHE C CB    1 
ATOM   8464  C  CG    . PHE C  2  628  ? 78.446  -2.554  96.130   1.00 16.67  ? 628  PHE C CG    1 
ATOM   8465  C  CD1   . PHE C  2  628  ? 77.309  -2.104  96.775   1.00 16.68  ? 628  PHE C CD1   1 
ATOM   8466  C  CD2   . PHE C  2  628  ? 79.513  -3.001  96.892   1.00 17.16  ? 628  PHE C CD2   1 
ATOM   8467  C  CE1   . PHE C  2  628  ? 77.241  -2.086  98.156   1.00 17.80  ? 628  PHE C CE1   1 
ATOM   8468  C  CE2   . PHE C  2  628  ? 79.452  -2.989  98.274   1.00 15.66  ? 628  PHE C CE2   1 
ATOM   8469  C  CZ    . PHE C  2  628  ? 78.316  -2.531  98.907   1.00 18.03  ? 628  PHE C CZ    1 
ATOM   8470  N  N     . TYR C  2  629  ? 77.807  -4.961  91.863   1.00 18.31  ? 629  TYR C N     1 
ATOM   8471  C  CA    . TYR C  2  629  ? 77.800  -5.040  90.410   1.00 17.79  ? 629  TYR C CA    1 
ATOM   8472  C  C     . TYR C  2  629  ? 76.407  -4.695  89.920   1.00 13.23  ? 629  TYR C C     1 
ATOM   8473  O  O     . TYR C  2  629  ? 75.416  -4.988  90.591   1.00 10.34  ? 629  TYR C O     1 
ATOM   8474  C  CB    . TYR C  2  629  ? 78.229  -6.429  89.912   1.00 21.89  ? 629  TYR C CB    1 
ATOM   8475  C  CG    . TYR C  2  629  ? 79.735  -6.670  89.927   1.00 41.87  ? 629  TYR C CG    1 
ATOM   8476  C  CD1   . TYR C  2  629  ? 80.598  -5.806  90.604   1.00 41.52  ? 629  TYR C CD1   1 
ATOM   8477  C  CD2   . TYR C  2  629  ? 80.296  -7.752  89.246   1.00 47.63  ? 629  TYR C CD2   1 
ATOM   8478  C  CE1   . TYR C  2  629  ? 81.975  -6.021  90.614   1.00 44.98  ? 629  TYR C CE1   1 
ATOM   8479  C  CE2   . TYR C  2  629  ? 81.673  -7.976  89.254   1.00 45.46  ? 629  TYR C CE2   1 
ATOM   8480  C  CZ    . TYR C  2  629  ? 82.504  -7.106  89.937   1.00 48.24  ? 629  TYR C CZ    1 
ATOM   8481  O  OH    . TYR C  2  629  ? 83.865  -7.316  89.945   1.00 53.38  ? 629  TYR C OH    1 
ATOM   8482  N  N     . ARG C  2  630  ? 76.343  -4.039  88.766   1.00 11.34  ? 630  ARG C N     1 
ATOM   8483  C  CA    . ARG C  2  630  ? 75.079  -3.578  88.207   1.00 7.47   ? 630  ARG C CA    1 
ATOM   8484  C  C     . ARG C  2  630  ? 74.477  -4.580  87.228   1.00 10.05  ? 630  ARG C C     1 
ATOM   8485  O  O     . ARG C  2  630  ? 75.072  -4.872  86.193   1.00 15.36  ? 630  ARG C O     1 
ATOM   8486  C  CB    . ARG C  2  630  ? 75.289  -2.252  87.490   1.00 5.35   ? 630  ARG C CB    1 
ATOM   8487  C  CG    . ARG C  2  630  ? 74.062  -1.774  86.767   1.00 5.52   ? 630  ARG C CG    1 
ATOM   8488  C  CD    . ARG C  2  630  ? 74.415  -0.840  85.632   1.00 6.58   ? 630  ARG C CD    1 
ATOM   8489  N  NE    . ARG C  2  630  ? 73.220  -0.185  85.118   1.00 9.10   ? 630  ARG C NE    1 
ATOM   8490  C  CZ    . ARG C  2  630  ? 72.506  -0.633  84.093   1.00 9.77   ? 630  ARG C CZ    1 
ATOM   8491  N  NH1   . ARG C  2  630  ? 71.425  0.031   83.704   1.00 12.00  ? 630  ARG C NH1   1 
ATOM   8492  N  NH2   . ARG C  2  630  ? 72.873  -1.738  83.456   1.00 6.56   ? 630  ARG C NH2   1 
ATOM   8493  N  N     . SER C  2  631  ? 73.290  -5.093  87.537   1.00 8.09   ? 631  SER C N     1 
ATOM   8494  C  CA    . SER C  2  631  ? 72.638  -6.047  86.649   1.00 8.10   ? 631  SER C CA    1 
ATOM   8495  C  C     . SER C  2  631  ? 72.082  -5.331  85.434   1.00 7.41   ? 631  SER C C     1 
ATOM   8496  O  O     . SER C  2  631  ? 72.136  -4.103  85.360   1.00 7.66   ? 631  SER C O     1 
ATOM   8497  C  CB    . SER C  2  631  ? 71.503  -6.776  87.372   1.00 10.21  ? 631  SER C CB    1 
ATOM   8498  O  OG    . SER C  2  631  ? 70.390  -5.926  87.599   1.00 7.08   ? 631  SER C OG    1 
ATOM   8499  N  N     . ASN C  2  632  ? 71.520  -6.100  84.503   1.00 6.93   ? 632  ASN C N     1 
ATOM   8500  C  CA    . ASN C  2  632  ? 70.872  -5.546  83.316   1.00 6.61   ? 632  ASN C CA    1 
ATOM   8501  C  C     . ASN C  2  632  ? 69.848  -4.477  83.674   1.00 6.87   ? 632  ASN C C     1 
ATOM   8502  O  O     . ASN C  2  632  ? 69.711  -3.465  82.985   1.00 7.79   ? 632  ASN C O     1 
ATOM   8503  C  CB    . ASN C  2  632  ? 70.169  -6.651  82.526   1.00 6.96   ? 632  ASN C CB    1 
ATOM   8504  C  CG    . ASN C  2  632  ? 71.113  -7.433  81.644   1.00 8.22   ? 632  ASN C CG    1 
ATOM   8505  O  OD1   . ASN C  2  632  ? 72.259  -7.031  81.428   1.00 8.93   ? 632  ASN C OD1   1 
ATOM   8506  N  ND2   . ASN C  2  632  ? 70.630  -8.556  81.112   1.00 5.49   ? 632  ASN C ND2   1 
ATOM   8507  N  N     . GLN C  2  633  ? 69.143  -4.714  84.771   1.00 5.35   ? 633  GLN C N     1 
ATOM   8508  C  CA    . GLN C  2  633  ? 68.040  -3.871  85.186   1.00 6.12   ? 633  GLN C CA    1 
ATOM   8509  C  C     . GLN C  2  633  ? 68.500  -2.787  86.159   1.00 8.08   ? 633  GLN C C     1 
ATOM   8510  O  O     . GLN C  2  633  ? 67.707  -1.956  86.605   1.00 9.16   ? 633  GLN C O     1 
ATOM   8511  C  CB    . GLN C  2  633  ? 66.939  -4.729  85.811   1.00 5.18   ? 633  GLN C CB    1 
ATOM   8512  C  CG    . GLN C  2  633  ? 66.147  -5.560  84.802   1.00 8.39   ? 633  GLN C CG    1 
ATOM   8513  C  CD    . GLN C  2  633  ? 66.957  -6.674  84.152   1.00 6.02   ? 633  GLN C CD    1 
ATOM   8514  O  OE1   . GLN C  2  633  ? 66.738  -7.018  82.990   1.00 6.04   ? 633  GLN C OE1   1 
ATOM   8515  N  NE2   . GLN C  2  633  ? 67.886  -7.247  84.903   1.00 6.12   ? 633  GLN C NE2   1 
ATOM   8516  N  N     . GLY C  2  634  ? 69.784  -2.794  86.487   1.00 5.41   ? 634  GLY C N     1 
ATOM   8517  C  CA    . GLY C  2  634  ? 70.319  -1.780  87.366   1.00 6.21   ? 634  GLY C CA    1 
ATOM   8518  C  C     . GLY C  2  634  ? 70.076  -2.068  88.833   1.00 6.95   ? 634  GLY C C     1 
ATOM   8519  O  O     . GLY C  2  634  ? 70.328  -1.219  89.683   1.00 7.95   ? 634  GLY C O     1 
ATOM   8520  N  N     . THR C  2  635  ? 69.574  -3.260  89.135   1.00 6.74   ? 635  THR C N     1 
ATOM   8521  C  CA    . THR C  2  635  ? 69.500  -3.713  90.516   1.00 5.69   ? 635  THR C CA    1 
ATOM   8522  C  C     . THR C  2  635  ? 70.907  -4.144  90.903   1.00 9.04   ? 635  THR C C     1 
ATOM   8523  O  O     . THR C  2  635  ? 71.628  -4.704  90.078   1.00 11.32  ? 635  THR C O     1 
ATOM   8524  C  CB    . THR C  2  635  ? 68.519  -4.894  90.685   1.00 4.78   ? 635  THR C CB    1 
ATOM   8525  O  OG1   . THR C  2  635  ? 68.972  -6.016  89.922   1.00 6.74   ? 635  THR C OG1   1 
ATOM   8526  C  CG2   . THR C  2  635  ? 67.138  -4.515  90.201   1.00 5.03   ? 635  THR C CG2   1 
ATOM   8527  N  N     . ALA C  2  636  ? 71.308  -3.877  92.144   1.00 12.97  ? 636  ALA C N     1 
ATOM   8528  C  CA    . ALA C  2  636  ? 72.674  -4.187  92.583   1.00 12.21  ? 636  ALA C CA    1 
ATOM   8529  C  C     . ALA C  2  636  ? 72.858  -5.649  92.964   1.00 12.24  ? 636  ALA C C     1 
ATOM   8530  O  O     . ALA C  2  636  ? 72.199  -6.155  93.873   1.00 10.83  ? 636  ALA C O     1 
ATOM   8531  C  CB    . ALA C  2  636  ? 73.093  -3.287  93.730   1.00 6.86   ? 636  ALA C CB    1 
ATOM   8532  N  N     . LEU C  2  637  ? 73.776  -6.312  92.270   1.00 13.57  ? 637  LEU C N     1 
ATOM   8533  C  CA    . LEU C  2  637  ? 74.084  -7.710  92.530   1.00 15.25  ? 637  LEU C CA    1 
ATOM   8534  C  C     . LEU C  2  637  ? 75.355  -7.796  93.343   1.00 18.64  ? 637  LEU C C     1 
ATOM   8535  O  O     . LEU C  2  637  ? 76.429  -7.502  92.827   1.00 19.62  ? 637  LEU C O     1 
ATOM   8536  C  CB    . LEU C  2  637  ? 74.322  -8.449  91.216   1.00 12.13  ? 637  LEU C CB    1 
ATOM   8537  C  CG    . LEU C  2  637  ? 73.121  -9.070  90.508   1.00 25.03  ? 637  LEU C CG    1 
ATOM   8538  C  CD1   . LEU C  2  637  ? 71.857  -8.201  90.620   1.00 15.50  ? 637  LEU C CD1   1 
ATOM   8539  C  CD2   . LEU C  2  637  ? 73.479  -9.362  89.054   1.00 20.50  ? 637  LEU C CD2   1 
ATOM   8540  N  N     . ASP C  2  638  ? 75.253  -8.193  94.608   1.00 16.81  ? 638  ASP C N     1 
ATOM   8541  C  CA    . ASP C  2  638  ? 76.470  -8.444  95.369   1.00 20.10  ? 638  ASP C CA    1 
ATOM   8542  C  C     . ASP C  2  638  ? 76.390  -9.514  96.454   1.00 20.48  ? 638  ASP C C     1 
ATOM   8543  O  O     . ASP C  2  638  ? 75.391  -9.653  97.165   1.00 19.10  ? 638  ASP C O     1 
ATOM   8544  C  CB    . ASP C  2  638  ? 77.080  -7.150  95.912   1.00 19.16  ? 638  ASP C CB    1 
ATOM   8545  C  CG    . ASP C  2  638  ? 76.345  -6.605  97.099   1.00 22.35  ? 638  ASP C CG    1 
ATOM   8546  O  OD1   . ASP C  2  638  ? 75.103  -6.728  97.139   1.00 32.87  ? 638  ASP C OD1   1 
ATOM   8547  O  OD2   . ASP C  2  638  ? 77.020  -6.048  97.992   1.00 20.67  ? 638  ASP C OD2   1 
ATOM   8548  N  N     . GLN C  2  639  ? 77.484  -10.258 96.568   1.00 20.47  ? 639  GLN C N     1 
ATOM   8549  C  CA    . GLN C  2  639  ? 77.587  -11.350 97.512   1.00 19.31  ? 639  GLN C CA    1 
ATOM   8550  C  C     . GLN C  2  639  ? 78.207  -10.855 98.805   1.00 18.62  ? 639  GLN C C     1 
ATOM   8551  O  O     . GLN C  2  639  ? 79.135  -10.045 98.791   1.00 20.38  ? 639  GLN C O     1 
ATOM   8552  C  CB    . GLN C  2  639  ? 78.443  -12.467 96.919   1.00 16.07  ? 639  GLN C CB    1 
ATOM   8553  C  CG    . GLN C  2  639  ? 77.917  -13.024 95.614   1.00 14.40  ? 639  GLN C CG    1 
ATOM   8554  C  CD    . GLN C  2  639  ? 78.991  -13.743 94.827   1.00 18.97  ? 639  GLN C CD    1 
ATOM   8555  O  OE1   . GLN C  2  639  ? 79.986  -13.136 94.425   1.00 17.82  ? 639  GLN C OE1   1 
ATOM   8556  N  NE2   . GLN C  2  639  ? 78.800  -15.044 94.603   1.00 17.95  ? 639  GLN C NE2   1 
ATOM   8557  N  N     . ARG C  2  640  ? 77.692  -11.340 99.925   1.00 14.77  ? 640  ARG C N     1 
ATOM   8558  C  CA    . ARG C  2  640  ? 78.232  -10.951 101.212  1.00 15.88  ? 640  ARG C CA    1 
ATOM   8559  C  C     . ARG C  2  640  ? 78.714  -12.202 101.921  1.00 19.20  ? 640  ARG C C     1 
ATOM   8560  O  O     . ARG C  2  640  ? 78.072  -13.247 101.830  1.00 17.18  ? 640  ARG C O     1 
ATOM   8561  C  CB    . ARG C  2  640  ? 77.161  -10.252 102.054  1.00 18.22  ? 640  ARG C CB    1 
ATOM   8562  C  CG    . ARG C  2  640  ? 76.709  -8.880  101.537  1.00 22.81  ? 640  ARG C CG    1 
ATOM   8563  C  CD    . ARG C  2  640  ? 75.645  -8.976  100.438  1.00 26.73  ? 640  ARG C CD    1 
ATOM   8564  N  NE    . ARG C  2  640  ? 74.549  -9.878  100.791  1.00 22.45  ? 640  ARG C NE    1 
ATOM   8565  C  CZ    . ARG C  2  640  ? 73.554  -9.562  101.615  1.00 24.95  ? 640  ARG C CZ    1 
ATOM   8566  N  NH1   . ARG C  2  640  ? 72.598  -10.451 101.876  1.00 22.63  ? 640  ARG C NH1   1 
ATOM   8567  N  NH2   . ARG C  2  640  ? 73.515  -8.358  102.180  1.00 24.51  ? 640  ARG C NH2   1 
ATOM   8568  N  N     . PRO C  2  641  ? 79.853  -12.107 102.623  1.00 20.07  ? 641  PRO C N     1 
ATOM   8569  C  CA    . PRO C  2  641  ? 80.346  -13.272 103.364  1.00 15.44  ? 641  PRO C CA    1 
ATOM   8570  C  C     . PRO C  2  641  ? 79.398  -13.665 104.500  1.00 16.37  ? 641  PRO C C     1 
ATOM   8571  O  O     . PRO C  2  641  ? 79.051  -12.822 105.333  1.00 16.18  ? 641  PRO C O     1 
ATOM   8572  C  CB    . PRO C  2  641  ? 81.689  -12.783 103.920  1.00 16.62  ? 641  PRO C CB    1 
ATOM   8573  C  CG    . PRO C  2  641  ? 81.584  -11.293 103.929  1.00 17.71  ? 641  PRO C CG    1 
ATOM   8574  C  CD    . PRO C  2  641  ? 80.750  -10.946 102.742  1.00 17.61  ? 641  PRO C CD    1 
ATOM   8575  N  N     . ARG C  2  642  ? 78.977  -14.928 104.517  1.00 16.36  ? 642  ARG C N     1 
ATOM   8576  C  CA    . ARG C  2  642  ? 78.127  -15.456 105.587  1.00 16.51  ? 642  ARG C CA    1 
ATOM   8577  C  C     . ARG C  2  642  ? 78.856  -16.296 106.634  1.00 17.60  ? 642  ARG C C     1 
ATOM   8578  O  O     . ARG C  2  642  ? 78.228  -16.826 107.553  1.00 20.45  ? 642  ARG C O     1 
ATOM   8579  C  CB    . ARG C  2  642  ? 76.920  -16.210 105.022  1.00 12.93  ? 642  ARG C CB    1 
ATOM   8580  C  CG    . ARG C  2  642  ? 75.856  -15.287 104.459  1.00 10.96  ? 642  ARG C CG    1 
ATOM   8581  C  CD    . ARG C  2  642  ? 75.410  -14.273 105.499  1.00 11.86  ? 642  ARG C CD    1 
ATOM   8582  N  NE    . ARG C  2  642  ? 74.623  -13.183 104.923  1.00 19.29  ? 642  ARG C NE    1 
ATOM   8583  C  CZ    . ARG C  2  642  ? 74.950  -11.893 104.998  1.00 20.21  ? 642  ARG C CZ    1 
ATOM   8584  N  NH1   .