data_5D4E
# 
_entry.id   5D4E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5D4E         
WWPDB D_1000212640 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '4G7H contains T.thermophius RPo complex' 4G7H unspecified 
PDB .                                         5D4C unspecified 
PDB .                                         5D4D unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5D4E 
_pdbx_database_status.recvd_initial_deposition_date   2015-08-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'     1 
'Ebright, R.H.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            535 
_citation.language                  ? 
_citation.page_first                444 
_citation.page_last                 447 
_citation.title                     
;The mechanism of RNA 5' capping with NAD(+), NADH and desphospho-CoA.
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature18622 
_citation.pdbx_database_id_PubMed   27383794 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bird, J.G.'    1  
primary 'Zhang, Y.'     2  
primary 'Tian, Y.'      3  
primary 'Panova, N.'    4  
primary 'Barvik, I.'    5  
primary 'Greene, L.'    6  
primary 'Liu, M.'       7  
primary 'Buckley, B.'   8  
primary 'Krasny, L.'    9  
primary 'Lee, J.K.'     10 
primary 'Kaplan, C.D.'  11 
primary 'Ebright, R.H.' 12 
primary 'Nickels, B.E.' 13 
# 
_cell.entry_id           5D4E 
_cell.length_a           185.811 
_cell.length_b           103.948 
_cell.length_c           297.143 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.47 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5D4E 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase subunit alpha'                              35056.164  4   2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                               125436.539 2   2.7.7.6 ? ? ? 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 2   2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                              11533.316  2   2.7.7.6 ? ? ? 
5  polymer     man 'RNA polymerase sigma factor SigA'                                       50769.398  2   ?       ? ? ? 
6  polymer     syn 'DNA (27-MER)'                                                           8421.432   2   ?       ? ? ? 
7  polymer     syn 
;DNA (5'-D(*CP*C*TP*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*AP*GP*AP*G)-3')
;
5845.786   2   ?       ? ? ? 
8  non-polymer syn 'MAGNESIUM ION'                                                          24.305     9   ?       ? ? ? 
9  non-polymer syn 'ZINC ION'                                                               65.409     4   ?       ? ? ? 
10 non-polymer syn "CYTIDINE-5'-MONOPHOSPHATE"                                              323.197    2   ?       ? ? ? 
11 non-polymer syn DIPHOSPHATE                                                              173.943    2   ?       ? ? ? 
12 non-polymer syn 'DEPHOSPHO COENZYME A'                                                   687.554    2   ?       ? ? ? 
13 water       nat water                                                                    18.015     775 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B,K,L ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C,M     ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D,N     ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E,O     ? 
5 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F,P     ? 
6 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H,S     ? 
7 polydeoxyribonucleotide no no '(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DA)(DG)(DA)(DG)' CCTGCATCCGTGAGTAGAG 
G,R     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   THR n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DT  n 
6 2    DA  n 
6 3    DT  n 
6 4    DA  n 
6 5    DA  n 
6 6    DT  n 
6 7    DG  n 
6 8    DG  n 
6 9    DG  n 
6 10   DA  n 
6 11   DG  n 
6 12   DC  n 
6 13   DT  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DA  n 
6 18   DC  n 
6 19   DG  n 
6 20   DG  n 
6 21   DA  n 
6 22   DT  n 
6 23   DG  n 
6 24   DC  n 
6 25   DA  n 
6 26   DG  n 
6 27   DG  n 
7 1    DC  n 
7 2    DC  n 
7 3    DT  n 
7 4    DG  n 
7 5    DC  n 
7 6    DA  n 
7 7    DT  n 
7 8    DC  n 
7 9    DC  n 
7 10   DG  n 
7 11   DT  n 
7 12   DG  n 
7 13   DA  n 
7 14   DG  n 
7 15   DT  n 
7 16   DA  n 
7 17   DG  n 
7 18   DA  n 
7 19   DG  n 
# 
_entity_src_gen.entity_id                          5 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   443 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'sigA, rpoD, TT_C0164' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB27 / ATCC BAA-163 / DSM 7039' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     262724 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          'plasmid ' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 315  ? 'Thermus thermophilus'                                     274    ? ? ?                            ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2 1 sample 1 1119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3 1 sample 1 1524 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 27 'Thermus thermophilus' ? 274 ? 
7 1 sample 1 19 'Thermus thermophilus' ? 274 ? 
# 
loop_
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.details 
_struct_ref.entity_id 
_struct_ref.id 
_struct_ref.seq_align 
_struct_ref.seq_dif 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_align_end 
RPOA_THETH UNP ? 1 1 ? ? Q9Z9H6 ? 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 ? 
RPOB_THET8 UNP ? 2 2 ? ? Q8RQE9 ? 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 ? 
RPOC_THET8 UNP ? 3 3 ? ? Q8RQE8 ? 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 ? 
RPOZ_THET8 UNP ? 4 4 ? ? Q8RQE7 ? 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 ? 
SIGA_THET2 UNP ? 5 5 ? ? Q72L95 ? 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLALEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 ? 
5D4E       PDB ? 6 6 ? ? 5D4E   ? ? 1 ? 
5D4E       PDB ? 7 7 ? ? 5D4E   ? ? 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5D4E A 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
2  1 5D4E B 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
3  2 5D4E C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4  3 5D4E D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5  4 5D4E E 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
6  5 5D4E F 21 ? 443  ? Q72L95 1 ? 423  ? 1 423  
7  6 5D4E H 1  ? 27   ? 5D4E   1 ? 27   ? 1 27   
8  7 5D4E G 1  ? 19   ? 5D4E   2 ? 20   ? 2 20   
9  1 5D4E K 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
10 1 5D4E L 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
11 2 5D4E M 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
12 3 5D4E N 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
13 4 5D4E O 1  ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
14 5 5D4E P 21 ? 443  ? Q72L95 1 ? 423  ? 1 423  
15 7 5D4E R 1  ? 19   ? 5D4E   2 ? 20   ? 2 20   
16 6 5D4E S 1  ? 27   ? 5D4E   1 ? 27   ? 1 27   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6  5D4E MET F 1  ? UNP Q72L95 ?   ?  'initiating methionine' -19 1  
6  5D4E GLY F 2  ? UNP Q72L95 ?   ?  'expression tag'        -18 2  
6  5D4E SER F 3  ? UNP Q72L95 ?   ?  'expression tag'        -17 3  
6  5D4E SER F 4  ? UNP Q72L95 ?   ?  'expression tag'        -16 4  
6  5D4E HIS F 5  ? UNP Q72L95 ?   ?  'expression tag'        -15 5  
6  5D4E HIS F 6  ? UNP Q72L95 ?   ?  'expression tag'        -14 6  
6  5D4E HIS F 7  ? UNP Q72L95 ?   ?  'expression tag'        -13 7  
6  5D4E HIS F 8  ? UNP Q72L95 ?   ?  'expression tag'        -12 8  
6  5D4E HIS F 9  ? UNP Q72L95 ?   ?  'expression tag'        -11 9  
6  5D4E HIS F 10 ? UNP Q72L95 ?   ?  'expression tag'        -10 10 
6  5D4E SER F 11 ? UNP Q72L95 ?   ?  'expression tag'        -9  11 
6  5D4E SER F 12 ? UNP Q72L95 ?   ?  'expression tag'        -8  12 
6  5D4E GLY F 13 ? UNP Q72L95 ?   ?  'expression tag'        -7  13 
6  5D4E LEU F 14 ? UNP Q72L95 ?   ?  'expression tag'        -6  14 
6  5D4E VAL F 15 ? UNP Q72L95 ?   ?  'expression tag'        -5  15 
6  5D4E PRO F 16 ? UNP Q72L95 ?   ?  'expression tag'        -4  16 
6  5D4E ARG F 17 ? UNP Q72L95 ?   ?  'expression tag'        -3  17 
6  5D4E GLY F 18 ? UNP Q72L95 ?   ?  'expression tag'        -2  18 
6  5D4E SER F 19 ? UNP Q72L95 ?   ?  'expression tag'        -1  19 
6  5D4E HIS F 20 ? UNP Q72L95 ?   ?  'expression tag'        0   20 
6  5D4E THR F 66 ? UNP Q72L95 ALA 46 conflict                46  21 
14 5D4E MET P 1  ? UNP Q72L95 ?   ?  'initiating methionine' -19 22 
14 5D4E GLY P 2  ? UNP Q72L95 ?   ?  'expression tag'        -18 23 
14 5D4E SER P 3  ? UNP Q72L95 ?   ?  'expression tag'        -17 24 
14 5D4E SER P 4  ? UNP Q72L95 ?   ?  'expression tag'        -16 25 
14 5D4E HIS P 5  ? UNP Q72L95 ?   ?  'expression tag'        -15 26 
14 5D4E HIS P 6  ? UNP Q72L95 ?   ?  'expression tag'        -14 27 
14 5D4E HIS P 7  ? UNP Q72L95 ?   ?  'expression tag'        -13 28 
14 5D4E HIS P 8  ? UNP Q72L95 ?   ?  'expression tag'        -12 29 
14 5D4E HIS P 9  ? UNP Q72L95 ?   ?  'expression tag'        -11 30 
14 5D4E HIS P 10 ? UNP Q72L95 ?   ?  'expression tag'        -10 31 
14 5D4E SER P 11 ? UNP Q72L95 ?   ?  'expression tag'        -9  32 
14 5D4E SER P 12 ? UNP Q72L95 ?   ?  'expression tag'        -8  33 
14 5D4E GLY P 13 ? UNP Q72L95 ?   ?  'expression tag'        -7  34 
14 5D4E LEU P 14 ? UNP Q72L95 ?   ?  'expression tag'        -6  35 
14 5D4E VAL P 15 ? UNP Q72L95 ?   ?  'expression tag'        -5  36 
14 5D4E PRO P 16 ? UNP Q72L95 ?   ?  'expression tag'        -4  37 
14 5D4E ARG P 17 ? UNP Q72L95 ?   ?  'expression tag'        -3  38 
14 5D4E GLY P 18 ? UNP Q72L95 ?   ?  'expression tag'        -2  39 
14 5D4E SER P 19 ? UNP Q72L95 ?   ?  'expression tag'        -1  40 
14 5D4E HIS P 20 ? UNP Q72L95 ?   ?  'expression tag'        0   41 
14 5D4E THR P 66 ? UNP Q72L95 ALA 46 conflict                46  42 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'          133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'      323.197 
COD non-polymer         . 'DEPHOSPHO COENZYME A'               ? 'C21 H35 N7 O13 P2 S' 687.554 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'        121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'     331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'      307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'     347.221 
DPO non-polymer         . DIPHOSPHATE                          ? 'O7 P2 -4'            173.943 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'     322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                                ? 'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'         117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'                65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5D4E 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.21 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.65 
_exptl_crystal.description                 rod 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.4 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM Tris-HCl, pH 8.4, 200 mM potassium chloride, 50 mM magnesium chloride, 9.5% PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-02-23 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5D4E 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            3.100 
_reflns.number_obs                   205055 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            0.11600 
_reflns.pdbx_Rsym_value              0.12000 
_reflns.pdbx_netI_over_sigmaI        6.0000 
_reflns.B_iso_Wilson_estimate        62.54 
_reflns.pdbx_redundancy              3.800 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.10 
_reflns_shell.d_res_low              3.15 
_reflns_shell.percent_possible_all   96.0 
_reflns_shell.Rmerge_I_obs           0.84800 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.400 
_reflns_shell.pdbx_redundancy        3.50 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5D4E 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     187101 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.68 
_refine.ls_d_res_high                            3.08 
_refine.ls_percent_reflns_obs                    89.9 
_refine.ls_R_factor_obs                          0.211 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.210 
_refine.ls_R_factor_R_free                       0.246 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.010 
_refine.ls_number_reflns_R_free                  9369 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4G7H 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'Ramdom selection' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.370 
_refine.pdbx_overall_phase_error                 27.110 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        55288 
_refine_hist.pdbx_number_atoms_nucleic_acid   1525 
_refine_hist.pdbx_number_atoms_ligand         126 
_refine_hist.number_atoms_solvent             775 
_refine_hist.number_atoms_total               57714 
_refine_hist.d_res_high                       3.08 
_refine_hist.d_res_low                        39.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 58160 'X-RAY DIFFRACTION' ? 
f_angle_d          0.690  ? ? 78950 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.466 ? ? 22550 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.051  ? ? 8883  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 10078 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.0786 3.1135  2128 0.2952 33.00  0.3918 . . 125 . . . . 
'X-RAY DIFFRACTION' . 3.1135 3.1502  3120 0.2885 47.00  0.3189 . . 154 . . . . 
'X-RAY DIFFRACTION' . 3.1502 3.1886  3595 0.2870 55.00  0.3378 . . 203 . . . . 
'X-RAY DIFFRACTION' . 3.1886 3.2289  4155 0.2864 63.00  0.3118 . . 219 . . . . 
'X-RAY DIFFRACTION' . 3.2289 3.2714  4711 0.2865 71.00  0.3253 . . 234 . . . . 
'X-RAY DIFFRACTION' . 3.2714 3.3162  5133 0.2737 79.00  0.3161 . . 272 . . . . 
'X-RAY DIFFRACTION' . 3.3162 3.3635  5567 0.2725 85.00  0.3174 . . 299 . . . . 
'X-RAY DIFFRACTION' . 3.3635 3.4137  5768 0.2640 89.00  0.2944 . . 307 . . . . 
'X-RAY DIFFRACTION' . 3.4137 3.4670  6064 0.2563 92.00  0.3200 . . 324 . . . . 
'X-RAY DIFFRACTION' . 3.4670 3.5238  6185 0.2507 95.00  0.2905 . . 325 . . . . 
'X-RAY DIFFRACTION' . 3.5238 3.5845  6442 0.2412 97.00  0.2728 . . 336 . . . . 
'X-RAY DIFFRACTION' . 3.5845 3.6497  6371 0.2393 98.00  0.2866 . . 340 . . . . 
'X-RAY DIFFRACTION' . 3.6497 3.7198  6506 0.2314 99.00  0.2650 . . 338 . . . . 
'X-RAY DIFFRACTION' . 3.7198 3.7957  6506 0.2267 99.00  0.2884 . . 343 . . . . 
'X-RAY DIFFRACTION' . 3.7957 3.8782  6505 0.2099 99.00  0.2545 . . 343 . . . . 
'X-RAY DIFFRACTION' . 3.8782 3.9683  6543 0.2053 100.00 0.2804 . . 343 . . . . 
'X-RAY DIFFRACTION' . 3.9683 4.0674  6549 0.2015 100.00 0.2331 . . 345 . . . . 
'X-RAY DIFFRACTION' . 4.0674 4.1773  6599 0.1935 100.00 0.2400 . . 348 . . . . 
'X-RAY DIFFRACTION' . 4.1773 4.3001  6566 0.1911 100.00 0.2181 . . 345 . . . . 
'X-RAY DIFFRACTION' . 4.3001 4.4387  6590 0.1780 100.00 0.2252 . . 348 . . . . 
'X-RAY DIFFRACTION' . 4.4387 4.5971  6554 0.1773 100.00 0.2098 . . 343 . . . . 
'X-RAY DIFFRACTION' . 4.5971 4.7809  6604 0.1776 100.00 0.2054 . . 348 . . . . 
'X-RAY DIFFRACTION' . 4.7809 4.9981  6598 0.1832 100.00 0.2162 . . 346 . . . . 
'X-RAY DIFFRACTION' . 4.9981 5.2610  6612 0.1945 100.00 0.2367 . . 348 . . . . 
'X-RAY DIFFRACTION' . 5.2610 5.5898  6609 0.1954 100.00 0.2502 . . 347 . . . . 
'X-RAY DIFFRACTION' . 5.5898 6.0200  6618 0.2033 100.00 0.2263 . . 349 . . . . 
'X-RAY DIFFRACTION' . 6.0200 6.6233  6641 0.2077 100.00 0.2566 . . 349 . . . . 
'X-RAY DIFFRACTION' . 6.6233 7.5760  6671 0.1976 100.00 0.2144 . . 351 . . . . 
'X-RAY DIFFRACTION' . 7.5760 9.5231  6685 0.1759 100.00 0.2032 . . 352 . . . . 
'X-RAY DIFFRACTION' . 9.5231 39.6849 6537 0.2017 95.00  0.2085 . . 345 . . . . 
# 
_struct.entry_id                     5D4E 
_struct.title                        
;Crystal structure of Thermus thermophilus product complex for transcription initiation with 3'-dephosphate-CoA and CTP
;
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5D4E 
_struct_keywords.text            
;Coenzyme A, RNA polymerase, transcription initiation, bacterial, NCIN, non-canonical initiating nucleotide, 3'-dephosphate-coenzyme A, primer-dependent initiation, DNA, Single-Stranded, DNA-Directed RNA Polymerases, Gene Expression Regulation, Promoter Regions, Genetic, Protein Conformation, Sigma Factor, transcription-dna complex
;
_struct_keywords.pdbx_keywords   transcription/dna 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 4  ? 
F  N N 5  ? 
G  N N 6  ? 
H  N N 7  ? 
I  N N 1  ? 
J  N N 1  ? 
K  N N 2  ? 
L  N N 3  ? 
M  N N 4  ? 
N  N N 5  ? 
O  N N 7  ? 
P  N N 6  ? 
Q  N N 8  ? 
R  N N 9  ? 
S  N N 9  ? 
T  N N 8  ? 
U  N N 8  ? 
V  N N 10 ? 
W  N N 11 ? 
X  N N 8  ? 
Y  N N 12 ? 
Z  N N 8  ? 
AA N N 8  ? 
BA N N 9  ? 
CA N N 9  ? 
DA N N 8  ? 
EA N N 10 ? 
FA N N 11 ? 
GA N N 8  ? 
HA N N 12 ? 
IA N N 8  ? 
JA N N 13 ? 
KA N N 13 ? 
LA N N 13 ? 
MA N N 13 ? 
NA N N 13 ? 
OA N N 13 ? 
PA N N 13 ? 
QA N N 13 ? 
RA N N 13 ? 
SA N N 13 ? 
TA N N 13 ? 
UA N N 13 ? 
VA N N 13 ? 
WA N N 13 ? 
XA N N 13 ? 
YA N N 13 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? LEU A 45   ? GLY A 31   LEU A 45   1 ? 15 
HELX_P HELX_P2   AA2 ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   AA6 TYR A 224  ? SER A 226  ? TYR A 224  SER A 226  5 ? 3  
HELX_P HELX_P7   AA7 GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P8   AA8 ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P9   AA9 ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P10  AB1 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P11  AB2 THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P12  AB3 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P13  AB4 GLY C 43   ? PHE C 52   ? GLY C 43   PHE C 52   1 ? 10 
HELX_P HELX_P14  AB5 PRO C 79   ? ASP C 87   ? PRO C 79   ASP C 87   1 ? 9  
HELX_P HELX_P15  AB6 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P16  AB7 ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P17  AB8 LEU C 217  ? MET C 222  ? LEU C 217  MET C 222  5 ? 6  
HELX_P HELX_P18  AB9 ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P19  AC1 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P20  AC2 LYS C 249  ? ALA C 262  ? LYS C 249  ALA C 262  1 ? 14 
HELX_P HELX_P21  AC3 GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P22  AC4 VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P23  AC5 THR C 335  ? MET C 361  ? THR C 335  MET C 361  1 ? 27 
HELX_P HELX_P24  AC6 THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P25  AC7 SER C 375  ? ARG C 388  ? SER C 375  ARG C 388  1 ? 14 
HELX_P HELX_P26  AC8 ASN C 399  ? LYS C 407  ? ASN C 399  LYS C 407  1 ? 9  
HELX_P HELX_P27  AC9 GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P28  AD1 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P29  AD2 THR C 487  ? TYR C 494  ? THR C 487  TYR C 494  1 ? 8  
HELX_P HELX_P30  AD3 SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P31  AD4 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P32  AD5 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P33  AD6 ASP C 554  ? GLN C 565  ? ASP C 554  GLN C 565  1 ? 12 
HELX_P HELX_P34  AD7 THR C 566  ? ALA C 568  ? THR C 566  ALA C 568  5 ? 3  
HELX_P HELX_P35  AD8 LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P36  AD9 GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P37  AE1 SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P38  AE2 THR C 768  ? PHE C 778  ? THR C 768  PHE C 778  1 ? 11 
HELX_P HELX_P39  AE3 PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P40  AE4 LEU C 874  ? MET C 880  ? LEU C 874  MET C 880  1 ? 7  
HELX_P HELX_P41  AE5 LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P42  AE6 LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P43  AE7 ASP C 937  ? GLY C 951  ? ASP C 937  GLY C 951  1 ? 15 
HELX_P HELX_P44  AE8 THR C 958  ? LEU C 968  ? THR C 958  LEU C 968  1 ? 11 
HELX_P HELX_P45  AE9 MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P46  AF1 GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P47  AF2 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P48  AF3 ASP C 1059 ? LYS C 1072 ? ASP C 1059 LYS C 1072 1 ? 14 
HELX_P HELX_P49  AF4 PRO C 1082 ? ALA C 1094 ? PRO C 1082 ALA C 1094 1 ? 13 
HELX_P HELX_P50  AF5 SER D 14   ? SER D 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P51  AF6 ILE D 84   ? ARG D 89   ? ILE D 84   ARG D 89   1 ? 6  
HELX_P HELX_P52  AF7 ILE D 102  ? VAL D 105  ? ILE D 102  VAL D 105  5 ? 4  
HELX_P HELX_P53  AF8 SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P54  AF9 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P55  AG1 THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P56  AG2 ASP D 372  ? GLU D 376  ? ASP D 372  GLU D 376  5 ? 5  
HELX_P HELX_P57  AG3 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P58  AG4 MET D 456  ? LEU D 468  ? MET D 456  LEU D 468  1 ? 13 
HELX_P HELX_P59  AG5 ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P60  AG6 SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P61  AG7 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P62  AG8 PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P63  AG9 SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P64  AH1 PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P65  AH2 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P66  AH3 GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P67  AH4 LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P68  AH5 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P69  AH6 ASN D 669  ? ARG D 679  ? ASN D 669  ARG D 679  1 ? 11 
HELX_P HELX_P70  AH7 GLN D 680  ? ILE D 683  ? GLN D 680  ILE D 683  5 ? 4  
HELX_P HELX_P71  AH8 ASP D 685  ? ILE D 695  ? ASP D 685  ILE D 695  1 ? 11 
HELX_P HELX_P72  AH9 HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P73  AI1 HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P74  AI2 VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P75  AI3 SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P76  AI4 ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P77  AI5 THR D 808  ? ARG D 818  ? THR D 808  ARG D 818  1 ? 11 
HELX_P HELX_P78  AI6 SER D 835  ? TYR D 841  ? SER D 835  TYR D 841  1 ? 7  
HELX_P HELX_P79  AI7 ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P80  AI8 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P81  AI9 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P82  AJ1 GLU D 907  ? SER D 945  ? GLU D 907  SER D 945  1 ? 39 
HELX_P HELX_P83  AJ2 GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P84  AJ3 GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P85  AJ4 THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P86  AJ5 ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P87  AJ6 ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P88  AJ7 THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P89  AJ8 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P90  AJ9 SER D 1167 ? ALA D 1180 ? SER D 1167 ALA D 1180 1 ? 14 
HELX_P HELX_P91  AK1 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P92  AK2 ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P93  AK3 PRO D 1232 ? THR D 1234 ? PRO D 1232 THR D 1234 5 ? 3  
HELX_P HELX_P94  AK4 GLN D 1254 ? GLU D 1264 ? GLN D 1254 GLU D 1264 1 ? 11 
HELX_P HELX_P95  AK5 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P96  AK6 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P97  AK7 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P98  AK8 LYS D 1397 ? ALA D 1409 ? LYS D 1397 ALA D 1409 1 ? 13 
HELX_P HELX_P99  AK9 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P100 AL1 SER D 1433 ? SER D 1439 ? SER D 1433 SER D 1439 1 ? 7  
HELX_P HELX_P101 AL2 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P102 AL3 GLY D 1461 ? LEU D 1468 ? GLY D 1461 LEU D 1468 1 ? 8  
HELX_P HELX_P103 AL4 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P104 AL5 ASP D 1488 ? ALA D 1502 ? ASP D 1488 ALA D 1502 1 ? 15 
HELX_P HELX_P105 AL6 GLY E 5    ? VAL E 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P106 AL7 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P107 AL8 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P108 AL9 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P109 AM1 ASP F 99   ? GLY F 109  ? ASP F 79   GLY F 89   1 ? 11 
HELX_P HELX_P110 AM2 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P111 AM3 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P112 AM4 ASP F 172  ? LYS F 184  ? ASP F 152  LYS F 164  1 ? 13 
HELX_P HELX_P113 AM5 PRO F 187  ? ASN F 211  ? PRO F 167  ASN F 191  1 ? 25 
HELX_P HELX_P114 AM6 ASN F 211  ? LYS F 220  ? ASN F 191  LYS F 200  1 ? 10 
HELX_P HELX_P115 AM7 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P116 AM8 GLU F 248  ? ARG F 252  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P117 AM9 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P118 AN1 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P119 AN2 THR F 307  ? MET F 315  ? THR F 287  MET F 295  1 ? 9  
HELX_P HELX_P120 AN3 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P121 AN4 PHE F 348  ? ILE F 353  ? PHE F 328  ILE F 333  5 ? 6  
HELX_P HELX_P122 AN5 SER F 360  ? ALA F 377  ? SER F 340  ALA F 357  1 ? 18 
HELX_P HELX_P123 AN6 SER F 382  ? GLY F 394  ? SER F 362  GLY F 374  1 ? 13 
HELX_P HELX_P124 AN7 THR F 402  ? GLY F 411  ? THR F 382  GLY F 391  1 ? 10 
HELX_P HELX_P125 AN8 GLU F 415  ? ARG F 436  ? GLU F 395  ARG F 416  1 ? 22 
HELX_P HELX_P126 AN9 ARG F 439  ? ASP F 443  ? ARG F 419  ASP F 423  5 ? 5  
HELX_P HELX_P127 AO1 GLY I 31   ? SER I 47   ? GLY K 31   SER K 47   1 ? 17 
HELX_P HELX_P128 AO2 ASP I 74   ? LYS I 83   ? ASP K 74   LYS K 83   1 ? 10 
HELX_P HELX_P129 AO3 ARG I 112  ? PHE I 114  ? ARG K 112  PHE K 114  5 ? 3  
HELX_P HELX_P130 AO4 PRO I 152  ? GLY I 157  ? PRO K 152  GLY K 157  1 ? 6  
HELX_P HELX_P131 AO5 THR I 206  ? TYR I 224  ? THR K 206  TYR K 224  1 ? 19 
HELX_P HELX_P132 AO6 GLY J 31   ? SER J 47   ? GLY L 31   SER L 47   1 ? 17 
HELX_P HELX_P133 AO7 ASP J 74   ? GLU J 84   ? ASP L 74   GLU L 84   1 ? 11 
HELX_P HELX_P134 AO8 ARG J 112  ? PHE J 114  ? ARG L 112  PHE L 114  5 ? 3  
HELX_P HELX_P135 AO9 PRO J 152  ? GLY J 157  ? PRO L 152  GLY L 157  1 ? 6  
HELX_P HELX_P136 AP1 THR J 206  ? THR J 223  ? THR L 206  THR L 223  1 ? 18 
HELX_P HELX_P137 AP2 TYR J 224  ? SER J 226  ? TYR L 224  SER L 226  5 ? 3  
HELX_P HELX_P138 AP3 THR K 19   ? GLN K 31   ? THR M 19   GLN M 31   1 ? 13 
HELX_P HELX_P139 AP4 PRO K 35   ? ARG K 39   ? PRO M 35   ARG M 39   5 ? 5  
HELX_P HELX_P140 AP5 GLY K 43   ? PHE K 52   ? GLY M 43   PHE M 52   1 ? 10 
HELX_P HELX_P141 AP6 PRO K 79   ? ASP K 87   ? PRO M 79   ASP M 87   1 ? 9  
HELX_P HELX_P142 AP7 LEU K 193  ? LEU K 200  ? LEU M 193  LEU M 200  1 ? 8  
HELX_P HELX_P143 AP8 ASP K 203  ? GLY K 212  ? ASP M 203  GLY M 212  1 ? 10 
HELX_P HELX_P144 AP9 LEU K 217  ? LEU K 221  ? LEU M 217  LEU M 221  5 ? 5  
HELX_P HELX_P145 AQ1 ASP K 223  ? ALA K 228  ? ASP M 223  ALA M 228  1 ? 6  
HELX_P HELX_P146 AQ2 ARG K 230  ? ARG K 243  ? ARG M 230  ARG M 243  1 ? 14 
HELX_P HELX_P147 AQ3 LYS K 249  ? ILE K 261  ? LYS M 249  ILE M 261  1 ? 13 
HELX_P HELX_P148 AQ4 GLY K 270  ? GLY K 282  ? GLY M 270  GLY M 282  1 ? 13 
HELX_P HELX_P149 AQ5 VAL K 302  ? GLY K 316  ? VAL M 302  GLY M 316  1 ? 15 
HELX_P HELX_P150 AQ6 THR K 335  ? MET K 361  ? THR M 335  MET M 361  1 ? 27 
HELX_P HELX_P151 AQ7 THR K 368  ? VAL K 373  ? THR M 368  VAL M 373  1 ? 6  
HELX_P HELX_P152 AQ8 SER K 375  ? ARG K 388  ? SER M 375  ARG M 388  1 ? 14 
HELX_P HELX_P153 AQ9 ASN K 399  ? ARG K 408  ? ASN M 399  ARG M 408  1 ? 10 
HELX_P HELX_P154 AR1 GLY K 424  ? ASP K 429  ? GLY M 424  ASP M 429  1 ? 6  
HELX_P HELX_P155 AR2 HIS K 431  ? TYR K 435  ? HIS M 431  TYR M 435  5 ? 5  
HELX_P HELX_P156 AR3 THR K 487  ? ASP K 492  ? THR M 487  ASP M 492  1 ? 6  
HELX_P HELX_P157 AR4 SER K 525  ? VAL K 529  ? SER M 525  VAL M 529  5 ? 5  
HELX_P HELX_P158 AR5 SER K 535  ? PHE K 540  ? SER M 535  PHE M 540  5 ? 6  
HELX_P HELX_P159 AR6 ASN K 543  ? ILE K 547  ? ASN M 543  ILE M 547  5 ? 5  
HELX_P HELX_P160 AR7 PHE K 549  ? ASP K 553  ? PHE M 549  ASP M 553  5 ? 5  
HELX_P HELX_P161 AR8 ASP K 554  ? GLN K 565  ? ASP M 554  GLN M 565  1 ? 12 
HELX_P HELX_P162 AR9 THR K 566  ? ALA K 568  ? THR M 566  ALA M 568  5 ? 3  
HELX_P HELX_P163 AS1 LEU K 583  ? SER K 591  ? LEU M 583  SER M 591  1 ? 9  
HELX_P HELX_P164 AS2 GLU K 692  ? ARG K 697  ? GLU M 692  ARG M 697  1 ? 6  
HELX_P HELX_P165 AS3 SER K 730  ? ARG K 735  ? SER M 730  ARG M 735  1 ? 6  
HELX_P HELX_P166 AS4 THR K 768  ? GLY K 779  ? THR M 768  GLY M 779  1 ? 12 
HELX_P HELX_P167 AS5 PRO K 854  ? MET K 858  ? PRO M 854  MET M 858  5 ? 5  
HELX_P HELX_P168 AS6 ASN K 872  ? LEU K 874  ? ASN M 872  LEU M 874  5 ? 3  
HELX_P HELX_P169 AS7 GLY K 875  ? MET K 880  ? GLY M 875  MET M 880  1 ? 6  
HELX_P HELX_P170 AS8 LEU K 882  ? GLY K 898  ? LEU M 882  GLY M 898  1 ? 17 
HELX_P HELX_P171 AS9 LYS K 910  ? GLU K 932  ? LYS M 910  GLU M 932  1 ? 23 
HELX_P HELX_P172 AT1 ASP K 937  ? GLY K 951  ? ASP M 937  GLY M 951  1 ? 15 
HELX_P HELX_P173 AT2 THR K 958  ? LEU K 968  ? THR M 958  LEU M 968  1 ? 11 
HELX_P HELX_P174 AT3 MET K 1000 ? MET K 1005 ? MET M 1000 MET M 1005 1 ? 6  
HELX_P HELX_P175 AT4 GLY K 1033 ? GLY K 1044 ? GLY M 1033 GLY M 1044 1 ? 12 
HELX_P HELX_P176 AT5 ALA K 1045 ? THR K 1054 ? ALA M 1045 THR M 1054 1 ? 10 
HELX_P HELX_P177 AT6 ASP K 1059 ? LYS K 1072 ? ASP M 1059 LYS M 1072 1 ? 14 
HELX_P HELX_P178 AT7 PRO K 1082 ? LEU K 1095 ? PRO M 1082 LEU M 1095 1 ? 14 
HELX_P HELX_P179 AT8 SER L 14   ? TRP L 21   ? SER N 14   TRP N 21   1 ? 8  
HELX_P HELX_P180 AT9 ASP L 46   ? GLY L 51   ? ASP N 46   GLY N 51   1 ? 6  
HELX_P HELX_P181 AU1 LYS L 82   ? TYR L 88   ? LYS N 82   TYR N 88   5 ? 7  
HELX_P HELX_P182 AU2 ILE L 102  ? ASP L 107  ? ILE N 102  ASP N 107  1 ? 6  
HELX_P HELX_P183 AU3 SER L 110  ? LEU L 116  ? SER N 110  LEU N 116  1 ? 7  
HELX_P HELX_P184 AU4 SER L 119  ? TYR L 128  ? SER N 119  TYR N 128  1 ? 10 
HELX_P HELX_P185 AU5 THR L 154  ? TYR L 163  ? THR N 154  TYR N 163  1 ? 10 
HELX_P HELX_P186 AU6 ASP L 423  ? LYS L 426  ? ASP N 423  LYS N 426  5 ? 4  
HELX_P HELX_P187 AU7 MET L 456  ? GLU L 467  ? MET N 456  GLU N 467  1 ? 12 
HELX_P HELX_P188 AU8 ASP L 469  ? MET L 481  ? ASP N 469  MET N 481  1 ? 13 
HELX_P HELX_P189 AU9 SER L 485  ? GLY L 506  ? SER N 485  GLY N 506  1 ? 22 
HELX_P HELX_P190 AV1 ARG L 508  ? TRP L 511  ? ARG N 508  TRP N 511  5 ? 4  
HELX_P HELX_P191 AV2 PRO L 521  ? ARG L 525  ? PRO N 521  ARG N 525  5 ? 5  
HELX_P HELX_P192 AV3 SER L 538  ? GLN L 560  ? SER N 538  GLN N 560  1 ? 23 
HELX_P HELX_P193 AV4 PRO L 563  ? ASP L 583  ? PRO N 563  ASP N 583  1 ? 21 
HELX_P HELX_P194 AV5 SER L 602  ? SER L 608  ? SER N 602  SER N 608  1 ? 7  
HELX_P HELX_P195 AV6 GLY L 612  ? LEU L 618  ? GLY N 612  LEU N 618  1 ? 7  
HELX_P HELX_P196 AV7 LYS L 646  ? PHE L 653  ? LYS N 646  PHE N 653  1 ? 8  
HELX_P HELX_P197 AV8 PHE L 653  ? LYS L 664  ? PHE N 653  LYS N 664  1 ? 12 
HELX_P HELX_P198 AV9 ASN L 669  ? ARG L 679  ? ASN N 669  ARG N 679  1 ? 11 
HELX_P HELX_P199 AW1 GLN L 680  ? ILE L 683  ? GLN N 680  ILE N 683  5 ? 4  
HELX_P HELX_P200 AW2 LYS L 684  ? ILE L 695  ? LYS N 684  ILE N 695  1 ? 12 
HELX_P HELX_P201 AW3 HIS L 709  ? LEU L 711  ? HIS N 709  LEU N 711  5 ? 3  
HELX_P HELX_P202 AW4 HIS L 729  ? LEU L 731  ? HIS N 729  LEU N 731  5 ? 3  
HELX_P HELX_P203 AW5 VAL L 732  ? ASN L 737  ? VAL N 732  ASN N 737  1 ? 6  
HELX_P HELX_P204 AW6 SER L 752  ? GLN L 762  ? SER N 752  GLN N 762  1 ? 11 
HELX_P HELX_P205 AW7 LEU L 764  ? ASN L 768  ? LEU N 764  ASN N 768  5 ? 5  
HELX_P HELX_P206 AW8 ARG L 783  ? GLN L 794  ? ARG N 783  GLN N 794  1 ? 12 
HELX_P HELX_P207 AW9 THR L 808  ? ARG L 818  ? THR N 808  ARG N 818  1 ? 11 
HELX_P HELX_P208 AX1 VAL L 836  ? TYR L 841  ? VAL N 836  TYR N 841  1 ? 6  
HELX_P HELX_P209 AX2 ASN L 845  ? HIS L 855  ? ASN N 845  HIS N 855  1 ? 11 
HELX_P HELX_P210 AX3 SER L 876  ? GLU L 891  ? SER N 876  GLU N 891  1 ? 16 
HELX_P HELX_P211 AX4 ASP L 892  ? ILE L 900  ? ASP N 892  ILE N 900  1 ? 9  
HELX_P HELX_P212 AX5 GLU L 907  ? SER L 945  ? GLU N 907  SER N 945  1 ? 39 
HELX_P HELX_P213 AX6 GLY L 950  ? ALA L 954  ? GLY N 950  ALA N 954  5 ? 5  
HELX_P HELX_P214 AX7 GLU L 958  ? MET L 980  ? GLU N 958  MET N 980  1 ? 23 
HELX_P HELX_P215 AX8 THR L 984  ? TYR L 1015 ? THR N 984  TYR N 1015 1 ? 32 
HELX_P HELX_P216 AX9 ASN L 1018 ? GLY L 1027 ? ASN N 1018 GLY N 1027 1 ? 10 
HELX_P HELX_P217 AY1 ASN L 1031 ? GLY L 1040 ? ASN N 1031 GLY N 1040 1 ? 10 
HELX_P HELX_P218 AY2 THR L 1066 ? HIS L 1103 ? THR N 1066 HIS N 1103 1 ? 38 
HELX_P HELX_P219 AY3 LYS L 1136 ? TYR L 1145 ? LYS N 1136 TYR N 1145 1 ? 10 
HELX_P HELX_P220 AY4 SER L 1167 ? ALA L 1180 ? SER N 1167 ALA N 1180 1 ? 14 
HELX_P HELX_P221 AY5 GLN L 1202 ? GLY L 1206 ? GLN N 1202 GLY N 1206 1 ? 5  
HELX_P HELX_P222 AY6 ALA L 1220 ? GLU L 1231 ? ALA N 1220 GLU N 1231 1 ? 12 
HELX_P HELX_P223 AY7 PRO L 1232 ? LEU L 1236 ? PRO N 1232 LEU N 1236 5 ? 5  
HELX_P HELX_P224 AY8 GLN L 1254 ? GLU L 1264 ? GLN N 1254 GLU N 1264 1 ? 11 
HELX_P HELX_P225 AY9 ASP L 1331 ? GLY L 1340 ? ASP N 1331 GLY N 1340 1 ? 10 
HELX_P HELX_P226 AZ1 GLY L 1340 ? GLN L 1359 ? GLY N 1340 GLN N 1359 1 ? 20 
HELX_P HELX_P227 AZ2 HIS L 1364 ? MET L 1376 ? HIS N 1364 MET N 1376 1 ? 13 
HELX_P HELX_P228 AZ3 LYS L 1397 ? GLY L 1411 ? LYS N 1397 GLY N 1411 1 ? 15 
HELX_P HELX_P229 AZ4 GLY L 1423 ? SER L 1430 ? GLY N 1423 SER N 1430 1 ? 8  
HELX_P HELX_P230 AZ5 SER L 1433 ? GLN L 1441 ? SER N 1433 GLN N 1441 1 ? 9  
HELX_P HELX_P231 AZ6 ASN L 1442 ? GLY L 1454 ? ASN N 1442 GLY N 1454 1 ? 13 
HELX_P HELX_P232 AZ7 GLY L 1461 ? GLY L 1469 ? GLY N 1461 GLY N 1469 1 ? 9  
HELX_P HELX_P233 AZ8 ALA L 1474 ? SER L 1478 ? ALA N 1474 SER N 1478 5 ? 5  
HELX_P HELX_P234 AZ9 GLN L 1489 ? ALA L 1502 ? GLN N 1489 ALA N 1502 1 ? 14 
HELX_P HELX_P235 BA1 GLY M 5    ? VAL M 13   ? GLY O 5    VAL O 13   1 ? 9  
HELX_P HELX_P236 BA2 SER M 15   ? HIS M 33   ? SER O 15   HIS O 33   1 ? 19 
HELX_P HELX_P237 BA3 ASN M 59   ? GLY M 71   ? ASN O 59   GLY O 71   1 ? 13 
HELX_P HELX_P238 BA4 PRO M 81   ? TYR M 93   ? PRO O 81   TYR O 93   1 ? 13 
HELX_P HELX_P239 BA5 ASP N 99   ? GLN N 110  ? ASP P 79   GLN P 90   1 ? 12 
HELX_P HELX_P240 BA6 THR N 115  ? GLY N 141  ? THR P 95   GLY P 121  1 ? 27 
HELX_P HELX_P241 BA7 ASP N 143  ? GLY N 157  ? ASP P 123  GLY P 137  1 ? 15 
HELX_P HELX_P242 BA8 ASP N 172  ? LYS N 184  ? ASP P 152  LYS P 164  1 ? 13 
HELX_P HELX_P243 BA9 PRO N 187  ? ASN N 211  ? PRO P 167  ASN P 191  1 ? 25 
HELX_P HELX_P244 BB1 ASN N 211  ? LYS N 220  ? ASN P 191  LYS P 200  1 ? 10 
HELX_P HELX_P245 BB2 LYS N 221  ? THR N 223  ? LYS P 201  THR P 203  5 ? 3  
HELX_P HELX_P246 BB3 SER N 228  ? PHE N 247  ? SER P 208  PHE P 227  1 ? 20 
HELX_P HELX_P247 BB4 GLU N 248  ? ARG N 252  ? GLU P 228  ARG P 232  5 ? 5  
HELX_P HELX_P248 BB5 LYS N 254  ? ALA N 275  ? LYS P 234  ALA P 255  1 ? 22 
HELX_P HELX_P249 BB6 PRO N 281  ? GLY N 303  ? PRO P 261  GLY P 283  1 ? 23 
HELX_P HELX_P250 BB7 THR N 307  ? MET N 315  ? THR P 287  MET P 295  1 ? 9  
HELX_P HELX_P251 BB8 ASP N 320  ? ALA N 331  ? ASP P 300  ALA P 311  1 ? 12 
HELX_P HELX_P252 BB9 TYR N 349  ? ILE N 353  ? TYR P 329  ILE P 333  5 ? 5  
HELX_P HELX_P253 BC1 SER N 360  ? SER N 379  ? SER P 340  SER P 359  1 ? 20 
HELX_P HELX_P254 BC2 SER N 382  ? LYS N 393  ? SER P 362  LYS P 373  1 ? 12 
HELX_P HELX_P255 BC3 THR N 402  ? GLY N 411  ? THR P 382  GLY P 391  1 ? 10 
HELX_P HELX_P256 BC4 THR N 413  ? ARG N 436  ? THR P 393  ARG P 416  1 ? 24 
HELX_P HELX_P257 BC5 ARG N 439  ? ASP N 443  ? ARG P 419  ASP P 423  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?   ? B  ASP 191  O   ? ? ? 1_555 Q  MG  .  MG    ? ? B ASP 191  B MG  2001 1_555 ? ? ? ? ? ? ?            2.572 ? 
metalc2  metalc ?   ? D  CYS 58   SG  ? ? ? 1_555 S  ZN  .  ZN    ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.327 ? 
metalc3  metalc ?   ? D  CYS 60   SG  ? ? ? 1_555 S  ZN  .  ZN    ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.289 ? 
metalc4  metalc ?   ? D  CYS 73   SG  ? ? ? 1_555 S  ZN  .  ZN    ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc5  metalc ?   ? D  CYS 76   SG  ? ? ? 1_555 S  ZN  .  ZN    ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc6  metalc ?   ? D  ASP 739  OD1 ? ? ? 1_555 T  MG  .  MG    ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?            2.101 ? 
metalc7  metalc ?   ? D  ASP 739  OD2 ? ? ? 1_555 X  MG  .  MG    ? ? D ASP 739  D MG  2007 1_555 ? ? ? ? ? ? ?            2.065 ? 
metalc8  metalc ?   ? D  ASP 741  OD1 ? ? ? 1_555 T  MG  .  MG    ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.005 ? 
metalc9  metalc ?   ? D  ASP 741  OD2 ? ? ? 1_555 T  MG  .  MG    ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.768 ? 
metalc10 metalc ?   ? D  ASP 743  OD1 ? ? ? 1_555 T  MG  .  MG    ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.128 ? 
metalc11 metalc ?   ? D  ASP 743  OD2 ? ? ? 1_555 T  MG  .  MG    ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.730 ? 
metalc12 metalc ?   ? D  LYS 840  O   ? ? ? 1_555 U  MG  .  MG    ? ? D LYS 840  D MG  2004 1_555 ? ? ? ? ? ? ?            2.011 ? 
metalc13 metalc ?   ? D  CYS 1112 SG  ? ? ? 1_555 R  ZN  .  ZN    ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.318 ? 
metalc14 metalc ?   ? D  CYS 1194 SG  ? ? ? 1_555 R  ZN  .  ZN    ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.285 ? 
metalc15 metalc ?   ? D  CYS 1201 SG  ? ? ? 1_555 R  ZN  .  ZN    ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc16 metalc ?   ? D  CYS 1204 SG  ? ? ? 1_555 R  ZN  .  ZN    ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.198 ? 
metalc17 metalc ?   ? F  ALA 312  O   ? ? ? 1_555 Z  MG  .  MG    ? ? F ALA 292  F MG  2001 1_555 ? ? ? ? ? ? ?            2.128 ? 
metalc18 metalc ?   ? F  GLY 316  O   ? ? ? 1_555 Z  MG  .  MG    ? ? F GLY 296  F MG  2001 1_555 ? ? ? ? ? ? ?            2.286 ? 
metalc19 metalc ?   ? F  TRP 319  O   ? ? ? 1_555 Z  MG  .  MG    ? ? F TRP 299  F MG  2001 1_555 ? ? ? ? ? ? ?            2.279 ? 
metalc20 metalc ?   ? L  CYS 58   SG  ? ? ? 1_555 CA ZN  .  ZN    ? ? N CYS 58   N ZN  1603 1_555 ? ? ? ? ? ? ?            2.317 ? 
metalc21 metalc ?   ? L  CYS 60   SG  ? ? ? 1_555 CA ZN  .  ZN    ? ? N CYS 60   N ZN  1603 1_555 ? ? ? ? ? ? ?            2.280 ? 
metalc22 metalc ?   ? L  CYS 73   SG  ? ? ? 1_555 CA ZN  .  ZN    ? ? N CYS 73   N ZN  1603 1_555 ? ? ? ? ? ? ?            2.333 ? 
metalc23 metalc ?   ? L  CYS 76   SG  ? ? ? 1_555 CA ZN  .  ZN    ? ? N CYS 76   N ZN  1603 1_555 ? ? ? ? ? ? ?            2.291 ? 
metalc24 metalc ?   ? L  ASP 739  OD1 ? ? ? 1_555 DA MG  .  MG    ? ? N ASP 739  N MG  1604 1_555 ? ? ? ? ? ? ?            2.008 ? 
metalc25 metalc ?   ? L  ASP 739  OD2 ? ? ? 1_555 GA MG  .  MG    ? ? N ASP 739  N MG  1607 1_555 ? ? ? ? ? ? ?            2.104 ? 
metalc26 metalc ?   ? L  ASP 741  OD1 ? ? ? 1_555 DA MG  .  MG    ? ? N ASP 741  N MG  1604 1_555 ? ? ? ? ? ? ?            2.113 ? 
metalc27 metalc ?   ? L  ASP 741  OD2 ? ? ? 1_555 DA MG  .  MG    ? ? N ASP 741  N MG  1604 1_555 ? ? ? ? ? ? ?            2.782 ? 
metalc28 metalc ?   ? L  ASP 743  OD1 ? ? ? 1_555 DA MG  .  MG    ? ? N ASP 743  N MG  1604 1_555 ? ? ? ? ? ? ?            2.100 ? 
metalc29 metalc ?   ? L  LYS 840  O   ? ? ? 1_555 AA MG  .  MG    ? ? N LYS 840  N MG  1601 1_555 ? ? ? ? ? ? ?            2.091 ? 
metalc30 metalc ?   ? L  CYS 1112 SG  ? ? ? 1_555 BA ZN  .  ZN    ? ? N CYS 1112 N ZN  1602 1_555 ? ? ? ? ? ? ?            2.262 ? 
metalc31 metalc ?   ? L  CYS 1194 SG  ? ? ? 1_555 BA ZN  .  ZN    ? ? N CYS 1194 N ZN  1602 1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc32 metalc ?   ? L  CYS 1201 SG  ? ? ? 1_555 BA ZN  .  ZN    ? ? N CYS 1201 N ZN  1602 1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc33 metalc ?   ? L  CYS 1204 SG  ? ? ? 1_555 BA ZN  .  ZN    ? ? N CYS 1204 N ZN  1602 1_555 ? ? ? ? ? ? ?            2.221 ? 
metalc34 metalc ?   ? N  ALA 312  O   ? ? ? 1_555 IA MG  .  MG    ? ? P ALA 292  P MG  2001 1_555 ? ? ? ? ? ? ?            2.347 ? 
metalc35 metalc ?   ? N  GLY 316  O   ? ? ? 1_555 IA MG  .  MG    ? ? P GLY 296  P MG  2001 1_555 ? ? ? ? ? ? ?            2.279 ? 
metalc36 metalc ?   ? N  TRP 319  O   ? ? ? 1_555 IA MG  .  MG    ? ? P TRP 299  P MG  2001 1_555 ? ? ? ? ? ? ?            2.930 ? 
metalc37 metalc ?   ? T  MG  .    MG  ? ? ? 1_555 V  C   .  "O3'" ? ? D MG  2003 D C   2005 1_555 ? ? ? ? ? ? ?            1.890 ? 
covale1  covale one ? V  C   .    P   ? ? ? 1_555 Y  COD .  O15   ? ? D C   2005 D COD 2008 1_555 ? ? ? ? ? ? ?            1.600 ? 
metalc38 metalc ?   ? W  DPO .    O3  ? ? ? 1_555 X  MG  .  MG    ? ? D DPO 2006 D MG  2007 1_555 ? ? ? ? ? ? ?            2.338 ? 
metalc39 metalc ?   ? W  DPO .    O6  ? ? ? 1_555 X  MG  .  MG    ? ? D DPO 2006 D MG  2007 1_555 ? ? ? ? ? ? ?            2.221 ? 
metalc40 metalc ?   ? DA MG  .    MG  ? ? ? 1_555 EA C   .  "O3'" ? ? N MG  1604 N C   1605 1_555 ? ? ? ? ? ? ?            1.778 ? 
covale2  covale one ? EA C   .    P   ? ? ? 1_555 HA COD .  O15   ? ? N C   1605 N COD 1608 1_555 ? ? ? ? ? ? ?            1.601 ? 
metalc41 metalc ?   ? FA DPO .    O1  ? ? ? 1_555 GA MG  .  MG    ? ? N DPO 1606 N MG  1607 1_555 ? ? ? ? ? ? ?            2.350 ? 
metalc42 metalc ?   ? FA DPO .    O6  ? ? ? 1_555 GA MG  .  MG    ? ? N DPO 1606 N MG  1607 1_555 ? ? ? ? ? ? ?            2.224 ? 
metalc43 metalc ?   ? GA MG  .    MG  ? ? ? 1_555 TA HOH .  O     ? ? N MG  1607 M HOH 1216 1_555 ? ? ? ? ? ? ?            2.812 ? 
hydrog1  hydrog ?   ? G  DC  16   O2  ? ? ? 1_555 H  DG  12 N2    ? ? H DC  16   G DG  13   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog2  hydrog ?   ? G  DA  17   N1  ? ? ? 1_555 H  DT  11 N3    ? ? H DA  17   G DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?   ? G  DA  17   N6  ? ? ? 1_555 H  DT  11 O4    ? ? H DA  17   G DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?   ? G  DC  18   N3  ? ? ? 1_555 H  DG  10 N1    ? ? H DC  18   G DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?   ? G  DC  18   N4  ? ? ? 1_555 H  DG  10 O6    ? ? H DC  18   G DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?   ? G  DC  18   O2  ? ? ? 1_555 H  DG  10 N2    ? ? H DC  18   G DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?   ? G  DG  19   N1  ? ? ? 1_555 H  DC  9  N3    ? ? H DG  19   G DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?   ? G  DG  19   N2  ? ? ? 1_555 H  DC  9  O2    ? ? H DG  19   G DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?   ? G  DG  19   O6  ? ? ? 1_555 H  DC  9  N4    ? ? H DG  19   G DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?   ? G  DG  20   N1  ? ? ? 1_555 H  DC  8  N3    ? ? H DG  20   G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?   ? G  DG  20   N2  ? ? ? 1_555 H  DC  8  O2    ? ? H DG  20   G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?   ? G  DG  20   O6  ? ? ? 1_555 H  DC  8  N4    ? ? H DG  20   G DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?   ? G  DA  21   N1  ? ? ? 1_555 H  DT  7  N3    ? ? H DA  21   G DT  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?   ? G  DA  21   N6  ? ? ? 1_555 H  DT  7  O4    ? ? H DA  21   G DT  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?   ? G  DT  22   N3  ? ? ? 1_555 H  DA  6  N1    ? ? H DT  22   G DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?   ? G  DT  22   O4  ? ? ? 1_555 H  DA  6  N6    ? ? H DT  22   G DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?   ? G  DG  23   N1  ? ? ? 1_555 H  DC  5  N3    ? ? H DG  23   G DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?   ? G  DG  23   N2  ? ? ? 1_555 H  DC  5  O2    ? ? H DG  23   G DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?   ? G  DG  23   O6  ? ? ? 1_555 H  DC  5  N4    ? ? H DG  23   G DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?   ? G  DC  24   N3  ? ? ? 1_555 H  DG  4  N1    ? ? H DC  24   G DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?   ? G  DC  24   N4  ? ? ? 1_555 H  DG  4  O6    ? ? H DC  24   G DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?   ? G  DC  24   O2  ? ? ? 1_555 H  DG  4  N2    ? ? H DC  24   G DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?   ? G  DA  25   N1  ? ? ? 1_555 H  DT  3  N3    ? ? H DA  25   G DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?   ? G  DA  25   N6  ? ? ? 1_555 H  DT  3  O4    ? ? H DA  25   G DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?   ? O  DT  3    N3  ? ? ? 1_555 P  DA  25 N1    ? ? R DT  4    S DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?   ? O  DT  3    O4  ? ? ? 1_555 P  DA  25 N6    ? ? R DT  4    S DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?   ? O  DG  4    N1  ? ? ? 1_555 P  DC  24 N3    ? ? R DG  5    S DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?   ? O  DG  4    N2  ? ? ? 1_555 P  DC  24 O2    ? ? R DG  5    S DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?   ? O  DG  4    O6  ? ? ? 1_555 P  DC  24 N4    ? ? R DG  5    S DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?   ? O  DC  5    N3  ? ? ? 1_555 P  DG  23 N1    ? ? R DC  6    S DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?   ? O  DC  5    N4  ? ? ? 1_555 P  DG  23 O6    ? ? R DC  6    S DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?   ? O  DC  5    O2  ? ? ? 1_555 P  DG  23 N2    ? ? R DC  6    S DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?   ? O  DA  6    N1  ? ? ? 1_555 P  DT  22 N3    ? ? R DA  7    S DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?   ? O  DA  6    N6  ? ? ? 1_555 P  DT  22 O4    ? ? R DA  7    S DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?   ? O  DT  7    N3  ? ? ? 1_555 P  DA  21 N1    ? ? R DT  8    S DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?   ? O  DT  7    O4  ? ? ? 1_555 P  DA  21 N6    ? ? R DT  8    S DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?   ? O  DC  8    N3  ? ? ? 1_555 P  DG  20 N1    ? ? R DC  9    S DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?   ? O  DC  8    N4  ? ? ? 1_555 P  DG  20 O6    ? ? R DC  9    S DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?   ? O  DC  8    O2  ? ? ? 1_555 P  DG  20 N2    ? ? R DC  9    S DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?   ? O  DC  9    N3  ? ? ? 1_555 P  DG  19 N1    ? ? R DC  10   S DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?   ? O  DC  9    N4  ? ? ? 1_555 P  DG  19 O6    ? ? R DC  10   S DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?   ? O  DC  9    O2  ? ? ? 1_555 P  DG  19 N2    ? ? R DC  10   S DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?   ? O  DG  10   N1  ? ? ? 1_555 P  DC  18 N3    ? ? R DG  11   S DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?   ? O  DG  10   N2  ? ? ? 1_555 P  DC  18 O2    ? ? R DG  11   S DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?   ? O  DG  10   O6  ? ? ? 1_555 P  DC  18 N4    ? ? R DG  11   S DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?   ? O  DT  11   N3  ? ? ? 1_555 P  DA  17 N1    ? ? R DT  12   S DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?   ? O  DT  11   O4  ? ? ? 1_555 P  DA  17 N6    ? ? R DT  12   S DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?   ? O  DG  12   N1  ? ? ? 1_555 P  DC  16 N3    ? ? R DG  13   S DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?   ? O  DG  12   N2  ? ? ? 1_555 P  DC  16 O2    ? ? R DG  13   S DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?   ? O  DG  12   O6  ? ? ? 1_555 P  DC  16 N4    ? ? R DG  13   S DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -10.75 
2  GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -11.28 
3  PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 1.02   
4  VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -5.90  
5  ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 -5.38  
6  GLU 26  I . ? GLU 26  K PRO 27  I ? PRO 27  K 1 -11.68 
7  ALA 8   J . ? ALA 8   L PRO 9   J ? PRO 9   L 1 14.04  
8  GLU 26  J . ? GLU 26  L PRO 27  J ? PRO 27  L 1 -12.32 
9  PHE 52  K . ? PHE 52  M PRO 53  K ? PRO 53  M 1 -0.12  
10 VAL 108 L . ? VAL 108 N PRO 109 L ? PRO 109 N 1 -6.35  
11 ALA 705 L . ? ALA 705 N PRO 706 L ? PRO 706 N 1 -1.06  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 4 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 8 ? 
AD2 ? 2 ? 
AD3 ? 3 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 5 ? 
AD8 ? 4 ? 
AD9 ? 3 ? 
AE1 ? 3 ? 
AE2 ? 4 ? 
AE3 ? 3 ? 
AE4 ? 4 ? 
AE5 ? 2 ? 
AE6 ? 3 ? 
AE7 ? 3 ? 
AE8 ? 3 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 4 ? 
AF6 ? 3 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
AF9 ? 4 ? 
AG1 ? 4 ? 
AG2 ? 2 ? 
AG3 ? 2 ? 
AG4 ? 2 ? 
AG5 ? 5 ? 
AG6 ? 4 ? 
AG7 ? 2 ? 
AG8 ? 2 ? 
AG9 ? 2 ? 
AH1 ? 3 ? 
AH2 ? 3 ? 
AH3 ? 3 ? 
AH4 ? 4 ? 
AH5 ? 5 ? 
AH6 ? 2 ? 
AH7 ? 3 ? 
AH8 ? 6 ? 
AH9 ? 2 ? 
AI1 ? 3 ? 
AI2 ? 4 ? 
AI3 ? 2 ? 
AI4 ? 2 ? 
AI5 ? 8 ? 
AI6 ? 4 ? 
AI7 ? 3 ? 
AI8 ? 2 ? 
AI9 ? 8 ? 
AJ1 ? 2 ? 
AJ2 ? 3 ? 
AJ3 ? 3 ? 
AJ4 ? 3 ? 
AJ5 ? 2 ? 
AJ6 ? 5 ? 
AJ7 ? 4 ? 
AJ8 ? 3 ? 
AJ9 ? 3 ? 
AK1 ? 4 ? 
AK2 ? 3 ? 
AK3 ? 4 ? 
AK4 ? 2 ? 
AK5 ? 3 ? 
AK6 ? 3 ? 
AK7 ? 3 ? 
AK8 ? 2 ? 
AK9 ? 2 ? 
AL1 ? 2 ? 
AL2 ? 2 ? 
AL3 ? 4 ? 
AL4 ? 3 ? 
AL5 ? 2 ? 
AL6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? parallel      
AD1 6 7 ? anti-parallel 
AD1 7 8 ? parallel      
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? parallel      
AE7 1 2 ? parallel      
AE7 2 3 ? anti-parallel 
AE8 1 2 ? parallel      
AE8 2 3 ? anti-parallel 
AE9 1 2 ? parallel      
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AF9 3 4 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG5 1 2 ? parallel      
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG5 4 5 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? parallel      
AH1 2 3 ? parallel      
AH2 1 2 ? anti-parallel 
AH2 2 3 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH3 2 3 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH4 2 3 ? parallel      
AH4 3 4 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH5 2 3 ? anti-parallel 
AH5 3 4 ? anti-parallel 
AH5 4 5 ? anti-parallel 
AH6 1 2 ? anti-parallel 
AH7 1 2 ? anti-parallel 
AH7 2 3 ? anti-parallel 
AH8 1 2 ? anti-parallel 
AH8 2 3 ? anti-parallel 
AH8 3 4 ? parallel      
AH8 4 5 ? anti-parallel 
AH8 5 6 ? anti-parallel 
AH9 1 2 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI1 2 3 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI2 3 4 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI5 2 3 ? anti-parallel 
AI5 3 4 ? anti-parallel 
AI5 4 5 ? parallel      
AI5 5 6 ? anti-parallel 
AI5 6 7 ? parallel      
AI5 7 8 ? anti-parallel 
AI6 1 2 ? anti-parallel 
AI6 2 3 ? anti-parallel 
AI6 3 4 ? anti-parallel 
AI7 1 2 ? anti-parallel 
AI7 2 3 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI9 1 2 ? anti-parallel 
AI9 2 3 ? anti-parallel 
AI9 3 4 ? anti-parallel 
AI9 4 5 ? anti-parallel 
AI9 5 6 ? parallel      
AI9 6 7 ? anti-parallel 
AI9 7 8 ? parallel      
AJ1 1 2 ? anti-parallel 
AJ2 1 2 ? anti-parallel 
AJ2 2 3 ? anti-parallel 
AJ3 1 2 ? parallel      
AJ3 2 3 ? anti-parallel 
AJ4 1 2 ? anti-parallel 
AJ4 2 3 ? anti-parallel 
AJ5 1 2 ? anti-parallel 
AJ6 1 2 ? anti-parallel 
AJ6 2 3 ? anti-parallel 
AJ6 3 4 ? anti-parallel 
AJ6 4 5 ? anti-parallel 
AJ7 1 2 ? anti-parallel 
AJ7 2 3 ? anti-parallel 
AJ7 3 4 ? anti-parallel 
AJ8 1 2 ? anti-parallel 
AJ8 2 3 ? anti-parallel 
AJ9 1 2 ? anti-parallel 
AJ9 2 3 ? anti-parallel 
AK1 1 2 ? anti-parallel 
AK1 2 3 ? anti-parallel 
AK1 3 4 ? anti-parallel 
AK2 1 2 ? anti-parallel 
AK2 2 3 ? anti-parallel 
AK3 1 2 ? anti-parallel 
AK3 2 3 ? anti-parallel 
AK3 3 4 ? anti-parallel 
AK4 1 2 ? anti-parallel 
AK5 1 2 ? anti-parallel 
AK5 2 3 ? parallel      
AK6 1 2 ? parallel      
AK6 2 3 ? anti-parallel 
AK7 1 2 ? parallel      
AK7 2 3 ? anti-parallel 
AK8 1 2 ? parallel      
AK9 1 2 ? anti-parallel 
AL1 1 2 ? anti-parallel 
AL2 1 2 ? anti-parallel 
AL3 1 2 ? anti-parallel 
AL3 2 3 ? anti-parallel 
AL3 3 4 ? anti-parallel 
AL4 1 2 ? anti-parallel 
AL4 2 3 ? anti-parallel 
AL5 1 2 ? anti-parallel 
AL6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
AA1 2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
AA1 3 ARG A 189  ? THR A 201  ? ARG A 189  THR A 201  
AA1 4 VAL A 174  ? LEU A 186  ? VAL A 174  LEU A 186  
AA2 1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
AA2 2 ARG A 137  ? VAL A 148  ? ARG A 137  VAL A 148  
AA2 3 PRO A 49   ? ILE A 58   ? PRO A 49   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
AA3 2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
AA4 1 LYS A 107  ? LYS A 110  ? LYS A 107  LYS A 110  
AA4 2 HIS A 128  ? LEU A 132  ? HIS A 128  LEU A 132  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
AA6 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA6 3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
AA6 4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
AA7 1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
AA7 2 ARG B 137  ? GLY B 147  ? ARG B 137  GLY B 147  
AA7 3 GLY B 50   ? ILE B 58   ? GLY B 50   ILE B 58   
AA7 4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
AA8 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA8 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AA9 1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
AA9 2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
AB1 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB1 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB2 1 ILE C 3    ? ARG C 5    ? ILE C 3    ARG C 5    
AB2 2 ARG C 900  ? ILE C 902  ? ARG C 900  ILE C 902  
AB2 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB3 1 ILE C 54   ? GLU C 55   ? ILE C 54   GLU C 55   
AB3 2 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
AB3 3 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
AB3 4 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
AB4 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB4 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB4 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB5 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB5 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB5 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB5 4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
AB6 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB6 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB6 3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
AB6 4 VAL C 182  ? VAL C 186  ? VAL C 182  VAL C 186  
AB6 5 LYS C 190  ? PRO C 192  ? LYS C 190  PRO C 192  
AB7 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB7 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB8 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB8 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB8 3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
AB9 4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
AB9 5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AB9 6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
AC1 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC1 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC2 1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
AC2 2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
AC2 3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC3 1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
AC3 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC3 3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
AC3 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC4 1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
AC4 2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
AC5 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC5 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC6 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AC6 2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC6 3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
AC6 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC6 5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
AC6 6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC6 7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
AC6 8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC7 1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
AC7 2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC7 3 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
AC7 4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
AC8 1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
AC8 2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
AC8 3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AC9 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AC9 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AD1 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD1 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD1 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AD1 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AD1 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AD1 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AD1 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AD1 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD2 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AD2 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AD3 1 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD3 2 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD3 3 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD4 1 GLY D 91   ? ALA D 100  ? GLY D 91   ALA D 100  
AD4 2 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AD5 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AD5 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AD5 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AD6 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AD6 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AD7 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AD7 2 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD7 3 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD7 4 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AD7 5 VAL D 317  ? GLU D 327  ? VAL D 317  GLU D 327  
AD8 1 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AD8 2 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD8 3 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD8 4 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AD9 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AD9 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AD9 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AE1 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE1 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE1 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AE2 1 GLU D 277  ? LEU D 284  ? GLU D 277  LEU D 284  
AE2 2 ALA D 268  ? ARG D 274  ? ALA D 268  ARG D 274  
AE2 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AE2 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AE3 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AE3 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AE3 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AE4 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AE4 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AE4 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AE4 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE5 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE5 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE6 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AE6 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AE6 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AE7 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AE7 2 ILE D 827  ? VAL D 829  ? ILE D 827  VAL D 829  
AE7 3 ARG D 832  ? THR D 834  ? ARG D 832  THR D 834  
AE8 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AE8 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE8 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AE9 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AE9 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AF1 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AF1 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AF2 1 PHE D 1123 ? PRO D 1125 ? PHE D 1123 PRO D 1125 
AF2 2 LEU D 1132 ? LEU D 1134 ? LEU D 1132 LEU D 1134 
AF3 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AF3 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AF4 1 TYR D 1207 ? ASP D 1208 ? TYR D 1207 ASP D 1208 
AF4 2 ARG D 1213 ? PRO D 1214 ? ARG D 1213 PRO D 1214 
AF5 1 SER D 1300 ? LYS D 1304 ? SER D 1300 LYS D 1304 
AF5 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AF5 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AF5 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AF6 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF6 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF6 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AF7 1 GLN D 1485 ? VAL D 1487 ? GLN D 1485 VAL D 1487 
AF7 2 VAL E 74   ? GLY E 76   ? VAL E 74   GLY E 76   
AF8 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF8 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
AF9 1 VAL I 10   ? GLN I 16   ? VAL K 10   GLN K 16   
AF9 2 TYR I 20   ? LEU I 28   ? TYR K 20   LEU K 28   
AF9 3 LEU I 192  ? THR I 201  ? LEU K 192  THR K 201  
AF9 4 VAL I 174  ? THR I 184  ? VAL K 174  THR K 184  
AG1 1 THR I 96   ? GLU I 104  ? THR K 96   GLU K 104  
AG1 2 ARG I 137  ? VAL I 148  ? ARG K 137  VAL K 148  
AG1 3 PRO I 49   ? ILE I 58   ? PRO K 49   ILE K 58   
AG1 4 ILE I 165  ? PRO I 166  ? ILE K 165  PRO K 166  
AG2 1 VAL I 87   ? PHE I 89   ? VAL K 87   PHE K 89   
AG2 2 VAL I 120  ? ILE I 122  ? VAL K 120  ILE K 122  
AG3 1 GLU I 108  ? LYS I 110  ? GLU K 108  LYS K 110  
AG3 2 HIS I 128  ? THR I 131  ? HIS K 128  THR K 131  
AG4 1 TYR I 150  ? VAL I 151  ? TYR K 150  VAL K 151  
AG4 2 ALA I 169  ? VAL I 170  ? ALA K 169  VAL K 170  
AG5 1 PRO I 228  ? ALA I 230  ? PRO K 228  ALA K 230  
AG5 2 VAL J 10   ? GLN J 16   ? VAL L 10   GLN L 16   
AG5 3 TYR J 20   ? LEU J 28   ? TYR L 20   LEU L 28   
AG5 4 ARG J 189  ? THR J 201  ? ARG L 189  THR L 201  
AG5 5 VAL J 174  ? LEU J 186  ? VAL L 174  LEU L 186  
AG6 1 THR J 96   ? GLU J 104  ? THR L 96   GLU L 104  
AG6 2 ARG J 137  ? GLY J 147  ? ARG L 137  GLY L 147  
AG6 3 GLY J 50   ? ILE J 58   ? GLY L 50   ILE L 58   
AG6 4 ILE J 165  ? PRO J 166  ? ILE L 165  PRO L 166  
AG7 1 VAL J 87   ? PHE J 89   ? VAL L 87   PHE L 89   
AG7 2 VAL J 120  ? ILE J 122  ? VAL L 120  ILE L 122  
AG8 1 LYS J 107  ? LYS J 110  ? LYS L 107  LYS L 110  
AG8 2 HIS J 128  ? LEU J 132  ? HIS L 128  LEU L 132  
AG9 1 TYR J 150  ? VAL J 151  ? TYR L 150  VAL L 151  
AG9 2 ALA J 169  ? VAL J 170  ? ALA L 169  VAL L 170  
AH1 1 ILE K 3    ? ARG K 5    ? ILE M 3    ARG M 5    
AH1 2 ARG K 900  ? ILE K 902  ? ARG M 900  ILE M 902  
AH1 3 VAL K 579  ? MET K 580  ? VAL M 579  MET M 580  
AH2 1 VAL K 65   ? LEU K 73   ? VAL M 65   LEU M 73   
AH2 2 GLN K 91   ? HIS K 102  ? GLN M 91   HIS M 102  
AH2 3 LEU K 107  ? PRO K 119  ? LEU M 107  PRO M 119  
AH3 1 PHE K 127  ? ILE K 129  ? PHE M 127  ILE M 129  
AH3 2 ALA K 132  ? ILE K 136  ? ALA M 132  ILE M 136  
AH3 3 SER K 392  ? PHE K 394  ? SER M 392  PHE M 394  
AH4 1 ARG K 331  ? ARG K 334  ? ARG M 331  ARG M 334  
AH4 2 SER K 138  ? ARG K 142  ? SER M 138  ARG M 142  
AH4 3 ARG K 409  ? SER K 411  ? ARG M 409  SER M 411  
AH4 4 ILE K 452  ? SER K 454  ? ILE M 452  SER M 454  
AH5 1 GLY K 145  ? PRO K 150  ? GLY M 145  PRO M 150  
AH5 2 TYR K 158  ? ILE K 163  ? TYR M 158  ILE M 163  
AH5 3 ILE K 172  ? VAL K 176  ? ILE M 172  VAL M 176  
AH5 4 VAL K 182  ? VAL K 186  ? VAL M 182  VAL M 186  
AH5 5 LYS K 190  ? PRO K 192  ? LYS M 190  PRO M 192  
AH6 1 ALA K 291  ? GLU K 294  ? ALA M 291  GLU M 294  
AH6 2 GLU K 297  ? ASP K 300  ? GLU M 297  ASP M 300  
AH7 1 ARG K 460  ? VAL K 461  ? ARG M 460  VAL M 461  
AH7 2 ILE K 467  ? VAL K 475  ? ILE M 467  VAL M 475  
AH7 3 VAL K 478  ? MET K 486  ? VAL M 478  MET M 486  
AH8 1 ARG K 460  ? VAL K 461  ? ARG M 460  VAL M 461  
AH8 2 ILE K 467  ? VAL K 475  ? ILE M 467  VAL M 475  
AH8 3 PHE K 531  ? ASP K 533  ? PHE M 531  ASP M 533  
AH8 4 THR K 495  ? ALA K 497  ? THR M 495  ALA M 497  
AH8 5 VAL K 513  ? ARG K 517  ? VAL M 513  ARG M 517  
AH8 6 GLU K 520  ? VAL K 524  ? GLU M 520  VAL M 524  
AH9 1 LEU K 503  ? GLU K 504  ? LEU M 503  GLU M 504  
AH9 2 ARG K 507  ? ILE K 508  ? ARG M 507  ILE M 508  
AI1 1 LEU K 595  ? TYR K 596  ? LEU M 595  TYR M 596  
AI1 2 LEU K 654  ? ASP K 657  ? LEU M 654  ASP M 657  
AI1 3 ARG K 640  ? PRO K 641  ? ARG M 640  PRO M 641  
AI2 1 LEU K 620  ? PRO K 624  ? LEU M 620  PRO M 624  
AI2 2 ARG K 610  ? TYR K 615  ? ARG M 610  TYR M 615  
AI2 3 GLY K 601  ? VAL K 606  ? GLY M 601  VAL M 606  
AI2 4 ARG K 648  ? VAL K 649  ? ARG M 648  VAL M 649  
AI3 1 TYR K 629  ? ARG K 630  ? TYR M 629  ARG M 630  
AI3 2 ALA K 636  ? LEU K 637  ? ALA M 636  LEU M 637  
AI4 1 SER K 661  ? GLU K 662  ? SER M 661  GLU M 662  
AI4 2 PHE K 665  ? LEU K 666  ? PHE M 665  LEU M 666  
AI5 1 LYS K 971  ? VAL K 972  ? LYS M 971  VAL M 972  
AI5 2 ILE K 987  ? LYS K 996  ? ILE M 987  LYS M 996  
AI5 3 LYS K 838  ? ALA K 840  ? LYS M 838  ALA M 840  
AI5 4 LYS K 846  ? LEU K 853  ? LYS M 846  LEU M 853  
AI5 5 ILE K 688  ? SER K 691  ? ILE M 688  SER M 691  
AI5 6 VAL K 869  ? LEU K 871  ? VAL M 869  LEU M 871  
AI5 7 GLN K 670  ? ILE K 676  ? GLN M 670  ILE M 676  
AI5 8 ILE K 987  ? LYS K 996  ? ILE M 987  LYS M 996  
AI6 1 SER K 702  ? ARG K 713  ? SER M 702  ARG M 713  
AI6 2 VAL K 819  ? ARG K 831  ? VAL M 819  ARG M 831  
AI6 3 GLY K 798  ? ARG K 807  ? GLY M 798  ARG M 807  
AI6 4 GLU K 748  ? VAL K 749  ? GLU M 748  VAL M 749  
AI7 1 ARG K 721  ? ILE K 722  ? ARG M 721  ILE M 722  
AI7 2 ARG K 758  ? PHE K 761  ? ARG M 758  PHE M 761  
AI7 3 VAL K 785  ? ASP K 787  ? VAL M 785  ASP M 787  
AI8 1 ILE K 754  ? VAL K 756  ? ILE M 754  VAL M 756  
AI8 2 LEU K 790  ? ARG K 791  ? LEU M 790  ARG M 791  
AI9 1 HIS K 1006 ? ARG K 1008 ? HIS M 1006 ARG M 1008 
AI9 2 SER L 626  ? VAL L 633  ? SER N 626  VAL N 633  
AI9 3 GLN L 744  ? HIS L 748  ? GLN N 744  HIS N 748  
AI9 4 VAL L 700  ? ASN L 703  ? VAL N 700  ASN N 703  
AI9 5 ILE L 713  ? VAL L 721  ? ILE N 713  VAL N 721  
AI9 6 GLN L 641  ? PRO L 645  ? GLN N 641  PRO N 645  
AI9 7 ILE L 726  ? LEU L 728  ? ILE N 726  LEU N 728  
AI9 8 SER L 626  ? VAL L 633  ? SER N 626  VAL N 633  
AJ1 1 ARG K 1031 ? PHE K 1032 ? ARG M 1031 PHE M 1032 
AJ1 2 LYS L 621  ? ARG L 622  ? LYS N 621  ARG N 622  
AJ2 1 LEU K 1097 ? LEU K 1102 ? LEU M 1097 LEU M 1102 
AJ2 2 LYS L 7    ? LEU L 12   ? LYS N 7    LEU N 12   
AJ2 3 LYS L 1456 ? ASP L 1457 ? LYS N 1456 ASP N 1457 
AJ3 1 SER L 22   ? GLU L 25   ? SER N 22   GLU N 25   
AJ3 2 MET L 90   ? ALA L 100  ? MET N 90   ALA N 100  
AJ3 3 ILE L 513  ? VAL L 519  ? ILE N 513  VAL N 519  
AJ4 1 LEU L 152  ? LEU L 153  ? LEU N 152  LEU N 153  
AJ4 2 TYR L 132  ? ASP L 136  ? TYR N 132  ASP N 136  
AJ4 3 ASP L 453  ? ARG L 455  ? ASP N 453  ARG N 455  
AJ5 1 ILE L 141  ? LEU L 142  ? ILE N 141  LEU N 142  
AJ5 2 VAL L 145  ? PRO L 146  ? VAL N 145  PRO N 146  
AJ6 1 GLN L 166  ? PRO L 170  ? GLN N 166  PRO N 170  
AJ6 2 GLY L 383  ? VAL L 396  ? GLY N 383  VAL N 396  
AJ6 3 GLY L 201  ? PRO L 226  ? GLY N 201  PRO N 226  
AJ6 4 THR L 330  ? ARG L 346  ? THR N 330  ARG N 346  
AJ6 5 VAL L 317  ? GLU L 327  ? VAL N 317  GLU N 327  
AJ7 1 GLU L 183  ? VAL L 185  ? GLU N 183  VAL N 185  
AJ7 2 GLY L 201  ? PRO L 226  ? GLY N 201  PRO N 226  
AJ7 3 GLY L 383  ? VAL L 396  ? GLY N 383  VAL N 396  
AJ7 4 ALA L 359  ? VAL L 361  ? ALA N 359  VAL N 361  
AJ8 1 ILE L 241  ? GLU L 244  ? ILE N 241  GLU N 244  
AJ8 2 PRO L 303  ? ARG L 312  ? PRO N 303  ARG N 312  
AJ8 3 TYR L 249  ? ARG L 252  ? TYR N 249  ARG N 252  
AJ9 1 ILE L 241  ? GLU L 244  ? ILE N 241  GLU N 244  
AJ9 2 PRO L 303  ? ARG L 312  ? PRO N 303  ARG N 312  
AJ9 3 VAL L 286  ? PRO L 290  ? VAL N 286  PRO N 290  
AK1 1 PRO L 278  ? LEU L 284  ? PRO N 278  LEU N 284  
AK1 2 ALA L 268  ? ARG L 273  ? ALA N 268  ARG N 273  
AK1 3 GLY L 257  ? GLU L 263  ? GLY N 257  GLU N 263  
AK1 4 ILE L 297  ? VAL L 298  ? ILE N 297  VAL N 298  
AK2 1 ASN L 352  ? VAL L 353  ? ASN N 352  VAL N 353  
AK2 2 LYS L 366  ? ALA L 369  ? LYS N 366  ALA N 369  
AK2 3 VAL L 377  ? ILE L 378  ? VAL N 377  ILE N 378  
AK3 1 ALA L 398  ? PRO L 402  ? ALA N 398  PRO N 402  
AK3 2 VAL L 443  ? GLU L 448  ? VAL N 443  GLU N 448  
AK3 3 GLY L 433  ? ASP L 438  ? GLY N 433  ASP N 438  
AK3 4 ARG L 414  ? VAL L 415  ? ARG N 414  VAL N 415  
AK4 1 VAL L 420  ? ALA L 422  ? VAL N 420  ALA N 422  
AK4 2 VAL L 427  ? LYS L 428  ? VAL N 427  LYS N 428  
AK5 1 MET L 527  ? GLN L 529  ? MET N 527  GLN N 529  
AK5 2 PHE L 535  ? THR L 537  ? PHE N 535  THR N 537  
AK5 3 VAL N 335  ? SER N 336  ? VAL P 315  SER P 316  
AK6 1 GLU L 805  ? PHE L 806  ? GLU N 805  PHE N 806  
AK6 2 PRO L 826  ? VAL L 829  ? PRO N 826  VAL N 829  
AK6 3 ARG L 832  ? SER L 835  ? ARG N 832  SER N 835  
AK7 1 VAL L 842  ? PHE L 843  ? VAL N 842  PHE N 843  
AK7 2 VAL L 864  ? TYR L 868  ? VAL N 864  TYR N 868  
AK7 3 LYS L 871  ? THR L 875  ? LYS N 871  THR N 875  
AK8 1 VAL L 1106 ? GLU L 1109 ? VAL N 1106 GLU N 1109 
AK8 2 GLY L 1199 ? CYS L 1201 ? GLY N 1199 CYS N 1201 
AK9 1 ILE L 1118 ? PRO L 1121 ? ILE N 1118 PRO N 1121 
AK9 2 GLU L 1185 ? VAL L 1188 ? GLU N 1185 VAL N 1188 
AL1 1 PHE L 1123 ? PRO L 1125 ? PHE N 1123 PRO N 1125 
AL1 2 LEU L 1132 ? LEU L 1134 ? LEU N 1132 LEU N 1134 
AL2 1 VAL L 1153 ? VAL L 1155 ? VAL N 1153 VAL N 1155 
AL2 2 VAL L 1158 ? LEU L 1160 ? VAL N 1158 LEU N 1160 
AL3 1 SER L 1300 ? LEU L 1305 ? SER N 1300 LEU N 1305 
AL3 2 LEU L 1290 ? GLU L 1295 ? LEU N 1290 GLU N 1295 
AL3 3 GLY L 1279 ? GLU L 1285 ? GLY N 1279 GLU N 1285 
AL3 4 TYR L 1318 ? VAL L 1319 ? TYR N 1318 VAL N 1319 
AL4 1 VAL L 1394 ? GLU L 1396 ? VAL N 1394 GLU N 1396 
AL4 2 TYR L 1378 ? ASP L 1383 ? TYR N 1378 ASP N 1383 
AL4 3 ALA L 1416 ? LEU L 1420 ? ALA N 1416 LEU N 1420 
AL5 1 GLN L 1485 ? ASP L 1488 ? GLN N 1485 ASP N 1488 
AL5 2 LEU M 73   ? GLY M 76   ? LEU O 73   GLY O 76   
AL6 1 LYS M 47   ? GLN M 49   ? LYS O 47   GLN O 49   
AL6 2 LEU M 54   ? ASP M 56   ? LEU O 54   ASP O 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 14   ? N ARG A 14   O GLU A 22   ? O GLU A 22   
AA1 2 3 N PHE A 23   ? N PHE A 23   O LEU A 197  ? O LEU A 197  
AA1 3 4 O ARG A 198  ? O ARG A 198  N ALA A 178  ? N ALA A 178  
AA2 1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
AA2 2 3 O GLY A 147  ? O GLY A 147  N GLY A 50   ? N GLY A 50   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
AA4 1 2 N LYS A 107  ? N LYS A 107  O LEU A 132  ? O LEU A 132  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N THR B 12   ? N THR B 12   O VAL B 24   ? O VAL B 24   
AA6 2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
AA6 3 4 O ARG B 198  ? O ARG B 198  N ALA B 178  ? N ALA B 178  
AA7 1 2 N ALA B 103  ? N ALA B 103  O LEU B 138  ? O LEU B 138  
AA7 2 3 O ARG B 143  ? O ARG B 143  N SER B 55   ? N SER B 55   
AA7 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA8 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AA9 1 2 N LYS B 107  ? N LYS B 107  O LEU B 132  ? O LEU B 132  
AB1 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB2 1 2 N LYS C 4    ? N LYS C 4    O ARG C 900  ? O ARG C 900  
AB2 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB3 1 2 N ILE C 54   ? N ILE C 54   O LEU C 66   ? O LEU C 66   
AB3 2 3 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
AB3 3 4 N LEU C 94   ? N LEU C 94   O LEU C 115  ? O LEU C 115  
AB4 1 2 N PHE C 127  ? N PHE C 127  O ARG C 134  ? O ARG C 134  
AB4 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB5 1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
AB5 2 3 N SER C 138  ? N SER C 138  O SER C 411  ? O SER C 411  
AB5 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB6 1 2 N THR C 149  ? N THR C 149  O ILE C 159  ? O ILE C 159  
AB6 2 3 N ALA C 160  ? N ALA C 160  O LEU C 174  ? O LEU C 174  
AB6 3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
AB6 4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
AB7 1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
AB8 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB8 2 3 N TYR C 471  ? N TYR C 471  O VAL C 484  ? O VAL C 484  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AB9 3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
AB9 4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AB9 5 6 N ALA C 515  ? N ALA C 515  O VAL C 522  ? O VAL C 522  
AC1 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC2 1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
AC2 2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
AC3 1 2 O VAL C 621  ? O VAL C 621  N VAL C 613  ? N VAL C 613  
AC3 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC3 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC4 1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
AC5 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC6 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AC6 2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
AC6 3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
AC6 4 5 O LEU C 853  ? O LEU C 853  N ILE C 690  ? N ILE C 690  
AC6 5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
AC6 6 7 O LEU C 871  ? O LEU C 871  N ALA C 675  ? N ALA C 675  
AC6 7 8 N GLN C 670  ? N GLN C 670  O ILE C 994  ? O ILE C 994  
AC7 1 2 N SER C 702  ? N SER C 702  O ARG C 831  ? O ARG C 831  
AC7 2 3 O ALA C 828  ? O ALA C 828  N ILE C 799  ? N ILE C 799  
AC7 3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
AC8 1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
AC8 2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AC9 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AD1 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD1 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AD1 3 4 O ALA D 746  ? O ALA D 746  N ASN D 703  ? N ASN D 703  
AD1 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AD1 5 6 O VAL D 719  ? O VAL D 719  N CYS D 642  ? N CYS D 642  
AD1 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AD1 7 8 O LEU D 728  ? O LEU D 728  N VAL D 632  ? N VAL D 632  
AD2 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD3 1 2 N GLN C 1100 ? N GLN C 1100 O ARG D 9    ? O ARG D 9    
AD3 2 3 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD4 1 2 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD5 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD5 2 3 N ILE D 133  ? N ILE D 133  O ARG D 455  ? O ARG D 455  
AD6 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AD7 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AD7 2 3 O GLU D 389  ? O GLU D 389  N ARG D 209  ? N ARG D 209  
AD7 3 4 N LEU D 225  ? N LEU D 225  O VAL D 331  ? O VAL D 331  
AD7 4 5 O THR D 334  ? O THR D 334  N GLU D 323  ? N GLU D 323  
AD8 1 2 N VAL D 185  ? N VAL D 185  O GLY D 201  ? O GLY D 201  
AD8 2 3 N ARG D 209  ? N ARG D 209  O GLU D 389  ? O GLU D 389  
AD8 3 4 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AD9 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AD9 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AE1 1 2 N ALA D 243  ? N ALA D 243  O LEU D 311  ? O LEU D 311  
AE1 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AE2 1 2 O LEU D 284  ? O LEU D 284  N ALA D 268  ? N ALA D 268  
AE2 2 3 O PHE D 269  ? O PHE D 269  N LYS D 262  ? N LYS D 262  
AE2 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AE3 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AE3 2 3 N ILE D 367  ? N ILE D 367  O VAL D 377  ? O VAL D 377  
AE4 1 2 N TYR D 401  ? N TYR D 401  O VAL D 444  ? O VAL D 444  
AE4 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AE4 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE5 1 2 N LEU D 421  ? N LEU D 421  O VAL D 427  ? O VAL D 427  
AE6 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AE6 2 3 N PHE D 535  ? N PHE D 535  O VAL F 335  ? O VAL F 315  
AE7 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AE7 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AE8 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AE8 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AE9 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AF1 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AF2 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AF3 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AF4 1 2 N ASP D 1208 ? N ASP D 1208 O ARG D 1213 ? O ARG D 1213 
AF5 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AF5 2 3 O SER D 1291 ? O SER D 1291 N GLU D 1284 ? N GLU D 1284 
AF5 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AF6 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF6 2 3 N GLU D 1380 ? N GLU D 1380 O LYS D 1418 ? O LYS D 1418 
AF7 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AF8 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
AF9 1 2 N ARG I 14   ? N ARG K 14   O GLU I 22   ? O GLU K 22   
AF9 2 3 N LEU I 28   ? N LEU K 28   O ASP I 193  ? O ASP K 193  
AF9 3 4 O TRP I 200  ? O TRP K 200  N ARG I 176  ? N ARG K 176  
AG1 1 2 N LEU I 101  ? N LEU K 101  O MET I 140  ? O MET K 140  
AG1 2 3 O GLY I 147  ? O GLY K 147  N GLY I 50   ? N GLY K 50   
AG1 3 4 N VAL I 56   ? N VAL K 56   O ILE I 165  ? O ILE K 165  
AG2 1 2 N ARG I 88   ? N ARG K 88   O GLU I 121  ? O GLU K 121  
AG3 1 2 N VAL I 109  ? N VAL K 109  O ALA I 130  ? O ALA K 130  
AG4 1 2 N VAL I 151  ? N VAL K 151  O ALA I 169  ? O ALA K 169  
AG5 1 2 N GLN I 229  ? N GLN K 229  O VAL J 13   ? O VAL L 13   
AG5 2 3 N THR J 12   ? N THR L 12   O VAL J 24   ? O VAL L 24   
AG5 3 4 N LEU J 25   ? N LEU L 25   O LEU J 195  ? O LEU L 195  
AG5 4 5 O THR J 196  ? O THR L 196  N GLN J 180  ? N GLN L 180  
AG6 1 2 N VAL J 97   ? N VAL L 97   O VAL J 144  ? O VAL L 144  
AG6 2 3 O ARG J 143  ? O ARG L 143  N SER J 55   ? N SER L 55   
AG6 3 4 N VAL J 56   ? N VAL L 56   O ILE J 165  ? O ILE L 165  
AG7 1 2 N ARG J 88   ? N ARG L 88   O GLU J 121  ? O GLU L 121  
AG8 1 2 N LYS J 107  ? N LYS L 107  O LEU J 132  ? O LEU L 132  
AG9 1 2 N VAL J 151  ? N VAL L 151  O ALA J 169  ? O ALA L 169  
AH1 1 2 N LYS K 4    ? N LYS M 4    O ARG K 900  ? O ARG M 900  
AH1 2 3 O TYR K 901  ? O TYR M 901  N MET K 580  ? N MET M 580  
AH2 1 2 N VAL K 65   ? N VAL M 65   O ILE K 101  ? O ILE M 101  
AH2 2 3 N LEU K 94   ? N LEU M 94   O GLY K 116  ? O GLY M 116  
AH3 1 2 N ILE K 129  ? N ILE M 129  O ALA K 132  ? O ALA M 132  
AH3 2 3 N VAL K 135  ? N VAL M 135  O GLN K 393  ? O GLN M 393  
AH4 1 2 O ARG K 334  ? O ARG M 334  N GLN K 139  ? N GLN M 139  
AH4 2 3 N SER K 138  ? N SER M 138  O SER K 411  ? O SER M 411  
AH4 3 4 N ILE K 410  ? N ILE M 410  O THR K 453  ? O THR M 453  
AH5 1 2 N THR K 149  ? N THR M 149  O ILE K 159  ? O ILE M 159  
AH5 2 3 N ALA K 160  ? N ALA M 160  O LEU K 174  ? O LEU M 174  
AH5 3 4 N GLU K 175  ? N GLU M 175  O SER K 183  ? O SER M 183  
AH5 4 5 N MET K 184  ? N MET M 184  O PHE K 191  ? O PHE M 191  
AH6 1 2 N ARG K 292  ? N ARG M 292  O LYS K 299  ? O LYS M 299  
AH7 1 2 N ARG K 460  ? N ARG M 460  O ARG K 468  ? O ARG M 468  
AH7 2 3 N ARG K 473  ? N ARG M 473  O THR K 480  ? O THR M 480  
AH8 1 2 N ARG K 460  ? N ARG M 460  O ARG K 468  ? O ARG M 468  
AH8 2 3 N ARG K 472  ? N ARG M 472  O MET K 532  ? O MET M 532  
AH8 3 4 O PHE K 531  ? O PHE M 531  N ALA K 497  ? N ALA M 497  
AH8 4 5 N ILE K 496  ? N ILE M 496  O ARG K 516  ? O ARG M 516  
AH8 5 6 N VAL K 513  ? N VAL M 513  O VAL K 524  ? O VAL M 524  
AH9 1 2 N GLU K 504  ? N GLU M 504  O ARG K 507  ? O ARG M 507  
AI1 1 2 N LEU K 595  ? N LEU M 595  O LEU K 655  ? O LEU M 655  
AI1 2 3 O ASP K 657  ? O ASP M 657  N ARG K 640  ? N ARG M 640  
AI2 1 2 O TYR K 623  ? O TYR M 623  N ILE K 611  ? N ILE M 611  
AI2 2 3 O ARG K 614  ? O ARG M 614  N GLU K 602  ? N GLU M 602  
AI2 3 4 N GLY K 601  ? N GLY M 601  O VAL K 649  ? O VAL M 649  
AI3 1 2 N TYR K 629  ? N TYR M 629  O LEU K 637  ? O LEU M 637  
AI4 1 2 N GLU K 662  ? N GLU M 662  O PHE K 665  ? O PHE M 665  
AI5 1 2 N VAL K 972  ? N VAL M 972  O ILE K 987  ? O ILE M 987  
AI5 2 3 O MET K 995  ? O MET M 995  N ALA K 840  ? N ALA M 840  
AI5 3 4 N LEU K 839  ? N LEU M 839  O GLY K 847  ? O GLY M 847  
AI5 4 5 O VAL K 848  ? O VAL M 848  N ILE K 688  ? N ILE M 688  
AI5 5 6 N VAL K 689  ? N VAL M 689  O ILE K 870  ? O ILE M 870  
AI5 6 7 O VAL K 869  ? O VAL M 869  N ALA K 675  ? N ALA M 675  
AI5 7 8 N VAL K 674  ? N VAL M 674  O GLY K 990  ? O GLY M 990  
AI6 1 2 N SER K 702  ? N SER M 702  O ARG K 831  ? O ARG M 831  
AI6 2 3 O ALA K 828  ? O ALA M 828  N ILE K 799  ? N ILE M 799  
AI6 3 4 O GLY K 798  ? O GLY M 798  N VAL K 749  ? N VAL M 749  
AI7 1 2 N ARG K 721  ? N ARG M 721  O THR K 759  ? O THR M 759  
AI7 2 3 N SER K 760  ? N SER M 760  O LYS K 786  ? O LYS M 786  
AI8 1 2 N LEU K 755  ? N LEU M 755  O LEU K 790  ? O LEU M 790  
AI9 1 2 N HIS K 1006 ? N HIS M 1006 O ARG L 628  ? O ARG N 628  
AI9 2 3 N SER L 629  ? N SER N 629  O MET L 745  ? O MET N 745  
AI9 3 4 O ALA L 746  ? O ALA N 746  N ASN L 703  ? N ASN N 703  
AI9 4 5 N LEU L 702  ? N LEU N 702  O GLN L 714  ? O GLN N 714  
AI9 5 6 O VAL L 719  ? O VAL N 719  N LEU L 644  ? N LEU N 644  
AI9 6 7 N GLY L 643  ? N GLY N 643  O GLN L 727  ? O GLN N 727  
AI9 7 8 O LEU L 728  ? O LEU N 728  N VAL L 632  ? N VAL N 632  
AJ1 1 2 N PHE K 1032 ? N PHE M 1032 O LYS L 621  ? O LYS N 621  
AJ2 1 2 N GLN K 1100 ? N GLN M 1100 O ARG L 9    ? O ARG N 9    
AJ2 2 3 N VAL L 8    ? N VAL N 8    O ASP L 1457 ? O ASP N 1457 
AJ3 1 2 N TYR L 23   ? N TYR N 23   O MET L 90   ? O MET N 90   
AJ3 2 3 N ALA L 99   ? N ALA N 99   O LEU L 514  ? O LEU N 514  
AJ4 1 2 O LEU L 153  ? O LEU N 153  N TYR L 132  ? N TYR N 132  
AJ4 2 3 N ILE L 133  ? N ILE N 133  O ARG L 455  ? O ARG N 455  
AJ5 1 2 N LEU L 142  ? N LEU N 142  O VAL L 145  ? O VAL N 145  
AJ6 1 2 N TYR L 169  ? N TYR N 169  O ILE L 393  ? O ILE N 393  
AJ6 2 3 O GLU L 389  ? O GLU N 389  N ARG L 209  ? N ARG N 209  
AJ6 3 4 N LEU L 225  ? N LEU N 225  O VAL L 331  ? O VAL N 331  
AJ6 4 5 O THR L 334  ? O THR N 334  N GLU L 323  ? N GLU N 323  
AJ7 1 2 N VAL L 185  ? N VAL N 185  O GLY L 201  ? O GLY N 201  
AJ7 2 3 N ARG L 209  ? N ARG N 209  O GLU L 389  ? O GLU N 389  
AJ7 3 4 O GLY L 383  ? O GLY N 383  N VAL L 361  ? N VAL N 361  
AJ8 1 2 N ALA L 243  ? N ALA N 243  O LEU L 311  ? O LEU N 311  
AJ8 2 3 O ALA L 307  ? O ALA N 307  N TYR L 249  ? N TYR N 249  
AJ9 1 2 N ALA L 243  ? N ALA N 243  O LEU L 311  ? O LEU N 311  
AJ9 2 3 O ARG L 312  ? O ARG N 312  N VAL L 286  ? N VAL N 286  
AK1 1 2 O LEU L 284  ? O LEU N 284  N ALA L 268  ? N ALA N 268  
AK1 2 3 O VAL L 271  ? O VAL N 271  N GLU L 260  ? N GLU N 260  
AK1 3 4 N GLY L 257  ? N GLY N 257  O VAL L 298  ? O VAL N 298  
AK2 1 2 N ASN L 352  ? N ASN N 352  O ALA L 369  ? O ALA N 369  
AK2 2 3 N ILE L 367  ? N ILE N 367  O VAL L 377  ? O VAL N 377  
AK3 1 2 N TYR L 401  ? N TYR N 401  O VAL L 444  ? O VAL N 444  
AK3 2 3 O ARG L 445  ? O ARG N 445  N GLU L 436  ? N GLU N 436  
AK3 3 4 O GLY L 433  ? O GLY N 433  N VAL L 415  ? N VAL N 415  
AK4 1 2 N LEU L 421  ? N LEU N 421  O VAL L 427  ? O VAL N 427  
AK5 1 2 N VAL L 528  ? N VAL N 528  O ALA L 536  ? O ALA N 536  
AK5 2 3 N PHE L 535  ? N PHE N 535  O VAL N 335  ? O VAL P 315  
AK6 1 2 N PHE L 806  ? N PHE N 806  O LYS L 828  ? O LYS N 828  
AK6 2 3 N ILE L 827  ? N ILE N 827  O THR L 834  ? O THR N 834  
AK7 1 2 N PHE L 843  ? N PHE N 843  O THR L 865  ? O THR N 865  
AK7 2 3 N VAL L 866  ? N VAL N 866  O LEU L 873  ? O LEU N 873  
AK8 1 2 N ARG L 1108 ? N ARG N 1108 O VAL L 1200 ? O VAL N 1200 
AK9 1 2 N ILE L 1118 ? N ILE N 1118 O VAL L 1188 ? O VAL N 1188 
AL1 1 2 N GLN L 1124 ? N GLN N 1124 O ARG L 1133 ? O ARG N 1133 
AL2 1 2 N VAL L 1153 ? N VAL N 1153 O LEU L 1160 ? O LEU N 1160 
AL3 1 2 O TYR L 1303 ? O TYR N 1303 N VAL L 1292 ? N VAL N 1292 
AL3 2 3 O SER L 1291 ? O SER N 1291 N GLU L 1284 ? N GLU N 1284 
AL3 3 4 N GLY L 1279 ? N GLY N 1279 O VAL L 1319 ? O VAL N 1319 
AL4 1 2 O LEU L 1395 ? O LEU N 1395 N VAL L 1379 ? N VAL N 1379 
AL4 2 3 N GLU L 1380 ? N GLU N 1380 O LYS L 1418 ? O LYS N 1418 
AL5 1 2 N GLN L 1485 ? N GLN N 1485 O GLY M 76   ? O GLY O 76   
AL6 1 2 N MET M 48   ? N MET O 48   O PHE M 55   ? O PHE O 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MG  2001 ? 4  'binding site for residue MG B 2001'                     
AC2 Software D ZN  2001 ? 4  'binding site for residue ZN D 2001'                     
AC3 Software D ZN  2002 ? 5  'binding site for residue ZN D 2002'                     
AC4 Software D MG  2003 ? 4  'binding site for residue MG D 2003'                     
AC5 Software D MG  2004 ? 2  'binding site for residue MG D 2004'                     
AC6 Software D DPO 2006 ? 4  'binding site for residue DPO D 2006'                    
AC7 Software D MG  2007 ? 3  'binding site for residue MG D 2007'                     
AC8 Software F MG  2001 ? 3  'binding site for residue MG F 2001'                     
AC9 Software N MG  1601 ? 2  'binding site for residue MG N 1601'                     
AD1 Software N ZN  1602 ? 4  'binding site for residue ZN N 1602'                     
AD2 Software N ZN  1603 ? 4  'binding site for residue ZN N 1603'                     
AD3 Software N MG  1604 ? 4  'binding site for residue MG N 1604'                     
AD4 Software N DPO 1606 ? 5  'binding site for residue DPO N 1606'                    
AD5 Software N MG  1607 ? 4  'binding site for residue MG N 1607'                     
AD6 Software P MG  2001 ? 3  'binding site for residue MG P 2001'                     
AD7 Software D C   2005 ? 12 'binding site for Di-nucleotide C D 2005 and COD D 2008' 
AD8 Software N C   1605 ? 12 'binding site for Di-nucleotide C N 1605 and COD N 1608' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ARG B  30   ? ARG B 30   . ? 1_555 ? 
2  AC1 4  ASP B  183  ? ASP B 183  . ? 1_555 ? 
3  AC1 4  ASP B  191  ? ASP B 191  . ? 1_555 ? 
4  AC1 4  ASP B  193  ? ASP B 193  . ? 1_555 ? 
5  AC2 4  CYS D  1112 ? CYS D 1112 . ? 1_555 ? 
6  AC2 4  CYS D  1194 ? CYS D 1194 . ? 1_555 ? 
7  AC2 4  CYS D  1201 ? CYS D 1201 . ? 1_555 ? 
8  AC2 4  CYS D  1204 ? CYS D 1204 . ? 1_555 ? 
9  AC3 5  CYS D  58   ? CYS D 58   . ? 1_555 ? 
10 AC3 5  CYS D  60   ? CYS D 60   . ? 1_555 ? 
11 AC3 5  LYS D  62   ? LYS D 62   . ? 1_555 ? 
12 AC3 5  CYS D  73   ? CYS D 73   . ? 1_555 ? 
13 AC3 5  CYS D  76   ? CYS D 76   . ? 1_555 ? 
14 AC4 4  ASP D  739  ? ASP D 739  . ? 1_555 ? 
15 AC4 4  ASP D  741  ? ASP D 741  . ? 1_555 ? 
16 AC4 4  ASP D  743  ? ASP D 743  . ? 1_555 ? 
17 AC4 4  C   V  .    ? C   D 2005 . ? 1_555 ? 
18 AC5 2  ASP B  168  ? ASP B 168  . ? 1_555 ? 
19 AC5 2  LYS D  840  ? LYS D 840  . ? 1_555 ? 
20 AC6 4  ARG C  879  ? ARG C 879  . ? 1_555 ? 
21 AC6 4  ASP D  739  ? ASP D 739  . ? 1_555 ? 
22 AC6 4  ARG D  1029 ? ARG D 1029 . ? 1_555 ? 
23 AC6 4  MG  X  .    ? MG  D 2007 . ? 1_555 ? 
24 AC7 3  ARG C  879  ? ARG C 879  . ? 1_555 ? 
25 AC7 3  ASP D  739  ? ASP D 739  . ? 1_555 ? 
26 AC7 3  DPO W  .    ? DPO D 2006 . ? 1_555 ? 
27 AC8 3  ALA F  312  ? ALA F 292  . ? 1_555 ? 
28 AC8 3  GLY F  316  ? GLY F 296  . ? 1_555 ? 
29 AC8 3  TRP F  319  ? TRP F 299  . ? 1_555 ? 
30 AC9 2  ASP J  168  ? ASP L 168  . ? 1_555 ? 
31 AC9 2  LYS L  840  ? LYS N 840  . ? 1_555 ? 
32 AD1 4  CYS L  1112 ? CYS N 1112 . ? 1_555 ? 
33 AD1 4  CYS L  1194 ? CYS N 1194 . ? 1_555 ? 
34 AD1 4  CYS L  1201 ? CYS N 1201 . ? 1_555 ? 
35 AD1 4  CYS L  1204 ? CYS N 1204 . ? 1_555 ? 
36 AD2 4  CYS L  58   ? CYS N 58   . ? 1_555 ? 
37 AD2 4  CYS L  60   ? CYS N 60   . ? 1_555 ? 
38 AD2 4  CYS L  73   ? CYS N 73   . ? 1_555 ? 
39 AD2 4  CYS L  76   ? CYS N 76   . ? 1_555 ? 
40 AD3 4  ASP L  739  ? ASP N 739  . ? 1_555 ? 
41 AD3 4  ASP L  741  ? ASP N 741  . ? 1_555 ? 
42 AD3 4  ASP L  743  ? ASP N 743  . ? 1_555 ? 
43 AD3 4  C   EA .    ? C   N 1605 . ? 1_555 ? 
44 AD4 5  ARG K  879  ? ARG M 879  . ? 1_555 ? 
45 AD4 5  ASP L  739  ? ASP N 739  . ? 1_555 ? 
46 AD4 5  ARG L  1029 ? ARG N 1029 . ? 1_555 ? 
47 AD4 5  MG  GA .    ? MG  N 1607 . ? 1_555 ? 
48 AD4 5  HOH UA .    ? HOH N 2140 . ? 1_555 ? 
49 AD5 4  GLU K  685  ? GLU M 685  . ? 1_555 ? 
50 AD5 4  HOH TA .    ? HOH M 1216 . ? 1_555 ? 
51 AD5 4  ASP L  739  ? ASP N 739  . ? 1_555 ? 
52 AD5 4  DPO FA .    ? DPO N 1606 . ? 1_555 ? 
53 AD6 3  ALA N  312  ? ALA P 292  . ? 1_555 ? 
54 AD6 3  GLY N  316  ? GLY P 296  . ? 1_555 ? 
55 AD6 3  TRP N  319  ? TRP P 299  . ? 1_555 ? 
56 AD7 12 GLN C  567  ? GLN C 567  . ? 1_555 ? 
57 AD7 12 LYS C  838  ? LYS C 838  . ? 1_555 ? 
58 AD7 12 LYS C  846  ? LYS C 846  . ? 1_555 ? 
59 AD7 12 HIS C  999  ? HIS C 999  . ? 1_555 ? 
60 AD7 12 ARG D  704  ? ARG D 704  . ? 1_555 ? 
61 AD7 12 ASP D  741  ? ASP D 741  . ? 1_555 ? 
62 AD7 12 ASP D  743  ? ASP D 743  . ? 1_555 ? 
63 AD7 12 MG  T  .    ? MG  D 2003 . ? 1_555 ? 
64 AD7 12 HOH MA .    ? HOH D 2136 . ? 1_555 ? 
65 AD7 12 DG  H  14   ? DG  G 15   . ? 1_555 ? 
66 AD7 12 DT  H  15   ? DT  G 16   . ? 1_555 ? 
67 AD7 12 DA  H  16   ? DA  G 17   . ? 1_555 ? 
68 AD8 12 GLN K  567  ? GLN M 567  . ? 1_555 ? 
69 AD8 12 LYS K  838  ? LYS M 838  . ? 1_555 ? 
70 AD8 12 LYS K  846  ? LYS M 846  . ? 1_555 ? 
71 AD8 12 TYR K  998  ? TYR M 998  . ? 1_555 ? 
72 AD8 12 HIS K  999  ? HIS M 999  . ? 1_555 ? 
73 AD8 12 ARG L  704  ? ARG N 704  . ? 1_555 ? 
74 AD8 12 ASP L  741  ? ASP N 741  . ? 1_555 ? 
75 AD8 12 ASP L  743  ? ASP N 743  . ? 1_555 ? 
76 AD8 12 MG  DA .    ? MG  N 1604 . ? 1_555 ? 
77 AD8 12 DG  O  14   ? DG  R 15   . ? 1_555 ? 
78 AD8 12 DT  O  15   ? DT  R 16   . ? 1_555 ? 
79 AD8 12 DA  O  16   ? DA  R 17   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5D4E 
_atom_sites.fract_transf_matrix[1][1]   0.005382 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000802 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009620 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003403 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1  4    ? 30.384  17.425  145.102  1.00 72.35  ?  4    SER A N     1 
ATOM   2     C  CA    . SER A  1  4    ? 30.321  16.404  144.062  1.00 86.28  ?  4    SER A CA    1 
ATOM   3     C  C     . SER A  1  4    ? 31.514  16.518  143.118  1.00 84.56  ?  4    SER A C     1 
ATOM   4     O  O     . SER A  1  4    ? 31.814  15.593  142.361  1.00 76.44  ?  4    SER A O     1 
ATOM   5     C  CB    . SER A  1  4    ? 29.011  16.518  143.278  1.00 83.50  ?  4    SER A CB    1 
ATOM   6     O  OG    . SER A  1  4    ? 28.869  15.452  142.355  1.00 64.01  ?  4    SER A OG    1 
ATOM   7     N  N     . LYS A  1  5    ? 32.193  17.659  143.171  1.00 86.86  ?  5    LYS A N     1 
ATOM   8     C  CA    . LYS A  1  5    ? 33.362  17.901  142.335  1.00 76.10  ?  5    LYS A CA    1 
ATOM   9     C  C     . LYS A  1  5    ? 34.554  17.073  142.808  1.00 69.09  ?  5    LYS A C     1 
ATOM   10    O  O     . LYS A  1  5    ? 34.836  16.999  144.004  1.00 72.38  ?  5    LYS A O     1 
ATOM   11    C  CB    . LYS A  1  5    ? 33.718  19.390  142.340  1.00 78.09  ?  5    LYS A CB    1 
ATOM   12    C  CG    . LYS A  1  5    ? 34.999  19.733  141.596  1.00 83.24  ?  5    LYS A CG    1 
ATOM   13    C  CD    . LYS A  1  5    ? 34.888  19.418  140.112  1.00 84.83  ?  5    LYS A CD    1 
ATOM   14    C  CE    . LYS A  1  5    ? 36.202  19.688  139.393  1.00 77.04  ?  5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A  1  5    ? 36.660  21.095  139.566  1.00 55.54  ?  5    LYS A NZ    1 
ATOM   16    N  N     . LEU A  1  6    ? 35.248  16.448  141.862  1.00 66.93  ?  6    LEU A N     1 
ATOM   17    C  CA    . LEU A  1  6    ? 36.416  15.635  142.177  1.00 61.39  ?  6    LEU A CA    1 
ATOM   18    C  C     . LEU A  1  6    ? 37.638  16.524  142.390  1.00 55.70  ?  6    LEU A C     1 
ATOM   19    O  O     . LEU A  1  6    ? 37.913  17.418  141.590  1.00 58.34  ?  6    LEU A O     1 
ATOM   20    C  CB    . LEU A  1  6    ? 36.675  14.623  141.058  1.00 53.21  ?  6    LEU A CB    1 
ATOM   21    C  CG    . LEU A  1  6    ? 37.203  13.241  141.455  1.00 54.03  ?  6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A  1  6    ? 38.672  13.290  141.838  1.00 63.30  ?  6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A  1  6    ? 36.376  12.667  142.593  1.00 59.04  ?  6    LEU A CD2   1 
ATOM   24    N  N     . LYS A  1  7    ? 38.368  16.275  143.473  1.00 51.40  ?  7    LYS A N     1 
ATOM   25    C  CA    . LYS A  1  7    ? 39.529  17.087  143.820  1.00 50.68  ?  7    LYS A CA    1 
ATOM   26    C  C     . LYS A  1  7    ? 40.799  16.602  143.126  1.00 49.22  ?  7    LYS A C     1 
ATOM   27    O  O     . LYS A  1  7    ? 40.759  15.679  142.314  1.00 50.18  ?  7    LYS A O     1 
ATOM   28    C  CB    . LYS A  1  7    ? 39.732  17.105  145.336  1.00 56.39  ?  7    LYS A CB    1 
ATOM   29    C  CG    . LYS A  1  7    ? 38.628  17.814  146.104  1.00 62.30  ?  7    LYS A CG    1 
ATOM   30    C  CD    . LYS A  1  7    ? 38.603  19.301  145.791  1.00 68.90  ?  7    LYS A CD    1 
ATOM   31    C  CE    . LYS A  1  7    ? 37.578  20.029  146.644  1.00 60.66  ?  7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A  1  7    ? 37.608  21.498  146.407  1.00 60.94  ?  7    LYS A NZ    1 
ATOM   33    N  N     . ALA A  1  8    ? 41.922  17.234  143.453  1.00 51.87  ?  8    ALA A N     1 
ATOM   34    C  CA    . ALA A  1  8    ? 43.207  16.897  142.847  1.00 40.58  ?  8    ALA A CA    1 
ATOM   35    C  C     . ALA A  1  8    ? 43.623  15.463  143.164  1.00 40.87  ?  8    ALA A C     1 
ATOM   36    O  O     . ALA A  1  8    ? 43.648  15.061  144.326  1.00 50.96  ?  8    ALA A O     1 
ATOM   37    C  CB    . ALA A  1  8    ? 44.279  17.876  143.299  1.00 41.83  ?  8    ALA A CB    1 
ATOM   38    N  N     . PRO A  1  9    ? 43.941  14.685  142.119  1.00 46.34  ?  9    PRO A N     1 
ATOM   39    C  CA    . PRO A  1  9    ? 44.303  13.266  142.218  1.00 48.79  ?  9    PRO A CA    1 
ATOM   40    C  C     . PRO A  1  9    ? 45.741  13.028  142.675  1.00 37.25  ?  9    PRO A C     1 
ATOM   41    O  O     . PRO A  1  9    ? 46.595  13.906  142.542  1.00 28.29  ?  9    PRO A O     1 
ATOM   42    C  CB    . PRO A  1  9    ? 44.126  12.771  140.782  1.00 45.43  ?  9    PRO A CB    1 
ATOM   43    C  CG    . PRO A  1  9    ? 44.445  13.960  139.951  1.00 47.08  ?  9    PRO A CG    1 
ATOM   44    C  CD    . PRO A  1  9    ? 43.942  15.154  140.722  1.00 47.73  ?  9    PRO A CD    1 
ATOM   45    N  N     . VAL A  1  10   ? 45.993  11.839  143.214  1.00 37.31  ?  10   VAL A N     1 
ATOM   46    C  CA    . VAL A  1  10   ? 47.341  11.411  143.560  1.00 44.74  ?  10   VAL A CA    1 
ATOM   47    C  C     . VAL A  1  10   ? 48.130  11.017  142.308  1.00 44.10  ?  10   VAL A C     1 
ATOM   48    O  O     . VAL A  1  10   ? 47.600  10.376  141.379  1.00 46.58  ?  10   VAL A O     1 
ATOM   49    C  CB    . VAL A  1  10   ? 47.344  10.261  144.608  1.00 45.53  ?  10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A  1  10   ? 46.713  8.999   144.043  1.00 51.33  ?  10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A  1  10   ? 48.759  9.979   145.100  1.00 41.26  ?  10   VAL A CG2   1 
ATOM   52    N  N     . PHE A  1  11   ? 49.396  11.430  142.302  1.00 49.42  ?  11   PHE A N     1 
ATOM   53    C  CA    . PHE A  1  11   ? 50.310  11.242  141.184  1.00 51.69  ?  11   PHE A CA    1 
ATOM   54    C  C     . PHE A  1  11   ? 51.517  10.412  141.625  1.00 45.29  ?  11   PHE A C     1 
ATOM   55    O  O     . PHE A  1  11   ? 52.336  10.863  142.424  1.00 51.64  ?  11   PHE A O     1 
ATOM   56    C  CB    . PHE A  1  11   ? 50.749  12.614  140.656  1.00 52.03  ?  11   PHE A CB    1 
ATOM   57    C  CG    . PHE A  1  11   ? 51.832  12.559  139.615  1.00 57.78  ?  11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A  1  11   ? 51.745  11.686  138.542  1.00 53.44  ?  11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A  1  11   ? 52.924  13.410  139.694  1.00 54.77  ?  11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A  1  11   ? 52.741  11.645  137.582  1.00 50.16  ?  11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A  1  11   ? 53.920  13.377  138.736  1.00 50.63  ?  11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A  1  11   ? 53.828  12.493  137.679  1.00 52.66  ?  11   PHE A CZ    1 
ATOM   63    N  N     . THR A  1  12   ? 51.619  9.198   141.095  1.00 39.82  ?  12   THR A N     1 
ATOM   64    C  CA    . THR A  1  12   ? 52.661  8.258   141.487  1.00 39.85  ?  12   THR A CA    1 
ATOM   65    C  C     . THR A  1  12   ? 53.714  8.123   140.387  1.00 43.57  ?  12   THR A C     1 
ATOM   66    O  O     . THR A  1  12   ? 53.402  8.236   139.202  1.00 40.55  ?  12   THR A O     1 
ATOM   67    C  CB    . THR A  1  12   ? 52.057  6.873   141.800  1.00 36.36  ?  12   THR A CB    1 
ATOM   68    O  OG1   . THR A  1  12   ? 50.896  7.034   142.625  1.00 37.27  ?  12   THR A OG1   1 
ATOM   69    C  CG2   . THR A  1  12   ? 53.065  5.983   142.517  1.00 41.78  ?  12   THR A CG2   1 
ATOM   70    N  N     . VAL A  1  13   ? 54.962  7.896   140.789  1.00 49.49  ?  13   VAL A N     1 
ATOM   71    C  CA    . VAL A  1  13   ? 56.068  7.753   139.846  1.00 39.76  ?  13   VAL A CA    1 
ATOM   72    C  C     . VAL A  1  13   ? 56.910  6.512   140.141  1.00 38.23  ?  13   VAL A C     1 
ATOM   73    O  O     . VAL A  1  13   ? 57.461  6.373   141.232  1.00 48.42  ?  13   VAL A O     1 
ATOM   74    C  CB    . VAL A  1  13   ? 56.994  8.988   139.877  1.00 42.78  ?  13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A  1  13   ? 58.228  8.752   139.020  1.00 42.80  ?  13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A  1  13   ? 56.245  10.234  139.422  1.00 45.89  ?  13   VAL A CG2   1 
ATOM   77    N  N     . ARG A  1  14   ? 57.003  5.613   139.166  1.00 37.67  ?  14   ARG A N     1 
ATOM   78    C  CA    . ARG A  1  14   ? 57.879  4.449   139.277  1.00 40.37  ?  14   ARG A CA    1 
ATOM   79    C  C     . ARG A  1  14   ? 58.945  4.506   138.190  1.00 47.92  ?  14   ARG A C     1 
ATOM   80    O  O     . ARG A  1  14   ? 58.628  4.686   137.021  1.00 48.73  ?  14   ARG A O     1 
ATOM   81    C  CB    . ARG A  1  14   ? 57.077  3.151   139.167  1.00 34.82  ?  14   ARG A CB    1 
ATOM   82    C  CG    . ARG A  1  14   ? 56.164  2.886   140.353  1.00 47.53  ?  14   ARG A CG    1 
ATOM   83    C  CD    . ARG A  1  14   ? 55.531  1.503   140.278  1.00 49.33  ?  14   ARG A CD    1 
ATOM   84    N  NE    . ARG A  1  14   ? 54.496  1.418   139.252  1.00 53.27  ?  14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A  1  14   ? 53.200  1.614   139.479  1.00 56.89  ?  14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A  1  14   ? 52.776  1.908   140.700  1.00 60.16  ?  14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A  1  14   ? 52.327  1.515   138.486  1.00 60.25  ?  14   ARG A NH2   1 
ATOM   88    N  N     . THR A  1  15   ? 60.210  4.364   138.571  1.00 55.60  ?  15   THR A N     1 
ATOM   89    C  CA    . THR A  1  15   ? 61.299  4.515   137.609  1.00 52.30  ?  15   THR A CA    1 
ATOM   90    C  C     . THR A  1  15   ? 62.300  3.363   137.626  1.00 55.73  ?  15   THR A C     1 
ATOM   91    O  O     . THR A  1  15   ? 62.676  2.866   138.688  1.00 53.20  ?  15   THR A O     1 
ATOM   92    C  CB    . THR A  1  15   ? 62.071  5.835   137.829  1.00 45.25  ?  15   THR A CB    1 
ATOM   93    O  OG1   . THR A  1  15   ? 62.575  5.879   139.170  1.00 52.20  ?  15   THR A OG1   1 
ATOM   94    C  CG2   . THR A  1  15   ? 61.168  7.034   137.590  1.00 35.62  ?  15   THR A CG2   1 
ATOM   95    N  N     . GLN A  1  16   ? 62.718  2.941   136.436  1.00 60.97  ?  16   GLN A N     1 
ATOM   96    C  CA    . GLN A  1  16   ? 63.826  2.007   136.293  1.00 61.59  ?  16   GLN A CA    1 
ATOM   97    C  C     . GLN A  1  16   ? 64.912  2.661   135.451  1.00 58.99  ?  16   GLN A C     1 
ATOM   98    O  O     . GLN A  1  16   ? 64.739  2.853   134.247  1.00 67.07  ?  16   GLN A O     1 
ATOM   99    C  CB    . GLN A  1  16   ? 63.360  0.718   135.617  1.00 59.49  ?  16   GLN A CB    1 
ATOM   100   C  CG    . GLN A  1  16   ? 62.192  0.037   136.306  1.00 71.34  ?  16   GLN A CG    1 
ATOM   101   C  CD    . GLN A  1  16   ? 61.707  -1.182  135.548  1.00 77.35  ?  16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A  1  16   ? 62.303  -1.582  134.547  1.00 75.13  ?  16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A  1  16   ? 60.618  -1.779  136.020  1.00 77.46  ?  16   GLN A NE2   1 
ATOM   104   N  N     . GLY A  1  17   ? 66.036  2.989   136.082  1.00 58.50  ?  17   GLY A N     1 
ATOM   105   C  CA    . GLY A  1  17   ? 67.132  3.655   135.401  1.00 63.14  ?  17   GLY A CA    1 
ATOM   106   C  C     . GLY A  1  17   ? 66.721  4.973   134.769  1.00 56.35  ?  17   GLY A C     1 
ATOM   107   O  O     . GLY A  1  17   ? 65.766  5.612   135.211  1.00 51.36  ?  17   GLY A O     1 
ATOM   108   N  N     . ARG A  1  18   ? 67.446  5.377   133.730  1.00 57.11  ?  18   ARG A N     1 
ATOM   109   C  CA    . ARG A  1  18   ? 67.127  6.595   132.994  1.00 64.48  ?  18   ARG A CA    1 
ATOM   110   C  C     . ARG A  1  18   ? 66.263  6.274   131.780  1.00 64.21  ?  18   ARG A C     1 
ATOM   111   O  O     . ARG A  1  18   ? 65.831  7.172   131.055  1.00 53.00  ?  18   ARG A O     1 
ATOM   112   C  CB    . ARG A  1  18   ? 68.408  7.287   132.527  1.00 57.45  ?  18   ARG A CB    1 
ATOM   113   C  CG    . ARG A  1  18   ? 69.395  7.604   133.633  1.00 55.22  ?  18   ARG A CG    1 
ATOM   114   C  CD    . ARG A  1  18   ? 70.610  8.326   133.076  1.00 52.60  ?  18   ARG A CD    1 
ATOM   115   N  NE    . ARG A  1  18   ? 70.232  9.508   132.306  1.00 46.69  ?  18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A  1  18   ? 70.043  10.714  132.832  1.00 52.38  ?  18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A  1  18   ? 70.195  10.902  134.136  1.00 56.16  ?  18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A  1  18   ? 69.699  11.732  132.055  1.00 52.28  ?  18   ARG A NH2   1 
ATOM   119   N  N     . GLU A  1  19   ? 66.015  4.986   131.570  1.00 67.94  ?  19   GLU A N     1 
ATOM   120   C  CA    . GLU A  1  19   ? 65.359  4.508   130.359  1.00 66.37  ?  19   GLU A CA    1 
ATOM   121   C  C     . GLU A  1  19   ? 63.835  4.546   130.444  1.00 59.14  ?  19   GLU A C     1 
ATOM   122   O  O     . GLU A  1  19   ? 63.178  5.269   129.697  1.00 57.00  ?  19   GLU A O     1 
ATOM   123   C  CB    . GLU A  1  19   ? 65.819  3.081   130.038  1.00 68.22  ?  19   GLU A CB    1 
ATOM   124   C  CG    . GLU A  1  19   ? 67.325  2.857   130.129  1.00 66.65  ?  19   GLU A CG    1 
ATOM   125   C  CD    . GLU A  1  19   ? 68.079  3.318   128.892  1.00 73.37  ?  19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A  1  19   ? 67.585  4.219   128.181  1.00 68.52  ?  19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A  1  19   ? 69.171  2.771   128.627  1.00 79.54  ?  19   GLU A OE2   1 
ATOM   128   N  N     . TYR A  1  20   ? 63.285  3.757   131.360  1.00 56.85  ?  20   TYR A N     1 
ATOM   129   C  CA    . TYR A  1  20   ? 61.850  3.508   131.411  1.00 46.68  ?  20   TYR A CA    1 
ATOM   130   C  C     . TYR A  1  20   ? 61.193  4.160   132.621  1.00 51.09  ?  20   TYR A C     1 
ATOM   131   O  O     . TYR A  1  20   ? 61.826  4.336   133.660  1.00 61.14  ?  20   TYR A O     1 
ATOM   132   C  CB    . TYR A  1  20   ? 61.600  1.999   131.430  1.00 44.71  ?  20   TYR A CB    1 
ATOM   133   C  CG    . TYR A  1  20   ? 60.157  1.598   131.628  1.00 49.04  ?  20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A  1  20   ? 59.204  1.864   130.655  1.00 49.53  ?  20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A  1  20   ? 59.752  0.936   132.779  1.00 51.95  ?  20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A  1  20   ? 57.885  1.495   130.829  1.00 50.18  ?  20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A  1  20   ? 58.434  0.559   132.960  1.00 52.27  ?  20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A  1  20   ? 57.505  0.840   131.981  1.00 52.97  ?  20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A  1  20   ? 56.191  0.468   132.149  1.00 51.35  ?  20   TYR A OH    1 
ATOM   140   N  N     . GLY A  1  21   ? 59.921  4.524   132.478  1.00 51.27  ?  21   GLY A N     1 
ATOM   141   C  CA    . GLY A  1  21   ? 59.168  5.075   133.588  1.00 47.99  ?  21   GLY A CA    1 
ATOM   142   C  C     . GLY A  1  21   ? 57.667  4.861   133.497  1.00 48.57  ?  21   GLY A C     1 
ATOM   143   O  O     . GLY A  1  21   ? 57.108  4.704   132.411  1.00 49.09  ?  21   GLY A O     1 
ATOM   144   N  N     . GLU A  1  22   ? 57.019  4.863   134.658  1.00 48.31  ?  22   GLU A N     1 
ATOM   145   C  CA    . GLU A  1  22   ? 55.572  4.743   134.766  1.00 37.68  ?  22   GLU A CA    1 
ATOM   146   C  C     . GLU A  1  22   ? 55.050  5.884   135.624  1.00 39.51  ?  22   GLU A C     1 
ATOM   147   O  O     . GLU A  1  22   ? 55.615  6.191   136.674  1.00 50.04  ?  22   GLU A O     1 
ATOM   148   C  CB    . GLU A  1  22   ? 55.178  3.406   135.397  1.00 34.61  ?  22   GLU A CB    1 
ATOM   149   C  CG    . GLU A  1  22   ? 55.732  2.192   134.678  1.00 43.98  ?  22   GLU A CG    1 
ATOM   150   C  CD    . GLU A  1  22   ? 55.125  0.887   135.163  1.00 47.27  ?  22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A  1  22   ? 54.350  0.913   136.142  1.00 46.70  ?  22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A  1  22   ? 55.421  -0.167  134.561  1.00 45.06  ?  22   GLU A OE2   1 
ATOM   153   N  N     . PHE A  1  23   ? 53.974  6.515   135.172  1.00 38.93  ?  23   PHE A N     1 
ATOM   154   C  CA    . PHE A  1  23   ? 53.404  7.650   135.880  1.00 39.48  ?  23   PHE A CA    1 
ATOM   155   C  C     . PHE A  1  23   ? 51.901  7.468   136.025  1.00 38.72  ?  23   PHE A C     1 
ATOM   156   O  O     . PHE A  1  23   ? 51.172  7.451   135.038  1.00 38.80  ?  23   PHE A O     1 
ATOM   157   C  CB    . PHE A  1  23   ? 53.716  8.946   135.129  1.00 36.73  ?  23   PHE A CB    1 
ATOM   158   C  CG    . PHE A  1  23   ? 55.175  9.126   134.817  1.00 41.91  ?  23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A  1  23   ? 56.010  9.790   135.699  1.00 44.54  ?  23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A  1  23   ? 55.714  8.622   133.644  1.00 44.88  ?  23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A  1  23   ? 57.352  9.953   135.416  1.00 43.88  ?  23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A  1  23   ? 57.055  8.780   133.356  1.00 44.92  ?  23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A  1  23   ? 57.875  9.447   134.243  1.00 49.34  ?  23   PHE A CZ    1 
ATOM   164   N  N     . VAL A  1  24   ? 51.438  7.339   137.261  1.00 39.12  ?  24   VAL A N     1 
ATOM   165   C  CA    . VAL A  1  24   ? 50.026  7.089   137.513  1.00 32.41  ?  24   VAL A CA    1 
ATOM   166   C  C     . VAL A  1  24   ? 49.333  8.352   138.011  1.00 33.73  ?  24   VAL A C     1 
ATOM   167   O  O     . VAL A  1  24   ? 49.891  9.108   138.798  1.00 39.58  ?  24   VAL A O     1 
ATOM   168   C  CB    . VAL A  1  24   ? 49.835  5.951   138.536  1.00 31.19  ?  24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A  1  24   ? 48.364  5.583   138.659  1.00 33.99  ?  24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A  1  24   ? 50.655  4.736   138.132  1.00 32.08  ?  24   VAL A CG2   1 
ATOM   171   N  N     . LEU A  1  25   ? 48.120  8.587   137.528  1.00 31.33  ?  25   LEU A N     1 
ATOM   172   C  CA    . LEU A  1  25   ? 47.306  9.690   138.001  1.00 32.86  ?  25   LEU A CA    1 
ATOM   173   C  C     . LEU A  1  25   ? 45.918  9.137   138.302  1.00 42.49  ?  25   LEU A C     1 
ATOM   174   O  O     . LEU A  1  25   ? 45.214  8.678   137.389  1.00 47.19  ?  25   LEU A O     1 
ATOM   175   C  CB    . LEU A  1  25   ? 47.229  10.772  136.925  1.00 28.54  ?  25   LEU A CB    1 
ATOM   176   C  CG    . LEU A  1  25   ? 46.888  12.195  137.363  1.00 39.06  ?  25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A  1  25   ? 47.948  12.722  138.316  1.00 40.08  ?  25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A  1  25   ? 46.750  13.106  136.152  1.00 30.93  ?  25   LEU A CD2   1 
ATOM   179   N  N     . GLU A  1  26   ? 45.540  9.140   139.580  1.00 46.72  ?  26   GLU A N     1 
ATOM   180   C  CA    . GLU A  1  26   ? 44.213  8.647   139.967  1.00 43.10  ?  26   GLU A CA    1 
ATOM   181   C  C     . GLU A  1  26   ? 43.653  9.333   141.212  1.00 43.34  ?  26   GLU A C     1 
ATOM   182   O  O     . GLU A  1  26   ? 44.412  9.778   142.059  1.00 44.40  ?  26   GLU A O     1 
ATOM   183   C  CB    . GLU A  1  26   ? 44.243  7.132   140.180  1.00 39.10  ?  26   GLU A CB    1 
ATOM   184   C  CG    . GLU A  1  26   ? 45.128  6.681   141.328  1.00 39.05  ?  26   GLU A CG    1 
ATOM   185   C  CD    . GLU A  1  26   ? 44.936  5.216   141.663  1.00 50.17  ?  26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A  1  26   ? 43.814  4.703   141.465  1.00 48.78  ?  26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A  1  26   ? 45.908  4.578   142.119  1.00 57.55  ?  26   GLU A OE2   1 
ATOM   188   N  N     . PRO A  1  27   ? 42.319  9.407   141.339  1.00 42.44  ?  27   PRO A N     1 
ATOM   189   C  CA    . PRO A  1  27   ? 41.300  9.103   140.333  1.00 39.13  ?  27   PRO A CA    1 
ATOM   190   C  C     . PRO A  1  27   ? 41.099  10.275  139.381  1.00 38.56  ?  27   PRO A C     1 
ATOM   191   O  O     . PRO A  1  27   ? 41.339  11.423  139.758  1.00 38.06  ?  27   PRO A O     1 
ATOM   192   C  CB    . PRO A  1  27   ? 40.044  8.893   141.175  1.00 41.46  ?  27   PRO A CB    1 
ATOM   193   C  CG    . PRO A  1  27   ? 40.233  9.805   142.328  1.00 44.67  ?  27   PRO A CG    1 
ATOM   194   C  CD    . PRO A  1  27   ? 41.712  9.794   142.625  1.00 48.32  ?  27   PRO A CD    1 
ATOM   195   N  N     . LEU A  1  28   ? 40.658  9.986   138.163  1.00 34.28  ?  28   LEU A N     1 
ATOM   196   C  CA    . LEU A  1  28   ? 40.280  11.030  137.222  1.00 29.20  ?  28   LEU A CA    1 
ATOM   197   C  C     . LEU A  1  28   ? 38.826  10.838  136.813  1.00 30.73  ?  28   LEU A C     1 
ATOM   198   O  O     . LEU A  1  28   ? 38.293  9.732   136.898  1.00 29.75  ?  28   LEU A O     1 
ATOM   199   C  CB    . LEU A  1  28   ? 41.193  11.005  135.996  1.00 33.56  ?  28   LEU A CB    1 
ATOM   200   C  CG    . LEU A  1  28   ? 42.654  11.391  136.242  1.00 34.21  ?  28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A  1  28   ? 43.492  11.154  134.996  1.00 33.91  ?  28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A  1  28   ? 42.754  12.841  136.686  1.00 32.33  ?  28   LEU A CD2   1 
ATOM   203   N  N     . GLU A  1  29   ? 38.185  11.914  136.372  1.00 30.87  ?  29   GLU A N     1 
ATOM   204   C  CA    . GLU A  1  29   ? 36.792  11.846  135.953  1.00 31.07  ?  29   GLU A CA    1 
ATOM   205   C  C     . GLU A  1  29   ? 36.664  10.968  134.716  1.00 36.68  ?  29   GLU A C     1 
ATOM   206   O  O     . GLU A  1  29   ? 37.643  10.745  134.003  1.00 41.76  ?  29   GLU A O     1 
ATOM   207   C  CB    . GLU A  1  29   ? 36.247  13.246  135.660  1.00 39.99  ?  29   GLU A CB    1 
ATOM   208   C  CG    . GLU A  1  29   ? 36.021  14.109  136.893  1.00 52.86  ?  29   GLU A CG    1 
ATOM   209   C  CD    . GLU A  1  29   ? 34.728  13.775  137.616  1.00 65.65  ?  29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A  1  29   ? 33.995  12.876  137.151  1.00 68.86  ?  29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A  1  29   ? 34.442  14.417  138.650  1.00 67.03  ?  29   GLU A OE2   1 
ATOM   212   N  N     . ARG A  1  30   ? 35.459  10.462  134.475  1.00 38.73  ?  30   ARG A N     1 
ATOM   213   C  CA    . ARG A  1  30   ? 35.207  9.583   133.339  1.00 37.86  ?  30   ARG A CA    1 
ATOM   214   C  C     . ARG A  1  30   ? 35.590  10.244  132.018  1.00 36.11  ?  30   ARG A C     1 
ATOM   215   O  O     . ARG A  1  30   ? 35.149  11.354  131.715  1.00 35.13  ?  30   ARG A O     1 
ATOM   216   C  CB    . ARG A  1  30   ? 33.735  9.162   133.309  1.00 44.26  ?  30   ARG A CB    1 
ATOM   217   C  CG    . ARG A  1  30   ? 33.373  8.234   132.160  1.00 52.92  ?  30   ARG A CG    1 
ATOM   218   C  CD    . ARG A  1  30   ? 31.915  7.803   132.237  1.00 57.88  ?  30   ARG A CD    1 
ATOM   219   N  NE    . ARG A  1  30   ? 30.996  8.928   132.093  1.00 66.32  ?  30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A  1  30   ? 30.384  9.252   130.958  1.00 69.36  ?  30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A  1  30   ? 30.589  8.532   129.863  1.00 59.83  ?  30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A  1  30   ? 29.563  10.293  130.919  1.00 61.99  ?  30   ARG A NH2   1 
ATOM   223   N  N     . GLY A  1  31   ? 36.421  9.556   131.241  1.00 29.42  ?  31   GLY A N     1 
ATOM   224   C  CA    . GLY A  1  31   ? 36.828  10.042  129.936  1.00 33.64  ?  31   GLY A CA    1 
ATOM   225   C  C     . GLY A  1  31   ? 38.100  10.869  129.943  1.00 32.28  ?  31   GLY A C     1 
ATOM   226   O  O     . GLY A  1  31   ? 38.592  11.261  128.886  1.00 33.19  ?  31   GLY A O     1 
ATOM   227   N  N     . PHE A  1  32   ? 38.636  11.140  131.128  1.00 33.60  ?  32   PHE A N     1 
ATOM   228   C  CA    . PHE A  1  32   ? 39.842  11.959  131.239  1.00 29.62  ?  32   PHE A CA    1 
ATOM   229   C  C     . PHE A  1  32   ? 41.130  11.157  131.107  1.00 29.36  ?  32   PHE A C     1 
ATOM   230   O  O     . PHE A  1  32   ? 42.208  11.730  130.940  1.00 30.35  ?  32   PHE A O     1 
ATOM   231   C  CB    . PHE A  1  32   ? 39.842  12.763  132.537  1.00 30.02  ?  32   PHE A CB    1 
ATOM   232   C  CG    . PHE A  1  32   ? 39.189  14.104  132.408  1.00 29.71  ?  32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A  1  32   ? 37.823  14.240  132.571  1.00 30.98  ?  32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A  1  32   ? 39.941  15.229  132.109  1.00 29.03  ?  32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A  1  32   ? 37.218  15.473  132.447  1.00 34.16  ?  32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A  1  32   ? 39.341  16.466  131.983  1.00 31.20  ?  32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A  1  32   ? 37.977  16.589  132.152  1.00 31.46  ?  32   PHE A CZ    1 
ATOM   238   N  N     . GLY A  1  33   ? 41.012  9.836   131.182  1.00 30.28  ?  33   GLY A N     1 
ATOM   239   C  CA    . GLY A  1  33   ? 42.149  8.964   130.954  1.00 30.43  ?  33   GLY A CA    1 
ATOM   240   C  C     . GLY A  1  33   ? 42.684  9.184   129.554  1.00 35.18  ?  33   GLY A C     1 
ATOM   241   O  O     . GLY A  1  33   ? 43.889  9.310   129.344  1.00 38.26  ?  33   GLY A O     1 
ATOM   242   N  N     . VAL A  1  34   ? 41.771  9.244   128.591  1.00 32.09  ?  34   VAL A N     1 
ATOM   243   C  CA    . VAL A  1  34   ? 42.128  9.510   127.204  1.00 30.18  ?  34   VAL A CA    1 
ATOM   244   C  C     . VAL A  1  34   ? 42.452  10.989  127.008  1.00 33.53  ?  34   VAL A C     1 
ATOM   245   O  O     . VAL A  1  34   ? 43.455  11.335  126.376  1.00 43.35  ?  34   VAL A O     1 
ATOM   246   C  CB    . VAL A  1  34   ? 40.993  9.096   126.248  1.00 23.89  ?  34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A  1  34   ? 41.284  9.560   124.830  1.00 26.20  ?  34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A  1  34   ? 40.788  7.589   126.290  1.00 25.80  ?  34   VAL A CG2   1 
ATOM   249   N  N     . THR A  1  35   ? 41.601  11.848  127.566  1.00 30.44  ?  35   THR A N     1 
ATOM   250   C  CA    . THR A  1  35   ? 41.733  13.298  127.429  1.00 30.67  ?  35   THR A CA    1 
ATOM   251   C  C     . THR A  1  35   ? 43.118  13.802  127.821  1.00 33.70  ?  35   THR A C     1 
ATOM   252   O  O     . THR A  1  35   ? 43.710  14.614  127.113  1.00 29.91  ?  35   THR A O     1 
ATOM   253   C  CB    . THR A  1  35   ? 40.677  14.049  128.264  1.00 27.24  ?  35   THR A CB    1 
ATOM   254   O  OG1   . THR A  1  35   ? 39.366  13.610  127.890  1.00 31.16  ?  35   THR A OG1   1 
ATOM   255   C  CG2   . THR A  1  35   ? 40.787  15.551  128.040  1.00 22.15  ?  35   THR A CG2   1 
ATOM   256   N  N     . LEU A  1  36   ? 43.622  13.343  128.961  1.00 36.17  ?  36   LEU A N     1 
ATOM   257   C  CA    . LEU A  1  36   ? 44.989  13.666  129.356  1.00 34.74  ?  36   LEU A CA    1 
ATOM   258   C  C     . LEU A  1  36   ? 46.017  12.752  128.693  1.00 36.90  ?  36   LEU A C     1 
ATOM   259   O  O     . LEU A  1  36   ? 47.054  13.214  128.217  1.00 34.41  ?  36   LEU A O     1 
ATOM   260   C  CB    . LEU A  1  36   ? 45.140  13.622  130.878  1.00 31.39  ?  36   LEU A CB    1 
ATOM   261   C  CG    . LEU A  1  36   ? 44.574  14.828  131.629  1.00 33.33  ?  36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A  1  36   ? 44.783  14.672  133.125  1.00 49.66  ?  36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A  1  36   ? 45.218  16.109  131.128  1.00 34.12  ?  36   LEU A CD2   1 
ATOM   264   N  N     . GLY A  1  37   ? 45.714  11.458  128.655  1.00 31.49  ?  37   GLY A N     1 
ATOM   265   C  CA    . GLY A  1  37   ? 46.670  10.454  128.223  1.00 36.47  ?  37   GLY A CA    1 
ATOM   266   C  C     . GLY A  1  37   ? 47.172  10.585  126.797  1.00 39.19  ?  37   GLY A C     1 
ATOM   267   O  O     . GLY A  1  37   ? 48.378  10.630  126.556  1.00 33.89  ?  37   GLY A O     1 
ATOM   268   N  N     . ASN A  1  38   ? 46.247  10.646  125.846  1.00 38.69  ?  38   ASN A N     1 
ATOM   269   C  CA    . ASN A  1  38   ? 46.620  10.665  124.433  1.00 39.92  ?  38   ASN A CA    1 
ATOM   270   C  C     . ASN A  1  38   ? 47.421  11.884  123.938  1.00 35.29  ?  38   ASN A C     1 
ATOM   271   O  O     . ASN A  1  38   ? 48.402  11.712  123.213  1.00 37.56  ?  38   ASN A O     1 
ATOM   272   C  CB    . ASN A  1  38   ? 45.400  10.415  123.541  1.00 39.31  ?  38   ASN A CB    1 
ATOM   273   C  CG    . ASN A  1  38   ? 45.782  10.140  122.101  1.00 34.42  ?  38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A  1  38   ? 46.220  9.039   121.763  1.00 26.29  ?  38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A  1  38   ? 45.613  11.138  121.241  1.00 32.58  ?  38   ASN A ND2   1 
ATOM   276   N  N     . PRO A  1  39   ? 47.010  13.112  124.311  1.00 31.57  ?  39   PRO A N     1 
ATOM   277   C  CA    . PRO A  1  39   ? 47.766  14.275  123.829  1.00 29.67  ?  39   PRO A CA    1 
ATOM   278   C  C     . PRO A  1  39   ? 49.195  14.288  124.344  1.00 30.09  ?  39   PRO A C     1 
ATOM   279   O  O     . PRO A  1  39   ? 50.087  14.759  123.642  1.00 34.41  ?  39   PRO A O     1 
ATOM   280   C  CB    . PRO A  1  39   ? 46.999  15.462  124.416  1.00 25.88  ?  39   PRO A CB    1 
ATOM   281   C  CG    . PRO A  1  39   ? 45.645  14.949  124.649  1.00 34.90  ?  39   PRO A CG    1 
ATOM   282   C  CD    . PRO A  1  39   ? 45.810  13.526  125.056  1.00 38.41  ?  39   PRO A CD    1 
ATOM   283   N  N     . LEU A  1  40   ? 49.408  13.784  125.555  1.00 31.07  ?  40   LEU A N     1 
ATOM   284   C  CA    . LEU A  1  40   ? 50.757  13.687  126.092  1.00 30.31  ?  40   LEU A CA    1 
ATOM   285   C  C     . LEU A  1  40   ? 51.578  12.717  125.254  1.00 32.33  ?  40   LEU A C     1 
ATOM   286   O  O     . LEU A  1  40   ? 52.756  12.951  125.005  1.00 33.11  ?  40   LEU A O     1 
ATOM   287   C  CB    . LEU A  1  40   ? 50.739  13.257  127.560  1.00 31.52  ?  40   LEU A CB    1 
ATOM   288   C  CG    . LEU A  1  40   ? 50.132  14.269  128.535  1.00 32.85  ?  40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A  1  40   ? 50.371  13.839  129.972  1.00 39.95  ?  40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A  1  40   ? 50.685  15.665  128.287  1.00 30.61  ?  40   LEU A CD2   1 
ATOM   291   N  N     . ARG A  1  41   ? 50.944  11.637  124.805  1.00 32.06  ?  41   ARG A N     1 
ATOM   292   C  CA    . ARG A  1  41   ? 51.611  10.676  123.935  1.00 29.42  ?  41   ARG A CA    1 
ATOM   293   C  C     . ARG A  1  41   ? 52.001  11.311  122.605  1.00 30.22  ?  41   ARG A C     1 
ATOM   294   O  O     . ARG A  1  41   ? 53.100  11.084  122.098  1.00 40.22  ?  41   ARG A O     1 
ATOM   295   C  CB    . ARG A  1  41   ? 50.725  9.455   123.687  1.00 30.34  ?  41   ARG A CB    1 
ATOM   296   C  CG    . ARG A  1  41   ? 51.316  8.469   122.689  1.00 28.11  ?  41   ARG A CG    1 
ATOM   297   C  CD    . ARG A  1  41   ? 50.470  7.214   122.561  1.00 33.50  ?  41   ARG A CD    1 
ATOM   298   N  NE    . ARG A  1  41   ? 51.119  6.210   121.721  1.00 35.18  ?  41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A  1  41   ? 50.955  6.114   120.406  1.00 31.69  ?  41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A  1  41   ? 50.157  6.961   119.770  1.00 33.99  ?  41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A  1  41   ? 51.589  5.168   119.726  1.00 24.96  ?  41   ARG A NH2   1 
ATOM   302   N  N     . ARG A  1  42   ? 51.098  12.108  122.044  1.00 23.14  ?  42   ARG A N     1 
ATOM   303   C  CA    . ARG A  1  42   ? 51.343  12.748  120.756  1.00 28.58  ?  42   ARG A CA    1 
ATOM   304   C  C     . ARG A  1  42   ? 52.514  13.723  120.814  1.00 29.22  ?  42   ARG A C     1 
ATOM   305   O  O     . ARG A  1  42   ? 53.280  13.845  119.857  1.00 33.06  ?  42   ARG A O     1 
ATOM   306   C  CB    . ARG A  1  42   ? 50.083  13.455  120.254  1.00 26.03  ?  42   ARG A CB    1 
ATOM   307   C  CG    . ARG A  1  42   ? 48.952  12.508  119.899  1.00 26.17  ?  42   ARG A CG    1 
ATOM   308   C  CD    . ARG A  1  42   ? 47.772  13.250  119.295  1.00 30.61  ?  42   ARG A CD    1 
ATOM   309   N  NE    . ARG A  1  42   ? 48.155  14.018  118.115  1.00 31.10  ?  42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A  1  42   ? 48.293  13.502  116.898  1.00 30.38  ?  42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A  1  42   ? 48.084  12.208  116.696  1.00 32.53  ?  42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A  1  42   ? 48.643  14.279  115.883  1.00 29.17  ?  42   ARG A NH2   1 
ATOM   313   N  N     . ILE A  1  43   ? 52.652  14.413  121.940  1.00 29.23  ?  43   ILE A N     1 
ATOM   314   C  CA    . ILE A  1  43   ? 53.739  15.367  122.119  1.00 33.99  ?  43   ILE A CA    1 
ATOM   315   C  C     . ILE A  1  43   ? 55.046  14.642  122.425  1.00 33.02  ?  43   ILE A C     1 
ATOM   316   O  O     . ILE A  1  43   ? 56.108  15.018  121.926  1.00 36.87  ?  43   ILE A O     1 
ATOM   317   C  CB    . ILE A  1  43   ? 53.425  16.378  123.242  1.00 31.83  ?  43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A  1  43   ? 52.108  17.100  122.951  1.00 27.55  ?  43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A  1  43   ? 54.556  17.385  123.394  1.00 32.58  ?  43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A  1  43   ? 51.695  18.071  124.028  1.00 30.29  ?  43   ILE A CD1   1 
ATOM   321   N  N     . LEU A  1  44   ? 54.958  13.593  123.235  1.00 26.80  ?  44   LEU A N     1 
ATOM   322   C  CA    . LEU A  1  44   ? 56.133  12.818  123.619  1.00 33.30  ?  44   LEU A CA    1 
ATOM   323   C  C     . LEU A  1  44   ? 56.772  12.100  122.433  1.00 37.55  ?  44   LEU A C     1 
ATOM   324   O  O     . LEU A  1  44   ? 57.976  11.847  122.427  1.00 46.03  ?  44   LEU A O     1 
ATOM   325   C  CB    . LEU A  1  44   ? 55.777  11.810  124.714  1.00 38.65  ?  44   LEU A CB    1 
ATOM   326   C  CG    . LEU A  1  44   ? 55.566  12.372  126.120  1.00 31.24  ?  44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A  1  44   ? 54.835  11.358  126.982  1.00 30.50  ?  44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A  1  44   ? 56.890  12.764  126.750  1.00 32.13  ?  44   LEU A CD2   1 
ATOM   329   N  N     . LEU A  1  45   ? 55.964  11.773  121.431  1.00 34.95  ?  45   LEU A N     1 
ATOM   330   C  CA    . LEU A  1  45   ? 56.462  11.057  120.262  1.00 32.65  ?  45   LEU A CA    1 
ATOM   331   C  C     . LEU A  1  45   ? 56.979  11.991  119.171  1.00 29.56  ?  45   LEU A C     1 
ATOM   332   O  O     . LEU A  1  45   ? 57.592  11.544  118.203  1.00 34.32  ?  45   LEU A O     1 
ATOM   333   C  CB    . LEU A  1  45   ? 55.377  10.138  119.698  1.00 27.07  ?  45   LEU A CB    1 
ATOM   334   C  CG    . LEU A  1  45   ? 55.095  8.875   120.511  1.00 25.38  ?  45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A  1  45   ? 53.970  8.073   119.880  1.00 25.39  ?  45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A  1  45   ? 56.356  8.034   120.635  1.00 24.52  ?  45   LEU A CD2   1 
ATOM   337   N  N     . SER A  1  46   ? 56.743  13.288  119.332  1.00 29.62  ?  46   SER A N     1 
ATOM   338   C  CA    . SER A  1  46   ? 57.079  14.243  118.284  1.00 35.11  ?  46   SER A CA    1 
ATOM   339   C  C     . SER A  1  46   ? 57.968  15.398  118.742  1.00 45.63  ?  46   SER A C     1 
ATOM   340   O  O     . SER A  1  46   ? 59.110  15.528  118.298  1.00 47.57  ?  46   SER A O     1 
ATOM   341   C  CB    . SER A  1  46   ? 55.802  14.792  117.642  1.00 36.84  ?  46   SER A CB    1 
ATOM   342   O  OG    . SER A  1  46   ? 54.956  15.384  118.613  1.00 35.43  ?  46   SER A OG    1 
ATOM   343   N  N     . SER A  1  47   ? 57.438  16.229  119.634  1.00 44.11  ?  47   SER A N     1 
ATOM   344   C  CA    . SER A  1  47   ? 58.035  17.531  119.925  1.00 40.84  ?  47   SER A CA    1 
ATOM   345   C  C     . SER A  1  47   ? 59.092  17.542  121.030  1.00 36.17  ?  47   SER A C     1 
ATOM   346   O  O     . SER A  1  47   ? 59.596  18.604  121.392  1.00 32.50  ?  47   SER A O     1 
ATOM   347   C  CB    . SER A  1  47   ? 56.939  18.548  120.248  1.00 40.55  ?  47   SER A CB    1 
ATOM   348   O  OG    . SER A  1  47   ? 56.020  18.651  119.176  1.00 45.70  ?  47   SER A OG    1 
ATOM   349   N  N     . ILE A  1  48   ? 59.424  16.373  121.567  1.00 37.34  ?  48   ILE A N     1 
ATOM   350   C  CA    . ILE A  1  48   ? 60.448  16.295  122.604  1.00 42.38  ?  48   ILE A CA    1 
ATOM   351   C  C     . ILE A  1  48   ? 61.852  16.443  122.020  1.00 47.93  ?  48   ILE A C     1 
ATOM   352   O  O     . ILE A  1  48   ? 62.277  15.631  121.198  1.00 50.70  ?  48   ILE A O     1 
ATOM   353   C  CB    . ILE A  1  48   ? 60.356  14.984  123.404  1.00 43.39  ?  48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A  1  48   ? 59.021  14.915  124.144  1.00 40.26  ?  48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A  1  48   ? 61.499  14.888  124.397  1.00 42.47  ?  48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A  1  48   ? 58.765  16.104  125.043  1.00 40.18  ?  48   ILE A CD1   1 
ATOM   357   N  N     . PRO A  1  49   ? 62.574  17.494  122.446  1.00 48.87  ?  49   PRO A N     1 
ATOM   358   C  CA    . PRO A  1  49   ? 63.931  17.789  121.974  1.00 45.04  ?  49   PRO A CA    1 
ATOM   359   C  C     . PRO A  1  49   ? 64.928  16.712  122.388  1.00 48.62  ?  49   PRO A C     1 
ATOM   360   O  O     . PRO A  1  49   ? 64.695  15.998  123.364  1.00 45.30  ?  49   PRO A O     1 
ATOM   361   C  CB    . PRO A  1  49   ? 64.269  19.108  122.680  1.00 35.69  ?  49   PRO A CB    1 
ATOM   362   C  CG    . PRO A  1  49   ? 62.951  19.692  123.066  1.00 39.40  ?  49   PRO A CG    1 
ATOM   363   C  CD    . PRO A  1  49   ? 62.089  18.517  123.387  1.00 47.59  ?  49   PRO A CD    1 
ATOM   364   N  N     . GLY A  1  50   ? 66.028  16.606  121.651  1.00 52.39  ?  50   GLY A N     1 
ATOM   365   C  CA    . GLY A  1  50   ? 67.049  15.614  121.930  1.00 46.61  ?  50   GLY A CA    1 
ATOM   366   C  C     . GLY A  1  50   ? 68.297  15.835  121.098  1.00 51.46  ?  50   GLY A C     1 
ATOM   367   O  O     . GLY A  1  50   ? 68.482  16.901  120.510  1.00 50.83  ?  50   GLY A O     1 
ATOM   368   N  N     . THR A  1  51   ? 69.158  14.825  121.049  1.00 54.24  ?  51   THR A N     1 
ATOM   369   C  CA    . THR A  1  51   ? 70.401  14.923  120.292  1.00 53.76  ?  51   THR A CA    1 
ATOM   370   C  C     . THR A  1  51   ? 70.547  13.782  119.291  1.00 50.96  ?  51   THR A C     1 
ATOM   371   O  O     . THR A  1  51   ? 70.068  12.671  119.522  1.00 50.73  ?  51   THR A O     1 
ATOM   372   C  CB    . THR A  1  51   ? 71.628  14.934  121.221  1.00 56.05  ?  51   THR A CB    1 
ATOM   373   O  OG1   . THR A  1  51   ? 71.612  13.764  122.048  1.00 54.71  ?  51   THR A OG1   1 
ATOM   374   C  CG2   . THR A  1  51   ? 71.620  16.175  122.102  1.00 52.47  ?  51   THR A CG2   1 
ATOM   375   N  N     . ALA A  1  52   ? 71.215  14.070  118.179  1.00 54.40  ?  52   ALA A N     1 
ATOM   376   C  CA    . ALA A  1  52   ? 71.460  13.076  117.141  1.00 55.81  ?  52   ALA A CA    1 
ATOM   377   C  C     . ALA A  1  52   ? 72.681  13.473  116.321  1.00 49.90  ?  52   ALA A C     1 
ATOM   378   O  O     . ALA A  1  52   ? 73.087  14.636  116.329  1.00 44.68  ?  52   ALA A O     1 
ATOM   379   C  CB    . ALA A  1  52   ? 70.244  12.937  116.243  1.00 52.32  ?  52   ALA A CB    1 
ATOM   380   N  N     . VAL A  1  53   ? 73.257  12.514  115.603  1.00 46.04  ?  53   VAL A N     1 
ATOM   381   C  CA    . VAL A  1  53   ? 74.421  12.806  114.782  1.00 44.08  ?  53   VAL A CA    1 
ATOM   382   C  C     . VAL A  1  53   ? 73.950  13.475  113.502  1.00 43.53  ?  53   VAL A C     1 
ATOM   383   O  O     . VAL A  1  53   ? 73.250  12.861  112.698  1.00 45.46  ?  53   VAL A O     1 
ATOM   384   C  CB    . VAL A  1  53   ? 75.161  11.512  114.403  1.00 37.39  ?  53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A  1  53   ? 76.326  11.817  113.479  1.00 40.85  ?  53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A  1  53   ? 75.631  10.779  115.649  1.00 41.59  ?  53   VAL A CG2   1 
ATOM   387   N  N     . THR A  1  54   ? 74.336  14.733  113.311  1.00 42.36  ?  54   THR A N     1 
ATOM   388   C  CA    . THR A  1  54   ? 73.936  15.470  112.116  1.00 46.25  ?  54   THR A CA    1 
ATOM   389   C  C     . THR A  1  54   ? 74.973  15.448  110.996  1.00 51.27  ?  54   THR A C     1 
ATOM   390   O  O     . THR A  1  54   ? 74.675  15.843  109.867  1.00 51.19  ?  54   THR A O     1 
ATOM   391   C  CB    . THR A  1  54   ? 73.569  16.932  112.442  1.00 49.08  ?  54   THR A CB    1 
ATOM   392   O  OG1   . THR A  1  54   ? 74.679  17.579  113.076  1.00 55.15  ?  54   THR A OG1   1 
ATOM   393   C  CG2   . THR A  1  54   ? 72.359  16.984  113.363  1.00 50.53  ?  54   THR A CG2   1 
ATOM   394   N  N     . SER A  1  55   ? 76.185  14.988  111.298  1.00 52.23  ?  55   SER A N     1 
ATOM   395   C  CA    . SER A  1  55   ? 77.221  14.915  110.265  1.00 51.21  ?  55   SER A CA    1 
ATOM   396   C  C     . SER A  1  55   ? 78.294  13.871  110.562  1.00 47.97  ?  55   SER A C     1 
ATOM   397   O  O     . SER A  1  55   ? 78.524  13.517  111.715  1.00 58.61  ?  55   SER A O     1 
ATOM   398   C  CB    . SER A  1  55   ? 77.862  16.288  110.046  1.00 47.19  ?  55   SER A CB    1 
ATOM   399   O  OG    . SER A  1  55   ? 78.710  16.277  108.911  1.00 50.75  ?  55   SER A OG    1 
ATOM   400   N  N     . VAL A  1  56   ? 78.939  13.372  109.511  1.00 41.42  ?  56   VAL A N     1 
ATOM   401   C  CA    . VAL A  1  56   ? 80.036  12.419  109.659  1.00 44.61  ?  56   VAL A CA    1 
ATOM   402   C  C     . VAL A  1  56   ? 81.159  12.705  108.666  1.00 48.71  ?  56   VAL A C     1 
ATOM   403   O  O     . VAL A  1  56   ? 80.919  12.816  107.465  1.00 49.33  ?  56   VAL A O     1 
ATOM   404   C  CB    . VAL A  1  56   ? 79.561  10.961  109.455  1.00 48.23  ?  56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A  1  56   ? 80.751  10.021  109.325  1.00 47.49  ?  56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A  1  56   ? 78.661  10.522  110.596  1.00 45.32  ?  56   VAL A CG2   1 
ATOM   407   N  N     . TYR A  1  57   ? 82.383  12.820  109.171  1.00 58.14  ?  57   TYR A N     1 
ATOM   408   C  CA    . TYR A  1  57   ? 83.555  12.920  108.308  1.00 62.48  ?  57   TYR A CA    1 
ATOM   409   C  C     . TYR A  1  57   ? 84.532  11.784  108.590  1.00 59.50  ?  57   TYR A C     1 
ATOM   410   O  O     . TYR A  1  57   ? 84.793  11.453  109.744  1.00 62.02  ?  57   TYR A O     1 
ATOM   411   C  CB    . TYR A  1  57   ? 84.257  14.268  108.478  1.00 57.02  ?  57   TYR A CB    1 
ATOM   412   C  CG    . TYR A  1  57   ? 85.584  14.343  107.753  1.00 67.47  ?  57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A  1  57   ? 85.637  14.531  106.377  1.00 73.27  ?  57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A  1  57   ? 86.784  14.218  108.443  1.00 70.74  ?  57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A  1  57   ? 86.847  14.595  105.710  1.00 72.64  ?  57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A  1  57   ? 87.999  14.281  107.784  1.00 74.64  ?  57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A  1  57   ? 88.025  14.470  106.417  1.00 76.70  ?  57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A  1  57   ? 89.231  14.534  105.757  1.00 74.04  ?  57   TYR A OH    1 
ATOM   419   N  N     . ILE A  1  58   ? 85.066  11.184  107.531  1.00 55.40  ?  58   ILE A N     1 
ATOM   420   C  CA    . ILE A  1  58   ? 86.053  10.119  107.668  1.00 54.99  ?  58   ILE A CA    1 
ATOM   421   C  C     . ILE A  1  58   ? 87.252  10.407  106.772  1.00 60.54  ?  58   ILE A C     1 
ATOM   422   O  O     . ILE A  1  58   ? 87.087  10.765  105.606  1.00 69.61  ?  58   ILE A O     1 
ATOM   423   C  CB    . ILE A  1  58   ? 85.463  8.743   107.297  1.00 45.91  ?  58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A  1  58   ? 84.179  8.476   108.085  1.00 43.49  ?  58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A  1  58   ? 86.479  7.640   107.550  1.00 48.23  ?  58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A  1  58   ? 83.512  7.167   107.739  1.00 46.01  ?  58   ILE A CD1   1 
ATOM   427   N  N     . GLU A  1  59   ? 88.454  10.260  107.321  1.00 61.53  ?  59   GLU A N     1 
ATOM   428   C  CA    . GLU A  1  59   ? 89.675  10.479  106.553  1.00 66.02  ?  59   GLU A CA    1 
ATOM   429   C  C     . GLU A  1  59   ? 89.747  9.506   105.382  1.00 65.78  ?  59   GLU A C     1 
ATOM   430   O  O     . GLU A  1  59   ? 89.378  8.337   105.516  1.00 65.41  ?  59   GLU A O     1 
ATOM   431   C  CB    . GLU A  1  59   ? 90.911  10.325  107.444  1.00 75.60  ?  59   GLU A CB    1 
ATOM   432   C  CG    . GLU A  1  59   ? 92.229  10.587  106.727  1.00 78.23  ?  59   GLU A CG    1 
ATOM   433   C  CD    . GLU A  1  59   ? 93.440  10.312  107.600  1.00 84.00  ?  59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A  1  59   ? 93.269  10.145  108.826  1.00 82.60  ?  59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A  1  59   ? 94.565  10.261  107.056  1.00 80.72  ?  59   GLU A OE2   1 
ATOM   436   N  N     . ASP A  1  60   ? 90.213  10.004  104.239  1.00 61.32  ?  60   ASP A N     1 
ATOM   437   C  CA    . ASP A  1  60   ? 90.333  9.212   103.015  1.00 69.58  ?  60   ASP A CA    1 
ATOM   438   C  C     . ASP A  1  60   ? 88.987  8.672   102.531  1.00 68.50  ?  60   ASP A C     1 
ATOM   439   O  O     . ASP A  1  60   ? 88.921  7.616   101.900  1.00 71.54  ?  60   ASP A O     1 
ATOM   440   C  CB    . ASP A  1  60   ? 91.346  8.072   103.188  1.00 76.51  ?  60   ASP A CB    1 
ATOM   441   C  CG    . ASP A  1  60   ? 92.746  8.575   103.488  1.00 80.33  ?  60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A  1  60   ? 93.074  9.708   103.077  1.00 74.42  ?  60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A  1  60   ? 93.520  7.836   104.134  1.00 76.15  ?  60   ASP A OD2   1 
ATOM   444   N  N     . VAL A  1  61   ? 87.917  9.401   102.833  1.00 65.71  ?  61   VAL A N     1 
ATOM   445   C  CA    . VAL A  1  61   ? 86.584  9.045   102.357  1.00 57.27  ?  61   VAL A CA    1 
ATOM   446   C  C     . VAL A  1  61   ? 85.905  10.257  101.730  1.00 57.18  ?  61   VAL A C     1 
ATOM   447   O  O     . VAL A  1  61   ? 85.633  11.254  102.402  1.00 50.07  ?  61   VAL A O     1 
ATOM   448   C  CB    . VAL A  1  61   ? 85.699  8.484   103.488  1.00 55.87  ?  61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A  1  61   ? 84.248  8.409   103.041  1.00 50.58  ?  61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A  1  61   ? 86.200  7.115   103.924  1.00 57.97  ?  61   VAL A CG2   1 
ATOM   451   N  N     . LEU A  1  62   ? 85.641  10.163  100.432  1.00 58.43  ?  62   LEU A N     1 
ATOM   452   C  CA    . LEU A  1  62   ? 85.061  11.269  99.683   1.00 58.54  ?  62   LEU A CA    1 
ATOM   453   C  C     . LEU A  1  62   ? 83.546  11.375  99.846   1.00 57.18  ?  62   LEU A C     1 
ATOM   454   O  O     . LEU A  1  62   ? 83.006  12.473  99.982   1.00 58.50  ?  62   LEU A O     1 
ATOM   455   C  CB    . LEU A  1  62   ? 85.441  11.160  98.205   1.00 58.75  ?  62   LEU A CB    1 
ATOM   456   C  CG    . LEU A  1  62   ? 86.946  11.241  97.943   1.00 51.80  ?  62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A  1  62   ? 87.258  11.025  96.474   1.00 50.09  ?  62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A  1  62   ? 87.494  12.578  98.421   1.00 51.19  ?  62   LEU A CD2   1 
ATOM   459   N  N     . HIS A  1  63   ? 82.862  10.234  99.831   1.00 49.22  ?  63   HIS A N     1 
ATOM   460   C  CA    . HIS A  1  63   ? 81.405  10.225  99.937   1.00 49.91  ?  63   HIS A CA    1 
ATOM   461   C  C     . HIS A  1  63   ? 80.861  8.977   100.633  1.00 51.11  ?  63   HIS A C     1 
ATOM   462   O  O     . HIS A  1  63   ? 81.618  8.086   101.020  1.00 52.17  ?  63   HIS A O     1 
ATOM   463   C  CB    . HIS A  1  63   ? 80.764  10.399  98.556   1.00 52.59  ?  63   HIS A CB    1 
ATOM   464   C  CG    . HIS A  1  63   ? 81.334  9.497   97.503   1.00 51.06  ?  63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A  1  63   ? 81.164  8.129   97.525   1.00 48.39  ?  63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A  1  63   ? 82.069  9.771   96.402   1.00 45.43  ?  63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A  1  63   ? 81.773  7.599   96.478   1.00 50.38  ?  63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A  1  63   ? 82.330  8.570   95.781   1.00 51.89  ?  63   HIS A NE2   1 
ATOM   469   N  N     . GLU A  1  64   ? 79.539  8.923   100.777  1.00 43.56  ?  64   GLU A N     1 
ATOM   470   C  CA    . GLU A  1  64   ? 78.871  7.863   101.529  1.00 44.97  ?  64   GLU A CA    1 
ATOM   471   C  C     . GLU A  1  64   ? 78.952  6.512   100.825  1.00 40.96  ?  64   GLU A C     1 
ATOM   472   O  O     . GLU A  1  64   ? 78.784  5.460   101.444  1.00 38.97  ?  64   GLU A O     1 
ATOM   473   C  CB    . GLU A  1  64   ? 77.406  8.243   101.769  1.00 42.50  ?  64   GLU A CB    1 
ATOM   474   C  CG    . GLU A  1  64   ? 76.658  7.328   102.728  1.00 50.65  ?  64   GLU A CG    1 
ATOM   475   C  CD    . GLU A  1  64   ? 75.245  7.806   103.007  1.00 59.10  ?  64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A  1  64   ? 74.876  8.893   102.512  1.00 52.28  ?  64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A  1  64   ? 74.503  7.096   103.720  1.00 60.39  ?  64   GLU A OE2   1 
ATOM   478   N  N     . PHE A  1  65   ? 79.220  6.548   99.526   1.00 46.08  ?  65   PHE A N     1 
ATOM   479   C  CA    . PHE A  1  65   ? 79.205  5.346   98.702   1.00 51.33  ?  65   PHE A CA    1 
ATOM   480   C  C     . PHE A  1  65   ? 80.574  4.676   98.610   1.00 54.45  ?  65   PHE A C     1 
ATOM   481   O  O     . PHE A  1  65   ? 80.761  3.725   97.852   1.00 56.75  ?  65   PHE A O     1 
ATOM   482   C  CB    . PHE A  1  65   ? 78.648  5.668   97.314   1.00 50.13  ?  65   PHE A CB    1 
ATOM   483   C  CG    . PHE A  1  65   ? 77.325  6.383   97.351   1.00 45.13  ?  65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A  1  65   ? 76.148  5.679   97.552   1.00 38.43  ?  65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A  1  65   ? 77.260  7.759   97.198   1.00 37.35  ?  65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A  1  65   ? 74.931  6.335   97.594   1.00 37.02  ?  65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A  1  65   ? 76.047  8.420   97.236   1.00 33.60  ?  65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A  1  65   ? 74.881  7.707   97.435   1.00 37.22  ?  65   PHE A CZ    1 
ATOM   489   N  N     . SER A  1  66   ? 81.532  5.189   99.374   1.00 49.35  ?  66   SER A N     1 
ATOM   490   C  CA    . SER A  1  66   ? 82.876  4.627   99.391   1.00 46.99  ?  66   SER A CA    1 
ATOM   491   C  C     . SER A  1  66   ? 82.975  3.420   100.321  1.00 40.92  ?  66   SER A C     1 
ATOM   492   O  O     . SER A  1  66   ? 82.001  3.037   100.968  1.00 33.65  ?  66   SER A O     1 
ATOM   493   C  CB    . SER A  1  66   ? 83.886  5.689   99.828   1.00 48.74  ?  66   SER A CB    1 
ATOM   494   O  OG    . SER A  1  66   ? 83.738  6.879   99.074   1.00 53.81  ?  66   SER A OG    1 
ATOM   495   N  N     . THR A  1  67   ? 84.163  2.825   100.369  1.00 50.00  ?  67   THR A N     1 
ATOM   496   C  CA    . THR A  1  67   ? 84.483  1.769   101.325  1.00 55.10  ?  67   THR A CA    1 
ATOM   497   C  C     . THR A  1  67   ? 85.901  1.984   101.843  1.00 63.15  ?  67   THR A C     1 
ATOM   498   O  O     . THR A  1  67   ? 86.758  2.501   101.125  1.00 70.84  ?  67   THR A O     1 
ATOM   499   C  CB    . THR A  1  67   ? 84.381  0.362   100.702  1.00 44.94  ?  67   THR A CB    1 
ATOM   500   O  OG1   . THR A  1  67   ? 85.072  0.341   99.447   1.00 55.51  ?  67   THR A OG1   1 
ATOM   501   C  CG2   . THR A  1  67   ? 82.927  -0.028  100.484  1.00 49.56  ?  67   THR A CG2   1 
ATOM   502   N  N     . ILE A  1  68   ? 86.148  1.589   103.087  1.00 58.91  ?  68   ILE A N     1 
ATOM   503   C  CA    . ILE A  1  68   ? 87.444  1.823   103.713  1.00 69.00  ?  68   ILE A CA    1 
ATOM   504   C  C     . ILE A  1  68   ? 88.277  0.547   103.794  1.00 74.29  ?  68   ILE A C     1 
ATOM   505   O  O     . ILE A  1  68   ? 87.814  -0.468  104.318  1.00 65.12  ?  68   ILE A O     1 
ATOM   506   C  CB    . ILE A  1  68   ? 87.285  2.418   105.127  1.00 72.31  ?  68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A  1  68   ? 86.275  3.567   105.110  1.00 67.99  ?  68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A  1  68   ? 88.630  2.887   105.665  1.00 71.12  ?  68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A  1  68   ? 85.984  4.145   106.477  1.00 60.90  ?  68   ILE A CD1   1 
ATOM   510   N  N     . PRO A  1  69   ? 89.509  0.594   103.260  1.00 77.33  ?  69   PRO A N     1 
ATOM   511   C  CA    . PRO A  1  69   ? 90.437  -0.543  103.316  1.00 67.38  ?  69   PRO A CA    1 
ATOM   512   C  C     . PRO A  1  69   ? 90.760  -0.927  104.756  1.00 64.13  ?  69   PRO A C     1 
ATOM   513   O  O     . PRO A  1  69   ? 91.106  -0.063  105.562  1.00 64.21  ?  69   PRO A O     1 
ATOM   514   C  CB    . PRO A  1  69   ? 91.693  -0.002  102.626  1.00 64.52  ?  69   PRO A CB    1 
ATOM   515   C  CG    . PRO A  1  69   ? 91.203  1.105   101.754  1.00 63.91  ?  69   PRO A CG    1 
ATOM   516   C  CD    . PRO A  1  69   ? 90.071  1.729   102.508  1.00 63.30  ?  69   PRO A CD    1 
ATOM   517   N  N     . GLY A  1  70   ? 90.649  -2.213  105.069  1.00 63.35  ?  70   GLY A N     1 
ATOM   518   C  CA    . GLY A  1  70   ? 90.881  -2.689  106.420  1.00 60.07  ?  70   GLY A CA    1 
ATOM   519   C  C     . GLY A  1  70   ? 89.656  -2.524  107.297  1.00 71.26  ?  70   GLY A C     1 
ATOM   520   O  O     . GLY A  1  70   ? 89.734  -2.663  108.518  1.00 80.86  ?  70   GLY A O     1 
ATOM   521   N  N     . VAL A  1  71   ? 88.522  -2.217  106.672  1.00 73.19  ?  71   VAL A N     1 
ATOM   522   C  CA    . VAL A  1  71   ? 87.257  -2.059  107.386  1.00 62.26  ?  71   VAL A CA    1 
ATOM   523   C  C     . VAL A  1  71   ? 86.161  -2.888  106.721  1.00 60.11  ?  71   VAL A C     1 
ATOM   524   O  O     . VAL A  1  71   ? 85.952  -2.797  105.511  1.00 64.83  ?  71   VAL A O     1 
ATOM   525   C  CB    . VAL A  1  71   ? 86.814  -0.581  107.437  1.00 55.91  ?  71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A  1  71   ? 85.473  -0.453  108.139  1.00 56.12  ?  71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A  1  71   ? 87.866  0.268   108.133  1.00 57.38  ?  71   VAL A CG2   1 
ATOM   528   N  N     . LYS A  1  72   ? 85.463  -3.695  107.514  1.00 53.10  ?  72   LYS A N     1 
ATOM   529   C  CA    . LYS A  1  72   ? 84.427  -4.580  106.988  1.00 60.22  ?  72   LYS A CA    1 
ATOM   530   C  C     . LYS A  1  72   ? 83.175  -3.820  106.555  1.00 61.49  ?  72   LYS A C     1 
ATOM   531   O  O     . LYS A  1  72   ? 82.624  -4.070  105.482  1.00 61.89  ?  72   LYS A O     1 
ATOM   532   C  CB    . LYS A  1  72   ? 84.057  -5.647  108.022  1.00 45.62  ?  72   LYS A CB    1 
ATOM   533   C  CG    . LYS A  1  72   ? 82.956  -6.595  107.576  1.00 38.37  ?  72   LYS A CG    1 
ATOM   534   C  CD    . LYS A  1  72   ? 82.605  -7.578  108.679  1.00 41.98  ?  72   LYS A CD    1 
ATOM   535   C  CE    . LYS A  1  72   ? 81.477  -8.502  108.260  1.00 45.42  ?  72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A  1  72   ? 81.110  -9.460  109.339  1.00 50.18  ?  72   LYS A NZ    1 
ATOM   537   N  N     . GLU A  1  73   ? 82.729  -2.892  107.395  1.00 59.30  ?  73   GLU A N     1 
ATOM   538   C  CA    . GLU A  1  73   ? 81.519  -2.127  107.116  1.00 59.08  ?  73   GLU A CA    1 
ATOM   539   C  C     . GLU A  1  73   ? 81.738  -1.068  106.039  1.00 52.34  ?  73   GLU A C     1 
ATOM   540   O  O     . GLU A  1  73   ? 82.744  -0.361  106.043  1.00 51.10  ?  73   GLU A O     1 
ATOM   541   C  CB    . GLU A  1  73   ? 80.991  -1.462  108.393  1.00 53.38  ?  73   GLU A CB    1 
ATOM   542   C  CG    . GLU A  1  73   ? 80.301  -2.406  109.369  1.00 58.45  ?  73   GLU A CG    1 
ATOM   543   C  CD    . GLU A  1  73   ? 81.276  -3.247  110.171  1.00 65.99  ?  73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A  1  73   ? 82.493  -2.973  110.106  1.00 64.36  ?  73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A  1  73   ? 80.825  -4.180  110.869  1.00 70.20  ?  73   GLU A OE2   1 
ATOM   546   N  N     . ASP A  1  74   ? 80.789  -0.970  105.114  1.00 49.57  ?  74   ASP A N     1 
ATOM   547   C  CA    . ASP A  1  74   ? 80.778  0.115   104.141  1.00 45.54  ?  74   ASP A CA    1 
ATOM   548   C  C     . ASP A  1  74   ? 80.351  1.397   104.845  1.00 43.27  ?  74   ASP A C     1 
ATOM   549   O  O     . ASP A  1  74   ? 79.734  1.344   105.908  1.00 47.86  ?  74   ASP A O     1 
ATOM   550   C  CB    . ASP A  1  74   ? 79.823  -0.206  102.992  1.00 52.04  ?  74   ASP A CB    1 
ATOM   551   C  CG    . ASP A  1  74   ? 78.463  -0.671  103.478  1.00 65.42  ?  74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A  1  74   ? 78.330  -1.867  103.816  1.00 64.55  ?  74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A  1  74   ? 77.528  0.157   103.522  1.00 61.40  ?  74   ASP A OD2   1 
ATOM   554   N  N     . VAL A  1  75   ? 80.685  2.542   104.254  1.00 38.97  ?  75   VAL A N     1 
ATOM   555   C  CA    . VAL A  1  75   ? 80.393  3.843   104.857  1.00 42.85  ?  75   VAL A CA    1 
ATOM   556   C  C     . VAL A  1  75   ? 78.911  4.010   105.204  1.00 46.78  ?  75   VAL A C     1 
ATOM   557   O  O     . VAL A  1  75   ? 78.566  4.571   106.247  1.00 45.39  ?  75   VAL A O     1 
ATOM   558   C  CB    . VAL A  1  75   ? 80.852  5.002   103.945  1.00 40.39  ?  75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A  1  75   ? 80.531  6.350   104.577  1.00 33.71  ?  75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A  1  75   ? 82.339  4.887   103.657  1.00 43.97  ?  75   VAL A CG2   1 
ATOM   561   N  N     . VAL A  1  76   ? 78.044  3.506   104.330  1.00 48.05  ?  76   VAL A N     1 
ATOM   562   C  CA    . VAL A  1  76   ? 76.604  3.556   104.556  1.00 46.31  ?  76   VAL A CA    1 
ATOM   563   C  C     . VAL A  1  76   ? 76.217  2.830   105.843  1.00 47.83  ?  76   VAL A C     1 
ATOM   564   O  O     . VAL A  1  76   ? 75.488  3.374   106.676  1.00 52.48  ?  76   VAL A O     1 
ATOM   565   C  CB    . VAL A  1  76   ? 75.826  2.947   103.373  1.00 50.37  ?  76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A  1  76   ? 74.335  2.917   103.674  1.00 51.17  ?  76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A  1  76   ? 76.105  3.727   102.098  1.00 41.57  ?  76   VAL A CG2   1 
ATOM   568   N  N     . GLU A  1  77   ? 76.716  1.608   106.004  1.00 41.91  ?  77   GLU A N     1 
ATOM   569   C  CA    . GLU A  1  77   ? 76.427  0.811   107.194  1.00 46.34  ?  77   GLU A CA    1 
ATOM   570   C  C     . GLU A  1  77   ? 76.995  1.465   108.452  1.00 49.06  ?  77   GLU A C     1 
ATOM   571   O  O     . GLU A  1  77   ? 76.388  1.406   109.525  1.00 46.64  ?  77   GLU A O     1 
ATOM   572   C  CB    . GLU A  1  77   ? 76.978  -0.608  107.039  1.00 40.24  ?  77   GLU A CB    1 
ATOM   573   C  CG    . GLU A  1  77   ? 76.649  -1.530  108.202  1.00 39.81  ?  77   GLU A CG    1 
ATOM   574   C  CD    . GLU A  1  77   ? 77.121  -2.953  107.969  1.00 57.28  ?  77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A  1  77   ? 76.745  -3.842  108.763  1.00 49.94  ?  77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A  1  77   ? 77.867  -3.182  106.993  1.00 61.07  ?  77   GLU A OE2   1 
ATOM   577   N  N     . ILE A  1  78   ? 78.161  2.089   108.310  1.00 51.38  ?  78   ILE A N     1 
ATOM   578   C  CA    . ILE A  1  78   ? 78.793  2.806   109.412  1.00 47.89  ?  78   ILE A CA    1 
ATOM   579   C  C     . ILE A  1  78   ? 77.919  3.968   109.870  1.00 43.30  ?  78   ILE A C     1 
ATOM   580   O  O     . ILE A  1  78   ? 77.717  4.168   111.067  1.00 49.99  ?  78   ILE A O     1 
ATOM   581   C  CB    . ILE A  1  78   ? 80.194  3.325   109.023  1.00 45.44  ?  78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A  1  78   ? 81.171  2.157   108.883  1.00 45.97  ?  78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A  1  78   ? 80.709  4.320   110.052  1.00 40.70  ?  78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A  1  78   ? 82.582  2.577   108.534  1.00 50.13  ?  78   ILE A CD1   1 
ATOM   585   N  N     . ILE A  1  79   ? 77.395  4.724   108.911  1.00 38.72  ?  79   ILE A N     1 
ATOM   586   C  CA    . ILE A  1  79   ? 76.505  5.837   109.222  1.00 44.16  ?  79   ILE A CA    1 
ATOM   587   C  C     . ILE A  1  79   ? 75.209  5.337   109.863  1.00 44.15  ?  79   ILE A C     1 
ATOM   588   O  O     . ILE A  1  79   ? 74.705  5.934   110.821  1.00 48.73  ?  79   ILE A O     1 
ATOM   589   C  CB    . ILE A  1  79   ? 76.199  6.687   107.969  1.00 43.82  ?  79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A  1  79   ? 77.477  7.364   107.469  1.00 42.08  ?  79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A  1  79   ? 75.141  7.734   108.271  1.00 44.81  ?  79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A  1  79   ? 77.258  8.327   106.326  1.00 42.00  ?  79   ILE A CD1   1 
ATOM   593   N  N     . LEU A  1  80   ? 74.685  4.230   109.341  1.00 42.78  ?  80   LEU A N     1 
ATOM   594   C  CA    . LEU A  1  80   ? 73.496  3.603   109.912  1.00 39.86  ?  80   LEU A CA    1 
ATOM   595   C  C     . LEU A  1  80   ? 73.725  3.217   111.368  1.00 39.47  ?  80   LEU A C     1 
ATOM   596   O  O     . LEU A  1  80   ? 72.831  3.353   112.201  1.00 46.79  ?  80   LEU A O     1 
ATOM   597   C  CB    . LEU A  1  80   ? 73.086  2.370   109.105  1.00 45.50  ?  80   LEU A CB    1 
ATOM   598   C  CG    . LEU A  1  80   ? 72.504  2.607   107.711  1.00 38.03  ?  80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A  1  80   ? 72.084  1.287   107.088  1.00 34.47  ?  80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A  1  80   ? 71.332  3.577   107.769  1.00 35.28  ?  80   LEU A CD2   1 
ATOM   601   N  N     . ASN A  1  81   ? 74.927  2.734   111.669  1.00 47.28  ?  81   ASN A N     1 
ATOM   602   C  CA    . ASN A  1  81   ? 75.294  2.414   113.044  1.00 46.90  ?  81   ASN A CA    1 
ATOM   603   C  C     . ASN A  1  81   ? 75.432  3.671   113.898  1.00 39.19  ?  81   ASN A C     1 
ATOM   604   O  O     . ASN A  1  81   ? 75.063  3.680   115.072  1.00 39.77  ?  81   ASN A O     1 
ATOM   605   C  CB    . ASN A  1  81   ? 76.590  1.602   113.083  1.00 42.45  ?  81   ASN A CB    1 
ATOM   606   C  CG    . ASN A  1  81   ? 76.424  0.212   112.499  1.00 47.64  ?  81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A  1  81   ? 75.372  -0.412  112.639  1.00 46.65  ?  81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A  1  81   ? 77.465  -0.279  111.836  1.00 51.84  ?  81   ASN A ND2   1 
ATOM   609   N  N     . LEU A  1  82   ? 75.958  4.733   113.295  1.00 39.83  ?  82   LEU A N     1 
ATOM   610   C  CA    . LEU A  1  82   ? 76.161  6.001   113.991  1.00 43.34  ?  82   LEU A CA    1 
ATOM   611   C  C     . LEU A  1  82   ? 74.850  6.724   114.286  1.00 45.35  ?  82   LEU A C     1 
ATOM   612   O  O     . LEU A  1  82   ? 74.802  7.605   115.144  1.00 46.15  ?  82   LEU A O     1 
ATOM   613   C  CB    . LEU A  1  82   ? 77.092  6.913   113.189  1.00 44.54  ?  82   LEU A CB    1 
ATOM   614   C  CG    . LEU A  1  82   ? 78.576  6.545   113.192  1.00 52.75  ?  82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A  1  82   ? 79.322  7.301   112.106  1.00 58.74  ?  82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A  1  82   ? 79.190  6.824   114.556  1.00 48.87  ?  82   LEU A CD2   1 
ATOM   617   N  N     . LYS A  1  83   ? 73.790  6.358   113.571  1.00 48.79  ?  83   LYS A N     1 
ATOM   618   C  CA    . LYS A  1  83   ? 72.478  6.951   113.821  1.00 45.89  ?  83   LYS A CA    1 
ATOM   619   C  C     . LYS A  1  83   ? 71.833  6.389   115.085  1.00 47.57  ?  83   LYS A C     1 
ATOM   620   O  O     . LYS A  1  83   ? 70.884  6.965   115.616  1.00 55.34  ?  83   LYS A O     1 
ATOM   621   C  CB    . LYS A  1  83   ? 71.553  6.769   112.615  1.00 35.15  ?  83   LYS A CB    1 
ATOM   622   C  CG    . LYS A  1  83   ? 71.869  7.700   111.457  1.00 43.00  ?  83   LYS A CG    1 
ATOM   623   C  CD    . LYS A  1  83   ? 70.980  7.425   110.258  1.00 45.56  ?  83   LYS A CD    1 
ATOM   624   C  CE    . LYS A  1  83   ? 69.513  7.611   110.598  1.00 43.55  ?  83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A  1  83   ? 68.647  7.379   109.410  1.00 50.23  ?  83   LYS A NZ    1 
ATOM   626   N  N     . GLU A  1  84   ? 72.356  5.266   115.566  1.00 43.62  ?  84   GLU A N     1 
ATOM   627   C  CA    . GLU A  1  84   ? 71.848  4.647   116.786  1.00 53.01  ?  84   GLU A CA    1 
ATOM   628   C  C     . GLU A  1  84   ? 72.582  5.159   118.022  1.00 55.85  ?  84   GLU A C     1 
ATOM   629   O  O     . GLU A  1  84   ? 72.337  4.698   119.138  1.00 57.14  ?  84   GLU A O     1 
ATOM   630   C  CB    . GLU A  1  84   ? 71.952  3.124   116.702  1.00 57.37  ?  84   GLU A CB    1 
ATOM   631   C  CG    . GLU A  1  84   ? 70.991  2.494   115.710  1.00 66.42  ?  84   GLU A CG    1 
ATOM   632   C  CD    . GLU A  1  84   ? 71.032  0.980   115.743  1.00 92.91  ?  84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A  1  84   ? 70.072  0.347   115.254  1.00 108.43 ?  84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A  1  84   ? 72.025  0.422   116.257  1.00 84.93  ?  84   GLU A OE2   1 
ATOM   635   N  N     . LEU A  1  85   ? 73.483  6.113   117.812  1.00 51.22  ?  85   LEU A N     1 
ATOM   636   C  CA    . LEU A  1  85   ? 74.273  6.685   118.896  1.00 44.43  ?  85   LEU A CA    1 
ATOM   637   C  C     . LEU A  1  85   ? 73.439  7.626   119.760  1.00 46.23  ?  85   LEU A C     1 
ATOM   638   O  O     . LEU A  1  85   ? 72.799  8.547   119.251  1.00 41.22  ?  85   LEU A O     1 
ATOM   639   C  CB    . LEU A  1  85   ? 75.481  7.432   118.329  1.00 36.34  ?  85   LEU A CB    1 
ATOM   640   C  CG    . LEU A  1  85   ? 76.487  7.996   119.333  1.00 37.20  ?  85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A  1  85   ? 77.189  6.869   120.073  1.00 47.00  ?  85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A  1  85   ? 77.492  8.897   118.632  1.00 42.11  ?  85   LEU A CD2   1 
ATOM   643   N  N     . VAL A  1  86   ? 73.447  7.387   121.068  1.00 52.16  ?  86   VAL A N     1 
ATOM   644   C  CA    . VAL A  1  86   ? 72.732  8.245   122.008  1.00 48.56  ?  86   VAL A CA    1 
ATOM   645   C  C     . VAL A  1  86   ? 73.711  9.129   122.771  1.00 46.91  ?  86   VAL A C     1 
ATOM   646   O  O     . VAL A  1  86   ? 74.488  8.644   123.594  1.00 48.39  ?  86   VAL A O     1 
ATOM   647   C  CB    . VAL A  1  86   ? 71.908  7.422   123.014  1.00 48.75  ?  86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A  1  86   ? 71.059  8.341   123.877  1.00 50.21  ?  86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A  1  86   ? 71.032  6.415   122.285  1.00 56.25  ?  86   VAL A CG2   1 
ATOM   650   N  N     . VAL A  1  87   ? 73.668  10.428  122.497  1.00 45.32  ?  87   VAL A N     1 
ATOM   651   C  CA    . VAL A  1  87   ? 74.600  11.368  123.108  1.00 53.28  ?  87   VAL A CA    1 
ATOM   652   C  C     . VAL A  1  87   ? 73.897  12.293  124.097  1.00 59.40  ?  87   VAL A C     1 
ATOM   653   O  O     . VAL A  1  87   ? 72.942  12.986  123.746  1.00 60.32  ?  87   VAL A O     1 
ATOM   654   C  CB    . VAL A  1  87   ? 75.327  12.216  122.045  1.00 59.75  ?  87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A  1  87   ? 76.335  13.144  122.703  1.00 52.85  ?  87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A  1  87   ? 76.014  11.319  121.029  1.00 59.36  ?  87   VAL A CG2   1 
ATOM   657   N  N     . ARG A  1  88   ? 74.381  12.299  125.334  1.00 62.63  ?  88   ARG A N     1 
ATOM   658   C  CA    . ARG A  1  88   ? 73.806  13.126  126.386  1.00 60.51  ?  88   ARG A CA    1 
ATOM   659   C  C     . ARG A  1  88   ? 74.637  14.379  126.631  1.00 58.82  ?  88   ARG A C     1 
ATOM   660   O  O     . ARG A  1  88   ? 75.830  14.297  126.930  1.00 62.18  ?  88   ARG A O     1 
ATOM   661   C  CB    . ARG A  1  88   ? 73.683  12.326  127.684  1.00 62.84  ?  88   ARG A CB    1 
ATOM   662   C  CG    . ARG A  1  88   ? 73.221  13.148  128.877  1.00 66.73  ?  88   ARG A CG    1 
ATOM   663   C  CD    . ARG A  1  88   ? 73.249  12.327  130.156  1.00 65.89  ?  88   ARG A CD    1 
ATOM   664   N  NE    . ARG A  1  88   ? 72.818  13.102  131.316  1.00 54.55  ?  88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A  1  88   ? 72.815  12.640  132.562  1.00 57.67  ?  88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A  1  88   ? 73.222  11.403  132.814  1.00 58.05  ?  88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A  1  88   ? 72.406  13.414  133.557  1.00 64.03  ?  88   ARG A NH2   1 
ATOM   668   N  N     . PHE A  1  89   ? 73.996  15.537  126.502  1.00 58.55  ?  89   PHE A N     1 
ATOM   669   C  CA    . PHE A  1  89   ? 74.643  16.811  126.796  1.00 69.17  ?  89   PHE A CA    1 
ATOM   670   C  C     . PHE A  1  89   ? 74.344  17.233  128.229  1.00 74.22  ?  89   PHE A C     1 
ATOM   671   O  O     . PHE A  1  89   ? 73.202  17.541  128.568  1.00 73.73  ?  89   PHE A O     1 
ATOM   672   C  CB    . PHE A  1  89   ? 74.167  17.900  125.831  1.00 64.37  ?  89   PHE A CB    1 
ATOM   673   C  CG    . PHE A  1  89   ? 74.650  17.721  124.420  1.00 66.41  ?  89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A  1  89   ? 75.636  16.796  124.119  1.00 66.39  ?  89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A  1  89   ? 74.123  18.487  123.395  1.00 64.33  ?  89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A  1  89   ? 76.080  16.634  122.820  1.00 64.10  ?  89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A  1  89   ? 74.563  18.330  122.096  1.00 58.79  ?  89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A  1  89   ? 75.543  17.403  121.808  1.00 59.25  ?  89   PHE A CZ    1 
ATOM   679   N  N     . LEU A  1  90   ? 75.376  17.250  129.066  1.00 68.18  ?  90   LEU A N     1 
ATOM   680   C  CA    . LEU A  1  90   ? 75.214  17.630  130.463  1.00 59.05  ?  90   LEU A CA    1 
ATOM   681   C  C     . LEU A  1  90   ? 74.987  19.132  130.601  1.00 60.30  ?  90   LEU A C     1 
ATOM   682   O  O     . LEU A  1  90   ? 74.340  19.588  131.543  1.00 57.89  ?  90   LEU A O     1 
ATOM   683   C  CB    . LEU A  1  90   ? 76.426  17.192  131.290  1.00 59.14  ?  90   LEU A CB    1 
ATOM   684   C  CG    . LEU A  1  90   ? 76.468  15.733  131.759  1.00 65.27  ?  90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A  1  90   ? 75.194  15.374  132.510  1.00 62.71  ?  90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A  1  90   ? 76.707  14.765  130.605  1.00 59.89  ?  90   LEU A CD2   1 
ATOM   687   N  N     . ASN A  1  91   ? 75.519  19.894  129.651  1.00 62.38  ?  91   ASN A N     1 
ATOM   688   C  CA    . ASN A  1  91   ? 75.359  21.342  129.653  1.00 66.95  ?  91   ASN A CA    1 
ATOM   689   C  C     . ASN A  1  91   ? 74.176  21.764  128.784  1.00 66.34  ?  91   ASN A C     1 
ATOM   690   O  O     . ASN A  1  91   ? 74.125  21.437  127.599  1.00 65.60  ?  91   ASN A O     1 
ATOM   691   C  CB    . ASN A  1  91   ? 76.647  22.015  129.170  1.00 74.66  ?  91   ASN A CB    1 
ATOM   692   C  CG    . ASN A  1  91   ? 76.730  23.481  129.563  1.00 69.22  ?  91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A  1  91   ? 75.722  24.185  129.610  1.00 67.34  ?  91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A  1  91   ? 77.942  23.946  129.845  1.00 64.51  ?  91   ASN A ND2   1 
ATOM   695   N  N     . PRO A  1  92   ? 73.211  22.481  129.379  1.00 64.80  ?  92   PRO A N     1 
ATOM   696   C  CA    . PRO A  1  92   ? 72.033  22.980  128.660  1.00 67.52  ?  92   PRO A CA    1 
ATOM   697   C  C     . PRO A  1  92   ? 72.386  24.013  127.591  1.00 69.08  ?  92   PRO A C     1 
ATOM   698   O  O     . PRO A  1  92   ? 71.705  24.094  126.569  1.00 73.15  ?  92   PRO A O     1 
ATOM   699   C  CB    . PRO A  1  92   ? 71.202  23.638  129.767  1.00 63.80  ?  92   PRO A CB    1 
ATOM   700   C  CG    . PRO A  1  92   ? 71.652  22.977  131.025  1.00 62.03  ?  92   PRO A CG    1 
ATOM   701   C  CD    . PRO A  1  92   ? 73.113  22.724  130.828  1.00 66.25  ?  92   PRO A CD    1 
ATOM   702   N  N     . SER A  1  93   ? 73.435  24.793  127.828  1.00 70.09  ?  93   SER A N     1 
ATOM   703   C  CA    . SER A  1  93   ? 73.855  25.817  126.877  1.00 73.75  ?  93   SER A CA    1 
ATOM   704   C  C     . SER A  1  93   ? 74.540  25.194  125.667  1.00 78.06  ?  93   SER A C     1 
ATOM   705   O  O     . SER A  1  93   ? 74.558  25.775  124.582  1.00 77.27  ?  93   SER A O     1 
ATOM   706   C  CB    . SER A  1  93   ? 74.795  26.821  127.548  1.00 81.48  ?  93   SER A CB    1 
ATOM   707   O  OG    . SER A  1  93   ? 74.150  27.490  128.618  1.00 102.64 ?  93   SER A OG    1 
ATOM   708   N  N     . LEU A  1  94   ? 75.104  24.007  125.867  1.00 79.44  ?  94   LEU A N     1 
ATOM   709   C  CA    . LEU A  1  94   ? 75.822  23.294  124.816  1.00 76.27  ?  94   LEU A CA    1 
ATOM   710   C  C     . LEU A  1  94   ? 74.890  22.894  123.674  1.00 74.66  ?  94   LEU A C     1 
ATOM   711   O  O     . LEU A  1  94   ? 73.824  22.323  123.902  1.00 75.21  ?  94   LEU A O     1 
ATOM   712   C  CB    . LEU A  1  94   ? 76.507  22.059  125.405  1.00 70.12  ?  94   LEU A CB    1 
ATOM   713   C  CG    . LEU A  1  94   ? 77.355  21.180  124.488  1.00 61.78  ?  94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A  1  94   ? 78.411  22.008  123.776  1.00 64.96  ?  94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A  1  94   ? 77.999  20.071  125.304  1.00 62.21  ?  94   LEU A CD2   1 
ATOM   716   N  N     . GLN A  1  95   ? 75.299  23.199  122.446  1.00 71.60  ?  95   GLN A N     1 
ATOM   717   C  CA    . GLN A  1  95   ? 74.476  22.920  121.271  1.00 71.41  ?  95   GLN A CA    1 
ATOM   718   C  C     . GLN A  1  95   ? 75.066  21.824  120.388  1.00 64.28  ?  95   GLN A C     1 
ATOM   719   O  O     . GLN A  1  95   ? 74.474  20.758  120.230  1.00 62.51  ?  95   GLN A O     1 
ATOM   720   C  CB    . GLN A  1  95   ? 74.257  24.194  120.451  1.00 65.56  ?  95   GLN A CB    1 
ATOM   721   C  CG    . GLN A  1  95   ? 73.435  25.253  121.164  1.00 70.43  ?  95   GLN A CG    1 
ATOM   722   C  CD    . GLN A  1  95   ? 72.021  24.793  121.457  1.00 70.60  ?  95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A  1  95   ? 71.470  23.949  120.749  1.00 74.98  ?  95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A  1  95   ? 71.426  25.343  122.509  1.00 71.62  ?  95   GLN A NE2   1 
ATOM   725   N  N     . THR A  1  96   ? 76.228  22.096  119.804  1.00 60.36  ?  96   THR A N     1 
ATOM   726   C  CA    . THR A  1  96   ? 76.874  21.137  118.917  1.00 57.50  ?  96   THR A CA    1 
ATOM   727   C  C     . THR A  1  96   ? 78.173  20.592  119.504  1.00 58.21  ?  96   THR A C     1 
ATOM   728   O  O     . THR A  1  96   ? 78.939  21.322  120.133  1.00 55.19  ?  96   THR A O     1 
ATOM   729   C  CB    . THR A  1  96   ? 77.155  21.749  117.531  1.00 58.88  ?  96   THR A CB    1 
ATOM   730   O  OG1   . THR A  1  96   ? 78.012  20.874  116.785  1.00 63.50  ?  96   THR A OG1   1 
ATOM   731   C  CG2   . THR A  1  96   ? 77.825  23.108  117.671  1.00 56.53  ?  96   THR A CG2   1 
ATOM   732   N  N     . VAL A  1  97   ? 78.409  19.300  119.299  1.00 55.97  ?  97   VAL A N     1 
ATOM   733   C  CA    . VAL A  1  97   ? 79.634  18.661  119.761  1.00 54.03  ?  97   VAL A CA    1 
ATOM   734   C  C     . VAL A  1  97   ? 80.236  17.803  118.656  1.00 59.83  ?  97   VAL A C     1 
ATOM   735   O  O     . VAL A  1  97   ? 79.531  17.032  118.003  1.00 65.87  ?  97   VAL A O     1 
ATOM   736   C  CB    . VAL A  1  97   ? 79.387  17.783  121.005  1.00 54.51  ?  97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A  1  97   ? 80.651  17.030  121.391  1.00 57.66  ?  97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A  1  97   ? 78.911  18.633  122.164  1.00 68.90  ?  97   VAL A CG2   1 
ATOM   739   N  N     . THR A  1  98   ? 81.540  17.950  118.442  1.00 59.55  ?  98   THR A N     1 
ATOM   740   C  CA    . THR A  1  98   ? 82.247  17.128  117.470  1.00 53.27  ?  98   THR A CA    1 
ATOM   741   C  C     . THR A  1  98   ? 83.039  16.035  118.175  1.00 49.33  ?  98   THR A C     1 
ATOM   742   O  O     . THR A  1  98   ? 84.038  16.308  118.839  1.00 54.52  ?  98   THR A O     1 
ATOM   743   C  CB    . THR A  1  98   ? 83.207  17.967  116.610  1.00 45.50  ?  98   THR A CB    1 
ATOM   744   O  OG1   . THR A  1  98   ? 82.481  19.020  115.966  1.00 49.45  ?  98   THR A OG1   1 
ATOM   745   C  CG2   . THR A  1  98   ? 83.874  17.096  115.556  1.00 42.84  ?  98   THR A CG2   1 
ATOM   746   N  N     . LEU A  1  99   ? 82.588  14.795  118.026  1.00 44.16  ?  99   LEU A N     1 
ATOM   747   C  CA    . LEU A  1  99   ? 83.281  13.657  118.612  1.00 47.73  ?  99   LEU A CA    1 
ATOM   748   C  C     . LEU A  1  99   ? 84.390  13.166  117.689  1.00 54.37  ?  99   LEU A C     1 
ATOM   749   O  O     . LEU A  1  99   ? 84.197  13.043  116.475  1.00 58.07  ?  99   LEU A O     1 
ATOM   750   C  CB    . LEU A  1  99   ? 82.303  12.520  118.920  1.00 46.95  ?  99   LEU A CB    1 
ATOM   751   C  CG    . LEU A  1  99   ? 81.487  12.607  120.214  1.00 52.90  ?  99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A  1  99   ? 80.398  13.665  120.121  1.00 53.19  ?  99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A  1  99   ? 80.890  11.251  120.562  1.00 56.96  ?  99   LEU A CD2   1 
ATOM   754   N  N     . LEU A  1  100  ? 85.552  12.893  118.275  1.00 58.97  ?  100  LEU A N     1 
ATOM   755   C  CA    . LEU A  1  100  ? 86.704  12.406  117.528  1.00 54.00  ?  100  LEU A CA    1 
ATOM   756   C  C     . LEU A  1  100  ? 86.973  10.944  117.859  1.00 58.87  ?  100  LEU A C     1 
ATOM   757   O  O     . LEU A  1  100  ? 87.065  10.571  119.029  1.00 62.91  ?  100  LEU A O     1 
ATOM   758   C  CB    . LEU A  1  100  ? 87.945  13.237  117.861  1.00 49.11  ?  100  LEU A CB    1 
ATOM   759   C  CG    . LEU A  1  100  ? 87.817  14.761  117.805  1.00 54.88  ?  100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A  1  100  ? 89.131  15.419  118.201  1.00 52.67  ?  100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A  1  100  ? 87.381  15.219  116.424  1.00 61.14  ?  100  LEU A CD2   1 
ATOM   762   N  N     . LEU A  1  101  ? 87.099  10.117  116.827  1.00 62.37  ?  101  LEU A N     1 
ATOM   763   C  CA    . LEU A  1  101  ? 87.436  8.712   117.015  1.00 57.26  ?  101  LEU A CA    1 
ATOM   764   C  C     . LEU A  1  101  ? 88.632  8.357   116.146  1.00 57.62  ?  101  LEU A C     1 
ATOM   765   O  O     . LEU A  1  101  ? 88.633  8.618   114.948  1.00 63.40  ?  101  LEU A O     1 
ATOM   766   C  CB    . LEU A  1  101  ? 86.241  7.819   116.672  1.00 56.84  ?  101  LEU A CB    1 
ATOM   767   C  CG    . LEU A  1  101  ? 86.298  6.341   117.075  1.00 56.26  ?  101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A  1  101  ? 84.896  5.821   117.344  1.00 58.51  ?  101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A  1  101  ? 86.978  5.487   116.011  1.00 53.86  ?  101  LEU A CD2   1 
ATOM   770   N  N     . LYS A  1  102  ? 89.657  7.773   116.752  1.00 63.38  ?  102  LYS A N     1 
ATOM   771   C  CA    . LYS A  1  102  ? 90.821  7.331   115.996  1.00 68.32  ?  102  LYS A CA    1 
ATOM   772   C  C     . LYS A  1  102  ? 91.212  5.918   116.416  1.00 72.80  ?  102  LYS A C     1 
ATOM   773   O  O     . LYS A  1  102  ? 91.587  5.686   117.566  1.00 87.25  ?  102  LYS A O     1 
ATOM   774   C  CB    . LYS A  1  102  ? 91.985  8.304   116.197  1.00 64.68  ?  102  LYS A CB    1 
ATOM   775   C  CG    . LYS A  1  102  ? 93.025  8.274   115.092  1.00 73.88  ?  102  LYS A CG    1 
ATOM   776   C  CD    . LYS A  1  102  ? 93.896  9.520   115.132  1.00 84.01  ?  102  LYS A CD    1 
ATOM   777   C  CE    . LYS A  1  102  ? 93.056  10.781  114.989  1.00 69.60  ?  102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A  1  102  ? 93.887  12.016  114.986  1.00 67.61  ?  102  LYS A NZ    1 
ATOM   779   N  N     . ALA A  1  103  ? 91.123  4.975   115.484  1.00 60.54  ?  103  ALA A N     1 
ATOM   780   C  CA    . ALA A  1  103  ? 91.389  3.576   115.804  1.00 63.18  ?  103  ALA A CA    1 
ATOM   781   C  C     . ALA A  1  103  ? 92.141  2.851   114.693  1.00 70.99  ?  103  ALA A C     1 
ATOM   782   O  O     . ALA A  1  103  ? 92.198  3.320   113.555  1.00 75.06  ?  103  ALA A O     1 
ATOM   783   C  CB    . ALA A  1  103  ? 90.089  2.850   116.126  1.00 52.42  ?  103  ALA A CB    1 
ATOM   784   N  N     . GLU A  1  104  ? 92.715  1.703   115.040  1.00 68.75  ?  104  GLU A N     1 
ATOM   785   C  CA    . GLU A  1  104  ? 93.434  0.869   114.084  1.00 69.47  ?  104  GLU A CA    1 
ATOM   786   C  C     . GLU A  1  104  ? 93.624  -0.540  114.638  1.00 62.42  ?  104  GLU A C     1 
ATOM   787   O  O     . GLU A  1  104  ? 93.196  -0.838  115.751  1.00 63.07  ?  104  GLU A O     1 
ATOM   788   C  CB    . GLU A  1  104  ? 94.789  1.489   113.735  1.00 76.32  ?  104  GLU A CB    1 
ATOM   789   C  CG    . GLU A  1  104  ? 95.696  1.734   114.930  1.00 88.89  ?  104  GLU A CG    1 
ATOM   790   C  CD    . GLU A  1  104  ? 96.994  2.417   114.543  1.00 97.10  ?  104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A  1  104  ? 97.875  2.564   115.418  1.00 94.15  ?  104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A  1  104  ? 97.132  2.808   113.364  1.00 94.06  ?  104  GLU A OE2   1 
ATOM   793   N  N     . GLY A  1  105  ? 94.263  -1.404  113.857  1.00 60.61  ?  105  GLY A N     1 
ATOM   794   C  CA    . GLY A  1  105  ? 94.518  -2.768  114.284  1.00 58.54  ?  105  GLY A CA    1 
ATOM   795   C  C     . GLY A  1  105  ? 93.271  -3.632  114.286  1.00 50.70  ?  105  GLY A C     1 
ATOM   796   O  O     . GLY A  1  105  ? 92.167  -3.132  114.075  1.00 59.80  ?  105  GLY A O     1 
ATOM   797   N  N     . PRO A  1  106  ? 93.441  -4.938  114.542  1.00 49.22  ?  106  PRO A N     1 
ATOM   798   C  CA    . PRO A  1  106  ? 92.352  -5.921  114.493  1.00 66.38  ?  106  PRO A CA    1 
ATOM   799   C  C     . PRO A  1  106  ? 91.406  -5.780  115.678  1.00 66.02  ?  106  PRO A C     1 
ATOM   800   O  O     . PRO A  1  106  ? 91.525  -6.532  116.645  1.00 67.43  ?  106  PRO A O     1 
ATOM   801   C  CB    . PRO A  1  106  ? 93.086  -7.267  114.584  1.00 56.29  ?  106  PRO A CB    1 
ATOM   802   C  CG    . PRO A  1  106  ? 94.522  -6.962  114.304  1.00 63.32  ?  106  PRO A CG    1 
ATOM   803   C  CD    . PRO A  1  106  ? 94.741  -5.575  114.799  1.00 60.68  ?  106  PRO A CD    1 
ATOM   804   N  N     . LYS A  1  107  ? 90.475  -4.833  115.601  1.00 70.08  ?  107  LYS A N     1 
ATOM   805   C  CA    . LYS A  1  107  ? 89.605  -4.547  116.740  1.00 71.48  ?  107  LYS A CA    1 
ATOM   806   C  C     . LYS A  1  107  ? 88.203  -4.119  116.324  1.00 62.61  ?  107  LYS A C     1 
ATOM   807   O  O     . LYS A  1  107  ? 88.017  -3.496  115.282  1.00 63.90  ?  107  LYS A O     1 
ATOM   808   C  CB    . LYS A  1  107  ? 90.223  -3.459  117.622  1.00 73.39  ?  107  LYS A CB    1 
ATOM   809   C  CG    . LYS A  1  107  ? 90.416  -2.127  116.911  1.00 64.92  ?  107  LYS A CG    1 
ATOM   810   C  CD    . LYS A  1  107  ? 90.873  -1.036  117.866  1.00 70.72  ?  107  LYS A CD    1 
ATOM   811   C  CE    . LYS A  1  107  ? 89.781  -0.659  118.852  1.00 63.55  ?  107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A  1  107  ? 90.195  0.488   119.708  1.00 57.13  ?  107  LYS A NZ    1 
ATOM   813   N  N     . GLU A  1  108  ? 87.220  -4.443  117.158  1.00 59.22  ?  108  GLU A N     1 
ATOM   814   C  CA    . GLU A  1  108  ? 85.854  -3.999  116.927  1.00 50.39  ?  108  GLU A CA    1 
ATOM   815   C  C     . GLU A  1  108  ? 85.632  -2.686  117.661  1.00 51.56  ?  108  GLU A C     1 
ATOM   816   O  O     . GLU A  1  108  ? 85.624  -2.643  118.891  1.00 59.01  ?  108  GLU A O     1 
ATOM   817   C  CB    . GLU A  1  108  ? 84.857  -5.052  117.411  1.00 41.60  ?  108  GLU A CB    1 
ATOM   818   C  CG    . GLU A  1  108  ? 84.912  -6.347  116.623  1.00 50.43  ?  108  GLU A CG    1 
ATOM   819   C  CD    . GLU A  1  108  ? 84.921  -7.573  117.514  1.00 57.54  ?  108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A  1  108  ? 83.837  -7.978  117.986  1.00 57.53  ?  108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A  1  108  ? 86.016  -8.131  117.742  1.00 64.75  ?  108  GLU A OE2   1 
ATOM   822   N  N     . VAL A  1  109  ? 85.453  -1.615  116.897  1.00 46.03  ?  109  VAL A N     1 
ATOM   823   C  CA    . VAL A  1  109  ? 85.322  -0.284  117.471  1.00 51.24  ?  109  VAL A CA    1 
ATOM   824   C  C     . VAL A  1  109  ? 83.916  -0.053  118.010  1.00 59.44  ?  109  VAL A C     1 
ATOM   825   O  O     . VAL A  1  109  ? 82.933  -0.136  117.273  1.00 62.50  ?  109  VAL A O     1 
ATOM   826   C  CB    . VAL A  1  109  ? 85.656  0.805   116.438  1.00 50.14  ?  109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A  1  109  ? 85.519  2.186   117.059  1.00 44.01  ?  109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A  1  109  ? 87.059  0.598   115.887  1.00 58.02  ?  109  VAL A CG2   1 
ATOM   829   N  N     . LYS A  1  110  ? 83.829  0.237   119.303  1.00 59.74  ?  110  LYS A N     1 
ATOM   830   C  CA    . LYS A  1  110  ? 82.549  0.518   119.941  1.00 56.71  ?  110  LYS A CA    1 
ATOM   831   C  C     . LYS A  1  110  ? 82.405  2.018   120.182  1.00 54.67  ?  110  LYS A C     1 
ATOM   832   O  O     . LYS A  1  110  ? 83.290  2.797   119.828  1.00 59.60  ?  110  LYS A O     1 
ATOM   833   C  CB    . LYS A  1  110  ? 82.414  -0.257  121.254  1.00 49.75  ?  110  LYS A CB    1 
ATOM   834   C  CG    . LYS A  1  110  ? 81.817  -1.656  121.112  1.00 39.38  ?  110  LYS A CG    1 
ATOM   835   C  CD    . LYS A  1  110  ? 82.662  -2.556  120.224  1.00 40.72  ?  110  LYS A CD    1 
ATOM   836   C  CE    . LYS A  1  110  ? 82.147  -3.987  120.228  1.00 56.35  ?  110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A  1  110  ? 80.735  -4.080  119.765  1.00 70.46  ?  110  LYS A NZ    1 
ATOM   838   N  N     . ALA A  1  111  ? 81.289  2.421   120.780  1.00 51.88  ?  111  ALA A N     1 
ATOM   839   C  CA    . ALA A  1  111  ? 81.035  3.833   121.045  1.00 62.49  ?  111  ALA A CA    1 
ATOM   840   C  C     . ALA A  1  111  ? 81.963  4.383   122.128  1.00 66.71  ?  111  ALA A C     1 
ATOM   841   O  O     . ALA A  1  111  ? 82.161  5.594   122.231  1.00 61.78  ?  111  ALA A O     1 
ATOM   842   C  CB    . ALA A  1  111  ? 79.578  4.048   121.430  1.00 68.39  ?  111  ALA A CB    1 
ATOM   843   N  N     . ARG A  1  112  ? 82.528  3.483   122.928  1.00 67.00  ?  112  ARG A N     1 
ATOM   844   C  CA    . ARG A  1  112  ? 83.446  3.856   124.001  1.00 53.93  ?  112  ARG A CA    1 
ATOM   845   C  C     . ARG A  1  112  ? 84.732  4.480   123.475  1.00 56.29  ?  112  ARG A C     1 
ATOM   846   O  O     . ARG A  1  112  ? 85.334  5.330   124.132  1.00 56.67  ?  112  ARG A O     1 
ATOM   847   C  CB    . ARG A  1  112  ? 83.791  2.631   124.850  1.00 47.94  ?  112  ARG A CB    1 
ATOM   848   C  CG    . ARG A  1  112  ? 83.043  2.553   126.167  1.00 57.38  ?  112  ARG A CG    1 
ATOM   849   C  CD    . ARG A  1  112  ? 82.941  1.116   126.654  1.00 56.27  ?  112  ARG A CD    1 
ATOM   850   N  NE    . ARG A  1  112  ? 83.324  0.167   125.612  1.00 61.33  ?  112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A  1  112  ? 82.964  -1.112  125.594  1.00 70.79  ?  112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A  1  112  ? 82.196  -1.601  126.560  1.00 74.50  ?  112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A  1  112  ? 83.365  -1.902  124.605  1.00 60.11  ?  112  ARG A NH2   1 
ATOM   854   N  N     . ASP A  1  113  ? 85.145  4.058   122.285  1.00 53.97  ?  113  ASP A N     1 
ATOM   855   C  CA    . ASP A  1  113  ? 86.439  4.449   121.738  1.00 49.69  ?  113  ASP A CA    1 
ATOM   856   C  C     . ASP A  1  113  ? 86.521  5.924   121.349  1.00 57.36  ?  113  ASP A C     1 
ATOM   857   O  O     . ASP A  1  113  ? 87.603  6.432   121.051  1.00 65.22  ?  113  ASP A O     1 
ATOM   858   C  CB    . ASP A  1  113  ? 86.807  3.555   120.553  1.00 49.12  ?  113  ASP A CB    1 
ATOM   859   C  CG    . ASP A  1  113  ? 86.859  2.088   120.929  1.00 52.49  ?  113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A  1  113  ? 86.016  1.651   121.740  1.00 50.49  ?  113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A  1  113  ? 87.746  1.371   120.421  1.00 62.43  ?  113  ASP A OD2   1 
ATOM   862   N  N     . PHE A  1  114  ? 85.382  6.608   121.351  1.00 54.66  ?  114  PHE A N     1 
ATOM   863   C  CA    . PHE A  1  114  ? 85.366  8.049   121.128  1.00 60.12  ?  114  PHE A CA    1 
ATOM   864   C  C     . PHE A  1  114  ? 86.149  8.757   122.226  1.00 61.46  ?  114  PHE A C     1 
ATOM   865   O  O     . PHE A  1  114  ? 86.063  8.384   123.396  1.00 63.03  ?  114  PHE A O     1 
ATOM   866   C  CB    . PHE A  1  114  ? 83.932  8.582   121.092  1.00 63.63  ?  114  PHE A CB    1 
ATOM   867   C  CG    . PHE A  1  114  ? 83.241  8.384   119.773  1.00 66.96  ?  114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A  1  114  ? 83.519  9.217   118.700  1.00 57.46  ?  114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A  1  114  ? 82.305  7.376   119.608  1.00 62.89  ?  114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A  1  114  ? 82.884  9.042   117.486  1.00 56.98  ?  114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A  1  114  ? 81.666  7.197   118.397  1.00 61.48  ?  114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A  1  114  ? 81.956  8.031   117.333  1.00 60.61  ?  114  PHE A CZ    1 
ATOM   873   N  N     . LEU A  1  115  ? 86.918  9.772   121.846  1.00 62.71  ?  115  LEU A N     1 
ATOM   874   C  CA    . LEU A  1  115  ? 87.675  10.554  122.816  1.00 64.49  ?  115  LEU A CA    1 
ATOM   875   C  C     . LEU A  1  115  ? 86.730  11.359  123.699  1.00 66.22  ?  115  LEU A C     1 
ATOM   876   O  O     . LEU A  1  115  ? 85.990  12.209  123.204  1.00 66.92  ?  115  LEU A O     1 
ATOM   877   C  CB    . LEU A  1  115  ? 88.668  11.480  122.113  1.00 62.81  ?  115  LEU A CB    1 
ATOM   878   C  CG    . LEU A  1  115  ? 89.789  10.789  121.332  1.00 70.14  ?  115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A  1  115  ? 90.765  11.813  120.768  1.00 64.64  ?  115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A  1  115  ? 90.510  9.773   122.207  1.00 56.35  ?  115  LEU A CD2   1 
ATOM   881   N  N     . PRO A  1  116  ? 86.753  11.086  125.013  1.00 69.16  ?  116  PRO A N     1 
ATOM   882   C  CA    . PRO A  1  116  ? 85.857  11.701  126.000  1.00 67.74  ?  116  PRO A CA    1 
ATOM   883   C  C     . PRO A  1  116  ? 85.885  13.228  125.967  1.00 67.58  ?  116  PRO A C     1 
ATOM   884   O  O     . PRO A  1  116  ? 86.957  13.831  125.925  1.00 67.04  ?  116  PRO A O     1 
ATOM   885   C  CB    . PRO A  1  116  ? 86.411  11.192  127.333  1.00 73.70  ?  116  PRO A CB    1 
ATOM   886   C  CG    . PRO A  1  116  ? 87.065  9.898   126.993  1.00 66.00  ?  116  PRO A CG    1 
ATOM   887   C  CD    . PRO A  1  116  ? 87.666  10.110  125.635  1.00 66.21  ?  116  PRO A CD    1 
ATOM   888   N  N     . VAL A  1  117  ? 84.703  13.836  125.979  1.00 63.78  ?  117  VAL A N     1 
ATOM   889   C  CA    . VAL A  1  117  ? 84.576  15.289  125.977  1.00 64.15  ?  117  VAL A CA    1 
ATOM   890   C  C     . VAL A  1  117  ? 83.808  15.734  127.221  1.00 70.69  ?  117  VAL A C     1 
ATOM   891   O  O     . VAL A  1  117  ? 82.892  15.045  127.672  1.00 67.60  ?  117  VAL A O     1 
ATOM   892   C  CB    . VAL A  1  117  ? 83.853  15.789  124.704  1.00 58.02  ?  117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A  1  117  ? 83.835  17.310  124.650  1.00 56.21  ?  117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A  1  117  ? 84.519  15.225  123.459  1.00 52.06  ?  117  VAL A CG2   1 
ATOM   895   N  N     . ALA A  1  118  ? 84.197  16.878  127.779  1.00 74.64  ?  118  ALA A N     1 
ATOM   896   C  CA    . ALA A  1  118  ? 83.548  17.420  128.969  1.00 74.12  ?  118  ALA A CA    1 
ATOM   897   C  C     . ALA A  1  118  ? 82.068  17.708  128.727  1.00 70.19  ?  118  ALA A C     1 
ATOM   898   O  O     . ALA A  1  118  ? 81.688  18.193  127.659  1.00 69.45  ?  118  ALA A O     1 
ATOM   899   C  CB    . ALA A  1  118  ? 84.265  18.680  129.433  1.00 77.48  ?  118  ALA A CB    1 
ATOM   900   N  N     . ASP A  1  119  ? 81.247  17.396  129.727  1.00 67.64  ?  119  ASP A N     1 
ATOM   901   C  CA    . ASP A  1  119  ? 79.796  17.592  129.664  1.00 76.52  ?  119  ASP A CA    1 
ATOM   902   C  C     . ASP A  1  119  ? 79.131  16.806  128.533  1.00 72.61  ?  119  ASP A C     1 
ATOM   903   O  O     . ASP A  1  119  ? 78.066  17.185  128.045  1.00 69.37  ?  119  ASP A O     1 
ATOM   904   C  CB    . ASP A  1  119  ? 79.439  19.080  129.563  1.00 78.67  ?  119  ASP A CB    1 
ATOM   905   C  CG    . ASP A  1  119  ? 79.857  19.864  130.791  1.00 79.11  ?  119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A  1  119  ? 79.974  19.255  131.876  1.00 83.22  ?  119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A  1  119  ? 80.065  21.090  130.672  1.00 80.30  ?  119  ASP A OD2   1 
ATOM   908   N  N     . VAL A  1  120  ? 79.764  15.710  128.123  1.00 65.62  ?  120  VAL A N     1 
ATOM   909   C  CA    . VAL A  1  120  ? 79.209  14.839  127.094  1.00 59.38  ?  120  VAL A CA    1 
ATOM   910   C  C     . VAL A  1  120  ? 79.320  13.379  127.516  1.00 56.04  ?  120  VAL A C     1 
ATOM   911   O  O     . VAL A  1  120  ? 80.420  12.874  127.745  1.00 56.17  ?  120  VAL A O     1 
ATOM   912   C  CB    . VAL A  1  120  ? 79.919  15.030  125.739  1.00 64.30  ?  120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A  1  120  ? 79.500  13.942  124.762  1.00 66.01  ?  120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A  1  120  ? 79.624  16.411  125.168  1.00 62.46  ?  120  VAL A CG2   1 
ATOM   915   N  N     . GLU A  1  121  ? 78.180  12.705  127.618  1.00 54.07  ?  121  GLU A N     1 
ATOM   916   C  CA    . GLU A  1  121  ? 78.159  11.313  128.052  1.00 58.39  ?  121  GLU A CA    1 
ATOM   917   C  C     . GLU A  1  121  ? 77.496  10.405  127.021  1.00 65.86  ?  121  GLU A C     1 
ATOM   918   O  O     . GLU A  1  121  ? 76.359  10.640  126.619  1.00 62.73  ?  121  GLU A O     1 
ATOM   919   C  CB    . GLU A  1  121  ? 77.434  11.183  129.393  1.00 62.17  ?  121  GLU A CB    1 
ATOM   920   C  CG    . GLU A  1  121  ? 77.293  9.748   129.882  1.00 71.71  ?  121  GLU A CG    1 
ATOM   921   C  CD    . GLU A  1  121  ? 76.331  9.617   131.048  1.00 71.49  ?  121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A  1  121  ? 75.766  10.647  131.475  1.00 66.37  ?  121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A  1  121  ? 76.137  8.483   131.535  1.00 77.09  ?  121  GLU A OE2   1 
ATOM   924   N  N     . ILE A  1  122  ? 78.209  9.365   126.599  1.00 64.50  ?  122  ILE A N     1 
ATOM   925   C  CA    . ILE A  1  122  ? 77.645  8.383   125.679  1.00 62.79  ?  122  ILE A CA    1 
ATOM   926   C  C     . ILE A  1  122  ? 76.782  7.391   126.454  1.00 59.16  ?  122  ILE A C     1 
ATOM   927   O  O     . ILE A  1  122  ? 77.264  6.716   127.364  1.00 70.50  ?  122  ILE A O     1 
ATOM   928   C  CB    . ILE A  1  122  ? 78.742  7.632   124.888  1.00 64.46  ?  122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A  1  122  ? 79.259  8.489   123.728  1.00 53.06  ?  122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A  1  122  ? 78.209  6.314   124.345  1.00 60.45  ?  122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A  1  122  ? 80.209  9.599   124.134  1.00 55.76  ?  122  ILE A CD1   1 
ATOM   932   N  N     . MET A  1  123  ? 75.503  7.319   126.098  1.00 50.98  ?  123  MET A N     1 
ATOM   933   C  CA    . MET A  1  123  ? 74.549  6.481   126.823  1.00 59.68  ?  123  MET A CA    1 
ATOM   934   C  C     . MET A  1  123  ? 74.621  5.003   126.434  1.00 61.97  ?  123  MET A C     1 
ATOM   935   O  O     . MET A  1  123  ? 74.331  4.126   127.250  1.00 55.78  ?  123  MET A O     1 
ATOM   936   C  CB    . MET A  1  123  ? 73.124  7.012   126.647  1.00 60.44  ?  123  MET A CB    1 
ATOM   937   C  CG    . MET A  1  123  ? 72.949  8.476   127.037  1.00 61.89  ?  123  MET A CG    1 
ATOM   938   S  SD    . MET A  1  123  ? 73.451  8.840   128.732  1.00 61.16  ?  123  MET A SD    1 
ATOM   939   C  CE    . MET A  1  123  ? 72.460  7.661   129.646  1.00 64.06  ?  123  MET A CE    1 
ATOM   940   N  N     . ASN A  1  124  ? 75.000  4.731   125.189  1.00 68.36  ?  124  ASN A N     1 
ATOM   941   C  CA    . ASN A  1  124  ? 75.159  3.355   124.720  1.00 65.70  ?  124  ASN A CA    1 
ATOM   942   C  C     . ASN A  1  124  ? 76.580  3.061   124.236  1.00 65.25  ?  124  ASN A C     1 
ATOM   943   O  O     . ASN A  1  124  ? 76.839  3.016   123.034  1.00 66.89  ?  124  ASN A O     1 
ATOM   944   C  CB    . ASN A  1  124  ? 74.126  3.016   123.636  1.00 53.74  ?  124  ASN A CB    1 
ATOM   945   C  CG    . ASN A  1  124  ? 74.111  4.023   122.497  1.00 49.12  ?  124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A  1  124  ? 74.527  5.171   122.657  1.00 44.76  ?  124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A  1  124  ? 73.622  3.595   121.340  1.00 45.53  ?  124  ASN A ND2   1 
ATOM   948   N  N     . PRO A  1  125  ? 77.506  2.856   125.184  1.00 60.29  ?  125  PRO A N     1 
ATOM   949   C  CA    . PRO A  1  125  ? 78.925  2.644   124.888  1.00 58.60  ?  125  PRO A CA    1 
ATOM   950   C  C     . PRO A  1  125  ? 79.202  1.305   124.205  1.00 60.42  ?  125  PRO A C     1 
ATOM   951   O  O     . PRO A  1  125  ? 80.220  1.166   123.526  1.00 57.57  ?  125  PRO A O     1 
ATOM   952   C  CB    . PRO A  1  125  ? 79.569  2.671   126.274  1.00 65.97  ?  125  PRO A CB    1 
ATOM   953   C  CG    . PRO A  1  125  ? 78.500  2.203   127.186  1.00 62.93  ?  125  PRO A CG    1 
ATOM   954   C  CD    . PRO A  1  125  ? 77.228  2.764   126.628  1.00 57.00  ?  125  PRO A CD    1 
ATOM   955   N  N     . ASP A  1  126  ? 78.306  0.339   124.377  1.00 58.63  ?  126  ASP A N     1 
ATOM   956   C  CA    . ASP A  1  126  ? 78.495  -0.994  123.808  1.00 59.71  ?  126  ASP A CA    1 
ATOM   957   C  C     . ASP A  1  126  ? 78.005  -1.083  122.365  1.00 68.33  ?  126  ASP A C     1 
ATOM   958   O  O     . ASP A  1  126  ? 78.043  -2.152  121.753  1.00 65.17  ?  126  ASP A O     1 
ATOM   959   C  CB    . ASP A  1  126  ? 77.804  -2.054  124.669  1.00 68.92  ?  126  ASP A CB    1 
ATOM   960   C  CG    . ASP A  1  126  ? 78.492  -2.260  126.003  1.00 76.94  ?  126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A  1  126  ? 79.072  -1.287  126.529  1.00 72.38  ?  126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A  1  126  ? 78.456  -3.396  126.523  1.00 77.81  ?  126  ASP A OD2   1 
ATOM   963   N  N     . LEU A  1  127  ? 77.543  0.042   121.828  1.00 69.06  ?  127  LEU A N     1 
ATOM   964   C  CA    . LEU A  1  127  ? 77.048  0.092   120.457  1.00 64.63  ?  127  LEU A CA    1 
ATOM   965   C  C     . LEU A  1  127  ? 78.180  -0.110  119.458  1.00 65.27  ?  127  LEU A C     1 
ATOM   966   O  O     . LEU A  1  127  ? 79.169  0.623   119.469  1.00 59.05  ?  127  LEU A O     1 
ATOM   967   C  CB    . LEU A  1  127  ? 76.364  1.434   120.190  1.00 60.90  ?  127  LEU A CB    1 
ATOM   968   C  CG    . LEU A  1  127  ? 76.016  1.746   118.733  1.00 55.55  ?  127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A  1  127  ? 74.925  0.814   118.223  1.00 62.43  ?  127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A  1  127  ? 75.604  3.201   118.576  1.00 42.29  ?  127  LEU A CD2   1 
ATOM   971   N  N     . HIS A  1  128  ? 78.022  -1.102  118.587  1.00 66.56  ?  128  HIS A N     1 
ATOM   972   C  CA    . HIS A  1  128  ? 79.027  -1.402  117.574  1.00 64.72  ?  128  HIS A CA    1 
ATOM   973   C  C     . HIS A  1  128  ? 79.026  -0.343  116.476  1.00 60.93  ?  128  HIS A C     1 
ATOM   974   O  O     . HIS A  1  128  ? 77.982  0.223   116.147  1.00 64.02  ?  128  HIS A O     1 
ATOM   975   C  CB    . HIS A  1  128  ? 78.785  -2.791  116.974  1.00 60.79  ?  128  HIS A CB    1 
ATOM   976   C  CG    . HIS A  1  128  ? 79.738  -3.151  115.878  1.00 62.39  ?  128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A  1  128  ? 81.101  -3.234  116.070  1.00 67.20  ?  128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A  1  128  ? 79.526  -3.449  114.573  1.00 69.50  ?  128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A  1  128  ? 81.685  -3.568  114.936  1.00 62.99  ?  128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A  1  128  ? 80.753  -3.704  114.009  1.00 65.41  ?  128  HIS A NE2   1 
ATOM   981   N  N     . ILE A  1  129  ? 80.201  -0.078  115.915  1.00 52.29  ?  129  ILE A N     1 
ATOM   982   C  CA    . ILE A  1  129  ? 80.332  0.886   114.827  1.00 60.91  ?  129  ILE A CA    1 
ATOM   983   C  C     . ILE A  1  129  ? 80.951  0.244   113.590  1.00 65.42  ?  129  ILE A C     1 
ATOM   984   O  O     . ILE A  1  129  ? 80.313  0.155   112.541  1.00 74.99  ?  129  ILE A O     1 
ATOM   985   C  CB    . ILE A  1  129  ? 81.171  2.108   115.244  1.00 59.83  ?  129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A  1  129  ? 80.471  2.870   116.369  1.00 63.90  ?  129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A  1  129  ? 81.406  3.025   114.052  1.00 55.64  ?  129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A  1  129  ? 81.205  4.114   116.803  1.00 66.88  ?  129  ILE A CD1   1 
ATOM   989   N  N     . ALA A  1  130  ? 82.199  -0.196  113.717  1.00 58.61  ?  130  ALA A N     1 
ATOM   990   C  CA    . ALA A  1  130  ? 82.904  -0.822  112.605  1.00 54.11  ?  130  ALA A CA    1 
ATOM   991   C  C     . ALA A  1  130  ? 83.883  -1.883  113.094  1.00 54.14  ?  130  ALA A C     1 
ATOM   992   O  O     . ALA A  1  130  ? 84.452  -1.761  114.178  1.00 65.50  ?  130  ALA A O     1 
ATOM   993   C  CB    . ALA A  1  130  ? 83.629  0.232   111.782  1.00 55.79  ?  130  ALA A CB    1 
ATOM   994   N  N     . THR A  1  131  ? 84.076  -2.921  112.288  1.00 56.16  ?  131  THR A N     1 
ATOM   995   C  CA    . THR A  1  131  ? 85.043  -3.967  112.601  1.00 52.70  ?  131  THR A CA    1 
ATOM   996   C  C     . THR A  1  131  ? 86.318  -3.757  111.789  1.00 52.21  ?  131  THR A C     1 
ATOM   997   O  O     . THR A  1  131  ? 86.322  -3.923  110.569  1.00 57.86  ?  131  THR A O     1 
ATOM   998   C  CB    . THR A  1  131  ? 84.472  -5.370  112.312  1.00 46.42  ?  131  THR A CB    1 
ATOM   999   O  OG1   . THR A  1  131  ? 83.338  -5.612  113.154  1.00 37.68  ?  131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A  1  131  ? 85.523  -6.441  112.565  1.00 43.12  ?  131  THR A CG2   1 
ATOM   1001  N  N     . LEU A  1  132  ? 87.397  -3.389  112.472  1.00 55.25  ?  132  LEU A N     1 
ATOM   1002  C  CA    . LEU A  1  132  ? 88.664  -3.104  111.806  1.00 53.31  ?  132  LEU A CA    1 
ATOM   1003  C  C     . LEU A  1  132  ? 89.613  -4.297  111.781  1.00 57.46  ?  132  LEU A C     1 
ATOM   1004  O  O     . LEU A  1  132  ? 89.726  -5.052  112.752  1.00 53.68  ?  132  LEU A O     1 
ATOM   1005  C  CB    . LEU A  1  132  ? 89.357  -1.885  112.422  1.00 50.61  ?  132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A  1  132  ? 89.052  -0.544  111.750  1.00 53.19  ?  132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A  1  132  ? 87.615  -0.117  112.013  1.00 53.51  ?  132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A  1  132  ? 90.030  0.528   112.204  1.00 56.06  ?  132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A  1  133  ? 90.305  -4.426  110.653  1.00 69.71  ?  133  GLU A N     1 
ATOM   1010  C  CA    . GLU A  1  133  ? 91.161  -5.561  110.352  1.00 67.19  ?  133  GLU A CA    1 
ATOM   1011  C  C     . GLU A  1  133  ? 92.621  -5.167  110.562  1.00 67.32  ?  133  GLU A C     1 
ATOM   1012  O  O     . GLU A  1  133  ? 92.916  -4.018  110.892  1.00 64.44  ?  133  GLU A O     1 
ATOM   1013  C  CB    . GLU A  1  133  ? 90.937  -5.955  108.891  1.00 77.26  ?  133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A  1  133  ? 91.337  -7.365  108.511  1.00 90.51  ?  133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A  1  133  ? 91.303  -7.577  107.011  1.00 83.61  ?  133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A  1  133  ? 90.963  -6.622  106.278  1.00 69.62  ?  133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A  1  133  ? 91.620  -8.696  106.564  1.00 85.28  ?  133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A  1  134  ? 93.533  -6.117  110.365  1.00 71.44  ?  134  GLU A N     1 
ATOM   1019  C  CA    . GLU A  1  134  ? 94.961  -5.839  110.458  1.00 70.01  ?  134  GLU A CA    1 
ATOM   1020  C  C     . GLU A  1  134  ? 95.376  -4.875  109.352  1.00 69.05  ?  134  GLU A C     1 
ATOM   1021  O  O     . GLU A  1  134  ? 95.127  -5.126  108.172  1.00 60.50  ?  134  GLU A O     1 
ATOM   1022  C  CB    . GLU A  1  134  ? 95.770  -7.135  110.352  1.00 63.59  ?  134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A  1  134  ? 96.700  -7.398  111.532  1.00 69.44  ?  134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A  1  134  ? 97.775  -6.336  111.696  1.00 66.93  ?  134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A  1  134  ? 98.250  -6.142  112.835  1.00 69.00  ?  134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A  1  134  ? 98.151  -5.700  110.689  1.00 62.09  ?  134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A  1  135  ? 96.013  -3.775  109.739  1.00 68.86  ?  135  GLY A N     1 
ATOM   1028  C  CA    . GLY A  1  135  ? 96.396  -2.744  108.793  1.00 61.69  ?  135  GLY A CA    1 
ATOM   1029  C  C     . GLY A  1  135  ? 95.283  -1.737  108.575  1.00 63.46  ?  135  GLY A C     1 
ATOM   1030  O  O     . GLY A  1  135  ? 95.498  -0.679  107.982  1.00 61.39  ?  135  GLY A O     1 
ATOM   1031  N  N     . GLY A  1  136  ? 94.090  -2.068  109.059  1.00 67.55  ?  136  GLY A N     1 
ATOM   1032  C  CA    . GLY A  1  136  ? 92.940  -1.192  108.931  1.00 66.82  ?  136  GLY A CA    1 
ATOM   1033  C  C     . GLY A  1  136  ? 93.017  0.002   109.861  1.00 68.46  ?  136  GLY A C     1 
ATOM   1034  O  O     . GLY A  1  136  ? 93.454  -0.121  111.004  1.00 75.59  ?  136  GLY A O     1 
ATOM   1035  N  N     . ARG A  1  137  ? 92.591  1.160   109.368  1.00 65.11  ?  137  ARG A N     1 
ATOM   1036  C  CA    . ARG A  1  137  ? 92.641  2.394   110.145  1.00 70.52  ?  137  ARG A CA    1 
ATOM   1037  C  C     . ARG A  1  137  ? 91.380  3.228   109.940  1.00 73.06  ?  137  ARG A C     1 
ATOM   1038  O  O     . ARG A  1  137  ? 90.949  3.448   108.808  1.00 83.75  ?  137  ARG A O     1 
ATOM   1039  C  CB    . ARG A  1  137  ? 93.877  3.211   109.764  1.00 76.72  ?  137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A  1  137  ? 95.188  2.667   110.319  1.00 79.60  ?  137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A  1  137  ? 96.392  3.166   109.529  1.00 79.08  ?  137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A  1  137  ? 96.349  4.605   109.282  1.00 86.71  ?  137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A  1  137  ? 96.022  5.154   108.115  1.00 85.36  ?  137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A  1  137  ? 95.707  4.382   107.083  1.00 74.65  ?  137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A  1  137  ? 96.009  6.473   107.979  1.00 87.66  ?  137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A  1  138  ? 90.794  3.693   111.040  1.00 65.60  ?  138  LEU A N     1 
ATOM   1047  C  CA    . LEU A  1  138  ? 89.578  4.500   110.977  1.00 60.09  ?  138  LEU A CA    1 
ATOM   1048  C  C     . LEU A  1  138  ? 89.702  5.799   111.769  1.00 56.67  ?  138  LEU A C     1 
ATOM   1049  O  O     . LEU A  1  138  ? 89.853  5.779   112.991  1.00 68.88  ?  138  LEU A O     1 
ATOM   1050  C  CB    . LEU A  1  138  ? 88.378  3.700   111.486  1.00 57.21  ?  138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A  1  138  ? 87.036  4.434   111.461  1.00 60.46  ?  138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A  1  138  ? 86.667  4.811   110.034  1.00 62.97  ?  138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A  1  138  ? 85.942  3.592   112.101  1.00 53.69  ?  138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A  1  139  ? 89.639  6.925   111.065  1.00 52.25  ?  139  ASN A N     1 
ATOM   1055  C  CA    . ASN A  1  139  ? 89.652  8.234   111.708  0.50 58.30  ?  139  ASN A CA    1 
ATOM   1056  C  C     . ASN A  1  139  ? 88.392  9.025   111.365  1.00 64.84  ?  139  ASN A C     1 
ATOM   1057  O  O     . ASN A  1  139  ? 88.195  9.427   110.218  1.00 66.96  ?  139  ASN A O     1 
ATOM   1058  C  CB    . ASN A  1  139  ? 90.903  9.018   111.305  0.50 53.28  ?  139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A  1  139  ? 91.031  10.336  112.044  0.50 58.00  ?  139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A  1  139  ? 90.410  10.541  113.087  0.50 59.73  ?  139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A  1  139  ? 91.845  11.237  111.507  0.50 58.01  ?  139  ASN A ND2   1 
ATOM   1062  N  N     . MET A  1  140  ? 87.545  9.249   112.367  1.00 65.36  ?  140  MET A N     1 
ATOM   1063  C  CA    . MET A  1  140  ? 86.264  9.916   112.163  1.00 56.71  ?  140  MET A CA    1 
ATOM   1064  C  C     . MET A  1  140  ? 86.091  11.154  113.033  1.00 56.48  ?  140  MET A C     1 
ATOM   1065  O  O     . MET A  1  140  ? 86.525  11.188  114.185  1.00 65.13  ?  140  MET A O     1 
ATOM   1066  C  CB    . MET A  1  140  ? 85.108  8.955   112.448  1.00 49.74  ?  140  MET A CB    1 
ATOM   1067  C  CG    . MET A  1  140  ? 85.091  7.707   111.592  1.00 60.05  ?  140  MET A CG    1 
ATOM   1068  S  SD    . MET A  1  140  ? 83.639  6.691   111.922  1.00 90.64  ?  140  MET A SD    1 
ATOM   1069  C  CE    . MET A  1  140  ? 83.771  6.475   113.695  1.00 69.88  ?  140  MET A CE    1 
ATOM   1070  N  N     . GLU A  1  141  ? 85.448  12.168  112.465  1.00 54.74  ?  141  GLU A N     1 
ATOM   1071  C  CA    . GLU A  1  141  ? 84.974  13.313  113.226  1.00 55.45  ?  141  GLU A CA    1 
ATOM   1072  C  C     . GLU A  1  141  ? 83.482  13.444  112.959  1.00 55.83  ?  141  GLU A C     1 
ATOM   1073  O  O     . GLU A  1  141  ? 83.071  13.747  111.838  1.00 60.48  ?  141  GLU A O     1 
ATOM   1074  C  CB    . GLU A  1  141  ? 85.694  14.589  112.791  1.00 52.93  ?  141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A  1  141  ? 87.208  14.502  112.859  1.00 63.46  ?  141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A  1  141  ? 87.884  15.806  112.482  1.00 76.42  ?  141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A  1  141  ? 87.169  16.783  112.174  1.00 73.06  ?  141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A  1  141  ? 89.132  15.853  112.496  1.00 81.04  ?  141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A  1  142  ? 82.668  13.213  113.984  1.00 49.90  ?  142  VAL A N     1 
ATOM   1080  C  CA    . VAL A  1  142  ? 81.220  13.243  113.801  1.00 40.10  ?  142  VAL A CA    1 
ATOM   1081  C  C     . VAL A  1  142  ? 80.590  14.435  114.516  1.00 46.39  ?  142  VAL A C     1 
ATOM   1082  O  O     . VAL A  1  142  ? 80.961  14.769  115.641  1.00 49.82  ?  142  VAL A O     1 
ATOM   1083  C  CB    . VAL A  1  142  ? 80.554  11.898  114.217  1.00 34.06  ?  142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A  1  142  ? 81.605  10.900  114.683  1.00 37.69  ?  142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A  1  142  ? 79.484  12.107  115.284  1.00 32.91  ?  142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A  1  143  ? 79.654  15.094  113.841  1.00 44.78  ?  143  ARG A N     1 
ATOM   1087  C  CA    . ARG A  1  143  ? 78.977  16.248  114.411  1.00 39.89  ?  143  ARG A CA    1 
ATOM   1088  C  C     . ARG A  1  143  ? 77.593  15.888  114.935  1.00 49.65  ?  143  ARG A C     1 
ATOM   1089  O  O     . ARG A  1  143  ? 76.709  15.483  114.169  1.00 52.91  ?  143  ARG A O     1 
ATOM   1090  C  CB    . ARG A  1  143  ? 78.876  17.382  113.393  1.00 34.98  ?  143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A  1  143  ? 78.067  18.558  113.896  1.00 41.25  ?  143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A  1  143  ? 78.113  19.734  112.943  1.00 40.88  ?  143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A  1  143  ? 77.216  20.800  113.376  1.00 39.76  ?  143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A  1  143  ? 77.164  22.006  112.822  1.00 55.64  ?  143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A  1  143  ? 77.967  22.307  111.810  1.00 61.63  ?  143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A  1  143  ? 76.313  22.912  113.283  1.00 59.47  ?  143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A  1  144  ? 77.426  16.041  116.248  1.00 52.22  ?  144  VAL A N     1 
ATOM   1098  C  CA    . VAL A  1  144  ? 76.168  15.770  116.935  1.00 45.66  ?  144  VAL A CA    1 
ATOM   1099  C  C     . VAL A  1  144  ? 75.537  17.081  117.397  1.00 49.29  ?  144  VAL A C     1 
ATOM   1100  O  O     . VAL A  1  144  ? 76.203  17.904  118.026  1.00 51.47  ?  144  VAL A O     1 
ATOM   1101  C  CB    . VAL A  1  144  ? 76.393  14.868  118.164  1.00 41.99  ?  144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A  1  144  ? 75.094  14.664  118.927  1.00 47.48  ?  144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A  1  144  ? 76.990  13.532  117.743  1.00 41.85  ?  144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A  1  145  ? 74.256  17.270  117.091  1.00 53.26  ?  145  ASP A N     1 
ATOM   1105  C  CA    . ASP A  1  145  ? 73.566  18.519  117.411  1.00 55.17  ?  145  ASP A CA    1 
ATOM   1106  C  C     . ASP A  1  145  ? 72.317  18.323  118.264  1.00 54.51  ?  145  ASP A C     1 
ATOM   1107  O  O     . ASP A  1  145  ? 71.759  17.228  118.337  1.00 46.60  ?  145  ASP A O     1 
ATOM   1108  C  CB    . ASP A  1  145  ? 73.169  19.258  116.129  1.00 51.12  ?  145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A  1  145  ? 74.342  19.935  115.454  1.00 62.66  ?  145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A  1  145  ? 75.063  19.258  114.692  1.00 65.80  ?  145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A  1  145  ? 74.536  21.149  115.674  1.00 67.19  ?  145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A  1  146  ? 71.891  19.404  118.911  1.00 57.70  ?  146  ARG A N     1 
ATOM   1113  C  CA    . ARG A  1  146  ? 70.583  19.457  119.547  1.00 58.46  ?  146  ARG A CA    1 
ATOM   1114  C  C     . ARG A  1  146  ? 69.543  19.767  118.482  1.00 57.25  ?  146  ARG A C     1 
ATOM   1115  O  O     . ARG A  1  146  ? 69.829  20.472  117.515  1.00 60.15  ?  146  ARG A O     1 
ATOM   1116  C  CB    . ARG A  1  146  ? 70.540  20.541  120.626  1.00 63.46  ?  146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A  1  146  ? 71.189  20.157  121.943  1.00 74.76  ?  146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A  1  146  ? 70.919  21.216  123.004  1.00 72.51  ?  146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A  1  146  ? 71.482  20.853  124.302  1.00 74.77  ?  146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A  1  146  ? 70.833  20.154  125.229  1.00 80.17  ?  146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A  1  146  ? 69.593  19.740  125.002  1.00 81.39  ?  146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A  1  146  ? 71.423  19.869  126.382  1.00 79.49  ?  146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A  1  147  ? 68.337  19.242  118.661  1.00 55.40  ?  147  GLY A N     1 
ATOM   1124  C  CA    . GLY A  1  147  ? 67.261  19.492  117.722  1.00 49.39  ?  147  GLY A CA    1 
ATOM   1125  C  C     . GLY A  1  147  ? 65.957  18.867  118.169  1.00 51.20  ?  147  GLY A C     1 
ATOM   1126  O  O     . GLY A  1  147  ? 65.860  18.326  119.271  1.00 48.17  ?  147  GLY A O     1 
ATOM   1127  N  N     . VAL A  1  148  ? 64.948  18.941  117.309  1.00 47.94  ?  148  VAL A N     1 
ATOM   1128  C  CA    . VAL A  1  148  ? 63.645  18.372  117.621  1.00 54.33  ?  148  VAL A CA    1 
ATOM   1129  C  C     . VAL A  1  148  ? 63.012  17.737  116.383  1.00 54.03  ?  148  VAL A C     1 
ATOM   1130  O  O     . VAL A  1  148  ? 63.047  18.305  115.290  1.00 35.97  ?  148  VAL A O     1 
ATOM   1131  C  CB    . VAL A  1  148  ? 62.702  19.434  118.243  1.00 45.18  ?  148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A  1  148  ? 62.652  20.687  117.376  1.00 47.56  ?  148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A  1  148  ? 61.309  18.863  118.470  1.00 44.11  ?  148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A  1  149  ? 62.451  16.544  116.559  1.00 56.76  ?  149  GLY A N     1 
ATOM   1135  C  CA    . GLY A  1  149  ? 61.778  15.853  115.477  1.00 55.75  ?  149  GLY A CA    1 
ATOM   1136  C  C     . GLY A  1  149  ? 62.734  15.126  114.554  1.00 49.74  ?  149  GLY A C     1 
ATOM   1137  O  O     . GLY A  1  149  ? 63.870  14.831  114.924  1.00 48.92  ?  149  GLY A O     1 
ATOM   1138  N  N     . TYR A  1  150  ? 62.266  14.839  113.343  1.00 46.15  ?  150  TYR A N     1 
ATOM   1139  C  CA    . TYR A  1  150  ? 63.059  14.111  112.361  1.00 46.17  ?  150  TYR A CA    1 
ATOM   1140  C  C     . TYR A  1  150  ? 63.417  14.999  111.176  1.00 48.46  ?  150  TYR A C     1 
ATOM   1141  O  O     . TYR A  1  150  ? 62.549  15.381  110.389  1.00 49.82  ?  150  TYR A O     1 
ATOM   1142  C  CB    . TYR A  1  150  ? 62.297  12.871  111.887  1.00 49.52  ?  150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A  1  150  ? 62.858  12.226  110.639  1.00 49.04  ?  150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A  1  150  ? 64.011  11.453  110.689  1.00 50.49  ?  150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A  1  150  ? 62.224  12.377  109.412  1.00 45.77  ?  150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A  1  150  ? 64.521  10.856  109.550  1.00 52.29  ?  150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A  1  150  ? 62.727  11.785  108.268  1.00 48.14  ?  150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A  1  150  ? 63.875  11.026  108.342  1.00 48.30  ?  150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A  1  150  ? 64.378  10.436  107.206  1.00 44.90  ?  150  TYR A OH    1 
ATOM   1150  N  N     . VAL A  1  151  ? 64.699  15.328  111.057  1.00 48.90  ?  151  VAL A N     1 
ATOM   1151  C  CA    . VAL A  1  151  ? 65.180  16.164  109.963  1.00 41.42  ?  151  VAL A CA    1 
ATOM   1152  C  C     . VAL A  1  151  ? 66.106  15.373  109.049  1.00 44.71  ?  151  VAL A C     1 
ATOM   1153  O  O     . VAL A  1  151  ? 67.218  15.021  109.443  1.00 47.03  ?  151  VAL A O     1 
ATOM   1154  C  CB    . VAL A  1  151  ? 65.933  17.399  110.483  1.00 35.57  ?  151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A  1  151  ? 66.454  18.227  109.320  1.00 36.93  ?  151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A  1  151  ? 65.029  18.234  111.377  1.00 36.34  ?  151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A  1  152  ? 65.644  15.086  107.822  1.00 51.57  ?  152  PRO A N     1 
ATOM   1158  C  CA    . PRO A  1  152  ? 66.423  14.326  106.838  1.00 55.40  ?  152  PRO A CA    1 
ATOM   1159  C  C     . PRO A  1  152  ? 67.702  15.056  106.446  1.00 50.80  ?  152  PRO A C     1 
ATOM   1160  O  O     . PRO A  1  152  ? 67.749  16.286  106.516  1.00 43.58  ?  152  PRO A O     1 
ATOM   1161  C  CB    . PRO A  1  152  ? 65.478  14.242  105.633  1.00 54.97  ?  152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A  1  152  ? 64.114  14.453  106.198  1.00 44.41  ?  152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A  1  152  ? 64.306  15.430  107.314  1.00 51.82  ?  152  PRO A CD    1 
ATOM   1164  N  N     . ALA A  1  153  ? 68.718  14.301  106.039  1.00 49.62  ?  153  ALA A N     1 
ATOM   1165  C  CA    . ALA A  1  153  ? 70.004  14.870  105.647  1.00 45.08  ?  153  ALA A CA    1 
ATOM   1166  C  C     . ALA A  1  153  ? 69.844  15.890  104.527  1.00 45.87  ?  153  ALA A C     1 
ATOM   1167  O  O     . ALA A  1  153  ? 70.578  16.876  104.461  1.00 46.86  ?  153  ALA A O     1 
ATOM   1168  C  CB    . ALA A  1  153  ? 70.962  13.767  105.223  1.00 40.81  ?  153  ALA A CB    1 
ATOM   1169  N  N     . GLU A  1  154  ? 68.870  15.648  103.657  1.00 49.56  ?  154  GLU A N     1 
ATOM   1170  C  CA    . GLU A  1  154  ? 68.613  16.516  102.515  1.00 47.84  ?  154  GLU A CA    1 
ATOM   1171  C  C     . GLU A  1  154  ? 68.160  17.905  102.951  1.00 46.87  ?  154  GLU A C     1 
ATOM   1172  O  O     . GLU A  1  154  ? 68.442  18.896  102.279  1.00 45.16  ?  154  GLU A O     1 
ATOM   1173  C  CB    . GLU A  1  154  ? 67.571  15.889  101.583  1.00 48.43  ?  154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A  1  154  ? 68.072  14.684  100.792  1.00 58.80  ?  154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A  1  154  ? 68.370  13.479  101.668  1.00 70.81  ?  154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A  1  154  ? 67.619  13.247  102.640  1.00 67.13  ?  154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A  1  154  ? 69.361  12.771  101.389  1.00 66.98  ?  154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A  1  155  ? 67.453  17.973  104.074  1.00 55.73  ?  155  LYS A N     1 
ATOM   1179  C  CA    . LYS A  1  155  ? 66.939  19.247  104.569  1.00 55.07  ?  155  LYS A CA    1 
ATOM   1180  C  C     . LYS A  1  155  ? 68.007  20.133  105.209  1.00 51.06  ?  155  LYS A C     1 
ATOM   1181  O  O     . LYS A  1  155  ? 68.132  21.307  104.857  1.00 48.85  ?  155  LYS A O     1 
ATOM   1182  C  CB    . LYS A  1  155  ? 65.781  19.022  105.547  1.00 54.56  ?  155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A  1  155  ? 64.410  19.269  104.938  1.00 57.06  ?  155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A  1  155  ? 64.286  20.704  104.447  1.00 62.96  ?  155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A  1  155  ? 62.986  20.926  103.688  1.00 66.22  ?  155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A  1  155  ? 62.932  20.135  102.426  1.00 47.25  ?  155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A  1  156  ? 68.774  19.578  106.144  1.00 53.39  ?  156  HIS A N     1 
ATOM   1188  C  CA    . HIS A  1  156  ? 69.787  20.369  106.842  1.00 50.31  ?  156  HIS A CA    1 
ATOM   1189  C  C     . HIS A  1  156  ? 71.080  20.541  106.042  1.00 53.69  ?  156  HIS A C     1 
ATOM   1190  O  O     . HIS A  1  156  ? 71.635  21.640  105.984  1.00 46.73  ?  156  HIS A O     1 
ATOM   1191  C  CB    . HIS A  1  156  ? 70.055  19.838  108.263  1.00 45.19  ?  156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A  1  156  ? 70.611  18.444  108.311  1.00 44.53  ?  156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A  1  156  ? 71.915  18.151  107.985  1.00 47.95  ?  156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A  1  156  ? 70.040  17.272  108.679  1.00 44.34  ?  156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A  1  156  ? 72.123  16.851  108.134  1.00 43.22  ?  156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A  1  156  ? 71.003  16.298  108.554  1.00 41.42  ?  156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A  1  157  ? 71.537  19.460  105.413  1.00 51.91  ?  157  GLY A N     1 
ATOM   1198  C  CA    . GLY A  1  157  ? 72.758  19.476  104.624  1.00 53.53  ?  157  GLY A CA    1 
ATOM   1199  C  C     . GLY A  1  157  ? 73.959  20.026  105.372  1.00 56.61  ?  157  GLY A C     1 
ATOM   1200  O  O     . GLY A  1  157  ? 74.744  20.799  104.821  1.00 55.45  ?  157  GLY A O     1 
ATOM   1201  N  N     . ILE A  1  158  ? 74.102  19.623  106.631  1.00 57.95  ?  158  ILE A N     1 
ATOM   1202  C  CA    . ILE A  1  158  ? 75.153  20.155  107.490  1.00 57.32  ?  158  ILE A CA    1 
ATOM   1203  C  C     . ILE A  1  158  ? 76.504  19.507  107.207  1.00 65.30  ?  158  ILE A C     1 
ATOM   1204  O  O     . ILE A  1  158  ? 76.665  18.292  107.339  1.00 63.37  ?  158  ILE A O     1 
ATOM   1205  C  CB    . ILE A  1  158  ? 74.806  19.970  108.980  1.00 52.28  ?  158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A  1  158  ? 73.579  20.808  109.349  1.00 47.42  ?  158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A  1  158  ? 75.990  20.347  109.856  1.00 54.15  ?  158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A  1  158  ? 73.185  20.703  110.807  1.00 54.75  ?  158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A  1  159  ? 77.471  20.333  106.819  1.00 64.84  ?  159  LYS A N     1 
ATOM   1210  C  CA    . LYS A  1  159  ? 78.820  19.868  106.522  1.00 63.93  ?  159  LYS A CA    1 
ATOM   1211  C  C     . LYS A  1  159  ? 79.844  20.809  107.146  1.00 68.13  ?  159  LYS A C     1 
ATOM   1212  O  O     . LYS A  1  159  ? 79.833  22.011  106.880  1.00 69.88  ?  159  LYS A O     1 
ATOM   1213  C  CB    . LYS A  1  159  ? 79.039  19.791  105.007  1.00 58.82  ?  159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A  1  159  ? 78.016  18.939  104.269  1.00 60.06  ?  159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A  1  159  ? 78.175  19.030  102.758  1.00 65.88  ?  159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A  1  159  ? 79.422  18.307  102.280  1.00 64.93  ?  159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A  1  159  ? 79.459  18.197  100.795  1.00 56.52  ?  159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A  1  160  ? 80.726  20.262  107.978  1.00 71.69  ?  160  ASP A N     1 
ATOM   1219  C  CA    . ASP A  1  160  ? 81.787  21.058  108.586  1.00 76.94  ?  160  ASP A CA    1 
ATOM   1220  C  C     . ASP A  1  160  ? 82.903  21.321  107.581  1.00 70.90  ?  160  ASP A C     1 
ATOM   1221  O  O     . ASP A  1  160  ? 83.427  22.432  107.497  1.00 60.17  ?  160  ASP A O     1 
ATOM   1222  C  CB    . ASP A  1  160  ? 82.343  20.368  109.835  1.00 75.25  ?  160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A  1  160  ? 81.365  20.386  110.997  1.00 75.26  ?  160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A  1  160  ? 80.544  21.326  111.071  1.00 66.61  ?  160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A  1  160  ? 81.420  19.463  111.838  1.00 69.74  ?  160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A  1  161  ? 83.261  20.293  106.819  1.00 74.09  ?  161  ARG A N     1 
ATOM   1227  C  CA    . ARG A  1  161  ? 84.259  20.436  105.766  1.00 76.93  ?  161  ARG A CA    1 
ATOM   1228  C  C     . ARG A  1  161  ? 83.758  19.875  104.436  1.00 72.36  ?  161  ARG A C     1 
ATOM   1229  O  O     . ARG A  1  161  ? 82.637  19.376  104.346  1.00 69.73  ?  161  ARG A O     1 
ATOM   1230  C  CB    . ARG A  1  161  ? 85.582  19.783  106.174  1.00 77.21  ?  161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A  1  161  ? 85.473  18.323  106.570  1.00 68.31  ?  161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A  1  161  ? 86.804  17.814  107.097  1.00 78.02  ?  161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A  1  161  ? 87.198  18.488  108.331  1.00 84.16  ?  161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A  1  161  ? 88.378  18.332  108.925  1.00 86.84  ?  161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A  1  161  ? 89.289  17.528  108.394  1.00 85.78  ?  161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A  1  161  ? 88.649  18.984  110.048  1.00 84.86  ?  161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A  1  162  ? 84.600  19.959  103.411  1.00 71.36  ?  162  ILE A N     1 
ATOM   1238  C  CA    . ILE A  1  162  ? 84.200  19.622  102.046  1.00 73.51  ?  162  ILE A CA    1 
ATOM   1239  C  C     . ILE A  1  162  ? 83.841  18.144  101.862  1.00 70.55  ?  162  ILE A C     1 
ATOM   1240  O  O     . ILE A  1  162  ? 82.921  17.811  101.114  1.00 65.77  ?  162  ILE A O     1 
ATOM   1241  C  CB    . ILE A  1  162  ? 85.300  20.016  101.032  1.00 70.49  ?  162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A  1  162  ? 85.844  21.413  101.346  1.00 61.36  ?  162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A  1  162  ? 84.769  19.950  99.607   1.00 70.23  ?  162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A  1  162  ? 84.813  22.518  101.235  1.00 56.83  ?  162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A  1  163  ? 84.563  17.264  102.547  1.00 67.64  ?  163  ASN A N     1 
ATOM   1246  C  CA    . ASN A  1  163  ? 84.347  15.825  102.405  1.00 66.95  ?  163  ASN A CA    1 
ATOM   1247  C  C     . ASN A  1  163  ? 83.384  15.232  103.432  1.00 65.39  ?  163  ASN A C     1 
ATOM   1248  O  O     . ASN A  1  163  ? 83.191  14.017  103.481  1.00 62.37  ?  163  ASN A O     1 
ATOM   1249  C  CB    . ASN A  1  163  ? 85.679  15.073  102.425  1.00 70.24  ?  163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A  1  163  ? 86.534  15.374  101.210  1.00 75.23  ?  163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A  1  163  ? 86.018  15.670  100.131  1.00 68.27  ?  163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A  1  163  ? 87.849  15.299  101.378  1.00 80.36  ?  163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A  1  164  ? 82.791  16.091  104.255  1.00 65.55  ?  164  ALA A N     1 
ATOM   1254  C  CA    . ALA A  1  164  ? 81.842  15.648  105.273  1.00 60.09  ?  164  ALA A CA    1 
ATOM   1255  C  C     . ALA A  1  164  ? 80.568  15.074  104.654  1.00 58.08  ?  164  ALA A C     1 
ATOM   1256  O  O     . ALA A  1  164  ? 80.185  15.440  103.543  1.00 58.51  ?  164  ALA A O     1 
ATOM   1257  C  CB    . ALA A  1  164  ? 81.504  16.794  106.213  1.00 63.83  ?  164  ALA A CB    1 
ATOM   1258  N  N     . ILE A  1  165  ? 79.919  14.169  105.380  1.00 56.89  ?  165  ILE A N     1 
ATOM   1259  C  CA    . ILE A  1  165  ? 78.684  13.546  104.915  1.00 48.73  ?  165  ILE A CA    1 
ATOM   1260  C  C     . ILE A  1  165  ? 77.503  13.924  105.804  1.00 51.63  ?  165  ILE A C     1 
ATOM   1261  O  O     . ILE A  1  165  ? 77.476  13.572  106.983  1.00 57.34  ?  165  ILE A O     1 
ATOM   1262  C  CB    . ILE A  1  165  ? 78.797  12.011  104.911  1.00 44.29  ?  165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A  1  165  ? 80.044  11.562  104.149  1.00 43.09  ?  165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A  1  165  ? 77.544  11.389  104.317  1.00 48.25  ?  165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A  1  165  ? 80.294  10.073  104.229  1.00 43.26  ?  165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A  1  166  ? 76.523  14.650  105.242  1.00 47.13  ?  166  PRO A N     1 
ATOM   1267  C  CA    . PRO A  1  166  ? 75.301  14.966  105.988  1.00 46.17  ?  166  PRO A CA    1 
ATOM   1268  C  C     . PRO A  1  166  ? 74.564  13.689  106.376  1.00 50.76  ?  166  PRO A C     1 
ATOM   1269  O  O     . PRO A  1  166  ? 74.515  12.746  105.585  1.00 47.70  ?  166  PRO A O     1 
ATOM   1270  C  CB    . PRO A  1  166  ? 74.474  15.767  104.979  1.00 39.58  ?  166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A  1  166  ? 75.474  16.340  104.042  1.00 43.39  ?  166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A  1  166  ? 76.547  15.299  103.922  1.00 55.98  ?  166  PRO A CD    1 
ATOM   1273  N  N     . VAL A  1  167  ? 74.007  13.661  107.583  1.00 51.05  ?  167  VAL A N     1 
ATOM   1274  C  CA    . VAL A  1  167  ? 73.336  12.471  108.091  1.00 45.23  ?  167  VAL A CA    1 
ATOM   1275  C  C     . VAL A  1  167  ? 71.896  12.787  108.485  1.00 42.79  ?  167  VAL A C     1 
ATOM   1276  O  O     . VAL A  1  167  ? 71.610  13.871  108.997  1.00 34.36  ?  167  VAL A O     1 
ATOM   1277  C  CB    . VAL A  1  167  ? 74.080  11.893  109.317  1.00 41.90  ?  167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A  1  167  ? 73.462  10.574  109.754  1.00 42.05  ?  167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A  1  167  ? 75.555  11.707  109.005  1.00 47.63  ?  167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A  1  168  ? 70.993  11.845  108.227  1.00 51.68  ?  168  ASP A N     1 
ATOM   1281  C  CA    . ASP A  1  168  ? 69.617  11.956  108.695  1.00 51.05  ?  168  ASP A CA    1 
ATOM   1282  C  C     . ASP A  1  168  ? 69.613  11.974  110.219  1.00 46.29  ?  168  ASP A C     1 
ATOM   1283  O  O     . ASP A  1  168  ? 70.175  11.085  110.861  1.00 41.42  ?  168  ASP A O     1 
ATOM   1284  C  CB    . ASP A  1  168  ? 68.777  10.781  108.187  1.00 53.38  ?  168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A  1  168  ? 68.685  10.737  106.674  1.00 54.23  ?  168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A  1  168  ? 68.516  11.808  106.053  1.00 49.95  ?  168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A  1  168  ? 68.782  9.629   106.105  1.00 60.13  ?  168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A  1  169  ? 68.977  12.987  110.794  1.00 47.12  ?  169  ALA A N     1 
ATOM   1289  C  CA    . ALA A  1  169  ? 68.988  13.163  112.240  1.00 47.67  ?  169  ALA A CA    1 
ATOM   1290  C  C     . ALA A  1  169  ? 67.631  12.871  112.869  1.00 46.16  ?  169  ALA A C     1 
ATOM   1291  O  O     . ALA A  1  169  ? 66.645  13.549  112.579  1.00 45.22  ?  169  ALA A O     1 
ATOM   1292  C  CB    . ALA A  1  169  ? 69.441  14.572  112.596  1.00 44.85  ?  169  ALA A CB    1 
ATOM   1293  N  N     . VAL A  1  170  ? 67.586  11.862  113.732  1.00 39.59  ?  170  VAL A N     1 
ATOM   1294  C  CA    . VAL A  1  170  ? 66.393  11.617  114.524  1.00 45.29  ?  170  VAL A CA    1 
ATOM   1295  C  C     . VAL A  1  170  ? 66.658  12.157  115.921  1.00 49.03  ?  170  VAL A C     1 
ATOM   1296  O  O     . VAL A  1  170  ? 67.385  11.549  116.708  1.00 55.21  ?  170  VAL A O     1 
ATOM   1297  C  CB    . VAL A  1  170  ? 66.079  10.115  114.615  1.00 46.66  ?  170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A  1  170  ? 64.832  9.883   115.453  1.00 46.33  ?  170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A  1  170  ? 65.915  9.522   113.224  1.00 36.79  ?  170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A  1  171  ? 66.046  13.294  116.230  1.00 44.57  ?  171  PHE A N     1 
ATOM   1301  C  CA    . PHE A  1  171  ? 66.332  13.994  117.476  1.00 47.53  ?  171  PHE A CA    1 
ATOM   1302  C  C     . PHE A  1  171  ? 65.583  13.436  118.681  1.00 48.64  ?  171  PHE A C     1 
ATOM   1303  O  O     . PHE A  1  171  ? 66.121  13.406  119.787  1.00 49.59  ?  171  PHE A O     1 
ATOM   1304  C  CB    . PHE A  1  171  ? 66.059  15.493  117.328  1.00 47.15  ?  171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A  1  171  ? 67.019  16.196  116.410  1.00 47.96  ?  171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A  1  171  ? 68.368  16.263  116.717  1.00 52.41  ?  171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A  1  171  ? 66.571  16.803  115.249  1.00 50.51  ?  171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A  1  171  ? 69.255  16.914  115.878  1.00 51.79  ?  171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A  1  171  ? 67.453  17.456  114.405  1.00 44.52  ?  171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A  1  171  ? 68.796  17.510  114.721  1.00 41.05  ?  171  PHE A CZ    1 
ATOM   1311  N  N     . SER A  1  172  ? 64.348  12.994  118.460  1.00 48.43  ?  172  SER A N     1 
ATOM   1312  C  CA    . SER A  1  172  ? 63.478  12.575  119.555  1.00 49.05  ?  172  SER A CA    1 
ATOM   1313  C  C     . SER A  1  172  ? 64.088  11.441  120.376  1.00 51.72  ?  172  SER A C     1 
ATOM   1314  O  O     . SER A  1  172  ? 64.312  10.343  119.865  1.00 51.75  ?  172  SER A O     1 
ATOM   1315  C  CB    . SER A  1  172  ? 62.102  12.165  119.022  1.00 50.71  ?  172  SER A CB    1 
ATOM   1316  O  OG    . SER A  1  172  ? 61.204  11.880  120.081  1.00 45.09  ?  172  SER A OG    1 
ATOM   1317  N  N     . PRO A  1  173  ? 64.367  11.719  121.658  1.00 50.19  ?  173  PRO A N     1 
ATOM   1318  C  CA    . PRO A  1  173  ? 64.949  10.768  122.610  1.00 47.68  ?  173  PRO A CA    1 
ATOM   1319  C  C     . PRO A  1  173  ? 63.958  9.692   123.034  1.00 44.55  ?  173  PRO A C     1 
ATOM   1320  O  O     . PRO A  1  173  ? 64.364  8.641   123.530  1.00 42.06  ?  173  PRO A O     1 
ATOM   1321  C  CB    . PRO A  1  173  ? 65.306  11.653  123.804  1.00 46.93  ?  173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A  1  173  ? 64.318  12.755  123.744  1.00 44.35  ?  173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A  1  173  ? 64.083  13.020  122.289  1.00 42.35  ?  173  PRO A CD    1 
ATOM   1324  N  N     . VAL A  1  174  ? 62.670  9.956   122.841  1.00 43.29  ?  174  VAL A N     1 
ATOM   1325  C  CA    . VAL A  1  174  ? 61.635  9.037   123.295  1.00 46.57  ?  174  VAL A CA    1 
ATOM   1326  C  C     . VAL A  1  174  ? 61.454  7.879   122.323  1.00 39.58  ?  174  VAL A C     1 
ATOM   1327  O  O     . VAL A  1  174  ? 61.099  8.080   121.162  1.00 39.77  ?  174  VAL A O     1 
ATOM   1328  C  CB    . VAL A  1  174  ? 60.288  9.757   123.458  1.00 42.89  ?  174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A  1  174  ? 59.257  8.808   124.033  1.00 34.25  ?  174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A  1  174  ? 60.446  10.985  124.344  1.00 42.69  ?  174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A  1  175  ? 61.703  6.666   122.804  1.00 35.24  ?  175  ARG A N     1 
ATOM   1332  C  CA    . ARG A  1  175  ? 61.558  5.475   121.975  1.00 34.54  ?  175  ARG A CA    1 
ATOM   1333  C  C     . ARG A  1  175  ? 60.124  4.952   121.880  1.00 35.50  ?  175  ARG A C     1 
ATOM   1334  O  O     . ARG A  1  175  ? 59.665  4.596   120.796  1.00 38.75  ?  175  ARG A O     1 
ATOM   1335  C  CB    . ARG A  1  175  ? 62.515  4.374   122.438  1.00 34.88  ?  175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A  1  175  ? 63.974  4.789   122.359  1.00 45.23  ?  175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A  1  175  ? 64.908  3.592   122.309  1.00 62.95  ?  175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A  1  175  ? 66.292  4.008   122.099  1.00 77.47  ?  175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A  1  175  ? 66.816  4.289   120.909  1.00 83.95  ?  175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A  1  175  ? 66.072  4.200   119.814  1.00 66.62  ?  175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A  1  175  ? 68.086  4.662   120.813  1.00 81.17  ?  175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A  1  176  ? 59.416  4.907   123.006  1.00 41.06  ?  176  ARG A N     1 
ATOM   1343  C  CA    . ARG A  1  176  ? 58.051  4.376   122.999  1.00 31.75  ?  176  ARG A CA    1 
ATOM   1344  C  C     . ARG A  1  176  ? 57.153  5.007   124.062  1.00 34.72  ?  176  ARG A C     1 
ATOM   1345  O  O     . ARG A  1  176  ? 57.603  5.314   125.161  1.00 41.50  ?  176  ARG A O     1 
ATOM   1346  C  CB    . ARG A  1  176  ? 58.075  2.850   123.154  1.00 29.95  ?  176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A  1  176  ? 56.709  2.182   123.104  1.00 29.10  ?  176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A  1  176  ? 56.769  0.860   122.350  1.00 46.46  ?  176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A  1  176  ? 57.701  -0.090  122.952  1.00 54.38  ?  176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A  1  176  ? 57.333  -1.141  123.678  1.00 58.27  ?  176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A  1  176  ? 56.047  -1.386  123.890  1.00 53.60  ?  176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A  1  176  ? 58.251  -1.952  124.188  1.00 56.16  ?  176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A  1  177  ? 55.882  5.206   123.727  1.00 32.41  ?  177  VAL A N     1 
ATOM   1354  C  CA    . VAL A  1  177  ? 54.914  5.730   124.687  1.00 32.64  ?  177  VAL A CA    1 
ATOM   1355  C  C     . VAL A  1  177  ? 53.607  4.949   124.629  1.00 35.39  ?  177  VAL A C     1 
ATOM   1356  O  O     . VAL A  1  177  ? 53.044  4.748   123.554  1.00 38.06  ?  177  VAL A O     1 
ATOM   1357  C  CB    . VAL A  1  177  ? 54.604  7.225   124.444  1.00 32.10  ?  177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A  1  177  ? 53.498  7.691   125.373  1.00 35.61  ?  177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A  1  177  ? 55.844  8.072   124.646  1.00 32.62  ?  177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A  1  178  ? 53.134  4.504   125.788  1.00 41.01  ?  178  ALA A N     1 
ATOM   1361  C  CA    . ALA A  1  178  ? 51.831  3.854   125.881  1.00 36.83  ?  178  ALA A CA    1 
ATOM   1362  C  C     . ALA A  1  178  ? 51.068  4.427   127.065  1.00 35.77  ?  178  ALA A C     1 
ATOM   1363  O  O     . ALA A  1  178  ? 51.672  4.975   127.979  1.00 42.64  ?  178  ALA A O     1 
ATOM   1364  C  CB    . ALA A  1  178  ? 51.997  2.354   126.035  1.00 31.39  ?  178  ALA A CB    1 
ATOM   1365  N  N     . PHE A  1  179  ? 49.744  4.329   127.048  1.00 33.78  ?  179  PHE A N     1 
ATOM   1366  C  CA    . PHE A  1  179  ? 48.971  4.715   128.226  1.00 28.96  ?  179  PHE A CA    1 
ATOM   1367  C  C     . PHE A  1  179  ? 47.764  3.817   128.467  1.00 32.28  ?  179  PHE A C     1 
ATOM   1368  O  O     . PHE A  1  179  ? 47.010  3.500   127.548  1.00 34.58  ?  179  PHE A O     1 
ATOM   1369  C  CB    . PHE A  1  179  ? 48.585  6.202   128.204  1.00 29.86  ?  179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A  1  179  ? 47.517  6.552   127.208  1.00 33.34  ?  179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A  1  179  ? 47.839  6.799   125.884  1.00 37.83  ?  179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A  1  179  ? 46.195  6.666   127.603  1.00 34.00  ?  179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A  1  179  ? 46.858  7.132   124.969  1.00 38.12  ?  179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A  1  179  ? 45.210  7.001   126.692  1.00 34.81  ?  179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A  1  179  ? 45.542  7.234   125.374  1.00 35.47  ?  179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A  1  180  ? 47.599  3.415   129.722  1.00 37.67  ?  180  GLN A N     1 
ATOM   1377  C  CA    . GLN A  1  180  ? 46.558  2.481   130.117  1.00 35.35  ?  180  GLN A CA    1 
ATOM   1378  C  C     . GLN A  1  180  ? 45.521  3.183   130.982  1.00 35.24  ?  180  GLN A C     1 
ATOM   1379  O  O     . GLN A  1  180  ? 45.862  3.828   131.974  1.00 34.73  ?  180  GLN A O     1 
ATOM   1380  C  CB    . GLN A  1  180  ? 47.175  1.319   130.896  1.00 39.36  ?  180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A  1  180  ? 46.220  0.181   131.199  1.00 43.39  ?  180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A  1  180  ? 46.429  -1.007  130.284  1.00 57.53  ?  180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A  1  180  ? 47.161  -0.922  129.297  1.00 61.50  ?  180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A  1  180  ? 45.792  -2.126  130.610  1.00 60.90  ?  180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A  1  181  ? 44.255  3.061   130.598  1.00 32.63  ?  181  VAL A N     1 
ATOM   1386  C  CA    . VAL A  1  181  ? 43.164  3.608   131.392  1.00 28.22  ?  181  VAL A CA    1 
ATOM   1387  C  C     . VAL A  1  181  ? 42.440  2.478   132.112  1.00 35.59  ?  181  VAL A C     1 
ATOM   1388  O  O     . VAL A  1  181  ? 41.759  1.664   131.486  1.00 31.89  ?  181  VAL A O     1 
ATOM   1389  C  CB    . VAL A  1  181  ? 42.160  4.383   130.525  1.00 25.31  ?  181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A  1  181  ? 41.030  4.924   131.386  1.00 32.32  ?  181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A  1  181  ? 42.860  5.513   129.787  1.00 25.32  ?  181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A  1  182  ? 42.587  2.437   133.432  1.00 40.40  ?  182  GLU A N     1 
ATOM   1393  C  CA    . GLU A  1  182  ? 42.011  1.360   134.230  1.00 38.57  ?  182  GLU A CA    1 
ATOM   1394  C  C     . GLU A  1  182  ? 40.871  1.872   135.100  1.00 37.48  ?  182  GLU A C     1 
ATOM   1395  O  O     . GLU A  1  182  ? 40.843  3.042   135.472  1.00 36.88  ?  182  GLU A O     1 
ATOM   1396  C  CB    . GLU A  1  182  ? 43.088  0.698   135.092  1.00 42.52  ?  182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A  1  182  ? 44.137  -0.054  134.289  1.00 53.31  ?  182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A  1  182  ? 45.270  -0.582  135.147  1.00 66.55  ?  182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A  1  182  ? 45.699  -1.734  134.922  1.00 70.80  ?  182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A  1  182  ? 45.739  0.156   136.040  1.00 70.29  ?  182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A  1  183  ? 39.922  0.995   135.412  1.00 39.09  ?  183  ASP A N     1 
ATOM   1402  C  CA    . ASP A  1  183  ? 38.761  1.394   136.199  1.00 40.09  ?  183  ASP A CA    1 
ATOM   1403  C  C     . ASP A  1  183  ? 39.081  1.523   137.685  1.00 40.40  ?  183  ASP A C     1 
ATOM   1404  O  O     . ASP A  1  183  ? 39.637  0.609   138.296  1.00 42.88  ?  183  ASP A O     1 
ATOM   1405  C  CB    . ASP A  1  183  ? 37.602  0.418   135.995  1.00 43.35  ?  183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A  1  183  ? 36.293  0.949   136.546  1.00 56.20  ?  183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A  1  183  ? 36.119  2.187   136.568  1.00 49.71  ?  183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A  1  183  ? 35.440  0.134   136.956  1.00 63.32  ?  183  ASP A OD2   1 
ATOM   1409  N  N     . THR A  1  184  ? 38.723  2.668   138.257  1.00 36.73  ?  184  THR A N     1 
ATOM   1410  C  CA    . THR A  1  184  ? 38.917  2.919   139.679  1.00 42.01  ?  184  THR A CA    1 
ATOM   1411  C  C     . THR A  1  184  ? 37.690  3.623   140.247  1.00 43.59  ?  184  THR A C     1 
ATOM   1412  O  O     . THR A  1  184  ? 36.828  4.088   139.497  1.00 48.56  ?  184  THR A O     1 
ATOM   1413  C  CB    . THR A  1  184  ? 40.173  3.775   139.948  1.00 46.56  ?  184  THR A CB    1 
ATOM   1414  O  OG1   . THR A  1  184  ? 40.444  3.810   141.355  1.00 52.49  ?  184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A  1  184  ? 39.977  5.197   139.440  1.00 43.02  ?  184  THR A CG2   1 
ATOM   1416  N  N     . ARG A  1  185  ? 37.608  3.691   141.572  1.00 44.13  ?  185  ARG A N     1 
ATOM   1417  C  CA    . ARG A  1  185  ? 36.484  4.345   142.229  1.00 47.12  ?  185  ARG A CA    1 
ATOM   1418  C  C     . ARG A  1  185  ? 36.898  5.023   143.531  1.00 48.99  ?  185  ARG A C     1 
ATOM   1419  O  O     . ARG A  1  185  ? 37.812  4.569   144.219  1.00 48.51  ?  185  ARG A O     1 
ATOM   1420  C  CB    . ARG A  1  185  ? 35.360  3.340   142.496  1.00 53.89  ?  185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A  1  185  ? 35.777  2.146   143.339  1.00 59.01  ?  185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A  1  185  ? 34.571  1.303   143.724  1.00 65.71  ?  185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A  1  185  ? 33.623  2.056   144.540  1.00 79.35  ?  185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A  1  185  ? 32.448  1.587   144.949  1.00 85.91  ?  185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A  1  185  ? 32.068  0.361   144.615  1.00 81.98  ?  185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A  1  185  ? 31.652  2.347   145.689  1.00 84.41  ?  185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A  1  186  ? 36.217  6.118   143.855  1.00 49.10  ?  186  LEU A N     1 
ATOM   1428  C  CA    . LEU A  1  186  ? 36.448  6.835   145.103  1.00 54.00  ?  186  LEU A CA    1 
ATOM   1429  C  C     . LEU A  1  186  ? 35.120  7.152   145.776  1.00 61.96  ?  186  LEU A C     1 
ATOM   1430  O  O     . LEU A  1  186  ? 34.282  7.859   145.215  1.00 64.71  ?  186  LEU A O     1 
ATOM   1431  C  CB    . LEU A  1  186  ? 37.222  8.129   144.848  1.00 51.82  ?  186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A  1  186  ? 37.414  9.033   146.068  1.00 47.85  ?  186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A  1  186  ? 38.260  8.337   147.123  1.00 55.68  ?  186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A  1  186  ? 38.032  10.364  145.669  1.00 56.32  ?  186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A  1  187  ? 34.933  6.631   146.984  1.00 57.61  ?  187  GLY A N     1 
ATOM   1436  C  CA    . GLY A  1  187  ? 33.681  6.804   147.693  1.00 64.45  ?  187  GLY A CA    1 
ATOM   1437  C  C     . GLY A  1  187  ? 32.554  6.064   147.001  1.00 65.55  ?  187  GLY A C     1 
ATOM   1438  O  O     . GLY A  1  187  ? 32.685  4.884   146.673  1.00 62.43  ?  187  GLY A O     1 
ATOM   1439  N  N     . GLN A  1  188  ? 31.447  6.760   146.769  1.00 61.85  ?  188  GLN A N     1 
ATOM   1440  C  CA    . GLN A  1  188  ? 30.288  6.153   146.124  1.00 73.58  ?  188  GLN A CA    1 
ATOM   1441  C  C     . GLN A  1  188  ? 30.305  6.375   144.614  1.00 71.75  ?  188  GLN A C     1 
ATOM   1442  O  O     . GLN A  1  188  ? 29.434  5.884   143.895  1.00 61.50  ?  188  GLN A O     1 
ATOM   1443  C  CB    . GLN A  1  188  ? 28.992  6.696   146.730  1.00 84.86  ?  188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A  1  188  ? 28.821  6.381   148.210  1.00 89.46  ?  188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A  1  188  ? 28.714  4.891   148.484  1.00 96.33  ?  188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A  1  188  ? 27.900  4.193   147.877  1.00 100.87 ?  188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A  1  188  ? 29.539  4.397   149.401  1.00 86.88  ?  188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A  1  189  ? 31.304  7.113   144.140  1.00 71.22  ?  189  ARG A N     1 
ATOM   1449  C  CA    . ARG A  1  189  ? 31.461  7.363   142.711  1.00 57.68  ?  189  ARG A CA    1 
ATOM   1450  C  C     . ARG A  1  189  ? 32.059  6.153   142.002  1.00 60.36  ?  189  ARG A C     1 
ATOM   1451  O  O     . ARG A  1  189  ? 32.996  5.530   142.500  1.00 64.94  ?  189  ARG A O     1 
ATOM   1452  C  CB    . ARG A  1  189  ? 32.327  8.602   142.468  1.00 49.57  ?  189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A  1  189  ? 31.556  9.913   142.482  1.00 51.88  ?  189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A  1  189  ? 32.462  11.091  142.163  1.00 49.20  ?  189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A  1  189  ? 33.338  11.427  143.282  1.00 68.04  ?  189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A  1  189  ? 33.140  12.453  144.104  1.00 69.99  ?  189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A  1  189  ? 33.987  12.685  145.098  1.00 65.21  ?  189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A  1  189  ? 32.096  13.252  143.929  1.00 70.97  ?  189  ARG A NH2   1 
ATOM   1459  N  N     . THR A  1  190  ? 31.513  5.829   140.835  1.00 58.81  ?  190  THR A N     1 
ATOM   1460  C  CA    . THR A  1  190  ? 31.962  4.674   140.066  1.00 63.28  ?  190  THR A CA    1 
ATOM   1461  C  C     . THR A  1  190  ? 32.380  5.072   138.656  1.00 57.91  ?  190  THR A C     1 
ATOM   1462  O  O     . THR A  1  190  ? 32.074  6.173   138.197  1.00 53.92  ?  190  THR A O     1 
ATOM   1463  C  CB    . THR A  1  190  ? 30.873  3.588   139.980  1.00 65.08  ?  190  THR A CB    1 
ATOM   1464  O  OG1   . THR A  1  190  ? 29.659  4.165   139.483  1.00 69.62  ?  190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A  1  190  ? 30.617  2.979   141.349  1.00 61.87  ?  190  THR A CG2   1 
ATOM   1466  N  N     . ASP A  1  191  ? 33.087  4.165   137.984  1.00 56.18  ?  191  ASP A N     1 
ATOM   1467  C  CA    . ASP A  1  191  ? 33.569  4.385   136.622  1.00 61.55  ?  191  ASP A CA    1 
ATOM   1468  C  C     . ASP A  1  191  ? 34.492  5.602   136.532  1.00 54.55  ?  191  ASP A C     1 
ATOM   1469  O  O     . ASP A  1  191  ? 34.286  6.495   135.708  1.00 49.29  ?  191  ASP A O     1 
ATOM   1470  C  CB    . ASP A  1  191  ? 32.397  4.506   135.637  1.00 67.87  ?  191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A  1  191  ? 32.828  4.354   134.188  1.00 69.61  ?  191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A  1  191  ? 33.916  3.790   133.944  1.00 64.73  ?  191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A  1  191  ? 32.073  4.792   133.293  1.00 60.76  ?  191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A  1  192  ? 35.506  5.630   137.393  1.00 47.40  ?  192  LEU A N     1 
ATOM   1475  C  CA    . LEU A  1  192  ? 36.492  6.705   137.379  1.00 40.75  ?  192  LEU A CA    1 
ATOM   1476  C  C     . LEU A  1  192  ? 37.771  6.250   136.682  1.00 39.83  ?  192  LEU A C     1 
ATOM   1477  O  O     . LEU A  1  192  ? 38.143  5.079   136.751  1.00 40.04  ?  192  LEU A O     1 
ATOM   1478  C  CB    . LEU A  1  192  ? 36.798  7.185   138.799  1.00 39.72  ?  192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A  1  192  ? 35.626  7.773   139.585  1.00 39.83  ?  192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A  1  192  ? 36.095  8.297   140.934  1.00 38.70  ?  192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A  1  192  ? 34.945  8.871   138.785  1.00 38.63  ?  192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A  1  193  ? 38.433  7.179   135.999  1.00 39.85  ?  193  ASP A N     1 
ATOM   1483  C  CA    . ASP A  1  193  ? 39.624  6.848   135.225  1.00 39.40  ?  193  ASP A CA    1 
ATOM   1484  C  C     . ASP A  1  193  ? 40.910  6.850   136.049  1.00 34.82  ?  193  ASP A C     1 
ATOM   1485  O  O     . ASP A  1  193  ? 41.205  7.802   136.771  1.00 33.81  ?  193  ASP A O     1 
ATOM   1486  C  CB    . ASP A  1  193  ? 39.777  7.794   134.028  1.00 38.61  ?  193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A  1  193  ? 38.713  7.576   132.970  1.00 38.72  ?  193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A  1  193  ? 37.994  6.557   133.043  1.00 39.43  ?  193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A  1  193  ? 38.604  8.421   132.057  1.00 39.66  ?  193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A  1  194  ? 41.666  5.765   135.927  1.00 33.24  ?  194  LYS A N     1 
ATOM   1491  C  CA    . LYS A  1  194  ? 43.010  5.678   136.475  1.00 32.21  ?  194  LYS A CA    1 
ATOM   1492  C  C     . LYS A  1  194  ? 43.989  5.684   135.308  1.00 35.28  ?  194  LYS A C     1 
ATOM   1493  O  O     . LYS A  1  194  ? 44.055  4.716   134.544  1.00 37.14  ?  194  LYS A O     1 
ATOM   1494  C  CB    . LYS A  1  194  ? 43.167  4.390   137.283  1.00 34.84  ?  194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A  1  194  ? 44.586  4.104   137.740  1.00 38.47  ?  194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A  1  194  ? 44.668  2.769   138.464  1.00 34.15  ?  194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A  1  194  ? 46.090  2.467   138.905  1.00 38.79  ?  194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A  1  194  ? 46.190  1.144   139.579  1.00 58.96  ?  194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A  1  195  ? 44.743  6.771   135.165  1.00 33.56  ?  195  LEU A N     1 
ATOM   1500  C  CA    . LEU A  1  195  ? 45.622  6.923   134.005  1.00 31.63  ?  195  LEU A CA    1 
ATOM   1501  C  C     . LEU A  1  195  ? 47.044  6.465   134.299  1.00 36.61  ?  195  LEU A C     1 
ATOM   1502  O  O     . LEU A  1  195  ? 47.625  6.851   135.306  1.00 35.98  ?  195  LEU A O     1 
ATOM   1503  C  CB    . LEU A  1  195  ? 45.634  8.375   133.523  1.00 35.28  ?  195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A  1  195  ? 46.612  8.703   132.391  1.00 31.90  ?  195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A  1  195  ? 46.336  7.837   131.171  1.00 35.47  ?  195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A  1  195  ? 46.548  10.179  132.028  1.00 28.25  ?  195  LEU A CD2   1 
ATOM   1507  N  N     . THR A  1  196  ? 47.606  5.643   133.420  1.00 38.06  ?  196  THR A N     1 
ATOM   1508  C  CA    . THR A  1  196  ? 48.984  5.197   133.599  1.00 38.80  ?  196  THR A CA    1 
ATOM   1509  C  C     . THR A  1  196  ? 49.824  5.403   132.341  1.00 38.98  ?  196  THR A C     1 
ATOM   1510  O  O     . THR A  1  196  ? 49.586  4.770   131.318  1.00 42.64  ?  196  THR A O     1 
ATOM   1511  C  CB    . THR A  1  196  ? 49.050  3.719   134.019  1.00 38.34  ?  196  THR A CB    1 
ATOM   1512  O  OG1   . THR A  1  196  ? 48.002  3.435   134.955  1.00 36.60  ?  196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A  1  196  ? 50.395  3.415   134.658  1.00 42.01  ?  196  THR A CG2   1 
ATOM   1514  N  N     . LEU A  1  197  ? 50.816  6.283   132.433  1.00 36.87  ?  197  LEU A N     1 
ATOM   1515  C  CA    . LEU A  1  197  ? 51.710  6.568   131.317  1.00 33.99  ?  197  LEU A CA    1 
ATOM   1516  C  C     . LEU A  1  197  ? 52.987  5.741   131.401  1.00 38.39  ?  197  LEU A C     1 
ATOM   1517  O  O     . LEU A  1  197  ? 53.705  5.794   132.394  1.00 48.24  ?  197  LEU A O     1 
ATOM   1518  C  CB    . LEU A  1  197  ? 52.071  8.054   131.291  1.00 32.19  ?  197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A  1  197  ? 51.078  9.020   130.647  1.00 34.54  ?  197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A  1  197  ? 51.523  10.452  130.870  1.00 41.20  ?  197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A  1  197  ? 50.952  8.732   129.163  1.00 36.17  ?  197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A  1  198  ? 53.270  4.985   130.348  1.00 33.88  ?  198  ARG A N     1 
ATOM   1523  C  CA    . ARG A  1  198  ? 54.497  4.207   130.268  1.00 37.92  ?  198  ARG A CA    1 
ATOM   1524  C  C     . ARG A  1  198  ? 55.400  4.781   129.184  1.00 42.76  ?  198  ARG A C     1 
ATOM   1525  O  O     . ARG A  1  198  ? 55.003  4.882   128.018  1.00 45.20  ?  198  ARG A O     1 
ATOM   1526  C  CB    . ARG A  1  198  ? 54.183  2.737   129.993  1.00 33.76  ?  198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A  1  198  ? 53.097  2.172   130.893  1.00 36.48  ?  198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A  1  198  ? 53.178  0.661   130.984  1.00 40.05  ?  198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A  1  198  ? 53.105  0.025   129.674  1.00 51.74  ?  198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A  1  198  ? 53.244  -1.281  129.474  1.00 55.03  ?  198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A  1  198  ? 53.166  -1.778  128.247  1.00 47.24  ?  198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A  1  198  ? 53.464  -2.089  130.502  1.00 58.92  ?  198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A  1  199  ? 56.612  5.166   129.578  1.00 44.98  ?  199  ILE A N     1 
ATOM   1534  C  CA    . ILE A  1  199  ? 57.535  5.851   128.678  1.00 40.88  ?  199  ILE A CA    1 
ATOM   1535  C  C     . ILE A  1  199  ? 58.915  5.197   128.615  1.00 43.63  ?  199  ILE A C     1 
ATOM   1536  O  O     . ILE A  1  199  ? 59.592  5.051   129.632  1.00 53.01  ?  199  ILE A O     1 
ATOM   1537  C  CB    . ILE A  1  199  ? 57.716  7.325   129.086  1.00 31.60  ?  199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A  1  199  ? 56.371  8.054   129.072  1.00 33.74  ?  199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A  1  199  ? 58.706  8.016   128.165  1.00 38.28  ?  199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A  1  199  ? 56.444  9.472   129.588  1.00 38.34  ?  199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A  1  200  ? 59.320  4.809   127.408  1.00 42.24  ?  200  TRP A N     1 
ATOM   1542  C  CA    . TRP A  1  200  ? 60.663  4.306   127.148  1.00 43.08  ?  200  TRP A CA    1 
ATOM   1543  C  C     . TRP A  1  200  ? 61.463  5.349   126.375  1.00 41.99  ?  200  TRP A C     1 
ATOM   1544  O  O     . TRP A  1  200  ? 61.034  5.800   125.306  1.00 44.20  ?  200  TRP A O     1 
ATOM   1545  C  CB    . TRP A  1  200  ? 60.612  3.028   126.311  1.00 38.81  ?  200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A  1  200  ? 59.976  1.848   126.972  1.00 39.00  ?  200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A  1  200  ? 60.614  0.821   127.602  1.00 40.71  ?  200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A  1  200  ? 58.576  1.554   127.042  1.00 42.75  ?  200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A  1  200  ? 59.698  -0.090  128.070  1.00 44.64  ?  200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A  1  200  ? 58.439  0.337   127.739  1.00 45.65  ?  200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A  1  200  ? 57.425  2.205   126.590  1.00 43.24  ?  200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A  1  200  ? 57.197  -0.241  127.994  1.00 47.87  ?  200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A  1  200  ? 56.193  1.628   126.842  1.00 46.68  ?  200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A  1  200  ? 56.089  0.418   127.539  1.00 44.66  ?  200  TRP A CH2   1 
ATOM   1555  N  N     . THR A  1  201  ? 62.625  5.721   126.909  1.00 42.53  ?  201  THR A N     1 
ATOM   1556  C  CA    . THR A  1  201  ? 63.538  6.629   126.216  1.00 49.42  ?  201  THR A CA    1 
ATOM   1557  C  C     . THR A  1  201  ? 64.895  5.973   125.960  1.00 49.25  ?  201  THR A C     1 
ATOM   1558  O  O     . THR A  1  201  ? 65.123  4.826   126.343  1.00 45.51  ?  201  THR A O     1 
ATOM   1559  C  CB    . THR A  1  201  ? 63.756  7.937   127.002  1.00 45.70  ?  201  THR A CB    1 
ATOM   1560  O  OG1   . THR A  1  201  ? 64.426  7.653   128.236  1.00 54.76  ?  201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A  1  201  ? 62.426  8.616   127.289  1.00 46.05  ?  201  THR A CG2   1 
ATOM   1562  N  N     . ASP A  1  202  ? 65.789  6.713   125.310  1.00 53.01  ?  202  ASP A N     1 
ATOM   1563  C  CA    . ASP A  1  202  ? 67.119  6.206   124.975  1.00 62.91  ?  202  ASP A CA    1 
ATOM   1564  C  C     . ASP A  1  202  ? 68.127  6.427   126.102  1.00 66.91  ?  202  ASP A C     1 
ATOM   1565  O  O     . ASP A  1  202  ? 69.232  5.883   126.077  1.00 65.01  ?  202  ASP A O     1 
ATOM   1566  C  CB    . ASP A  1  202  ? 67.630  6.844   123.678  1.00 63.48  ?  202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A  1  202  ? 67.536  8.362   123.692  1.00 62.75  ?  202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A  1  202  ? 67.291  8.940   124.771  1.00 55.92  ?  202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A  1  202  ? 67.713  8.979   122.619  1.00 63.20  ?  202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A  1  203  ? 67.739  7.229   127.087  1.00 62.33  ?  203  GLY A N     1 
ATOM   1571  C  CA    . GLY A  1  203  ? 68.612  7.539   128.202  1.00 49.22  ?  203  GLY A CA    1 
ATOM   1572  C  C     . GLY A  1  203  ? 69.162  8.948   128.124  1.00 45.64  ?  203  GLY A C     1 
ATOM   1573  O  O     . GLY A  1  203  ? 69.699  9.462   129.105  1.00 51.73  ?  203  GLY A O     1 
ATOM   1574  N  N     . SER A  1  204  ? 69.032  9.571   126.956  1.00 48.96  ?  204  SER A N     1 
ATOM   1575  C  CA    . SER A  1  204  ? 69.473  10.950  126.768  1.00 54.91  ?  204  SER A CA    1 
ATOM   1576  C  C     . SER A  1  204  ? 68.742  11.863  127.745  1.00 48.30  ?  204  SER A C     1 
ATOM   1577  O  O     . SER A  1  204  ? 69.364  12.637  128.472  1.00 46.80  ?  204  SER A O     1 
ATOM   1578  C  CB    . SER A  1  204  ? 69.227  11.405  125.327  1.00 51.86  ?  204  SER A CB    1 
ATOM   1579  O  OG    . SER A  1  204  ? 69.673  12.735  125.125  1.00 50.42  ?  204  SER A OG    1 
ATOM   1580  N  N     . VAL A  1  205  ? 67.418  11.763  127.756  1.00 46.24  ?  205  VAL A N     1 
ATOM   1581  C  CA    . VAL A  1  205  ? 66.611  12.424  128.773  1.00 49.30  ?  205  VAL A CA    1 
ATOM   1582  C  C     . VAL A  1  205  ? 65.735  11.388  129.469  1.00 52.57  ?  205  VAL A C     1 
ATOM   1583  O  O     . VAL A  1  205  ? 65.367  10.371  128.878  1.00 47.43  ?  205  VAL A O     1 
ATOM   1584  C  CB    . VAL A  1  205  ? 65.737  13.557  128.191  1.00 52.12  ?  205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A  1  205  ? 66.592  14.547  127.411  1.00 49.42  ?  205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A  1  205  ? 64.634  12.992  127.314  1.00 55.84  ?  205  VAL A CG2   1 
ATOM   1587  N  N     . THR A  1  206  ? 65.417  11.644  130.732  1.00 62.12  ?  206  THR A N     1 
ATOM   1588  C  CA    . THR A  1  206  ? 64.630  10.710  131.525  1.00 61.27  ?  206  THR A CA    1 
ATOM   1589  C  C     . THR A  1  206  ? 63.148  10.832  131.182  1.00 50.52  ?  206  THR A C     1 
ATOM   1590  O  O     . THR A  1  206  ? 62.696  11.898  130.763  1.00 49.71  ?  206  THR A O     1 
ATOM   1591  C  CB    . THR A  1  206  ? 64.833  10.954  133.034  1.00 58.80  ?  206  THR A CB    1 
ATOM   1592  O  OG1   . THR A  1  206  ? 64.289  12.229  133.393  1.00 56.02  ?  206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A  1  206  ? 66.314  10.919  133.382  1.00 57.10  ?  206  THR A CG2   1 
ATOM   1594  N  N     . PRO A  1  207  ? 62.393  9.731   131.344  1.00 41.80  ?  207  PRO A N     1 
ATOM   1595  C  CA    . PRO A  1  207  ? 60.943  9.732   131.120  1.00 44.11  ?  207  PRO A CA    1 
ATOM   1596  C  C     . PRO A  1  207  ? 60.242  10.865  131.866  1.00 46.94  ?  207  PRO A C     1 
ATOM   1597  O  O     . PRO A  1  207  ? 59.324  11.479  131.322  1.00 45.34  ?  207  PRO A O     1 
ATOM   1598  C  CB    . PRO A  1  207  ? 60.509  8.382   131.692  1.00 46.44  ?  207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A  1  207  ? 61.687  7.505   131.483  1.00 46.05  ?  207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A  1  207  ? 62.898  8.381   131.655  1.00 45.45  ?  207  PRO A CD    1 
ATOM   1601  N  N     . LEU A  1  208  ? 60.681  11.136  133.092  1.00 49.44  ?  208  LEU A N     1 
ATOM   1602  C  CA    . LEU A  1  208  ? 60.100  12.204  133.898  1.00 52.19  ?  208  LEU A CA    1 
ATOM   1603  C  C     . LEU A  1  208  ? 60.308  13.572  133.255  1.00 51.58  ?  208  LEU A C     1 
ATOM   1604  O  O     . LEU A  1  208  ? 59.369  14.361  133.146  1.00 48.69  ?  208  LEU A O     1 
ATOM   1605  C  CB    . LEU A  1  208  ? 60.682  12.196  135.314  1.00 51.59  ?  208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A  1  208  ? 60.223  13.334  136.229  1.00 52.97  ?  208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A  1  208  ? 58.713  13.297  136.427  1.00 47.69  ?  208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A  1  208  ? 60.944  13.277  137.567  1.00 57.99  ?  208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A  1  209  ? 61.540  13.847  132.838  1.00 48.59  ?  209  GLU A N     1 
ATOM   1610  C  CA    . GLU A  1  209  ? 61.863  15.112  132.188  1.00 50.27  ?  209  GLU A CA    1 
ATOM   1611  C  C     . GLU A  1  209  ? 61.030  15.288  130.926  1.00 50.10  ?  209  GLU A C     1 
ATOM   1612  O  O     . GLU A  1  209  ? 60.430  16.345  130.706  1.00 51.98  ?  209  GLU A O     1 
ATOM   1613  C  CB    . GLU A  1  209  ? 63.356  15.183  131.853  1.00 57.24  ?  209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A  1  209  ? 64.258  15.370  133.066  1.00 65.17  ?  209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A  1  209  ? 65.734  15.323  132.714  1.00 70.42  ?  209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A  1  209  ? 66.570  15.463  133.632  1.00 64.47  ?  209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A  1  209  ? 66.059  15.147  131.521  1.00 73.83  ?  209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A  1  210  ? 60.989  14.236  130.112  1.00 48.57  ?  210  ALA A N     1 
ATOM   1619  C  CA    . ALA A  1  210  ? 60.214  14.235  128.879  1.00 45.27  ?  210  ALA A CA    1 
ATOM   1620  C  C     . ALA A  1  210  ? 58.749  14.551  129.154  1.00 42.82  ?  210  ALA A C     1 
ATOM   1621  O  O     . ALA A  1  210  ? 58.151  15.393  128.483  1.00 38.17  ?  210  ALA A O     1 
ATOM   1622  C  CB    . ALA A  1  210  ? 60.344  12.892  128.177  1.00 43.72  ?  210  ALA A CB    1 
ATOM   1623  N  N     . LEU A  1  211  ? 58.183  13.876  130.151  1.00 41.26  ?  211  LEU A N     1 
ATOM   1624  C  CA    . LEU A  1  211  ? 56.795  14.097  130.543  1.00 39.77  ?  211  LEU A CA    1 
ATOM   1625  C  C     . LEU A  1  211  ? 56.562  15.544  130.963  1.00 41.58  ?  211  LEU A C     1 
ATOM   1626  O  O     . LEU A  1  211  ? 55.590  16.174  130.541  1.00 41.28  ?  211  LEU A O     1 
ATOM   1627  C  CB    . LEU A  1  211  ? 56.400  13.148  131.678  1.00 40.25  ?  211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A  1  211  ? 55.029  13.369  132.324  1.00 42.95  ?  211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A  1  211  ? 53.912  13.277  131.295  1.00 36.45  ?  211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A  1  211  ? 54.800  12.375  133.454  1.00 43.73  ?  211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A  1  212  ? 57.464  16.067  131.786  1.00 42.07  ?  212  ASN A N     1 
ATOM   1632  C  CA    . ASN A  1  212  ? 57.356  17.436  132.274  1.00 42.13  ?  212  ASN A CA    1 
ATOM   1633  C  C     . ASN A  1  212  ? 57.375  18.471  131.154  1.00 42.23  ?  212  ASN A C     1 
ATOM   1634  O  O     . ASN A  1  212  ? 56.503  19.339  131.091  1.00 44.60  ?  212  ASN A O     1 
ATOM   1635  C  CB    . ASN A  1  212  ? 58.456  17.733  133.294  1.00 46.07  ?  212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A  1  212  ? 58.292  16.938  134.574  1.00 53.18  ?  212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A  1  212  ? 57.173  16.684  135.021  1.00 48.87  ?  212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A  1  212  ? 59.411  16.536  135.169  1.00 53.35  ?  212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A  1  213  ? 58.360  18.377  130.265  1.00 48.08  ?  213  GLN A N     1 
ATOM   1640  C  CA    . GLN A  1  213  ? 58.443  19.328  129.159  1.00 52.03  ?  213  GLN A CA    1 
ATOM   1641  C  C     . GLN A  1  213  ? 57.319  19.129  128.139  1.00 42.44  ?  213  GLN A C     1 
ATOM   1642  O  O     . GLN A  1  213  ? 56.957  20.057  127.420  1.00 32.88  ?  213  GLN A O     1 
ATOM   1643  C  CB    . GLN A  1  213  ? 59.821  19.296  128.489  1.00 46.29  ?  213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A  1  213  ? 60.289  17.924  128.053  1.00 46.65  ?  213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A  1  213  ? 61.771  17.899  127.729  1.00 63.08  ?  213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A  1  213  ? 62.345  18.908  127.318  1.00 59.49  ?  213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A  1  213  ? 62.401  16.745  127.923  1.00 63.88  ?  213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A  1  214  ? 56.764  17.921  128.092  1.00 43.13  ?  214  ALA A N     1 
ATOM   1649  C  CA    . ALA A  1  214  ? 55.595  17.654  127.259  1.00 37.94  ?  214  ALA A CA    1 
ATOM   1650  C  C     . ALA A  1  214  ? 54.388  18.408  127.807  1.00 39.20  ?  214  ALA A C     1 
ATOM   1651  O  O     . ALA A  1  214  ? 53.672  19.089  127.064  1.00 35.20  ?  214  ALA A O     1 
ATOM   1652  C  CB    . ALA A  1  214  ? 55.310  16.164  127.202  1.00 33.24  ?  214  ALA A CB    1 
ATOM   1653  N  N     . VAL A  1  215  ? 54.171  18.276  129.114  1.00 42.82  ?  215  VAL A N     1 
ATOM   1654  C  CA    . VAL A  1  215  ? 53.109  19.000  129.804  1.00 44.80  ?  215  VAL A CA    1 
ATOM   1655  C  C     . VAL A  1  215  ? 53.280  20.502  129.600  1.00 41.36  ?  215  VAL A C     1 
ATOM   1656  O  O     . VAL A  1  215  ? 52.313  21.219  129.332  1.00 37.34  ?  215  VAL A O     1 
ATOM   1657  C  CB    . VAL A  1  215  ? 53.094  18.684  131.317  1.00 41.01  ?  215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A  1  215  ? 52.108  19.584  132.045  1.00 46.00  ?  215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A  1  215  ? 52.754  17.221  131.555  1.00 36.29  ?  215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A  1  216  ? 54.521  20.965  129.716  1.00 41.42  ?  216  GLU A N     1 
ATOM   1661  C  CA    . GLU A  1  216  ? 54.841  22.370  129.492  1.00 45.36  ?  216  GLU A CA    1 
ATOM   1662  C  C     . GLU A  1  216  ? 54.483  22.802  128.072  1.00 45.82  ?  216  GLU A C     1 
ATOM   1663  O  O     . GLU A  1  216  ? 53.956  23.894  127.867  1.00 41.72  ?  216  GLU A O     1 
ATOM   1664  C  CB    . GLU A  1  216  ? 56.322  22.639  129.777  1.00 46.49  ?  216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A  1  216  ? 56.797  24.038  129.395  1.00 42.95  ?  216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A  1  216  ? 56.082  25.140  130.158  1.00 44.16  ?  216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A  1  216  ? 55.599  24.882  131.281  1.00 48.33  ?  216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A  1  216  ? 56.002  26.270  129.631  1.00 41.70  ?  216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A  1  217  ? 54.770  21.940  127.100  1.00 42.36  ?  217  ILE A N     1 
ATOM   1670  C  CA    . ILE A  1  217  ? 54.429  22.214  125.707  1.00 35.00  ?  217  ILE A CA    1 
ATOM   1671  C  C     . ILE A  1  217  ? 52.920  22.356  125.528  1.00 41.44  ?  217  ILE A C     1 
ATOM   1672  O  O     . ILE A  1  217  ? 52.444  23.309  124.905  1.00 36.34  ?  217  ILE A O     1 
ATOM   1673  C  CB    . ILE A  1  217  ? 54.956  21.112  124.768  1.00 30.21  ?  217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A  1  217  ? 56.470  21.237  124.600  1.00 37.40  ?  217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A  1  217  ? 54.284  21.197  123.408  1.00 32.75  ?  217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A  1  217  ? 57.083  20.143  123.752  1.00 35.94  ?  217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A  1  218  ? 52.174  21.408  126.087  1.00 41.22  ?  218  LEU A N     1 
ATOM   1678  C  CA    . LEU A  1  218  ? 50.719  21.414  125.967  1.00 37.01  ?  218  LEU A CA    1 
ATOM   1679  C  C     . LEU A  1  218  ? 50.102  22.645  126.629  1.00 41.15  ?  218  LEU A C     1 
ATOM   1680  O  O     . LEU A  1  218  ? 49.164  23.243  126.098  1.00 38.78  ?  218  LEU A O     1 
ATOM   1681  C  CB    . LEU A  1  218  ? 50.128  20.135  126.565  1.00 33.72  ?  218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A  1  218  ? 48.634  19.900  126.336  1.00 33.95  ?  218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A  1  218  ? 48.305  19.941  124.854  1.00 34.05  ?  218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A  1  218  ? 48.208  18.574  126.941  1.00 31.97  ?  218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A  1  219  ? 50.641  23.018  127.786  1.00 44.91  ?  219  ARG A N     1 
ATOM   1686  C  CA    . ARG A  1  219  ? 50.160  24.180  128.527  1.00 45.30  ?  219  ARG A CA    1 
ATOM   1687  C  C     . ARG A  1  219  ? 50.448  25.453  127.735  1.00 44.23  ?  219  ARG A C     1 
ATOM   1688  O  O     . ARG A  1  219  ? 49.576  26.315  127.571  1.00 42.36  ?  219  ARG A O     1 
ATOM   1689  C  CB    . ARG A  1  219  ? 50.835  24.233  129.904  1.00 46.93  ?  219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A  1  219  ? 50.155  25.135  130.932  1.00 52.64  ?  219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A  1  219  ? 50.706  26.550  130.891  1.00 53.81  ?  219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A  1  219  ? 52.164  26.564  130.962  1.00 44.07  ?  219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A  1  219  ? 52.911  27.641  130.745  1.00 48.06  ?  219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A  1  219  ? 52.338  28.799  130.443  1.00 46.72  ?  219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A  1  219  ? 54.231  27.561  130.829  1.00 46.81  ?  219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A  1  220  ? 51.679  25.553  127.245  1.00 44.42  ?  220  GLU A N     1 
ATOM   1697  C  CA    . GLU A  1  220  ? 52.114  26.678  126.429  1.00 46.34  ?  220  GLU A CA    1 
ATOM   1698  C  C     . GLU A  1  220  ? 51.230  26.817  125.195  1.00 51.86  ?  220  GLU A C     1 
ATOM   1699  O  O     . GLU A  1  220  ? 50.960  27.927  124.734  1.00 51.87  ?  220  GLU A O     1 
ATOM   1700  C  CB    . GLU A  1  220  ? 53.578  26.498  126.020  1.00 45.16  ?  220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A  1  220  ? 54.135  27.608  125.146  1.00 56.91  ?  220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A  1  220  ? 55.596  27.393  124.799  1.00 71.80  ?  220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A  1  220  ? 56.268  26.612  125.505  1.00 61.64  ?  220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A  1  220  ? 56.071  28.002  123.817  1.00 88.60  ?  220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A  1  221  ? 50.776  25.685  124.665  1.00 52.68  ?  221  HIS A N     1 
ATOM   1706  C  CA    . HIS A  1  221  ? 49.854  25.697  123.536  1.00 48.13  ?  221  HIS A CA    1 
ATOM   1707  C  C     . HIS A  1  221  ? 48.463  26.146  123.966  1.00 44.32  ?  221  HIS A C     1 
ATOM   1708  O  O     . HIS A  1  221  ? 47.757  26.814  123.212  1.00 43.78  ?  221  HIS A O     1 
ATOM   1709  C  CB    . HIS A  1  221  ? 49.795  24.327  122.860  1.00 43.19  ?  221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A  1  221  ? 50.883  24.106  121.855  1.00 43.47  ?  221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A  1  221  ? 52.132  23.638  122.201  1.00 48.22  ?  221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A  1  221  ? 50.909  24.302  120.517  1.00 42.50  ?  221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A  1  221  ? 52.880  23.549  121.115  1.00 50.63  ?  221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A  1  221  ? 52.165  23.945  120.081  1.00 51.75  ?  221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A  1  222  ? 48.075  25.781  125.184  1.00 43.75  ?  222  LEU A N     1 
ATOM   1716  C  CA    . LEU A  1  222  ? 46.799  26.220  125.734  1.00 45.77  ?  222  LEU A CA    1 
ATOM   1717  C  C     . LEU A  1  222  ? 46.792  27.728  125.967  1.00 49.97  ?  222  LEU A C     1 
ATOM   1718  O  O     . LEU A  1  222  ? 45.733  28.355  126.013  1.00 50.40  ?  222  LEU A O     1 
ATOM   1719  C  CB    . LEU A  1  222  ? 46.487  25.478  127.033  1.00 41.47  ?  222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A  1  222  ? 46.022  24.031  126.869  1.00 37.31  ?  222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A  1  222  ? 45.918  23.349  128.221  1.00 40.38  ?  222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A  1  222  ? 44.687  23.991  126.146  1.00 34.48  ?  222  LEU A CD2   1 
ATOM   1723  N  N     . THR A  1  223  ? 47.983  28.304  126.110  1.00 51.11  ?  223  THR A N     1 
ATOM   1724  C  CA    . THR A  1  223  ? 48.123  29.747  126.280  1.00 50.59  ?  223  THR A CA    1 
ATOM   1725  C  C     . THR A  1  223  ? 47.659  30.504  125.035  1.00 52.68  ?  223  THR A C     1 
ATOM   1726  O  O     . THR A  1  223  ? 47.211  31.645  125.122  1.00 49.78  ?  223  THR A O     1 
ATOM   1727  C  CB    . THR A  1  223  ? 49.589  30.135  126.579  1.00 57.16  ?  223  THR A CB    1 
ATOM   1728  O  OG1   . THR A  1  223  ? 50.120  29.271  127.591  1.00 69.01  ?  223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A  1  223  ? 49.688  31.583  127.045  1.00 58.08  ?  223  THR A CG2   1 
ATOM   1730  N  N     . TYR A  1  224  ? 47.755  29.854  123.879  1.00 57.40  ?  224  TYR A N     1 
ATOM   1731  C  CA    . TYR A  1  224  ? 47.484  30.506  122.598  1.00 54.05  ?  224  TYR A CA    1 
ATOM   1732  C  C     . TYR A  1  224  ? 46.029  30.942  122.419  1.00 53.02  ?  224  TYR A C     1 
ATOM   1733  O  O     . TYR A  1  224  ? 45.712  31.706  121.507  1.00 58.64  ?  224  TYR A O     1 
ATOM   1734  C  CB    . TYR A  1  224  ? 47.910  29.604  121.437  1.00 46.40  ?  224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A  1  224  ? 49.380  29.244  121.447  1.00 50.03  ?  224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A  1  224  ? 50.321  30.096  122.010  1.00 56.36  ?  224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A  1  224  ? 49.825  28.050  120.894  1.00 53.87  ?  224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A  1  224  ? 51.666  29.770  122.022  1.00 57.69  ?  224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A  1  224  ? 51.168  27.715  120.901  1.00 55.95  ?  224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A  1  224  ? 52.083  28.579  121.468  1.00 56.62  ?  224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A  1  224  ? 53.419  28.249  121.478  1.00 55.54  ?  224  TYR A OH    1 
ATOM   1742  N  N     . PHE A  1  225  ? 45.148  30.461  123.289  1.00 49.63  ?  225  PHE A N     1 
ATOM   1743  C  CA    . PHE A  1  225  ? 43.737  30.823  123.216  1.00 55.79  ?  225  PHE A CA    1 
ATOM   1744  C  C     . PHE A  1  225  ? 43.446  32.090  124.017  1.00 71.39  ?  225  PHE A C     1 
ATOM   1745  O  O     . PHE A  1  225  ? 42.321  32.592  124.014  1.00 63.37  ?  225  PHE A O     1 
ATOM   1746  C  CB    . PHE A  1  225  ? 42.863  29.676  123.727  1.00 47.77  ?  225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A  1  225  ? 42.930  28.437  122.880  1.00 52.71  ?  225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A  1  225  ? 43.939  27.506  123.065  1.00 51.45  ?  225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A  1  225  ? 41.977  28.199  121.903  1.00 47.86  ?  225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A  1  225  ? 44.000  26.363  122.288  1.00 42.06  ?  225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A  1  225  ? 42.032  27.058  121.124  1.00 43.24  ?  225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A  1  225  ? 43.045  26.140  121.316  1.00 39.27  ?  225  PHE A CZ    1 
ATOM   1753  N  N     . SER A  1  226  ? 44.469  32.602  124.697  1.00 81.42  ?  226  SER A N     1 
ATOM   1754  C  CA    . SER A  1  226  ? 44.313  33.747  125.592  1.00 86.35  ?  226  SER A CA    1 
ATOM   1755  C  C     . SER A  1  226  ? 43.864  35.016  124.874  1.00 85.80  ?  226  SER A C     1 
ATOM   1756  O  O     . SER A  1  226  ? 42.992  35.735  125.363  1.00 91.76  ?  226  SER A O     1 
ATOM   1757  C  CB    . SER A  1  226  ? 45.612  34.015  126.358  1.00 79.74  ?  226  SER A CB    1 
ATOM   1758  O  OG    . SER A  1  226  ? 46.699  34.211  125.469  1.00 68.12  ?  226  SER A OG    1 
ATOM   1759  N  N     . ASN A  1  227  ? 44.458  35.287  123.717  1.00 75.40  ?  227  ASN A N     1 
ATOM   1760  C  CA    . ASN A  1  227  ? 44.161  36.510  122.981  1.00 78.78  ?  227  ASN A CA    1 
ATOM   1761  C  C     . ASN A  1  227  ? 43.225  36.266  121.801  1.00 76.31  ?  227  ASN A C     1 
ATOM   1762  O  O     . ASN A  1  227  ? 43.626  35.684  120.793  1.00 72.44  ?  227  ASN A O     1 
ATOM   1763  C  CB    . ASN A  1  227  ? 45.459  37.167  122.502  1.00 78.72  ?  227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A  1  227  ? 45.220  38.485  121.790  1.00 80.00  ?  227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A  1  227  ? 44.204  39.147  122.005  1.00 82.52  ?  227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A  1  227  ? 46.160  38.873  120.937  1.00 78.83  ?  227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A  1  228  ? 41.966  36.714  121.928  1.00 74.53  ?  228  PRO A N     1 
ATOM   1768  C  CA    . PRO A  1  228  ? 40.966  36.594  120.863  1.00 69.12  ?  228  PRO A CA    1 
ATOM   1769  C  C     . PRO A  1  228  ? 41.184  37.642  119.780  1.00 65.86  ?  228  PRO A C     1 
ATOM   1770  O  O     . PRO A  1  228  ? 41.802  38.674  120.035  1.00 71.95  ?  228  PRO A O     1 
ATOM   1771  C  CB    . PRO A  1  228  ? 39.640  36.870  121.589  1.00 70.57  ?  228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A  1  228  ? 39.962  36.829  123.060  1.00 80.94  ?  228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A  1  228  ? 41.380  37.272  123.156  1.00 78.57  ?  228  PRO A CD    1 
ATOM   1774  N  N     . GLN A  1  229  ? 40.682  37.371  118.580  1.00 66.40  ?  229  GLN A N     1 
ATOM   1775  C  CA    . GLN A  1  229  ? 40.732  38.336  117.491  1.00 65.62  ?  229  GLN A CA    1 
ATOM   1776  C  C     . GLN A  1  229  ? 39.423  38.270  116.714  1.00 72.37  ?  229  GLN A C     1 
ATOM   1777  O  O     . GLN A  1  229  ? 38.965  37.186  116.351  1.00 72.98  ?  229  GLN A O     1 
ATOM   1778  C  CB    . GLN A  1  229  ? 41.916  38.042  116.565  1.00 60.68  ?  229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A  1  229  ? 42.385  39.232  115.740  1.00 66.02  ?  229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A  1  229  ? 43.213  40.218  116.548  1.00 74.02  ?  229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A  1  229  ? 43.487  39.999  117.729  1.00 70.87  ?  229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A  1  229  ? 43.618  41.311  115.911  1.00 64.83  ?  229  GLN A NE2   1 
ATOM   1783  N  N     . ALA A  1  230  ? 38.819  39.427  116.467  1.00 81.19  ?  230  ALA A N     1 
ATOM   1784  C  CA    . ALA A  1  230  ? 37.551  39.484  115.751  1.00 80.64  ?  230  ALA A CA    1 
ATOM   1785  C  C     . ALA A  1  230  ? 37.725  39.034  114.304  1.00 81.94  ?  230  ALA A C     1 
ATOM   1786  O  O     . ALA A  1  230  ? 38.818  39.124  113.745  1.00 78.17  ?  230  ALA A O     1 
ATOM   1787  C  CB    . ALA A  1  230  ? 36.973  40.891  115.806  1.00 82.53  ?  230  ALA A CB    1 
ATOM   1788  N  N     . ALA A  1  231  ? 36.645  38.546  113.702  1.00 82.70  ?  231  ALA A N     1 
ATOM   1789  C  CA    . ALA A  1  231  ? 36.689  38.104  112.314  1.00 92.01  ?  231  ALA A CA    1 
ATOM   1790  C  C     . ALA A  1  231  ? 36.334  39.255  111.380  1.00 110.70 ?  231  ALA A C     1 
ATOM   1791  O  O     . ALA A  1  231  ? 35.209  39.757  111.395  1.00 111.74 ?  231  ALA A O     1 
ATOM   1792  C  CB    . ALA A  1  231  ? 35.752  36.928  112.096  1.00 86.89  ?  231  ALA A CB    1 
ATOM   1793  N  N     . ALA A  1  232  ? 37.301  39.664  110.565  1.00 115.48 ?  232  ALA A N     1 
ATOM   1794  C  CA    . ALA A  1  232  ? 37.126  40.796  109.662  1.00 114.32 ?  232  ALA A CA    1 
ATOM   1795  C  C     . ALA A  1  232  ? 36.572  40.346  108.316  1.00 125.03 ?  232  ALA A C     1 
ATOM   1796  O  O     . ALA A  1  232  ? 36.433  41.150  107.392  1.00 127.66 ?  232  ALA A O     1 
ATOM   1797  C  CB    . ALA A  1  232  ? 38.442  41.538  109.478  1.00 98.20  ?  232  ALA A CB    1 
ATOM   1798  N  N     . VAL A  1  233  ? 36.266  39.056  108.212  1.00 125.26 ?  233  VAL A N     1 
ATOM   1799  C  CA    . VAL A  1  233  ? 35.717  38.480  106.989  1.00 134.59 ?  233  VAL A CA    1 
ATOM   1800  C  C     . VAL A  1  233  ? 34.393  39.143  106.608  1.00 128.98 ?  233  VAL A C     1 
ATOM   1801  O  O     . VAL A  1  233  ? 34.123  39.380  105.429  1.00 125.99 ?  233  VAL A O     1 
ATOM   1802  C  CB    . VAL A  1  233  ? 35.503  36.959  107.136  1.00 130.20 ?  233  VAL A CB    1 
ATOM   1803  C  CG1   . VAL A  1  233  ? 35.091  36.345  105.806  1.00 119.37 ?  233  VAL A CG1   1 
ATOM   1804  C  CG2   . VAL A  1  233  ? 36.766  36.295  107.664  1.00 117.36 ?  233  VAL A CG2   1 
ATOM   1805  N  N     . ALA A  1  234  ? 33.576  39.447  107.611  1.00 120.99 ?  234  ALA A N     1 
ATOM   1806  C  CA    . ALA A  1  234  ? 32.292  40.100  107.380  1.00 116.25 ?  234  ALA A CA    1 
ATOM   1807  C  C     . ALA A  1  234  ? 32.476  41.539  106.907  1.00 114.87 ?  234  ALA A C     1 
ATOM   1808  O  O     . ALA A  1  234  ? 32.722  42.441  107.709  1.00 106.60 ?  234  ALA A O     1 
ATOM   1809  C  CB    . ALA A  1  234  ? 31.441  40.058  108.640  1.00 107.59 ?  234  ALA A CB    1 
ATOM   1810  N  N     . LEU B  1  6    ? 58.642  28.321  116.631  1.00 85.78  ?  6    LEU B N     1 
ATOM   1811  C  CA    . LEU B  1  6    ? 58.022  28.576  115.335  1.00 96.94  ?  6    LEU B CA    1 
ATOM   1812  C  C     . LEU B  1  6    ? 57.464  29.995  115.250  1.00 94.79  ?  6    LEU B C     1 
ATOM   1813  O  O     . LEU B  1  6    ? 58.125  30.905  114.751  1.00 97.23  ?  6    LEU B O     1 
ATOM   1814  C  CB    . LEU B  1  6    ? 56.913  27.554  115.058  1.00 98.01  ?  6    LEU B CB    1 
ATOM   1815  C  CG    . LEU B  1  6    ? 56.142  27.686  113.740  1.00 95.61  ?  6    LEU B CG    1 
ATOM   1816  C  CD1   . LEU B  1  6    ? 57.077  27.562  112.546  1.00 100.49 ?  6    LEU B CD1   1 
ATOM   1817  C  CD2   . LEU B  1  6    ? 55.019  26.661  113.661  1.00 74.92  ?  6    LEU B CD2   1 
ATOM   1818  N  N     . LYS B  1  7    ? 56.241  30.171  115.739  1.00 86.62  ?  7    LYS B N     1 
ATOM   1819  C  CA    . LYS B  1  7    ? 55.546  31.447  115.652  1.00 80.12  ?  7    LYS B CA    1 
ATOM   1820  C  C     . LYS B  1  7    ? 54.459  31.489  116.719  1.00 68.34  ?  7    LYS B C     1 
ATOM   1821  O  O     . LYS B  1  7    ? 54.049  30.447  117.229  1.00 70.77  ?  7    LYS B O     1 
ATOM   1822  C  CB    . LYS B  1  7    ? 54.931  31.598  114.257  1.00 74.56  ?  7    LYS B CB    1 
ATOM   1823  C  CG    . LYS B  1  7    ? 54.362  32.972  113.939  1.00 68.80  ?  7    LYS B CG    1 
ATOM   1824  C  CD    . LYS B  1  7    ? 53.628  32.951  112.608  1.00 72.32  ?  7    LYS B CD    1 
ATOM   1825  C  CE    . LYS B  1  7    ? 52.954  34.280  112.313  1.00 77.65  ?  7    LYS B CE    1 
ATOM   1826  N  NZ    . LYS B  1  7    ? 52.168  34.222  111.048  1.00 76.35  ?  7    LYS B NZ    1 
ATOM   1827  N  N     . ALA B  1  8    ? 54.001  32.688  117.067  1.00 66.77  ?  8    ALA B N     1 
ATOM   1828  C  CA    . ALA B  1  8    ? 52.858  32.830  117.960  1.00 63.34  ?  8    ALA B CA    1 
ATOM   1829  C  C     . ALA B  1  8    ? 51.576  32.748  117.139  1.00 64.26  ?  8    ALA B C     1 
ATOM   1830  O  O     . ALA B  1  8    ? 51.279  33.648  116.352  1.00 65.44  ?  8    ALA B O     1 
ATOM   1831  C  CB    . ALA B  1  8    ? 52.929  34.147  118.713  1.00 61.46  ?  8    ALA B CB    1 
ATOM   1832  N  N     . PRO B  1  9    ? 50.809  31.663  117.324  1.00 59.77  ?  9    PRO B N     1 
ATOM   1833  C  CA    . PRO B  1  9    ? 49.622  31.390  116.508  1.00 50.01  ?  9    PRO B CA    1 
ATOM   1834  C  C     . PRO B  1  9    ? 48.516  32.409  116.737  1.00 48.20  ?  9    PRO B C     1 
ATOM   1835  O  O     . PRO B  1  9    ? 48.274  32.809  117.875  1.00 60.66  ?  9    PRO B O     1 
ATOM   1836  C  CB    . PRO B  1  9    ? 49.165  30.011  117.001  1.00 53.34  ?  9    PRO B CB    1 
ATOM   1837  C  CG    . PRO B  1  9    ? 50.362  29.424  117.687  1.00 55.29  ?  9    PRO B CG    1 
ATOM   1838  C  CD    . PRO B  1  9    ? 51.059  30.592  118.301  1.00 56.96  ?  9    PRO B CD    1 
ATOM   1839  N  N     . VAL B  1  10   ? 47.855  32.824  115.663  1.00 46.66  ?  10   VAL B N     1 
ATOM   1840  C  CA    . VAL B  1  10   ? 46.710  33.716  115.786  1.00 50.57  ?  10   VAL B CA    1 
ATOM   1841  C  C     . VAL B  1  10   ? 45.409  32.943  116.005  1.00 48.51  ?  10   VAL B C     1 
ATOM   1842  O  O     . VAL B  1  10   ? 45.193  31.856  115.441  1.00 53.50  ?  10   VAL B O     1 
ATOM   1843  C  CB    . VAL B  1  10   ? 46.581  34.684  114.587  1.00 50.18  ?  10   VAL B CB    1 
ATOM   1844  C  CG1   . VAL B  1  10   ? 47.866  35.476  114.412  1.00 53.42  ?  10   VAL B CG1   1 
ATOM   1845  C  CG2   . VAL B  1  10   ? 46.233  33.936  113.311  1.00 58.08  ?  10   VAL B CG2   1 
ATOM   1846  N  N     . PHE B  1  11   ? 44.566  33.519  116.857  1.00 46.54  ?  11   PHE B N     1 
ATOM   1847  C  CA    . PHE B  1  11   ? 43.297  32.931  117.252  1.00 49.56  ?  11   PHE B CA    1 
ATOM   1848  C  C     . PHE B  1  11   ? 42.160  33.882  116.896  1.00 47.63  ?  11   PHE B C     1 
ATOM   1849  O  O     . PHE B  1  11   ? 42.047  34.967  117.464  1.00 50.54  ?  11   PHE B O     1 
ATOM   1850  C  CB    . PHE B  1  11   ? 43.312  32.648  118.757  1.00 53.69  ?  11   PHE B CB    1 
ATOM   1851  C  CG    . PHE B  1  11   ? 42.013  32.123  119.295  1.00 55.14  ?  11   PHE B CG    1 
ATOM   1852  C  CD1   . PHE B  1  11   ? 41.527  30.891  118.892  1.00 52.46  ?  11   PHE B CD1   1 
ATOM   1853  C  CD2   . PHE B  1  11   ? 41.287  32.854  120.221  1.00 59.90  ?  11   PHE B CD2   1 
ATOM   1854  C  CE1   . PHE B  1  11   ? 40.333  30.405  119.392  1.00 54.69  ?  11   PHE B CE1   1 
ATOM   1855  C  CE2   . PHE B  1  11   ? 40.094  32.373  120.726  1.00 56.56  ?  11   PHE B CE2   1 
ATOM   1856  C  CZ    . PHE B  1  11   ? 39.616  31.147  120.310  1.00 52.47  ?  11   PHE B CZ    1 
ATOM   1857  N  N     . THR B  1  12   ? 41.324  33.469  115.950  1.00 46.33  ?  12   THR B N     1 
ATOM   1858  C  CA    . THR B  1  12   ? 40.231  34.300  115.462  1.00 44.48  ?  12   THR B CA    1 
ATOM   1859  C  C     . THR B  1  12   ? 38.879  33.732  115.884  1.00 46.57  ?  12   THR B C     1 
ATOM   1860  O  O     . THR B  1  12   ? 38.664  32.519  115.846  1.00 49.24  ?  12   THR B O     1 
ATOM   1861  C  CB    . THR B  1  12   ? 40.271  34.422  113.928  1.00 42.85  ?  12   THR B CB    1 
ATOM   1862  O  OG1   . THR B  1  12   ? 41.586  34.810  113.514  1.00 56.98  ?  12   THR B OG1   1 
ATOM   1863  C  CG2   . THR B  1  12   ? 39.263  35.454  113.442  1.00 48.64  ?  12   THR B CG2   1 
ATOM   1864  N  N     . VAL B  1  13   ? 37.974  34.621  116.282  1.00 52.00  ?  13   VAL B N     1 
ATOM   1865  C  CA    . VAL B  1  13   ? 36.654  34.229  116.761  1.00 50.07  ?  13   VAL B CA    1 
ATOM   1866  C  C     . VAL B  1  13   ? 35.548  34.811  115.883  1.00 50.80  ?  13   VAL B C     1 
ATOM   1867  O  O     . VAL B  1  13   ? 35.603  35.976  115.492  1.00 59.24  ?  13   VAL B O     1 
ATOM   1868  C  CB    . VAL B  1  13   ? 36.434  34.701  118.212  1.00 52.72  ?  13   VAL B CB    1 
ATOM   1869  C  CG1   . VAL B  1  13   ? 35.084  34.234  118.731  1.00 51.71  ?  13   VAL B CG1   1 
ATOM   1870  C  CG2   . VAL B  1  13   ? 37.554  34.202  119.109  1.00 54.07  ?  13   VAL B CG2   1 
ATOM   1871  N  N     . ARG B  1  14   ? 34.549  33.992  115.574  1.00 51.80  ?  14   ARG B N     1 
ATOM   1872  C  CA    . ARG B  1  14   ? 33.383  34.442  114.824  1.00 58.14  ?  14   ARG B CA    1 
ATOM   1873  C  C     . ARG B  1  14   ? 32.124  33.970  115.543  1.00 60.12  ?  14   ARG B C     1 
ATOM   1874  O  O     . ARG B  1  14   ? 31.888  32.770  115.663  1.00 64.67  ?  14   ARG B O     1 
ATOM   1875  C  CB    . ARG B  1  14   ? 33.426  33.879  113.404  1.00 54.80  ?  14   ARG B CB    1 
ATOM   1876  C  CG    . ARG B  1  14   ? 32.433  34.501  112.439  1.00 57.87  ?  14   ARG B CG    1 
ATOM   1877  C  CD    . ARG B  1  14   ? 32.618  33.922  111.047  1.00 73.94  ?  14   ARG B CD    1 
ATOM   1878  N  NE    . ARG B  1  14   ? 34.023  33.934  110.646  1.00 90.43  ?  14   ARG B NE    1 
ATOM   1879  C  CZ    . ARG B  1  14   ? 34.491  33.383  109.531  1.00 99.01  ?  14   ARG B CZ    1 
ATOM   1880  N  NH1   . ARG B  1  14   ? 35.787  33.445  109.253  1.00 94.99  ?  14   ARG B NH1   1 
ATOM   1881  N  NH2   . ARG B  1  14   ? 33.666  32.769  108.694  1.00 100.57 ?  14   ARG B NH2   1 
ATOM   1882  N  N     . THR B  1  15   ? 31.313  34.907  116.022  1.00 61.84  ?  15   THR B N     1 
ATOM   1883  C  CA    . THR B  1  15   ? 30.165  34.549  116.851  1.00 63.01  ?  15   THR B CA    1 
ATOM   1884  C  C     . THR B  1  15   ? 28.827  35.052  116.317  1.00 65.46  ?  15   THR B C     1 
ATOM   1885  O  O     . THR B  1  15   ? 28.699  36.210  115.918  1.00 67.90  ?  15   THR B O     1 
ATOM   1886  C  CB    . THR B  1  15   ? 30.335  35.060  118.297  1.00 60.50  ?  15   THR B CB    1 
ATOM   1887  O  OG1   . THR B  1  15   ? 30.611  36.466  118.279  1.00 59.67  ?  15   THR B OG1   1 
ATOM   1888  C  CG2   . THR B  1  15   ? 31.477  34.335  118.989  1.00 59.92  ?  15   THR B CG2   1 
ATOM   1889  N  N     . GLN B  1  16   ? 27.835  34.166  116.311  1.00 63.15  ?  16   GLN B N     1 
ATOM   1890  C  CA    . GLN B  1  16   ? 26.459  34.553  116.028  1.00 66.23  ?  16   GLN B CA    1 
ATOM   1891  C  C     . GLN B  1  16   ? 25.619  34.350  117.284  1.00 66.52  ?  16   GLN B C     1 
ATOM   1892  O  O     . GLN B  1  16   ? 25.353  33.217  117.683  1.00 61.31  ?  16   GLN B O     1 
ATOM   1893  C  CB    . GLN B  1  16   ? 25.883  33.720  114.882  1.00 61.02  ?  16   GLN B CB    1 
ATOM   1894  C  CG    . GLN B  1  16   ? 26.635  33.846  113.567  1.00 72.60  ?  16   GLN B CG    1 
ATOM   1895  C  CD    . GLN B  1  16   ? 26.028  32.989  112.469  1.00 74.62  ?  16   GLN B CD    1 
ATOM   1896  O  OE1   . GLN B  1  16   ? 24.927  32.457  112.618  1.00 62.00  ?  16   GLN B OE1   1 
ATOM   1897  N  NE2   . GLN B  1  16   ? 26.748  32.848  111.361  1.00 61.40  ?  16   GLN B NE2   1 
ATOM   1898  N  N     . GLY B  1  17   ? 25.202  35.453  117.899  1.00 69.47  ?  17   GLY B N     1 
ATOM   1899  C  CA    . GLY B  1  17   ? 24.416  35.400  119.118  1.00 60.14  ?  17   GLY B CA    1 
ATOM   1900  C  C     . GLY B  1  17   ? 25.123  34.694  120.260  1.00 49.96  ?  17   GLY B C     1 
ATOM   1901  O  O     . GLY B  1  17   ? 26.352  34.653  120.314  1.00 47.59  ?  17   GLY B O     1 
ATOM   1902  N  N     . ARG B  1  18   ? 24.338  34.144  121.181  1.00 52.56  ?  18   ARG B N     1 
ATOM   1903  C  CA    . ARG B  1  18   ? 24.877  33.400  122.314  1.00 58.69  ?  18   ARG B CA    1 
ATOM   1904  C  C     . ARG B  1  18   ? 24.885  31.899  122.036  1.00 59.01  ?  18   ARG B C     1 
ATOM   1905  O  O     . ARG B  1  18   ? 25.279  31.100  122.886  1.00 59.07  ?  18   ARG B O     1 
ATOM   1906  C  CB    . ARG B  1  18   ? 24.062  33.691  123.578  1.00 60.09  ?  18   ARG B CB    1 
ATOM   1907  C  CG    . ARG B  1  18   ? 24.083  35.147  124.017  1.00 53.84  ?  18   ARG B CG    1 
ATOM   1908  C  CD    . ARG B  1  18   ? 23.226  35.367  125.256  1.00 44.54  ?  18   ARG B CD    1 
ATOM   1909  N  NE    . ARG B  1  18   ? 23.653  34.536  126.378  1.00 42.97  ?  18   ARG B NE    1 
ATOM   1910  C  CZ    . ARG B  1  18   ? 24.624  34.864  127.225  1.00 53.09  ?  18   ARG B CZ    1 
ATOM   1911  N  NH1   . ARG B  1  18   ? 24.946  34.046  128.219  1.00 53.32  ?  18   ARG B NH1   1 
ATOM   1912  N  NH2   . ARG B  1  18   ? 25.278  36.009  127.078  1.00 53.14  ?  18   ARG B NH2   1 
ATOM   1913  N  N     . GLU B  1  19   ? 24.450  31.525  120.838  1.00 56.18  ?  19   GLU B N     1 
ATOM   1914  C  CA    . GLU B  1  19   ? 24.245  30.123  120.492  1.00 52.65  ?  19   GLU B CA    1 
ATOM   1915  C  C     . GLU B  1  19   ? 25.476  29.464  119.874  1.00 48.69  ?  19   GLU B C     1 
ATOM   1916  O  O     . GLU B  1  19   ? 26.035  28.518  120.430  1.00 46.65  ?  19   GLU B O     1 
ATOM   1917  C  CB    . GLU B  1  19   ? 23.056  29.986  119.536  1.00 68.12  ?  19   GLU B CB    1 
ATOM   1918  C  CG    . GLU B  1  19   ? 21.769  30.629  120.036  1.00 69.29  ?  19   GLU B CG    1 
ATOM   1919  C  CD    . GLU B  1  19   ? 21.120  29.849  121.163  1.00 61.72  ?  19   GLU B CD    1 
ATOM   1920  O  OE1   . GLU B  1  19   ? 20.178  30.381  121.790  1.00 59.99  ?  19   GLU B OE1   1 
ATOM   1921  O  OE2   . GLU B  1  19   ? 21.545  28.703  121.419  1.00 65.88  ?  19   GLU B OE2   1 
ATOM   1922  N  N     . TYR B  1  20   ? 25.884  29.966  118.714  1.00 48.47  ?  20   TYR B N     1 
ATOM   1923  C  CA    . TYR B  1  20   ? 26.904  29.316  117.898  1.00 47.76  ?  20   TYR B CA    1 
ATOM   1924  C  C     . TYR B  1  20   ? 28.207  30.110  117.862  1.00 50.11  ?  20   TYR B C     1 
ATOM   1925  O  O     . TYR B  1  20   ? 28.199  31.335  117.991  1.00 54.05  ?  20   TYR B O     1 
ATOM   1926  C  CB    . TYR B  1  20   ? 26.362  29.121  116.478  1.00 46.62  ?  20   TYR B CB    1 
ATOM   1927  C  CG    . TYR B  1  20   ? 27.358  28.571  115.484  1.00 46.46  ?  20   TYR B CG    1 
ATOM   1928  C  CD1   . TYR B  1  20   ? 27.921  27.316  115.659  1.00 46.35  ?  20   TYR B CD1   1 
ATOM   1929  C  CD2   . TYR B  1  20   ? 27.719  29.300  114.357  1.00 47.95  ?  20   TYR B CD2   1 
ATOM   1930  C  CE1   . TYR B  1  20   ? 28.828  26.807  114.751  1.00 50.77  ?  20   TYR B CE1   1 
ATOM   1931  C  CE2   . TYR B  1  20   ? 28.624  28.797  113.440  1.00 46.36  ?  20   TYR B CE2   1 
ATOM   1932  C  CZ    . TYR B  1  20   ? 29.174  27.549  113.643  1.00 49.52  ?  20   TYR B CZ    1 
ATOM   1933  O  OH    . TYR B  1  20   ? 30.074  27.035  112.739  1.00 53.94  ?  20   TYR B OH    1 
ATOM   1934  N  N     . GLY B  1  21   ? 29.326  29.409  117.692  1.00 47.03  ?  21   GLY B N     1 
ATOM   1935  C  CA    . GLY B  1  21   ? 30.610  30.071  117.544  1.00 43.51  ?  21   GLY B CA    1 
ATOM   1936  C  C     . GLY B  1  21   ? 31.635  29.285  116.745  1.00 45.60  ?  21   GLY B C     1 
ATOM   1937  O  O     . GLY B  1  21   ? 31.586  28.054  116.678  1.00 46.33  ?  21   GLY B O     1 
ATOM   1938  N  N     . GLU B  1  22   ? 32.577  30.014  116.149  1.00 46.13  ?  22   GLU B N     1 
ATOM   1939  C  CA    . GLU B  1  22   ? 33.649  29.430  115.350  1.00 38.77  ?  22   GLU B CA    1 
ATOM   1940  C  C     . GLU B  1  22   ? 34.989  29.975  115.813  1.00 38.18  ?  22   GLU B C     1 
ATOM   1941  O  O     . GLU B  1  22   ? 35.156  31.183  115.976  1.00 45.06  ?  22   GLU B O     1 
ATOM   1942  C  CB    . GLU B  1  22   ? 33.467  29.756  113.869  1.00 40.97  ?  22   GLU B CB    1 
ATOM   1943  C  CG    . GLU B  1  22   ? 32.153  29.299  113.281  1.00 48.94  ?  22   GLU B CG    1 
ATOM   1944  C  CD    . GLU B  1  22   ? 32.108  29.455  111.773  1.00 65.75  ?  22   GLU B CD    1 
ATOM   1945  O  OE1   . GLU B  1  22   ? 33.187  29.592  111.156  1.00 65.56  ?  22   GLU B OE1   1 
ATOM   1946  O  OE2   . GLU B  1  22   ? 30.995  29.442  111.206  1.00 66.55  ?  22   GLU B OE2   1 
ATOM   1947  N  N     . PHE B  1  23   ? 35.949  29.081  116.011  1.00 33.39  ?  23   PHE B N     1 
ATOM   1948  C  CA    . PHE B  1  23   ? 37.241  29.467  116.553  1.00 41.02  ?  23   PHE B CA    1 
ATOM   1949  C  C     . PHE B  1  23   ? 38.365  28.870  115.723  1.00 38.51  ?  23   PHE B C     1 
ATOM   1950  O  O     . PHE B  1  23   ? 38.505  27.652  115.638  1.00 33.44  ?  23   PHE B O     1 
ATOM   1951  C  CB    . PHE B  1  23   ? 37.352  29.015  118.011  1.00 39.54  ?  23   PHE B CB    1 
ATOM   1952  C  CG    . PHE B  1  23   ? 36.205  29.467  118.869  1.00 38.49  ?  23   PHE B CG    1 
ATOM   1953  C  CD1   . PHE B  1  23   ? 35.056  28.700  118.975  1.00 35.86  ?  23   PHE B CD1   1 
ATOM   1954  C  CD2   . PHE B  1  23   ? 36.270  30.664  119.562  1.00 48.21  ?  23   PHE B CD2   1 
ATOM   1955  C  CE1   . PHE B  1  23   ? 33.997  29.115  119.757  1.00 42.83  ?  23   PHE B CE1   1 
ATOM   1956  C  CE2   . PHE B  1  23   ? 35.215  31.084  120.348  1.00 51.99  ?  23   PHE B CE2   1 
ATOM   1957  C  CZ    . PHE B  1  23   ? 34.076  30.309  120.446  1.00 51.57  ?  23   PHE B CZ    1 
ATOM   1958  N  N     . VAL B  1  24   ? 39.167  29.736  115.112  1.00 36.14  ?  24   VAL B N     1 
ATOM   1959  C  CA    . VAL B  1  24   ? 40.264  29.282  114.267  1.00 32.49  ?  24   VAL B CA    1 
ATOM   1960  C  C     . VAL B  1  24   ? 41.612  29.593  114.904  1.00 35.60  ?  24   VAL B C     1 
ATOM   1961  O  O     . VAL B  1  24   ? 41.850  30.709  115.353  1.00 37.32  ?  24   VAL B O     1 
ATOM   1962  C  CB    . VAL B  1  24   ? 40.194  29.920  112.866  1.00 33.43  ?  24   VAL B CB    1 
ATOM   1963  C  CG1   . VAL B  1  24   ? 41.358  29.452  112.006  1.00 42.02  ?  24   VAL B CG1   1 
ATOM   1964  C  CG2   . VAL B  1  24   ? 38.869  29.587  112.201  1.00 34.23  ?  24   VAL B CG2   1 
ATOM   1965  N  N     . LEU B  1  25   ? 42.490  28.598  114.949  1.00 34.64  ?  25   LEU B N     1 
ATOM   1966  C  CA    . LEU B  1  25   ? 43.831  28.791  115.480  1.00 37.48  ?  25   LEU B CA    1 
ATOM   1967  C  C     . LEU B  1  25   ? 44.848  28.358  114.434  1.00 39.98  ?  25   LEU B C     1 
ATOM   1968  O  O     . LEU B  1  25   ? 44.931  27.172  114.092  1.00 42.02  ?  25   LEU B O     1 
ATOM   1969  C  CB    . LEU B  1  25   ? 44.010  27.977  116.764  1.00 39.17  ?  25   LEU B CB    1 
ATOM   1970  C  CG    . LEU B  1  25   ? 45.268  28.220  117.598  1.00 40.43  ?  25   LEU B CG    1 
ATOM   1971  C  CD1   . LEU B  1  25   ? 45.293  29.644  118.125  1.00 41.36  ?  25   LEU B CD1   1 
ATOM   1972  C  CD2   . LEU B  1  25   ? 45.352  27.220  118.743  1.00 32.92  ?  25   LEU B CD2   1 
ATOM   1973  N  N     . GLU B  1  26   ? 45.598  29.322  113.901  1.00 47.91  ?  26   GLU B N     1 
ATOM   1974  C  CA    . GLU B  1  26   ? 46.623  29.012  112.900  1.00 48.39  ?  26   GLU B CA    1 
ATOM   1975  C  C     . GLU B  1  26   ? 47.799  29.985  112.945  1.00 49.23  ?  26   GLU B C     1 
ATOM   1976  O  O     . GLU B  1  26   ? 47.634  31.125  113.363  1.00 51.56  ?  26   GLU B O     1 
ATOM   1977  C  CB    . GLU B  1  26   ? 46.010  29.007  111.497  1.00 46.71  ?  26   GLU B CB    1 
ATOM   1978  C  CG    . GLU B  1  26   ? 45.414  30.341  111.080  1.00 50.36  ?  26   GLU B CG    1 
ATOM   1979  C  CD    . GLU B  1  26   ? 44.977  30.355  109.629  1.00 60.36  ?  26   GLU B CD    1 
ATOM   1980  O  OE1   . GLU B  1  26   ? 45.453  29.495  108.857  1.00 61.84  ?  26   GLU B OE1   1 
ATOM   1981  O  OE2   . GLU B  1  26   ? 44.158  31.223  109.262  1.00 64.71  ?  26   GLU B OE2   1 
ATOM   1982  N  N     . PRO B  1  27   ? 48.989  29.551  112.497  1.00 45.00  ?  27   PRO B N     1 
ATOM   1983  C  CA    . PRO B  1  27   ? 49.409  28.188  112.160  1.00 43.38  ?  27   PRO B CA    1 
ATOM   1984  C  C     . PRO B  1  27   ? 49.804  27.396  113.401  1.00 43.98  ?  27   PRO B C     1 
ATOM   1985  O  O     . PRO B  1  27   ? 50.132  27.988  114.428  1.00 44.14  ?  27   PRO B O     1 
ATOM   1986  C  CB    . PRO B  1  27   ? 50.635  28.418  111.278  1.00 48.28  ?  27   PRO B CB    1 
ATOM   1987  C  CG    . PRO B  1  27   ? 51.223  29.669  111.804  1.00 46.36  ?  27   PRO B CG    1 
ATOM   1988  C  CD    . PRO B  1  27   ? 50.058  30.528  112.222  1.00 48.30  ?  27   PRO B CD    1 
ATOM   1989  N  N     . LEU B  1  28   ? 49.774  26.072  113.301  1.00 47.30  ?  28   LEU B N     1 
ATOM   1990  C  CA    . LEU B  1  28   ? 50.233  25.209  114.382  1.00 42.26  ?  28   LEU B CA    1 
ATOM   1991  C  C     . LEU B  1  28   ? 51.213  24.180  113.832  1.00 36.57  ?  28   LEU B C     1 
ATOM   1992  O  O     . LEU B  1  28   ? 51.212  23.897  112.636  1.00 43.53  ?  28   LEU B O     1 
ATOM   1993  C  CB    . LEU B  1  28   ? 49.048  24.511  115.052  1.00 45.60  ?  28   LEU B CB    1 
ATOM   1994  C  CG    . LEU B  1  28   ? 47.989  25.421  115.683  1.00 42.50  ?  28   LEU B CG    1 
ATOM   1995  C  CD1   . LEU B  1  28   ? 46.774  24.619  116.123  1.00 37.11  ?  28   LEU B CD1   1 
ATOM   1996  C  CD2   . LEU B  1  28   ? 48.574  26.195  116.855  1.00 47.21  ?  28   LEU B CD2   1 
ATOM   1997  N  N     . GLU B  1  29   ? 52.049  23.625  114.704  1.00 36.17  ?  29   GLU B N     1 
ATOM   1998  C  CA    . GLU B  1  29   ? 53.015  22.613  114.292  1.00 44.16  ?  29   GLU B CA    1 
ATOM   1999  C  C     . GLU B  1  29   ? 52.279  21.344  113.869  1.00 51.31  ?  29   GLU B C     1 
ATOM   2000  O  O     . GLU B  1  29   ? 51.127  21.137  114.251  1.00 57.94  ?  29   GLU B O     1 
ATOM   2001  C  CB    . GLU B  1  29   ? 53.998  22.318  115.429  1.00 56.01  ?  29   GLU B CB    1 
ATOM   2002  C  CG    . GLU B  1  29   ? 55.213  21.490  115.023  1.00 66.23  ?  29   GLU B CG    1 
ATOM   2003  C  CD    . GLU B  1  29   ? 56.061  22.172  113.965  1.00 80.48  ?  29   GLU B CD    1 
ATOM   2004  O  OE1   . GLU B  1  29   ? 56.626  21.462  113.105  1.00 74.31  ?  29   GLU B OE1   1 
ATOM   2005  O  OE2   . GLU B  1  29   ? 56.169  23.417  113.997  1.00 85.96  ?  29   GLU B OE2   1 
ATOM   2006  N  N     . ARG B  1  30   ? 52.939  20.509  113.070  1.00 48.33  ?  30   ARG B N     1 
ATOM   2007  C  CA    . ARG B  1  30   ? 52.322  19.296  112.540  1.00 48.30  ?  30   ARG B CA    1 
ATOM   2008  C  C     . ARG B  1  30   ? 51.809  18.374  113.643  1.00 46.51  ?  30   ARG B C     1 
ATOM   2009  O  O     . ARG B  1  30   ? 52.557  17.983  114.539  1.00 39.80  ?  30   ARG B O     1 
ATOM   2010  C  CB    . ARG B  1  30   ? 53.316  18.537  111.657  1.00 50.16  ?  30   ARG B CB    1 
ATOM   2011  C  CG    . ARG B  1  30   ? 52.735  17.306  110.980  1.00 46.63  ?  30   ARG B CG    1 
ATOM   2012  C  CD    . ARG B  1  30   ? 53.823  16.463  110.331  1.00 43.96  ?  30   ARG B CD    1 
ATOM   2013  N  NE    . ARG B  1  30   ? 54.685  15.825  111.323  1.00 42.32  ?  30   ARG B NE    1 
ATOM   2014  C  CZ    . ARG B  1  30   ? 55.754  15.093  111.026  1.00 41.68  ?  30   ARG B CZ    1 
ATOM   2015  N  NH1   . ARG B  1  30   ? 56.104  14.905  109.761  1.00 40.65  ?  30   ARG B NH1   1 
ATOM   2016  N  NH2   . ARG B  1  30   ? 56.478  14.550  111.995  1.00 51.99  ?  30   ARG B NH2   1 
ATOM   2017  N  N     . GLY B  1  31   ? 50.528  18.027  113.562  1.00 47.52  ?  31   GLY B N     1 
ATOM   2018  C  CA    . GLY B  1  31   ? 49.919  17.112  114.509  1.00 41.55  ?  31   GLY B CA    1 
ATOM   2019  C  C     . GLY B  1  31   ? 49.190  17.788  115.654  1.00 38.15  ?  31   GLY B C     1 
ATOM   2020  O  O     . GLY B  1  31   ? 48.336  17.176  116.296  1.00 36.65  ?  31   GLY B O     1 
ATOM   2021  N  N     . PHE B  1  32   ? 49.516  19.052  115.909  1.00 45.81  ?  32   PHE B N     1 
ATOM   2022  C  CA    . PHE B  1  32   ? 48.965  19.766  117.060  1.00 43.54  ?  32   PHE B CA    1 
ATOM   2023  C  C     . PHE B  1  32   ? 47.509  20.189  116.896  1.00 41.23  ?  32   PHE B C     1 
ATOM   2024  O  O     . PHE B  1  32   ? 46.840  20.514  117.879  1.00 44.39  ?  32   PHE B O     1 
ATOM   2025  C  CB    . PHE B  1  32   ? 49.835  20.972  117.426  1.00 34.35  ?  32   PHE B CB    1 
ATOM   2026  C  CG    . PHE B  1  32   ? 51.005  20.622  118.295  1.00 40.54  ?  32   PHE B CG    1 
ATOM   2027  C  CD1   . PHE B  1  32   ? 52.219  20.270  117.734  1.00 46.48  ?  32   PHE B CD1   1 
ATOM   2028  C  CD2   . PHE B  1  32   ? 50.884  20.626  119.674  1.00 40.71  ?  32   PHE B CD2   1 
ATOM   2029  C  CE1   . PHE B  1  32   ? 53.295  19.938  118.532  1.00 46.19  ?  32   PHE B CE1   1 
ATOM   2030  C  CE2   . PHE B  1  32   ? 51.958  20.295  120.478  1.00 41.38  ?  32   PHE B CE2   1 
ATOM   2031  C  CZ    . PHE B  1  32   ? 53.165  19.950  119.906  1.00 43.47  ?  32   PHE B CZ    1 
ATOM   2032  N  N     . GLY B  1  33   ? 47.023  20.181  115.659  1.00 40.84  ?  33   GLY B N     1 
ATOM   2033  C  CA    . GLY B  1  33   ? 45.637  20.517  115.386  1.00 37.78  ?  33   GLY B CA    1 
ATOM   2034  C  C     . GLY B  1  33   ? 44.681  19.599  116.122  1.00 34.59  ?  33   GLY B C     1 
ATOM   2035  O  O     . GLY B  1  33   ? 43.751  20.059  116.789  1.00 28.80  ?  33   GLY B O     1 
ATOM   2036  N  N     . VAL B  1  34   ? 44.912  18.295  116.003  1.00 35.35  ?  34   VAL B N     1 
ATOM   2037  C  CA    . VAL B  1  34   ? 44.086  17.308  116.688  1.00 34.60  ?  34   VAL B CA    1 
ATOM   2038  C  C     . VAL B  1  34   ? 44.515  17.128  118.143  1.00 33.49  ?  34   VAL B C     1 
ATOM   2039  O  O     . VAL B  1  34   ? 43.731  16.675  118.978  1.00 33.35  ?  34   VAL B O     1 
ATOM   2040  C  CB    . VAL B  1  34   ? 44.121  15.944  115.968  1.00 35.93  ?  34   VAL B CB    1 
ATOM   2041  C  CG1   . VAL B  1  34   ? 43.599  16.083  114.547  1.00 35.51  ?  34   VAL B CG1   1 
ATOM   2042  C  CG2   . VAL B  1  34   ? 45.530  15.380  115.964  1.00 33.34  ?  34   VAL B CG2   1 
ATOM   2043  N  N     . THR B  1  35   ? 45.758  17.497  118.443  1.00 33.23  ?  35   THR B N     1 
ATOM   2044  C  CA    . THR B  1  35   ? 46.279  17.389  119.800  1.00 32.55  ?  35   THR B CA    1 
ATOM   2045  C  C     . THR B  1  35   ? 45.566  18.380  120.706  1.00 27.58  ?  35   THR B C     1 
ATOM   2046  O  O     . THR B  1  35   ? 45.236  18.064  121.845  1.00 27.93  ?  35   THR B O     1 
ATOM   2047  C  CB    . THR B  1  35   ? 47.800  17.638  119.855  1.00 37.93  ?  35   THR B CB    1 
ATOM   2048  O  OG1   . THR B  1  35   ? 48.476  16.662  119.052  1.00 39.20  ?  35   THR B OG1   1 
ATOM   2049  C  CG2   . THR B  1  35   ? 48.307  17.540  121.285  1.00 35.65  ?  35   THR B CG2   1 
ATOM   2050  N  N     . LEU B  1  36   ? 45.339  19.586  120.199  1.00 31.13  ?  36   LEU B N     1 
ATOM   2051  C  CA    . LEU B  1  36   ? 44.523  20.564  120.909  1.00 31.28  ?  36   LEU B CA    1 
ATOM   2052  C  C     . LEU B  1  36   ? 43.034  20.305  120.693  1.00 31.78  ?  36   LEU B C     1 
ATOM   2053  O  O     . LEU B  1  36   ? 42.226  20.494  121.600  1.00 36.14  ?  36   LEU B O     1 
ATOM   2054  C  CB    . LEU B  1  36   ? 44.874  21.984  120.468  1.00 26.30  ?  36   LEU B CB    1 
ATOM   2055  C  CG    . LEU B  1  36   ? 46.320  22.415  120.712  1.00 30.56  ?  36   LEU B CG    1 
ATOM   2056  C  CD1   . LEU B  1  36   ? 46.514  23.868  120.313  1.00 39.59  ?  36   LEU B CD1   1 
ATOM   2057  C  CD2   . LEU B  1  36   ? 46.706  22.192  122.166  1.00 29.86  ?  36   LEU B CD2   1 
ATOM   2058  N  N     . GLY B  1  37   ? 42.683  19.864  119.489  1.00 33.34  ?  37   GLY B N     1 
ATOM   2059  C  CA    . GLY B  1  37   ? 41.292  19.696  119.101  1.00 31.14  ?  37   GLY B CA    1 
ATOM   2060  C  C     . GLY B  1  37   ? 40.518  18.625  119.849  1.00 30.71  ?  37   GLY B C     1 
ATOM   2061  O  O     . GLY B  1  37   ? 39.424  18.883  120.350  1.00 29.67  ?  37   GLY B O     1 
ATOM   2062  N  N     . ASN B  1  38   ? 41.075  17.421  119.915  1.00 29.58  ?  38   ASN B N     1 
ATOM   2063  C  CA    . ASN B  1  38   ? 40.395  16.298  120.564  1.00 27.71  ?  38   ASN B CA    1 
ATOM   2064  C  C     . ASN B  1  38   ? 40.025  16.471  122.045  1.00 31.32  ?  38   ASN B C     1 
ATOM   2065  O  O     . ASN B  1  38   ? 38.865  16.276  122.406  1.00 36.49  ?  38   ASN B O     1 
ATOM   2066  C  CB    . ASN B  1  38   ? 41.156  14.985  120.341  1.00 30.65  ?  38   ASN B CB    1 
ATOM   2067  C  CG    . ASN B  1  38   ? 40.833  14.348  119.007  1.00 45.21  ?  38   ASN B CG    1 
ATOM   2068  O  OD1   . ASN B  1  38   ? 39.681  14.342  118.575  1.00 50.39  ?  38   ASN B OD1   1 
ATOM   2069  N  ND2   . ASN B  1  38   ? 41.850  13.809  118.345  1.00 53.52  ?  38   ASN B ND2   1 
ATOM   2070  N  N     . PRO B  1  39   ? 40.998  16.831  122.906  1.00 32.76  ?  39   PRO B N     1 
ATOM   2071  C  CA    . PRO B  1  39   ? 40.686  16.916  124.338  1.00 31.18  ?  39   PRO B CA    1 
ATOM   2072  C  C     . PRO B  1  39   ? 39.635  17.972  124.631  1.00 27.73  ?  39   PRO B C     1 
ATOM   2073  O  O     . PRO B  1  39   ? 38.742  17.735  125.443  1.00 30.28  ?  39   PRO B O     1 
ATOM   2074  C  CB    . PRO B  1  39   ? 42.015  17.348  124.966  1.00 31.08  ?  39   PRO B CB    1 
ATOM   2075  C  CG    . PRO B  1  39   ? 43.040  17.033  123.958  1.00 32.57  ?  39   PRO B CG    1 
ATOM   2076  C  CD    . PRO B  1  39   ? 42.392  17.217  122.638  1.00 32.43  ?  39   PRO B CD    1 
ATOM   2077  N  N     . LEU B  1  40   ? 39.750  19.122  123.974  1.00 25.12  ?  40   LEU B N     1 
ATOM   2078  C  CA    . LEU B  1  40   ? 38.803  20.208  124.173  1.00 30.37  ?  40   LEU B CA    1 
ATOM   2079  C  C     . LEU B  1  40   ? 37.384  19.751  123.857  1.00 30.19  ?  40   LEU B C     1 
ATOM   2080  O  O     . LEU B  1  40   ? 36.459  20.018  124.623  1.00 31.52  ?  40   LEU B O     1 
ATOM   2081  C  CB    . LEU B  1  40   ? 39.184  21.428  123.331  1.00 26.57  ?  40   LEU B CB    1 
ATOM   2082  C  CG    . LEU B  1  40   ? 40.490  22.126  123.717  1.00 26.06  ?  40   LEU B CG    1 
ATOM   2083  C  CD1   . LEU B  1  40   ? 40.651  23.429  122.951  1.00 28.84  ?  40   LEU B CD1   1 
ATOM   2084  C  CD2   . LEU B  1  40   ? 40.562  22.368  125.220  1.00 27.96  ?  40   LEU B CD2   1 
ATOM   2085  N  N     . ARG B  1  41   ? 37.224  19.049  122.739  1.00 29.26  ?  41   ARG B N     1 
ATOM   2086  C  CA    . ARG B  1  41   ? 35.931  18.487  122.363  1.00 29.40  ?  41   ARG B CA    1 
ATOM   2087  C  C     . ARG B  1  41   ? 35.389  17.574  123.459  1.00 29.95  ?  41   ARG B C     1 
ATOM   2088  O  O     . ARG B  1  41   ? 34.221  17.671  123.837  1.00 30.42  ?  41   ARG B O     1 
ATOM   2089  C  CB    . ARG B  1  41   ? 36.040  17.704  121.054  1.00 33.41  ?  41   ARG B CB    1 
ATOM   2090  C  CG    . ARG B  1  41   ? 34.836  16.819  120.785  1.00 36.38  ?  41   ARG B CG    1 
ATOM   2091  C  CD    . ARG B  1  41   ? 35.119  15.768  119.727  1.00 33.98  ?  41   ARG B CD    1 
ATOM   2092  N  NE    . ARG B  1  41   ? 34.187  14.648  119.832  1.00 29.66  ?  41   ARG B NE    1 
ATOM   2093  C  CZ    . ARG B  1  41   ? 32.958  14.648  119.325  1.00 33.76  ?  41   ARG B CZ    1 
ATOM   2094  N  NH1   . ARG B  1  41   ? 32.178  13.585  119.473  1.00 27.92  ?  41   ARG B NH1   1 
ATOM   2095  N  NH2   . ARG B  1  41   ? 32.507  15.710  118.671  1.00 31.19  ?  41   ARG B NH2   1 
ATOM   2096  N  N     . ARG B  1  42   ? 36.247  16.691  123.962  1.00 27.07  ?  42   ARG B N     1 
ATOM   2097  C  CA    . ARG B  1  42   ? 35.870  15.771  125.029  1.00 27.97  ?  42   ARG B CA    1 
ATOM   2098  C  C     . ARG B  1  42   ? 35.454  16.532  126.281  1.00 27.97  ?  42   ARG B C     1 
ATOM   2099  O  O     . ARG B  1  42   ? 34.446  16.213  126.911  1.00 28.16  ?  42   ARG B O     1 
ATOM   2100  C  CB    . ARG B  1  42   ? 37.028  14.827  125.356  1.00 22.15  ?  42   ARG B CB    1 
ATOM   2101  C  CG    . ARG B  1  42   ? 37.466  13.953  124.198  1.00 21.83  ?  42   ARG B CG    1 
ATOM   2102  C  CD    . ARG B  1  42   ? 38.650  13.082  124.587  1.00 27.36  ?  42   ARG B CD    1 
ATOM   2103  N  NE    . ARG B  1  42   ? 38.308  12.137  125.645  1.00 25.36  ?  42   ARG B NE    1 
ATOM   2104  C  CZ    . ARG B  1  42   ? 37.895  10.892  125.429  1.00 24.77  ?  42   ARG B CZ    1 
ATOM   2105  N  NH1   . ARG B  1  42   ? 37.775  10.438  124.190  1.00 27.30  ?  42   ARG B NH1   1 
ATOM   2106  N  NH2   . ARG B  1  42   ? 37.603  10.101  126.452  1.00 24.73  ?  42   ARG B NH2   1 
ATOM   2107  N  N     . ILE B  1  43   ? 36.239  17.544  126.633  1.00 24.56  ?  43   ILE B N     1 
ATOM   2108  C  CA    . ILE B  1  43   ? 35.965  18.357  127.810  1.00 27.36  ?  43   ILE B CA    1 
ATOM   2109  C  C     . ILE B  1  43   ? 34.698  19.192  127.633  1.00 31.30  ?  43   ILE B C     1 
ATOM   2110  O  O     . ILE B  1  43   ? 33.860  19.259  128.534  1.00 31.54  ?  43   ILE B O     1 
ATOM   2111  C  CB    . ILE B  1  43   ? 37.159  19.272  128.140  1.00 26.08  ?  43   ILE B CB    1 
ATOM   2112  C  CG1   . ILE B  1  43   ? 38.366  18.429  128.551  1.00 26.17  ?  43   ILE B CG1   1 
ATOM   2113  C  CG2   . ILE B  1  43   ? 36.798  20.253  129.243  1.00 29.37  ?  43   ILE B CG2   1 
ATOM   2114  C  CD1   . ILE B  1  43   ? 39.622  19.233  128.788  1.00 30.39  ?  43   ILE B CD1   1 
ATOM   2115  N  N     . LEU B  1  44   ? 34.560  19.813  126.465  1.00 28.26  ?  44   LEU B N     1 
ATOM   2116  C  CA    . LEU B  1  44   ? 33.403  20.653  126.164  1.00 25.70  ?  44   LEU B CA    1 
ATOM   2117  C  C     . LEU B  1  44   ? 32.080  19.900  126.263  1.00 28.28  ?  44   LEU B C     1 
ATOM   2118  O  O     . LEU B  1  44   ? 31.070  20.462  126.685  1.00 33.65  ?  44   LEU B O     1 
ATOM   2119  C  CB    . LEU B  1  44   ? 33.538  21.276  124.775  1.00 28.01  ?  44   LEU B CB    1 
ATOM   2120  C  CG    . LEU B  1  44   ? 34.493  22.461  124.638  1.00 25.84  ?  44   LEU B CG    1 
ATOM   2121  C  CD1   . LEU B  1  44   ? 34.835  22.695  123.176  1.00 29.83  ?  44   LEU B CD1   1 
ATOM   2122  C  CD2   . LEU B  1  44   ? 33.876  23.703  125.248  1.00 32.81  ?  44   LEU B CD2   1 
ATOM   2123  N  N     . LEU B  1  45   ? 32.082  18.635  125.859  1.00 26.60  ?  45   LEU B N     1 
ATOM   2124  C  CA    . LEU B  1  45   ? 30.869  17.825  125.924  1.00 29.82  ?  45   LEU B CA    1 
ATOM   2125  C  C     . LEU B  1  45   ? 30.571  17.306  127.331  1.00 33.68  ?  45   LEU B C     1 
ATOM   2126  O  O     . LEU B  1  45   ? 29.448  17.425  127.818  1.00 42.01  ?  45   LEU B O     1 
ATOM   2127  C  CB    . LEU B  1  45   ? 30.958  16.651  124.946  1.00 31.16  ?  45   LEU B CB    1 
ATOM   2128  C  CG    . LEU B  1  45   ? 31.020  17.009  123.457  1.00 33.33  ?  45   LEU B CG    1 
ATOM   2129  C  CD1   . LEU B  1  45   ? 31.217  15.760  122.614  1.00 26.92  ?  45   LEU B CD1   1 
ATOM   2130  C  CD2   . LEU B  1  45   ? 29.764  17.752  123.031  1.00 34.56  ?  45   LEU B CD2   1 
ATOM   2131  N  N     . SER B  1  46   ? 31.577  16.718  127.971  1.00 32.49  ?  46   SER B N     1 
ATOM   2132  C  CA    . SER B  1  46   ? 31.400  16.098  129.284  1.00 27.04  ?  46   SER B CA    1 
ATOM   2133  C  C     . SER B  1  46   ? 31.492  17.025  130.502  1.00 30.44  ?  46   SER B C     1 
ATOM   2134  O  O     . SER B  1  46   ? 30.699  16.910  131.434  1.00 37.58  ?  46   SER B O     1 
ATOM   2135  C  CB    . SER B  1  46   ? 32.372  14.928  129.451  1.00 27.75  ?  46   SER B CB    1 
ATOM   2136  O  OG    . SER B  1  46   ? 33.714  15.353  129.287  1.00 33.92  ?  46   SER B OG    1 
ATOM   2137  N  N     . SER B  1  47   ? 32.471  17.924  130.507  1.00 26.95  ?  47   SER B N     1 
ATOM   2138  C  CA    . SER B  1  47   ? 32.855  18.602  131.747  1.00 26.15  ?  47   SER B CA    1 
ATOM   2139  C  C     . SER B  1  47   ? 32.309  20.009  132.015  1.00 32.76  ?  47   SER B C     1 
ATOM   2140  O  O     . SER B  1  47   ? 32.579  20.580  133.072  1.00 32.14  ?  47   SER B O     1 
ATOM   2141  C  CB    . SER B  1  47   ? 34.377  18.599  131.889  1.00 31.63  ?  47   SER B CB    1 
ATOM   2142  O  OG    . SER B  1  47   ? 34.858  17.270  131.940  1.00 35.56  ?  47   SER B OG    1 
ATOM   2143  N  N     . ILE B  1  48   ? 31.548  20.568  131.081  1.00 32.69  ?  48   ILE B N     1 
ATOM   2144  C  CA    . ILE B  1  48   ? 31.070  21.939  131.248  1.00 30.17  ?  48   ILE B CA    1 
ATOM   2145  C  C     . ILE B  1  48   ? 29.823  22.012  132.129  1.00 40.31  ?  48   ILE B C     1 
ATOM   2146  O  O     . ILE B  1  48   ? 28.802  21.398  131.819  1.00 47.94  ?  48   ILE B O     1 
ATOM   2147  C  CB    . ILE B  1  48   ? 30.804  22.621  129.896  1.00 30.67  ?  48   ILE B CB    1 
ATOM   2148  C  CG1   . ILE B  1  48   ? 32.046  22.535  129.011  1.00 32.60  ?  48   ILE B CG1   1 
ATOM   2149  C  CG2   . ILE B  1  48   ? 30.428  24.074  130.100  1.00 28.91  ?  48   ILE B CG2   1 
ATOM   2150  C  CD1   . ILE B  1  48   ? 33.262  23.205  129.608  1.00 34.12  ?  48   ILE B CD1   1 
ATOM   2151  N  N     . PRO B  1  49   ? 29.915  22.764  133.240  1.00 40.69  ?  49   PRO B N     1 
ATOM   2152  C  CA    . PRO B  1  49   ? 28.839  22.935  134.226  1.00 34.47  ?  49   PRO B CA    1 
ATOM   2153  C  C     . PRO B  1  49   ? 27.573  23.538  133.626  1.00 34.46  ?  49   PRO B C     1 
ATOM   2154  O  O     . PRO B  1  49   ? 27.640  24.551  132.931  1.00 35.68  ?  49   PRO B O     1 
ATOM   2155  C  CB    . PRO B  1  49   ? 29.448  23.913  135.236  1.00 35.05  ?  49   PRO B CB    1 
ATOM   2156  C  CG    . PRO B  1  49   ? 30.917  23.728  135.101  1.00 43.55  ?  49   PRO B CG    1 
ATOM   2157  C  CD    . PRO B  1  49   ? 31.144  23.467  133.645  1.00 42.31  ?  49   PRO B CD    1 
ATOM   2158  N  N     . GLY B  1  50   ? 26.431  22.920  133.910  1.00 34.88  ?  50   GLY B N     1 
ATOM   2159  C  CA    . GLY B  1  50   ? 25.154  23.382  133.396  1.00 33.37  ?  50   GLY B CA    1 
ATOM   2160  C  C     . GLY B  1  50   ? 24.002  22.888  134.249  1.00 36.17  ?  50   GLY B C     1 
ATOM   2161  O  O     . GLY B  1  50   ? 24.217  22.298  135.306  1.00 46.07  ?  50   GLY B O     1 
ATOM   2162  N  N     . THR B  1  51   ? 22.777  23.134  133.795  1.00 35.47  ?  51   THR B N     1 
ATOM   2163  C  CA    . THR B  1  51   ? 21.591  22.721  134.542  1.00 40.28  ?  51   THR B CA    1 
ATOM   2164  C  C     . THR B  1  51   ? 20.676  21.828  133.707  1.00 37.52  ?  51   THR B C     1 
ATOM   2165  O  O     . THR B  1  51   ? 20.718  21.862  132.477  1.00 45.71  ?  51   THR B O     1 
ATOM   2166  C  CB    . THR B  1  51   ? 20.788  23.937  135.050  1.00 45.74  ?  51   THR B CB    1 
ATOM   2167  O  OG1   . THR B  1  51   ? 20.315  24.704  133.936  1.00 45.82  ?  51   THR B OG1   1 
ATOM   2168  C  CG2   . THR B  1  51   ? 21.659  24.820  135.933  1.00 46.72  ?  51   THR B CG2   1 
ATOM   2169  N  N     . ALA B  1  52   ? 19.851  21.033  134.383  1.00 32.41  ?  52   ALA B N     1 
ATOM   2170  C  CA    . ALA B  1  52   ? 18.950  20.104  133.704  1.00 38.71  ?  52   ALA B CA    1 
ATOM   2171  C  C     . ALA B  1  52   ? 17.750  19.736  134.568  1.00 35.08  ?  52   ALA B C     1 
ATOM   2172  O  O     . ALA B  1  52   ? 17.769  19.926  135.782  1.00 39.24  ?  52   ALA B O     1 
ATOM   2173  C  CB    . ALA B  1  52   ? 19.700  18.847  133.299  1.00 41.99  ?  52   ALA B CB    1 
ATOM   2174  N  N     . VAL B  1  53   ? 16.712  19.197  133.935  1.00 31.13  ?  53   VAL B N     1 
ATOM   2175  C  CA    . VAL B  1  53   ? 15.553  18.701  134.665  1.00 38.41  ?  53   VAL B CA    1 
ATOM   2176  C  C     . VAL B  1  53   ? 15.720  17.207  134.924  1.00 42.69  ?  53   VAL B C     1 
ATOM   2177  O  O     . VAL B  1  53   ? 15.636  16.395  134.000  1.00 42.06  ?  53   VAL B O     1 
ATOM   2178  C  CB    . VAL B  1  53   ? 14.258  18.924  133.863  1.00 38.08  ?  53   VAL B CB    1 
ATOM   2179  C  CG1   . VAL B  1  53   ? 13.067  18.321  134.591  1.00 44.99  ?  53   VAL B CG1   1 
ATOM   2180  C  CG2   . VAL B  1  53   ? 14.044  20.407  133.606  1.00 39.86  ?  53   VAL B CG2   1 
ATOM   2181  N  N     . THR B  1  54   ? 15.966  16.852  136.182  1.00 40.67  ?  54   THR B N     1 
ATOM   2182  C  CA    . THR B  1  54   ? 16.216  15.460  136.549  1.00 43.10  ?  54   THR B CA    1 
ATOM   2183  C  C     . THR B  1  54   ? 14.983  14.650  136.966  1.00 41.08  ?  54   THR B C     1 
ATOM   2184  O  O     . THR B  1  54   ? 15.027  13.421  136.988  1.00 39.69  ?  54   THR B O     1 
ATOM   2185  C  CB    . THR B  1  54   ? 17.255  15.378  137.679  1.00 42.13  ?  54   THR B CB    1 
ATOM   2186  O  OG1   . THR B  1  54   ? 16.859  16.244  138.748  1.00 45.19  ?  54   THR B OG1   1 
ATOM   2187  C  CG2   . THR B  1  54   ? 18.619  15.815  137.178  1.00 45.01  ?  54   THR B CG2   1 
ATOM   2188  N  N     . SER B  1  55   ? 13.888  15.329  137.294  1.00 44.01  ?  55   SER B N     1 
ATOM   2189  C  CA    . SER B  1  55   ? 12.690  14.634  137.763  1.00 47.73  ?  55   SER B CA    1 
ATOM   2190  C  C     . SER B  1  55   ? 11.407  15.423  137.509  1.00 48.20  ?  55   SER B C     1 
ATOM   2191  O  O     . SER B  1  55   ? 11.413  16.653  137.517  1.00 41.67  ?  55   SER B O     1 
ATOM   2192  C  CB    . SER B  1  55   ? 12.814  14.290  139.249  1.00 47.86  ?  55   SER B CB    1 
ATOM   2193  O  OG    . SER B  1  55   ? 11.703  13.529  139.690  1.00 53.77  ?  55   SER B OG    1 
ATOM   2194  N  N     . VAL B  1  56   ? 10.306  14.710  137.290  1.00 44.21  ?  56   VAL B N     1 
ATOM   2195  C  CA    . VAL B  1  56   ? 9.015   15.351  137.055  1.00 53.71  ?  56   VAL B CA    1 
ATOM   2196  C  C     . VAL B  1  56   ? 7.892   14.629  137.792  1.00 59.43  ?  56   VAL B C     1 
ATOM   2197  O  O     . VAL B  1  56   ? 7.743   13.414  137.670  1.00 57.73  ?  56   VAL B O     1 
ATOM   2198  C  CB    . VAL B  1  56   ? 8.667   15.398  135.548  1.00 59.50  ?  56   VAL B CB    1 
ATOM   2199  C  CG1   . VAL B  1  56   ? 7.250   15.917  135.341  1.00 52.41  ?  56   VAL B CG1   1 
ATOM   2200  C  CG2   . VAL B  1  56   ? 9.664   16.258  134.790  1.00 57.25  ?  56   VAL B CG2   1 
ATOM   2201  N  N     . TYR B  1  57   ? 7.107   15.379  138.559  1.00 62.65  ?  57   TYR B N     1 
ATOM   2202  C  CA    . TYR B  1  57   ? 5.915   14.827  139.196  1.00 58.39  ?  57   TYR B CA    1 
ATOM   2203  C  C     . TYR B  1  57   ? 4.661   15.523  138.690  1.00 55.01  ?  57   TYR B C     1 
ATOM   2204  O  O     . TYR B  1  57   ? 4.562   16.745  138.739  1.00 54.90  ?  57   TYR B O     1 
ATOM   2205  C  CB    . TYR B  1  57   ? 5.994   14.949  140.719  1.00 64.71  ?  57   TYR B CB    1 
ATOM   2206  C  CG    . TYR B  1  57   ? 4.666   14.711  141.407  1.00 64.74  ?  57   TYR B CG    1 
ATOM   2207  C  CD1   . TYR B  1  57   ? 4.159   13.427  141.557  1.00 67.71  ?  57   TYR B CD1   1 
ATOM   2208  C  CD2   . TYR B  1  57   ? 3.918   15.772  141.904  1.00 66.31  ?  57   TYR B CD2   1 
ATOM   2209  C  CE1   . TYR B  1  57   ? 2.945   13.205  142.182  1.00 67.72  ?  57   TYR B CE1   1 
ATOM   2210  C  CE2   . TYR B  1  57   ? 2.703   15.559  142.529  1.00 65.64  ?  57   TYR B CE2   1 
ATOM   2211  C  CZ    . TYR B  1  57   ? 2.222   14.274  142.667  1.00 69.06  ?  57   TYR B CZ    1 
ATOM   2212  O  OH    . TYR B  1  57   ? 1.015   14.057  143.289  1.00 75.79  ?  57   TYR B OH    1 
ATOM   2213  N  N     . ILE B  1  58   ? 3.704   14.739  138.204  1.00 57.52  ?  58   ILE B N     1 
ATOM   2214  C  CA    . ILE B  1  58   ? 2.441   15.287  137.723  1.00 63.97  ?  58   ILE B CA    1 
ATOM   2215  C  C     . ILE B  1  58   ? 1.276   14.660  138.482  1.00 66.36  ?  58   ILE B C     1 
ATOM   2216  O  O     . ILE B  1  58   ? 1.228   13.442  138.657  1.00 65.33  ?  58   ILE B O     1 
ATOM   2217  C  CB    . ILE B  1  58   ? 2.256   15.048  136.212  1.00 60.75  ?  58   ILE B CB    1 
ATOM   2218  C  CG1   . ILE B  1  58   ? 3.509   15.475  135.445  1.00 64.71  ?  58   ILE B CG1   1 
ATOM   2219  C  CG2   . ILE B  1  58   ? 1.040   15.802  135.698  1.00 68.45  ?  58   ILE B CG2   1 
ATOM   2220  C  CD1   . ILE B  1  58   ? 3.447   15.175  133.963  1.00 72.40  ?  58   ILE B CD1   1 
ATOM   2221  N  N     . GLU B  1  59   ? 0.346   15.498  138.932  1.00 69.51  ?  59   GLU B N     1 
ATOM   2222  C  CA    . GLU B  1  59   ? -0.792  15.041  139.727  1.00 73.57  ?  59   GLU B CA    1 
ATOM   2223  C  C     . GLU B  1  59   ? -1.652  14.027  138.977  1.00 66.71  ?  59   GLU B C     1 
ATOM   2224  O  O     . GLU B  1  59   ? -1.938  14.199  137.791  1.00 65.71  ?  59   GLU B O     1 
ATOM   2225  C  CB    . GLU B  1  59   ? -1.650  16.229  140.173  1.00 82.04  ?  59   GLU B CB    1 
ATOM   2226  C  CG    . GLU B  1  59   ? -2.829  15.843  141.056  1.00 81.63  ?  59   GLU B CG    1 
ATOM   2227  C  CD    . GLU B  1  59   ? -3.687  17.031  141.445  1.00 86.87  ?  59   GLU B CD    1 
ATOM   2228  O  OE1   . GLU B  1  59   ? -3.332  18.171  141.076  1.00 93.74  ?  59   GLU B OE1   1 
ATOM   2229  O  OE2   . GLU B  1  59   ? -4.719  16.823  142.119  1.00 77.61  ?  59   GLU B OE2   1 
ATOM   2230  N  N     . ASP B  1  60   ? -2.048  12.970  139.683  1.00 62.83  ?  60   ASP B N     1 
ATOM   2231  C  CA    . ASP B  1  60   ? -2.871  11.897  139.124  1.00 68.06  ?  60   ASP B CA    1 
ATOM   2232  C  C     . ASP B  1  60   ? -2.206  11.196  137.941  1.00 64.83  ?  60   ASP B C     1 
ATOM   2233  O  O     . ASP B  1  60   ? -2.884  10.634  137.082  1.00 65.15  ?  60   ASP B O     1 
ATOM   2234  C  CB    . ASP B  1  60   ? -4.266  12.407  138.739  1.00 78.44  ?  60   ASP B CB    1 
ATOM   2235  C  CG    . ASP B  1  60   ? -5.107  12.780  139.948  1.00 74.69  ?  60   ASP B CG    1 
ATOM   2236  O  OD1   . ASP B  1  60   ? -4.964  12.123  141.002  1.00 67.72  ?  60   ASP B OD1   1 
ATOM   2237  O  OD2   . ASP B  1  60   ? -5.912  13.729  139.844  1.00 68.97  ?  60   ASP B OD2   1 
ATOM   2238  N  N     . VAL B  1  61   ? -0.878  11.230  137.907  1.00 69.07  ?  61   VAL B N     1 
ATOM   2239  C  CA    . VAL B  1  61   ? -0.117  10.532  136.878  1.00 67.33  ?  61   VAL B CA    1 
ATOM   2240  C  C     . VAL B  1  61   ? 0.816   9.520   137.526  1.00 62.87  ?  61   VAL B C     1 
ATOM   2241  O  O     . VAL B  1  61   ? 1.708   9.885   138.291  1.00 63.17  ?  61   VAL B O     1 
ATOM   2242  C  CB    . VAL B  1  61   ? 0.706   11.502  136.012  1.00 65.72  ?  61   VAL B CB    1 
ATOM   2243  C  CG1   . VAL B  1  61   ? 1.627   10.730  135.081  1.00 63.54  ?  61   VAL B CG1   1 
ATOM   2244  C  CG2   . VAL B  1  61   ? -0.214  12.416  135.220  1.00 70.58  ?  61   VAL B CG2   1 
ATOM   2245  N  N     . LEU B  1  62   ? 0.604   8.246   137.215  1.00 65.29  ?  62   LEU B N     1 
ATOM   2246  C  CA    . LEU B  1  62   ? 1.369   7.171   137.836  1.00 76.81  ?  62   LEU B CA    1 
ATOM   2247  C  C     . LEU B  1  62   ? 2.763   7.018   137.234  1.00 79.30  ?  62   LEU B C     1 
ATOM   2248  O  O     . LEU B  1  62   ? 3.765   7.245   137.913  1.00 70.94  ?  62   LEU B O     1 
ATOM   2249  C  CB    . LEU B  1  62   ? 0.603   5.848   137.753  1.00 79.18  ?  62   LEU B CB    1 
ATOM   2250  C  CG    . LEU B  1  62   ? -0.736  5.815   138.495  1.00 79.21  ?  62   LEU B CG    1 
ATOM   2251  C  CD1   . LEU B  1  62   ? -1.376  4.438   138.396  1.00 78.70  ?  62   LEU B CD1   1 
ATOM   2252  C  CD2   . LEU B  1  62   ? -0.556  6.225   139.949  1.00 71.90  ?  62   LEU B CD2   1 
ATOM   2253  N  N     . HIS B  1  63   ? 2.826   6.636   135.961  1.00 80.17  ?  63   HIS B N     1 
ATOM   2254  C  CA    . HIS B  1  63   ? 4.112   6.390   135.312  1.00 75.63  ?  63   HIS B CA    1 
ATOM   2255  C  C     . HIS B  1  63   ? 4.379   7.279   134.094  1.00 70.52  ?  63   HIS B C     1 
ATOM   2256  O  O     . HIS B  1  63   ? 3.555   8.113   133.721  1.00 65.94  ?  63   HIS B O     1 
ATOM   2257  C  CB    . HIS B  1  63   ? 4.264   4.908   134.949  1.00 78.32  ?  63   HIS B CB    1 
ATOM   2258  C  CG    . HIS B  1  63   ? 3.060   4.318   134.277  1.00 84.97  ?  63   HIS B CG    1 
ATOM   2259  N  ND1   . HIS B  1  63   ? 2.770   4.542   132.944  1.00 85.32  ?  63   HIS B ND1   1 
ATOM   2260  C  CD2   . HIS B  1  63   ? 2.085   3.514   134.746  1.00 88.22  ?  63   HIS B CD2   1 
ATOM   2261  C  CE1   . HIS B  1  63   ? 1.663   3.898   132.630  1.00 85.27  ?  63   HIS B CE1   1 
ATOM   2262  N  NE2   . HIS B  1  63   ? 1.221   3.265   133.699  1.00 89.46  ?  63   HIS B NE2   1 
ATOM   2263  N  N     . GLU B  1  64   ? 5.547   7.081   133.488  1.00 75.04  ?  64   GLU B N     1 
ATOM   2264  C  CA    . GLU B  1  64   ? 6.024   7.907   132.381  1.00 74.72  ?  64   GLU B CA    1 
ATOM   2265  C  C     . GLU B  1  64   ? 5.201   7.713   131.109  1.00 68.53  ?  64   GLU B C     1 
ATOM   2266  O  O     . GLU B  1  64   ? 5.076   8.625   130.291  1.00 66.79  ?  64   GLU B O     1 
ATOM   2267  C  CB    . GLU B  1  64   ? 7.500   7.593   132.110  1.00 76.72  ?  64   GLU B CB    1 
ATOM   2268  C  CG    . GLU B  1  64   ? 8.157   8.438   131.031  1.00 81.90  ?  64   GLU B CG    1 
ATOM   2269  C  CD    . GLU B  1  64   ? 9.643   8.152   130.895  1.00 86.70  ?  64   GLU B CD    1 
ATOM   2270  O  OE1   . GLU B  1  64   ? 10.324  8.873   130.134  1.00 83.71  ?  64   GLU B OE1   1 
ATOM   2271  O  OE2   . GLU B  1  64   ? 10.131  7.206   131.550  1.00 75.12  ?  64   GLU B OE2   1 
ATOM   2272  N  N     . PHE B  1  65   ? 4.637   6.522   130.954  1.00 64.62  ?  65   PHE B N     1 
ATOM   2273  C  CA    . PHE B  1  65   ? 3.894   6.170   129.749  1.00 63.34  ?  65   PHE B CA    1 
ATOM   2274  C  C     . PHE B  1  65   ? 2.399   6.445   129.879  1.00 71.11  ?  65   PHE B C     1 
ATOM   2275  O  O     . PHE B  1  65   ? 1.617   6.089   128.998  1.00 71.80  ?  65   PHE B O     1 
ATOM   2276  C  CB    . PHE B  1  65   ? 4.148   4.710   129.372  1.00 67.97  ?  65   PHE B CB    1 
ATOM   2277  C  CG    . PHE B  1  65   ? 5.583   4.416   129.047  1.00 75.82  ?  65   PHE B CG    1 
ATOM   2278  C  CD1   . PHE B  1  65   ? 6.082   4.659   127.777  1.00 70.07  ?  65   PHE B CD1   1 
ATOM   2279  C  CD2   . PHE B  1  65   ? 6.437   3.909   130.012  1.00 76.49  ?  65   PHE B CD2   1 
ATOM   2280  C  CE1   . PHE B  1  65   ? 7.404   4.394   127.473  1.00 64.04  ?  65   PHE B CE1   1 
ATOM   2281  C  CE2   . PHE B  1  65   ? 7.761   3.643   129.715  1.00 73.29  ?  65   PHE B CE2   1 
ATOM   2282  C  CZ    . PHE B  1  65   ? 8.244   3.886   128.444  1.00 69.29  ?  65   PHE B CZ    1 
ATOM   2283  N  N     . SER B  1  66   ? 2.009   7.074   130.983  1.00 76.07  ?  66   SER B N     1 
ATOM   2284  C  CA    . SER B  1  66   ? 0.604   7.373   131.237  1.00 72.35  ?  66   SER B CA    1 
ATOM   2285  C  C     . SER B  1  66   ? 0.092   8.488   130.328  1.00 79.80  ?  66   SER B C     1 
ATOM   2286  O  O     . SER B  1  66   ? 0.842   9.049   129.527  1.00 70.41  ?  66   SER B O     1 
ATOM   2287  C  CB    . SER B  1  66   ? 0.404   7.771   132.700  1.00 71.08  ?  66   SER B CB    1 
ATOM   2288  O  OG    . SER B  1  66   ? 0.962   6.805   133.575  1.00 72.68  ?  66   SER B OG    1 
ATOM   2289  N  N     . THR B  1  67   ? -1.190  8.809   130.467  1.00 88.69  ?  67   THR B N     1 
ATOM   2290  C  CA    . THR B  1  67   ? -1.817  9.851   129.662  1.00 82.06  ?  67   THR B CA    1 
ATOM   2291  C  C     . THR B  1  67   ? -2.619  10.810  130.538  1.00 77.57  ?  67   THR B C     1 
ATOM   2292  O  O     . THR B  1  67   ? -3.207  10.405  131.541  1.00 76.45  ?  67   THR B O     1 
ATOM   2293  C  CB    . THR B  1  67   ? -2.729  9.253   128.570  1.00 71.95  ?  67   THR B CB    1 
ATOM   2294  O  OG1   . THR B  1  67   ? -3.428  10.307  127.897  1.00 80.14  ?  67   THR B OG1   1 
ATOM   2295  C  CG2   . THR B  1  67   ? -3.737  8.289   129.180  1.00 60.81  ?  67   THR B CG2   1 
ATOM   2296  N  N     . ILE B  1  68   ? -2.635  12.083  130.156  1.00 76.35  ?  68   ILE B N     1 
ATOM   2297  C  CA    . ILE B  1  68   ? -3.306  13.108  130.947  1.00 83.58  ?  68   ILE B CA    1 
ATOM   2298  C  C     . ILE B  1  68   ? -4.593  13.595  130.286  1.00 91.16  ?  68   ILE B C     1 
ATOM   2299  O  O     . ILE B  1  68   ? -4.553  14.193  129.210  1.00 89.07  ?  68   ILE B O     1 
ATOM   2300  C  CB    . ILE B  1  68   ? -2.385  14.316  131.195  1.00 72.49  ?  68   ILE B CB    1 
ATOM   2301  C  CG1   . ILE B  1  68   ? -1.068  13.861  131.823  1.00 68.89  ?  68   ILE B CG1   1 
ATOM   2302  C  CG2   . ILE B  1  68   ? -3.079  15.340  132.078  1.00 75.47  ?  68   ILE B CG2   1 
ATOM   2303  C  CD1   . ILE B  1  68   ? -0.101  14.990  132.094  1.00 73.45  ?  68   ILE B CD1   1 
ATOM   2304  N  N     . PRO B  1  69   ? -5.741  13.333  130.932  1.00 92.24  ?  69   PRO B N     1 
ATOM   2305  C  CA    . PRO B  1  69   ? -7.050  13.790  130.451  1.00 83.90  ?  69   PRO B CA    1 
ATOM   2306  C  C     . PRO B  1  69   ? -7.140  15.313  130.413  1.00 84.60  ?  69   PRO B C     1 
ATOM   2307  O  O     . PRO B  1  69   ? -6.774  15.977  131.385  1.00 83.29  ?  69   PRO B O     1 
ATOM   2308  C  CB    . PRO B  1  69   ? -8.021  13.234  131.498  1.00 73.47  ?  69   PRO B CB    1 
ATOM   2309  C  CG    . PRO B  1  69   ? -7.298  12.088  132.120  1.00 71.72  ?  69   PRO B CG    1 
ATOM   2310  C  CD    . PRO B  1  69   ? -5.860  12.502  132.142  1.00 80.54  ?  69   PRO B CD    1 
ATOM   2311  N  N     . GLY B  1  70   ? -7.626  15.856  129.301  1.00 77.72  ?  70   GLY B N     1 
ATOM   2312  C  CA    . GLY B  1  70   ? -7.758  17.293  129.148  1.00 82.86  ?  70   GLY B CA    1 
ATOM   2313  C  C     . GLY B  1  70   ? -6.544  17.924  128.493  1.00 87.65  ?  70   GLY B C     1 
ATOM   2314  O  O     . GLY B  1  70   ? -6.562  19.102  128.134  1.00 91.57  ?  70   GLY B O     1 
ATOM   2315  N  N     . VAL B  1  71   ? -5.485  17.136  128.339  1.00 84.58  ?  71   VAL B N     1 
ATOM   2316  C  CA    . VAL B  1  71   ? -4.255  17.615  127.720  1.00 81.15  ?  71   VAL B CA    1 
ATOM   2317  C  C     . VAL B  1  71   ? -3.952  16.832  126.445  1.00 76.02  ?  71   VAL B C     1 
ATOM   2318  O  O     . VAL B  1  71   ? -3.983  15.601  126.441  1.00 73.41  ?  71   VAL B O     1 
ATOM   2319  C  CB    . VAL B  1  71   ? -3.060  17.513  128.689  1.00 79.94  ?  71   VAL B CB    1 
ATOM   2320  C  CG1   . VAL B  1  71   ? -1.785  17.992  128.015  1.00 81.17  ?  71   VAL B CG1   1 
ATOM   2321  C  CG2   . VAL B  1  71   ? -3.332  18.318  129.951  1.00 73.41  ?  71   VAL B CG2   1 
ATOM   2322  N  N     . LYS B  1  72   ? -3.665  17.555  125.367  1.00 83.83  ?  72   LYS B N     1 
ATOM   2323  C  CA    . LYS B  1  72   ? -3.394  16.941  124.069  1.00 83.48  ?  72   LYS B CA    1 
ATOM   2324  C  C     . LYS B  1  72   ? -2.116  16.101  124.072  1.00 80.69  ?  72   LYS B C     1 
ATOM   2325  O  O     . LYS B  1  72   ? -2.122  14.954  123.624  1.00 78.90  ?  72   LYS B O     1 
ATOM   2326  C  CB    . LYS B  1  72   ? -3.340  18.009  122.971  1.00 84.33  ?  72   LYS B CB    1 
ATOM   2327  C  CG    . LYS B  1  72   ? -2.881  17.499  121.613  1.00 90.10  ?  72   LYS B CG    1 
ATOM   2328  C  CD    . LYS B  1  72   ? -3.360  18.407  120.485  1.00 86.41  ?  72   LYS B CD    1 
ATOM   2329  C  CE    . LYS B  1  72   ? -3.019  19.867  120.745  1.00 80.57  ?  72   LYS B CE    1 
ATOM   2330  N  NZ    . LYS B  1  72   ? -1.552  20.099  120.846  1.00 91.27  ?  72   LYS B NZ    1 
ATOM   2331  N  N     . GLU B  1  73   ? -1.027  16.670  124.580  1.00 70.50  ?  73   GLU B N     1 
ATOM   2332  C  CA    . GLU B  1  73   ? 0.237   15.944  124.664  1.00 63.47  ?  73   GLU B CA    1 
ATOM   2333  C  C     . GLU B  1  73   ? 0.219   14.948  125.817  1.00 66.87  ?  73   GLU B C     1 
ATOM   2334  O  O     . GLU B  1  73   ? -0.355  15.219  126.871  1.00 74.65  ?  73   GLU B O     1 
ATOM   2335  C  CB    . GLU B  1  73   ? 1.413   16.908  124.842  1.00 60.93  ?  73   GLU B CB    1 
ATOM   2336  C  CG    . GLU B  1  73   ? 1.576   17.929  123.730  1.00 73.19  ?  73   GLU B CG    1 
ATOM   2337  C  CD    . GLU B  1  73   ? 0.803   19.204  123.995  1.00 74.24  ?  73   GLU B CD    1 
ATOM   2338  O  OE1   . GLU B  1  73   ? -0.001  19.225  124.950  1.00 75.41  ?  73   GLU B OE1   1 
ATOM   2339  O  OE2   . GLU B  1  73   ? 1.005   20.188  123.251  1.00 71.13  ?  73   GLU B OE2   1 
ATOM   2340  N  N     . ASP B  1  74   ? 0.847   13.794  125.614  1.00 62.61  ?  74   ASP B N     1 
ATOM   2341  C  CA    . ASP B  1  74   ? 0.978   12.808  126.681  1.00 63.62  ?  74   ASP B CA    1 
ATOM   2342  C  C     . ASP B  1  74   ? 2.133   13.171  127.612  1.00 69.51  ?  74   ASP B C     1 
ATOM   2343  O  O     . ASP B  1  74   ? 2.772   14.208  127.438  1.00 64.51  ?  74   ASP B O     1 
ATOM   2344  C  CB    . ASP B  1  74   ? 1.159   11.396  126.114  1.00 67.35  ?  74   ASP B CB    1 
ATOM   2345  C  CG    . ASP B  1  74   ? 2.244   11.318  125.050  1.00 70.56  ?  74   ASP B CG    1 
ATOM   2346  O  OD1   . ASP B  1  74   ? 3.125   12.204  125.011  1.00 68.96  ?  74   ASP B OD1   1 
ATOM   2347  O  OD2   . ASP B  1  74   ? 2.216   10.356  124.252  1.00 61.45  ?  74   ASP B OD2   1 
ATOM   2348  N  N     . VAL B  1  75   ? 2.396   12.316  128.594  1.00 68.10  ?  75   VAL B N     1 
ATOM   2349  C  CA    . VAL B  1  75   ? 3.455   12.563  129.568  1.00 64.37  ?  75   VAL B CA    1 
ATOM   2350  C  C     . VAL B  1  75   ? 4.828   12.655  128.902  1.00 60.30  ?  75   VAL B C     1 
ATOM   2351  O  O     . VAL B  1  75   ? 5.630   13.531  129.229  1.00 54.93  ?  75   VAL B O     1 
ATOM   2352  C  CB    . VAL B  1  75   ? 3.479   11.467  130.653  1.00 64.41  ?  75   VAL B CB    1 
ATOM   2353  C  CG1   . VAL B  1  75   ? 4.635   11.689  131.613  1.00 61.05  ?  75   VAL B CG1   1 
ATOM   2354  C  CG2   . VAL B  1  75   ? 2.156   11.436  131.405  1.00 68.70  ?  75   VAL B CG2   1 
ATOM   2355  N  N     . VAL B  1  76   ? 5.078   11.752  127.958  1.00 59.23  ?  76   VAL B N     1 
ATOM   2356  C  CA    . VAL B  1  76   ? 6.358   11.678  127.258  1.00 53.47  ?  76   VAL B CA    1 
ATOM   2357  C  C     . VAL B  1  76   ? 6.724   12.990  126.575  1.00 49.82  ?  76   VAL B C     1 
ATOM   2358  O  O     . VAL B  1  76   ? 7.819   13.530  126.782  1.00 45.60  ?  76   VAL B O     1 
ATOM   2359  C  CB    . VAL B  1  76   ? 6.340   10.571  126.191  1.00 54.26  ?  76   VAL B CB    1 
ATOM   2360  C  CG1   . VAL B  1  76   ? 7.696   10.471  125.510  1.00 52.57  ?  76   VAL B CG1   1 
ATOM   2361  C  CG2   . VAL B  1  76   ? 5.942   9.239   126.811  1.00 57.15  ?  76   VAL B CG2   1 
ATOM   2362  N  N     . GLU B  1  77   ? 5.803   13.495  125.759  1.00 48.14  ?  77   GLU B N     1 
ATOM   2363  C  CA    . GLU B  1  77   ? 6.023   14.731  125.018  1.00 50.29  ?  77   GLU B CA    1 
ATOM   2364  C  C     . GLU B  1  77   ? 6.332   15.883  125.971  1.00 54.26  ?  77   GLU B C     1 
ATOM   2365  O  O     . GLU B  1  77   ? 7.242   16.684  125.726  1.00 55.45  ?  77   GLU B O     1 
ATOM   2366  C  CB    . GLU B  1  77   ? 4.802   15.065  124.160  1.00 51.97  ?  77   GLU B CB    1 
ATOM   2367  C  CG    . GLU B  1  77   ? 5.000   16.257  123.239  1.00 62.31  ?  77   GLU B CG    1 
ATOM   2368  C  CD    . GLU B  1  77   ? 5.943   15.954  122.089  1.00 69.19  ?  77   GLU B CD    1 
ATOM   2369  O  OE1   . GLU B  1  77   ? 6.453   16.911  121.468  1.00 66.36  ?  77   GLU B OE1   1 
ATOM   2370  O  OE2   . GLU B  1  77   ? 6.171   14.759  121.801  1.00 69.02  ?  77   GLU B OE2   1 
ATOM   2371  N  N     . ILE B  1  78   ? 5.579   15.947  127.065  1.00 53.62  ?  78   ILE B N     1 
ATOM   2372  C  CA    . ILE B  1  78   ? 5.802   16.949  128.100  1.00 55.37  ?  78   ILE B CA    1 
ATOM   2373  C  C     . ILE B  1  78   ? 7.212   16.829  128.664  1.00 48.48  ?  78   ILE B C     1 
ATOM   2374  O  O     . ILE B  1  78   ? 7.895   17.834  128.873  1.00 47.95  ?  78   ILE B O     1 
ATOM   2375  C  CB    . ILE B  1  78   ? 4.792   16.803  129.254  1.00 59.09  ?  78   ILE B CB    1 
ATOM   2376  C  CG1   . ILE B  1  78   ? 3.360   16.982  128.746  1.00 60.03  ?  78   ILE B CG1   1 
ATOM   2377  C  CG2   . ILE B  1  78   ? 5.081   17.815  130.345  1.00 53.17  ?  78   ILE B CG2   1 
ATOM   2378  C  CD1   . ILE B  1  78   ? 2.301   16.718  129.795  1.00 56.57  ?  78   ILE B CD1   1 
ATOM   2379  N  N     . ILE B  1  79   ? 7.640   15.593  128.903  1.00 43.63  ?  79   ILE B N     1 
ATOM   2380  C  CA    . ILE B  1  79   ? 8.970   15.317  129.437  1.00 48.34  ?  79   ILE B CA    1 
ATOM   2381  C  C     . ILE B  1  79   ? 10.066  15.823  128.493  1.00 50.05  ?  79   ILE B C     1 
ATOM   2382  O  O     . ILE B  1  79   ? 11.060  16.401  128.937  1.00 46.29  ?  79   ILE B O     1 
ATOM   2383  C  CB    . ILE B  1  79   ? 9.153   13.804  129.741  1.00 50.70  ?  79   ILE B CB    1 
ATOM   2384  C  CG1   . ILE B  1  79   ? 8.295   13.390  130.942  1.00 47.56  ?  79   ILE B CG1   1 
ATOM   2385  C  CG2   . ILE B  1  79   ? 10.617  13.459  129.977  1.00 49.51  ?  79   ILE B CG2   1 
ATOM   2386  C  CD1   . ILE B  1  79   ? 8.556   11.986  131.409  1.00 48.39  ?  79   ILE B CD1   1 
ATOM   2387  N  N     . LEU B  1  80   ? 9.866   15.621  127.192  1.00 43.28  ?  80   LEU B N     1 
ATOM   2388  C  CA    . LEU B  1  80   ? 10.820  16.071  126.175  1.00 38.27  ?  80   LEU B CA    1 
ATOM   2389  C  C     . LEU B  1  80   ? 10.871  17.597  126.088  1.00 43.95  ?  80   LEU B C     1 
ATOM   2390  O  O     . LEU B  1  80   ? 11.939  18.198  125.933  1.00 47.10  ?  80   LEU B O     1 
ATOM   2391  C  CB    . LEU B  1  80   ? 10.424  15.501  124.807  1.00 38.00  ?  80   LEU B CB    1 
ATOM   2392  C  CG    . LEU B  1  80   ? 10.356  13.977  124.635  1.00 43.56  ?  80   LEU B CG    1 
ATOM   2393  C  CD1   . LEU B  1  80   ? 9.889   13.557  123.230  1.00 43.93  ?  80   LEU B CD1   1 
ATOM   2394  C  CD2   . LEU B  1  80   ? 11.707  13.356  124.968  1.00 39.93  ?  80   LEU B CD2   1 
ATOM   2395  N  N     . ASN B  1  81   ? 9.699   18.214  126.170  1.00 44.47  ?  81   ASN B N     1 
ATOM   2396  C  CA    . ASN B  1  81   ? 9.598   19.660  126.166  1.00 44.77  ?  81   ASN B CA    1 
ATOM   2397  C  C     . ASN B  1  81   ? 10.350  20.199  127.375  1.00 42.03  ?  81   ASN B C     1 
ATOM   2398  O  O     . ASN B  1  81   ? 10.997  21.245  127.308  1.00 44.15  ?  81   ASN B O     1 
ATOM   2399  C  CB    . ASN B  1  81   ? 8.127   20.077  126.207  1.00 48.38  ?  81   ASN B CB    1 
ATOM   2400  C  CG    . ASN B  1  81   ? 7.398   19.788  124.903  1.00 54.92  ?  81   ASN B CG    1 
ATOM   2401  O  OD1   . ASN B  1  81   ? 7.921   20.037  123.815  1.00 67.86  ?  81   ASN B OD1   1 
ATOM   2402  N  ND2   . ASN B  1  81   ? 6.181   19.266  125.007  1.00 50.58  ?  81   ASN B ND2   1 
ATOM   2403  N  N     . LEU B  1  82   ? 10.277  19.458  128.476  1.00 38.64  ?  82   LEU B N     1 
ATOM   2404  C  CA    . LEU B  1  82   ? 10.984  19.815  129.699  1.00 40.90  ?  82   LEU B CA    1 
ATOM   2405  C  C     . LEU B  1  82   ? 12.493  19.619  129.547  1.00 41.95  ?  82   LEU B C     1 
ATOM   2406  O  O     . LEU B  1  82   ? 13.285  20.341  130.158  1.00 42.85  ?  82   LEU B O     1 
ATOM   2407  C  CB    . LEU B  1  82   ? 10.432  19.013  130.885  1.00 39.22  ?  82   LEU B CB    1 
ATOM   2408  C  CG    . LEU B  1  82   ? 9.044   19.457  131.360  1.00 40.06  ?  82   LEU B CG    1 
ATOM   2409  C  CD1   . LEU B  1  82   ? 8.406   18.384  132.213  1.00 45.49  ?  82   LEU B CD1   1 
ATOM   2410  C  CD2   . LEU B  1  82   ? 9.139   20.766  132.125  1.00 42.73  ?  82   LEU B CD2   1 
ATOM   2411  N  N     . LYS B  1  83   ? 12.884  18.636  128.734  1.00 41.99  ?  83   LYS B N     1 
ATOM   2412  C  CA    . LYS B  1  83   ? 14.295  18.423  128.415  1.00 43.31  ?  83   LYS B CA    1 
ATOM   2413  C  C     . LYS B  1  83   ? 14.833  19.596  127.613  1.00 45.00  ?  83   LYS B C     1 
ATOM   2414  O  O     . LYS B  1  83   ? 16.003  19.943  127.733  1.00 40.25  ?  83   LYS B O     1 
ATOM   2415  C  CB    . LYS B  1  83   ? 14.506  17.140  127.606  1.00 38.93  ?  83   LYS B CB    1 
ATOM   2416  C  CG    . LYS B  1  83   ? 14.286  15.842  128.351  1.00 40.28  ?  83   LYS B CG    1 
ATOM   2417  C  CD    . LYS B  1  83   ? 14.596  14.660  127.431  1.00 34.45  ?  83   LYS B CD    1 
ATOM   2418  C  CE    . LYS B  1  83   ? 14.542  13.318  128.163  1.00 41.04  ?  83   LYS B CE    1 
ATOM   2419  N  NZ    . LYS B  1  83   ? 14.951  12.185  127.274  1.00 46.38  ?  83   LYS B NZ    1 
ATOM   2420  N  N     . GLU B  1  84   ? 13.972  20.211  126.805  1.00 41.06  ?  84   GLU B N     1 
ATOM   2421  C  CA    . GLU B  1  84   ? 14.380  21.368  126.011  1.00 47.64  ?  84   GLU B CA    1 
ATOM   2422  C  C     . GLU B  1  84   ? 14.362  22.684  126.792  1.00 47.39  ?  84   GLU B C     1 
ATOM   2423  O  O     . GLU B  1  84   ? 14.678  23.734  126.234  1.00 46.00  ?  84   GLU B O     1 
ATOM   2424  C  CB    . GLU B  1  84   ? 13.522  21.498  124.749  1.00 50.42  ?  84   GLU B CB    1 
ATOM   2425  C  CG    . GLU B  1  84   ? 13.760  20.416  123.721  1.00 53.53  ?  84   GLU B CG    1 
ATOM   2426  C  CD    . GLU B  1  84   ? 13.168  20.763  122.372  1.00 61.64  ?  84   GLU B CD    1 
ATOM   2427  O  OE1   . GLU B  1  84   ? 12.839  21.950  122.149  1.00 65.57  ?  84   GLU B OE1   1 
ATOM   2428  O  OE2   . GLU B  1  84   ? 13.032  19.845  121.536  1.00 56.29  ?  84   GLU B OE2   1 
ATOM   2429  N  N     . LEU B  1  85   ? 13.988  22.627  128.068  1.00 46.67  ?  85   LEU B N     1 
ATOM   2430  C  CA    . LEU B  1  85   ? 13.955  23.811  128.924  1.00 44.64  ?  85   LEU B CA    1 
ATOM   2431  C  C     . LEU B  1  85   ? 15.365  24.229  129.341  1.00 47.84  ?  85   LEU B C     1 
ATOM   2432  O  O     . LEU B  1  85   ? 16.129  23.414  129.850  1.00 62.73  ?  85   LEU B O     1 
ATOM   2433  C  CB    . LEU B  1  85   ? 13.099  23.527  130.162  1.00 39.86  ?  85   LEU B CB    1 
ATOM   2434  C  CG    . LEU B  1  85   ? 13.014  24.640  131.204  1.00 42.19  ?  85   LEU B CG    1 
ATOM   2435  C  CD1   . LEU B  1  85   ? 12.427  25.900  130.594  1.00 50.82  ?  85   LEU B CD1   1 
ATOM   2436  C  CD2   . LEU B  1  85   ? 12.187  24.178  132.384  1.00 35.14  ?  85   LEU B CD2   1 
ATOM   2437  N  N     . VAL B  1  86   ? 15.707  25.495  129.120  1.00 44.90  ?  86   VAL B N     1 
ATOM   2438  C  CA    . VAL B  1  86   ? 17.024  26.008  129.487  1.00 47.52  ?  86   VAL B CA    1 
ATOM   2439  C  C     . VAL B  1  86   ? 16.945  26.886  130.737  1.00 53.13  ?  86   VAL B C     1 
ATOM   2440  O  O     . VAL B  1  86   ? 16.340  27.958  130.718  1.00 57.73  ?  86   VAL B O     1 
ATOM   2441  C  CB    . VAL B  1  86   ? 17.648  26.809  128.335  1.00 45.23  ?  86   VAL B CB    1 
ATOM   2442  C  CG1   . VAL B  1  86   ? 18.961  27.432  128.775  1.00 45.91  ?  86   VAL B CG1   1 
ATOM   2443  C  CG2   . VAL B  1  86   ? 17.844  25.910  127.122  1.00 48.25  ?  86   VAL B CG2   1 
ATOM   2444  N  N     . VAL B  1  87   ? 17.546  26.421  131.827  1.00 53.55  ?  87   VAL B N     1 
ATOM   2445  C  CA    . VAL B  1  87   ? 17.496  27.148  133.092  1.00 53.64  ?  87   VAL B CA    1 
ATOM   2446  C  C     . VAL B  1  87   ? 18.876  27.684  133.471  1.00 49.62  ?  87   VAL B C     1 
ATOM   2447  O  O     . VAL B  1  87   ? 19.877  26.982  133.345  1.00 49.49  ?  87   VAL B O     1 
ATOM   2448  C  CB    . VAL B  1  87   ? 16.946  26.255  134.228  1.00 49.69  ?  87   VAL B CB    1 
ATOM   2449  C  CG1   . VAL B  1  87   ? 16.922  27.010  135.549  1.00 50.11  ?  87   VAL B CG1   1 
ATOM   2450  C  CG2   . VAL B  1  87   ? 15.555  25.748  133.876  1.00 39.22  ?  87   VAL B CG2   1 
ATOM   2451  N  N     . ARG B  1  88   ? 18.920  28.931  133.933  1.00 48.02  ?  88   ARG B N     1 
ATOM   2452  C  CA    . ARG B  1  88   ? 20.177  29.575  134.300  1.00 54.37  ?  88   ARG B CA    1 
ATOM   2453  C  C     . ARG B  1  88   ? 20.184  30.002  135.768  1.00 60.44  ?  88   ARG B C     1 
ATOM   2454  O  O     . ARG B  1  88   ? 19.300  30.735  136.214  1.00 65.12  ?  88   ARG B O     1 
ATOM   2455  C  CB    . ARG B  1  88   ? 20.425  30.788  133.400  1.00 56.78  ?  88   ARG B CB    1 
ATOM   2456  C  CG    . ARG B  1  88   ? 21.717  31.536  133.681  1.00 61.34  ?  88   ARG B CG    1 
ATOM   2457  C  CD    . ARG B  1  88   ? 21.868  32.718  132.735  1.00 70.45  ?  88   ARG B CD    1 
ATOM   2458  N  NE    . ARG B  1  88   ? 23.133  33.423  132.921  1.00 92.89  ?  88   ARG B NE    1 
ATOM   2459  C  CZ    . ARG B  1  88   ? 23.517  34.470  132.198  1.00 98.66  ?  88   ARG B CZ    1 
ATOM   2460  N  NH1   . ARG B  1  88   ? 22.731  34.936  131.235  1.00 80.79  ?  88   ARG B NH1   1 
ATOM   2461  N  NH2   . ARG B  1  88   ? 24.686  35.052  132.434  1.00 96.03  ?  88   ARG B NH2   1 
ATOM   2462  N  N     . PHE B  1  89   ? 21.186  29.541  136.513  1.00 57.57  ?  89   PHE B N     1 
ATOM   2463  C  CA    . PHE B  1  89   ? 21.324  29.896  137.923  1.00 57.93  ?  89   PHE B CA    1 
ATOM   2464  C  C     . PHE B  1  89   ? 22.234  31.107  138.101  1.00 65.77  ?  89   PHE B C     1 
ATOM   2465  O  O     . PHE B  1  89   ? 23.424  31.050  137.788  1.00 64.10  ?  89   PHE B O     1 
ATOM   2466  C  CB    . PHE B  1  89   ? 21.880  28.719  138.730  1.00 58.29  ?  89   PHE B CB    1 
ATOM   2467  C  CG    . PHE B  1  89   ? 20.933  27.558  138.854  1.00 58.52  ?  89   PHE B CG    1 
ATOM   2468  C  CD1   . PHE B  1  89   ? 19.600  27.687  138.502  1.00 55.04  ?  89   PHE B CD1   1 
ATOM   2469  C  CD2   . PHE B  1  89   ? 21.379  26.338  139.334  1.00 60.66  ?  89   PHE B CD2   1 
ATOM   2470  C  CE1   . PHE B  1  89   ? 18.732  26.616  138.619  1.00 51.39  ?  89   PHE B CE1   1 
ATOM   2471  C  CE2   . PHE B  1  89   ? 20.514  25.265  139.454  1.00 52.43  ?  89   PHE B CE2   1 
ATOM   2472  C  CZ    . PHE B  1  89   ? 19.190  25.404  139.095  1.00 41.55  ?  89   PHE B CZ    1 
ATOM   2473  N  N     . LEU B  1  90   ? 21.602  32.159  138.579  1.00 66.61  ?  90   LEU B N     1 
ATOM   2474  C  CA    . LEU B  1  90   ? 22.223  33.400  138.898  1.00 70.87  ?  90   LEU B CA    1 
ATOM   2475  C  C     . LEU B  1  90   ? 23.120  33.219  140.078  1.00 75.35  ?  90   LEU B C     1 
ATOM   2476  O  O     . LEU B  1  90   ? 24.166  33.820  140.154  1.00 79.17  ?  90   LEU B O     1 
ATOM   2477  C  CB    . LEU B  1  90   ? 21.169  34.442  139.185  1.00 69.57  ?  90   LEU B CB    1 
ATOM   2478  C  CG    . LEU B  1  90   ? 20.640  35.160  137.953  1.00 74.68  ?  90   LEU B CG    1 
ATOM   2479  C  CD1   . LEU B  1  90   ? 21.785  35.506  137.024  1.00 75.63  ?  90   LEU B CD1   1 
ATOM   2480  C  CD2   . LEU B  1  90   ? 19.625  34.320  137.223  1.00 71.67  ?  90   LEU B CD2   1 
ATOM   2481  N  N     . ASN B  1  91   ? 22.691  32.391  141.015  1.00 75.03  ?  91   ASN B N     1 
ATOM   2482  C  CA    . ASN B  1  91   ? 23.445  32.144  142.234  1.00 68.40  ?  91   ASN B CA    1 
ATOM   2483  C  C     . ASN B  1  91   ? 24.414  31.018  142.086  1.00 65.60  ?  91   ASN B C     1 
ATOM   2484  O  O     . ASN B  1  91   ? 24.022  29.891  141.958  1.00 65.52  ?  91   ASN B O     1 
ATOM   2485  C  CB    . ASN B  1  91   ? 22.467  31.776  143.325  1.00 69.15  ?  91   ASN B CB    1 
ATOM   2486  C  CG    . ASN B  1  91   ? 23.119  31.626  144.662  1.00 74.85  ?  91   ASN B CG    1 
ATOM   2487  O  OD1   . ASN B  1  91   ? 24.320  31.423  144.755  1.00 74.75  ?  91   ASN B OD1   1 
ATOM   2488  N  ND2   . ASN B  1  91   ? 22.321  31.704  145.713  1.00 59.97  ?  91   ASN B ND2   1 
ATOM   2489  N  N     . PRO B  1  92   ? 25.746  31.373  142.145  1.00 64.32  ?  92   PRO B N     1 
ATOM   2490  C  CA    . PRO B  1  92   ? 26.688  30.264  141.979  1.00 66.37  ?  92   PRO B CA    1 
ATOM   2491  C  C     . PRO B  1  92   ? 26.562  29.214  143.031  1.00 65.94  ?  92   PRO B C     1 
ATOM   2492  O  O     . PRO B  1  92   ? 26.785  28.059  142.765  1.00 62.70  ?  92   PRO B O     1 
ATOM   2493  C  CB    . PRO B  1  92   ? 28.050  30.924  142.112  1.00 63.77  ?  92   PRO B CB    1 
ATOM   2494  C  CG    . PRO B  1  92   ? 27.813  32.136  142.892  1.00 65.96  ?  92   PRO B CG    1 
ATOM   2495  C  CD    . PRO B  1  92   ? 26.580  32.644  142.271  1.00 59.16  ?  92   PRO B CD    1 
ATOM   2496  N  N     . SER B  1  93   ? 26.251  29.639  144.238  1.00 66.25  ?  93   SER B N     1 
ATOM   2497  C  CA    . SER B  1  93   ? 26.119  28.753  145.388  1.00 59.32  ?  93   SER B CA    1 
ATOM   2498  C  C     . SER B  1  93   ? 24.976  27.758  145.196  1.00 65.33  ?  93   SER B C     1 
ATOM   2499  O  O     . SER B  1  93   ? 24.993  26.663  145.761  1.00 69.80  ?  93   SER B O     1 
ATOM   2500  C  CB    . SER B  1  93   ? 25.893  29.569  146.662  1.00 55.63  ?  93   SER B CB    1 
ATOM   2501  O  OG    . SER B  1  93   ? 26.927  30.519  146.851  1.00 65.00  ?  93   SER B OG    1 
ATOM   2502  N  N     . LEU B  1  94   ? 23.990  28.145  144.392  1.00 60.39  ?  94   LEU B N     1 
ATOM   2503  C  CA    . LEU B  1  94   ? 22.785  27.343  144.191  1.00 55.85  ?  94   LEU B CA    1 
ATOM   2504  C  C     . LEU B  1  94   ? 23.071  26.009  143.506  1.00 54.56  ?  94   LEU B C     1 
ATOM   2505  O  O     . LEU B  1  94   ? 23.871  25.935  142.574  1.00 61.48  ?  94   LEU B O     1 
ATOM   2506  C  CB    . LEU B  1  94   ? 21.746  28.138  143.395  1.00 61.27  ?  94   LEU B CB    1 
ATOM   2507  C  CG    . LEU B  1  94   ? 20.400  27.475  143.095  1.00 56.66  ?  94   LEU B CG    1 
ATOM   2508  C  CD1   . LEU B  1  94   ? 19.749  26.956  144.365  1.00 55.05  ?  94   LEU B CD1   1 
ATOM   2509  C  CD2   . LEU B  1  94   ? 19.488  28.468  142.395  1.00 57.22  ?  94   LEU B CD2   1 
ATOM   2510  N  N     . GLN B  1  95   ? 22.411  24.958  143.982  1.00 56.86  ?  95   GLN B N     1 
ATOM   2511  C  CA    . GLN B  1  95   ? 22.593  23.617  143.440  1.00 54.03  ?  95   GLN B CA    1 
ATOM   2512  C  C     . GLN B  1  95   ? 21.326  23.110  142.757  1.00 52.54  ?  95   GLN B C     1 
ATOM   2513  O  O     . GLN B  1  95   ? 21.321  22.855  141.554  1.00 60.45  ?  95   GLN B O     1 
ATOM   2514  C  CB    . GLN B  1  95   ? 23.019  22.645  144.542  1.00 58.94  ?  95   GLN B CB    1 
ATOM   2515  C  CG    . GLN B  1  95   ? 24.346  22.987  145.207  1.00 68.14  ?  95   GLN B CG    1 
ATOM   2516  C  CD    . GLN B  1  95   ? 25.548  22.548  144.392  1.00 74.42  ?  95   GLN B CD    1 
ATOM   2517  O  OE1   . GLN B  1  95   ? 25.434  22.251  143.202  1.00 73.54  ?  95   GLN B OE1   1 
ATOM   2518  N  NE2   . GLN B  1  95   ? 26.709  22.497  145.036  1.00 74.93  ?  95   GLN B NE2   1 
ATOM   2519  N  N     . THR B  1  96   ? 20.258  22.955  143.532  1.00 54.06  ?  96   THR B N     1 
ATOM   2520  C  CA    . THR B  1  96   ? 19.002  22.431  143.002  1.00 53.84  ?  96   THR B CA    1 
ATOM   2521  C  C     . THR B  1  96   ? 17.793  23.306  143.339  1.00 51.70  ?  96   THR B C     1 
ATOM   2522  O  O     . THR B  1  96   ? 17.752  23.952  144.386  1.00 56.15  ?  96   THR B O     1 
ATOM   2523  C  CB    . THR B  1  96   ? 18.742  20.996  143.495  1.00 51.45  ?  96   THR B CB    1 
ATOM   2524  O  OG1   . THR B  1  96   ? 17.444  20.569  143.063  1.00 53.65  ?  96   THR B OG1   1 
ATOM   2525  C  CG2   . THR B  1  96   ? 18.814  20.932  145.013  1.00 61.79  ?  96   THR B CG2   1 
ATOM   2526  N  N     . VAL B  1  97   ? 16.815  23.326  142.434  1.00 43.18  ?  97   VAL B N     1 
ATOM   2527  C  CA    . VAL B  1  97   ? 15.583  24.088  142.619  1.00 42.79  ?  97   VAL B CA    1 
ATOM   2528  C  C     . VAL B  1  97   ? 14.380  23.224  142.248  1.00 45.42  ?  97   VAL B C     1 
ATOM   2529  O  O     . VAL B  1  97   ? 14.494  22.314  141.428  1.00 46.12  ?  97   VAL B O     1 
ATOM   2530  C  CB    . VAL B  1  97   ? 15.556  25.357  141.735  1.00 45.34  ?  97   VAL B CB    1 
ATOM   2531  C  CG1   . VAL B  1  97   ? 14.475  26.321  142.206  1.00 48.80  ?  97   VAL B CG1   1 
ATOM   2532  C  CG2   . VAL B  1  97   ? 16.905  26.051  141.743  1.00 58.53  ?  97   VAL B CG2   1 
ATOM   2533  N  N     . THR B  1  98   ? 13.231  23.509  142.855  1.00 59.64  ?  98   THR B N     1 
ATOM   2534  C  CA    . THR B  1  98   ? 11.983  22.840  142.501  1.00 61.11  ?  98   THR B CA    1 
ATOM   2535  C  C     . THR B  1  98   ? 10.988  23.847  141.930  1.00 54.26  ?  98   THR B C     1 
ATOM   2536  O  O     . THR B  1  98   ? 10.536  24.752  142.632  1.00 54.63  ?  98   THR B O     1 
ATOM   2537  C  CB    . THR B  1  98   ? 11.346  22.134  143.716  1.00 63.01  ?  98   THR B CB    1 
ATOM   2538  O  OG1   . THR B  1  98   ? 12.260  21.166  144.248  1.00 67.64  ?  98   THR B OG1   1 
ATOM   2539  C  CG2   . THR B  1  98   ? 10.053  21.437  143.312  1.00 52.95  ?  98   THR B CG2   1 
ATOM   2540  N  N     . LEU B  1  99   ? 10.652  23.689  140.654  1.00 53.59  ?  99   LEU B N     1 
ATOM   2541  C  CA    . LEU B  1  99   ? 9.738   24.613  139.989  1.00 49.54  ?  99   LEU B CA    1 
ATOM   2542  C  C     . LEU B  1  99   ? 8.314   24.066  139.955  1.00 58.29  ?  99   LEU B C     1 
ATOM   2543  O  O     . LEU B  1  99   ? 8.083   22.935  139.527  1.00 49.97  ?  99   LEU B O     1 
ATOM   2544  C  CB    . LEU B  1  99   ? 10.217  24.926  138.569  1.00 46.72  ?  99   LEU B CB    1 
ATOM   2545  C  CG    . LEU B  1  99   ? 11.256  26.033  138.363  1.00 47.52  ?  99   LEU B CG    1 
ATOM   2546  C  CD1   . LEU B  1  99   ? 12.552  25.743  139.101  1.00 50.63  ?  99   LEU B CD1   1 
ATOM   2547  C  CD2   . LEU B  1  99   ? 11.522  26.232  136.877  1.00 47.69  ?  99   LEU B CD2   1 
ATOM   2548  N  N     . LEU B  1  100  ? 7.361   24.875  140.406  1.00 64.26  ?  100  LEU B N     1 
ATOM   2549  C  CA    . LEU B  1  100  ? 5.961   24.467  140.438  1.00 59.03  ?  100  LEU B CA    1 
ATOM   2550  C  C     . LEU B  1  100  ? 5.174   25.103  139.297  1.00 61.28  ?  100  LEU B C     1 
ATOM   2551  O  O     . LEU B  1  100  ? 5.385   26.269  138.959  1.00 66.88  ?  100  LEU B O     1 
ATOM   2552  C  CB    . LEU B  1  100  ? 5.316   24.833  141.779  1.00 59.96  ?  100  LEU B CB    1 
ATOM   2553  C  CG    . LEU B  1  100  ? 5.922   24.270  143.068  1.00 55.22  ?  100  LEU B CG    1 
ATOM   2554  C  CD1   . LEU B  1  100  ? 7.016   25.181  143.616  1.00 46.97  ?  100  LEU B CD1   1 
ATOM   2555  C  CD2   . LEU B  1  100  ? 4.838   24.042  144.110  1.00 55.51  ?  100  LEU B CD2   1 
ATOM   2556  N  N     . LEU B  1  101  ? 4.268   24.333  138.705  1.00 53.61  ?  101  LEU B N     1 
ATOM   2557  C  CA    . LEU B  1  101  ? 3.412   24.849  137.644  1.00 59.45  ?  101  LEU B CA    1 
ATOM   2558  C  C     . LEU B  1  101  ? 1.968   24.396  137.817  1.00 65.75  ?  101  LEU B C     1 
ATOM   2559  O  O     . LEU B  1  101  ? 1.682   23.198  137.875  1.00 62.96  ?  101  LEU B O     1 
ATOM   2560  C  CB    . LEU B  1  101  ? 3.933   24.428  136.270  1.00 70.28  ?  101  LEU B CB    1 
ATOM   2561  C  CG    . LEU B  1  101  ? 3.184   25.029  135.080  1.00 73.27  ?  101  LEU B CG    1 
ATOM   2562  C  CD1   . LEU B  1  101  ? 4.161   25.679  134.116  1.00 76.23  ?  101  LEU B CD1   1 
ATOM   2563  C  CD2   . LEU B  1  101  ? 2.348   23.972  134.373  1.00 65.95  ?  101  LEU B CD2   1 
ATOM   2564  N  N     . LYS B  1  102  ? 1.063   25.366  137.892  1.00 72.15  ?  102  LYS B N     1 
ATOM   2565  C  CA    . LYS B  1  102  ? -0.359  25.091  138.059  1.00 71.69  ?  102  LYS B CA    1 
ATOM   2566  C  C     . LYS B  1  102  ? -1.172  25.893  137.050  1.00 71.28  ?  102  LYS B C     1 
ATOM   2567  O  O     . LYS B  1  102  ? -1.079  27.121  137.005  1.00 72.11  ?  102  LYS B O     1 
ATOM   2568  C  CB    . LYS B  1  102  ? -0.803  25.430  139.484  1.00 76.64  ?  102  LYS B CB    1 
ATOM   2569  C  CG    . LYS B  1  102  ? -0.040  24.676  140.562  1.00 79.67  ?  102  LYS B CG    1 
ATOM   2570  C  CD    . LYS B  1  102  ? -0.406  25.152  141.958  1.00 71.36  ?  102  LYS B CD    1 
ATOM   2571  C  CE    . LYS B  1  102  ? 0.418   24.425  143.010  1.00 65.03  ?  102  LYS B CE    1 
ATOM   2572  N  NZ    . LYS B  1  102  ? 0.136   24.919  144.384  1.00 69.95  ?  102  LYS B NZ    1 
ATOM   2573  N  N     . ALA B  1  103  ? -1.962  25.195  136.240  1.00 70.53  ?  103  ALA B N     1 
ATOM   2574  C  CA    . ALA B  1  103  ? -2.777  25.844  135.219  1.00 81.39  ?  103  ALA B CA    1 
ATOM   2575  C  C     . ALA B  1  103  ? -3.981  24.988  134.843  1.00 78.33  ?  103  ALA B C     1 
ATOM   2576  O  O     . ALA B  1  103  ? -4.020  23.796  135.141  1.00 73.45  ?  103  ALA B O     1 
ATOM   2577  C  CB    . ALA B  1  103  ? -1.940  26.153  133.986  1.00 86.30  ?  103  ALA B CB    1 
ATOM   2578  N  N     . GLU B  1  104  ? -4.964  25.604  134.193  1.00 86.86  ?  104  GLU B N     1 
ATOM   2579  C  CA    . GLU B  1  104  ? -6.153  24.886  133.743  1.00 89.31  ?  104  GLU B CA    1 
ATOM   2580  C  C     . GLU B  1  104  ? -6.879  25.629  132.624  1.00 88.21  ?  104  GLU B C     1 
ATOM   2581  O  O     . GLU B  1  104  ? -6.457  26.707  132.203  1.00 87.98  ?  104  GLU B O     1 
ATOM   2582  C  CB    . GLU B  1  104  ? -7.110  24.640  134.912  1.00 96.62  ?  104  GLU B CB    1 
ATOM   2583  C  CG    . GLU B  1  104  ? -7.577  25.908  135.608  1.00 101.43 ?  104  GLU B CG    1 
ATOM   2584  C  CD    . GLU B  1  104  ? -8.611  25.636  136.681  1.00 100.32 ?  104  GLU B CD    1 
ATOM   2585  O  OE1   . GLU B  1  104  ? -8.907  26.560  137.468  1.00 106.54 ?  104  GLU B OE1   1 
ATOM   2586  O  OE2   . GLU B  1  104  ? -9.130  24.501  136.736  1.00 92.69  ?  104  GLU B OE2   1 
ATOM   2587  N  N     . GLY B  1  105  ? -7.974  25.044  132.150  1.00 85.59  ?  105  GLY B N     1 
ATOM   2588  C  CA    . GLY B  1  105  ? -8.785  25.660  131.117  1.00 94.41  ?  105  GLY B CA    1 
ATOM   2589  C  C     . GLY B  1  105  ? -8.139  25.615  129.747  1.00 102.72 ?  105  GLY B C     1 
ATOM   2590  O  O     . GLY B  1  105  ? -7.103  24.977  129.566  1.00 105.30 ?  105  GLY B O     1 
ATOM   2591  N  N     . PRO B  1  106  ? -8.750  26.301  128.770  1.00 105.75 ?  106  PRO B N     1 
ATOM   2592  C  CA    . PRO B  1  106  ? -8.261  26.344  127.387  1.00 108.12 ?  106  PRO B CA    1 
ATOM   2593  C  C     . PRO B  1  106  ? -7.033  27.240  127.245  1.00 105.96 ?  106  PRO B C     1 
ATOM   2594  O  O     . PRO B  1  106  ? -7.157  28.396  126.839  1.00 110.20 ?  106  PRO B O     1 
ATOM   2595  C  CB    . PRO B  1  106  ? -9.444  26.940  126.622  1.00 112.82 ?  106  PRO B CB    1 
ATOM   2596  C  CG    . PRO B  1  106  ? -10.157 27.773  127.630  1.00 116.25 ?  106  PRO B CG    1 
ATOM   2597  C  CD    . PRO B  1  106  ? -10.006 27.053  128.939  1.00 111.66 ?  106  PRO B CD    1 
ATOM   2598  N  N     . LYS B  1  107  ? -5.860  26.709  127.575  1.00 98.07  ?  107  LYS B N     1 
ATOM   2599  C  CA    . LYS B  1  107  ? -4.644  27.516  127.567  1.00 95.52  ?  107  LYS B CA    1 
ATOM   2600  C  C     . LYS B  1  107  ? -3.415  26.717  127.141  1.00 89.07  ?  107  LYS B C     1 
ATOM   2601  O  O     . LYS B  1  107  ? -3.265  25.551  127.502  1.00 82.64  ?  107  LYS B O     1 
ATOM   2602  C  CB    . LYS B  1  107  ? -4.416  28.130  128.951  1.00 93.13  ?  107  LYS B CB    1 
ATOM   2603  C  CG    . LYS B  1  107  ? -3.211  29.052  129.044  1.00 90.95  ?  107  LYS B CG    1 
ATOM   2604  C  CD    . LYS B  1  107  ? -2.989  29.516  130.474  1.00 93.19  ?  107  LYS B CD    1 
ATOM   2605  C  CE    . LYS B  1  107  ? -1.753  30.393  130.586  1.00 87.12  ?  107  LYS B CE    1 
ATOM   2606  N  NZ    . LYS B  1  107  ? -1.500  30.802  131.995  1.00 77.55  ?  107  LYS B NZ    1 
ATOM   2607  N  N     . GLU B  1  108  ? -2.538  27.356  126.372  1.00 87.75  ?  108  GLU B N     1 
ATOM   2608  C  CA    . GLU B  1  108  ? -1.270  26.748  125.987  1.00 83.89  ?  108  GLU B CA    1 
ATOM   2609  C  C     . GLU B  1  108  ? -0.178  27.168  126.965  1.00 82.05  ?  108  GLU B C     1 
ATOM   2610  O  O     . GLU B  1  108  ? 0.198   28.339  127.027  1.00 79.50  ?  108  GLU B O     1 
ATOM   2611  C  CB    . GLU B  1  108  ? -0.889  27.148  124.560  1.00 89.62  ?  108  GLU B CB    1 
ATOM   2612  C  CG    . GLU B  1  108  ? -1.864  26.665  123.497  1.00 94.53  ?  108  GLU B CG    1 
ATOM   2613  C  CD    . GLU B  1  108  ? -1.417  27.015  122.090  1.00 104.20 ?  108  GLU B CD    1 
ATOM   2614  O  OE1   . GLU B  1  108  ? -0.399  27.726  121.946  1.00 105.30 ?  108  GLU B OE1   1 
ATOM   2615  O  OE2   . GLU B  1  108  ? -2.081  26.575  121.127  1.00 97.00  ?  108  GLU B OE2   1 
ATOM   2616  N  N     . VAL B  1  109  ? 0.328   26.203  127.725  1.00 81.60  ?  109  VAL B N     1 
ATOM   2617  C  CA    . VAL B  1  109  ? 1.293   26.477  128.785  1.00 79.33  ?  109  VAL B CA    1 
ATOM   2618  C  C     . VAL B  1  109  ? 2.715   26.639  128.256  1.00 73.04  ?  109  VAL B C     1 
ATOM   2619  O  O     . VAL B  1  109  ? 3.265   25.733  127.630  1.00 64.39  ?  109  VAL B O     1 
ATOM   2620  C  CB    . VAL B  1  109  ? 1.281   25.368  129.853  1.00 72.08  ?  109  VAL B CB    1 
ATOM   2621  C  CG1   . VAL B  1  109  ? 2.254   25.701  130.970  1.00 71.76  ?  109  VAL B CG1   1 
ATOM   2622  C  CG2   . VAL B  1  109  ? -0.122  25.176  130.404  1.00 73.48  ?  109  VAL B CG2   1 
ATOM   2623  N  N     . LYS B  1  110  ? 3.305   27.800  128.520  1.00 70.31  ?  110  LYS B N     1 
ATOM   2624  C  CA    . LYS B  1  110  ? 4.680   28.072  128.126  1.00 67.67  ?  110  LYS B CA    1 
ATOM   2625  C  C     . LYS B  1  110  ? 5.612   28.001  129.332  1.00 70.67  ?  110  LYS B C     1 
ATOM   2626  O  O     . LYS B  1  110  ? 5.179   27.689  130.441  1.00 68.83  ?  110  LYS B O     1 
ATOM   2627  C  CB    . LYS B  1  110  ? 4.784   29.442  127.454  1.00 75.29  ?  110  LYS B CB    1 
ATOM   2628  C  CG    . LYS B  1  110  ? 3.997   29.554  126.157  1.00 80.47  ?  110  LYS B CG    1 
ATOM   2629  C  CD    . LYS B  1  110  ? 4.486   28.546  125.128  1.00 76.97  ?  110  LYS B CD    1 
ATOM   2630  C  CE    . LYS B  1  110  ? 3.709   28.654  123.826  1.00 76.43  ?  110  LYS B CE    1 
ATOM   2631  N  NZ    . LYS B  1  110  ? 2.259   28.372  124.016  1.00 75.11  ?  110  LYS B NZ    1 
ATOM   2632  N  N     . ALA B  1  111  ? 6.891   28.287  129.111  1.00 74.29  ?  111  ALA B N     1 
ATOM   2633  C  CA    . ALA B  1  111  ? 7.880   28.262  130.185  1.00 73.72  ?  111  ALA B CA    1 
ATOM   2634  C  C     . ALA B  1  111  ? 7.729   29.471  131.104  1.00 75.03  ?  111  ALA B C     1 
ATOM   2635  O  O     . ALA B  1  111  ? 8.299   29.513  132.194  1.00 76.68  ?  111  ALA B O     1 
ATOM   2636  C  CB    . ALA B  1  111  ? 9.287   28.199  129.612  1.00 63.04  ?  111  ALA B CB    1 
ATOM   2637  N  N     . ARG B  1  112  ? 6.953   30.451  130.655  1.00 72.31  ?  112  ARG B N     1 
ATOM   2638  C  CA    . ARG B  1  112  ? 6.698   31.654  131.434  1.00 72.24  ?  112  ARG B CA    1 
ATOM   2639  C  C     . ARG B  1  112  ? 5.711   31.364  132.561  1.00 73.98  ?  112  ARG B C     1 
ATOM   2640  O  O     . ARG B  1  112  ? 5.560   32.160  133.488  1.00 75.14  ?  112  ARG B O     1 
ATOM   2641  C  CB    . ARG B  1  112  ? 6.137   32.751  130.530  1.00 76.92  ?  112  ARG B CB    1 
ATOM   2642  C  CG    . ARG B  1  112  ? 6.751   34.123  130.741  1.00 75.13  ?  112  ARG B CG    1 
ATOM   2643  C  CD    . ARG B  1  112  ? 6.027   35.167  129.908  1.00 76.22  ?  112  ARG B CD    1 
ATOM   2644  N  NE    . ARG B  1  112  ? 5.732   34.676  128.564  1.00 81.55  ?  112  ARG B NE    1 
ATOM   2645  C  CZ    . ARG B  1  112  ? 6.538   34.825  127.518  1.00 80.96  ?  112  ARG B CZ    1 
ATOM   2646  N  NH1   . ARG B  1  112  ? 7.696   35.456  127.654  1.00 74.58  ?  112  ARG B NH1   1 
ATOM   2647  N  NH2   . ARG B  1  112  ? 6.184   34.343  126.333  1.00 71.78  ?  112  ARG B NH2   1 
ATOM   2648  N  N     . ASP B  1  113  ? 5.049   30.215  132.477  1.00 73.14  ?  113  ASP B N     1 
ATOM   2649  C  CA    . ASP B  1  113  ? 3.985   29.865  133.414  1.00 78.75  ?  113  ASP B CA    1 
ATOM   2650  C  C     . ASP B  1  113  ? 4.516   29.286  134.722  1.00 77.61  ?  113  ASP B C     1 
ATOM   2651  O  O     . ASP B  1  113  ? 3.745   28.990  135.636  1.00 73.69  ?  113  ASP B O     1 
ATOM   2652  C  CB    . ASP B  1  113  ? 3.005   28.886  132.763  1.00 75.72  ?  113  ASP B CB    1 
ATOM   2653  C  CG    . ASP B  1  113  ? 2.401   29.431  131.485  1.00 86.42  ?  113  ASP B CG    1 
ATOM   2654  O  OD1   . ASP B  1  113  ? 3.053   30.274  130.832  1.00 89.21  ?  113  ASP B OD1   1 
ATOM   2655  O  OD2   . ASP B  1  113  ? 1.276   29.019  131.132  1.00 86.41  ?  113  ASP B OD2   1 
ATOM   2656  N  N     . PHE B  1  114  ? 5.831   29.119  134.807  1.00 81.25  ?  114  PHE B N     1 
ATOM   2657  C  CA    . PHE B  1  114  ? 6.459   28.697  136.052  1.00 78.25  ?  114  PHE B CA    1 
ATOM   2658  C  C     . PHE B  1  114  ? 6.657   29.908  136.952  1.00 79.83  ?  114  PHE B C     1 
ATOM   2659  O  O     . PHE B  1  114  ? 7.297   30.883  136.553  1.00 86.75  ?  114  PHE B O     1 
ATOM   2660  C  CB    . PHE B  1  114  ? 7.803   28.018  135.782  1.00 74.23  ?  114  PHE B CB    1 
ATOM   2661  C  CG    . PHE B  1  114  ? 7.685   26.676  135.114  1.00 73.65  ?  114  PHE B CG    1 
ATOM   2662  C  CD1   . PHE B  1  114  ? 7.462   25.531  135.862  1.00 66.59  ?  114  PHE B CD1   1 
ATOM   2663  C  CD2   . PHE B  1  114  ? 7.806   26.558  133.739  1.00 70.55  ?  114  PHE B CD2   1 
ATOM   2664  C  CE1   . PHE B  1  114  ? 7.355   24.295  135.252  1.00 61.68  ?  114  PHE B CE1   1 
ATOM   2665  C  CE2   . PHE B  1  114  ? 7.701   25.324  133.123  1.00 66.54  ?  114  PHE B CE2   1 
ATOM   2666  C  CZ    . PHE B  1  114  ? 7.475   24.192  133.881  1.00 62.82  ?  114  PHE B CZ    1 
ATOM   2667  N  N     . LEU B  1  115  ? 6.099   29.849  138.158  1.00 68.47  ?  115  LEU B N     1 
ATOM   2668  C  CA    . LEU B  1  115  ? 6.214   30.949  139.111  1.00 61.19  ?  115  LEU B CA    1 
ATOM   2669  C  C     . LEU B  1  115  ? 7.677   31.243  139.425  1.00 60.76  ?  115  LEU B C     1 
ATOM   2670  O  O     . LEU B  1  115  ? 8.442   30.333  139.743  1.00 57.93  ?  115  LEU B O     1 
ATOM   2671  C  CB    . LEU B  1  115  ? 5.435   30.657  140.398  1.00 70.15  ?  115  LEU B CB    1 
ATOM   2672  C  CG    . LEU B  1  115  ? 4.989   29.221  140.689  1.00 80.77  ?  115  LEU B CG    1 
ATOM   2673  C  CD1   . LEU B  1  115  ? 4.904   28.990  142.190  1.00 62.49  ?  115  LEU B CD1   1 
ATOM   2674  C  CD2   . LEU B  1  115  ? 3.646   28.927  140.032  1.00 74.09  ?  115  LEU B CD2   1 
ATOM   2675  N  N     . PRO B  1  116  ? 8.066   32.524  139.322  1.00 66.91  ?  116  PRO B N     1 
ATOM   2676  C  CA    . PRO B  1  116  ? 9.449   32.993  139.467  1.00 69.89  ?  116  PRO B CA    1 
ATOM   2677  C  C     . PRO B  1  116  ? 10.116  32.532  140.760  1.00 60.49  ?  116  PRO B C     1 
ATOM   2678  O  O     . PRO B  1  116  ? 9.471   32.467  141.807  1.00 55.34  ?  116  PRO B O     1 
ATOM   2679  C  CB    . PRO B  1  116  ? 9.299   34.516  139.470  1.00 66.02  ?  116  PRO B CB    1 
ATOM   2680  C  CG    . PRO B  1  116  ? 8.063   34.766  138.684  1.00 64.48  ?  116  PRO B CG    1 
ATOM   2681  C  CD    . PRO B  1  116  ? 7.140   33.631  139.023  1.00 61.21  ?  116  PRO B CD    1 
ATOM   2682  N  N     . VAL B  1  117  ? 11.401  32.207  140.669  1.00 57.03  ?  117  VAL B N     1 
ATOM   2683  C  CA    . VAL B  1  117  ? 12.189  31.808  141.828  1.00 64.63  ?  117  VAL B CA    1 
ATOM   2684  C  C     . VAL B  1  117  ? 13.422  32.704  141.911  1.00 62.44  ?  117  VAL B C     1 
ATOM   2685  O  O     . VAL B  1  117  ? 13.967  33.112  140.885  1.00 57.89  ?  117  VAL B O     1 
ATOM   2686  C  CB    . VAL B  1  117  ? 12.616  30.323  141.739  1.00 62.37  ?  117  VAL B CB    1 
ATOM   2687  C  CG1   . VAL B  1  117  ? 13.353  29.892  143.000  1.00 45.57  ?  117  VAL B CG1   1 
ATOM   2688  C  CG2   . VAL B  1  117  ? 11.404  29.432  141.506  1.00 58.73  ?  117  VAL B CG2   1 
ATOM   2689  N  N     . ALA B  1  118  ? 13.846  33.019  143.133  1.00 68.76  ?  118  ALA B N     1 
ATOM   2690  C  CA    . ALA B  1  118  ? 15.001  33.884  143.356  1.00 73.87  ?  118  ALA B CA    1 
ATOM   2691  C  C     . ALA B  1  118  ? 16.258  33.348  142.677  1.00 64.01  ?  118  ALA B C     1 
ATOM   2692  O  O     . ALA B  1  118  ? 16.628  32.189  142.865  1.00 62.72  ?  118  ALA B O     1 
ATOM   2693  C  CB    . ALA B  1  118  ? 15.241  34.073  144.849  1.00 72.20  ?  118  ALA B CB    1 
ATOM   2694  N  N     . ASP B  1  119  ? 16.898  34.204  141.884  1.00 62.07  ?  119  ASP B N     1 
ATOM   2695  C  CA    . ASP B  1  119  ? 18.125  33.862  141.165  1.00 74.32  ?  119  ASP B CA    1 
ATOM   2696  C  C     . ASP B  1  119  ? 17.959  32.678  140.210  1.00 67.42  ?  119  ASP B C     1 
ATOM   2697  O  O     . ASP B  1  119  ? 18.915  31.951  139.934  1.00 61.55  ?  119  ASP B O     1 
ATOM   2698  C  CB    . ASP B  1  119  ? 19.283  33.619  142.139  1.00 76.02  ?  119  ASP B CB    1 
ATOM   2699  C  CG    . ASP B  1  119  ? 19.653  34.863  142.924  1.00 75.93  ?  119  ASP B CG    1 
ATOM   2700  O  OD1   . ASP B  1  119  ? 19.588  35.971  142.350  1.00 70.64  ?  119  ASP B OD1   1 
ATOM   2701  O  OD2   . ASP B  1  119  ? 20.006  34.733  144.115  1.00 82.12  ?  119  ASP B OD2   1 
ATOM   2702  N  N     . VAL B  1  120  ? 16.742  32.491  139.711  1.00 58.78  ?  120  VAL B N     1 
ATOM   2703  C  CA    . VAL B  1  120  ? 16.477  31.472  138.703  1.00 55.57  ?  120  VAL B CA    1 
ATOM   2704  C  C     . VAL B  1  120  ? 15.934  32.122  137.436  1.00 58.59  ?  120  VAL B C     1 
ATOM   2705  O  O     . VAL B  1  120  ? 14.820  32.648  137.426  1.00 54.32  ?  120  VAL B O     1 
ATOM   2706  C  CB    . VAL B  1  120  ? 15.475  30.420  139.207  1.00 61.97  ?  120  VAL B CB    1 
ATOM   2707  C  CG1   . VAL B  1  120  ? 15.103  29.462  138.088  1.00 62.18  ?  120  VAL B CG1   1 
ATOM   2708  C  CG2   . VAL B  1  120  ? 16.054  29.663  140.392  1.00 63.61  ?  120  VAL B CG2   1 
ATOM   2709  N  N     . GLU B  1  121  ? 16.725  32.078  136.369  1.00 68.77  ?  121  GLU B N     1 
ATOM   2710  C  CA    . GLU B  1  121  ? 16.361  32.729  135.115  1.00 66.11  ?  121  GLU B CA    1 
ATOM   2711  C  C     . GLU B  1  121  ? 15.964  31.714  134.049  1.00 56.33  ?  121  GLU B C     1 
ATOM   2712  O  O     . GLU B  1  121  ? 16.635  30.701  133.864  1.00 59.23  ?  121  GLU B O     1 
ATOM   2713  C  CB    . GLU B  1  121  ? 17.521  33.589  134.607  1.00 64.15  ?  121  GLU B CB    1 
ATOM   2714  C  CG    . GLU B  1  121  ? 17.250  34.297  133.288  1.00 73.30  ?  121  GLU B CG    1 
ATOM   2715  C  CD    . GLU B  1  121  ? 18.451  35.078  132.788  1.00 83.26  ?  121  GLU B CD    1 
ATOM   2716  O  OE1   . GLU B  1  121  ? 18.340  35.729  131.727  1.00 74.70  ?  121  GLU B OE1   1 
ATOM   2717  O  OE2   . GLU B  1  121  ? 19.507  35.041  133.456  1.00 85.57  ?  121  GLU B OE2   1 
ATOM   2718  N  N     . ILE B  1  122  ? 14.870  31.992  133.349  1.00 46.12  ?  122  ILE B N     1 
ATOM   2719  C  CA    . ILE B  1  122  ? 14.439  31.135  132.254  1.00 54.34  ?  122  ILE B CA    1 
ATOM   2720  C  C     . ILE B  1  122  ? 14.801  31.768  130.913  1.00 62.80  ?  122  ILE B C     1 
ATOM   2721  O  O     . ILE B  1  122  ? 14.221  32.778  130.513  1.00 64.90  ?  122  ILE B O     1 
ATOM   2722  C  CB    . ILE B  1  122  ? 12.928  30.859  132.320  1.00 47.87  ?  122  ILE B CB    1 
ATOM   2723  C  CG1   . ILE B  1  122  ? 12.578  30.183  133.647  1.00 43.60  ?  122  ILE B CG1   1 
ATOM   2724  C  CG2   . ILE B  1  122  ? 12.491  29.998  131.146  1.00 52.80  ?  122  ILE B CG2   1 
ATOM   2725  C  CD1   . ILE B  1  122  ? 11.118  29.817  133.783  1.00 53.27  ?  122  ILE B CD1   1 
ATOM   2726  N  N     . MET B  1  123  ? 15.763  31.162  130.224  1.00 57.10  ?  123  MET B N     1 
ATOM   2727  C  CA    . MET B  1  123  ? 16.295  31.714  128.983  1.00 57.95  ?  123  MET B CA    1 
ATOM   2728  C  C     . MET B  1  123  ? 15.283  31.669  127.845  1.00 56.42  ?  123  MET B C     1 
ATOM   2729  O  O     . MET B  1  123  ? 15.260  32.554  126.991  1.00 65.12  ?  123  MET B O     1 
ATOM   2730  C  CB    . MET B  1  123  ? 17.569  30.971  128.574  1.00 58.92  ?  123  MET B CB    1 
ATOM   2731  C  CG    . MET B  1  123  ? 18.696  31.073  129.586  1.00 58.17  ?  123  MET B CG    1 
ATOM   2732  S  SD    . MET B  1  123  ? 19.304  32.758  129.769  1.00 69.43  ?  123  MET B SD    1 
ATOM   2733  C  CE    . MET B  1  123  ? 19.869  33.093  128.103  1.00 69.47  ?  123  MET B CE    1 
ATOM   2734  N  N     . ASN B  1  124  ? 14.449  30.634  127.836  1.00 50.04  ?  124  ASN B N     1 
ATOM   2735  C  CA    . ASN B  1  124  ? 13.464  30.455  126.775  1.00 61.53  ?  124  ASN B CA    1 
ATOM   2736  C  C     . ASN B  1  124  ? 12.035  30.373  127.304  1.00 67.58  ?  124  ASN B C     1 
ATOM   2737  O  O     . ASN B  1  124  ? 11.446  29.293  127.347  1.00 67.54  ?  124  ASN B O     1 
ATOM   2738  C  CB    . ASN B  1  124  ? 13.795  29.209  125.949  1.00 67.01  ?  124  ASN B CB    1 
ATOM   2739  C  CG    . ASN B  1  124  ? 14.081  27.994  126.813  1.00 62.55  ?  124  ASN B CG    1 
ATOM   2740  O  OD1   . ASN B  1  124  ? 14.597  28.117  127.924  1.00 63.60  ?  124  ASN B OD1   1 
ATOM   2741  N  ND2   . ASN B  1  124  ? 13.744  26.814  126.306  1.00 58.98  ?  124  ASN B ND2   1 
ATOM   2742  N  N     . PRO B  1  125  ? 11.468  31.524  127.697  1.00 65.09  ?  125  PRO B N     1 
ATOM   2743  C  CA    . PRO B  1  125  ? 10.127  31.572  128.289  1.00 58.79  ?  125  PRO B CA    1 
ATOM   2744  C  C     . PRO B  1  125  ? 9.032   31.229  127.283  1.00 67.88  ?  125  PRO B C     1 
ATOM   2745  O  O     . PRO B  1  125  ? 7.929   30.857  127.684  1.00 66.90  ?  125  PRO B O     1 
ATOM   2746  C  CB    . PRO B  1  125  ? 9.999   33.030  128.734  1.00 60.08  ?  125  PRO B CB    1 
ATOM   2747  C  CG    . PRO B  1  125  ? 10.887  33.778  127.806  1.00 62.81  ?  125  PRO B CG    1 
ATOM   2748  C  CD    . PRO B  1  125  ? 12.050  32.869  127.541  1.00 58.56  ?  125  PRO B CD    1 
ATOM   2749  N  N     . ASP B  1  126  ? 9.338   31.350  125.994  1.00 73.21  ?  126  ASP B N     1 
ATOM   2750  C  CA    . ASP B  1  126  ? 8.357   31.091  124.944  1.00 68.98  ?  126  ASP B CA    1 
ATOM   2751  C  C     . ASP B  1  126  ? 8.252   29.607  124.610  1.00 66.09  ?  126  ASP B C     1 
ATOM   2752  O  O     . ASP B  1  126  ? 7.437   29.209  123.778  1.00 62.64  ?  126  ASP B O     1 
ATOM   2753  C  CB    . ASP B  1  126  ? 8.700   31.883  123.680  1.00 70.27  ?  126  ASP B CB    1 
ATOM   2754  C  CG    . ASP B  1  126  ? 8.670   33.383  123.902  1.00 87.33  ?  126  ASP B CG    1 
ATOM   2755  O  OD1   . ASP B  1  126  ? 9.059   33.832  125.001  1.00 98.59  ?  126  ASP B OD1   1 
ATOM   2756  O  OD2   . ASP B  1  126  ? 8.256   34.114  122.978  1.00 89.80  ?  126  ASP B OD2   1 
ATOM   2757  N  N     . LEU B  1  127  ? 9.079   28.793  125.260  1.00 66.70  ?  127  LEU B N     1 
ATOM   2758  C  CA    . LEU B  1  127  ? 9.086   27.354  125.021  1.00 60.88  ?  127  LEU B CA    1 
ATOM   2759  C  C     . LEU B  1  127  ? 7.753   26.711  125.386  1.00 60.61  ?  127  LEU B C     1 
ATOM   2760  O  O     . LEU B  1  127  ? 7.199   26.969  126.452  1.00 66.31  ?  127  LEU B O     1 
ATOM   2761  C  CB    . LEU B  1  127  ? 10.213  26.681  125.805  1.00 56.83  ?  127  LEU B CB    1 
ATOM   2762  C  CG    . LEU B  1  127  ? 10.219  25.153  125.737  1.00 54.19  ?  127  LEU B CG    1 
ATOM   2763  C  CD1   . LEU B  1  127  ? 10.445  24.676  124.309  1.00 62.73  ?  127  LEU B CD1   1 
ATOM   2764  C  CD2   . LEU B  1  127  ? 11.261  24.572  126.671  1.00 50.43  ?  127  LEU B CD2   1 
ATOM   2765  N  N     . HIS B  1  128  ? 7.248   25.868  124.492  1.00 58.15  ?  128  HIS B N     1 
ATOM   2766  C  CA    . HIS B  1  128  ? 5.981   25.184  124.712  1.00 59.53  ?  128  HIS B CA    1 
ATOM   2767  C  C     . HIS B  1  128  ? 6.151   23.957  125.606  1.00 62.71  ?  128  HIS B C     1 
ATOM   2768  O  O     . HIS B  1  128  ? 7.119   23.208  125.471  1.00 58.96  ?  128  HIS B O     1 
ATOM   2769  C  CB    . HIS B  1  128  ? 5.366   24.777  123.371  1.00 63.14  ?  128  HIS B CB    1 
ATOM   2770  C  CG    . HIS B  1  128  ? 4.074   24.034  123.499  1.00 65.43  ?  128  HIS B CG    1 
ATOM   2771  N  ND1   . HIS B  1  128  ? 2.982   24.553  124.163  1.00 70.14  ?  128  HIS B ND1   1 
ATOM   2772  C  CD2   . HIS B  1  128  ? 3.697   22.815  123.049  1.00 65.21  ?  128  HIS B CD2   1 
ATOM   2773  C  CE1   . HIS B  1  128  ? 1.990   23.682  124.117  1.00 68.55  ?  128  HIS B CE1   1 
ATOM   2774  N  NE2   . HIS B  1  128  ? 2.396   22.620  123.446  1.00 59.66  ?  128  HIS B NE2   1 
ATOM   2775  N  N     . ILE B  1  129  ? 5.207   23.761  126.522  1.00 64.34  ?  129  ILE B N     1 
ATOM   2776  C  CA    . ILE B  1  129  ? 5.209   22.587  127.393  1.00 60.53  ?  129  ILE B CA    1 
ATOM   2777  C  C     . ILE B  1  129  ? 4.040   21.659  127.059  1.00 66.29  ?  129  ILE B C     1 
ATOM   2778  O  O     . ILE B  1  129  ? 4.246   20.518  126.645  1.00 72.25  ?  129  ILE B O     1 
ATOM   2779  C  CB    . ILE B  1  129  ? 5.189   22.960  128.897  1.00 62.86  ?  129  ILE B CB    1 
ATOM   2780  C  CG1   . ILE B  1  129  ? 6.571   23.432  129.358  1.00 58.12  ?  129  ILE B CG1   1 
ATOM   2781  C  CG2   . ILE B  1  129  ? 4.781   21.762  129.740  1.00 64.39  ?  129  ILE B CG2   1 
ATOM   2782  C  CD1   . ILE B  1  129  ? 6.922   24.848  128.964  1.00 62.67  ?  129  ILE B CD1   1 
ATOM   2783  N  N     . ALA B  1  130  ? 2.816   22.146  127.244  1.00 69.53  ?  130  ALA B N     1 
ATOM   2784  C  CA    . ALA B  1  130  ? 1.628   21.360  126.923  1.00 72.36  ?  130  ALA B CA    1 
ATOM   2785  C  C     . ALA B  1  130  ? 0.421   22.243  126.617  1.00 76.45  ?  130  ALA B C     1 
ATOM   2786  O  O     . ALA B  1  130  ? 0.361   23.397  127.038  1.00 72.04  ?  130  ALA B O     1 
ATOM   2787  C  CB    . ALA B  1  130  ? 1.309   20.395  128.056  1.00 68.24  ?  130  ALA B CB    1 
ATOM   2788  N  N     . THR B  1  131  ? -0.538  21.691  125.880  1.00 77.33  ?  131  THR B N     1 
ATOM   2789  C  CA    . THR B  1  131  ? -1.778  22.396  125.577  1.00 78.61  ?  131  THR B CA    1 
ATOM   2790  C  C     . THR B  1  131  ? -2.924  21.831  126.405  1.00 84.93  ?  131  THR B C     1 
ATOM   2791  O  O     . THR B  1  131  ? -3.174  20.626  126.393  1.00 77.46  ?  131  THR B O     1 
ATOM   2792  C  CB    . THR B  1  131  ? -2.154  22.284  124.087  1.00 77.24  ?  131  THR B CB    1 
ATOM   2793  O  OG1   . THR B  1  131  ? -2.150  20.907  123.695  1.00 81.23  ?  131  THR B OG1   1 
ATOM   2794  C  CG2   . THR B  1  131  ? -1.172  23.053  123.221  1.00 71.58  ?  131  THR B CG2   1 
ATOM   2795  N  N     . LEU B  1  132  ? -3.620  22.707  127.121  1.00 91.67  ?  132  LEU B N     1 
ATOM   2796  C  CA    . LEU B  1  132  ? -4.763  22.295  127.926  1.00 84.98  ?  132  LEU B CA    1 
ATOM   2797  C  C     . LEU B  1  132  ? -6.082  22.727  127.295  1.00 93.49  ?  132  LEU B C     1 
ATOM   2798  O  O     . LEU B  1  132  ? -6.252  23.887  126.910  1.00 91.68  ?  132  LEU B O     1 
ATOM   2799  C  CB    . LEU B  1  132  ? -4.656  22.841  129.351  1.00 81.00  ?  132  LEU B CB    1 
ATOM   2800  C  CG    . LEU B  1  132  ? -3.840  22.026  130.357  1.00 75.22  ?  132  LEU B CG    1 
ATOM   2801  C  CD1   . LEU B  1  132  ? -2.346  22.144  130.095  1.00 77.33  ?  132  LEU B CD1   1 
ATOM   2802  C  CD2   . LEU B  1  132  ? -4.176  22.456  131.773  1.00 78.71  ?  132  LEU B CD2   1 
ATOM   2803  N  N     . GLU B  1  133  ? -7.010  21.779  127.206  1.00 93.08  ?  133  GLU B N     1 
ATOM   2804  C  CA    . GLU B  1  133  ? -8.326  22.013  126.626  1.00 97.29  ?  133  GLU B CA    1 
ATOM   2805  C  C     . GLU B  1  133  ? -9.310  22.468  127.696  1.00 108.53 ?  133  GLU B C     1 
ATOM   2806  O  O     . GLU B  1  133  ? -8.919  22.771  128.823  1.00 112.31 ?  133  GLU B O     1 
ATOM   2807  C  CB    . GLU B  1  133  ? -8.845  20.734  125.969  1.00 88.29  ?  133  GLU B CB    1 
ATOM   2808  C  CG    . GLU B  1  133  ? -7.905  20.137  124.936  1.00 90.66  ?  133  GLU B CG    1 
ATOM   2809  C  CD    . GLU B  1  133  ? -8.334  18.751  124.494  1.00 94.91  ?  133  GLU B CD    1 
ATOM   2810  O  OE1   . GLU B  1  133  ? -9.153  18.128  125.202  1.00 93.44  ?  133  GLU B OE1   1 
ATOM   2811  O  OE2   . GLU B  1  133  ? -7.853  18.286  123.440  1.00 97.04  ?  133  GLU B OE2   1 
ATOM   2812  N  N     . GLU B  1  134  ? -10.590 22.514  127.338  1.00 113.19 ?  134  GLU B N     1 
ATOM   2813  C  CA    . GLU B  1  134  ? -11.635 22.870  128.289  1.00 117.39 ?  134  GLU B CA    1 
ATOM   2814  C  C     . GLU B  1  134  ? -11.791 21.771  129.333  1.00 114.94 ?  134  GLU B C     1 
ATOM   2815  O  O     . GLU B  1  134  ? -11.997 20.606  128.994  1.00 108.78 ?  134  GLU B O     1 
ATOM   2816  C  CB    . GLU B  1  134  ? -12.965 23.090  127.564  1.00 121.66 ?  134  GLU B CB    1 
ATOM   2817  C  CG    . GLU B  1  134  ? -12.968 24.254  126.584  1.00 126.83 ?  134  GLU B CG    1 
ATOM   2818  C  CD    . GLU B  1  134  ? -13.093 25.603  127.269  1.00 129.93 ?  134  GLU B CD    1 
ATOM   2819  O  OE1   . GLU B  1  134  ? -13.034 26.633  126.566  1.00 138.68 ?  134  GLU B OE1   1 
ATOM   2820  O  OE2   . GLU B  1  134  ? -13.257 25.634  128.507  1.00 127.69 ?  134  GLU B OE2   1 
ATOM   2821  N  N     . GLY B  1  135  ? -11.690 22.147  130.604  1.00 110.31 ?  135  GLY B N     1 
ATOM   2822  C  CA    . GLY B  1  135  ? -11.810 21.194  131.691  1.00 105.02 ?  135  GLY B CA    1 
ATOM   2823  C  C     . GLY B  1  135  ? -10.492 20.532  132.047  1.00 103.27 ?  135  GLY B C     1 
ATOM   2824  O  O     . GLY B  1  135  ? -10.390 19.842  133.061  1.00 101.93 ?  135  GLY B O     1 
ATOM   2825  N  N     . GLY B  1  136  ? -9.481  20.741  131.209  1.00 103.22 ?  136  GLY B N     1 
ATOM   2826  C  CA    . GLY B  1  136  ? -8.165  20.173  131.439  1.00 98.23  ?  136  GLY B CA    1 
ATOM   2827  C  C     . GLY B  1  136  ? -7.418  20.856  132.568  1.00 91.80  ?  136  GLY B C     1 
ATOM   2828  O  O     . GLY B  1  136  ? -7.430  22.082  132.677  1.00 85.49  ?  136  GLY B O     1 
ATOM   2829  N  N     . ARG B  1  137  ? -6.765  20.060  133.410  1.00 86.88  ?  137  ARG B N     1 
ATOM   2830  C  CA    . ARG B  1  137  ? -6.013  20.591  134.542  1.00 85.16  ?  137  ARG B CA    1 
ATOM   2831  C  C     . ARG B  1  137  ? -4.582  20.061  134.562  1.00 76.39  ?  137  ARG B C     1 
ATOM   2832  O  O     . ARG B  1  137  ? -4.352  18.863  134.395  1.00 69.33  ?  137  ARG B O     1 
ATOM   2833  C  CB    . ARG B  1  137  ? -6.713  20.248  135.860  1.00 93.86  ?  137  ARG B CB    1 
ATOM   2834  C  CG    . ARG B  1  137  ? -8.137  20.771  135.968  1.00 104.37 ?  137  ARG B CG    1 
ATOM   2835  C  CD    . ARG B  1  137  ? -8.790  20.343  137.274  1.00 109.94 ?  137  ARG B CD    1 
ATOM   2836  N  NE    . ARG B  1  137  ? -8.151  20.953  138.437  1.00 103.09 ?  137  ARG B NE    1 
ATOM   2837  C  CZ    . ARG B  1  137  ? -8.551  22.090  138.998  1.00 102.36 ?  137  ARG B CZ    1 
ATOM   2838  N  NH1   . ARG B  1  137  ? -9.592  22.745  138.504  1.00 96.36  ?  137  ARG B NH1   1 
ATOM   2839  N  NH2   . ARG B  1  137  ? -7.912  22.572  140.055  1.00 99.15  ?  137  ARG B NH2   1 
ATOM   2840  N  N     . LEU B  1  138  ? -3.625  20.960  134.765  1.00 77.69  ?  138  LEU B N     1 
ATOM   2841  C  CA    . LEU B  1  138  ? -2.220  20.578  134.843  1.00 79.13  ?  138  LEU B CA    1 
ATOM   2842  C  C     . LEU B  1  138  ? -1.552  21.127  136.101  1.00 76.69  ?  138  LEU B C     1 
ATOM   2843  O  O     . LEU B  1  138  ? -1.398  22.341  136.260  1.00 76.66  ?  138  LEU B O     1 
ATOM   2844  C  CB    . LEU B  1  138  ? -1.461  21.057  133.604  1.00 78.56  ?  138  LEU B CB    1 
ATOM   2845  C  CG    . LEU B  1  138  ? -0.005  20.605  133.483  1.00 67.72  ?  138  LEU B CG    1 
ATOM   2846  C  CD1   . LEU B  1  138  ? 0.072   19.093  133.344  1.00 66.58  ?  138  LEU B CD1   1 
ATOM   2847  C  CD2   . LEU B  1  138  ? 0.678   21.292  132.311  1.00 63.84  ?  138  LEU B CD2   1 
ATOM   2848  N  N     . ASN B  1  139  ? -1.158  20.221  136.989  1.00 71.27  ?  139  ASN B N     1 
ATOM   2849  C  CA    . ASN B  1  139  ? -0.410  20.579  138.187  1.00 77.60  ?  139  ASN B CA    1 
ATOM   2850  C  C     . ASN B  1  139  ? 0.833   19.706  138.290  1.00 77.72  ?  139  ASN B C     1 
ATOM   2851  O  O     . ASN B  1  139  ? 0.730   18.488  138.447  1.00 72.64  ?  139  ASN B O     1 
ATOM   2852  C  CB    . ASN B  1  139  ? -1.284  20.412  139.434  1.00 85.06  ?  139  ASN B CB    1 
ATOM   2853  C  CG    . ASN B  1  139  ? -0.546  20.752  140.719  1.00 84.12  ?  139  ASN B CG    1 
ATOM   2854  O  OD1   . ASN B  1  139  ? 0.441   21.489  140.709  1.00 79.44  ?  139  ASN B OD1   1 
ATOM   2855  N  ND2   . ASN B  1  139  ? -1.027  20.215  141.835  1.00 68.75  ?  139  ASN B ND2   1 
ATOM   2856  N  N     . MET B  1  140  ? 2.007   20.323  138.199  1.00 68.45  ?  140  MET B N     1 
ATOM   2857  C  CA    . MET B  1  140  ? 3.246   19.555  138.199  1.00 56.49  ?  140  MET B CA    1 
ATOM   2858  C  C     . MET B  1  140  ? 4.403   20.250  138.911  1.00 55.17  ?  140  MET B C     1 
ATOM   2859  O  O     . MET B  1  140  ? 4.406   21.469  139.081  1.00 60.25  ?  140  MET B O     1 
ATOM   2860  C  CB    . MET B  1  140  ? 3.662   19.209  136.768  1.00 62.18  ?  140  MET B CB    1 
ATOM   2861  C  CG    . MET B  1  140  ? 4.009   20.419  135.916  1.00 69.81  ?  140  MET B CG    1 
ATOM   2862  S  SD    . MET B  1  140  ? 4.886   19.974  134.406  1.00 71.87  ?  140  MET B SD    1 
ATOM   2863  C  CE    . MET B  1  140  ? 3.731   18.820  133.674  1.00 60.53  ?  140  MET B CE    1 
ATOM   2864  N  N     . GLU B  1  141  ? 5.385   19.454  139.320  1.00 51.07  ?  141  GLU B N     1 
ATOM   2865  C  CA    . GLU B  1  141  ? 6.610   19.967  139.917  1.00 62.36  ?  141  GLU B CA    1 
ATOM   2866  C  C     . GLU B  1  141  ? 7.809   19.367  139.193  1.00 56.78  ?  141  GLU B C     1 
ATOM   2867  O  O     . GLU B  1  141  ? 7.873   18.154  138.983  1.00 54.63  ?  141  GLU B O     1 
ATOM   2868  C  CB    . GLU B  1  141  ? 6.675   19.617  141.406  1.00 66.91  ?  141  GLU B CB    1 
ATOM   2869  C  CG    . GLU B  1  141  ? 5.542   20.196  142.239  1.00 76.60  ?  141  GLU B CG    1 
ATOM   2870  C  CD    . GLU B  1  141  ? 5.615   19.777  143.695  1.00 82.42  ?  141  GLU B CD    1 
ATOM   2871  O  OE1   . GLU B  1  141  ? 6.620   19.144  144.085  1.00 78.08  ?  141  GLU B OE1   1 
ATOM   2872  O  OE2   . GLU B  1  141  ? 4.667   20.080  144.450  1.00 82.56  ?  141  GLU B OE2   1 
ATOM   2873  N  N     . VAL B  1  142  ? 8.754   20.218  138.805  1.00 50.10  ?  142  VAL B N     1 
ATOM   2874  C  CA    . VAL B  1  142  ? 9.958   19.751  138.127  1.00 53.19  ?  142  VAL B CA    1 
ATOM   2875  C  C     . VAL B  1  142  ? 11.224  20.034  138.934  1.00 48.44  ?  142  VAL B C     1 
ATOM   2876  O  O     . VAL B  1  142  ? 11.398  21.118  139.498  1.00 43.31  ?  142  VAL B O     1 
ATOM   2877  C  CB    . VAL B  1  142  ? 10.089  20.330  136.697  1.00 49.19  ?  142  VAL B CB    1 
ATOM   2878  C  CG1   . VAL B  1  142  ? 8.970   19.806  135.810  1.00 50.37  ?  142  VAL B CG1   1 
ATOM   2879  C  CG2   . VAL B  1  142  ? 10.085  21.848  136.725  1.00 54.65  ?  142  VAL B CG2   1 
ATOM   2880  N  N     . ARG B  1  143  ? 12.097  19.034  138.984  1.00 42.72  ?  143  ARG B N     1 
ATOM   2881  C  CA    . ARG B  1  143  ? 13.340  19.104  139.738  1.00 41.48  ?  143  ARG B CA    1 
ATOM   2882  C  C     . ARG B  1  143  ? 14.494  19.513  138.829  1.00 44.64  ?  143  ARG B C     1 
ATOM   2883  O  O     . ARG B  1  143  ? 14.820  18.812  137.872  1.00 47.24  ?  143  ARG B O     1 
ATOM   2884  C  CB    . ARG B  1  143  ? 13.628  17.744  140.375  1.00 36.18  ?  143  ARG B CB    1 
ATOM   2885  C  CG    . ARG B  1  143  ? 15.008  17.610  140.992  1.00 43.30  ?  143  ARG B CG    1 
ATOM   2886  C  CD    . ARG B  1  143  ? 15.116  18.353  142.309  1.00 51.23  ?  143  ARG B CD    1 
ATOM   2887  N  NE    . ARG B  1  143  ? 16.430  18.173  142.921  1.00 53.59  ?  143  ARG B NE    1 
ATOM   2888  C  CZ    . ARG B  1  143  ? 16.766  17.135  143.681  1.00 52.95  ?  143  ARG B CZ    1 
ATOM   2889  N  NH1   . ARG B  1  143  ? 15.884  16.175  143.924  1.00 48.08  ?  143  ARG B NH1   1 
ATOM   2890  N  NH2   . ARG B  1  143  ? 17.985  17.055  144.197  1.00 52.30  ?  143  ARG B NH2   1 
ATOM   2891  N  N     . VAL B  1  144  ? 15.110  20.651  139.132  1.00 39.12  ?  144  VAL B N     1 
ATOM   2892  C  CA    . VAL B  1  144  ? 16.220  21.154  138.333  1.00 35.50  ?  144  VAL B CA    1 
ATOM   2893  C  C     . VAL B  1  144  ? 17.527  21.119  139.117  1.00 42.33  ?  144  VAL B C     1 
ATOM   2894  O  O     . VAL B  1  144  ? 17.633  21.715  140.185  1.00 48.06  ?  144  VAL B O     1 
ATOM   2895  C  CB    . VAL B  1  144  ? 15.956  22.592  137.850  1.00 38.09  ?  144  VAL B CB    1 
ATOM   2896  C  CG1   . VAL B  1  144  ? 17.194  23.167  137.180  1.00 40.57  ?  144  VAL B CG1   1 
ATOM   2897  C  CG2   . VAL B  1  144  ? 14.765  22.620  136.904  1.00 37.17  ?  144  VAL B CG2   1 
ATOM   2898  N  N     . ASP B  1  145  ? 18.522  20.421  138.580  1.00 44.29  ?  145  ASP B N     1 
ATOM   2899  C  CA    . ASP B  1  145  ? 19.810  20.287  139.251  1.00 46.00  ?  145  ASP B CA    1 
ATOM   2900  C  C     . ASP B  1  145  ? 20.946  20.871  138.421  1.00 45.50  ?  145  ASP B C     1 
ATOM   2901  O  O     . ASP B  1  145  ? 20.823  21.031  137.206  1.00 41.67  ?  145  ASP B O     1 
ATOM   2902  C  CB    . ASP B  1  145  ? 20.110  18.817  139.555  1.00 52.35  ?  145  ASP B CB    1 
ATOM   2903  C  CG    . ASP B  1  145  ? 19.276  18.274  140.698  1.00 60.35  ?  145  ASP B CG    1 
ATOM   2904  O  OD1   . ASP B  1  145  ? 19.714  18.395  141.862  1.00 66.15  ?  145  ASP B OD1   1 
ATOM   2905  O  OD2   . ASP B  1  145  ? 18.190  17.719  140.433  1.00 56.75  ?  145  ASP B OD2   1 
ATOM   2906  N  N     . ARG B  1  146  ? 22.049  21.193  139.089  1.00 45.43  ?  146  ARG B N     1 
ATOM   2907  C  CA    . ARG B  1  146  ? 23.258  21.632  138.405  1.00 43.75  ?  146  ARG B CA    1 
ATOM   2908  C  C     . ARG B  1  146  ? 24.292  20.511  138.379  1.00 49.32  ?  146  ARG B C     1 
ATOM   2909  O  O     . ARG B  1  146  ? 24.610  19.923  139.413  1.00 55.63  ?  146  ARG B O     1 
ATOM   2910  C  CB    . ARG B  1  146  ? 23.842  22.878  139.073  1.00 38.20  ?  146  ARG B CB    1 
ATOM   2911  C  CG    . ARG B  1  146  ? 25.238  23.232  138.585  1.00 51.36  ?  146  ARG B CG    1 
ATOM   2912  C  CD    . ARG B  1  146  ? 25.423  24.735  138.446  1.00 72.26  ?  146  ARG B CD    1 
ATOM   2913  N  NE    . ARG B  1  146  ? 25.305  25.434  139.722  1.00 73.05  ?  146  ARG B NE    1 
ATOM   2914  C  CZ    . ARG B  1  146  ? 25.411  26.752  139.862  1.00 74.24  ?  146  ARG B CZ    1 
ATOM   2915  N  NH1   . ARG B  1  146  ? 25.636  27.516  138.801  1.00 71.78  ?  146  ARG B NH1   1 
ATOM   2916  N  NH2   . ARG B  1  146  ? 25.292  27.306  141.060  1.00 78.40  ?  146  ARG B NH2   1 
ATOM   2917  N  N     . GLY B  1  147  ? 24.810  20.217  137.191  1.00 43.15  ?  147  GLY B N     1 
ATOM   2918  C  CA    . GLY B  1  147  ? 25.790  19.160  137.026  1.00 42.59  ?  147  GLY B CA    1 
ATOM   2919  C  C     . GLY B  1  147  ? 26.472  19.220  135.673  1.00 39.31  ?  147  GLY B C     1 
ATOM   2920  O  O     . GLY B  1  147  ? 26.366  20.218  134.960  1.00 34.96  ?  147  GLY B O     1 
ATOM   2921  N  N     . VAL B  1  148  ? 27.176  18.149  135.319  1.00 40.44  ?  148  VAL B N     1 
ATOM   2922  C  CA    . VAL B  1  148  ? 27.901  18.096  134.056  1.00 37.79  ?  148  VAL B CA    1 
ATOM   2923  C  C     . VAL B  1  148  ? 27.562  16.841  133.258  1.00 38.09  ?  148  VAL B C     1 
ATOM   2924  O  O     . VAL B  1  148  ? 27.029  15.872  133.800  1.00 35.03  ?  148  VAL B O     1 
ATOM   2925  C  CB    . VAL B  1  148  ? 29.424  18.131  134.280  1.00 29.40  ?  148  VAL B CB    1 
ATOM   2926  C  CG1   . VAL B  1  148  ? 29.841  19.445  134.921  1.00 31.94  ?  148  VAL B CG1   1 
ATOM   2927  C  CG2   . VAL B  1  148  ? 29.861  16.950  135.130  1.00 19.86  ?  148  VAL B CG2   1 
ATOM   2928  N  N     . GLY B  1  149  ? 27.874  16.873  131.965  1.00 37.25  ?  149  GLY B N     1 
ATOM   2929  C  CA    . GLY B  1  149  ? 27.720  15.715  131.102  1.00 30.20  ?  149  GLY B CA    1 
ATOM   2930  C  C     . GLY B  1  149  ? 26.283  15.348  130.791  1.00 28.84  ?  149  GLY B C     1 
ATOM   2931  O  O     . GLY B  1  149  ? 25.400  16.204  130.760  1.00 29.50  ?  149  GLY B O     1 
ATOM   2932  N  N     . TYR B  1  150  ? 26.058  14.060  130.549  1.00 30.62  ?  150  TYR B N     1 
ATOM   2933  C  CA    . TYR B  1  150  ? 24.729  13.545  130.247  1.00 31.86  ?  150  TYR B CA    1 
ATOM   2934  C  C     . TYR B  1  150  ? 24.460  12.311  131.099  1.00 35.64  ?  150  TYR B C     1 
ATOM   2935  O  O     . TYR B  1  150  ? 25.142  11.295  130.969  1.00 42.08  ?  150  TYR B O     1 
ATOM   2936  C  CB    . TYR B  1  150  ? 24.627  13.194  128.760  1.00 31.57  ?  150  TYR B CB    1 
ATOM   2937  C  CG    . TYR B  1  150  ? 23.272  12.685  128.317  1.00 28.08  ?  150  TYR B CG    1 
ATOM   2938  C  CD1   . TYR B  1  150  ? 22.971  11.327  128.352  1.00 28.53  ?  150  TYR B CD1   1 
ATOM   2939  C  CD2   . TYR B  1  150  ? 22.301  13.559  127.849  1.00 26.19  ?  150  TYR B CD2   1 
ATOM   2940  C  CE1   . TYR B  1  150  ? 21.736  10.858  127.944  1.00 28.21  ?  150  TYR B CE1   1 
ATOM   2941  C  CE2   . TYR B  1  150  ? 21.065  13.099  127.436  1.00 28.50  ?  150  TYR B CE2   1 
ATOM   2942  C  CZ    . TYR B  1  150  ? 20.787  11.749  127.486  1.00 31.30  ?  150  TYR B CZ    1 
ATOM   2943  O  OH    . TYR B  1  150  ? 19.555  11.290  127.076  1.00 30.87  ?  150  TYR B OH    1 
ATOM   2944  N  N     . VAL B  1  151  ? 23.468  12.404  131.977  1.00 33.73  ?  151  VAL B N     1 
ATOM   2945  C  CA    . VAL B  1  151  ? 23.131  11.292  132.855  1.00 32.78  ?  151  VAL B CA    1 
ATOM   2946  C  C     . VAL B  1  151  ? 21.725  10.765  132.583  1.00 35.02  ?  151  VAL B C     1 
ATOM   2947  O  O     . VAL B  1  151  ? 20.743  11.482  132.776  1.00 37.42  ?  151  VAL B O     1 
ATOM   2948  C  CB    . VAL B  1  151  ? 23.252  11.690  134.337  1.00 36.10  ?  151  VAL B CB    1 
ATOM   2949  C  CG1   . VAL B  1  151  ? 22.903  10.511  135.231  1.00 39.23  ?  151  VAL B CG1   1 
ATOM   2950  C  CG2   . VAL B  1  151  ? 24.656  12.194  134.636  1.00 31.13  ?  151  VAL B CG2   1 
ATOM   2951  N  N     . PRO B  1  152  ? 21.629  9.506   132.126  1.00 38.08  ?  152  PRO B N     1 
ATOM   2952  C  CA    . PRO B  1  152  ? 20.344  8.837   131.898  1.00 37.27  ?  152  PRO B CA    1 
ATOM   2953  C  C     . PRO B  1  152  ? 19.501  8.804   133.168  1.00 41.43  ?  152  PRO B C     1 
ATOM   2954  O  O     . PRO B  1  152  ? 20.049  8.867   134.269  1.00 44.65  ?  152  PRO B O     1 
ATOM   2955  C  CB    . PRO B  1  152  ? 20.758  7.416   131.506  1.00 33.94  ?  152  PRO B CB    1 
ATOM   2956  C  CG    . PRO B  1  152  ? 22.113  7.572   130.922  1.00 35.61  ?  152  PRO B CG    1 
ATOM   2957  C  CD    . PRO B  1  152  ? 22.768  8.668   131.711  1.00 39.84  ?  152  PRO B CD    1 
ATOM   2958  N  N     . ALA B  1  153  ? 18.184  8.711   133.007  1.00 45.55  ?  153  ALA B N     1 
ATOM   2959  C  CA    . ALA B  1  153  ? 17.259  8.735   134.137  1.00 45.22  ?  153  ALA B CA    1 
ATOM   2960  C  C     . ALA B  1  153  ? 17.551  7.636   135.151  1.00 45.33  ?  153  ALA B C     1 
ATOM   2961  O  O     . ALA B  1  153  ? 17.486  7.860   136.360  1.00 47.65  ?  153  ALA B O     1 
ATOM   2962  C  CB    . ALA B  1  153  ? 15.823  8.630   133.643  1.00 46.88  ?  153  ALA B CB    1 
ATOM   2963  N  N     . GLU B  1  154  ? 17.884  6.453   134.649  1.00 43.79  ?  154  GLU B N     1 
ATOM   2964  C  CA    . GLU B  1  154  ? 18.105  5.289   135.498  1.00 52.17  ?  154  GLU B CA    1 
ATOM   2965  C  C     . GLU B  1  154  ? 19.393  5.389   136.314  1.00 54.69  ?  154  GLU B C     1 
ATOM   2966  O  O     . GLU B  1  154  ? 19.530  4.730   137.345  1.00 57.87  ?  154  GLU B O     1 
ATOM   2967  C  CB    . GLU B  1  154  ? 18.115  4.009   134.655  1.00 54.23  ?  154  GLU B CB    1 
ATOM   2968  C  CG    . GLU B  1  154  ? 16.792  3.696   133.956  1.00 62.71  ?  154  GLU B CG    1 
ATOM   2969  C  CD    . GLU B  1  154  ? 16.557  4.539   132.712  1.00 73.32  ?  154  GLU B CD    1 
ATOM   2970  O  OE1   . GLU B  1  154  ? 17.441  5.351   132.363  1.00 74.15  ?  154  GLU B OE1   1 
ATOM   2971  O  OE2   . GLU B  1  154  ? 15.486  4.391   132.083  1.00 64.71  ?  154  GLU B OE2   1 
ATOM   2972  N  N     . LYS B  1  155  ? 20.332  6.209   135.852  1.00 51.89  ?  155  LYS B N     1 
ATOM   2973  C  CA    . LYS B  1  155  ? 21.630  6.332   136.512  1.00 48.39  ?  155  LYS B CA    1 
ATOM   2974  C  C     . LYS B  1  155  ? 21.598  7.194   137.775  1.00 50.45  ?  155  LYS B C     1 
ATOM   2975  O  O     . LYS B  1  155  ? 22.155  6.811   138.805  1.00 53.08  ?  155  LYS B O     1 
ATOM   2976  C  CB    . LYS B  1  155  ? 22.692  6.840   135.535  1.00 43.19  ?  155  LYS B CB    1 
ATOM   2977  C  CG    . LYS B  1  155  ? 22.974  5.877   134.394  1.00 50.72  ?  155  LYS B CG    1 
ATOM   2978  C  CD    . LYS B  1  155  ? 23.351  4.500   134.923  1.00 58.99  ?  155  LYS B CD    1 
ATOM   2979  C  CE    . LYS B  1  155  ? 23.443  3.477   133.800  1.00 66.82  ?  155  LYS B CE    1 
ATOM   2980  N  NZ    . LYS B  1  155  ? 24.444  3.864   132.766  1.00 66.74  ?  155  LYS B NZ    1 
ATOM   2981  N  N     . HIS B  1  156  ? 20.960  8.358   137.695  1.00 50.06  ?  156  HIS B N     1 
ATOM   2982  C  CA    . HIS B  1  156  ? 20.819  9.216   138.868  1.00 48.20  ?  156  HIS B CA    1 
ATOM   2983  C  C     . HIS B  1  156  ? 19.685  8.720   139.764  1.00 52.98  ?  156  HIS B C     1 
ATOM   2984  O  O     . HIS B  1  156  ? 19.809  8.715   140.990  1.00 46.25  ?  156  HIS B O     1 
ATOM   2985  C  CB    . HIS B  1  156  ? 20.605  10.679  138.464  1.00 46.38  ?  156  HIS B CB    1 
ATOM   2986  C  CG    . HIS B  1  156  ? 19.333  10.924  137.713  1.00 46.67  ?  156  HIS B CG    1 
ATOM   2987  N  ND1   . HIS B  1  156  ? 18.129  11.163  138.351  1.00 51.63  ?  156  HIS B ND1   1 
ATOM   2988  C  CD2   . HIS B  1  156  ? 19.073  10.968  136.391  1.00 44.71  ?  156  HIS B CD2   1 
ATOM   2989  C  CE1   . HIS B  1  156  ? 17.189  11.342  137.446  1.00 48.04  ?  156  HIS B CE1   1 
ATOM   2990  N  NE2   . HIS B  1  156  ? 17.729  11.231  136.245  1.00 44.83  ?  156  HIS B NE2   1 
ATOM   2991  N  N     . GLY B  1  157  ? 18.586  8.308   139.133  1.00 57.85  ?  157  GLY B N     1 
ATOM   2992  C  CA    . GLY B  1  157  ? 17.461  7.680   139.809  1.00 62.34  ?  157  GLY B CA    1 
ATOM   2993  C  C     . GLY B  1  157  ? 16.926  8.385   141.042  1.00 66.61  ?  157  GLY B C     1 
ATOM   2994  O  O     . GLY B  1  157  ? 16.623  7.740   142.047  1.00 72.74  ?  157  GLY B O     1 
ATOM   2995  N  N     . ILE B  1  158  ? 16.809  9.707   140.972  1.00 59.18  ?  158  ILE B N     1 
ATOM   2996  C  CA    . ILE B  1  158  ? 16.347  10.480  142.121  1.00 67.87  ?  158  ILE B CA    1 
ATOM   2997  C  C     . ILE B  1  158  ? 14.827  10.649  142.154  1.00 69.41  ?  158  ILE B C     1 
ATOM   2998  O  O     . ILE B  1  158  ? 14.181  10.803  141.116  1.00 60.55  ?  158  ILE B O     1 
ATOM   2999  C  CB    . ILE B  1  158  ? 17.043  11.857  142.210  1.00 53.96  ?  158  ILE B CB    1 
ATOM   3000  C  CG1   . ILE B  1  158  ? 16.619  12.760  141.054  1.00 38.37  ?  158  ILE B CG1   1 
ATOM   3001  C  CG2   . ILE B  1  158  ? 18.556  11.690  142.229  1.00 51.77  ?  158  ILE B CG2   1 
ATOM   3002  C  CD1   . ILE B  1  158  ? 17.200  14.147  141.146  1.00 52.55  ?  158  ILE B CD1   1 
ATOM   3003  N  N     . LYS B  1  159  ? 14.265  10.600  143.359  1.00 67.81  ?  159  LYS B N     1 
ATOM   3004  C  CA    . LYS B  1  159  ? 12.834  10.807  143.560  1.00 68.80  ?  159  LYS B CA    1 
ATOM   3005  C  C     . LYS B  1  159  ? 12.564  11.663  144.794  1.00 65.11  ?  159  LYS B C     1 
ATOM   3006  O  O     . LYS B  1  159  ? 13.056  11.367  145.883  1.00 61.55  ?  159  LYS B O     1 
ATOM   3007  C  CB    . LYS B  1  159  ? 12.107  9.467   143.698  1.00 66.44  ?  159  LYS B CB    1 
ATOM   3008  C  CG    . LYS B  1  159  ? 11.864  8.736   142.388  1.00 72.77  ?  159  LYS B CG    1 
ATOM   3009  C  CD    . LYS B  1  159  ? 10.940  7.543   142.595  1.00 71.54  ?  159  LYS B CD    1 
ATOM   3010  C  CE    . LYS B  1  159  ? 10.610  6.855   141.279  1.00 78.06  ?  159  LYS B CE    1 
ATOM   3011  N  NZ    . LYS B  1  159  ? 11.819  6.278   140.627  1.00 84.59  ?  159  LYS B NZ    1 
ATOM   3012  N  N     . ASP B  1  160  ? 11.790  12.730  144.618  1.00 63.68  ?  160  ASP B N     1 
ATOM   3013  C  CA    . ASP B  1  160  ? 11.353  13.543  145.748  1.00 65.00  ?  160  ASP B CA    1 
ATOM   3014  C  C     . ASP B  1  160  ? 10.048  13.015  146.341  1.00 64.48  ?  160  ASP B C     1 
ATOM   3015  O  O     . ASP B  1  160  ? 9.670   13.382  147.454  1.00 65.55  ?  160  ASP B O     1 
ATOM   3016  C  CB    . ASP B  1  160  ? 11.193  15.006  145.333  1.00 74.75  ?  160  ASP B CB    1 
ATOM   3017  C  CG    . ASP B  1  160  ? 12.518  15.667  145.013  1.00 71.90  ?  160  ASP B CG    1 
ATOM   3018  O  OD1   . ASP B  1  160  ? 13.542  15.260  145.600  1.00 65.38  ?  160  ASP B OD1   1 
ATOM   3019  O  OD2   . ASP B  1  160  ? 12.534  16.594  144.175  1.00 72.61  ?  160  ASP B OD2   1 
ATOM   3020  N  N     . ARG B  1  161  ? 9.370   12.148  145.594  1.00 61.15  ?  161  ARG B N     1 
ATOM   3021  C  CA    . ARG B  1  161  ? 8.148   11.505  146.069  1.00 60.13  ?  161  ARG B CA    1 
ATOM   3022  C  C     . ARG B  1  161  ? 7.848   10.231  145.281  1.00 65.84  ?  161  ARG B C     1 
ATOM   3023  O  O     . ARG B  1  161  ? 8.580   9.877   144.358  1.00 72.12  ?  161  ARG B O     1 
ATOM   3024  C  CB    . ARG B  1  161  ? 6.959   12.468  146.028  1.00 58.45  ?  161  ARG B CB    1 
ATOM   3025  C  CG    . ARG B  1  161  ? 6.639   13.025  144.657  1.00 62.32  ?  161  ARG B CG    1 
ATOM   3026  C  CD    . ARG B  1  161  ? 5.542   14.073  144.754  1.00 66.12  ?  161  ARG B CD    1 
ATOM   3027  N  NE    . ARG B  1  161  ? 5.954   15.217  145.562  1.00 67.43  ?  161  ARG B NE    1 
ATOM   3028  C  CZ    . ARG B  1  161  ? 5.166   16.245  145.861  1.00 68.28  ?  161  ARG B CZ    1 
ATOM   3029  N  NH1   . ARG B  1  161  ? 3.915   16.275  145.422  1.00 66.22  ?  161  ARG B NH1   1 
ATOM   3030  N  NH2   . ARG B  1  161  ? 5.627   17.244  146.601  1.00 60.52  ?  161  ARG B NH2   1 
ATOM   3031  N  N     . ILE B  1  162  ? 6.767   9.551   145.648  1.00 64.05  ?  162  ILE B N     1 
ATOM   3032  C  CA    . ILE B  1  162  ? 6.473   8.225   145.107  1.00 67.94  ?  162  ILE B CA    1 
ATOM   3033  C  C     . ILE B  1  162  ? 6.137   8.228   143.611  1.00 73.05  ?  162  ILE B C     1 
ATOM   3034  O  O     . ILE B  1  162  ? 6.561   7.338   142.871  1.00 71.14  ?  162  ILE B O     1 
ATOM   3035  C  CB    . ILE B  1  162  ? 5.356   7.517   145.919  1.00 67.97  ?  162  ILE B CB    1 
ATOM   3036  C  CG1   . ILE B  1  162  ? 5.070   6.124   145.353  1.00 71.46  ?  162  ILE B CG1   1 
ATOM   3037  C  CG2   . ILE B  1  162  ? 4.091   8.366   145.965  1.00 71.08  ?  162  ILE B CG2   1 
ATOM   3038  C  CD1   . ILE B  1  162  ? 6.254   5.183   145.416  1.00 68.60  ?  162  ILE B CD1   1 
ATOM   3039  N  N     . ASN B  1  163  ? 5.391   9.233   143.165  1.00 69.05  ?  163  ASN B N     1 
ATOM   3040  C  CA    . ASN B  1  163  ? 4.974   9.301   141.768  1.00 71.08  ?  163  ASN B CA    1 
ATOM   3041  C  C     . ASN B  1  163  ? 5.899   10.137  140.890  1.00 68.63  ?  163  ASN B C     1 
ATOM   3042  O  O     . ASN B  1  163  ? 5.625   10.340  139.707  1.00 68.65  ?  163  ASN B O     1 
ATOM   3043  C  CB    . ASN B  1  163  ? 3.533   9.801   141.658  1.00 73.08  ?  163  ASN B CB    1 
ATOM   3044  C  CG    . ASN B  1  163  ? 2.529   8.793   142.178  1.00 80.31  ?  163  ASN B CG    1 
ATOM   3045  O  OD1   . ASN B  1  163  ? 2.750   7.583   142.100  1.00 68.93  ?  163  ASN B OD1   1 
ATOM   3046  N  ND2   . ASN B  1  163  ? 1.417   9.286   142.710  1.00 96.88  ?  163  ASN B ND2   1 
ATOM   3047  N  N     . ALA B  1  164  ? 6.989   10.624  141.475  1.00 67.06  ?  164  ALA B N     1 
ATOM   3048  C  CA    . ALA B  1  164  ? 7.969   11.410  140.734  1.00 66.19  ?  164  ALA B CA    1 
ATOM   3049  C  C     . ALA B  1  164  ? 8.611   10.585  139.621  1.00 68.38  ?  164  ALA B C     1 
ATOM   3050  O  O     . ALA B  1  164  ? 9.100   9.479   139.858  1.00 68.43  ?  164  ALA B O     1 
ATOM   3051  C  CB    . ALA B  1  164  ? 9.033   11.959  141.674  1.00 61.82  ?  164  ALA B CB    1 
ATOM   3052  N  N     . ILE B  1  165  ? 8.603   11.128  138.408  1.00 63.27  ?  165  ILE B N     1 
ATOM   3053  C  CA    . ILE B  1  165  ? 9.174   10.445  137.252  1.00 55.34  ?  165  ILE B CA    1 
ATOM   3054  C  C     . ILE B  1  165  ? 10.584  10.942  136.957  1.00 52.68  ?  165  ILE B C     1 
ATOM   3055  O  O     . ILE B  1  165  ? 10.789  12.134  136.724  1.00 51.80  ?  165  ILE B O     1 
ATOM   3056  C  CB    . ILE B  1  165  ? 8.309   10.649  135.994  1.00 54.90  ?  165  ILE B CB    1 
ATOM   3057  C  CG1   . ILE B  1  165  ? 6.882   10.158  136.239  1.00 60.15  ?  165  ILE B CG1   1 
ATOM   3058  C  CG2   . ILE B  1  165  ? 8.928   9.938   134.800  1.00 58.60  ?  165  ILE B CG2   1 
ATOM   3059  C  CD1   . ILE B  1  165  ? 5.950   10.388  135.071  1.00 60.92  ?  165  ILE B CD1   1 
ATOM   3060  N  N     . PRO B  1  166  ? 11.565  10.027  136.967  1.00 50.17  ?  166  PRO B N     1 
ATOM   3061  C  CA    . PRO B  1  166  ? 12.947  10.386  136.638  1.00 45.90  ?  166  PRO B CA    1 
ATOM   3062  C  C     . PRO B  1  166  ? 13.084  10.721  135.156  1.00 46.45  ?  166  PRO B C     1 
ATOM   3063  O  O     . PRO B  1  166  ? 12.492  10.048  134.310  1.00 45.01  ?  166  PRO B O     1 
ATOM   3064  C  CB    . PRO B  1  166  ? 13.727  9.113   136.975  1.00 44.63  ?  166  PRO B CB    1 
ATOM   3065  C  CG    . PRO B  1  166  ? 12.733  8.016   136.832  1.00 46.71  ?  166  PRO B CG    1 
ATOM   3066  C  CD    . PRO B  1  166  ? 11.425  8.596   137.288  1.00 56.83  ?  166  PRO B CD    1 
ATOM   3067  N  N     . VAL B  1  167  ? 13.860  11.757  134.854  1.00 46.74  ?  167  VAL B N     1 
ATOM   3068  C  CA    . VAL B  1  167  ? 14.024  12.229  133.483  1.00 41.83  ?  167  VAL B CA    1 
ATOM   3069  C  C     . VAL B  1  167  ? 15.497  12.229  133.093  1.00 39.38  ?  167  VAL B C     1 
ATOM   3070  O  O     . VAL B  1  167  ? 16.357  12.575  133.907  1.00 36.89  ?  167  VAL B O     1 
ATOM   3071  C  CB    . VAL B  1  167  ? 13.456  13.658  133.322  1.00 41.63  ?  167  VAL B CB    1 
ATOM   3072  C  CG1   . VAL B  1  167  ? 13.720  14.199  131.924  1.00 42.79  ?  167  VAL B CG1   1 
ATOM   3073  C  CG2   . VAL B  1  167  ? 11.971  13.674  133.626  1.00 46.98  ?  167  VAL B CG2   1 
ATOM   3074  N  N     . ASP B  1  168  ? 15.784  11.827  131.856  1.00 39.86  ?  168  ASP B N     1 
ATOM   3075  C  CA    . ASP B  1  168  ? 17.138  11.901  131.325  1.00 36.27  ?  168  ASP B CA    1 
ATOM   3076  C  C     . ASP B  1  168  ? 17.612  13.343  131.437  1.00 34.02  ?  168  ASP B C     1 
ATOM   3077  O  O     . ASP B  1  168  ? 16.955  14.264  130.951  1.00 35.09  ?  168  ASP B O     1 
ATOM   3078  C  CB    . ASP B  1  168  ? 17.168  11.458  129.861  1.00 34.53  ?  168  ASP B CB    1 
ATOM   3079  C  CG    . ASP B  1  168  ? 16.456  10.139  129.632  1.00 38.28  ?  168  ASP B CG    1 
ATOM   3080  O  OD1   . ASP B  1  168  ? 16.554  9.246   130.498  1.00 47.63  ?  168  ASP B OD1   1 
ATOM   3081  O  OD2   . ASP B  1  168  ? 15.792  9.996   128.584  1.00 39.42  ?  168  ASP B OD2   1 
ATOM   3082  N  N     . ALA B  1  169  ? 18.752  13.538  132.085  1.00 30.91  ?  169  ALA B N     1 
ATOM   3083  C  CA    . ALA B  1  169  ? 19.227  14.881  132.383  1.00 38.13  ?  169  ALA B CA    1 
ATOM   3084  C  C     . ALA B  1  169  ? 20.335  15.310  131.438  1.00 36.23  ?  169  ALA B C     1 
ATOM   3085  O  O     . ALA B  1  169  ? 21.393  14.684  131.391  1.00 36.70  ?  169  ALA B O     1 
ATOM   3086  C  CB    . ALA B  1  169  ? 19.709  14.958  133.821  1.00 40.38  ?  169  ALA B CB    1 
ATOM   3087  N  N     . VAL B  1  170  ? 20.099  16.382  130.690  1.00 36.04  ?  170  VAL B N     1 
ATOM   3088  C  CA    . VAL B  1  170  ? 21.151  16.923  129.850  1.00 35.89  ?  170  VAL B CA    1 
ATOM   3089  C  C     . VAL B  1  170  ? 21.721  18.139  130.557  1.00 29.78  ?  170  VAL B C     1 
ATOM   3090  O  O     . VAL B  1  170  ? 21.138  19.222  130.528  1.00 34.06  ?  170  VAL B O     1 
ATOM   3091  C  CB    . VAL B  1  170  ? 20.590  17.372  128.490  1.00 34.67  ?  170  VAL B CB    1 
ATOM   3092  C  CG1   . VAL B  1  170  ? 21.721  17.736  127.543  1.00 44.64  ?  170  VAL B CG1   1 
ATOM   3093  C  CG2   . VAL B  1  170  ? 19.709  16.284  127.891  1.00 32.10  ?  170  VAL B CG2   1 
ATOM   3094  N  N     . PHE B  1  171  ? 22.888  17.961  131.159  1.00 27.26  ?  171  PHE B N     1 
ATOM   3095  C  CA    . PHE B  1  171  ? 23.515  19.027  131.923  1.00 38.31  ?  171  PHE B CA    1 
ATOM   3096  C  C     . PHE B  1  171  ? 24.301  19.972  131.031  1.00 43.02  ?  171  PHE B C     1 
ATOM   3097  O  O     . PHE B  1  171  ? 24.250  21.190  131.201  1.00 46.06  ?  171  PHE B O     1 
ATOM   3098  C  CB    . PHE B  1  171  ? 24.410  18.449  133.021  1.00 41.71  ?  171  PHE B CB    1 
ATOM   3099  C  CG    . PHE B  1  171  ? 23.650  17.782  134.134  1.00 42.76  ?  171  PHE B CG    1 
ATOM   3100  C  CD1   . PHE B  1  171  ? 22.964  18.538  135.071  1.00 43.22  ?  171  PHE B CD1   1 
ATOM   3101  C  CD2   . PHE B  1  171  ? 23.624  16.402  134.246  1.00 41.17  ?  171  PHE B CD2   1 
ATOM   3102  C  CE1   . PHE B  1  171  ? 22.266  17.931  136.098  1.00 40.55  ?  171  PHE B CE1   1 
ATOM   3103  C  CE2   . PHE B  1  171  ? 22.927  15.788  135.270  1.00 38.35  ?  171  PHE B CE2   1 
ATOM   3104  C  CZ    . PHE B  1  171  ? 22.247  16.554  136.197  1.00 36.75  ?  171  PHE B CZ    1 
ATOM   3105  N  N     . SER B  1  172  ? 25.023  19.392  130.076  1.00 40.60  ?  172  SER B N     1 
ATOM   3106  C  CA    . SER B  1  172  ? 25.934  20.148  129.229  1.00 41.85  ?  172  SER B CA    1 
ATOM   3107  C  C     . SER B  1  172  ? 25.218  21.269  128.491  1.00 41.60  ?  172  SER B C     1 
ATOM   3108  O  O     . SER B  1  172  ? 24.291  21.021  127.719  1.00 37.19  ?  172  SER B O     1 
ATOM   3109  C  CB    . SER B  1  172  ? 26.626  19.221  128.227  1.00 36.90  ?  172  SER B CB    1 
ATOM   3110  O  OG    . SER B  1  172  ? 27.535  19.940  127.410  1.00 33.73  ?  172  SER B OG    1 
ATOM   3111  N  N     . PRO B  1  173  ? 25.644  22.516  128.741  1.00 39.34  ?  173  PRO B N     1 
ATOM   3112  C  CA    . PRO B  1  173  ? 25.113  23.673  128.020  1.00 40.14  ?  173  PRO B CA    1 
ATOM   3113  C  C     . PRO B  1  173  ? 25.569  23.630  126.570  1.00 37.91  ?  173  PRO B C     1 
ATOM   3114  O  O     . PRO B  1  173  ? 24.960  24.266  125.712  1.00 42.28  ?  173  PRO B O     1 
ATOM   3115  C  CB    . PRO B  1  173  ? 25.753  24.858  128.744  1.00 40.20  ?  173  PRO B CB    1 
ATOM   3116  C  CG    . PRO B  1  173  ? 27.011  24.312  129.303  1.00 36.99  ?  173  PRO B CG    1 
ATOM   3117  C  CD    . PRO B  1  173  ? 26.700  22.897  129.695  1.00 32.58  ?  173  PRO B CD    1 
ATOM   3118  N  N     . VAL B  1  174  ? 26.635  22.880  126.307  1.00 33.46  ?  174  VAL B N     1 
ATOM   3119  C  CA    . VAL B  1  174  ? 27.118  22.696  124.949  1.00 34.94  ?  174  VAL B CA    1 
ATOM   3120  C  C     . VAL B  1  174  ? 26.286  21.636  124.239  1.00 31.47  ?  174  VAL B C     1 
ATOM   3121  O  O     . VAL B  1  174  ? 26.253  20.477  124.653  1.00 24.36  ?  174  VAL B O     1 
ATOM   3122  C  CB    . VAL B  1  174  ? 28.589  22.253  124.937  1.00 32.33  ?  174  VAL B CB    1 
ATOM   3123  C  CG1   . VAL B  1  174  ? 29.051  22.024  123.513  1.00 35.32  ?  174  VAL B CG1   1 
ATOM   3124  C  CG2   . VAL B  1  174  ? 29.460  23.288  125.627  1.00 32.72  ?  174  VAL B CG2   1 
ATOM   3125  N  N     . ARG B  1  175  ? 25.613  22.042  123.168  1.00 34.10  ?  175  ARG B N     1 
ATOM   3126  C  CA    . ARG B  1  175  ? 24.785  21.126  122.395  1.00 28.52  ?  175  ARG B CA    1 
ATOM   3127  C  C     . ARG B  1  175  ? 25.602  20.303  121.406  1.00 33.83  ?  175  ARG B C     1 
ATOM   3128  O  O     . ARG B  1  175  ? 25.323  19.122  121.198  1.00 35.48  ?  175  ARG B O     1 
ATOM   3129  C  CB    . ARG B  1  175  ? 23.662  21.878  121.680  1.00 33.45  ?  175  ARG B CB    1 
ATOM   3130  C  CG    . ARG B  1  175  ? 22.714  22.585  122.632  1.00 45.81  ?  175  ARG B CG    1 
ATOM   3131  C  CD    . ARG B  1  175  ? 21.384  22.909  121.972  1.00 55.05  ?  175  ARG B CD    1 
ATOM   3132  N  NE    . ARG B  1  175  ? 20.435  23.472  122.928  1.00 63.97  ?  175  ARG B NE    1 
ATOM   3133  C  CZ    . ARG B  1  175  ? 19.717  22.749  123.782  1.00 71.40  ?  175  ARG B CZ    1 
ATOM   3134  N  NH1   . ARG B  1  175  ? 19.839  21.428  123.804  1.00 60.85  ?  175  ARG B NH1   1 
ATOM   3135  N  NH2   . ARG B  1  175  ? 18.877  23.347  124.617  1.00 70.81  ?  175  ARG B NH2   1 
ATOM   3136  N  N     . ARG B  1  176  ? 26.603  20.927  120.791  1.00 31.00  ?  176  ARG B N     1 
ATOM   3137  C  CA    . ARG B  1  176  ? 27.444  20.215  119.832  1.00 27.07  ?  176  ARG B CA    1 
ATOM   3138  C  C     . ARG B  1  176  ? 28.863  20.773  119.746  1.00 32.16  ?  176  ARG B C     1 
ATOM   3139  O  O     . ARG B  1  176  ? 29.080  21.970  119.911  1.00 40.25  ?  176  ARG B O     1 
ATOM   3140  C  CB    . ARG B  1  176  ? 26.787  20.216  118.446  1.00 30.41  ?  176  ARG B CB    1 
ATOM   3141  C  CG    . ARG B  1  176  ? 27.563  19.455  117.381  1.00 36.16  ?  176  ARG B CG    1 
ATOM   3142  C  CD    . ARG B  1  176  ? 26.636  18.861  116.339  1.00 37.92  ?  176  ARG B CD    1 
ATOM   3143  N  NE    . ARG B  1  176  ? 26.211  19.830  115.333  1.00 32.42  ?  176  ARG B NE    1 
ATOM   3144  C  CZ    . ARG B  1  176  ? 26.657  19.846  114.081  1.00 34.81  ?  176  ARG B CZ    1 
ATOM   3145  N  NH1   . ARG B  1  176  ? 27.540  18.942  113.679  1.00 33.56  ?  176  ARG B NH1   1 
ATOM   3146  N  NH2   . ARG B  1  176  ? 26.218  20.761  113.229  1.00 34.65  ?  176  ARG B NH2   1 
ATOM   3147  N  N     . VAL B  1  177  ? 29.827  19.893  119.492  1.00 29.40  ?  177  VAL B N     1 
ATOM   3148  C  CA    . VAL B  1  177  ? 31.199  20.305  119.224  1.00 32.15  ?  177  VAL B CA    1 
ATOM   3149  C  C     . VAL B  1  177  ? 31.705  19.613  117.967  1.00 41.26  ?  177  VAL B C     1 
ATOM   3150  O  O     . VAL B  1  177  ? 31.663  18.386  117.872  1.00 43.83  ?  177  VAL B O     1 
ATOM   3151  C  CB    . VAL B  1  177  ? 32.144  19.945  120.381  1.00 35.86  ?  177  VAL B CB    1 
ATOM   3152  C  CG1   . VAL B  1  177  ? 33.585  20.250  119.999  1.00 38.92  ?  177  VAL B CG1   1 
ATOM   3153  C  CG2   . VAL B  1  177  ? 31.755  20.691  121.639  1.00 30.88  ?  177  VAL B CG2   1 
ATOM   3154  N  N     . ALA B  1  178  ? 32.177  20.394  117.001  1.00 41.18  ?  178  ALA B N     1 
ATOM   3155  C  CA    . ALA B  1  178  ? 32.723  19.817  115.777  1.00 36.51  ?  178  ALA B CA    1 
ATOM   3156  C  C     . ALA B  1  178  ? 34.022  20.501  115.371  1.00 39.01  ?  178  ALA B C     1 
ATOM   3157  O  O     . ALA B  1  178  ? 34.039  21.704  115.125  1.00 47.49  ?  178  ALA B O     1 
ATOM   3158  C  CB    . ALA B  1  178  ? 31.704  19.902  114.652  1.00 39.39  ?  178  ALA B CB    1 
ATOM   3159  N  N     . PHE B  1  179  ? 35.110  19.739  115.292  1.00 34.06  ?  179  PHE B N     1 
ATOM   3160  C  CA    . PHE B  1  179  ? 36.389  20.321  114.893  1.00 36.20  ?  179  PHE B CA    1 
ATOM   3161  C  C     . PHE B  1  179  ? 36.986  19.666  113.648  1.00 36.70  ?  179  PHE B C     1 
ATOM   3162  O  O     . PHE B  1  179  ? 36.795  18.475  113.401  1.00 39.07  ?  179  PHE B O     1 
ATOM   3163  C  CB    . PHE B  1  179  ? 37.393  20.306  116.053  1.00 33.44  ?  179  PHE B CB    1 
ATOM   3164  C  CG    . PHE B  1  179  ? 38.147  19.016  116.195  1.00 30.62  ?  179  PHE B CG    1 
ATOM   3165  C  CD1   . PHE B  1  179  ? 37.568  17.923  116.817  1.00 31.71  ?  179  PHE B CD1   1 
ATOM   3166  C  CD2   . PHE B  1  179  ? 39.444  18.902  115.722  1.00 29.12  ?  179  PHE B CD2   1 
ATOM   3167  C  CE1   . PHE B  1  179  ? 38.264  16.736  116.952  1.00 36.75  ?  179  PHE B CE1   1 
ATOM   3168  C  CE2   . PHE B  1  179  ? 40.145  17.718  115.854  1.00 33.22  ?  179  PHE B CE2   1 
ATOM   3169  C  CZ    . PHE B  1  179  ? 39.555  16.635  116.470  1.00 30.27  ?  179  PHE B CZ    1 
ATOM   3170  N  N     . GLN B  1  180  ? 37.709  20.466  112.870  1.00 36.94  ?  180  GLN B N     1 
ATOM   3171  C  CA    . GLN B  1  180  ? 38.358  20.000  111.653  1.00 43.39  ?  180  GLN B CA    1 
ATOM   3172  C  C     . GLN B  1  180  ? 39.743  20.628  111.534  1.00 38.74  ?  180  GLN B C     1 
ATOM   3173  O  O     . GLN B  1  180  ? 39.931  21.803  111.855  1.00 39.26  ?  180  GLN B O     1 
ATOM   3174  C  CB    . GLN B  1  180  ? 37.511  20.359  110.431  1.00 47.47  ?  180  GLN B CB    1 
ATOM   3175  C  CG    . GLN B  1  180  ? 38.014  19.773  109.122  1.00 53.97  ?  180  GLN B CG    1 
ATOM   3176  C  CD    . GLN B  1  180  ? 37.226  20.268  107.924  1.00 67.62  ?  180  GLN B CD    1 
ATOM   3177  O  OE1   . GLN B  1  180  ? 36.667  21.365  107.943  1.00 70.30  ?  180  GLN B OE1   1 
ATOM   3178  N  NE2   . GLN B  1  180  ? 37.174  19.456  106.874  1.00 71.87  ?  180  GLN B NE2   1 
ATOM   3179  N  N     . VAL B  1  181  ? 40.714  19.842  111.081  1.00 36.56  ?  181  VAL B N     1 
ATOM   3180  C  CA    . VAL B  1  181  ? 42.078  20.333  110.923  1.00 39.60  ?  181  VAL B CA    1 
ATOM   3181  C  C     . VAL B  1  181  ? 42.480  20.382  109.453  1.00 46.06  ?  181  VAL B C     1 
ATOM   3182  O  O     . VAL B  1  181  ? 42.463  19.365  108.760  1.00 47.02  ?  181  VAL B O     1 
ATOM   3183  C  CB    . VAL B  1  181  ? 43.082  19.465  111.697  1.00 39.92  ?  181  VAL B CB    1 
ATOM   3184  C  CG1   . VAL B  1  181  ? 44.496  19.998  111.514  1.00 41.95  ?  181  VAL B CG1   1 
ATOM   3185  C  CG2   . VAL B  1  181  ? 42.712  19.423  113.168  1.00 39.29  ?  181  VAL B CG2   1 
ATOM   3186  N  N     . GLU B  1  182  ? 42.843  21.570  108.981  1.00 47.56  ?  182  GLU B N     1 
ATOM   3187  C  CA    . GLU B  1  182  ? 43.211  21.742  107.581  1.00 43.91  ?  182  GLU B CA    1 
ATOM   3188  C  C     . GLU B  1  182  ? 44.701  22.016  107.436  1.00 46.23  ?  182  GLU B C     1 
ATOM   3189  O  O     . GLU B  1  182  ? 45.294  22.703  108.262  1.00 50.18  ?  182  GLU B O     1 
ATOM   3190  C  CB    . GLU B  1  182  ? 42.404  22.880  106.952  1.00 48.03  ?  182  GLU B CB    1 
ATOM   3191  C  CG    . GLU B  1  182  ? 40.897  22.704  107.063  1.00 58.25  ?  182  GLU B CG    1 
ATOM   3192  C  CD    . GLU B  1  182  ? 40.127  23.871  106.475  1.00 65.24  ?  182  GLU B CD    1 
ATOM   3193  O  OE1   . GLU B  1  182  ? 38.899  23.943  106.693  1.00 67.73  ?  182  GLU B OE1   1 
ATOM   3194  O  OE2   . GLU B  1  182  ? 40.748  24.714  105.794  1.00 66.64  ?  182  GLU B OE2   1 
ATOM   3195  N  N     . ASP B  1  183  ? 45.305  21.473  106.384  1.00 60.32  ?  183  ASP B N     1 
ATOM   3196  C  CA    . ASP B  1  183  ? 46.718  21.710  106.121  1.00 59.86  ?  183  ASP B CA    1 
ATOM   3197  C  C     . ASP B  1  183  ? 46.953  23.146  105.672  1.00 55.33  ?  183  ASP B C     1 
ATOM   3198  O  O     . ASP B  1  183  ? 46.167  23.708  104.909  1.00 46.86  ?  183  ASP B O     1 
ATOM   3199  C  CB    . ASP B  1  183  ? 47.249  20.729  105.074  1.00 65.15  ?  183  ASP B CB    1 
ATOM   3200  C  CG    . ASP B  1  183  ? 47.477  19.343  105.641  1.00 79.81  ?  183  ASP B CG    1 
ATOM   3201  O  OD1   . ASP B  1  183  ? 46.485  18.611  105.844  1.00 79.30  ?  183  ASP B OD1   1 
ATOM   3202  O  OD2   . ASP B  1  183  ? 48.650  18.985  105.883  1.00 82.68  ?  183  ASP B OD2   1 
ATOM   3203  N  N     . THR B  1  184  ? 48.038  23.735  106.160  1.00 59.38  ?  184  THR B N     1 
ATOM   3204  C  CA    . THR B  1  184  ? 48.383  25.109  105.829  1.00 59.67  ?  184  THR B CA    1 
ATOM   3205  C  C     . THR B  1  184  ? 49.895  25.301  105.795  1.00 66.27  ?  184  THR B C     1 
ATOM   3206  O  O     . THR B  1  184  ? 50.655  24.496  106.352  1.00 63.30  ?  184  THR B O     1 
ATOM   3207  C  CB    . THR B  1  184  ? 47.768  26.108  106.829  1.00 59.21  ?  184  THR B CB    1 
ATOM   3208  O  OG1   . THR B  1  184  ? 48.072  27.447  106.419  1.00 68.71  ?  184  THR B OG1   1 
ATOM   3209  C  CG2   . THR B  1  184  ? 48.317  25.874  108.227  1.00 56.28  ?  184  THR B CG2   1 
ATOM   3210  N  N     . ARG B  1  185  ? 50.321  26.375  105.139  1.00 70.14  ?  185  ARG B N     1 
ATOM   3211  C  CA    . ARG B  1  185  ? 51.738  26.664  104.985  1.00 77.13  ?  185  ARG B CA    1 
ATOM   3212  C  C     . ARG B  1  185  ? 52.098  28.075  105.445  1.00 78.50  ?  185  ARG B C     1 
ATOM   3213  O  O     . ARG B  1  185  ? 51.332  29.022  105.255  1.00 76.95  ?  185  ARG B O     1 
ATOM   3214  C  CB    . ARG B  1  185  ? 52.175  26.456  103.531  1.00 85.00  ?  185  ARG B CB    1 
ATOM   3215  C  CG    . ARG B  1  185  ? 51.621  27.480  102.552  1.00 81.34  ?  185  ARG B CG    1 
ATOM   3216  C  CD    . ARG B  1  185  ? 52.165  27.256  101.150  1.00 88.77  ?  185  ARG B CD    1 
ATOM   3217  N  NE    . ARG B  1  185  ? 51.875  28.383  100.268  1.00 85.50  ?  185  ARG B NE    1 
ATOM   3218  C  CZ    . ARG B  1  185  ? 52.696  29.412  100.080  1.00 86.08  ?  185  ARG B CZ    1 
ATOM   3219  N  NH1   . ARG B  1  185  ? 53.862  29.455  100.711  1.00 78.09  ?  185  ARG B NH1   1 
ATOM   3220  N  NH2   . ARG B  1  185  ? 52.351  30.397  99.261   1.00 74.82  ?  185  ARG B NH2   1 
ATOM   3221  N  N     . LEU B  1  186  ? 53.265  28.198  106.067  1.00 83.05  ?  186  LEU B N     1 
ATOM   3222  C  CA    . LEU B  1  186  ? 53.819  29.494  106.437  1.00 91.09  ?  186  LEU B CA    1 
ATOM   3223  C  C     . LEU B  1  186  ? 55.244  29.579  105.913  1.00 97.55  ?  186  LEU B C     1 
ATOM   3224  O  O     . LEU B  1  186  ? 56.123  28.844  106.367  1.00 92.94  ?  186  LEU B O     1 
ATOM   3225  C  CB    . LEU B  1  186  ? 53.811  29.671  107.955  1.00 90.44  ?  186  LEU B CB    1 
ATOM   3226  C  CG    . LEU B  1  186  ? 54.519  30.913  108.504  1.00 93.82  ?  186  LEU B CG    1 
ATOM   3227  C  CD1   . LEU B  1  186  ? 53.704  32.172  108.238  1.00 87.46  ?  186  LEU B CD1   1 
ATOM   3228  C  CD2   . LEU B  1  186  ? 54.814  30.754  109.989  1.00 85.00  ?  186  LEU B CD2   1 
ATOM   3229  N  N     . GLY B  1  187  ? 55.474  30.482  104.965  1.00 100.86 ?  187  GLY B N     1 
ATOM   3230  C  CA    . GLY B  1  187  ? 56.768  30.570  104.315  1.00 106.99 ?  187  GLY B CA    1 
ATOM   3231  C  C     . GLY B  1  187  ? 57.061  29.300  103.541  1.00 102.86 ?  187  GLY B C     1 
ATOM   3232  O  O     . GLY B  1  187  ? 56.284  28.898  102.672  1.00 85.05  ?  187  GLY B O     1 
ATOM   3233  N  N     . GLN B  1  188  ? 58.186  28.665  103.852  1.00 100.08 ?  188  GLN B N     1 
ATOM   3234  C  CA    . GLN B  1  188  ? 58.551  27.415  103.195  1.00 103.98 ?  188  GLN B CA    1 
ATOM   3235  C  C     . GLN B  1  188  ? 58.138  26.180  104.006  1.00 101.98 ?  188  GLN B C     1 
ATOM   3236  O  O     . GLN B  1  188  ? 58.376  25.048  103.585  1.00 97.80  ?  188  GLN B O     1 
ATOM   3237  C  CB    . GLN B  1  188  ? 60.049  27.388  102.867  1.00 98.91  ?  188  GLN B CB    1 
ATOM   3238  C  CG    . GLN B  1  188  ? 60.422  26.472  101.702  1.00 98.51  ?  188  GLN B CG    1 
ATOM   3239  C  CD    . GLN B  1  188  ? 59.684  26.816  100.417  1.00 93.44  ?  188  GLN B CD    1 
ATOM   3240  O  OE1   . GLN B  1  188  ? 59.347  27.975  100.169  1.00 91.48  ?  188  GLN B OE1   1 
ATOM   3241  N  NE2   . GLN B  1  188  ? 59.428  25.805  99.594   1.00 83.26  ?  188  GLN B NE2   1 
ATOM   3242  N  N     . ARG B  1  189  ? 57.515  26.394  105.164  1.00 99.33  ?  189  ARG B N     1 
ATOM   3243  C  CA    . ARG B  1  189  ? 56.973  25.274  105.925  1.00 94.55  ?  189  ARG B CA    1 
ATOM   3244  C  C     . ARG B  1  189  ? 55.631  24.901  105.312  1.00 90.60  ?  189  ARG B C     1 
ATOM   3245  O  O     . ARG B  1  189  ? 54.690  25.688  105.355  1.00 83.63  ?  189  ARG B O     1 
ATOM   3246  C  CB    . ARG B  1  189  ? 56.755  25.679  107.384  1.00 94.42  ?  189  ARG B CB    1 
ATOM   3247  C  CG    . ARG B  1  189  ? 57.982  26.220  108.101  1.00 100.47 ?  189  ARG B CG    1 
ATOM   3248  C  CD    . ARG B  1  189  ? 58.917  25.104  108.535  1.00 112.90 ?  189  ARG B CD    1 
ATOM   3249  N  NE    . ARG B  1  189  ? 59.760  25.509  109.658  1.00 120.48 ?  189  ARG B NE    1 
ATOM   3250  C  CZ    . ARG B  1  189  ? 59.439  25.324  110.935  1.00 111.78 ?  189  ARG B CZ    1 
ATOM   3251  N  NH1   . ARG B  1  189  ? 60.264  25.723  111.894  1.00 97.81  ?  189  ARG B NH1   1 
ATOM   3252  N  NH2   . ARG B  1  189  ? 58.293  24.737  111.254  1.00 102.02 ?  189  ARG B NH2   1 
ATOM   3253  N  N     . THR B  1  190  ? 55.540  23.703  104.744  1.00 93.70  ?  190  THR B N     1 
ATOM   3254  C  CA    . THR B  1  190  ? 54.309  23.269  104.084  1.00 97.77  ?  190  THR B CA    1 
ATOM   3255  C  C     . THR B  1  190  ? 53.377  22.388  104.924  1.00 93.60  ?  190  THR B C     1 
ATOM   3256  O  O     . THR B  1  190  ? 52.233  22.145  104.539  1.00 88.66  ?  190  THR B O     1 
ATOM   3257  C  CB    . THR B  1  190  ? 54.621  22.552  102.760  1.00 95.77  ?  190  THR B CB    1 
ATOM   3258  O  OG1   . THR B  1  190  ? 55.418  21.390  103.020  1.00 94.78  ?  190  THR B OG1   1 
ATOM   3259  C  CG2   . THR B  1  190  ? 55.381  23.486  101.830  1.00 96.48  ?  190  THR B CG2   1 
ATOM   3260  N  N     . ASP B  1  191  ? 53.865  21.918  106.067  1.00 85.62  ?  191  ASP B N     1 
ATOM   3261  C  CA    . ASP B  1  191  ? 53.158  20.891  106.832  1.00 76.12  ?  191  ASP B CA    1 
ATOM   3262  C  C     . ASP B  1  191  ? 52.299  21.404  107.989  1.00 71.58  ?  191  ASP B C     1 
ATOM   3263  O  O     . ASP B  1  191  ? 51.738  20.608  108.742  1.00 67.47  ?  191  ASP B O     1 
ATOM   3264  C  CB    . ASP B  1  191  ? 54.137  19.821  107.327  1.00 76.82  ?  191  ASP B CB    1 
ATOM   3265  C  CG    . ASP B  1  191  ? 55.319  20.409  108.071  1.00 90.62  ?  191  ASP B CG    1 
ATOM   3266  O  OD1   . ASP B  1  191  ? 55.566  21.626  107.932  1.00 86.77  ?  191  ASP B OD1   1 
ATOM   3267  O  OD2   . ASP B  1  191  ? 56.006  19.652  108.790  1.00 96.90  ?  191  ASP B OD2   1 
ATOM   3268  N  N     . LEU B  1  192  ? 52.198  22.722  108.135  1.00 70.38  ?  192  LEU B N     1 
ATOM   3269  C  CA    . LEU B  1  192  ? 51.570  23.299  109.324  1.00 59.96  ?  192  LEU B CA    1 
ATOM   3270  C  C     . LEU B  1  192  ? 50.076  22.994  109.438  1.00 51.77  ?  192  LEU B C     1 
ATOM   3271  O  O     . LEU B  1  192  ? 49.421  22.669  108.450  1.00 52.04  ?  192  LEU B O     1 
ATOM   3272  C  CB    . LEU B  1  192  ? 51.834  24.804  109.403  1.00 56.56  ?  192  LEU B CB    1 
ATOM   3273  C  CG    . LEU B  1  192  ? 53.317  25.172  109.478  1.00 61.27  ?  192  LEU B CG    1 
ATOM   3274  C  CD1   . LEU B  1  192  ? 53.493  26.633  109.852  1.00 77.39  ?  192  LEU B CD1   1 
ATOM   3275  C  CD2   . LEU B  1  192  ? 54.057  24.269  110.457  1.00 55.61  ?  192  LEU B CD2   1 
ATOM   3276  N  N     . ASP B  1  193  ? 49.553  23.081  110.658  1.00 46.61  ?  193  ASP B N     1 
ATOM   3277  C  CA    . ASP B  1  193  ? 48.158  22.745  110.928  1.00 42.84  ?  193  ASP B CA    1 
ATOM   3278  C  C     . ASP B  1  193  ? 47.295  23.975  111.194  1.00 41.74  ?  193  ASP B C     1 
ATOM   3279  O  O     . ASP B  1  193  ? 47.758  24.968  111.756  1.00 42.96  ?  193  ASP B O     1 
ATOM   3280  C  CB    . ASP B  1  193  ? 48.055  21.780  112.114  1.00 47.61  ?  193  ASP B CB    1 
ATOM   3281  C  CG    . ASP B  1  193  ? 48.489  20.369  111.761  1.00 55.16  ?  193  ASP B CG    1 
ATOM   3282  O  OD1   . ASP B  1  193  ? 49.319  20.209  110.841  1.00 62.43  ?  193  ASP B OD1   1 
ATOM   3283  O  OD2   . ASP B  1  193  ? 47.999  19.419  112.409  1.00 52.12  ?  193  ASP B OD2   1 
ATOM   3284  N  N     . LYS B  1  194  ? 46.035  23.892  110.784  1.00 39.14  ?  194  LYS B N     1 
ATOM   3285  C  CA    . LYS B  1  194  ? 45.059  24.944  111.026  1.00 38.56  ?  194  LYS B CA    1 
ATOM   3286  C  C     . LYS B  1  194  ? 43.849  24.349  111.735  1.00 41.46  ?  194  LYS B C     1 
ATOM   3287  O  O     . LYS B  1  194  ? 43.179  23.464  111.193  1.00 42.70  ?  194  LYS B O     1 
ATOM   3288  C  CB    . LYS B  1  194  ? 44.630  25.585  109.707  1.00 39.85  ?  194  LYS B CB    1 
ATOM   3289  C  CG    . LYS B  1  194  ? 43.503  26.595  109.839  1.00 44.66  ?  194  LYS B CG    1 
ATOM   3290  C  CD    . LYS B  1  194  ? 43.107  27.152  108.483  1.00 45.96  ?  194  LYS B CD    1 
ATOM   3291  C  CE    . LYS B  1  194  ? 42.023  28.205  108.613  1.00 47.65  ?  194  LYS B CE    1 
ATOM   3292  N  NZ    . LYS B  1  194  ? 41.679  28.802  107.294  1.00 64.92  ?  194  LYS B NZ    1 
ATOM   3293  N  N     . LEU B  1  195  ? 43.571  24.831  112.944  1.00 34.65  ?  195  LEU B N     1 
ATOM   3294  C  CA    . LEU B  1  195  ? 42.503  24.252  113.756  1.00 35.23  ?  195  LEU B CA    1 
ATOM   3295  C  C     . LEU B  1  195  ? 41.198  25.037  113.685  1.00 33.14  ?  195  LEU B C     1 
ATOM   3296  O  O     . LEU B  1  195  ? 41.134  26.189  114.106  1.00 35.58  ?  195  LEU B O     1 
ATOM   3297  C  CB    . LEU B  1  195  ? 42.947  24.119  115.215  1.00 34.19  ?  195  LEU B CB    1 
ATOM   3298  C  CG    . LEU B  1  195  ? 41.866  23.672  116.203  1.00 24.41  ?  195  LEU B CG    1 
ATOM   3299  C  CD1   . LEU B  1  195  ? 41.290  22.322  115.809  1.00 29.19  ?  195  LEU B CD1   1 
ATOM   3300  C  CD2   . LEU B  1  195  ? 42.424  23.625  117.613  1.00 31.63  ?  195  LEU B CD2   1 
ATOM   3301  N  N     . THR B  1  196  ? 40.159  24.400  113.157  1.00 31.88  ?  196  THR B N     1 
ATOM   3302  C  CA    . THR B  1  196  ? 38.831  25.002  113.120  1.00 31.60  ?  196  THR B CA    1 
ATOM   3303  C  C     . THR B  1  196  ? 37.928  24.301  114.130  1.00 36.06  ?  196  THR B C     1 
ATOM   3304  O  O     . THR B  1  196  ? 37.757  23.087  114.077  1.00 35.23  ?  196  THR B O     1 
ATOM   3305  C  CB    . THR B  1  196  ? 38.203  24.913  111.716  1.00 39.32  ?  196  THR B CB    1 
ATOM   3306  O  OG1   . THR B  1  196  ? 39.046  25.578  110.765  1.00 39.13  ?  196  THR B OG1   1 
ATOM   3307  C  CG2   . THR B  1  196  ? 36.825  25.559  111.706  1.00 34.68  ?  196  THR B CG2   1 
ATOM   3308  N  N     . LEU B  1  197  ? 37.359  25.069  115.054  1.00 40.82  ?  197  LEU B N     1 
ATOM   3309  C  CA    . LEU B  1  197  ? 36.554  24.502  116.130  1.00 34.03  ?  197  LEU B CA    1 
ATOM   3310  C  C     . LEU B  1  197  ? 35.198  25.194  116.244  1.00 31.03  ?  197  LEU B C     1 
ATOM   3311  O  O     . LEU B  1  197  ? 35.123  26.377  116.563  1.00 40.55  ?  197  LEU B O     1 
ATOM   3312  C  CB    . LEU B  1  197  ? 37.320  24.590  117.453  1.00 29.30  ?  197  LEU B CB    1 
ATOM   3313  C  CG    . LEU B  1  197  ? 36.664  24.035  118.717  1.00 33.23  ?  197  LEU B CG    1 
ATOM   3314  C  CD1   . LEU B  1  197  ? 36.133  22.632  118.482  1.00 38.21  ?  197  LEU B CD1   1 
ATOM   3315  C  CD2   . LEU B  1  197  ? 37.662  24.041  119.862  1.00 22.73  ?  197  LEU B CD2   1 
ATOM   3316  N  N     . ARG B  1  198  ? 34.130  24.447  115.988  1.00 27.26  ?  198  ARG B N     1 
ATOM   3317  C  CA    . ARG B  1  198  ? 32.776  24.993  116.004  1.00 32.23  ?  198  ARG B CA    1 
ATOM   3318  C  C     . ARG B  1  198  ? 31.987  24.489  117.208  1.00 38.74  ?  198  ARG B C     1 
ATOM   3319  O  O     . ARG B  1  198  ? 31.952  23.282  117.479  1.00 36.91  ?  198  ARG B O     1 
ATOM   3320  C  CB    . ARG B  1  198  ? 32.044  24.622  114.715  1.00 32.94  ?  198  ARG B CB    1 
ATOM   3321  C  CG    . ARG B  1  198  ? 32.757  25.059  113.448  1.00 36.07  ?  198  ARG B CG    1 
ATOM   3322  C  CD    . ARG B  1  198  ? 32.390  24.158  112.279  1.00 46.77  ?  198  ARG B CD    1 
ATOM   3323  N  NE    . ARG B  1  198  ? 30.962  24.194  111.979  1.00 48.99  ?  198  ARG B NE    1 
ATOM   3324  C  CZ    . ARG B  1  198  ? 30.332  23.287  111.239  1.00 46.99  ?  198  ARG B CZ    1 
ATOM   3325  N  NH1   . ARG B  1  198  ? 29.030  23.400  111.014  1.00 40.40  ?  198  ARG B NH1   1 
ATOM   3326  N  NH2   . ARG B  1  198  ? 31.004  22.263  110.729  1.00 37.49  ?  198  ARG B NH2   1 
ATOM   3327  N  N     . ILE B  1  199  ? 31.351  25.416  117.924  1.00 39.89  ?  199  ILE B N     1 
ATOM   3328  C  CA    . ILE B  1  199  ? 30.610  25.073  119.137  1.00 29.90  ?  199  ILE B CA    1 
ATOM   3329  C  C     . ILE B  1  199  ? 29.169  25.589  119.135  1.00 32.22  ?  199  ILE B C     1 
ATOM   3330  O  O     . ILE B  1  199  ? 28.919  26.773  118.893  1.00 35.42  ?  199  ILE B O     1 
ATOM   3331  C  CB    . ILE B  1  199  ? 31.315  25.604  120.402  1.00 24.42  ?  199  ILE B CB    1 
ATOM   3332  C  CG1   . ILE B  1  199  ? 32.792  25.209  120.408  1.00 24.25  ?  199  ILE B CG1   1 
ATOM   3333  C  CG2   . ILE B  1  199  ? 30.621  25.091  121.653  1.00 28.86  ?  199  ILE B CG2   1 
ATOM   3334  C  CD1   . ILE B  1  199  ? 33.560  25.742  121.595  1.00 26.40  ?  199  ILE B CD1   1 
ATOM   3335  N  N     . TRP B  1  200  ? 28.232  24.684  119.410  1.00 30.47  ?  200  TRP B N     1 
ATOM   3336  C  CA    . TRP B  1  200  ? 26.822  25.025  119.577  1.00 36.17  ?  200  TRP B CA    1 
ATOM   3337  C  C     . TRP B  1  200  ? 26.414  24.849  121.037  1.00 41.51  ?  200  TRP B C     1 
ATOM   3338  O  O     . TRP B  1  200  ? 26.555  23.757  121.598  1.00 39.61  ?  200  TRP B O     1 
ATOM   3339  C  CB    . TRP B  1  200  ? 25.938  24.117  118.721  1.00 33.90  ?  200  TRP B CB    1 
ATOM   3340  C  CG    . TRP B  1  200  ? 26.066  24.297  117.242  1.00 36.66  ?  200  TRP B CG    1 
ATOM   3341  C  CD1   . TRP B  1  200  ? 25.235  25.012  116.429  1.00 36.55  ?  200  TRP B CD1   1 
ATOM   3342  C  CD2   . TRP B  1  200  ? 27.071  23.731  116.392  1.00 38.11  ?  200  TRP B CD2   1 
ATOM   3343  N  NE1   . TRP B  1  200  ? 25.667  24.934  115.127  1.00 40.42  ?  200  TRP B NE1   1 
ATOM   3344  C  CE2   . TRP B  1  200  ? 26.791  24.152  115.077  1.00 36.29  ?  200  TRP B CE2   1 
ATOM   3345  C  CE3   . TRP B  1  200  ? 28.182  22.912  116.616  1.00 34.04  ?  200  TRP B CE3   1 
ATOM   3346  C  CZ2   . TRP B  1  200  ? 27.581  23.783  113.992  1.00 32.71  ?  200  TRP B CZ2   1 
ATOM   3347  C  CZ3   . TRP B  1  200  ? 28.965  22.548  115.538  1.00 35.68  ?  200  TRP B CZ3   1 
ATOM   3348  C  CH2   . TRP B  1  200  ? 28.662  22.984  114.242  1.00 38.00  ?  200  TRP B CH2   1 
ATOM   3349  N  N     . THR B  1  201  ? 25.897  25.916  121.642  1.00 44.56  ?  201  THR B N     1 
ATOM   3350  C  CA    . THR B  1  201  ? 25.416  25.864  123.020  1.00 36.98  ?  201  THR B CA    1 
ATOM   3351  C  C     . THR B  1  201  ? 23.934  26.217  123.103  1.00 44.32  ?  201  THR B C     1 
ATOM   3352  O  O     . THR B  1  201  ? 23.304  26.509  122.086  1.00 52.65  ?  201  THR B O     1 
ATOM   3353  C  CB    . THR B  1  201  ? 26.200  26.817  123.933  1.00 37.35  ?  201  THR B CB    1 
ATOM   3354  O  OG1   . THR B  1  201  ? 25.931  28.173  123.557  1.00 45.55  ?  201  THR B OG1   1 
ATOM   3355  C  CG2   . THR B  1  201  ? 27.693  26.549  123.829  1.00 42.63  ?  201  THR B CG2   1 
ATOM   3356  N  N     . ASP B  1  202  ? 23.383  26.197  124.315  1.00 45.55  ?  202  ASP B N     1 
ATOM   3357  C  CA    . ASP B  1  202  ? 21.957  26.467  124.510  1.00 53.21  ?  202  ASP B CA    1 
ATOM   3358  C  C     . ASP B  1  202  ? 21.648  27.927  124.847  1.00 49.98  ?  202  ASP B C     1 
ATOM   3359  O  O     . ASP B  1  202  ? 20.485  28.298  125.009  1.00 47.56  ?  202  ASP B O     1 
ATOM   3360  C  CB    . ASP B  1  202  ? 21.347  25.531  125.566  1.00 49.29  ?  202  ASP B CB    1 
ATOM   3361  C  CG    . ASP B  1  202  ? 22.045  25.620  126.915  1.00 47.17  ?  202  ASP B CG    1 
ATOM   3362  O  OD1   . ASP B  1  202  ? 22.805  26.583  127.148  1.00 48.10  ?  202  ASP B OD1   1 
ATOM   3363  O  OD2   . ASP B  1  202  ? 21.822  24.720  127.754  1.00 44.33  ?  202  ASP B OD2   1 
ATOM   3364  N  N     . GLY B  1  203  ? 22.689  28.747  124.955  1.00 45.85  ?  203  GLY B N     1 
ATOM   3365  C  CA    . GLY B  1  203  ? 22.511  30.161  125.226  1.00 51.37  ?  203  GLY B CA    1 
ATOM   3366  C  C     . GLY B  1  203  ? 22.774  30.552  126.669  1.00 55.30  ?  203  GLY B C     1 
ATOM   3367  O  O     . GLY B  1  203  ? 23.008  31.724  126.966  1.00 57.24  ?  203  GLY B O     1 
ATOM   3368  N  N     . SER B  1  204  ? 22.726  29.575  127.569  1.00 59.41  ?  204  SER B N     1 
ATOM   3369  C  CA    . SER B  1  204  ? 23.036  29.819  128.973  1.00 50.75  ?  204  SER B CA    1 
ATOM   3370  C  C     . SER B  1  204  ? 24.517  30.144  129.121  1.00 48.85  ?  204  SER B C     1 
ATOM   3371  O  O     . SER B  1  204  ? 24.909  30.958  129.957  1.00 49.59  ?  204  SER B O     1 
ATOM   3372  C  CB    . SER B  1  204  ? 22.668  28.604  129.828  1.00 41.13  ?  204  SER B CB    1 
ATOM   3373  O  OG    . SER B  1  204  ? 23.396  27.456  129.428  1.00 43.02  ?  204  SER B OG    1 
ATOM   3374  N  N     . VAL B  1  205  ? 25.333  29.494  128.298  1.00 48.82  ?  205  VAL B N     1 
ATOM   3375  C  CA    . VAL B  1  205  ? 26.764  29.756  128.250  1.00 44.69  ?  205  VAL B CA    1 
ATOM   3376  C  C     . VAL B  1  205  ? 27.169  30.025  126.806  1.00 48.78  ?  205  VAL B C     1 
ATOM   3377  O  O     . VAL B  1  205  ? 26.872  29.230  125.918  1.00 50.41  ?  205  VAL B O     1 
ATOM   3378  C  CB    . VAL B  1  205  ? 27.577  28.559  128.778  1.00 38.61  ?  205  VAL B CB    1 
ATOM   3379  C  CG1   . VAL B  1  205  ? 29.067  28.848  128.694  1.00 42.01  ?  205  VAL B CG1   1 
ATOM   3380  C  CG2   . VAL B  1  205  ? 27.173  28.225  130.206  1.00 44.49  ?  205  VAL B CG2   1 
ATOM   3381  N  N     . THR B  1  206  ? 27.838  31.149  126.569  1.00 51.12  ?  206  THR B N     1 
ATOM   3382  C  CA    . THR B  1  206  ? 28.303  31.478  125.226  1.00 50.72  ?  206  THR B CA    1 
ATOM   3383  C  C     . THR B  1  206  ? 29.478  30.577  124.847  1.00 51.90  ?  206  THR B C     1 
ATOM   3384  O  O     . THR B  1  206  ? 30.270  30.198  125.712  1.00 49.38  ?  206  THR B O     1 
ATOM   3385  C  CB    . THR B  1  206  ? 28.723  32.960  125.114  1.00 53.86  ?  206  THR B CB    1 
ATOM   3386  O  OG1   . THR B  1  206  ? 29.921  33.183  125.868  1.00 59.74  ?  206  THR B OG1   1 
ATOM   3387  C  CG2   . THR B  1  206  ? 27.619  33.869  125.629  1.00 46.88  ?  206  THR B CG2   1 
ATOM   3388  N  N     . PRO B  1  207  ? 29.585  30.225  123.553  1.00 46.23  ?  207  PRO B N     1 
ATOM   3389  C  CA    . PRO B  1  207  ? 30.636  29.338  123.040  1.00 40.05  ?  207  PRO B CA    1 
ATOM   3390  C  C     . PRO B  1  207  ? 32.038  29.733  123.497  1.00 44.25  ?  207  PRO B C     1 
ATOM   3391  O  O     . PRO B  1  207  ? 32.840  28.856  123.827  1.00 47.48  ?  207  PRO B O     1 
ATOM   3392  C  CB    . PRO B  1  207  ? 30.511  29.504  121.525  1.00 39.82  ?  207  PRO B CB    1 
ATOM   3393  C  CG    . PRO B  1  207  ? 29.071  29.784  121.314  1.00 45.60  ?  207  PRO B CG    1 
ATOM   3394  C  CD    . PRO B  1  207  ? 28.633  30.610  122.494  1.00 44.93  ?  207  PRO B CD    1 
ATOM   3395  N  N     . LEU B  1  208  ? 32.326  31.030  123.520  1.00 42.24  ?  208  LEU B N     1 
ATOM   3396  C  CA    . LEU B  1  208  ? 33.633  31.508  123.956  1.00 45.16  ?  208  LEU B CA    1 
ATOM   3397  C  C     . LEU B  1  208  ? 33.880  31.141  125.415  1.00 44.36  ?  208  LEU B C     1 
ATOM   3398  O  O     . LEU B  1  208  ? 34.961  30.667  125.771  1.00 49.27  ?  208  LEU B O     1 
ATOM   3399  C  CB    . LEU B  1  208  ? 33.754  33.021  123.756  1.00 49.24  ?  208  LEU B CB    1 
ATOM   3400  C  CG    . LEU B  1  208  ? 35.077  33.658  124.190  1.00 50.33  ?  208  LEU B CG    1 
ATOM   3401  C  CD1   . LEU B  1  208  ? 36.260  32.955  123.539  1.00 46.89  ?  208  LEU B CD1   1 
ATOM   3402  C  CD2   . LEU B  1  208  ? 35.088  35.144  123.864  1.00 46.45  ?  208  LEU B CD2   1 
ATOM   3403  N  N     . GLU B  1  209  ? 32.869  31.356  126.251  1.00 41.93  ?  209  GLU B N     1 
ATOM   3404  C  CA    . GLU B  1  209  ? 32.955  31.004  127.662  1.00 43.91  ?  209  GLU B CA    1 
ATOM   3405  C  C     . GLU B  1  209  ? 33.181  29.508  127.827  1.00 46.11  ?  209  GLU B C     1 
ATOM   3406  O  O     . GLU B  1  209  ? 33.966  29.079  128.673  1.00 47.48  ?  209  GLU B O     1 
ATOM   3407  C  CB    . GLU B  1  209  ? 31.685  31.428  128.402  1.00 45.28  ?  209  GLU B CB    1 
ATOM   3408  C  CG    . GLU B  1  209  ? 31.536  32.930  128.572  1.00 52.37  ?  209  GLU B CG    1 
ATOM   3409  C  CD    . GLU B  1  209  ? 30.178  33.320  129.124  1.00 57.71  ?  209  GLU B CD    1 
ATOM   3410  O  OE1   . GLU B  1  209  ? 29.983  34.514  129.435  1.00 56.83  ?  209  GLU B OE1   1 
ATOM   3411  O  OE2   . GLU B  1  209  ? 29.304  32.433  129.243  1.00 52.17  ?  209  GLU B OE2   1 
ATOM   3412  N  N     . ALA B  1  210  ? 32.494  28.720  127.005  1.00 43.64  ?  210  ALA B N     1 
ATOM   3413  C  CA    . ALA B  1  210  ? 32.631  27.269  127.036  1.00 39.74  ?  210  ALA B CA    1 
ATOM   3414  C  C     . ALA B  1  210  ? 34.060  26.848  126.713  1.00 37.61  ?  210  ALA B C     1 
ATOM   3415  O  O     . ALA B  1  210  ? 34.657  26.041  127.427  1.00 37.07  ?  210  ALA B O     1 
ATOM   3416  C  CB    . ALA B  1  210  ? 31.655  26.626  126.069  1.00 34.92  ?  210  ALA B CB    1 
ATOM   3417  N  N     . LEU B  1  211  ? 34.603  27.405  125.634  1.00 36.50  ?  211  LEU B N     1 
ATOM   3418  C  CA    . LEU B  1  211  ? 35.972  27.112  125.222  1.00 35.73  ?  211  LEU B CA    1 
ATOM   3419  C  C     . LEU B  1  211  ? 36.972  27.521  126.303  1.00 39.60  ?  211  LEU B C     1 
ATOM   3420  O  O     . LEU B  1  211  ? 37.963  26.823  126.545  1.00 37.21  ?  211  LEU B O     1 
ATOM   3421  C  CB    . LEU B  1  211  ? 36.290  27.810  123.897  1.00 33.97  ?  211  LEU B CB    1 
ATOM   3422  C  CG    . LEU B  1  211  ? 37.701  27.651  123.324  1.00 35.46  ?  211  LEU B CG    1 
ATOM   3423  C  CD1   . LEU B  1  211  ? 38.095  26.184  123.242  1.00 34.45  ?  211  LEU B CD1   1 
ATOM   3424  C  CD2   . LEU B  1  211  ? 37.793  28.306  121.954  1.00 32.12  ?  211  LEU B CD2   1 
ATOM   3425  N  N     . ASN B  1  212  ? 36.701  28.648  126.955  1.00 38.71  ?  212  ASN B N     1 
ATOM   3426  C  CA    . ASN B  1  212  ? 37.558  29.135  128.031  1.00 39.99  ?  212  ASN B CA    1 
ATOM   3427  C  C     . ASN B  1  212  ? 37.553  28.210  129.248  1.00 40.21  ?  212  ASN B C     1 
ATOM   3428  O  O     . ASN B  1  212  ? 38.606  27.912  129.818  1.00 35.19  ?  212  ASN B O     1 
ATOM   3429  C  CB    . ASN B  1  212  ? 37.161  30.556  128.436  1.00 41.56  ?  212  ASN B CB    1 
ATOM   3430  C  CG    . ASN B  1  212  ? 37.397  31.566  127.328  1.00 48.27  ?  212  ASN B CG    1 
ATOM   3431  O  OD1   . ASN B  1  212  ? 38.354  31.452  126.561  1.00 43.86  ?  212  ASN B OD1   1 
ATOM   3432  N  ND2   . ASN B  1  212  ? 36.521  32.559  127.237  1.00 48.39  ?  212  ASN B ND2   1 
ATOM   3433  N  N     . GLN B  1  213  ? 36.364  27.759  129.640  1.00 39.78  ?  213  GLN B N     1 
ATOM   3434  C  CA    . GLN B  1  213  ? 36.238  26.809  130.740  1.00 38.68  ?  213  GLN B CA    1 
ATOM   3435  C  C     . GLN B  1  213  ? 36.923  25.499  130.378  1.00 42.10  ?  213  GLN B C     1 
ATOM   3436  O  O     . GLN B  1  213  ? 37.500  24.831  131.234  1.00 36.80  ?  213  GLN B O     1 
ATOM   3437  C  CB    . GLN B  1  213  ? 34.769  26.550  131.077  1.00 33.33  ?  213  GLN B CB    1 
ATOM   3438  C  CG    . GLN B  1  213  ? 34.021  27.760  131.605  1.00 42.30  ?  213  GLN B CG    1 
ATOM   3439  C  CD    . GLN B  1  213  ? 32.593  27.433  132.000  1.00 39.30  ?  213  GLN B CD    1 
ATOM   3440  O  OE1   . GLN B  1  213  ? 32.337  26.442  132.683  1.00 36.75  ?  213  GLN B OE1   1 
ATOM   3441  N  NE2   . GLN B  1  213  ? 31.653  28.266  131.565  1.00 36.34  ?  213  GLN B NE2   1 
ATOM   3442  N  N     . ALA B  1  214  ? 36.856  25.142  129.099  1.00 43.91  ?  214  ALA B N     1 
ATOM   3443  C  CA    . ALA B  1  214  ? 37.476  23.919  128.607  1.00 37.13  ?  214  ALA B CA    1 
ATOM   3444  C  C     . ALA B  1  214  ? 38.997  23.977  128.723  1.00 34.81  ?  214  ALA B C     1 
ATOM   3445  O  O     . ALA B  1  214  ? 39.619  23.078  129.297  1.00 33.65  ?  214  ALA B O     1 
ATOM   3446  C  CB    . ALA B  1  214  ? 37.061  23.659  127.169  1.00 36.29  ?  214  ALA B CB    1 
ATOM   3447  N  N     . VAL B  1  215  ? 39.594  25.034  128.179  1.00 30.03  ?  215  VAL B N     1 
ATOM   3448  C  CA    . VAL B  1  215  ? 41.043  25.184  128.247  1.00 36.53  ?  215  VAL B CA    1 
ATOM   3449  C  C     . VAL B  1  215  ? 41.506  25.352  129.694  1.00 40.89  ?  215  VAL B C     1 
ATOM   3450  O  O     . VAL B  1  215  ? 42.614  24.942  130.054  1.00 38.89  ?  215  VAL B O     1 
ATOM   3451  C  CB    . VAL B  1  215  ? 41.561  26.345  127.361  1.00 30.16  ?  215  VAL B CB    1 
ATOM   3452  C  CG1   . VAL B  1  215  ? 41.283  26.056  125.897  1.00 41.45  ?  215  VAL B CG1   1 
ATOM   3453  C  CG2   . VAL B  1  215  ? 40.936  27.664  127.768  1.00 36.00  ?  215  VAL B CG2   1 
ATOM   3454  N  N     . GLU B  1  216  ? 40.645  25.938  130.523  1.00 37.57  ?  216  GLU B N     1 
ATOM   3455  C  CA    . GLU B  1  216  ? 40.936  26.076  131.946  1.00 42.60  ?  216  GLU B CA    1 
ATOM   3456  C  C     . GLU B  1  216  ? 40.992  24.709  132.626  1.00 40.30  ?  216  GLU B C     1 
ATOM   3457  O  O     . GLU B  1  216  ? 41.922  24.419  133.381  1.00 41.00  ?  216  GLU B O     1 
ATOM   3458  C  CB    . GLU B  1  216  ? 39.900  26.976  132.628  1.00 41.63  ?  216  GLU B CB    1 
ATOM   3459  C  CG    . GLU B  1  216  ? 40.000  27.020  134.152  1.00 49.90  ?  216  GLU B CG    1 
ATOM   3460  C  CD    . GLU B  1  216  ? 41.286  27.662  134.655  1.00 55.55  ?  216  GLU B CD    1 
ATOM   3461  O  OE1   . GLU B  1  216  ? 41.627  27.452  135.840  1.00 49.21  ?  216  GLU B OE1   1 
ATOM   3462  O  OE2   . GLU B  1  216  ? 41.952  28.378  133.877  1.00 51.40  ?  216  GLU B OE2   1 
ATOM   3463  N  N     . ILE B  1  217  ? 39.994  23.875  132.349  1.00 36.86  ?  217  ILE B N     1 
ATOM   3464  C  CA    . ILE B  1  217  ? 39.945  22.523  132.894  1.00 35.54  ?  217  ILE B CA    1 
ATOM   3465  C  C     . ILE B  1  217  ? 41.149  21.705  132.438  1.00 36.62  ?  217  ILE B C     1 
ATOM   3466  O  O     . ILE B  1  217  ? 41.763  20.989  133.233  1.00 34.68  ?  217  ILE B O     1 
ATOM   3467  C  CB    . ILE B  1  217  ? 38.641  21.800  132.492  1.00 33.08  ?  217  ILE B CB    1 
ATOM   3468  C  CG1   . ILE B  1  217  ? 37.447  22.409  133.229  1.00 32.63  ?  217  ILE B CG1   1 
ATOM   3469  C  CG2   . ILE B  1  217  ? 38.733  20.311  132.793  1.00 28.42  ?  217  ILE B CG2   1 
ATOM   3470  C  CD1   . ILE B  1  217  ? 36.113  21.822  132.820  1.00 30.03  ?  217  ILE B CD1   1 
ATOM   3471  N  N     . LEU B  1  218  ? 41.493  21.823  131.159  1.00 35.17  ?  218  LEU B N     1 
ATOM   3472  C  CA    . LEU B  1  218  ? 42.636  21.093  130.623  1.00 33.40  ?  218  LEU B CA    1 
ATOM   3473  C  C     . LEU B  1  218  ? 43.940  21.539  131.281  1.00 42.81  ?  218  LEU B C     1 
ATOM   3474  O  O     . LEU B  1  218  ? 44.776  20.707  131.641  1.00 42.24  ?  218  LEU B O     1 
ATOM   3475  C  CB    . LEU B  1  218  ? 42.724  21.243  129.104  1.00 31.54  ?  218  LEU B CB    1 
ATOM   3476  C  CG    . LEU B  1  218  ? 43.794  20.369  128.442  1.00 33.46  ?  218  LEU B CG    1 
ATOM   3477  C  CD1   . LEU B  1  218  ? 43.606  18.912  128.830  1.00 32.37  ?  218  LEU B CD1   1 
ATOM   3478  C  CD2   . LEU B  1  218  ? 43.769  20.525  126.933  1.00 38.37  ?  218  LEU B CD2   1 
ATOM   3479  N  N     . ARG B  1  219  ? 44.106  22.849  131.441  1.00 41.48  ?  219  ARG B N     1 
ATOM   3480  C  CA    . ARG B  1  219  ? 45.298  23.390  132.087  1.00 39.45  ?  219  ARG B CA    1 
ATOM   3481  C  C     . ARG B  1  219  ? 45.403  22.905  133.531  1.00 44.43  ?  219  ARG B C     1 
ATOM   3482  O  O     . ARG B  1  219  ? 46.467  22.460  133.978  1.00 45.48  ?  219  ARG B O     1 
ATOM   3483  C  CB    . ARG B  1  219  ? 45.280  24.918  132.056  1.00 41.05  ?  219  ARG B CB    1 
ATOM   3484  C  CG    . ARG B  1  219  ? 46.568  25.557  132.556  1.00 56.86  ?  219  ARG B CG    1 
ATOM   3485  C  CD    . ARG B  1  219  ? 46.344  26.998  132.983  1.00 56.75  ?  219  ARG B CD    1 
ATOM   3486  N  NE    . ARG B  1  219  ? 45.331  27.095  134.030  1.00 51.24  ?  219  ARG B NE    1 
ATOM   3487  C  CZ    . ARG B  1  219  ? 45.556  26.830  135.313  1.00 51.81  ?  219  ARG B CZ    1 
ATOM   3488  N  NH1   . ARG B  1  219  ? 46.762  26.449  135.713  1.00 44.15  ?  219  ARG B NH1   1 
ATOM   3489  N  NH2   . ARG B  1  219  ? 44.573  26.943  136.196  1.00 49.85  ?  219  ARG B NH2   1 
ATOM   3490  N  N     . GLU B  1  220  ? 44.290  22.994  134.253  1.00 39.48  ?  220  GLU B N     1 
ATOM   3491  C  CA    . GLU B  1  220  ? 44.237  22.559  135.642  1.00 43.32  ?  220  GLU B CA    1 
ATOM   3492  C  C     . GLU B  1  220  ? 44.578  21.078  135.761  1.00 44.04  ?  220  GLU B C     1 
ATOM   3493  O  O     . GLU B  1  220  ? 45.257  20.660  136.699  1.00 46.13  ?  220  GLU B O     1 
ATOM   3494  C  CB    . GLU B  1  220  ? 42.859  22.838  136.245  1.00 42.24  ?  220  GLU B CB    1 
ATOM   3495  C  CG    . GLU B  1  220  ? 42.734  22.429  137.704  1.00 49.58  ?  220  GLU B CG    1 
ATOM   3496  C  CD    . GLU B  1  220  ? 41.372  22.747  138.286  1.00 65.26  ?  220  GLU B CD    1 
ATOM   3497  O  OE1   . GLU B  1  220  ? 40.567  23.403  137.591  1.00 69.42  ?  220  GLU B OE1   1 
ATOM   3498  O  OE2   . GLU B  1  220  ? 41.108  22.340  139.438  1.00 65.62  ?  220  GLU B OE2   1 
ATOM   3499  N  N     . HIS B  1  221  ? 44.108  20.288  134.801  1.00 41.69  ?  221  HIS B N     1 
ATOM   3500  C  CA    . HIS B  1  221  ? 44.439  18.870  134.768  1.00 40.88  ?  221  HIS B CA    1 
ATOM   3501  C  C     . HIS B  1  221  ? 45.909  18.656  134.429  1.00 44.66  ?  221  HIS B C     1 
ATOM   3502  O  O     . HIS B  1  221  ? 46.499  17.645  134.809  1.00 40.31  ?  221  HIS B O     1 
ATOM   3503  C  CB    . HIS B  1  221  ? 43.544  18.120  133.780  1.00 38.20  ?  221  HIS B CB    1 
ATOM   3504  C  CG    . HIS B  1  221  ? 42.247  17.664  134.371  1.00 37.83  ?  221  HIS B CG    1 
ATOM   3505  N  ND1   . HIS B  1  221  ? 41.179  18.508  134.563  1.00 35.91  ?  221  HIS B ND1   1 
ATOM   3506  C  CD2   . HIS B  1  221  ? 41.855  16.447  134.825  1.00 37.66  ?  221  HIS B CD2   1 
ATOM   3507  C  CE1   . HIS B  1  221  ? 40.177  17.833  135.105  1.00 40.19  ?  221  HIS B CE1   1 
ATOM   3508  N  NE2   . HIS B  1  221  ? 40.564  16.583  135.273  1.00 35.52  ?  221  HIS B NE2   1 
ATOM   3509  N  N     . LEU B  1  222  ? 46.496  19.610  133.712  1.00 44.89  ?  222  LEU B N     1 
ATOM   3510  C  CA    . LEU B  1  222  ? 47.918  19.552  133.400  1.00 39.59  ?  222  LEU B CA    1 
ATOM   3511  C  C     . LEU B  1  222  ? 48.753  19.877  134.629  1.00 43.27  ?  222  LEU B C     1 
ATOM   3512  O  O     . LEU B  1  222  ? 49.894  19.429  134.752  1.00 49.42  ?  222  LEU B O     1 
ATOM   3513  C  CB    . LEU B  1  222  ? 48.267  20.502  132.256  1.00 38.74  ?  222  LEU B CB    1 
ATOM   3514  C  CG    . LEU B  1  222  ? 47.893  20.011  130.859  1.00 42.46  ?  222  LEU B CG    1 
ATOM   3515  C  CD1   . LEU B  1  222  ? 48.353  21.007  129.810  1.00 41.25  ?  222  LEU B CD1   1 
ATOM   3516  C  CD2   . LEU B  1  222  ? 48.495  18.637  130.608  1.00 42.37  ?  222  LEU B CD2   1 
ATOM   3517  N  N     . THR B  1  223  ? 48.181  20.654  135.544  1.00 48.12  ?  223  THR B N     1 
ATOM   3518  C  CA    . THR B  1  223  ? 48.864  20.963  136.796  1.00 50.93  ?  223  THR B CA    1 
ATOM   3519  C  C     . THR B  1  223  ? 48.889  19.758  137.734  1.00 46.19  ?  223  THR B C     1 
ATOM   3520  O  O     . THR B  1  223  ? 49.548  19.786  138.772  1.00 50.29  ?  223  THR B O     1 
ATOM   3521  C  CB    . THR B  1  223  ? 48.205  22.146  137.532  1.00 45.63  ?  223  THR B CB    1 
ATOM   3522  O  OG1   . THR B  1  223  ? 46.889  21.773  137.960  1.00 47.58  ?  223  THR B OG1   1 
ATOM   3523  C  CG2   . THR B  1  223  ? 48.120  23.362  136.624  1.00 47.61  ?  223  THR B CG2   1 
ATOM   3524  N  N     . TYR B  1  224  ? 48.172  18.701  137.364  1.00 45.62  ?  224  TYR B N     1 
ATOM   3525  C  CA    . TYR B  1  224  ? 48.065  17.516  138.212  1.00 45.33  ?  224  TYR B CA    1 
ATOM   3526  C  C     . TYR B  1  224  ? 49.341  16.678  138.277  1.00 42.34  ?  224  TYR B C     1 
ATOM   3527  O  O     . TYR B  1  224  ? 49.423  15.740  139.069  1.00 39.00  ?  224  TYR B O     1 
ATOM   3528  C  CB    . TYR B  1  224  ? 46.876  16.645  137.798  1.00 45.94  ?  224  TYR B CB    1 
ATOM   3529  C  CG    . TYR B  1  224  ? 45.536  17.198  138.225  1.00 42.39  ?  224  TYR B CG    1 
ATOM   3530  C  CD1   . TYR B  1  224  ? 45.444  18.143  139.237  1.00 41.94  ?  224  TYR B CD1   1 
ATOM   3531  C  CD2   . TYR B  1  224  ? 44.363  16.771  137.618  1.00 48.85  ?  224  TYR B CD2   1 
ATOM   3532  C  CE1   . TYR B  1  224  ? 44.219  18.651  139.631  1.00 48.14  ?  224  TYR B CE1   1 
ATOM   3533  C  CE2   . TYR B  1  224  ? 43.133  17.273  138.004  1.00 45.73  ?  224  TYR B CE2   1 
ATOM   3534  C  CZ    . TYR B  1  224  ? 43.067  18.211  139.012  1.00 47.41  ?  224  TYR B CZ    1 
ATOM   3535  O  OH    . TYR B  1  224  ? 41.845  18.711  139.398  1.00 46.04  ?  224  TYR B OH    1 
ATOM   3536  N  N     . PHE B  1  225  ? 50.332  16.994  137.449  1.00 47.23  ?  225  PHE B N     1 
ATOM   3537  C  CA    . PHE B  1  225  ? 51.641  16.403  137.668  1.00 50.00  ?  225  PHE B CA    1 
ATOM   3538  C  C     . PHE B  1  225  ? 52.481  17.487  138.318  1.00 60.68  ?  225  PHE B C     1 
ATOM   3539  O  O     . PHE B  1  225  ? 52.984  18.386  137.644  1.00 61.74  ?  225  PHE B O     1 
ATOM   3540  C  CB    . PHE B  1  225  ? 52.286  15.998  136.340  1.00 46.34  ?  225  PHE B CB    1 
ATOM   3541  C  CG    . PHE B  1  225  ? 51.367  15.250  135.410  1.00 43.09  ?  225  PHE B CG    1 
ATOM   3542  C  CD1   . PHE B  1  225  ? 51.338  13.865  135.407  1.00 43.42  ?  225  PHE B CD1   1 
ATOM   3543  C  CD2   . PHE B  1  225  ? 50.549  15.933  134.523  1.00 38.96  ?  225  PHE B CD2   1 
ATOM   3544  C  CE1   . PHE B  1  225  ? 50.501  13.175  134.547  1.00 38.85  ?  225  PHE B CE1   1 
ATOM   3545  C  CE2   . PHE B  1  225  ? 49.709  15.248  133.662  1.00 37.18  ?  225  PHE B CE2   1 
ATOM   3546  C  CZ    . PHE B  1  225  ? 49.685  13.868  133.674  1.00 31.29  ?  225  PHE B CZ    1 
ATOM   3547  N  N     . SER B  1  226  ? 52.632  17.394  139.635  1.00 66.94  ?  226  SER B N     1 
ATOM   3548  C  CA    . SER B  1  226  ? 53.481  18.313  140.384  1.00 71.65  ?  226  SER B CA    1 
ATOM   3549  C  C     . SER B  1  226  ? 54.322  17.581  141.420  1.00 72.58  ?  226  SER B C     1 
ATOM   3550  O  O     . SER B  1  226  ? 55.547  17.501  141.317  1.00 74.71  ?  226  SER B O     1 
ATOM   3551  C  CB    . SER B  1  226  ? 52.638  19.399  141.058  1.00 71.50  ?  226  SER B CB    1 
ATOM   3552  O  OG    . SER B  1  226  ? 52.082  20.283  140.099  1.00 62.72  ?  226  SER B OG    1 
ATOM   3553  N  N     . ASN B  1  227  ? 53.629  17.053  142.424  1.00 63.88  ?  227  ASN B N     1 
ATOM   3554  C  CA    . ASN B  1  227  ? 54.255  16.421  143.576  1.00 70.20  ?  227  ASN B CA    1 
ATOM   3555  C  C     . ASN B  1  227  ? 53.930  14.933  143.660  1.00 72.02  ?  227  ASN B C     1 
ATOM   3556  O  O     . ASN B  1  227  ? 52.790  14.558  143.940  1.00 67.44  ?  227  ASN B O     1 
ATOM   3557  C  CB    . ASN B  1  227  ? 53.803  17.128  144.857  1.00 78.23  ?  227  ASN B CB    1 
ATOM   3558  C  CG    . ASN B  1  227  ? 54.427  16.536  146.105  1.00 91.19  ?  227  ASN B CG    1 
ATOM   3559  O  OD1   . ASN B  1  227  ? 53.941  15.542  146.647  1.00 84.26  ?  227  ASN B OD1   1 
ATOM   3560  N  ND2   . ASN B  1  227  ? 55.505  17.153  146.575  1.00 92.80  ?  227  ASN B ND2   1 
ATOM   3561  N  N     . PRO B  1  228  ? 54.934  14.079  143.413  1.00 64.78  ?  228  PRO B N     1 
ATOM   3562  C  CA    . PRO B  1  228  ? 54.780  12.624  143.519  1.00 63.06  ?  228  PRO B CA    1 
ATOM   3563  C  C     . PRO B  1  228  ? 54.432  12.184  144.939  1.00 62.59  ?  228  PRO B C     1 
ATOM   3564  O  O     . PRO B  1  228  ? 54.441  10.983  145.211  1.00 50.99  ?  228  PRO B O     1 
ATOM   3565  C  CB    . PRO B  1  228  ? 56.165  12.099  143.132  1.00 57.49  ?  228  PRO B CB    1 
ATOM   3566  C  CG    . PRO B  1  228  ? 56.754  13.178  142.290  1.00 54.97  ?  228  PRO B CG    1 
ATOM   3567  C  CD    . PRO B  1  228  ? 56.259  14.455  142.893  1.00 58.63  ?  228  PRO B CD    1 
ATOM   3568  N  N     . MET C  2  1    ? 67.294  -16.115 114.391  1.00 86.04  ?  1    MET C N     1 
ATOM   3569  C  CA    . MET C  2  1    ? 66.055  -16.605 114.985  1.00 87.42  ?  1    MET C CA    1 
ATOM   3570  C  C     . MET C  2  1    ? 65.661  -17.963 114.410  1.00 85.63  ?  1    MET C C     1 
ATOM   3571  O  O     . MET C  2  1    ? 66.026  -18.298 113.283  1.00 88.16  ?  1    MET C O     1 
ATOM   3572  C  CB    . MET C  2  1    ? 64.928  -15.589 114.782  1.00 84.06  ?  1    MET C CB    1 
ATOM   3573  C  CG    . MET C  2  1    ? 64.677  -15.215 113.330  1.00 78.85  ?  1    MET C CG    1 
ATOM   3574  S  SD    . MET C  2  1    ? 63.516  -13.844 113.156  1.00 98.83  ?  1    MET C SD    1 
ATOM   3575  C  CE    . MET C  2  1    ? 64.424  -12.521 113.953  1.00 64.56  ?  1    MET C CE    1 
ATOM   3576  N  N     . GLU C  2  2    ? 64.918  -18.739 115.194  1.00 79.49  ?  2    GLU C N     1 
ATOM   3577  C  CA    . GLU C  2  2    ? 64.489  -20.073 114.784  1.00 78.30  ?  2    GLU C CA    1 
ATOM   3578  C  C     . GLU C  2  2    ? 63.575  -20.014 113.562  1.00 77.50  ?  2    GLU C C     1 
ATOM   3579  O  O     . GLU C  2  2    ? 62.775  -19.089 113.418  1.00 75.66  ?  2    GLU C O     1 
ATOM   3580  C  CB    . GLU C  2  2    ? 63.771  -20.782 115.937  1.00 62.11  ?  2    GLU C CB    1 
ATOM   3581  C  CG    . GLU C  2  2    ? 63.463  -22.251 115.670  1.00 79.80  ?  2    GLU C CG    1 
ATOM   3582  C  CD    . GLU C  2  2    ? 62.500  -22.843 116.682  1.00 93.12  ?  2    GLU C CD    1 
ATOM   3583  O  OE1   . GLU C  2  2    ? 62.810  -23.915 117.246  1.00 97.99  ?  2    GLU C OE1   1 
ATOM   3584  O  OE2   . GLU C  2  2    ? 61.428  -22.244 116.907  1.00 94.35  ?  2    GLU C OE2   1 
ATOM   3585  N  N     . ILE C  2  3    ? 63.704  -21.001 112.680  1.00 70.23  ?  3    ILE C N     1 
ATOM   3586  C  CA    . ILE C  2  3    ? 62.862  -21.088 111.493  1.00 56.48  ?  3    ILE C CA    1 
ATOM   3587  C  C     . ILE C  2  3    ? 62.019  -22.357 111.531  1.00 52.31  ?  3    ILE C C     1 
ATOM   3588  O  O     . ILE C  2  3    ? 62.550  -23.463 111.434  1.00 54.33  ?  3    ILE C O     1 
ATOM   3589  C  CB    . ILE C  2  3    ? 63.707  -21.089 110.206  1.00 46.35  ?  3    ILE C CB    1 
ATOM   3590  C  CG1   . ILE C  2  3    ? 64.543  -19.810 110.116  1.00 53.72  ?  3    ILE C CG1   1 
ATOM   3591  C  CG2   . ILE C  2  3    ? 62.819  -21.235 108.983  1.00 42.65  ?  3    ILE C CG2   1 
ATOM   3592  C  CD1   . ILE C  2  3    ? 65.388  -19.721 108.866  1.00 53.44  ?  3    ILE C CD1   1 
ATOM   3593  N  N     . LYS C  2  4    ? 60.706  -22.204 111.669  1.00 49.07  ?  4    LYS C N     1 
ATOM   3594  C  CA    . LYS C  2  4    ? 59.838  -23.376 111.748  1.00 45.60  ?  4    LYS C CA    1 
ATOM   3595  C  C     . LYS C  2  4    ? 59.344  -23.811 110.372  1.00 52.56  ?  4    LYS C C     1 
ATOM   3596  O  O     . LYS C  2  4    ? 58.787  -23.010 109.622  1.00 52.47  ?  4    LYS C O     1 
ATOM   3597  C  CB    . LYS C  2  4    ? 58.652  -23.127 112.681  1.00 51.16  ?  4    LYS C CB    1 
ATOM   3598  C  CG    . LYS C  2  4    ? 57.819  -24.374 112.951  1.00 53.26  ?  4    LYS C CG    1 
ATOM   3599  C  CD    . LYS C  2  4    ? 56.639  -24.074 113.864  1.00 58.58  ?  4    LYS C CD    1 
ATOM   3600  C  CE    . LYS C  2  4    ? 55.964  -25.355 114.332  1.00 52.79  ?  4    LYS C CE    1 
ATOM   3601  N  NZ    . LYS C  2  4    ? 55.569  -26.226 113.192  1.00 52.93  ?  4    LYS C NZ    1 
ATOM   3602  N  N     . ARG C  2  5    ? 59.545  -25.086 110.054  1.00 55.17  ?  5    ARG C N     1 
ATOM   3603  C  CA    . ARG C  2  5    ? 59.143  -25.634 108.763  1.00 52.14  ?  5    ARG C CA    1 
ATOM   3604  C  C     . ARG C  2  5    ? 57.836  -26.409 108.864  1.00 52.80  ?  5    ARG C C     1 
ATOM   3605  O  O     . ARG C  2  5    ? 57.564  -27.057 109.876  1.00 51.10  ?  5    ARG C O     1 
ATOM   3606  C  CB    . ARG C  2  5    ? 60.235  -26.548 108.204  1.00 55.13  ?  5    ARG C CB    1 
ATOM   3607  C  CG    . ARG C  2  5    ? 61.397  -25.822 107.551  1.00 54.82  ?  5    ARG C CG    1 
ATOM   3608  C  CD    . ARG C  2  5    ? 62.435  -26.811 107.040  1.00 58.95  ?  5    ARG C CD    1 
ATOM   3609  N  NE    . ARG C  2  5    ? 63.104  -26.327 105.836  1.00 60.64  ?  5    ARG C NE    1 
ATOM   3610  C  CZ    . ARG C  2  5    ? 62.666  -26.550 104.600  1.00 60.52  ?  5    ARG C CZ    1 
ATOM   3611  N  NH1   . ARG C  2  5    ? 63.335  -26.072 103.560  1.00 48.34  ?  5    ARG C NH1   1 
ATOM   3612  N  NH2   . ARG C  2  5    ? 61.556  -27.252 104.405  1.00 58.73  ?  5    ARG C NH2   1 
ATOM   3613  N  N     . PHE C  2  6    ? 57.028  -26.336 107.812  1.00 54.66  ?  6    PHE C N     1 
ATOM   3614  C  CA    . PHE C  2  6    ? 55.776  -27.079 107.761  1.00 60.30  ?  6    PHE C CA    1 
ATOM   3615  C  C     . PHE C  2  6    ? 55.772  -28.090 106.616  1.00 68.36  ?  6    PHE C C     1 
ATOM   3616  O  O     . PHE C  2  6    ? 56.721  -28.171 105.834  1.00 65.25  ?  6    PHE C O     1 
ATOM   3617  C  CB    . PHE C  2  6    ? 54.590  -26.123 107.594  1.00 58.44  ?  6    PHE C CB    1 
ATOM   3618  C  CG    . PHE C  2  6    ? 54.410  -25.162 108.738  1.00 57.81  ?  6    PHE C CG    1 
ATOM   3619  C  CD1   . PHE C  2  6    ? 55.057  -23.937 108.742  1.00 48.48  ?  6    PHE C CD1   1 
ATOM   3620  C  CD2   . PHE C  2  6    ? 53.580  -25.479 109.801  1.00 57.90  ?  6    PHE C CD2   1 
ATOM   3621  C  CE1   . PHE C  2  6    ? 54.887  -23.050 109.790  1.00 44.39  ?  6    PHE C CE1   1 
ATOM   3622  C  CE2   . PHE C  2  6    ? 53.407  -24.596 110.852  1.00 51.76  ?  6    PHE C CE2   1 
ATOM   3623  C  CZ    . PHE C  2  6    ? 54.061  -23.380 110.845  1.00 40.00  ?  6    PHE C CZ    1 
ATOM   3624  N  N     . GLY C  2  7    ? 54.692  -28.860 106.534  1.00 67.33  ?  7    GLY C N     1 
ATOM   3625  C  CA    . GLY C  2  7    ? 54.439  -29.756 105.419  1.00 69.93  ?  7    GLY C CA    1 
ATOM   3626  C  C     . GLY C  2  7    ? 54.932  -31.176 105.621  1.00 76.81  ?  7    GLY C C     1 
ATOM   3627  O  O     . GLY C  2  7    ? 55.986  -31.403 106.214  1.00 77.25  ?  7    GLY C O     1 
ATOM   3628  N  N     . ARG C  2  8    ? 54.164  -32.136 105.111  1.00 88.94  ?  8    ARG C N     1 
ATOM   3629  C  CA    . ARG C  2  8    ? 54.515  -33.551 105.219  1.00 92.87  ?  8    ARG C CA    1 
ATOM   3630  C  C     . ARG C  2  8    ? 55.133  -34.157 103.954  1.00 82.59  ?  8    ARG C C     1 
ATOM   3631  O  O     . ARG C  2  8    ? 55.520  -35.325 103.949  1.00 82.82  ?  8    ARG C O     1 
ATOM   3632  C  CB    . ARG C  2  8    ? 53.299  -34.365 105.674  1.00 94.19  ?  8    ARG C CB    1 
ATOM   3633  C  CG    . ARG C  2  8    ? 52.732  -33.894 107.004  1.00 100.17 ?  8    ARG C CG    1 
ATOM   3634  C  CD    . ARG C  2  8    ? 51.583  -34.763 107.480  1.00 119.05 ?  8    ARG C CD    1 
ATOM   3635  N  NE    . ARG C  2  8    ? 51.081  -34.316 108.777  1.00 138.05 ?  8    ARG C NE    1 
ATOM   3636  C  CZ    . ARG C  2  8    ? 50.106  -34.915 109.452  1.00 138.66 ?  8    ARG C CZ    1 
ATOM   3637  N  NH1   . ARG C  2  8    ? 49.517  -35.995 108.954  1.00 134.92 ?  8    ARG C NH1   1 
ATOM   3638  N  NH2   . ARG C  2  8    ? 49.717  -34.435 110.626  1.00 130.62 ?  8    ARG C NH2   1 
ATOM   3639  N  N     . ILE C  2  9    ? 55.227  -33.367 102.889  1.00 84.30  ?  9    ILE C N     1 
ATOM   3640  C  CA    . ILE C  2  9    ? 55.742  -33.871 101.617  1.00 87.26  ?  9    ILE C CA    1 
ATOM   3641  C  C     . ILE C  2  9    ? 57.260  -33.754 101.532  1.00 92.96  ?  9    ILE C C     1 
ATOM   3642  O  O     . ILE C  2  9    ? 57.818  -32.666 101.674  1.00 94.61  ?  9    ILE C O     1 
ATOM   3643  C  CB    . ILE C  2  9    ? 55.106  -33.152 100.408  1.00 82.99  ?  9    ILE C CB    1 
ATOM   3644  C  CG1   . ILE C  2  9    ? 53.592  -33.374 100.389  1.00 79.83  ?  9    ILE C CG1   1 
ATOM   3645  C  CG2   . ILE C  2  9    ? 55.729  -33.637 99.107   1.00 70.98  ?  9    ILE C CG2   1 
ATOM   3646  C  CD1   . ILE C  2  9    ? 52.895  -32.719 99.217   1.00 67.61  ?  9    ILE C CD1   1 
ATOM   3647  N  N     . ARG C  2  10   ? 57.922  -34.882 101.297  1.00 90.57  ?  10   ARG C N     1 
ATOM   3648  C  CA    . ARG C  2  10   ? 59.376  -34.914 101.200  1.00 88.99  ?  10   ARG C CA    1 
ATOM   3649  C  C     . ARG C  2  10   ? 59.827  -34.994 99.744   1.00 88.73  ?  10   ARG C C     1 
ATOM   3650  O  O     . ARG C  2  10   ? 59.585  -35.993 99.065   1.00 81.03  ?  10   ARG C O     1 
ATOM   3651  C  CB    . ARG C  2  10   ? 59.933  -36.098 101.994  1.00 91.70  ?  10   ARG C CB    1 
ATOM   3652  C  CG    . ARG C  2  10   ? 61.450  -36.216 101.973  1.00 91.31  ?  10   ARG C CG    1 
ATOM   3653  C  CD    . ARG C  2  10   ? 61.921  -37.406 102.798  1.00 89.57  ?  10   ARG C CD    1 
ATOM   3654  N  NE    . ARG C  2  10   ? 61.346  -38.664 102.327  1.00 91.40  ?  10   ARG C NE    1 
ATOM   3655  C  CZ    . ARG C  2  10   ? 61.952  -39.496 101.485  1.00 91.92  ?  10   ARG C CZ    1 
ATOM   3656  N  NH1   . ARG C  2  10   ? 61.350  -40.617 101.111  1.00 89.68  ?  10   ARG C NH1   1 
ATOM   3657  N  NH2   . ARG C  2  10   ? 63.160  -39.210 101.019  1.00 91.58  ?  10   ARG C NH2   1 
ATOM   3658  N  N     . GLU C  2  11   ? 60.479  -33.936 99.270   1.00 84.21  ?  11   GLU C N     1 
ATOM   3659  C  CA    . GLU C  2  11   ? 60.992  -33.904 97.904   1.00 76.46  ?  11   GLU C CA    1 
ATOM   3660  C  C     . GLU C  2  11   ? 62.153  -34.875 97.735   1.00 72.33  ?  11   GLU C C     1 
ATOM   3661  O  O     . GLU C  2  11   ? 63.129  -34.829 98.482   1.00 68.04  ?  11   GLU C O     1 
ATOM   3662  C  CB    . GLU C  2  11   ? 61.426  -32.487 97.517   1.00 80.31  ?  11   GLU C CB    1 
ATOM   3663  C  CG    . GLU C  2  11   ? 60.287  -31.592 97.052   1.00 85.37  ?  11   GLU C CG    1 
ATOM   3664  C  CD    . GLU C  2  11   ? 59.978  -30.470 98.026   1.00 88.23  ?  11   GLU C CD    1 
ATOM   3665  O  OE1   . GLU C  2  11   ? 60.862  -30.120 98.836   1.00 92.28  ?  11   GLU C OE1   1 
ATOM   3666  O  OE2   . GLU C  2  11   ? 58.848  -29.937 97.979   1.00 74.74  ?  11   GLU C OE2   1 
ATOM   3667  N  N     . VAL C  2  12   ? 62.036  -35.756 96.747   1.00 74.30  ?  12   VAL C N     1 
ATOM   3668  C  CA    . VAL C  2  12   ? 63.039  -36.789 96.516   1.00 74.98  ?  12   VAL C CA    1 
ATOM   3669  C  C     . VAL C  2  12   ? 64.264  -36.227 95.795   1.00 71.90  ?  12   VAL C C     1 
ATOM   3670  O  O     . VAL C  2  12   ? 65.351  -36.801 95.857   1.00 81.38  ?  12   VAL C O     1 
ATOM   3671  C  CB    . VAL C  2  12   ? 62.450  -37.973 95.717   1.00 70.01  ?  12   VAL C CB    1 
ATOM   3672  C  CG1   . VAL C  2  12   ? 62.375  -37.632 94.238   1.00 66.42  ?  12   VAL C CG1   1 
ATOM   3673  C  CG2   . VAL C  2  12   ? 63.274  -39.234 95.940   1.00 76.95  ?  12   VAL C CG2   1 
ATOM   3674  N  N     . ILE C  2  13   ? 64.082  -35.103 95.110   1.00 64.78  ?  13   ILE C N     1 
ATOM   3675  C  CA    . ILE C  2  13   ? 65.172  -34.467 94.379   1.00 59.32  ?  13   ILE C CA    1 
ATOM   3676  C  C     . ILE C  2  13   ? 65.138  -32.954 94.557   1.00 58.31  ?  13   ILE C C     1 
ATOM   3677  O  O     . ILE C  2  13   ? 64.064  -32.359 94.650   1.00 62.27  ?  13   ILE C O     1 
ATOM   3678  C  CB    . ILE C  2  13   ? 65.118  -34.793 92.869   1.00 63.43  ?  13   ILE C CB    1 
ATOM   3679  C  CG1   . ILE C  2  13   ? 63.738  -34.464 92.297   1.00 64.47  ?  13   ILE C CG1   1 
ATOM   3680  C  CG2   . ILE C  2  13   ? 65.465  -36.253 92.619   1.00 71.34  ?  13   ILE C CG2   1 
ATOM   3681  C  CD1   . ILE C  2  13   ? 63.627  -34.692 90.807   1.00 70.48  ?  13   ILE C CD1   1 
ATOM   3682  N  N     . PRO C  2  14   ? 66.320  -32.324 94.608   1.00 53.12  ?  14   PRO C N     1 
ATOM   3683  C  CA    . PRO C  2  14   ? 66.391  -30.863 94.679   1.00 56.28  ?  14   PRO C CA    1 
ATOM   3684  C  C     . PRO C  2  14   ? 66.113  -30.247 93.315   1.00 55.39  ?  14   PRO C C     1 
ATOM   3685  O  O     . PRO C  2  14   ? 65.888  -30.973 92.346   1.00 55.86  ?  14   PRO C O     1 
ATOM   3686  C  CB    . PRO C  2  14   ? 67.845  -30.609 95.078   1.00 53.44  ?  14   PRO C CB    1 
ATOM   3687  C  CG    . PRO C  2  14   ? 68.585  -31.772 94.521   1.00 49.06  ?  14   PRO C CG    1 
ATOM   3688  C  CD    . PRO C  2  14   ? 67.655  -32.945 94.668   1.00 57.12  ?  14   PRO C CD    1 
ATOM   3689  N  N     . LEU C  2  15   ? 66.127  -28.922 93.240   1.00 53.62  ?  15   LEU C N     1 
ATOM   3690  C  CA    . LEU C  2  15   ? 65.933  -28.245 91.968   1.00 54.55  ?  15   LEU C CA    1 
ATOM   3691  C  C     . LEU C  2  15   ? 67.172  -28.386 91.099   1.00 50.59  ?  15   LEU C C     1 
ATOM   3692  O  O     . LEU C  2  15   ? 68.282  -28.100 91.548   1.00 50.48  ?  15   LEU C O     1 
ATOM   3693  C  CB    . LEU C  2  15   ? 65.623  -26.762 92.177   1.00 57.57  ?  15   LEU C CB    1 
ATOM   3694  C  CG    . LEU C  2  15   ? 64.233  -26.384 92.689   1.00 51.94  ?  15   LEU C CG    1 
ATOM   3695  C  CD1   . LEU C  2  15   ? 64.066  -24.874 92.682   1.00 34.04  ?  15   LEU C CD1   1 
ATOM   3696  C  CD2   . LEU C  2  15   ? 63.155  -27.049 91.851   1.00 54.72  ?  15   LEU C CD2   1 
ATOM   3697  N  N     . PRO C  2  16   ? 66.985  -28.830 89.848   1.00 51.30  ?  16   PRO C N     1 
ATOM   3698  C  CA    . PRO C  2  16   ? 68.079  -28.833 88.873   1.00 50.81  ?  16   PRO C CA    1 
ATOM   3699  C  C     . PRO C  2  16   ? 68.549  -27.402 88.654   1.00 44.28  ?  16   PRO C C     1 
ATOM   3700  O  O     . PRO C  2  16   ? 67.764  -26.483 88.892   1.00 40.62  ?  16   PRO C O     1 
ATOM   3701  C  CB    . PRO C  2  16   ? 67.414  -29.379 87.605   1.00 47.21  ?  16   PRO C CB    1 
ATOM   3702  C  CG    . PRO C  2  16   ? 65.954  -29.134 87.797   1.00 47.59  ?  16   PRO C CG    1 
ATOM   3703  C  CD    . PRO C  2  16   ? 65.720  -29.301 89.263   1.00 49.96  ?  16   PRO C CD    1 
ATOM   3704  N  N     . PRO C  2  17   ? 69.808  -27.212 88.222   1.00 48.62  ?  17   PRO C N     1 
ATOM   3705  C  CA    . PRO C  2  17   ? 70.335  -25.857 88.023   1.00 49.03  ?  17   PRO C CA    1 
ATOM   3706  C  C     . PRO C  2  17   ? 69.429  -25.053 87.098   1.00 56.66  ?  17   PRO C C     1 
ATOM   3707  O  O     . PRO C  2  17   ? 69.080  -25.515 86.014   1.00 56.82  ?  17   PRO C O     1 
ATOM   3708  C  CB    . PRO C  2  17   ? 71.700  -26.099 87.367   1.00 47.81  ?  17   PRO C CB    1 
ATOM   3709  C  CG    . PRO C  2  17   ? 71.654  -27.512 86.862   1.00 52.11  ?  17   PRO C CG    1 
ATOM   3710  C  CD    . PRO C  2  17   ? 70.779  -28.243 87.824   1.00 52.80  ?  17   PRO C CD    1 
ATOM   3711  N  N     . LEU C  2  18   ? 69.050  -23.858 87.534   1.00 50.43  ?  18   LEU C N     1 
ATOM   3712  C  CA    . LEU C  2  18   ? 68.019  -23.094 86.846   1.00 46.97  ?  18   LEU C CA    1 
ATOM   3713  C  C     . LEU C  2  18   ? 68.545  -22.362 85.613   1.00 51.11  ?  18   LEU C C     1 
ATOM   3714  O  O     . LEU C  2  18   ? 67.771  -21.966 84.743   1.00 61.06  ?  18   LEU C O     1 
ATOM   3715  C  CB    . LEU C  2  18   ? 67.348  -22.116 87.814   1.00 44.41  ?  18   LEU C CB    1 
ATOM   3716  C  CG    . LEU C  2  18   ? 66.791  -22.733 89.103   1.00 41.00  ?  18   LEU C CG    1 
ATOM   3717  C  CD1   . LEU C  2  18   ? 66.154  -21.670 89.984   1.00 35.61  ?  18   LEU C CD1   1 
ATOM   3718  C  CD2   . LEU C  2  18   ? 65.798  -23.847 88.797   1.00 44.72  ?  18   LEU C CD2   1 
ATOM   3719  N  N     . THR C  2  19   ? 69.860  -22.186 85.540   1.00 48.30  ?  19   THR C N     1 
ATOM   3720  C  CA    . THR C  2  19   ? 70.472  -21.497 84.407   1.00 46.74  ?  19   THR C CA    1 
ATOM   3721  C  C     . THR C  2  19   ? 70.943  -22.457 83.316   1.00 49.72  ?  19   THR C C     1 
ATOM   3722  O  O     . THR C  2  19   ? 71.567  -22.035 82.342   1.00 51.29  ?  19   THR C O     1 
ATOM   3723  C  CB    . THR C  2  19   ? 71.649  -20.600 84.844   1.00 47.66  ?  19   THR C CB    1 
ATOM   3724  O  OG1   . THR C  2  19   ? 72.627  -21.389 85.531   1.00 51.24  ?  19   THR C OG1   1 
ATOM   3725  C  CG2   . THR C  2  19   ? 71.162  -19.488 85.763   1.00 51.62  ?  19   THR C CG2   1 
ATOM   3726  N  N     . GLU C  2  20   ? 70.653  -23.744 83.489   1.00 45.16  ?  20   GLU C N     1 
ATOM   3727  C  CA    . GLU C  2  20   ? 71.087  -24.767 82.537   1.00 54.48  ?  20   GLU C CA    1 
ATOM   3728  C  C     . GLU C  2  20   ? 70.546  -24.530 81.126   1.00 53.78  ?  20   GLU C C     1 
ATOM   3729  O  O     . GLU C  2  20   ? 71.213  -24.837 80.136   1.00 55.38  ?  20   GLU C O     1 
ATOM   3730  C  CB    . GLU C  2  20   ? 70.680  -26.161 83.019   1.00 49.88  ?  20   GLU C CB    1 
ATOM   3731  C  CG    . GLU C  2  20   ? 69.181  -26.387 83.053   1.00 53.68  ?  20   GLU C CG    1 
ATOM   3732  C  CD    . GLU C  2  20   ? 68.822  -27.840 83.238   1.00 65.22  ?  20   GLU C CD    1 
ATOM   3733  O  OE1   . GLU C  2  20   ? 69.498  -28.693 82.629   1.00 70.97  ?  20   GLU C OE1   1 
ATOM   3734  O  OE2   . GLU C  2  20   ? 67.870  -28.127 83.993   1.00 60.95  ?  20   GLU C OE2   1 
ATOM   3735  N  N     . ILE C  2  21   ? 69.343  -23.965 81.048   1.00 51.04  ?  21   ILE C N     1 
ATOM   3736  C  CA    . ILE C  2  21   ? 68.658  -23.729 79.780   1.00 43.81  ?  21   ILE C CA    1 
ATOM   3737  C  C     . ILE C  2  21   ? 69.436  -22.762 78.889   1.00 41.52  ?  21   ILE C C     1 
ATOM   3738  O  O     . ILE C  2  21   ? 69.181  -22.661 77.689   1.00 49.02  ?  21   ILE C O     1 
ATOM   3739  C  CB    . ILE C  2  21   ? 67.231  -23.185 80.016   1.00 55.02  ?  21   ILE C CB    1 
ATOM   3740  C  CG1   . ILE C  2  21   ? 66.338  -23.439 78.799   1.00 56.99  ?  21   ILE C CG1   1 
ATOM   3741  C  CG2   . ILE C  2  21   ? 67.267  -21.704 80.387   1.00 49.21  ?  21   ILE C CG2   1 
ATOM   3742  C  CD1   . ILE C  2  21   ? 66.111  -24.901 78.519   1.00 56.59  ?  21   ILE C CD1   1 
ATOM   3743  N  N     . GLN C  2  22   ? 70.383  -22.052 79.491   1.00 42.89  ?  22   GLN C N     1 
ATOM   3744  C  CA    . GLN C  2  22   ? 71.260  -21.143 78.766   1.00 48.73  ?  22   GLN C CA    1 
ATOM   3745  C  C     . GLN C  2  22   ? 72.663  -21.737 78.673   1.00 44.59  ?  22   GLN C C     1 
ATOM   3746  O  O     . GLN C  2  22   ? 73.169  -22.008 77.578   1.00 43.61  ?  22   GLN C O     1 
ATOM   3747  C  CB    . GLN C  2  22   ? 71.303  -19.781 79.463   1.00 41.18  ?  22   GLN C CB    1 
ATOM   3748  C  CG    . GLN C  2  22   ? 69.948  -19.100 79.572   1.00 36.58  ?  22   GLN C CG    1 
ATOM   3749  C  CD    . GLN C  2  22   ? 69.470  -18.531 78.251   1.00 36.85  ?  22   GLN C CD    1 
ATOM   3750  O  OE1   . GLN C  2  22   ? 70.261  -18.014 77.463   1.00 36.45  ?  22   GLN C OE1   1 
ATOM   3751  N  NE2   . GLN C  2  22   ? 68.169  -18.625 78.001   1.00 41.01  ?  22   GLN C NE2   1 
ATOM   3752  N  N     . VAL C  2  23   ? 73.280  -21.933 79.836   1.00 47.62  ?  23   VAL C N     1 
ATOM   3753  C  CA    . VAL C  2  23   ? 74.651  -22.426 79.932   1.00 51.04  ?  23   VAL C CA    1 
ATOM   3754  C  C     . VAL C  2  23   ? 74.867  -23.752 79.206   1.00 49.29  ?  23   VAL C C     1 
ATOM   3755  O  O     . VAL C  2  23   ? 75.728  -23.844 78.327   1.00 51.21  ?  23   VAL C O     1 
ATOM   3756  C  CB    . VAL C  2  23   ? 75.100  -22.575 81.403   1.00 55.96  ?  23   VAL C CB    1 
ATOM   3757  C  CG1   . VAL C  2  23   ? 76.598  -22.829 81.477   1.00 59.86  ?  23   VAL C CG1   1 
ATOM   3758  C  CG2   . VAL C  2  23   ? 74.736  -21.331 82.198   1.00 50.00  ?  23   VAL C CG2   1 
ATOM   3759  N  N     . GLU C  2  24   ? 74.087  -24.769 79.566   1.00 45.53  ?  24   GLU C N     1 
ATOM   3760  C  CA    . GLU C  2  24   ? 74.249  -26.091 78.965   1.00 44.06  ?  24   GLU C CA    1 
ATOM   3761  C  C     . GLU C  2  24   ? 74.013  -26.047 77.459   1.00 52.22  ?  24   GLU C C     1 
ATOM   3762  O  O     . GLU C  2  24   ? 74.735  -26.680 76.691   1.00 57.81  ?  24   GLU C O     1 
ATOM   3763  C  CB    . GLU C  2  24   ? 73.318  -27.113 79.620   1.00 40.72  ?  24   GLU C CB    1 
ATOM   3764  C  CG    . GLU C  2  24   ? 73.352  -28.483 78.963   1.00 52.69  ?  24   GLU C CG    1 
ATOM   3765  C  CD    . GLU C  2  24   ? 72.538  -29.513 79.719   1.00 78.24  ?  24   GLU C CD    1 
ATOM   3766  O  OE1   . GLU C  2  24   ? 71.929  -29.152 80.748   1.00 80.14  ?  24   GLU C OE1   1 
ATOM   3767  O  OE2   . GLU C  2  24   ? 72.511  -30.685 79.287   1.00 81.78  ?  24   GLU C OE2   1 
ATOM   3768  N  N     . SER C  2  25   ? 73.008  -25.285 77.044   1.00 51.42  ?  25   SER C N     1 
ATOM   3769  C  CA    . SER C  2  25   ? 72.700  -25.125 75.629   1.00 48.16  ?  25   SER C CA    1 
ATOM   3770  C  C     . SER C  2  25   ? 73.873  -24.544 74.842   1.00 49.00  ?  25   SER C C     1 
ATOM   3771  O  O     . SER C  2  25   ? 74.351  -25.157 73.885   1.00 59.35  ?  25   SER C O     1 
ATOM   3772  C  CB    . SER C  2  25   ? 71.467  -24.237 75.451   1.00 52.91  ?  25   SER C CB    1 
ATOM   3773  O  OG    . SER C  2  25   ? 71.334  -23.818 74.104   1.00 59.03  ?  25   SER C OG    1 
ATOM   3774  N  N     . TYR C  2  26   ? 74.338  -23.366 75.249   1.00 46.14  ?  26   TYR C N     1 
ATOM   3775  C  CA    . TYR C  2  26   ? 75.402  -22.680 74.519   1.00 40.06  ?  26   TYR C CA    1 
ATOM   3776  C  C     . TYR C  2  26   ? 76.711  -23.466 74.564   1.00 50.14  ?  26   TYR C C     1 
ATOM   3777  O  O     . TYR C  2  26   ? 77.474  -23.476 73.594   1.00 55.41  ?  26   TYR C O     1 
ATOM   3778  C  CB    . TYR C  2  26   ? 75.605  -21.267 75.064   1.00 38.93  ?  26   TYR C CB    1 
ATOM   3779  C  CG    . TYR C  2  26   ? 76.399  -20.360 74.152   1.00 40.57  ?  26   TYR C CG    1 
ATOM   3780  C  CD1   . TYR C  2  26   ? 75.851  -19.883 72.968   1.00 38.72  ?  26   TYR C CD1   1 
ATOM   3781  C  CD2   . TYR C  2  26   ? 77.690  -19.968 74.481   1.00 46.97  ?  26   TYR C CD2   1 
ATOM   3782  C  CE1   . TYR C  2  26   ? 76.570  -19.049 72.132   1.00 39.43  ?  26   TYR C CE1   1 
ATOM   3783  C  CE2   . TYR C  2  26   ? 78.416  -19.133 73.653   1.00 44.61  ?  26   TYR C CE2   1 
ATOM   3784  C  CZ    . TYR C  2  26   ? 77.852  -18.677 72.479   1.00 42.64  ?  26   TYR C CZ    1 
ATOM   3785  O  OH    . TYR C  2  26   ? 78.571  -17.847 71.649   1.00 42.38  ?  26   TYR C OH    1 
ATOM   3786  N  N     . ARG C  2  27   ? 76.962  -24.124 75.693   1.00 54.42  ?  27   ARG C N     1 
ATOM   3787  C  CA    . ARG C  2  27   ? 78.134  -24.984 75.837   1.00 56.29  ?  27   ARG C CA    1 
ATOM   3788  C  C     . ARG C  2  27   ? 78.079  -26.151 74.857   1.00 56.39  ?  27   ARG C C     1 
ATOM   3789  O  O     . ARG C  2  27   ? 79.068  -26.464 74.193   1.00 55.61  ?  27   ARG C O     1 
ATOM   3790  C  CB    . ARG C  2  27   ? 78.243  -25.507 77.270   1.00 50.99  ?  27   ARG C CB    1 
ATOM   3791  C  CG    . ARG C  2  27   ? 78.970  -26.834 77.400   1.00 40.75  ?  27   ARG C CG    1 
ATOM   3792  C  CD    . ARG C  2  27   ? 78.957  -27.320 78.837   1.00 49.22  ?  27   ARG C CD    1 
ATOM   3793  N  NE    . ARG C  2  27   ? 78.918  -28.777 78.918   1.00 67.00  ?  27   ARG C NE    1 
ATOM   3794  C  CZ    . ARG C  2  27   ? 77.798  -29.490 78.970   1.00 74.21  ?  27   ARG C CZ    1 
ATOM   3795  N  NH1   . ARG C  2  27   ? 77.853  -30.814 79.043   1.00 76.53  ?  27   ARG C NH1   1 
ATOM   3796  N  NH2   . ARG C  2  27   ? 76.620  -28.880 78.948   1.00 62.14  ?  27   ARG C NH2   1 
ATOM   3797  N  N     . ARG C  2  28   ? 76.914  -26.788 74.773   1.00 58.18  ?  28   ARG C N     1 
ATOM   3798  C  CA    . ARG C  2  28   ? 76.695  -27.880 73.832   1.00 56.86  ?  28   ARG C CA    1 
ATOM   3799  C  C     . ARG C  2  28   ? 76.853  -27.396 72.395   1.00 53.59  ?  28   ARG C C     1 
ATOM   3800  O  O     . ARG C  2  28   ? 77.296  -28.140 71.521   1.00 47.39  ?  28   ARG C O     1 
ATOM   3801  C  CB    . ARG C  2  28   ? 75.307  -28.487 74.036   1.00 54.43  ?  28   ARG C CB    1 
ATOM   3802  C  CG    . ARG C  2  28   ? 75.203  -29.395 75.249   1.00 59.82  ?  28   ARG C CG    1 
ATOM   3803  C  CD    . ARG C  2  28   ? 75.827  -30.751 74.984   1.00 63.86  ?  28   ARG C CD    1 
ATOM   3804  N  NE    . ARG C  2  28   ? 74.993  -31.565 74.104   1.00 75.47  ?  28   ARG C NE    1 
ATOM   3805  C  CZ    . ARG C  2  28   ? 75.162  -31.665 72.790   1.00 77.17  ?  28   ARG C CZ    1 
ATOM   3806  N  NH1   . ARG C  2  28   ? 76.145  -31.005 72.190   1.00 65.50  ?  28   ARG C NH1   1 
ATOM   3807  N  NH2   . ARG C  2  28   ? 74.350  -32.431 72.074   1.00 82.09  ?  28   ARG C NH2   1 
ATOM   3808  N  N     . ALA C  2  29   ? 76.490  -26.139 72.161   1.00 59.74  ?  29   ALA C N     1 
ATOM   3809  C  CA    . ALA C  2  29   ? 76.631  -25.539 70.841   1.00 59.07  ?  29   ALA C CA    1 
ATOM   3810  C  C     . ALA C  2  29   ? 78.097  -25.348 70.464   1.00 55.33  ?  29   ALA C C     1 
ATOM   3811  O  O     . ALA C  2  29   ? 78.515  -25.728 69.371   1.00 59.27  ?  29   ALA C O     1 
ATOM   3812  C  CB    . ALA C  2  29   ? 75.888  -24.211 70.776   1.00 56.03  ?  29   ALA C CB    1 
ATOM   3813  N  N     . LEU C  2  30   ? 78.874  -24.757 71.366   1.00 55.42  ?  30   LEU C N     1 
ATOM   3814  C  CA    . LEU C  2  30   ? 80.276  -24.451 71.074   1.00 53.13  ?  30   LEU C CA    1 
ATOM   3815  C  C     . LEU C  2  30   ? 81.216  -25.654 71.171   1.00 66.69  ?  30   LEU C C     1 
ATOM   3816  O  O     . LEU C  2  30   ? 82.047  -25.866 70.286   1.00 67.32  ?  30   LEU C O     1 
ATOM   3817  C  CB    . LEU C  2  30   ? 80.784  -23.313 71.964   1.00 52.16  ?  30   LEU C CB    1 
ATOM   3818  C  CG    . LEU C  2  30   ? 80.139  -21.940 71.751   1.00 50.37  ?  30   LEU C CG    1 
ATOM   3819  C  CD1   . LEU C  2  30   ? 81.086  -20.833 72.194   1.00 50.14  ?  30   LEU C CD1   1 
ATOM   3820  C  CD2   . LEU C  2  30   ? 79.721  -21.754 70.301   1.00 53.16  ?  30   LEU C CD2   1 
ATOM   3821  N  N     . GLN C  2  31   ? 81.080  -26.428 72.246   1.00 67.81  ?  31   GLN C N     1 
ATOM   3822  C  CA    . GLN C  2  31   ? 81.938  -27.589 72.497   1.00 67.97  ?  31   GLN C CA    1 
ATOM   3823  C  C     . GLN C  2  31   ? 83.434  -27.270 72.451   1.00 67.61  ?  31   GLN C C     1 
ATOM   3824  O  O     . GLN C  2  31   ? 84.199  -27.953 71.771   1.00 78.05  ?  31   GLN C O     1 
ATOM   3825  C  CB    . GLN C  2  31   ? 81.616  -28.732 71.527   1.00 55.38  ?  31   GLN C CB    1 
ATOM   3826  C  CG    . GLN C  2  31   ? 80.406  -29.563 71.915   1.00 56.41  ?  31   GLN C CG    1 
ATOM   3827  C  CD    . GLN C  2  31   ? 80.185  -30.734 70.978   1.00 57.30  ?  31   GLN C CD    1 
ATOM   3828  O  OE1   . GLN C  2  31   ? 79.860  -31.839 71.413   1.00 52.30  ?  31   GLN C OE1   1 
ATOM   3829  N  NE2   . GLN C  2  31   ? 80.362  -30.496 69.683   1.00 47.76  ?  31   GLN C NE2   1 
ATOM   3830  N  N     . ALA C  2  32   ? 83.850  -26.240 73.182   1.00 64.06  ?  32   ALA C N     1 
ATOM   3831  C  CA    . ALA C  2  32   ? 85.257  -25.855 73.222   1.00 67.34  ?  32   ALA C CA    1 
ATOM   3832  C  C     . ALA C  2  32   ? 86.043  -26.715 74.209   1.00 65.99  ?  32   ALA C C     1 
ATOM   3833  O  O     . ALA C  2  32   ? 87.273  -26.760 74.167   1.00 58.37  ?  32   ALA C O     1 
ATOM   3834  C  CB    . ALA C  2  32   ? 85.396  -24.381 73.570   1.00 58.01  ?  32   ALA C CB    1 
ATOM   3835  N  N     . ASP C  2  33   ? 85.325  -27.401 75.092   1.00 66.73  ?  33   ASP C N     1 
ATOM   3836  C  CA    . ASP C  2  33   ? 85.950  -28.246 76.105   1.00 72.89  ?  33   ASP C CA    1 
ATOM   3837  C  C     . ASP C  2  33   ? 86.139  -29.677 75.615   1.00 75.85  ?  33   ASP C C     1 
ATOM   3838  O  O     . ASP C  2  33   ? 86.550  -30.555 76.375   1.00 75.74  ?  33   ASP C O     1 
ATOM   3839  C  CB    . ASP C  2  33   ? 85.148  -28.225 77.408   1.00 74.84  ?  33   ASP C CB    1 
ATOM   3840  C  CG    . ASP C  2  33   ? 85.304  -26.921 78.166   1.00 74.48  ?  33   ASP C CG    1 
ATOM   3841  O  OD1   . ASP C  2  33   ? 86.322  -26.229 77.954   1.00 76.24  ?  33   ASP C OD1   1 
ATOM   3842  O  OD2   . ASP C  2  33   ? 84.411  -26.590 78.975   1.00 72.29  ?  33   ASP C OD2   1 
ATOM   3843  N  N     . VAL C  2  34   ? 85.826  -29.908 74.345   1.00 70.85  ?  34   VAL C N     1 
ATOM   3844  C  CA    . VAL C  2  34   ? 86.004  -31.224 73.745   1.00 75.34  ?  34   VAL C CA    1 
ATOM   3845  C  C     . VAL C  2  34   ? 87.002  -31.140 72.587   1.00 73.22  ?  34   VAL C C     1 
ATOM   3846  O  O     . VAL C  2  34   ? 87.006  -30.163 71.836   1.00 67.97  ?  34   VAL C O     1 
ATOM   3847  C  CB    . VAL C  2  34   ? 84.638  -31.805 73.280   1.00 69.20  ?  34   VAL C CB    1 
ATOM   3848  C  CG1   . VAL C  2  34   ? 84.745  -32.484 71.919   1.00 66.66  ?  34   VAL C CG1   1 
ATOM   3849  C  CG2   . VAL C  2  34   ? 84.079  -32.760 74.330   1.00 64.66  ?  34   VAL C CG2   1 
ATOM   3850  N  N     . PRO C  2  35   ? 87.861  -32.167 72.447   1.00 67.98  ?  35   PRO C N     1 
ATOM   3851  C  CA    . PRO C  2  35   ? 88.877  -32.206 71.387   1.00 58.33  ?  35   PRO C CA    1 
ATOM   3852  C  C     . PRO C  2  35   ? 88.256  -32.338 69.998   1.00 57.95  ?  35   PRO C C     1 
ATOM   3853  O  O     . PRO C  2  35   ? 87.268  -33.057 69.845   1.00 59.24  ?  35   PRO C O     1 
ATOM   3854  C  CB    . PRO C  2  35   ? 89.698  -33.452 71.735   1.00 61.75  ?  35   PRO C CB    1 
ATOM   3855  C  CG    . PRO C  2  35   ? 88.799  -34.285 72.575   1.00 58.29  ?  35   PRO C CG    1 
ATOM   3856  C  CD    . PRO C  2  35   ? 87.970  -33.320 73.357   1.00 60.76  ?  35   PRO C CD    1 
ATOM   3857  N  N     . PRO C  2  36   ? 88.844  -31.661 68.995   1.00 53.94  ?  36   PRO C N     1 
ATOM   3858  C  CA    . PRO C  2  36   ? 88.310  -31.534 67.632   1.00 60.24  ?  36   PRO C CA    1 
ATOM   3859  C  C     . PRO C  2  36   ? 87.866  -32.855 67.006   1.00 65.20  ?  36   PRO C C     1 
ATOM   3860  O  O     . PRO C  2  36   ? 86.917  -32.864 66.222   1.00 66.18  ?  36   PRO C O     1 
ATOM   3861  C  CB    . PRO C  2  36   ? 89.493  -30.953 66.853   1.00 57.26  ?  36   PRO C CB    1 
ATOM   3862  C  CG    . PRO C  2  36   ? 90.241  -30.167 67.863   1.00 48.28  ?  36   PRO C CG    1 
ATOM   3863  C  CD    . PRO C  2  36   ? 90.122  -30.942 69.148   1.00 57.66  ?  36   PRO C CD    1 
ATOM   3864  N  N     . GLU C  2  37   ? 88.538  -33.950 67.347   1.00 64.81  ?  37   GLU C N     1 
ATOM   3865  C  CA    . GLU C  2  37   ? 88.170  -35.256 66.814   1.00 62.80  ?  37   GLU C CA    1 
ATOM   3866  C  C     . GLU C  2  37   ? 86.944  -35.831 67.521   1.00 56.48  ?  37   GLU C C     1 
ATOM   3867  O  O     . GLU C  2  37   ? 86.267  -36.709 66.987   1.00 61.96  ?  37   GLU C O     1 
ATOM   3868  C  CB    . GLU C  2  37   ? 89.345  -36.237 66.891   1.00 64.12  ?  37   GLU C CB    1 
ATOM   3869  C  CG    . GLU C  2  37   ? 89.946  -36.407 68.280   1.00 70.39  ?  37   GLU C CG    1 
ATOM   3870  C  CD    . GLU C  2  37   ? 91.103  -35.458 68.542   1.00 64.80  ?  37   GLU C CD    1 
ATOM   3871  O  OE1   . GLU C  2  37   ? 91.416  -34.636 67.653   1.00 55.30  ?  37   GLU C OE1   1 
ATOM   3872  O  OE2   . GLU C  2  37   ? 91.702  -35.539 69.636   1.00 56.34  ?  37   GLU C OE2   1 
ATOM   3873  N  N     . LYS C  2  38   ? 86.662  -35.335 68.722   1.00 46.67  ?  38   LYS C N     1 
ATOM   3874  C  CA    . LYS C  2  38   ? 85.508  -35.801 69.485   1.00 61.20  ?  38   LYS C CA    1 
ATOM   3875  C  C     . LYS C  2  38   ? 84.271  -34.916 69.321   1.00 64.02  ?  38   LYS C C     1 
ATOM   3876  O  O     . LYS C  2  38   ? 83.218  -35.207 69.890   1.00 54.20  ?  38   LYS C O     1 
ATOM   3877  C  CB    . LYS C  2  38   ? 85.857  -35.931 70.970   1.00 62.87  ?  38   LYS C CB    1 
ATOM   3878  C  CG    . LYS C  2  38   ? 86.789  -37.083 71.296   1.00 62.15  ?  38   LYS C CG    1 
ATOM   3879  C  CD    . LYS C  2  38   ? 86.877  -37.295 72.799   1.00 60.50  ?  38   LYS C CD    1 
ATOM   3880  C  CE    . LYS C  2  38   ? 87.855  -38.402 73.148   1.00 65.20  ?  38   LYS C CE    1 
ATOM   3881  N  NZ    . LYS C  2  38   ? 87.952  -38.606 74.620   1.00 69.40  ?  38   LYS C NZ    1 
ATOM   3882  N  N     . ARG C  2  39   ? 84.395  -33.845 68.543   1.00 63.49  ?  39   ARG C N     1 
ATOM   3883  C  CA    . ARG C  2  39   ? 83.295  -32.895 68.384   1.00 59.99  ?  39   ARG C CA    1 
ATOM   3884  C  C     . ARG C  2  39   ? 82.115  -33.489 67.615   1.00 70.96  ?  39   ARG C C     1 
ATOM   3885  O  O     . ARG C  2  39   ? 82.266  -33.974 66.494   1.00 77.77  ?  39   ARG C O     1 
ATOM   3886  C  CB    . ARG C  2  39   ? 83.782  -31.606 67.716   1.00 59.87  ?  39   ARG C CB    1 
ATOM   3887  C  CG    . ARG C  2  39   ? 84.529  -30.672 68.656   1.00 56.79  ?  39   ARG C CG    1 
ATOM   3888  C  CD    . ARG C  2  39   ? 85.179  -29.525 67.903   1.00 58.90  ?  39   ARG C CD    1 
ATOM   3889  N  NE    . ARG C  2  39   ? 85.840  -28.582 68.802   1.00 55.02  ?  39   ARG C NE    1 
ATOM   3890  C  CZ    . ARG C  2  39   ? 86.771  -27.713 68.419   1.00 56.22  ?  39   ARG C CZ    1 
ATOM   3891  N  NH1   . ARG C  2  39   ? 87.162  -27.673 67.153   1.00 45.88  ?  39   ARG C NH1   1 
ATOM   3892  N  NH2   . ARG C  2  39   ? 87.318  -26.890 69.304   1.00 54.36  ?  39   ARG C NH2   1 
ATOM   3893  N  N     . GLU C  2  40   ? 80.941  -33.436 68.236   1.00 75.54  ?  40   GLU C N     1 
ATOM   3894  C  CA    . GLU C  2  40   ? 79.715  -34.014 67.687   1.00 72.64  ?  40   GLU C CA    1 
ATOM   3895  C  C     . GLU C  2  40   ? 79.151  -33.200 66.523   1.00 69.39  ?  40   GLU C C     1 
ATOM   3896  O  O     . GLU C  2  40   ? 79.516  -32.043 66.329   1.00 64.40  ?  40   GLU C O     1 
ATOM   3897  C  CB    . GLU C  2  40   ? 78.660  -34.174 68.785   1.00 62.03  ?  40   GLU C CB    1 
ATOM   3898  C  CG    . GLU C  2  40   ? 79.113  -35.003 69.986   1.00 66.02  ?  40   GLU C CG    1 
ATOM   3899  C  CD    . GLU C  2  40   ? 79.355  -36.467 69.650   1.00 84.00  ?  40   GLU C CD    1 
ATOM   3900  O  OE1   . GLU C  2  40   ? 80.421  -36.785 69.080   1.00 83.80  ?  40   GLU C OE1   1 
ATOM   3901  O  OE2   . GLU C  2  40   ? 78.482  -37.304 69.965   1.00 80.29  ?  40   GLU C OE2   1 
ATOM   3902  N  N     . ASN C  2  41   ? 78.250  -33.810 65.757   1.00 66.64  ?  41   ASN C N     1 
ATOM   3903  C  CA    . ASN C  2  41   ? 77.711  -33.183 64.553   1.00 65.63  ?  41   ASN C CA    1 
ATOM   3904  C  C     . ASN C  2  41   ? 76.637  -32.156 64.900   1.00 61.53  ?  41   ASN C C     1 
ATOM   3905  O  O     . ASN C  2  41   ? 76.073  -31.508 64.027   1.00 60.19  ?  41   ASN C O     1 
ATOM   3906  C  CB    . ASN C  2  41   ? 77.142  -34.250 63.612   1.00 75.96  ?  41   ASN C CB    1 
ATOM   3907  C  CG    . ASN C  2  41   ? 76.834  -33.709 62.224   1.00 78.80  ?  41   ASN C CG    1 
ATOM   3908  O  OD1   . ASN C  2  41   ? 77.264  -32.615 61.859   1.00 72.05  ?  41   ASN C OD1   1 
ATOM   3909  N  ND2   . ASN C  2  41   ? 76.086  -34.479 61.442   1.00 83.52  ?  41   ASN C ND2   1 
ATOM   3910  N  N     . VAL C  2  42   ? 76.360  -32.007 66.190   1.00 64.36  ?  42   VAL C N     1 
ATOM   3911  C  CA    . VAL C  2  42   ? 75.392  -31.024 66.655   1.00 46.20  ?  42   VAL C CA    1 
ATOM   3912  C  C     . VAL C  2  42   ? 76.085  -29.703 66.988   1.00 44.07  ?  42   VAL C C     1 
ATOM   3913  O  O     . VAL C  2  42   ? 77.235  -29.687 67.431   1.00 55.27  ?  42   VAL C O     1 
ATOM   3914  C  CB    . VAL C  2  42   ? 74.613  -31.533 67.884   1.00 53.96  ?  42   VAL C CB    1 
ATOM   3915  C  CG1   . VAL C  2  42   ? 73.848  -32.800 67.537   1.00 56.26  ?  42   VAL C CG1   1 
ATOM   3916  C  CG2   . VAL C  2  42   ? 75.558  -31.788 69.046   1.00 61.68  ?  42   VAL C CG2   1 
ATOM   3917  N  N     . GLY C  2  43   ? 75.401  -28.593 66.732   1.00 48.65  ?  43   GLY C N     1 
ATOM   3918  C  CA    . GLY C  2  43   ? 75.942  -27.285 67.057   1.00 56.26  ?  43   GLY C CA    1 
ATOM   3919  C  C     . GLY C  2  43   ? 76.695  -26.641 65.911   1.00 51.85  ?  43   GLY C C     1 
ATOM   3920  O  O     . GLY C  2  43   ? 76.438  -26.939 64.747   1.00 58.30  ?  43   GLY C O     1 
ATOM   3921  N  N     . ILE C  2  44   ? 77.623  -25.749 66.249   1.00 53.90  ?  44   ILE C N     1 
ATOM   3922  C  CA    . ILE C  2  44   ? 78.401  -25.010 65.257   1.00 62.75  ?  44   ILE C CA    1 
ATOM   3923  C  C     . ILE C  2  44   ? 79.126  -25.949 64.289   1.00 66.04  ?  44   ILE C C     1 
ATOM   3924  O  O     . ILE C  2  44   ? 79.287  -25.635 63.106   1.00 66.62  ?  44   ILE C O     1 
ATOM   3925  C  CB    . ILE C  2  44   ? 79.402  -24.038 65.938   1.00 62.08  ?  44   ILE C CB    1 
ATOM   3926  C  CG1   . ILE C  2  44   ? 80.217  -23.268 64.897   1.00 68.39  ?  44   ILE C CG1   1 
ATOM   3927  C  CG2   . ILE C  2  44   ? 80.322  -24.786 66.887   1.00 62.94  ?  44   ILE C CG2   1 
ATOM   3928  C  CD1   . ILE C  2  44   ? 81.280  -22.371 65.500   1.00 62.62  ?  44   ILE C CD1   1 
ATOM   3929  N  N     . GLN C  2  45   ? 79.526  -27.112 64.798   1.00 60.79  ?  45   GLN C N     1 
ATOM   3930  C  CA    . GLN C  2  45   ? 80.176  -28.142 63.995   1.00 66.93  ?  45   GLN C CA    1 
ATOM   3931  C  C     . GLN C  2  45   ? 79.326  -28.515 62.780   1.00 74.52  ?  45   GLN C C     1 
ATOM   3932  O  O     . GLN C  2  45   ? 79.851  -28.686 61.677   1.00 77.19  ?  45   GLN C O     1 
ATOM   3933  C  CB    . GLN C  2  45   ? 80.449  -29.381 64.852   1.00 73.01  ?  45   GLN C CB    1 
ATOM   3934  C  CG    . GLN C  2  45   ? 81.152  -30.520 64.122   1.00 84.03  ?  45   GLN C CG    1 
ATOM   3935  C  CD    . GLN C  2  45   ? 82.666  -30.395 64.143   1.00 71.07  ?  45   GLN C CD    1 
ATOM   3936  O  OE1   . GLN C  2  45   ? 83.212  -29.367 64.544   1.00 64.46  ?  45   GLN C OE1   1 
ATOM   3937  N  NE2   . GLN C  2  45   ? 83.351  -31.451 63.718   1.00 64.25  ?  45   GLN C NE2   1 
ATOM   3938  N  N     . ALA C  2  46   ? 78.015  -28.624 62.990   1.00 66.24  ?  46   ALA C N     1 
ATOM   3939  C  CA    . ALA C  2  46   ? 77.073  -28.918 61.910   1.00 63.33  ?  46   ALA C CA    1 
ATOM   3940  C  C     . ALA C  2  46   ? 77.187  -27.895 60.792   1.00 61.12  ?  46   ALA C C     1 
ATOM   3941  O  O     . ALA C  2  46   ? 77.176  -28.251 59.614   1.00 63.75  ?  46   ALA C O     1 
ATOM   3942  C  CB    . ALA C  2  46   ? 75.648  -28.950 62.436   1.00 71.14  ?  46   ALA C CB    1 
ATOM   3943  N  N     . ALA C  2  47   ? 77.300  -26.624 61.169   1.00 64.41  ?  47   ALA C N     1 
ATOM   3944  C  CA    . ALA C  2  47   ? 77.416  -25.548 60.192   1.00 73.08  ?  47   ALA C CA    1 
ATOM   3945  C  C     . ALA C  2  47   ? 78.655  -25.761 59.335   1.00 69.33  ?  47   ALA C C     1 
ATOM   3946  O  O     . ALA C  2  47   ? 78.657  -25.454 58.145   1.00 65.17  ?  47   ALA C O     1 
ATOM   3947  C  CB    . ALA C  2  47   ? 77.465  -24.193 60.882   1.00 69.73  ?  47   ALA C CB    1 
ATOM   3948  N  N     . PHE C  2  48   ? 79.704  -26.302 59.947   1.00 77.20  ?  48   PHE C N     1 
ATOM   3949  C  CA    . PHE C  2  48   ? 80.939  -26.583 59.227   1.00 70.48  ?  48   PHE C CA    1 
ATOM   3950  C  C     . PHE C  2  48   ? 80.790  -27.830 58.359   1.00 72.12  ?  48   PHE C C     1 
ATOM   3951  O  O     . PHE C  2  48   ? 81.435  -27.951 57.317   1.00 72.59  ?  48   PHE C O     1 
ATOM   3952  C  CB    . PHE C  2  48   ? 82.106  -26.742 60.206   1.00 55.79  ?  48   PHE C CB    1 
ATOM   3953  C  CG    . PHE C  2  48   ? 82.764  -25.440 60.591   1.00 55.13  ?  48   PHE C CG    1 
ATOM   3954  C  CD1   . PHE C  2  48   ? 83.156  -24.528 59.622   1.00 57.66  ?  48   PHE C CD1   1 
ATOM   3955  C  CD2   . PHE C  2  48   ? 82.989  -25.128 61.922   1.00 58.97  ?  48   PHE C CD2   1 
ATOM   3956  C  CE1   . PHE C  2  48   ? 83.764  -23.333 59.976   1.00 49.28  ?  48   PHE C CE1   1 
ATOM   3957  C  CE2   . PHE C  2  48   ? 83.593  -23.936 62.280   1.00 53.05  ?  48   PHE C CE2   1 
ATOM   3958  C  CZ    . PHE C  2  48   ? 83.981  -23.039 61.307   1.00 43.26  ?  48   PHE C CZ    1 
ATOM   3959  N  N     . ARG C  2  49   ? 79.940  -28.756 58.790   1.00 68.12  ?  49   ARG C N     1 
ATOM   3960  C  CA    . ARG C  2  49   ? 79.725  -29.994 58.045   1.00 58.33  ?  49   ARG C CA    1 
ATOM   3961  C  C     . ARG C  2  49   ? 78.745  -29.843 56.882   1.00 72.10  ?  49   ARG C C     1 
ATOM   3962  O  O     . ARG C  2  49   ? 78.864  -30.534 55.871   1.00 81.94  ?  49   ARG C O     1 
ATOM   3963  C  CB    . ARG C  2  49   ? 79.289  -31.122 58.980   1.00 50.81  ?  49   ARG C CB    1 
ATOM   3964  C  CG    . ARG C  2  49   ? 80.391  -31.590 59.913   1.00 62.80  ?  49   ARG C CG    1 
ATOM   3965  C  CD    . ARG C  2  49   ? 80.096  -32.972 60.465   1.00 81.82  ?  49   ARG C CD    1 
ATOM   3966  N  NE    . ARG C  2  49   ? 79.788  -33.923 59.402   1.00 82.96  ?  49   ARG C NE    1 
ATOM   3967  C  CZ    . ARG C  2  49   ? 79.567  -35.217 59.600   1.00 95.52  ?  49   ARG C CZ    1 
ATOM   3968  N  NH1   . ARG C  2  49   ? 79.624  -35.721 60.825   1.00 91.36  ?  49   ARG C NH1   1 
ATOM   3969  N  NH2   . ARG C  2  49   ? 79.292  -36.009 58.574   1.00 110.66 ?  49   ARG C NH2   1 
ATOM   3970  N  N     . GLU C  2  50   ? 77.775  -28.945 57.030   1.00 69.80  ?  50   GLU C N     1 
ATOM   3971  C  CA    . GLU C  2  50   ? 76.796  -28.703 55.976   1.00 67.77  ?  50   GLU C CA    1 
ATOM   3972  C  C     . GLU C  2  50   ? 77.366  -27.845 54.851   1.00 69.47  ?  50   GLU C C     1 
ATOM   3973  O  O     . GLU C  2  50   ? 77.184  -28.153 53.673   1.00 84.17  ?  50   GLU C O     1 
ATOM   3974  C  CB    . GLU C  2  50   ? 75.533  -28.047 56.543   1.00 83.02  ?  50   GLU C CB    1 
ATOM   3975  C  CG    . GLU C  2  50   ? 74.702  -28.956 57.439   1.00 92.71  ?  50   GLU C CG    1 
ATOM   3976  C  CD    . GLU C  2  50   ? 73.409  -28.304 57.903   1.00 83.42  ?  50   GLU C CD    1 
ATOM   3977  O  OE1   . GLU C  2  50   ? 72.607  -28.985 58.578   1.00 73.03  ?  50   GLU C OE1   1 
ATOM   3978  O  OE2   . GLU C  2  50   ? 73.195  -27.113 57.593   1.00 78.96  ?  50   GLU C OE2   1 
ATOM   3979  N  N     . THR C  2  51   ? 78.055  -26.770 55.221   1.00 61.78  ?  51   THR C N     1 
ATOM   3980  C  CA    . THR C  2  51   ? 78.562  -25.805 54.250   1.00 66.96  ?  51   THR C CA    1 
ATOM   3981  C  C     . THR C  2  51   ? 79.738  -26.367 53.450   1.00 77.48  ?  51   THR C C     1 
ATOM   3982  O  O     . THR C  2  51   ? 80.040  -25.895 52.352   1.00 76.17  ?  51   THR C O     1 
ATOM   3983  C  CB    . THR C  2  51   ? 78.982  -24.482 54.939   1.00 66.90  ?  51   THR C CB    1 
ATOM   3984  O  OG1   . THR C  2  51   ? 77.991  -24.103 55.903   1.00 71.77  ?  51   THR C OG1   1 
ATOM   3985  C  CG2   . THR C  2  51   ? 79.141  -23.363 53.918   1.00 65.97  ?  51   THR C CG2   1 
ATOM   3986  N  N     . PHE C  2  52   ? 80.387  -27.392 53.995   1.00 85.49  ?  52   PHE C N     1 
ATOM   3987  C  CA    . PHE C  2  52   ? 81.568  -27.978 53.367   1.00 83.34  ?  52   PHE C CA    1 
ATOM   3988  C  C     . PHE C  2  52   ? 81.299  -29.411 52.901   1.00 83.03  ?  52   PHE C C     1 
ATOM   3989  O  O     . PHE C  2  52   ? 80.447  -30.098 53.466   1.00 78.35  ?  52   PHE C O     1 
ATOM   3990  C  CB    . PHE C  2  52   ? 82.757  -27.933 54.333   1.00 69.67  ?  52   PHE C CB    1 
ATOM   3991  C  CG    . PHE C  2  52   ? 83.314  -26.553 54.543   1.00 67.39  ?  52   PHE C CG    1 
ATOM   3992  C  CD1   . PHE C  2  52   ? 84.270  -26.040 53.683   1.00 71.75  ?  52   PHE C CD1   1 
ATOM   3993  C  CD2   . PHE C  2  52   ? 82.879  -25.766 55.597   1.00 68.88  ?  52   PHE C CD2   1 
ATOM   3994  C  CE1   . PHE C  2  52   ? 84.785  -24.770 53.870   1.00 69.68  ?  52   PHE C CE1   1 
ATOM   3995  C  CE2   . PHE C  2  52   ? 83.390  -24.495 55.789   1.00 68.19  ?  52   PHE C CE2   1 
ATOM   3996  C  CZ    . PHE C  2  52   ? 84.344  -23.997 54.924   1.00 64.10  ?  52   PHE C CZ    1 
ATOM   3997  N  N     . PRO C  2  53   ? 82.023  -29.870 51.863   1.00 84.00  ?  53   PRO C N     1 
ATOM   3998  C  CA    . PRO C  2  53   ? 83.075  -29.165 51.116   1.00 79.06  ?  53   PRO C CA    1 
ATOM   3999  C  C     . PRO C  2  53   ? 82.538  -28.169 50.088   1.00 77.91  ?  53   PRO C C     1 
ATOM   4000  O  O     . PRO C  2  53   ? 81.441  -28.353 49.560   1.00 83.09  ?  53   PRO C O     1 
ATOM   4001  C  CB    . PRO C  2  53   ? 83.828  -30.302 50.403   1.00 82.42  ?  53   PRO C CB    1 
ATOM   4002  C  CG    . PRO C  2  53   ? 83.104  -31.588 50.768   1.00 84.19  ?  53   PRO C CG    1 
ATOM   4003  C  CD    . PRO C  2  53   ? 81.767  -31.201 51.295   1.00 77.69  ?  53   PRO C CD    1 
ATOM   4004  N  N     . ILE C  2  54   ? 83.318  -27.129 49.811   1.00 76.08  ?  54   ILE C N     1 
ATOM   4005  C  CA    . ILE C  2  54   ? 82.965  -26.147 48.792   1.00 84.81  ?  54   ILE C CA    1 
ATOM   4006  C  C     . ILE C  2  54   ? 83.675  -26.467 47.480   1.00 97.44  ?  54   ILE C C     1 
ATOM   4007  O  O     . ILE C  2  54   ? 84.899  -26.364 47.385   1.00 91.71  ?  54   ILE C O     1 
ATOM   4008  C  CB    . ILE C  2  54   ? 83.349  -24.719 49.223   1.00 79.70  ?  54   ILE C CB    1 
ATOM   4009  C  CG1   . ILE C  2  54   ? 82.719  -24.376 50.573   1.00 83.38  ?  54   ILE C CG1   1 
ATOM   4010  C  CG2   . ILE C  2  54   ? 82.932  -23.712 48.161   1.00 79.47  ?  54   ILE C CG2   1 
ATOM   4011  C  CD1   . ILE C  2  54   ? 83.062  -22.987 51.069   1.00 79.57  ?  54   ILE C CD1   1 
ATOM   4012  N  N     . GLU C  2  55   ? 82.902  -26.848 46.469   1.00 101.89 ?  55   GLU C N     1 
ATOM   4013  C  CA    . GLU C  2  55   ? 83.464  -27.222 45.176   1.00 100.61 ?  55   GLU C CA    1 
ATOM   4014  C  C     . GLU C  2  55   ? 82.809  -26.459 44.027   1.00 106.04 ?  55   GLU C C     1 
ATOM   4015  O  O     . GLU C  2  55   ? 81.694  -25.955 44.165   1.00 105.76 ?  55   GLU C O     1 
ATOM   4016  C  CB    . GLU C  2  55   ? 83.337  -28.732 44.960   1.00 91.73  ?  55   GLU C CB    1 
ATOM   4017  C  CG    . GLU C  2  55   ? 82.012  -29.312 45.427   1.00 86.46  ?  55   GLU C CG    1 
ATOM   4018  C  CD    . GLU C  2  55   ? 81.977  -30.824 45.341   1.00 83.40  ?  55   GLU C CD    1 
ATOM   4019  O  OE1   . GLU C  2  55   ? 81.272  -31.452 46.160   1.00 80.90  ?  55   GLU C OE1   1 
ATOM   4020  O  OE2   . GLU C  2  55   ? 82.653  -31.385 44.453   1.00 78.25  ?  55   GLU C OE2   1 
ATOM   4021  N  N     . GLU C  2  56   ? 83.517  -26.382 42.902   1.00 105.14 ?  56   GLU C N     1 
ATOM   4022  C  CA    . GLU C  2  56   ? 83.045  -25.670 41.714   1.00 107.57 ?  56   GLU C CA    1 
ATOM   4023  C  C     . GLU C  2  56   ? 82.737  -24.204 42.007   1.00 103.55 ?  56   GLU C C     1 
ATOM   4024  O  O     . GLU C  2  56   ? 83.280  -23.305 41.363   1.00 98.06  ?  56   GLU C O     1 
ATOM   4025  C  CB    . GLU C  2  56   ? 81.818  -26.362 41.112   1.00 108.28 ?  56   GLU C CB    1 
ATOM   4026  C  CG    . GLU C  2  56   ? 81.291  -25.709 39.845   1.00 108.69 ?  56   GLU C CG    1 
ATOM   4027  C  CD    . GLU C  2  56   ? 79.978  -26.309 39.385   1.00 106.34 ?  56   GLU C CD    1 
ATOM   4028  O  OE1   . GLU C  2  56   ? 79.633  -26.151 38.194   1.00 93.15  ?  56   GLU C OE1   1 
ATOM   4029  O  OE2   . GLU C  2  56   ? 79.287  -26.937 40.216   1.00 108.33 ?  56   GLU C OE2   1 
ATOM   4030  N  N     . GLY C  2  63   ? 91.913  -23.567 43.458   1.00 104.24 ?  63   GLY C N     1 
ATOM   4031  C  CA    . GLY C  2  63   ? 91.633  -24.984 43.611   1.00 100.54 ?  63   GLY C CA    1 
ATOM   4032  C  C     . GLY C  2  63   ? 90.176  -25.312 43.350   1.00 88.31  ?  63   GLY C C     1 
ATOM   4033  O  O     . GLY C  2  63   ? 89.307  -24.448 43.464   1.00 99.35  ?  63   GLY C O     1 
ATOM   4034  N  N     . LEU C  2  64   ? 89.906  -26.564 42.995   1.00 84.82  ?  64   LEU C N     1 
ATOM   4035  C  CA    . LEU C  2  64   ? 88.545  -26.985 42.676   1.00 94.58  ?  64   LEU C CA    1 
ATOM   4036  C  C     . LEU C  2  64   ? 87.741  -27.390 43.911   1.00 92.50  ?  64   LEU C C     1 
ATOM   4037  O  O     . LEU C  2  64   ? 86.514  -27.477 43.854   1.00 97.60  ?  64   LEU C O     1 
ATOM   4038  C  CB    . LEU C  2  64   ? 88.564  -28.132 41.662   1.00 96.85  ?  64   LEU C CB    1 
ATOM   4039  C  CG    . LEU C  2  64   ? 89.228  -27.855 40.310   1.00 95.68  ?  64   LEU C CG    1 
ATOM   4040  C  CD1   . LEU C  2  64   ? 89.167  -29.087 39.418   1.00 85.28  ?  64   LEU C CD1   1 
ATOM   4041  C  CD2   . LEU C  2  64   ? 88.585  -26.660 39.621   1.00 87.47  ?  64   LEU C CD2   1 
ATOM   4042  N  N     . VAL C  2  65   ? 88.429  -27.636 45.024   1.00 88.56  ?  65   VAL C N     1 
ATOM   4043  C  CA    . VAL C  2  65   ? 87.765  -28.064 46.256   1.00 88.09  ?  65   VAL C CA    1 
ATOM   4044  C  C     . VAL C  2  65   ? 88.367  -27.408 47.502   1.00 89.93  ?  65   VAL C C     1 
ATOM   4045  O  O     . VAL C  2  65   ? 89.584  -27.410 47.690   1.00 87.96  ?  65   VAL C O     1 
ATOM   4046  C  CB    . VAL C  2  65   ? 87.812  -29.607 46.423   1.00 79.30  ?  65   VAL C CB    1 
ATOM   4047  C  CG1   . VAL C  2  65   ? 87.369  -30.017 47.821   1.00 63.50  ?  65   VAL C CG1   1 
ATOM   4048  C  CG2   . VAL C  2  65   ? 86.956  -30.296 45.368   1.00 78.70  ?  65   VAL C CG2   1 
ATOM   4049  N  N     . LEU C  2  66   ? 87.505  -26.846 48.346   1.00 92.62  ?  66   LEU C N     1 
ATOM   4050  C  CA    . LEU C  2  66   ? 87.915  -26.340 49.652   1.00 84.87  ?  66   LEU C CA    1 
ATOM   4051  C  C     . LEU C  2  66   ? 87.130  -27.071 50.737   1.00 77.17  ?  66   LEU C C     1 
ATOM   4052  O  O     . LEU C  2  66   ? 85.914  -26.917 50.844   1.00 82.41  ?  66   LEU C O     1 
ATOM   4053  C  CB    . LEU C  2  66   ? 87.688  -24.829 49.748   1.00 78.01  ?  66   LEU C CB    1 
ATOM   4054  C  CG    . LEU C  2  66   ? 88.171  -24.131 51.023   1.00 77.32  ?  66   LEU C CG    1 
ATOM   4055  C  CD1   . LEU C  2  66   ? 89.654  -24.381 51.250   1.00 88.31  ?  66   LEU C CD1   1 
ATOM   4056  C  CD2   . LEU C  2  66   ? 87.887  -22.637 50.956   1.00 83.73  ?  66   LEU C CD2   1 
ATOM   4057  N  N     . ASP C  2  67   ? 87.829  -27.864 51.542   1.00 73.79  ?  67   ASP C N     1 
ATOM   4058  C  CA    . ASP C  2  67   ? 87.172  -28.734 52.513   1.00 78.17  ?  67   ASP C CA    1 
ATOM   4059  C  C     . ASP C  2  67   ? 87.498  -28.341 53.954   1.00 85.94  ?  67   ASP C C     1 
ATOM   4060  O  O     . ASP C  2  67   ? 88.536  -27.735 54.227   1.00 84.48  ?  67   ASP C O     1 
ATOM   4061  C  CB    . ASP C  2  67   ? 87.552  -30.198 52.256   1.00 78.72  ?  67   ASP C CB    1 
ATOM   4062  C  CG    . ASP C  2  67   ? 86.718  -31.173 53.069   1.00 77.74  ?  67   ASP C CG    1 
ATOM   4063  O  OD1   . ASP C  2  67   ? 85.597  -30.805 53.478   1.00 81.37  ?  67   ASP C OD1   1 
ATOM   4064  O  OD2   . ASP C  2  67   ? 87.183  -32.310 53.295   1.00 69.75  ?  67   ASP C OD2   1 
ATOM   4065  N  N     . PHE C  2  68   ? 86.595  -28.685 54.867   1.00 81.21  ?  68   PHE C N     1 
ATOM   4066  C  CA    . PHE C  2  68   ? 86.759  -28.370 56.281   1.00 73.64  ?  68   PHE C CA    1 
ATOM   4067  C  C     . PHE C  2  68   ? 87.425  -29.509 57.044   1.00 70.00  ?  68   PHE C C     1 
ATOM   4068  O  O     . PHE C  2  68   ? 86.932  -30.638 57.052   1.00 59.42  ?  68   PHE C O     1 
ATOM   4069  C  CB    . PHE C  2  68   ? 85.403  -28.038 56.913   1.00 75.71  ?  68   PHE C CB    1 
ATOM   4070  C  CG    . PHE C  2  68   ? 85.449  -27.885 58.409   1.00 72.85  ?  68   PHE C CG    1 
ATOM   4071  C  CD1   . PHE C  2  68   ? 85.928  -26.719 58.986   1.00 66.52  ?  68   PHE C CD1   1 
ATOM   4072  C  CD2   . PHE C  2  68   ? 85.005  -28.905 59.239   1.00 59.66  ?  68   PHE C CD2   1 
ATOM   4073  C  CE1   . PHE C  2  68   ? 85.971  -26.573 60.360   1.00 56.79  ?  68   PHE C CE1   1 
ATOM   4074  C  CE2   . PHE C  2  68   ? 85.045  -28.766 60.614   1.00 60.49  ?  68   PHE C CE2   1 
ATOM   4075  C  CZ    . PHE C  2  68   ? 85.527  -27.597 61.175   1.00 62.49  ?  68   PHE C CZ    1 
ATOM   4076  N  N     . LEU C  2  69   ? 88.547  -29.203 57.687   1.00 66.16  ?  69   LEU C N     1 
ATOM   4077  C  CA    . LEU C  2  69   ? 89.229  -30.181 58.525   1.00 59.31  ?  69   LEU C CA    1 
ATOM   4078  C  C     . LEU C  2  69   ? 88.861  -30.012 59.993   1.00 52.98  ?  69   LEU C C     1 
ATOM   4079  O  O     . LEU C  2  69   ? 88.277  -30.913 60.594   1.00 52.52  ?  69   LEU C O     1 
ATOM   4080  C  CB    . LEU C  2  69   ? 90.744  -30.124 58.332   1.00 68.30  ?  69   LEU C CB    1 
ATOM   4081  C  CG    . LEU C  2  69   ? 91.257  -30.680 57.002   1.00 71.48  ?  69   LEU C CG    1 
ATOM   4082  C  CD1   . LEU C  2  69   ? 92.648  -31.262 57.175   1.00 78.68  ?  69   LEU C CD1   1 
ATOM   4083  C  CD2   . LEU C  2  69   ? 90.307  -31.726 56.430   1.00 66.74  ?  69   LEU C CD2   1 
ATOM   4084  N  N     . GLU C  2  70   ? 89.204  -28.866 60.574   1.00 52.44  ?  70   GLU C N     1 
ATOM   4085  C  CA    . GLU C  2  70   ? 88.848  -28.622 61.976   1.00 55.44  ?  70   GLU C CA    1 
ATOM   4086  C  C     . GLU C  2  70   ? 88.756  -27.134 62.288   1.00 58.17  ?  70   GLU C C     1 
ATOM   4087  O  O     . GLU C  2  70   ? 89.160  -26.318 61.481   1.00 56.94  ?  70   GLU C O     1 
ATOM   4088  C  CB    . GLU C  2  70   ? 89.824  -29.321 62.929   1.00 67.69  ?  70   GLU C CB    1 
ATOM   4089  C  CG    . GLU C  2  70   ? 91.225  -28.732 62.962   1.00 75.03  ?  70   GLU C CG    1 
ATOM   4090  C  CD    . GLU C  2  70   ? 92.124  -29.441 63.960   1.00 76.31  ?  70   GLU C CD    1 
ATOM   4091  O  OE1   . GLU C  2  70   ? 93.044  -28.791 64.502   1.00 75.74  ?  70   GLU C OE1   1 
ATOM   4092  O  OE2   . GLU C  2  70   ? 91.910  -30.649 64.202   1.00 71.98  ?  70   GLU C OE2   1 
ATOM   4093  N  N     . TYR C  2  71   ? 88.180  -26.783 63.434   1.00 56.28  ?  71   TYR C N     1 
ATOM   4094  C  CA    . TYR C  2  71   ? 88.143  -25.387 63.869   1.00 49.28  ?  71   TYR C CA    1 
ATOM   4095  C  C     . TYR C  2  71   ? 88.570  -25.287 65.328   1.00 52.75  ?  71   TYR C C     1 
ATOM   4096  O  O     . TYR C  2  71   ? 88.615  -26.295 66.032   1.00 56.58  ?  71   TYR C O     1 
ATOM   4097  C  CB    . TYR C  2  71   ? 86.737  -24.805 63.711   1.00 57.13  ?  71   TYR C CB    1 
ATOM   4098  C  CG    . TYR C  2  71   ? 85.789  -25.190 64.827   1.00 58.41  ?  71   TYR C CG    1 
ATOM   4099  C  CD1   . TYR C  2  71   ? 85.167  -26.431 64.838   1.00 61.51  ?  71   TYR C CD1   1 
ATOM   4100  C  CD2   . TYR C  2  71   ? 85.516  -24.311 65.870   1.00 50.59  ?  71   TYR C CD2   1 
ATOM   4101  C  CE1   . TYR C  2  71   ? 84.303  -26.788 65.857   1.00 61.46  ?  71   TYR C CE1   1 
ATOM   4102  C  CE2   . TYR C  2  71   ? 84.655  -24.662 66.892   1.00 56.39  ?  71   TYR C CE2   1 
ATOM   4103  C  CZ    . TYR C  2  71   ? 84.051  -25.901 66.880   1.00 60.85  ?  71   TYR C CZ    1 
ATOM   4104  O  OH    . TYR C  2  71   ? 83.190  -26.257 67.895   1.00 65.00  ?  71   TYR C OH    1 
ATOM   4105  N  N     . ARG C  2  72   ? 88.875  -24.076 65.785   1.00 58.14  ?  72   ARG C N     1 
ATOM   4106  C  CA    . ARG C  2  72   ? 89.191  -23.865 67.197   1.00 70.88  ?  72   ARG C CA    1 
ATOM   4107  C  C     . ARG C  2  72   ? 88.753  -22.500 67.731   1.00 76.47  ?  72   ARG C C     1 
ATOM   4108  O  O     . ARG C  2  72   ? 88.782  -21.492 67.018   1.00 75.81  ?  72   ARG C O     1 
ATOM   4109  C  CB    . ARG C  2  72   ? 90.683  -24.092 67.479   1.00 69.56  ?  72   ARG C CB    1 
ATOM   4110  C  CG    . ARG C  2  72   ? 91.621  -23.032 66.916   1.00 58.31  ?  72   ARG C CG    1 
ATOM   4111  C  CD    . ARG C  2  72   ? 93.045  -23.252 67.414   1.00 59.76  ?  72   ARG C CD    1 
ATOM   4112  N  NE    . ARG C  2  72   ? 94.005  -22.354 66.778   1.00 70.94  ?  72   ARG C NE    1 
ATOM   4113  C  CZ    . ARG C  2  72   ? 94.412  -21.200 67.298   1.00 68.05  ?  72   ARG C CZ    1 
ATOM   4114  N  NH1   . ARG C  2  72   ? 93.940  -20.794 68.470   1.00 65.57  ?  72   ARG C NH1   1 
ATOM   4115  N  NH2   . ARG C  2  72   ? 95.290  -20.449 66.645   1.00 63.52  ?  72   ARG C NH2   1 
ATOM   4116  N  N     . LEU C  2  73   ? 88.339  -22.492 68.995   1.00 68.08  ?  73   LEU C N     1 
ATOM   4117  C  CA    . LEU C  2  73   ? 88.038  -21.263 69.715   1.00 53.71  ?  73   LEU C CA    1 
ATOM   4118  C  C     . LEU C  2  73   ? 89.214  -20.926 70.619   1.00 55.81  ?  73   LEU C C     1 
ATOM   4119  O  O     . LEU C  2  73   ? 89.742  -21.796 71.312   1.00 55.53  ?  73   LEU C O     1 
ATOM   4120  C  CB    . LEU C  2  73   ? 86.777  -21.434 70.560   1.00 51.61  ?  73   LEU C CB    1 
ATOM   4121  C  CG    . LEU C  2  73   ? 85.476  -21.682 69.803   1.00 45.84  ?  73   LEU C CG    1 
ATOM   4122  C  CD1   . LEU C  2  73   ? 84.406  -22.198 70.746   1.00 44.25  ?  73   LEU C CD1   1 
ATOM   4123  C  CD2   . LEU C  2  73   ? 85.019  -20.405 69.122   1.00 56.70  ?  73   LEU C CD2   1 
ATOM   4124  N  N     . GLY C  2  74   ? 89.619  -19.663 70.615   1.00 61.60  ?  74   GLY C N     1 
ATOM   4125  C  CA    . GLY C  2  74   ? 90.748  -19.230 71.415   1.00 70.21  ?  74   GLY C CA    1 
ATOM   4126  C  C     . GLY C  2  74   ? 90.343  -18.854 72.825   1.00 70.79  ?  74   GLY C C     1 
ATOM   4127  O  O     . GLY C  2  74   ? 89.394  -19.407 73.383   1.00 63.28  ?  74   GLY C O     1 
ATOM   4128  N  N     . GLU C  2  75   ? 91.078  -17.916 73.409   1.00 72.49  ?  75   GLU C N     1 
ATOM   4129  C  CA    . GLU C  2  75   ? 90.759  -17.411 74.735   1.00 68.13  ?  75   GLU C CA    1 
ATOM   4130  C  C     . GLU C  2  75   ? 90.357  -15.948 74.620   1.00 57.85  ?  75   GLU C C     1 
ATOM   4131  O  O     . GLU C  2  75   ? 90.790  -15.257 73.697   1.00 61.21  ?  75   GLU C O     1 
ATOM   4132  C  CB    . GLU C  2  75   ? 91.960  -17.569 75.669   1.00 65.85  ?  75   GLU C CB    1 
ATOM   4133  C  CG    . GLU C  2  75   ? 92.347  -19.014 75.922   1.00 66.81  ?  75   GLU C CG    1 
ATOM   4134  C  CD    . GLU C  2  75   ? 91.210  -19.821 76.516   1.00 71.12  ?  75   GLU C CD    1 
ATOM   4135  O  OE1   . GLU C  2  75   ? 90.916  -20.916 75.990   1.00 71.86  ?  75   GLU C OE1   1 
ATOM   4136  O  OE2   . GLU C  2  75   ? 90.610  -19.359 77.509   1.00 74.24  ?  75   GLU C OE2   1 
ATOM   4137  N  N     . PRO C  2  76   ? 89.512  -15.474 75.546   1.00 52.77  ?  76   PRO C N     1 
ATOM   4138  C  CA    . PRO C  2  76   ? 89.075  -14.076 75.499   1.00 54.27  ?  76   PRO C CA    1 
ATOM   4139  C  C     . PRO C  2  76   ? 90.254  -13.117 75.618   1.00 51.73  ?  76   PRO C C     1 
ATOM   4140  O  O     . PRO C  2  76   ? 91.059  -13.249 76.538   1.00 55.33  ?  76   PRO C O     1 
ATOM   4141  C  CB    . PRO C  2  76   ? 88.177  -13.953 76.732   1.00 61.23  ?  76   PRO C CB    1 
ATOM   4142  C  CG    . PRO C  2  76   ? 87.688  -15.340 76.981   1.00 59.65  ?  76   PRO C CG    1 
ATOM   4143  C  CD    . PRO C  2  76   ? 88.828  -16.234 76.607   1.00 56.68  ?  76   PRO C CD    1 
ATOM   4144  N  N     . PRO C  2  77   ? 90.352  -12.154 74.690   1.00 54.54  ?  77   PRO C N     1 
ATOM   4145  C  CA    . PRO C  2  77   ? 91.415  -11.144 74.717   1.00 64.11  ?  77   PRO C CA    1 
ATOM   4146  C  C     . PRO C  2  77   ? 91.263  -10.192 75.899   1.00 59.42  ?  77   PRO C C     1 
ATOM   4147  O  O     . PRO C  2  77   ? 92.213  -9.498  76.257   1.00 61.51  ?  77   PRO C O     1 
ATOM   4148  C  CB    . PRO C  2  77   ? 91.218  -10.394 73.395   1.00 64.09  ?  77   PRO C CB    1 
ATOM   4149  C  CG    . PRO C  2  77   ? 89.796  -10.631 73.027   1.00 62.17  ?  77   PRO C CG    1 
ATOM   4150  C  CD    . PRO C  2  77   ? 89.483  -12.012 73.510   1.00 60.22  ?  77   PRO C CD    1 
ATOM   4151  N  N     . PHE C  2  78   ? 90.073  -10.159 76.490   1.00 60.91  ?  78   PHE C N     1 
ATOM   4152  C  CA    . PHE C  2  78   ? 89.813  -9.314  77.649   1.00 64.83  ?  78   PHE C CA    1 
ATOM   4153  C  C     . PHE C  2  78   ? 88.873  -10.017 78.623   1.00 66.54  ?  78   PHE C C     1 
ATOM   4154  O  O     . PHE C  2  78   ? 88.018  -10.799 78.206   1.00 63.09  ?  78   PHE C O     1 
ATOM   4155  C  CB    . PHE C  2  78   ? 89.205  -7.979  77.211   1.00 69.47  ?  78   PHE C CB    1 
ATOM   4156  C  CG    . PHE C  2  78   ? 90.032  -7.235  76.201   1.00 71.99  ?  78   PHE C CG    1 
ATOM   4157  C  CD1   . PHE C  2  78   ? 91.119  -6.476  76.600   1.00 66.24  ?  78   PHE C CD1   1 
ATOM   4158  C  CD2   . PHE C  2  78   ? 89.721  -7.294  74.853   1.00 71.94  ?  78   PHE C CD2   1 
ATOM   4159  C  CE1   . PHE C  2  78   ? 91.881  -5.791  75.674   1.00 61.84  ?  78   PHE C CE1   1 
ATOM   4160  C  CE2   . PHE C  2  78   ? 90.479  -6.610  73.922   1.00 64.20  ?  78   PHE C CE2   1 
ATOM   4161  C  CZ    . PHE C  2  78   ? 91.560  -5.857  74.333   1.00 59.76  ?  78   PHE C CZ    1 
ATOM   4162  N  N     . PRO C  2  79   ? 89.035  -9.748  79.929   1.00 72.77  ?  79   PRO C N     1 
ATOM   4163  C  CA    . PRO C  2  79   ? 88.115  -10.278 80.942   1.00 70.24  ?  79   PRO C CA    1 
ATOM   4164  C  C     . PRO C  2  79   ? 86.746  -9.605  80.854   1.00 68.62  ?  79   PRO C C     1 
ATOM   4165  O  O     . PRO C  2  79   ? 86.622  -8.546  80.238   1.00 66.87  ?  79   PRO C O     1 
ATOM   4166  C  CB    . PRO C  2  79   ? 88.805  -9.925  82.263   1.00 56.95  ?  79   PRO C CB    1 
ATOM   4167  C  CG    . PRO C  2  79   ? 89.670  -8.758  81.937   1.00 62.35  ?  79   PRO C CG    1 
ATOM   4168  C  CD    . PRO C  2  79   ? 90.143  -8.989  80.534   1.00 63.39  ?  79   PRO C CD    1 
ATOM   4169  N  N     . GLN C  2  80   ? 85.738  -10.219 81.464   1.00 55.36  ?  80   GLN C N     1 
ATOM   4170  C  CA    . GLN C  2  80   ? 84.363  -9.735  81.377   1.00 53.39  ?  80   GLN C CA    1 
ATOM   4171  C  C     . GLN C  2  80   ? 84.214  -8.301  81.885   1.00 65.56  ?  80   GLN C C     1 
ATOM   4172  O  O     . GLN C  2  80   ? 83.545  -7.474  81.257   1.00 59.26  ?  80   GLN C O     1 
ATOM   4173  C  CB    . GLN C  2  80   ? 83.435  -10.665 82.156   1.00 41.55  ?  80   GLN C CB    1 
ATOM   4174  C  CG    . GLN C  2  80   ? 83.603  -12.130 81.799   1.00 39.36  ?  80   GLN C CG    1 
ATOM   4175  C  CD    . GLN C  2  80   ? 82.834  -13.046 82.723   1.00 47.68  ?  80   GLN C CD    1 
ATOM   4176  O  OE1   . GLN C  2  80   ? 82.117  -12.588 83.612   1.00 59.52  ?  80   GLN C OE1   1 
ATOM   4177  N  NE2   . GLN C  2  80   ? 82.980  -14.351 82.521   1.00 46.31  ?  80   GLN C NE2   1 
ATOM   4178  N  N     . ASP C  2  81   ? 84.844  -8.017  83.021   1.00 73.34  ?  81   ASP C N     1 
ATOM   4179  C  CA    . ASP C  2  81   ? 84.770  -6.697  83.638   1.00 72.78  ?  81   ASP C CA    1 
ATOM   4180  C  C     . ASP C  2  81   ? 85.296  -5.610  82.708   1.00 67.72  ?  81   ASP C C     1 
ATOM   4181  O  O     . ASP C  2  81   ? 84.690  -4.547  82.576   1.00 65.54  ?  81   ASP C O     1 
ATOM   4182  C  CB    . ASP C  2  81   ? 85.541  -6.677  84.960   1.00 73.84  ?  81   ASP C CB    1 
ATOM   4183  C  CG    . ASP C  2  81   ? 84.961  -7.630  85.988   1.00 96.42  ?  81   ASP C CG    1 
ATOM   4184  O  OD1   . ASP C  2  81   ? 83.765  -7.972  85.876   1.00 93.94  ?  81   ASP C OD1   1 
ATOM   4185  O  OD2   . ASP C  2  81   ? 85.701  -8.034  86.910   1.00 114.23 ?  81   ASP C OD2   1 
ATOM   4186  N  N     . GLU C  2  82   ? 86.422  -5.888  82.059   1.00 69.06  ?  82   GLU C N     1 
ATOM   4187  C  CA    . GLU C  2  82   ? 87.020  -4.941  81.126   1.00 76.50  ?  82   GLU C CA    1 
ATOM   4188  C  C     . GLU C  2  82   ? 86.130  -4.749  79.902   1.00 77.06  ?  82   GLU C C     1 
ATOM   4189  O  O     . GLU C  2  82   ? 86.075  -3.660  79.327   1.00 79.11  ?  82   GLU C O     1 
ATOM   4190  C  CB    . GLU C  2  82   ? 88.416  -5.407  80.705   1.00 85.98  ?  82   GLU C CB    1 
ATOM   4191  C  CG    . GLU C  2  82   ? 89.168  -4.414  79.831   1.00 87.25  ?  82   GLU C CG    1 
ATOM   4192  C  CD    . GLU C  2  82   ? 90.586  -4.858  79.526   1.00 89.65  ?  82   GLU C CD    1 
ATOM   4193  O  OE1   . GLU C  2  82   ? 91.007  -5.912  80.049   1.00 90.08  ?  82   GLU C OE1   1 
ATOM   4194  O  OE2   . GLU C  2  82   ? 91.280  -4.154  78.763   1.00 84.92  ?  82   GLU C OE2   1 
ATOM   4195  N  N     . CYS C  2  83   ? 85.433  -5.810  79.508   1.00 73.20  ?  83   CYS C N     1 
ATOM   4196  C  CA    . CYS C  2  83   ? 84.489  -5.727  78.401   1.00 69.39  ?  83   CYS C CA    1 
ATOM   4197  C  C     . CYS C  2  83   ? 83.344  -4.792  78.763   1.00 71.87  ?  83   CYS C C     1 
ATOM   4198  O  O     . CYS C  2  83   ? 82.946  -3.947  77.960   1.00 70.75  ?  83   CYS C O     1 
ATOM   4199  C  CB    . CYS C  2  83   ? 83.947  -7.110  78.039   1.00 64.55  ?  83   CYS C CB    1 
ATOM   4200  S  SG    . CYS C  2  83   ? 85.165  -8.217  77.297   1.00 78.72  ?  83   CYS C SG    1 
ATOM   4201  N  N     . ARG C  2  84   ? 82.822  -4.944  79.977   1.00 70.74  ?  84   ARG C N     1 
ATOM   4202  C  CA    . ARG C  2  84   ? 81.747  -4.080  80.455   1.00 69.30  ?  84   ARG C CA    1 
ATOM   4203  C  C     . ARG C  2  84   ? 82.216  -2.632  80.590   1.00 71.24  ?  84   ARG C C     1 
ATOM   4204  O  O     . ARG C  2  84   ? 81.446  -1.698  80.366   1.00 68.33  ?  84   ARG C O     1 
ATOM   4205  C  CB    . ARG C  2  84   ? 81.201  -4.581  81.795   1.00 66.93  ?  84   ARG C CB    1 
ATOM   4206  C  CG    . ARG C  2  84   ? 80.535  -5.945  81.732   1.00 58.14  ?  84   ARG C CG    1 
ATOM   4207  C  CD    . ARG C  2  84   ? 79.836  -6.272  83.041   1.00 50.95  ?  84   ARG C CD    1 
ATOM   4208  N  NE    . ARG C  2  84   ? 79.152  -7.561  82.995   1.00 49.54  ?  84   ARG C NE    1 
ATOM   4209  C  CZ    . ARG C  2  84   ? 79.650  -8.690  83.488   1.00 50.92  ?  84   ARG C CZ    1 
ATOM   4210  N  NH1   . ARG C  2  84   ? 80.841  -8.693  84.069   1.00 53.86  ?  84   ARG C NH1   1 
ATOM   4211  N  NH2   . ARG C  2  84   ? 78.957  -9.817  83.401   1.00 49.95  ?  84   ARG C NH2   1 
ATOM   4212  N  N     . GLU C  2  85   ? 83.483  -2.459  80.956   1.00 78.93  ?  85   GLU C N     1 
ATOM   4213  C  CA    . GLU C  2  85   ? 84.068  -1.134  81.140   1.00 79.15  ?  85   GLU C CA    1 
ATOM   4214  C  C     . GLU C  2  85   ? 84.257  -0.386  79.823   1.00 76.99  ?  85   GLU C C     1 
ATOM   4215  O  O     . GLU C  2  85   ? 83.838  0.762   79.684   1.00 81.33  ?  85   GLU C O     1 
ATOM   4216  C  CB    . GLU C  2  85   ? 85.419  -1.245  81.854   1.00 82.31  ?  85   GLU C CB    1 
ATOM   4217  C  CG    . GLU C  2  85   ? 85.330  -1.512  83.347   1.00 86.23  ?  85   GLU C CG    1 
ATOM   4218  C  CD    . GLU C  2  85   ? 85.177  -0.241  84.158   1.00 96.11  ?  85   GLU C CD    1 
ATOM   4219  O  OE1   . GLU C  2  85   ? 85.007  -0.340  85.392   1.00 94.44  ?  85   GLU C OE1   1 
ATOM   4220  O  OE2   . GLU C  2  85   ? 85.233  0.856   83.563   1.00 92.72  ?  85   GLU C OE2   1 
ATOM   4221  N  N     . LYS C  2  86   ? 84.893  -1.048  78.863   1.00 81.12  ?  86   LYS C N     1 
ATOM   4222  C  CA    . LYS C  2  86   ? 85.313  -0.404  77.620   1.00 82.67  ?  86   LYS C CA    1 
ATOM   4223  C  C     . LYS C  2  86   ? 84.273  -0.475  76.502   1.00 78.86  ?  86   LYS C C     1 
ATOM   4224  O  O     . LYS C  2  86   ? 84.559  -0.103  75.363   1.00 72.04  ?  86   LYS C O     1 
ATOM   4225  C  CB    . LYS C  2  86   ? 86.652  -0.978  77.149   1.00 79.42  ?  86   LYS C CB    1 
ATOM   4226  C  CG    . LYS C  2  86   ? 87.790  -0.730  78.125   1.00 82.45  ?  86   LYS C CG    1 
ATOM   4227  C  CD    . LYS C  2  86   ? 89.087  -1.361  77.654   1.00 90.29  ?  86   LYS C CD    1 
ATOM   4228  C  CE    . LYS C  2  86   ? 90.215  -1.081  78.635   1.00 93.12  ?  86   LYS C CE    1 
ATOM   4229  N  NZ    . LYS C  2  86   ? 91.487  -1.736  78.224   1.00 96.41  ?  86   LYS C NZ    1 
ATOM   4230  N  N     . ASP C  2  87   ? 83.085  -0.976  76.834   1.00 79.14  ?  87   ASP C N     1 
ATOM   4231  C  CA    . ASP C  2  87   ? 81.989  -1.128  75.874   1.00 79.26  ?  87   ASP C CA    1 
ATOM   4232  C  C     . ASP C  2  87   ? 82.347  -2.121  74.772   1.00 73.21  ?  87   ASP C C     1 
ATOM   4233  O  O     . ASP C  2  87   ? 81.995  -1.929  73.607   1.00 68.09  ?  87   ASP C O     1 
ATOM   4234  C  CB    . ASP C  2  87   ? 81.568  0.221   75.274   1.00 77.05  ?  87   ASP C CB    1 
ATOM   4235  C  CG    . ASP C  2  87   ? 80.928  1.144   76.296   1.00 77.24  ?  87   ASP C CG    1 
ATOM   4236  O  OD1   . ASP C  2  87   ? 81.139  0.931   77.509   1.00 83.46  ?  87   ASP C OD1   1 
ATOM   4237  O  OD2   . ASP C  2  87   ? 80.216  2.084   75.884   1.00 65.17  ?  87   ASP C OD2   1 
ATOM   4238  N  N     . LEU C  2  88   ? 83.051  -3.182  75.154   1.00 68.22  ?  88   LEU C N     1 
ATOM   4239  C  CA    . LEU C  2  88   ? 83.440  -4.223  74.215   1.00 62.57  ?  88   LEU C CA    1 
ATOM   4240  C  C     . LEU C  2  88   ? 82.522  -5.430  74.346   1.00 54.82  ?  88   LEU C C     1 
ATOM   4241  O  O     . LEU C  2  88   ? 81.624  -5.452  75.185   1.00 62.13  ?  88   LEU C O     1 
ATOM   4242  C  CB    . LEU C  2  88   ? 84.889  -4.648  74.457   1.00 68.86  ?  88   LEU C CB    1 
ATOM   4243  C  CG    . LEU C  2  88   ? 85.962  -3.567  74.312   1.00 73.55  ?  88   LEU C CG    1 
ATOM   4244  C  CD1   . LEU C  2  88   ? 87.332  -4.125  74.666   1.00 68.55  ?  88   LEU C CD1   1 
ATOM   4245  C  CD2   . LEU C  2  88   ? 85.962  -2.990  72.903   1.00 64.65  ?  88   LEU C CD2   1 
ATOM   4246  N  N     . THR C  2  89   ? 82.760  -6.436  73.513   1.00 51.11  ?  89   THR C N     1 
ATOM   4247  C  CA    . THR C  2  89   ? 81.989  -7.669  73.558   1.00 52.94  ?  89   THR C CA    1 
ATOM   4248  C  C     . THR C  2  89   ? 82.864  -8.796  74.091   1.00 47.36  ?  89   THR C C     1 
ATOM   4249  O  O     . THR C  2  89   ? 83.989  -8.984  73.632   1.00 49.37  ?  89   THR C O     1 
ATOM   4250  C  CB    . THR C  2  89   ? 81.448  -8.045  72.161   1.00 49.01  ?  89   THR C CB    1 
ATOM   4251  O  OG1   . THR C  2  89   ? 80.492  -7.065  71.736   1.00 47.00  ?  89   THR C OG1   1 
ATOM   4252  C  CG2   . THR C  2  89   ? 80.783  -9.413  72.185   1.00 45.99  ?  89   THR C CG2   1 
ATOM   4253  N  N     . TYR C  2  90   ? 82.353  -9.543  75.064   1.00 44.74  ?  90   TYR C N     1 
ATOM   4254  C  CA    . TYR C  2  90   ? 83.109  -10.657 75.613   1.00 46.12  ?  90   TYR C CA    1 
ATOM   4255  C  C     . TYR C  2  90   ? 82.999  -11.814 74.634   1.00 55.51  ?  90   TYR C C     1 
ATOM   4256  O  O     . TYR C  2  90   ? 81.908  -12.321 74.371   1.00 55.31  ?  90   TYR C O     1 
ATOM   4257  C  CB    . TYR C  2  90   ? 82.559  -11.049 76.983   1.00 45.08  ?  90   TYR C CB    1 
ATOM   4258  C  CG    . TYR C  2  90   ? 83.376  -12.095 77.705   1.00 44.35  ?  90   TYR C CG    1 
ATOM   4259  C  CD1   . TYR C  2  90   ? 84.628  -11.792 78.221   1.00 48.06  ?  90   TYR C CD1   1 
ATOM   4260  C  CD2   . TYR C  2  90   ? 82.887  -13.383 77.886   1.00 45.60  ?  90   TYR C CD2   1 
ATOM   4261  C  CE1   . TYR C  2  90   ? 85.377  -12.745 78.886   1.00 55.68  ?  90   TYR C CE1   1 
ATOM   4262  C  CE2   . TYR C  2  90   ? 83.625  -14.341 78.553   1.00 46.00  ?  90   TYR C CE2   1 
ATOM   4263  C  CZ    . TYR C  2  90   ? 84.870  -14.018 79.051   1.00 53.72  ?  90   TYR C CZ    1 
ATOM   4264  O  OH    . TYR C  2  90   ? 85.610  -14.969 79.714   1.00 61.26  ?  90   TYR C OH    1 
ATOM   4265  N  N     . GLN C  2  91   ? 84.141  -12.230 74.099   1.00 62.52  ?  91   GLN C N     1 
ATOM   4266  C  CA    . GLN C  2  91   ? 84.157  -13.154 72.976   1.00 61.99  ?  91   GLN C CA    1 
ATOM   4267  C  C     . GLN C  2  91   ? 85.485  -13.890 72.863   1.00 70.01  ?  91   GLN C C     1 
ATOM   4268  O  O     . GLN C  2  91   ? 86.495  -13.462 73.422   1.00 70.69  ?  91   GLN C O     1 
ATOM   4269  C  CB    . GLN C  2  91   ? 83.886  -12.386 71.682   1.00 54.51  ?  91   GLN C CB    1 
ATOM   4270  C  CG    . GLN C  2  91   ? 84.865  -11.249 71.431   1.00 59.22  ?  91   GLN C CG    1 
ATOM   4271  C  CD    . GLN C  2  91   ? 84.407  -10.311 70.330   1.00 63.27  ?  91   GLN C CD    1 
ATOM   4272  O  OE1   . GLN C  2  91   ? 83.363  -10.523 69.713   1.00 69.14  ?  91   GLN C OE1   1 
ATOM   4273  N  NE2   . GLN C  2  91   ? 85.191  -9.268  70.078   1.00 47.23  ?  91   GLN C NE2   1 
ATOM   4274  N  N     . ALA C  2  92   ? 85.474  -14.999 72.131   1.00 71.89  ?  92   ALA C N     1 
ATOM   4275  C  CA    . ALA C  2  92   ? 86.697  -15.717 71.802   1.00 70.38  ?  92   ALA C CA    1 
ATOM   4276  C  C     . ALA C  2  92   ? 86.871  -15.750 70.288   1.00 65.23  ?  92   ALA C C     1 
ATOM   4277  O  O     . ALA C  2  92   ? 85.885  -15.805 69.547   1.00 64.44  ?  92   ALA C O     1 
ATOM   4278  C  CB    . ALA C  2  92   ? 86.659  -17.129 72.368   1.00 61.58  ?  92   ALA C CB    1 
ATOM   4279  N  N     . PRO C  2  93   ? 88.128  -15.703 69.821   1.00 66.48  ?  93   PRO C N     1 
ATOM   4280  C  CA    . PRO C  2  93   ? 88.393  -15.750 68.381   1.00 68.33  ?  93   PRO C CA    1 
ATOM   4281  C  C     . PRO C  2  93   ? 88.014  -17.104 67.795   1.00 69.30  ?  93   PRO C C     1 
ATOM   4282  O  O     . PRO C  2  93   ? 88.014  -18.111 68.505   1.00 59.79  ?  93   PRO C O     1 
ATOM   4283  C  CB    . PRO C  2  93   ? 89.908  -15.538 68.300   1.00 67.74  ?  93   PRO C CB    1 
ATOM   4284  C  CG    . PRO C  2  93   ? 90.424  -15.996 69.619   1.00 69.72  ?  93   PRO C CG    1 
ATOM   4285  C  CD    . PRO C  2  93   ? 89.369  -15.609 70.609   1.00 67.34  ?  93   PRO C CD    1 
ATOM   4286  N  N     . LEU C  2  94   ? 87.684  -17.120 66.509   1.00 69.61  ?  94   LEU C N     1 
ATOM   4287  C  CA    . LEU C  2  94   ? 87.336  -18.361 65.835   1.00 68.63  ?  94   LEU C CA    1 
ATOM   4288  C  C     . LEU C  2  94   ? 88.259  -18.614 64.651   1.00 74.81  ?  94   LEU C C     1 
ATOM   4289  O  O     . LEU C  2  94   ? 88.259  -17.858 63.678   1.00 72.96  ?  94   LEU C O     1 
ATOM   4290  C  CB    . LEU C  2  94   ? 85.881  -18.329 65.372   1.00 57.62  ?  94   LEU C CB    1 
ATOM   4291  C  CG    . LEU C  2  94   ? 85.395  -19.571 64.625   1.00 56.35  ?  94   LEU C CG    1 
ATOM   4292  C  CD1   . LEU C  2  94   ? 85.635  -20.824 65.451   1.00 49.52  ?  94   LEU C CD1   1 
ATOM   4293  C  CD2   . LEU C  2  94   ? 83.926  -19.434 64.274   1.00 54.78  ?  94   LEU C CD2   1 
ATOM   4294  N  N     . TYR C  2  95   ? 89.045  -19.680 64.738   1.00 72.54  ?  95   TYR C N     1 
ATOM   4295  C  CA    . TYR C  2  95   ? 89.934  -20.053 63.648   1.00 69.15  ?  95   TYR C CA    1 
ATOM   4296  C  C     . TYR C  2  95   ? 89.410  -21.302 62.950   1.00 66.86  ?  95   TYR C C     1 
ATOM   4297  O  O     . TYR C  2  95   ? 88.843  -22.191 63.589   1.00 60.72  ?  95   TYR C O     1 
ATOM   4298  C  CB    . TYR C  2  95   ? 91.355  -20.289 64.163   1.00 72.65  ?  95   TYR C CB    1 
ATOM   4299  C  CG    . TYR C  2  95   ? 92.002  -19.072 64.788   1.00 68.76  ?  95   TYR C CG    1 
ATOM   4300  C  CD1   . TYR C  2  95   ? 92.476  -18.030 64.002   1.00 70.61  ?  95   TYR C CD1   1 
ATOM   4301  C  CD2   . TYR C  2  95   ? 92.150  -18.973 66.165   1.00 67.36  ?  95   TYR C CD2   1 
ATOM   4302  C  CE1   . TYR C  2  95   ? 93.074  -16.920 64.571   1.00 71.35  ?  95   TYR C CE1   1 
ATOM   4303  C  CE2   . TYR C  2  95   ? 92.746  -17.868 66.743   1.00 60.58  ?  95   TYR C CE2   1 
ATOM   4304  C  CZ    . TYR C  2  95   ? 93.206  -16.845 65.941   1.00 67.74  ?  95   TYR C CZ    1 
ATOM   4305  O  OH    . TYR C  2  95   ? 93.799  -15.743 66.513   1.00 69.52  ?  95   TYR C OH    1 
ATOM   4306  N  N     . ALA C  2  96   ? 89.599  -21.363 61.637   1.00 58.67  ?  96   ALA C N     1 
ATOM   4307  C  CA    . ALA C  2  96   ? 89.165  -22.515 60.860   1.00 60.24  ?  96   ALA C CA    1 
ATOM   4308  C  C     . ALA C  2  96   ? 90.300  -23.080 60.021   1.00 62.97  ?  96   ALA C C     1 
ATOM   4309  O  O     . ALA C  2  96   ? 90.786  -22.433 59.097   1.00 65.06  ?  96   ALA C O     1 
ATOM   4310  C  CB    . ALA C  2  96   ? 87.995  -22.144 59.973   1.00 65.56  ?  96   ALA C CB    1 
ATOM   4311  N  N     . ARG C  2  97   ? 90.704  -24.301 60.342   1.00 58.96  ?  97   ARG C N     1 
ATOM   4312  C  CA    . ARG C  2  97   ? 91.723  -25.014 59.589   1.00 69.52  ?  97   ARG C CA    1 
ATOM   4313  C  C     . ARG C  2  97   ? 91.102  -25.842 58.466   1.00 69.14  ?  97   ARG C C     1 
ATOM   4314  O  O     . ARG C  2  97   ? 90.394  -26.839 58.705   1.00 57.37  ?  97   ARG C O     1 
ATOM   4315  C  CB    . ARG C  2  97   ? 92.545  -25.910 60.517   1.00 66.76  ?  97   ARG C CB    1 
ATOM   4316  C  CG    . ARG C  2  97   ? 93.602  -26.735 59.808   1.00 66.23  ?  97   ARG C CG    1 
ATOM   4317  C  CD    . ARG C  2  97   ? 94.389  -27.578 60.795   1.00 74.30  ?  97   ARG C CD    1 
ATOM   4318  N  NE    . ARG C  2  97   ? 95.099  -28.667 60.131   1.00 89.77  ?  97   ARG C NE    1 
ATOM   4319  C  CZ    . ARG C  2  97   ? 95.854  -29.562 60.760   1.00 88.16  ?  97   ARG C CZ    1 
ATOM   4320  N  NH1   . ARG C  2  97   ? 96.457  -30.521 60.069   1.00 86.34  ?  97   ARG C NH1   1 
ATOM   4321  N  NH2   . ARG C  2  97   ? 96.005  -29.498 62.077   1.00 81.58  ?  97   ARG C NH2   1 
ATOM   4322  N  N     . LEU C  2  98   ? 91.410  -25.411 57.244   1.00 80.57  ?  98   LEU C N     1 
ATOM   4323  C  CA    . LEU C  2  98   ? 90.881  -25.973 56.013   1.00 86.84  ?  98   LEU C CA    1 
ATOM   4324  C  C     . LEU C  2  98   ? 92.022  -26.323 55.055   1.00 87.83  ?  98   LEU C C     1 
ATOM   4325  O  O     . LEU C  2  98   ? 93.181  -25.906 55.243   1.00 90.11  ?  98   LEU C O     1 
ATOM   4326  C  CB    . LEU C  2  98   ? 89.950  -24.964 55.332   1.00 89.90  ?  98   LEU C CB    1 
ATOM   4327  C  CG    . LEU C  2  98   ? 89.007  -24.134 56.208   1.00 78.65  ?  98   LEU C CG    1 
ATOM   4328  C  CD1   . LEU C  2  98   ? 88.654  -22.821 55.520   1.00 76.87  ?  98   LEU C CD1   1 
ATOM   4329  C  CD2   . LEU C  2  98   ? 87.747  -24.912 56.537   1.00 70.97  ?  98   LEU C CD2   1 
ATOM   4330  N  N     . GLN C  2  99   ? 91.677  -27.094 54.027   1.00 84.68  ?  99   GLN C N     1 
ATOM   4331  C  CA    . GLN C  2  99   ? 92.627  -27.500 53.002   1.00 90.44  ?  99   GLN C CA    1 
ATOM   4332  C  C     . GLN C  2  99   ? 92.087  -27.222 51.603   1.00 89.15  ?  99   GLN C C     1 
ATOM   4333  O  O     . GLN C  2  99   ? 90.913  -27.457 51.316   1.00 91.08  ?  99   GLN C O     1 
ATOM   4334  C  CB    . GLN C  2  99   ? 92.968  -28.986 53.145   1.00 84.94  ?  99   GLN C CB    1 
ATOM   4335  C  CG    . GLN C  2  99   ? 91.769  -29.920 53.056   1.00 73.26  ?  99   GLN C CG    1 
ATOM   4336  C  CD    . GLN C  2  99   ? 92.155  -31.375 53.219   1.00 74.86  ?  99   GLN C CD    1 
ATOM   4337  O  OE1   . GLN C  2  99   ? 91.382  -32.276 52.891   1.00 65.55  ?  99   GLN C OE1   1 
ATOM   4338  N  NE2   . GLN C  2  99   ? 93.357  -31.612 53.730   1.00 78.35  ?  99   GLN C NE2   1 
ATOM   4339  N  N     . LEU C  2  100  ? 92.957  -26.715 50.738   1.00 89.30  ?  100  LEU C N     1 
ATOM   4340  C  CA    . LEU C  2  100  ? 92.614  -26.484 49.344   1.00 85.01  ?  100  LEU C CA    1 
ATOM   4341  C  C     . LEU C  2  100  ? 93.102  -27.660 48.507   1.00 91.04  ?  100  LEU C C     1 
ATOM   4342  O  O     . LEU C  2  100  ? 94.309  -27.897 48.398   1.00 100.37 ?  100  LEU C O     1 
ATOM   4343  C  CB    . LEU C  2  100  ? 93.245  -25.182 48.852   1.00 75.91  ?  100  LEU C CB    1 
ATOM   4344  C  CG    . LEU C  2  100  ? 92.917  -24.765 47.418   1.00 79.39  ?  100  LEU C CG    1 
ATOM   4345  C  CD1   . LEU C  2  100  ? 91.417  -24.601 47.244   1.00 85.11  ?  100  LEU C CD1   1 
ATOM   4346  C  CD2   . LEU C  2  100  ? 93.649  -23.482 47.054   1.00 83.76  ?  100  LEU C CD2   1 
ATOM   4347  N  N     . ILE C  2  101  ? 92.158  -28.401 47.934   1.00 85.46  ?  101  ILE C N     1 
ATOM   4348  C  CA    . ILE C  2  101  ? 92.477  -29.583 47.139   1.00 84.21  ?  101  ILE C CA    1 
ATOM   4349  C  C     . ILE C  2  101  ? 92.157  -29.378 45.660   1.00 94.58  ?  101  ILE C C     1 
ATOM   4350  O  O     . ILE C  2  101  ? 91.042  -29.000 45.302   1.00 101.55 ?  101  ILE C O     1 
ATOM   4351  C  CB    . ILE C  2  101  ? 91.717  -30.831 47.646   1.00 71.69  ?  101  ILE C CB    1 
ATOM   4352  C  CG1   . ILE C  2  101  ? 92.187  -31.212 49.050   1.00 75.10  ?  101  ILE C CG1   1 
ATOM   4353  C  CG2   . ILE C  2  101  ? 91.905  -32.003 46.691   1.00 70.38  ?  101  ILE C CG2   1 
ATOM   4354  C  CD1   . ILE C  2  101  ? 91.582  -32.504 49.567   1.00 58.65  ?  101  ILE C CD1   1 
ATOM   4355  N  N     . HIS C  2  102  ? 93.141  -29.630 44.804   1.00 90.94  ?  102  HIS C N     1 
ATOM   4356  C  CA    . HIS C  2  102  ? 92.923  -29.592 43.363   0.50 93.10  ?  102  HIS C CA    1 
ATOM   4357  C  C     . HIS C  2  102  ? 92.593  -30.999 42.870   1.00 97.75  ?  102  HIS C C     1 
ATOM   4358  O  O     . HIS C  2  102  ? 93.176  -31.977 43.337   1.00 100.01 ?  102  HIS C O     1 
ATOM   4359  C  CB    . HIS C  2  102  ? 94.161  -29.043 42.652   0.50 89.53  ?  102  HIS C CB    1 
ATOM   4360  C  CG    . HIS C  2  102  ? 93.878  -28.477 41.294   0.50 89.37  ?  102  HIS C CG    1 
ATOM   4361  N  ND1   . HIS C  2  102  ? 94.833  -27.817 40.551   0.50 85.53  ?  102  HIS C ND1   1 
ATOM   4362  C  CD2   . HIS C  2  102  ? 92.748  -28.468 40.550   0.50 88.55  ?  102  HIS C CD2   1 
ATOM   4363  C  CE1   . HIS C  2  102  ? 94.303  -27.427 39.405   0.50 83.35  ?  102  HIS C CE1   1 
ATOM   4364  N  NE2   . HIS C  2  102  ? 93.040  -27.809 39.378   0.50 85.20  ?  102  HIS C NE2   1 
ATOM   4365  N  N     . LYS C  2  103  ? 91.645  -31.102 41.945   1.00 97.38  ?  103  LYS C N     1 
ATOM   4366  C  CA    . LYS C  2  103  ? 91.180  -32.401 41.463   1.00 101.16 ?  103  LYS C CA    1 
ATOM   4367  C  C     . LYS C  2  103  ? 92.050  -32.962 40.337   1.00 102.52 ?  103  LYS C C     1 
ATOM   4368  O  O     . LYS C  2  103  ? 91.964  -34.145 40.005   1.00 84.95  ?  103  LYS C O     1 
ATOM   4369  C  CB    . LYS C  2  103  ? 89.716  -32.313 41.029   1.00 101.51 ?  103  LYS C CB    1 
ATOM   4370  C  CG    . LYS C  2  103  ? 88.753  -32.075 42.186   1.00 93.90  ?  103  LYS C CG    1 
ATOM   4371  C  CD    . LYS C  2  103  ? 87.413  -31.553 41.690   1.00 93.01  ?  103  LYS C CD    1 
ATOM   4372  C  CE    . LYS C  2  103  ? 86.801  -32.476 40.651   1.00 97.80  ?  103  LYS C CE    1 
ATOM   4373  N  NZ    . LYS C  2  103  ? 86.505  -33.824 41.210   1.00 84.53  ?  103  LYS C NZ    1 
ATOM   4374  N  N     . ASP C  2  104  ? 92.872  -32.104 39.741   1.00 107.45 ?  104  ASP C N     1 
ATOM   4375  C  CA    . ASP C  2  104  ? 93.838  -32.544 38.742   1.00 105.21 ?  104  ASP C CA    1 
ATOM   4376  C  C     . ASP C  2  104  ? 95.188  -32.721 39.420   1.00 101.12 ?  104  ASP C C     1 
ATOM   4377  O  O     . ASP C  2  104  ? 95.675  -33.841 39.591   1.00 94.60  ?  104  ASP C O     1 
ATOM   4378  C  CB    . ASP C  2  104  ? 93.958  -31.517 37.614   1.00 101.40 ?  104  ASP C CB    1 
ATOM   4379  C  CG    . ASP C  2  104  ? 92.613  -31.106 37.052   1.00 107.24 ?  104  ASP C CG    1 
ATOM   4380  O  OD1   . ASP C  2  104  ? 92.086  -31.829 36.180   1.00 106.93 ?  104  ASP C OD1   1 
ATOM   4381  O  OD2   . ASP C  2  104  ? 92.085  -30.058 37.482   1.00 112.66 ?  104  ASP C OD2   1 
ATOM   4382  N  N     . THR C  2  105  ? 95.784  -31.598 39.801   1.00 97.25  ?  105  THR C N     1 
ATOM   4383  C  CA    . THR C  2  105  ? 97.012  -31.597 40.580   1.00 92.64  ?  105  THR C CA    1 
ATOM   4384  C  C     . THR C  2  105  ? 96.727  -32.190 41.956   1.00 97.97  ?  105  THR C C     1 
ATOM   4385  O  O     . THR C  2  105  ? 95.813  -31.750 42.649   1.00 104.36 ?  105  THR C O     1 
ATOM   4386  C  CB    . THR C  2  105  ? 97.553  -30.162 40.742   1.00 90.17  ?  105  THR C CB    1 
ATOM   4387  O  OG1   . THR C  2  105  ? 97.683  -29.547 39.454   1.00 82.51  ?  105  THR C OG1   1 
ATOM   4388  C  CG2   . THR C  2  105  ? 98.902  -30.170 41.434   1.00 88.73  ?  105  THR C CG2   1 
ATOM   4389  N  N     . GLY C  2  106  ? 97.510  -33.187 42.355   1.00 93.39  ?  106  GLY C N     1 
ATOM   4390  C  CA    . GLY C  2  106  ? 97.306  -33.846 43.634   1.00 91.57  ?  106  GLY C CA    1 
ATOM   4391  C  C     . GLY C  2  106  ? 97.678  -32.991 44.833   1.00 93.69  ?  106  GLY C C     1 
ATOM   4392  O  O     . GLY C  2  106  ? 97.556  -33.428 45.978   1.00 92.40  ?  106  GLY C O     1 
ATOM   4393  N  N     . LEU C  2  107  ? 98.130  -31.770 44.564   1.00 94.12  ?  107  LEU C N     1 
ATOM   4394  C  CA    . LEU C  2  107  ? 98.585  -30.848 45.601   1.00 90.32  ?  107  LEU C CA    1 
ATOM   4395  C  C     . LEU C  2  107  ? 97.493  -30.509 46.612   1.00 95.71  ?  107  LEU C C     1 
ATOM   4396  O  O     . LEU C  2  107  ? 96.326  -30.344 46.255   1.00 95.49  ?  107  LEU C O     1 
ATOM   4397  C  CB    . LEU C  2  107  ? 99.121  -29.563 44.962   1.00 82.01  ?  107  LEU C CB    1 
ATOM   4398  C  CG    . LEU C  2  107  ? 99.608  -28.437 45.877   1.00 84.83  ?  107  LEU C CG    1 
ATOM   4399  C  CD1   . LEU C  2  107  ? 100.747 -28.912 46.768   1.00 84.79  ?  107  LEU C CD1   1 
ATOM   4400  C  CD2   . LEU C  2  107  ? 100.033 -27.232 45.052   1.00 70.81  ?  107  LEU C CD2   1 
ATOM   4401  N  N     . ILE C  2  108  ? 97.886  -30.416 47.879   1.00 91.20  ?  108  ILE C N     1 
ATOM   4402  C  CA    . ILE C  2  108  ? 96.981  -30.017 48.949   1.00 81.87  ?  108  ILE C CA    1 
ATOM   4403  C  C     . ILE C  2  108  ? 97.592  -28.865 49.741   1.00 95.43  ?  108  ILE C C     1 
ATOM   4404  O  O     . ILE C  2  108  ? 98.709  -28.978 50.247   1.00 102.83 ?  108  ILE C O     1 
ATOM   4405  C  CB    . ILE C  2  108  ? 96.694  -31.185 49.911   1.00 78.60  ?  108  ILE C CB    1 
ATOM   4406  C  CG1   . ILE C  2  108  ? 96.119  -32.381 49.147   1.00 82.88  ?  108  ILE C CG1   1 
ATOM   4407  C  CG2   . ILE C  2  108  ? 95.751  -30.742 51.020   1.00 82.40  ?  108  ILE C CG2   1 
ATOM   4408  C  CD1   . ILE C  2  108  ? 95.845  -33.592 50.018   1.00 63.29  ?  108  ILE C CD1   1 
ATOM   4409  N  N     . LYS C  2  109  ? 96.866  -27.755 49.840   1.00 98.08  ?  109  LYS C N     1 
ATOM   4410  C  CA    . LYS C  2  109  ? 97.357  -26.593 50.584   1.00 98.49  ?  109  LYS C CA    1 
ATOM   4411  C  C     . LYS C  2  109  ? 96.673  -26.456 51.946   1.00 98.95  ?  109  LYS C C     1 
ATOM   4412  O  O     . LYS C  2  109  ? 95.480  -26.172 52.025   1.00 102.90 ?  109  LYS C O     1 
ATOM   4413  C  CB    . LYS C  2  109  ? 97.180  -25.311 49.764   1.00 98.42  ?  109  LYS C CB    1 
ATOM   4414  C  CG    . LYS C  2  109  ? 97.410  -24.027 50.551   1.00 104.45 ?  109  LYS C CG    1 
ATOM   4415  C  CD    . LYS C  2  109  ? 98.825  -23.947 51.099   1.00 103.42 ?  109  LYS C CD    1 
ATOM   4416  C  CE    . LYS C  2  109  ? 99.012  -22.706 51.957   1.00 100.31 ?  109  LYS C CE    1 
ATOM   4417  N  NZ    . LYS C  2  109  ? 100.369 -22.658 52.565   1.00 86.48  ?  109  LYS C NZ    1 
ATOM   4418  N  N     . GLU C  2  110  ? 97.443  -26.645 53.015   1.00 98.66  ?  110  GLU C N     1 
ATOM   4419  C  CA    . GLU C  2  110  ? 96.898  -26.644 54.371   1.00 92.86  ?  110  GLU C CA    1 
ATOM   4420  C  C     . GLU C  2  110  ? 97.021  -25.278 55.039   1.00 89.54  ?  110  GLU C C     1 
ATOM   4421  O  O     . GLU C  2  110  ? 98.073  -24.643 54.964   1.00 93.15  ?  110  GLU C O     1 
ATOM   4422  C  CB    . GLU C  2  110  ? 97.620  -27.693 55.219   1.00 93.05  ?  110  GLU C CB    1 
ATOM   4423  C  CG    . GLU C  2  110  ? 96.914  -28.041 56.512   1.00 78.27  ?  110  GLU C CG    1 
ATOM   4424  C  CD    . GLU C  2  110  ? 95.701  -28.918 56.287   1.00 83.31  ?  110  GLU C CD    1 
ATOM   4425  O  OE1   . GLU C  2  110  ? 94.914  -29.090 57.240   1.00 89.35  ?  110  GLU C OE1   1 
ATOM   4426  O  OE2   . GLU C  2  110  ? 95.537  -29.437 55.161   1.00 68.36  ?  110  GLU C OE2   1 
ATOM   4427  N  N     . ASP C  2  111  ? 95.950  -24.823 55.690   1.00 88.47  ?  111  ASP C N     1 
ATOM   4428  C  CA    . ASP C  2  111  ? 96.014  -23.543 56.401   1.00 89.73  ?  111  ASP C CA    1 
ATOM   4429  C  C     . ASP C  2  111  ? 94.944  -23.433 57.486   1.00 83.82  ?  111  ASP C C     1 
ATOM   4430  O  O     . ASP C  2  111  ? 93.998  -24.212 57.502   1.00 76.90  ?  111  ASP C O     1 
ATOM   4431  C  CB    . ASP C  2  111  ? 95.880  -22.379 55.412   1.00 85.75  ?  111  ASP C CB    1 
ATOM   4432  C  CG    . ASP C  2  111  ? 96.455  -21.079 55.951   1.00 85.05  ?  111  ASP C CG    1 
ATOM   4433  O  OD1   . ASP C  2  111  ? 96.589  -20.943 57.186   1.00 77.36  ?  111  ASP C OD1   1 
ATOM   4434  O  OD2   . ASP C  2  111  ? 96.772  -20.189 55.133   1.00 97.66  ?  111  ASP C OD2   1 
ATOM   4435  N  N     . GLU C  2  112  ? 95.110  -22.480 58.401   1.00 85.83  ?  112  GLU C N     1 
ATOM   4436  C  CA    . GLU C  2  112  ? 94.019  -22.092 59.298   1.00 77.85  ?  112  GLU C CA    1 
ATOM   4437  C  C     . GLU C  2  112  ? 93.801  -20.574 59.277   1.00 77.15  ?  112  GLU C C     1 
ATOM   4438  O  O     . GLU C  2  112  ? 94.731  -19.792 59.483   1.00 72.49  ?  112  GLU C O     1 
ATOM   4439  C  CB    . GLU C  2  112  ? 94.211  -22.630 60.726   1.00 68.25  ?  112  GLU C CB    1 
ATOM   4440  C  CG    . GLU C  2  112  ? 95.291  -21.955 61.556   1.00 76.43  ?  112  GLU C CG    1 
ATOM   4441  C  CD    . GLU C  2  112  ? 95.185  -22.300 63.034   1.00 68.81  ?  112  GLU C CD    1 
ATOM   4442  O  OE1   . GLU C  2  112  ? 95.846  -21.626 63.853   1.00 59.46  ?  112  GLU C OE1   1 
ATOM   4443  O  OE2   . GLU C  2  112  ? 94.438  -23.243 63.375   1.00 53.79  ?  112  GLU C OE2   1 
ATOM   4444  N  N     . VAL C  2  113  ? 92.564  -20.170 59.004   1.00 78.59  ?  113  VAL C N     1 
ATOM   4445  C  CA    . VAL C  2  113  ? 92.244  -18.765 58.779   1.00 79.40  ?  113  VAL C CA    1 
ATOM   4446  C  C     . VAL C  2  113  ? 91.336  -18.205 59.873   1.00 81.11  ?  113  VAL C C     1 
ATOM   4447  O  O     . VAL C  2  113  ? 90.472  -18.907 60.400   1.00 71.36  ?  113  VAL C O     1 
ATOM   4448  C  CB    . VAL C  2  113  ? 91.569  -18.565 57.402   1.00 68.61  ?  113  VAL C CB    1 
ATOM   4449  C  CG1   . VAL C  2  113  ? 91.627  -17.107 56.984   1.00 70.29  ?  113  VAL C CG1   1 
ATOM   4450  C  CG2   . VAL C  2  113  ? 92.239  -19.437 56.353   1.00 74.70  ?  113  VAL C CG2   1 
ATOM   4451  N  N     . PHE C  2  114  ? 91.546  -16.937 60.209   1.00 84.33  ?  114  PHE C N     1 
ATOM   4452  C  CA    . PHE C  2  114  ? 90.733  -16.250 61.206   1.00 83.37  ?  114  PHE C CA    1 
ATOM   4453  C  C     . PHE C  2  114  ? 89.334  -15.967 60.657   1.00 83.73  ?  114  PHE C C     1 
ATOM   4454  O  O     . PHE C  2  114  ? 89.183  -15.308 59.628   1.00 83.82  ?  114  PHE C O     1 
ATOM   4455  C  CB    . PHE C  2  114  ? 91.429  -14.948 61.610   1.00 75.99  ?  114  PHE C CB    1 
ATOM   4456  C  CG    . PHE C  2  114  ? 90.698  -14.160 62.655   1.00 83.30  ?  114  PHE C CG    1 
ATOM   4457  C  CD1   . PHE C  2  114  ? 90.540  -14.659 63.936   1.00 80.87  ?  114  PHE C CD1   1 
ATOM   4458  C  CD2   . PHE C  2  114  ? 90.190  -12.905 62.361   1.00 87.92  ?  114  PHE C CD2   1 
ATOM   4459  C  CE1   . PHE C  2  114  ? 89.875  -13.929 64.902   1.00 80.92  ?  114  PHE C CE1   1 
ATOM   4460  C  CE2   . PHE C  2  114  ? 89.528  -12.167 63.323   1.00 90.11  ?  114  PHE C CE2   1 
ATOM   4461  C  CZ    . PHE C  2  114  ? 89.371  -12.679 64.595   1.00 83.99  ?  114  PHE C CZ    1 
ATOM   4462  N  N     . LEU C  2  115  ? 88.315  -16.466 61.351   1.00 81.95  ?  115  LEU C N     1 
ATOM   4463  C  CA    . LEU C  2  115  ? 86.929  -16.317 60.908   1.00 81.03  ?  115  LEU C CA    1 
ATOM   4464  C  C     . LEU C  2  115  ? 86.214  -15.144 61.566   1.00 82.46  ?  115  LEU C C     1 
ATOM   4465  O  O     . LEU C  2  115  ? 85.042  -14.888 61.287   1.00 76.40  ?  115  LEU C O     1 
ATOM   4466  C  CB    . LEU C  2  115  ? 86.136  -17.596 61.181   1.00 67.36  ?  115  LEU C CB    1 
ATOM   4467  C  CG    . LEU C  2  115  ? 86.451  -18.828 60.341   1.00 57.33  ?  115  LEU C CG    1 
ATOM   4468  C  CD1   . LEU C  2  115  ? 85.362  -19.867 60.544   1.00 44.62  ?  115  LEU C CD1   1 
ATOM   4469  C  CD2   . LEU C  2  115  ? 86.584  -18.456 58.873   1.00 61.24  ?  115  LEU C CD2   1 
ATOM   4470  N  N     . GLY C  2  116  ? 86.917  -14.435 62.440   1.00 81.78  ?  116  GLY C N     1 
ATOM   4471  C  CA    . GLY C  2  116  ? 86.295  -13.398 63.239   1.00 82.30  ?  116  GLY C CA    1 
ATOM   4472  C  C     . GLY C  2  116  ? 86.115  -13.861 64.671   1.00 75.39  ?  116  GLY C C     1 
ATOM   4473  O  O     . GLY C  2  116  ? 86.552  -14.952 65.038   1.00 68.35  ?  116  GLY C O     1 
ATOM   4474  N  N     . HIS C  2  117  ? 85.470  -13.032 65.483   1.00 71.80  ?  117  HIS C N     1 
ATOM   4475  C  CA    . HIS C  2  117  ? 85.248  -13.358 66.886   1.00 65.09  ?  117  HIS C CA    1 
ATOM   4476  C  C     . HIS C  2  117  ? 83.807  -13.784 67.132   1.00 61.63  ?  117  HIS C C     1 
ATOM   4477  O  O     . HIS C  2  117  ? 82.884  -13.292 66.481   1.00 58.40  ?  117  HIS C O     1 
ATOM   4478  C  CB    . HIS C  2  117  ? 85.588  -12.161 67.774   1.00 67.51  ?  117  HIS C CB    1 
ATOM   4479  C  CG    . HIS C  2  117  ? 87.055  -11.926 67.943   1.00 71.53  ?  117  HIS C CG    1 
ATOM   4480  N  ND1   . HIS C  2  117  ? 87.789  -12.494 68.959   1.00 70.46  ?  117  HIS C ND1   1 
ATOM   4481  C  CD2   . HIS C  2  117  ? 87.928  -11.171 67.228   1.00 75.49  ?  117  HIS C CD2   1 
ATOM   4482  C  CE1   . HIS C  2  117  ? 89.050  -12.109 68.864   1.00 74.49  ?  117  HIS C CE1   1 
ATOM   4483  N  NE2   . HIS C  2  117  ? 89.156  -11.304 67.820   1.00 81.17  ?  117  HIS C NE2   1 
ATOM   4484  N  N     . ILE C  2  118  ? 83.617  -14.701 68.075   1.00 61.83  ?  118  ILE C N     1 
ATOM   4485  C  CA    . ILE C  2  118  ? 82.276  -15.140 68.442   1.00 58.19  ?  118  ILE C CA    1 
ATOM   4486  C  C     . ILE C  2  118  ? 82.058  -14.937 69.941   1.00 58.60  ?  118  ILE C C     1 
ATOM   4487  O  O     . ILE C  2  118  ? 82.944  -15.224 70.743   1.00 57.56  ?  118  ILE C O     1 
ATOM   4488  C  CB    . ILE C  2  118  ? 82.053  -16.621 68.041   1.00 50.19  ?  118  ILE C CB    1 
ATOM   4489  C  CG1   . ILE C  2  118  ? 81.231  -17.368 69.092   1.00 46.59  ?  118  ILE C CG1   1 
ATOM   4490  C  CG2   . ILE C  2  118  ? 83.384  -17.320 67.834   1.00 54.18  ?  118  ILE C CG2   1 
ATOM   4491  C  CD1   . ILE C  2  118  ? 81.098  -18.844 68.810   1.00 41.46  ?  118  ILE C CD1   1 
ATOM   4492  N  N     . PRO C  2  119  ? 80.863  -14.450 70.319   1.00 62.87  ?  119  PRO C N     1 
ATOM   4493  C  CA    . PRO C  2  119  ? 80.532  -14.091 71.704   1.00 57.42  ?  119  PRO C CA    1 
ATOM   4494  C  C     . PRO C  2  119  ? 80.571  -15.276 72.663   1.00 55.73  ?  119  PRO C C     1 
ATOM   4495  O  O     . PRO C  2  119  ? 80.176  -16.384 72.299   1.00 52.73  ?  119  PRO C O     1 
ATOM   4496  C  CB    . PRO C  2  119  ? 79.100  -13.557 71.590   1.00 56.14  ?  119  PRO C CB    1 
ATOM   4497  C  CG    . PRO C  2  119  ? 78.985  -13.091 70.183   1.00 54.17  ?  119  PRO C CG    1 
ATOM   4498  C  CD    . PRO C  2  119  ? 79.789  -14.070 69.387   1.00 60.56  ?  119  PRO C CD    1 
ATOM   4499  N  N     . LEU C  2  120  ? 81.041  -15.031 73.883   1.00 47.01  ?  120  LEU C N     1 
ATOM   4500  C  CA    . LEU C  2  120  ? 81.127  -16.071 74.900   1.00 44.44  ?  120  LEU C CA    1 
ATOM   4501  C  C     . LEU C  2  120  ? 80.114  -15.853 76.019   1.00 45.28  ?  120  LEU C C     1 
ATOM   4502  O  O     . LEU C  2  120  ? 79.918  -14.730 76.481   1.00 49.91  ?  120  LEU C O     1 
ATOM   4503  C  CB    . LEU C  2  120  ? 82.542  -16.136 75.475   1.00 48.76  ?  120  LEU C CB    1 
ATOM   4504  C  CG    . LEU C  2  120  ? 83.380  -17.323 75.003   1.00 54.56  ?  120  LEU C CG    1 
ATOM   4505  C  CD1   . LEU C  2  120  ? 82.879  -18.611 75.639   1.00 50.58  ?  120  LEU C CD1   1 
ATOM   4506  C  CD2   . LEU C  2  120  ? 83.331  -17.424 73.492   1.00 56.50  ?  120  LEU C CD2   1 
ATOM   4507  N  N     . MET C  2  121  ? 79.466  -16.933 76.442   1.00 41.24  ?  121  MET C N     1 
ATOM   4508  C  CA    . MET C  2  121  ? 78.506  -16.868 77.538   1.00 45.86  ?  121  MET C CA    1 
ATOM   4509  C  C     . MET C  2  121  ? 79.217  -16.862 78.894   1.00 51.34  ?  121  MET C C     1 
ATOM   4510  O  O     . MET C  2  121  ? 80.323  -17.386 79.027   1.00 49.94  ?  121  MET C O     1 
ATOM   4511  C  CB    . MET C  2  121  ? 77.510  -18.030 77.450   1.00 43.34  ?  121  MET C CB    1 
ATOM   4512  C  CG    . MET C  2  121  ? 76.396  -17.983 78.487   1.00 42.26  ?  121  MET C CG    1 
ATOM   4513  S  SD    . MET C  2  121  ? 75.231  -19.350 78.372   1.00 45.45  ?  121  MET C SD    1 
ATOM   4514  C  CE    . MET C  2  121  ? 74.062  -18.716 77.176   1.00 40.47  ?  121  MET C CE    1 
ATOM   4515  N  N     . THR C  2  122  ? 78.577  -16.260 79.893   1.00 51.40  ?  122  THR C N     1 
ATOM   4516  C  CA    . THR C  2  122  ? 79.117  -16.215 81.244   1.00 47.31  ?  122  THR C CA    1 
ATOM   4517  C  C     . THR C  2  122  ? 78.621  -17.430 82.031   1.00 45.54  ?  122  THR C C     1 
ATOM   4518  O  O     . THR C  2  122  ? 77.849  -18.238 81.513   1.00 41.95  ?  122  THR C O     1 
ATOM   4519  C  CB    . THR C  2  122  ? 78.695  -14.909 81.955   1.00 52.47  ?  122  THR C CB    1 
ATOM   4520  O  OG1   . THR C  2  122  ? 78.636  -13.841 81.001   1.00 36.81  ?  122  THR C OG1   1 
ATOM   4521  C  CG2   . THR C  2  122  ? 79.677  -14.537 83.059   1.00 62.86  ?  122  THR C CG2   1 
ATOM   4522  N  N     . GLU C  2  123  ? 79.064  -17.560 83.278   1.00 45.12  ?  123  GLU C N     1 
ATOM   4523  C  CA    . GLU C  2  123  ? 78.665  -18.675 84.127   1.00 47.12  ?  123  GLU C CA    1 
ATOM   4524  C  C     . GLU C  2  123  ? 77.192  -18.556 84.501   1.00 55.60  ?  123  GLU C C     1 
ATOM   4525  O  O     . GLU C  2  123  ? 76.516  -19.559 84.733   1.00 56.17  ?  123  GLU C O     1 
ATOM   4526  C  CB    . GLU C  2  123  ? 79.529  -18.716 85.391   1.00 52.81  ?  123  GLU C CB    1 
ATOM   4527  C  CG    . GLU C  2  123  ? 79.288  -19.931 86.277   1.00 71.34  ?  123  GLU C CG    1 
ATOM   4528  C  CD    . GLU C  2  123  ? 80.036  -19.854 87.598   1.00 75.37  ?  123  GLU C CD    1 
ATOM   4529  O  OE1   . GLU C  2  123  ? 80.070  -20.871 88.324   1.00 69.90  ?  123  GLU C OE1   1 
ATOM   4530  O  OE2   . GLU C  2  123  ? 80.587  -18.777 87.913   1.00 74.38  ?  123  GLU C OE2   1 
ATOM   4531  N  N     . ASP C  2  124  ? 76.702  -17.321 84.546   1.00 56.16  ?  124  ASP C N     1 
ATOM   4532  C  CA    . ASP C  2  124  ? 75.316  -17.049 84.915   1.00 49.96  ?  124  ASP C CA    1 
ATOM   4533  C  C     . ASP C  2  124  ? 74.339  -17.344 83.778   1.00 49.52  ?  124  ASP C C     1 
ATOM   4534  O  O     . ASP C  2  124  ? 73.128  -17.403 83.992   1.00 52.13  ?  124  ASP C O     1 
ATOM   4535  C  CB    . ASP C  2  124  ? 75.163  -15.601 85.395   1.00 50.95  ?  124  ASP C CB    1 
ATOM   4536  C  CG    . ASP C  2  124  ? 75.799  -14.596 84.446   1.00 55.88  ?  124  ASP C CG    1 
ATOM   4537  O  OD1   . ASP C  2  124  ? 75.694  -14.781 83.214   1.00 51.92  ?  124  ASP C OD1   1 
ATOM   4538  O  OD2   . ASP C  2  124  ? 76.407  -13.619 84.933   1.00 48.99  ?  124  ASP C OD2   1 
ATOM   4539  N  N     . GLY C  2  125  ? 74.870  -17.539 82.574   1.00 47.44  ?  125  GLY C N     1 
ATOM   4540  C  CA    . GLY C  2  125  ? 74.046  -17.847 81.420   1.00 39.85  ?  125  GLY C CA    1 
ATOM   4541  C  C     . GLY C  2  125  ? 73.651  -16.661 80.560   1.00 36.80  ?  125  GLY C C     1 
ATOM   4542  O  O     . GLY C  2  125  ? 72.660  -16.725 79.834   1.00 41.08  ?  125  GLY C O     1 
ATOM   4543  N  N     . SER C  2  126  ? 74.416  -15.576 80.638   1.00 39.83  ?  126  SER C N     1 
ATOM   4544  C  CA    . SER C  2  126  ? 74.150  -14.394 79.817   1.00 38.03  ?  126  SER C CA    1 
ATOM   4545  C  C     . SER C  2  126  ? 75.338  -14.044 78.919   1.00 36.08  ?  126  SER C C     1 
ATOM   4546  O  O     . SER C  2  126  ? 76.334  -14.763 78.887   1.00 38.69  ?  126  SER C O     1 
ATOM   4547  C  CB    . SER C  2  126  ? 73.780  -13.194 80.694   1.00 41.82  ?  126  SER C CB    1 
ATOM   4548  O  OG    . SER C  2  126  ? 74.882  -12.763 81.474   1.00 39.07  ?  126  SER C OG    1 
ATOM   4549  N  N     . PHE C  2  127  ? 75.221  -12.940 78.186   1.00 39.92  ?  127  PHE C N     1 
ATOM   4550  C  CA    . PHE C  2  127  ? 76.294  -12.483 77.305   1.00 39.52  ?  127  PHE C CA    1 
ATOM   4551  C  C     . PHE C  2  127  ? 76.636  -11.025 77.576   1.00 41.50  ?  127  PHE C C     1 
ATOM   4552  O  O     . PHE C  2  127  ? 75.888  -10.319 78.244   1.00 43.87  ?  127  PHE C O     1 
ATOM   4553  C  CB    . PHE C  2  127  ? 75.889  -12.626 75.837   1.00 44.64  ?  127  PHE C CB    1 
ATOM   4554  C  CG    . PHE C  2  127  ? 75.663  -14.042 75.400   1.00 41.15  ?  127  PHE C CG    1 
ATOM   4555  C  CD1   . PHE C  2  127  ? 74.421  -14.634 75.545   1.00 40.14  ?  127  PHE C CD1   1 
ATOM   4556  C  CD2   . PHE C  2  127  ? 76.688  -14.776 74.832   1.00 44.42  ?  127  PHE C CD2   1 
ATOM   4557  C  CE1   . PHE C  2  127  ? 74.208  -15.935 75.138   1.00 43.88  ?  127  PHE C CE1   1 
ATOM   4558  C  CE2   . PHE C  2  127  ? 76.481  -16.079 74.423   1.00 47.99  ?  127  PHE C CE2   1 
ATOM   4559  C  CZ    . PHE C  2  127  ? 75.239  -16.659 74.576   1.00 46.85  ?  127  PHE C CZ    1 
ATOM   4560  N  N     . ILE C  2  128  ? 77.780  -10.580 77.069   1.00 43.10  ?  128  ILE C N     1 
ATOM   4561  C  CA    . ILE C  2  128  ? 78.120  -9.164  77.100   1.00 40.16  ?  128  ILE C CA    1 
ATOM   4562  C  C     . ILE C  2  128  ? 78.354  -8.673  75.679   1.00 44.28  ?  128  ILE C C     1 
ATOM   4563  O  O     . ILE C  2  128  ? 79.331  -9.055  75.039   1.00 53.45  ?  128  ILE C O     1 
ATOM   4564  C  CB    . ILE C  2  128  ? 79.380  -8.898  77.940   1.00 43.91  ?  128  ILE C CB    1 
ATOM   4565  C  CG1   . ILE C  2  128  ? 79.216  -9.475  79.347   1.00 40.25  ?  128  ILE C CG1   1 
ATOM   4566  C  CG2   . ILE C  2  128  ? 79.675  -7.407  77.997   1.00 43.66  ?  128  ILE C CG2   1 
ATOM   4567  C  CD1   . ILE C  2  128  ? 80.459  -9.362  80.197   1.00 47.69  ?  128  ILE C CD1   1 
ATOM   4568  N  N     . ILE C  2  129  ? 77.460  -7.823  75.188   1.00 45.34  ?  129  ILE C N     1 
ATOM   4569  C  CA    . ILE C  2  129  ? 77.552  -7.333  73.818   1.00 44.55  ?  129  ILE C CA    1 
ATOM   4570  C  C     . ILE C  2  129  ? 77.660  -5.812  73.803   1.00 52.94  ?  129  ILE C C     1 
ATOM   4571  O  O     . ILE C  2  129  ? 76.737  -5.113  74.226   1.00 52.32  ?  129  ILE C O     1 
ATOM   4572  C  CB    . ILE C  2  129  ? 76.332  -7.766  72.979   1.00 42.90  ?  129  ILE C CB    1 
ATOM   4573  C  CG1   . ILE C  2  129  ? 75.960  -9.225  73.269   1.00 34.88  ?  129  ILE C CG1   1 
ATOM   4574  C  CG2   . ILE C  2  129  ? 76.602  -7.551  71.498   1.00 49.47  ?  129  ILE C CG2   1 
ATOM   4575  C  CD1   . ILE C  2  129  ? 77.007  -10.226 72.843   1.00 38.55  ?  129  ILE C CD1   1 
ATOM   4576  N  N     . ASN C  2  130  ? 78.793  -5.312  73.315   1.00 57.39  ?  130  ASN C N     1 
ATOM   4577  C  CA    . ASN C  2  130  ? 79.084  -3.877  73.297   1.00 56.61  ?  130  ASN C CA    1 
ATOM   4578  C  C     . ASN C  2  130  ? 79.088  -3.223  74.680   1.00 55.13  ?  130  ASN C C     1 
ATOM   4579  O  O     . ASN C  2  130  ? 78.835  -2.026  74.808   1.00 59.69  ?  130  ASN C O     1 
ATOM   4580  C  CB    . ASN C  2  130  ? 78.140  -3.127  72.350   1.00 59.22  ?  130  ASN C CB    1 
ATOM   4581  C  CG    . ASN C  2  130  ? 78.653  -3.092  70.925   1.00 68.14  ?  130  ASN C CG    1 
ATOM   4582  O  OD1   . ASN C  2  130  ? 79.546  -3.853  70.554   1.00 71.58  ?  130  ASN C OD1   1 
ATOM   4583  N  ND2   . ASN C  2  130  ? 78.089  -2.201  70.116   1.00 65.91  ?  130  ASN C ND2   1 
ATOM   4584  N  N     . GLY C  2  131  ? 79.377  -4.013  75.709   1.00 55.18  ?  131  GLY C N     1 
ATOM   4585  C  CA    . GLY C  2  131  ? 79.495  -3.494  77.060   1.00 56.27  ?  131  GLY C CA    1 
ATOM   4586  C  C     . GLY C  2  131  ? 78.243  -3.643  77.902   1.00 58.42  ?  131  GLY C C     1 
ATOM   4587  O  O     . GLY C  2  131  ? 78.241  -3.306  79.087   1.00 63.44  ?  131  GLY C O     1 
ATOM   4588  N  N     . ALA C  2  132  ? 77.176  -4.153  77.295   1.00 51.71  ?  132  ALA C N     1 
ATOM   4589  C  CA    . ALA C  2  132  ? 75.908  -4.318  77.998   1.00 53.59  ?  132  ALA C CA    1 
ATOM   4590  C  C     . ALA C  2  132  ? 75.512  -5.786  78.108   1.00 49.87  ?  132  ALA C C     1 
ATOM   4591  O  O     . ALA C  2  132  ? 75.528  -6.519  77.120   1.00 51.44  ?  132  ALA C O     1 
ATOM   4592  C  CB    . ALA C  2  132  ? 74.810  -3.523  77.305   1.00 52.27  ?  132  ALA C CB    1 
ATOM   4593  N  N     . ASP C  2  133  ? 75.158  -6.210  79.317   1.00 49.95  ?  133  ASP C N     1 
ATOM   4594  C  CA    . ASP C  2  133  ? 74.704  -7.575  79.543   1.00 48.51  ?  133  ASP C CA    1 
ATOM   4595  C  C     . ASP C  2  133  ? 73.410  -7.843  78.783   1.00 50.83  ?  133  ASP C C     1 
ATOM   4596  O  O     . ASP C  2  133  ? 72.502  -7.010  78.770   1.00 54.37  ?  133  ASP C O     1 
ATOM   4597  C  CB    . ASP C  2  133  ? 74.503  -7.837  81.037   1.00 59.36  ?  133  ASP C CB    1 
ATOM   4598  C  CG    . ASP C  2  133  ? 75.790  -7.712  81.830   1.00 66.28  ?  133  ASP C CG    1 
ATOM   4599  O  OD1   . ASP C  2  133  ? 76.656  -6.903  81.435   1.00 65.35  ?  133  ASP C OD1   1 
ATOM   4600  O  OD2   . ASP C  2  133  ? 75.933  -8.425  82.848   1.00 62.99  ?  133  ASP C OD2   1 
ATOM   4601  N  N     . ARG C  2  134  ? 73.335  -9.007  78.148   1.00 46.41  ?  134  ARG C N     1 
ATOM   4602  C  CA    . ARG C  2  134  ? 72.173  -9.383  77.353   1.00 46.12  ?  134  ARG C CA    1 
ATOM   4603  C  C     . ARG C  2  134  ? 71.788  -10.840 77.579   1.00 34.05  ?  134  ARG C C     1 
ATOM   4604  O  O     . ARG C  2  134  ? 72.608  -11.652 78.011   1.00 34.39  ?  134  ARG C O     1 
ATOM   4605  C  CB    . ARG C  2  134  ? 72.438  -9.133  75.866   1.00 45.45  ?  134  ARG C CB    1 
ATOM   4606  C  CG    . ARG C  2  134  ? 72.501  -7.662  75.488   1.00 44.23  ?  134  ARG C CG    1 
ATOM   4607  C  CD    . ARG C  2  134  ? 72.682  -7.482  73.993   1.00 44.26  ?  134  ARG C CD    1 
ATOM   4608  N  NE    . ARG C  2  134  ? 71.929  -6.335  73.498   1.00 47.61  ?  134  ARG C NE    1 
ATOM   4609  C  CZ    . ARG C  2  134  ? 70.652  -6.389  73.136   1.00 53.43  ?  134  ARG C CZ    1 
ATOM   4610  N  NH1   . ARG C  2  134  ? 69.989  -7.534  73.213   1.00 47.56  ?  134  ARG C NH1   1 
ATOM   4611  N  NH2   . ARG C  2  134  ? 70.037  -5.299  72.697   1.00 55.84  ?  134  ARG C NH2   1 
ATOM   4612  N  N     . VAL C  2  135  ? 70.533  -11.160 77.287   1.00 33.82  ?  135  VAL C N     1 
ATOM   4613  C  CA    . VAL C  2  135  ? 70.035  -12.521 77.436   1.00 40.99  ?  135  VAL C CA    1 
ATOM   4614  C  C     . VAL C  2  135  ? 69.297  -12.974 76.183   1.00 45.55  ?  135  VAL C C     1 
ATOM   4615  O  O     . VAL C  2  135  ? 68.445  -12.255 75.654   1.00 41.71  ?  135  VAL C O     1 
ATOM   4616  C  CB    . VAL C  2  135  ? 69.106  -12.660 78.663   1.00 38.05  ?  135  VAL C CB    1 
ATOM   4617  C  CG1   . VAL C  2  135  ? 68.357  -13.987 78.629   1.00 30.99  ?  135  VAL C CG1   1 
ATOM   4618  C  CG2   . VAL C  2  135  ? 69.902  -12.526 79.952   1.00 43.21  ?  135  VAL C CG2   1 
ATOM   4619  N  N     . ILE C  2  136  ? 69.643  -14.166 75.705   1.00 41.43  ?  136  ILE C N     1 
ATOM   4620  C  CA    . ILE C  2  136  ? 68.948  -14.772 74.580   1.00 39.65  ?  136  ILE C CA    1 
ATOM   4621  C  C     . ILE C  2  136  ? 67.780  -15.594 75.104   1.00 40.45  ?  136  ILE C C     1 
ATOM   4622  O  O     . ILE C  2  136  ? 67.971  -16.562 75.841   1.00 37.52  ?  136  ILE C O     1 
ATOM   4623  C  CB    . ILE C  2  136  ? 69.879  -15.684 73.765   1.00 37.63  ?  136  ILE C CB    1 
ATOM   4624  C  CG1   . ILE C  2  136  ? 71.133  -14.922 73.330   1.00 38.86  ?  136  ILE C CG1   1 
ATOM   4625  C  CG2   . ILE C  2  136  ? 69.146  -16.253 72.560   1.00 41.26  ?  136  ILE C CG2   1 
ATOM   4626  C  CD1   . ILE C  2  136  ? 70.854  -13.750 72.421   1.00 29.48  ?  136  ILE C CD1   1 
ATOM   4627  N  N     . VAL C  2  137  ? 66.569  -15.203 74.720   1.00 38.72  ?  137  VAL C N     1 
ATOM   4628  C  CA    . VAL C  2  137  ? 65.361  -15.852 75.215   1.00 43.97  ?  137  VAL C CA    1 
ATOM   4629  C  C     . VAL C  2  137  ? 65.010  -17.096 74.404   1.00 39.02  ?  137  VAL C C     1 
ATOM   4630  O  O     . VAL C  2  137  ? 64.970  -17.051 73.174   1.00 45.60  ?  137  VAL C O     1 
ATOM   4631  C  CB    . VAL C  2  137  ? 64.164  -14.883 75.199   1.00 40.71  ?  137  VAL C CB    1 
ATOM   4632  C  CG1   . VAL C  2  137  ? 62.919  -15.564 75.747   1.00 46.80  ?  137  VAL C CG1   1 
ATOM   4633  C  CG2   . VAL C  2  137  ? 64.487  -13.634 76.001   1.00 35.25  ?  137  VAL C CG2   1 
ATOM   4634  N  N     . SER C  2  138  ? 64.757  -18.201 75.100   1.00 24.14  ?  138  SER C N     1 
ATOM   4635  C  CA    . SER C  2  138  ? 64.348  -19.441 74.452   1.00 36.08  ?  138  SER C CA    1 
ATOM   4636  C  C     . SER C  2  138  ? 63.063  -19.223 73.665   1.00 40.89  ?  138  SER C C     1 
ATOM   4637  O  O     . SER C  2  138  ? 62.239  -18.391 74.039   1.00 46.30  ?  138  SER C O     1 
ATOM   4638  C  CB    . SER C  2  138  ? 64.144  -20.545 75.490   1.00 38.06  ?  138  SER C CB    1 
ATOM   4639  O  OG    . SER C  2  138  ? 65.345  -20.806 76.194   1.00 52.02  ?  138  SER C OG    1 
ATOM   4640  N  N     . GLN C  2  139  ? 62.896  -19.961 72.572   1.00 43.08  ?  139  GLN C N     1 
ATOM   4641  C  CA    . GLN C  2  139  ? 61.736  -19.768 71.708   1.00 37.75  ?  139  GLN C CA    1 
ATOM   4642  C  C     . GLN C  2  139  ? 60.958  -21.054 71.454   1.00 36.58  ?  139  GLN C C     1 
ATOM   4643  O  O     . GLN C  2  139  ? 61.453  -21.964 70.798   1.00 42.87  ?  139  GLN C O     1 
ATOM   4644  C  CB    . GLN C  2  139  ? 62.169  -19.167 70.371   1.00 44.44  ?  139  GLN C CB    1 
ATOM   4645  C  CG    . GLN C  2  139  ? 61.033  -18.954 69.384   1.00 48.70  ?  139  GLN C CG    1 
ATOM   4646  C  CD    . GLN C  2  139  ? 61.504  -18.340 68.080   1.00 57.16  ?  139  GLN C CD    1 
ATOM   4647  O  OE1   . GLN C  2  139  ? 62.682  -18.018 67.922   1.00 55.53  ?  139  GLN C OE1   1 
ATOM   4648  N  NE2   . GLN C  2  139  ? 60.584  -18.175 67.136   1.00 64.52  ?  139  GLN C NE2   1 
ATOM   4649  N  N     . ILE C  2  140  ? 59.729  -21.116 71.953   1.00 37.57  ?  140  ILE C N     1 
ATOM   4650  C  CA    . ILE C  2  140  ? 58.877  -22.268 71.691   1.00 36.66  ?  140  ILE C CA    1 
ATOM   4651  C  C     . ILE C  2  140  ? 58.310  -22.181 70.279   1.00 42.31  ?  140  ILE C C     1 
ATOM   4652  O  O     . ILE C  2  140  ? 57.966  -21.098 69.802   1.00 49.03  ?  140  ILE C O     1 
ATOM   4653  C  CB    . ILE C  2  140  ? 57.731  -22.393 72.726   1.00 32.58  ?  140  ILE C CB    1 
ATOM   4654  C  CG1   . ILE C  2  140  ? 56.948  -23.690 72.513   1.00 28.46  ?  140  ILE C CG1   1 
ATOM   4655  C  CG2   . ILE C  2  140  ? 56.809  -21.182 72.676   1.00 34.76  ?  140  ILE C CG2   1 
ATOM   4656  C  CD1   . ILE C  2  140  ? 55.986  -24.011 73.631   1.00 28.33  ?  140  ILE C CD1   1 
ATOM   4657  N  N     . HIS C  2  141  ? 58.241  -23.320 69.599   1.00 42.24  ?  141  HIS C N     1 
ATOM   4658  C  CA    . HIS C  2  141  ? 57.626  -23.369 68.279   1.00 39.87  ?  141  HIS C CA    1 
ATOM   4659  C  C     . HIS C  2  141  ? 57.066  -24.752 67.975   1.00 42.23  ?  141  HIS C C     1 
ATOM   4660  O  O     . HIS C  2  141  ? 57.168  -25.670 68.791   1.00 41.69  ?  141  HIS C O     1 
ATOM   4661  C  CB    . HIS C  2  141  ? 58.611  -22.927 67.190   1.00 43.47  ?  141  HIS C CB    1 
ATOM   4662  C  CG    . HIS C  2  141  ? 59.742  -23.881 66.965   1.00 57.27  ?  141  HIS C CG    1 
ATOM   4663  N  ND1   . HIS C  2  141  ? 60.407  -23.973 65.760   1.00 62.46  ?  141  HIS C ND1   1 
ATOM   4664  C  CD2   . HIS C  2  141  ? 60.332  -24.781 67.787   1.00 57.22  ?  141  HIS C CD2   1 
ATOM   4665  C  CE1   . HIS C  2  141  ? 61.352  -24.891 65.849   1.00 60.98  ?  141  HIS C CE1   1 
ATOM   4666  N  NE2   . HIS C  2  141  ? 61.328  -25.397 67.069   1.00 58.70  ?  141  HIS C NE2   1 
ATOM   4667  N  N     . ARG C  2  142  ? 56.471  -24.890 66.797   1.00 42.53  ?  142  ARG C N     1 
ATOM   4668  C  CA    . ARG C  2  142  ? 55.878  -26.152 66.386   1.00 53.93  ?  142  ARG C CA    1 
ATOM   4669  C  C     . ARG C  2  142  ? 56.968  -27.083 65.867   1.00 58.41  ?  142  ARG C C     1 
ATOM   4670  O  O     . ARG C  2  142  ? 57.680  -26.751 64.918   1.00 45.63  ?  142  ARG C O     1 
ATOM   4671  C  CB    . ARG C  2  142  ? 54.819  -25.906 65.312   1.00 51.02  ?  142  ARG C CB    1 
ATOM   4672  C  CG    . ARG C  2  142  ? 53.880  -27.072 65.068   1.00 54.98  ?  142  ARG C CG    1 
ATOM   4673  C  CD    . ARG C  2  142  ? 52.861  -26.716 63.999   1.00 58.46  ?  142  ARG C CD    1 
ATOM   4674  N  NE    . ARG C  2  142  ? 51.994  -27.840 63.662   1.00 64.27  ?  142  ARG C NE    1 
ATOM   4675  C  CZ    . ARG C  2  142  ? 51.142  -27.841 62.642   1.00 65.44  ?  142  ARG C CZ    1 
ATOM   4676  N  NH1   . ARG C  2  142  ? 51.047  -26.776 61.857   1.00 68.23  ?  142  ARG C NH1   1 
ATOM   4677  N  NH2   . ARG C  2  142  ? 50.390  -28.906 62.403   1.00 64.42  ?  142  ARG C NH2   1 
ATOM   4678  N  N     . SER C  2  143  ? 57.100  -28.245 66.498   1.00 61.46  ?  143  SER C N     1 
ATOM   4679  C  CA    . SER C  2  143  ? 58.142  -29.195 66.129   1.00 63.33  ?  143  SER C CA    1 
ATOM   4680  C  C     . SER C  2  143  ? 57.868  -29.802 64.761   1.00 66.73  ?  143  SER C C     1 
ATOM   4681  O  O     . SER C  2  143  ? 56.722  -30.107 64.432   1.00 69.63  ?  143  SER C O     1 
ATOM   4682  C  CB    . SER C  2  143  ? 58.256  -30.310 67.171   1.00 63.86  ?  143  SER C CB    1 
ATOM   4683  O  OG    . SER C  2  143  ? 57.215  -31.260 67.016   1.00 65.54  ?  143  SER C OG    1 
ATOM   4684  N  N     . PRO C  2  144  ? 58.926  -29.973 63.958   1.00 64.89  ?  144  PRO C N     1 
ATOM   4685  C  CA    . PRO C  2  144  ? 58.828  -30.628 62.651   1.00 65.20  ?  144  PRO C CA    1 
ATOM   4686  C  C     . PRO C  2  144  ? 58.303  -32.055 62.769   1.00 56.63  ?  144  PRO C C     1 
ATOM   4687  O  O     . PRO C  2  144  ? 58.384  -32.659 63.838   1.00 56.46  ?  144  PRO C O     1 
ATOM   4688  C  CB    . PRO C  2  144  ? 60.279  -30.642 62.165   1.00 76.33  ?  144  PRO C CB    1 
ATOM   4689  C  CG    . PRO C  2  144  ? 60.900  -29.472 62.833   1.00 68.52  ?  144  PRO C CG    1 
ATOM   4690  C  CD    . PRO C  2  144  ? 60.268  -29.414 64.192   1.00 69.35  ?  144  PRO C CD    1 
ATOM   4691  N  N     . GLY C  2  145  ? 57.757  -32.579 61.678   1.00 57.14  ?  145  GLY C N     1 
ATOM   4692  C  CA    . GLY C  2  145  ? 57.241  -33.934 61.668   1.00 66.84  ?  145  GLY C CA    1 
ATOM   4693  C  C     . GLY C  2  145  ? 56.100  -34.115 60.689   1.00 67.55  ?  145  GLY C C     1 
ATOM   4694  O  O     . GLY C  2  145  ? 55.937  -33.331 59.751   1.00 61.75  ?  145  GLY C O     1 
ATOM   4695  N  N     . VAL C  2  146  ? 55.311  -35.162 60.909   1.00 65.56  ?  146  VAL C N     1 
ATOM   4696  C  CA    . VAL C  2  146  ? 54.136  -35.429 60.091   1.00 83.45  ?  146  VAL C CA    1 
ATOM   4697  C  C     . VAL C  2  146  ? 52.881  -35.373 60.955   1.00 89.03  ?  146  VAL C C     1 
ATOM   4698  O  O     . VAL C  2  146  ? 52.717  -36.173 61.878   1.00 89.90  ?  146  VAL C O     1 
ATOM   4699  C  CB    . VAL C  2  146  ? 54.223  -36.809 59.414   1.00 87.04  ?  146  VAL C CB    1 
ATOM   4700  C  CG1   . VAL C  2  146  ? 53.010  -37.039 58.527   1.00 88.64  ?  146  VAL C CG1   1 
ATOM   4701  C  CG2   . VAL C  2  146  ? 55.506  -36.923 58.606   1.00 84.33  ?  146  VAL C CG2   1 
ATOM   4702  N  N     . TYR C  2  147  ? 51.998  -34.425 60.655   1.00 80.22  ?  147  TYR C N     1 
ATOM   4703  C  CA    . TYR C  2  147  ? 50.789  -34.236 61.452   1.00 75.73  ?  147  TYR C CA    1 
ATOM   4704  C  C     . TYR C  2  147  ? 49.523  -34.465 60.633   1.00 83.10  ?  147  TYR C C     1 
ATOM   4705  O  O     . TYR C  2  147  ? 49.534  -34.345 59.409   1.00 82.03  ?  147  TYR C O     1 
ATOM   4706  C  CB    . TYR C  2  147  ? 50.771  -32.839 62.075   1.00 75.99  ?  147  TYR C CB    1 
ATOM   4707  C  CG    . TYR C  2  147  ? 51.973  -32.541 62.943   1.00 74.53  ?  147  TYR C CG    1 
ATOM   4708  C  CD1   . TYR C  2  147  ? 52.084  -33.081 64.218   1.00 68.65  ?  147  TYR C CD1   1 
ATOM   4709  C  CD2   . TYR C  2  147  ? 52.996  -31.717 62.488   1.00 68.34  ?  147  TYR C CD2   1 
ATOM   4710  C  CE1   . TYR C  2  147  ? 53.181  -32.811 65.016   1.00 64.90  ?  147  TYR C CE1   1 
ATOM   4711  C  CE2   . TYR C  2  147  ? 54.096  -31.441 63.279   1.00 62.36  ?  147  TYR C CE2   1 
ATOM   4712  C  CZ    . TYR C  2  147  ? 54.183  -31.991 64.542   1.00 64.68  ?  147  TYR C CZ    1 
ATOM   4713  O  OH    . TYR C  2  147  ? 55.275  -31.721 65.335   1.00 63.59  ?  147  TYR C OH    1 
ATOM   4714  N  N     . PHE C  2  148  ? 48.434  -34.798 61.318   1.00 83.27  ?  148  PHE C N     1 
ATOM   4715  C  CA    . PHE C  2  148  ? 47.162  -35.070 60.658   1.00 82.12  ?  148  PHE C CA    1 
ATOM   4716  C  C     . PHE C  2  148  ? 46.017  -34.350 61.361   1.00 82.06  ?  148  PHE C C     1 
ATOM   4717  O  O     . PHE C  2  148  ? 45.743  -34.603 62.534   1.00 76.08  ?  148  PHE C O     1 
ATOM   4718  C  CB    . PHE C  2  148  ? 46.894  -36.576 60.626   1.00 80.71  ?  148  PHE C CB    1 
ATOM   4719  C  CG    . PHE C  2  148  ? 47.957  -37.363 59.915   1.00 86.96  ?  148  PHE C CG    1 
ATOM   4720  C  CD1   . PHE C  2  148  ? 49.078  -37.812 60.594   1.00 92.95  ?  148  PHE C CD1   1 
ATOM   4721  C  CD2   . PHE C  2  148  ? 47.838  -37.652 58.566   1.00 94.33  ?  148  PHE C CD2   1 
ATOM   4722  C  CE1   . PHE C  2  148  ? 50.060  -38.532 59.942   1.00 94.83  ?  148  PHE C CE1   1 
ATOM   4723  C  CE2   . PHE C  2  148  ? 48.815  -38.374 57.909   1.00 97.40  ?  148  PHE C CE2   1 
ATOM   4724  C  CZ    . PHE C  2  148  ? 49.928  -38.813 58.597   1.00 97.68  ?  148  PHE C CZ    1 
ATOM   4725  N  N     . THR C  2  149  ? 45.345  -33.458 60.640   1.00 79.97  ?  149  THR C N     1 
ATOM   4726  C  CA    . THR C  2  149  ? 44.270  -32.661 61.228   1.00 76.36  ?  149  THR C CA    1 
ATOM   4727  C  C     . THR C  2  149  ? 42.959  -32.829 60.467   1.00 77.06  ?  149  THR C C     1 
ATOM   4728  O  O     . THR C  2  149  ? 42.966  -32.996 59.254   1.00 84.85  ?  149  THR C O     1 
ATOM   4729  C  CB    . THR C  2  149  ? 44.638  -31.165 61.261   1.00 76.00  ?  149  THR C CB    1 
ATOM   4730  O  OG1   . THR C  2  149  ? 45.021  -30.736 59.949   1.00 73.45  ?  149  THR C OG1   1 
ATOM   4731  C  CG2   . THR C  2  149  ? 45.790  -30.919 62.224   1.00 73.18  ?  149  THR C CG2   1 
ATOM   4732  N  N     . PRO C  2  150  ? 41.824  -32.787 61.182   1.00 76.49  ?  150  PRO C N     1 
ATOM   4733  C  CA    . PRO C  2  150  ? 40.518  -32.879 60.520   1.00 79.48  ?  150  PRO C CA    1 
ATOM   4734  C  C     . PRO C  2  150  ? 40.256  -31.666 59.632   1.00 87.43  ?  150  PRO C C     1 
ATOM   4735  O  O     . PRO C  2  150  ? 40.540  -30.540 60.041   1.00 90.28  ?  150  PRO C O     1 
ATOM   4736  C  CB    . PRO C  2  150  ? 39.531  -32.890 61.692   1.00 77.89  ?  150  PRO C CB    1 
ATOM   4737  C  CG    . PRO C  2  150  ? 40.333  -33.328 62.873   1.00 80.53  ?  150  PRO C CG    1 
ATOM   4738  C  CD    . PRO C  2  150  ? 41.699  -32.762 62.648   1.00 79.12  ?  150  PRO C CD    1 
ATOM   4739  N  N     . ASP C  2  151  ? 39.726  -31.896 58.434   1.00 87.71  ?  151  ASP C N     1 
ATOM   4740  C  CA    . ASP C  2  151  ? 39.411  -30.809 57.515   1.00 84.46  ?  151  ASP C CA    1 
ATOM   4741  C  C     . ASP C  2  151  ? 38.223  -30.025 58.059   1.00 80.17  ?  151  ASP C C     1 
ATOM   4742  O  O     . ASP C  2  151  ? 37.125  -30.566 58.188   1.00 75.08  ?  151  ASP C O     1 
ATOM   4743  C  CB    . ASP C  2  151  ? 39.094  -31.361 56.121   1.00 86.28  ?  151  ASP C CB    1 
ATOM   4744  C  CG    . ASP C  2  151  ? 39.186  -30.304 55.029   1.00 90.88  ?  151  ASP C CG    1 
ATOM   4745  O  OD1   . ASP C  2  151  ? 38.999  -29.106 55.326   1.00 88.75  ?  151  ASP C OD1   1 
ATOM   4746  O  OD2   . ASP C  2  151  ? 39.444  -30.677 53.865   1.00 88.29  ?  151  ASP C OD2   1 
ATOM   4747  N  N     . PRO C  2  152  ? 38.444  -28.742 58.386   1.00 88.54  ?  152  PRO C N     1 
ATOM   4748  C  CA    . PRO C  2  152  ? 37.399  -27.894 58.970   1.00 92.29  ?  152  PRO C CA    1 
ATOM   4749  C  C     . PRO C  2  152  ? 36.226  -27.672 58.019   1.00 91.06  ?  152  PRO C C     1 
ATOM   4750  O  O     . PRO C  2  152  ? 35.074  -27.680 58.455   1.00 89.62  ?  152  PRO C O     1 
ATOM   4751  C  CB    . PRO C  2  152  ? 38.129  -26.572 59.237   1.00 100.34 ?  152  PRO C CB    1 
ATOM   4752  C  CG    . PRO C  2  152  ? 39.299  -26.584 58.309   1.00 95.01  ?  152  PRO C CG    1 
ATOM   4753  C  CD    . PRO C  2  152  ? 39.715  -28.017 58.219   1.00 90.07  ?  152  PRO C CD    1 
ATOM   4754  N  N     . ALA C  2  153  ? 36.519  -27.477 56.737   1.00 94.61  ?  153  ALA C N     1 
ATOM   4755  C  CA    . ALA C  2  153  ? 35.482  -27.234 55.741   1.00 93.67  ?  153  ALA C CA    1 
ATOM   4756  C  C     . ALA C  2  153  ? 34.795  -28.525 55.302   1.00 90.03  ?  153  ALA C C     1 
ATOM   4757  O  O     . ALA C  2  153  ? 33.624  -28.519 54.924   1.00 88.05  ?  153  ALA C O     1 
ATOM   4758  C  CB    . ALA C  2  153  ? 36.067  -26.508 54.534   1.00 81.71  ?  153  ALA C CB    1 
ATOM   4759  N  N     . ARG C  2  154  ? 35.529  -29.631 55.362   1.00 89.38  ?  154  ARG C N     1 
ATOM   4760  C  CA    . ARG C  2  154  ? 35.038  -30.907 54.854   1.00 81.60  ?  154  ARG C CA    1 
ATOM   4761  C  C     . ARG C  2  154  ? 35.085  -32.002 55.914   1.00 78.21  ?  154  ARG C C     1 
ATOM   4762  O  O     . ARG C  2  154  ? 36.101  -32.678 56.063   1.00 89.28  ?  154  ARG C O     1 
ATOM   4763  C  CB    . ARG C  2  154  ? 35.856  -31.333 53.633   1.00 95.01  ?  154  ARG C CB    1 
ATOM   4764  C  CG    . ARG C  2  154  ? 35.833  -30.332 52.488   1.00 88.69  ?  154  ARG C CG    1 
ATOM   4765  C  CD    . ARG C  2  154  ? 36.805  -30.727 51.389   1.00 95.74  ?  154  ARG C CD    1 
ATOM   4766  N  NE    . ARG C  2  154  ? 36.672  -32.133 51.020   1.00 112.91 ?  154  ARG C NE    1 
ATOM   4767  C  CZ    . ARG C  2  154  ? 35.728  -32.610 50.215   1.00 116.73 ?  154  ARG C CZ    1 
ATOM   4768  N  NH1   . ARG C  2  154  ? 34.822  -31.793 49.695   1.00 105.46 ?  154  ARG C NH1   1 
ATOM   4769  N  NH2   . ARG C  2  154  ? 35.685  -33.906 49.935   1.00 114.10 ?  154  ARG C NH2   1 
ATOM   4770  N  N     . PRO C  2  155  ? 33.982  -32.174 56.659   1.00 80.30  ?  155  PRO C N     1 
ATOM   4771  C  CA    . PRO C  2  155  ? 33.876  -33.215 57.690   1.00 85.18  ?  155  PRO C CA    1 
ATOM   4772  C  C     . PRO C  2  155  ? 34.040  -34.616 57.106   1.00 85.60  ?  155  PRO C C     1 
ATOM   4773  O  O     . PRO C  2  155  ? 33.399  -34.943 56.108   1.00 85.26  ?  155  PRO C O     1 
ATOM   4774  C  CB    . PRO C  2  155  ? 32.450  -33.035 58.222   1.00 78.43  ?  155  PRO C CB    1 
ATOM   4775  C  CG    . PRO C  2  155  ? 32.100  -31.624 57.905   1.00 83.61  ?  155  PRO C CG    1 
ATOM   4776  C  CD    . PRO C  2  155  ? 32.775  -31.333 56.600   1.00 84.86  ?  155  PRO C CD    1 
ATOM   4777  N  N     . GLY C  2  156  ? 34.888  -35.430 57.727   1.00 86.56  ?  156  GLY C N     1 
ATOM   4778  C  CA    . GLY C  2  156  ? 35.132  -36.783 57.260   1.00 89.08  ?  156  GLY C CA    1 
ATOM   4779  C  C     . GLY C  2  156  ? 36.432  -36.928 56.488   1.00 92.97  ?  156  GLY C C     1 
ATOM   4780  O  O     . GLY C  2  156  ? 36.864  -38.040 56.186   1.00 91.70  ?  156  GLY C O     1 
ATOM   4781  N  N     . ARG C  2  157  ? 37.058  -35.799 56.173   1.00 90.22  ?  157  ARG C N     1 
ATOM   4782  C  CA    . ARG C  2  157  ? 38.314  -35.795 55.428   1.00 92.82  ?  157  ARG C CA    1 
ATOM   4783  C  C     . ARG C  2  157  ? 39.434  -35.195 56.273   1.00 92.83  ?  157  ARG C C     1 
ATOM   4784  O  O     . ARG C  2  157  ? 39.175  -34.445 57.214   1.00 91.88  ?  157  ARG C O     1 
ATOM   4785  C  CB    . ARG C  2  157  ? 38.161  -35.023 54.116   1.00 96.20  ?  157  ARG C CB    1 
ATOM   4786  C  CG    . ARG C  2  157  ? 37.096  -35.587 53.186   1.00 100.31 ?  157  ARG C CG    1 
ATOM   4787  C  CD    . ARG C  2  157  ? 37.400  -37.029 52.807   1.00 105.96 ?  157  ARG C CD    1 
ATOM   4788  N  NE    . ARG C  2  157  ? 36.336  -37.625 52.003   1.00 107.56 ?  157  ARG C NE    1 
ATOM   4789  C  CZ    . ARG C  2  157  ? 36.287  -37.579 50.675   1.00 111.56 ?  157  ARG C CZ    1 
ATOM   4790  N  NH1   . ARG C  2  157  ? 37.242  -36.960 49.995   1.00 111.91 ?  157  ARG C NH1   1 
ATOM   4791  N  NH2   . ARG C  2  157  ? 35.281  -38.150 50.026   1.00 96.23  ?  157  ARG C NH2   1 
ATOM   4792  N  N     . TYR C  2  158  ? 40.677  -35.532 55.942   1.00 89.17  ?  158  TYR C N     1 
ATOM   4793  C  CA    . TYR C  2  158  ? 41.814  -35.093 56.747   1.00 80.60  ?  158  TYR C CA    1 
ATOM   4794  C  C     . TYR C  2  158  ? 42.949  -34.489 55.922   1.00 76.08  ?  158  TYR C C     1 
ATOM   4795  O  O     . TYR C  2  158  ? 43.104  -34.786 54.738   1.00 83.56  ?  158  TYR C O     1 
ATOM   4796  C  CB    . TYR C  2  158  ? 42.341  -36.251 57.599   1.00 87.17  ?  158  TYR C CB    1 
ATOM   4797  C  CG    . TYR C  2  158  ? 41.296  -36.865 58.505   1.00 92.59  ?  158  TYR C CG    1 
ATOM   4798  C  CD1   . TYR C  2  158  ? 41.085  -36.374 59.787   1.00 88.55  ?  158  TYR C CD1   1 
ATOM   4799  C  CD2   . TYR C  2  158  ? 40.520  -37.935 58.077   1.00 93.84  ?  158  TYR C CD2   1 
ATOM   4800  C  CE1   . TYR C  2  158  ? 40.130  -36.932 60.617   1.00 89.73  ?  158  TYR C CE1   1 
ATOM   4801  C  CE2   . TYR C  2  158  ? 39.563  -38.498 58.900   1.00 90.89  ?  158  TYR C CE2   1 
ATOM   4802  C  CZ    . TYR C  2  158  ? 39.373  -37.993 60.168   1.00 90.84  ?  158  TYR C CZ    1 
ATOM   4803  O  OH    . TYR C  2  158  ? 38.421  -38.552 60.989   1.00 91.50  ?  158  TYR C OH    1 
ATOM   4804  N  N     . ILE C  2  159  ? 43.736  -33.637 56.569   1.00 79.01  ?  159  ILE C N     1 
ATOM   4805  C  CA    . ILE C  2  159  ? 44.891  -33.002 55.953   1.00 77.02  ?  159  ILE C CA    1 
ATOM   4806  C  C     . ILE C  2  159  ? 46.165  -33.501 56.622   1.00 84.56  ?  159  ILE C C     1 
ATOM   4807  O  O     . ILE C  2  159  ? 46.255  -33.549 57.853   1.00 91.91  ?  159  ILE C O     1 
ATOM   4808  C  CB    . ILE C  2  159  ? 44.841  -31.468 56.101   1.00 74.73  ?  159  ILE C CB    1 
ATOM   4809  C  CG1   . ILE C  2  159  ? 43.420  -30.945 55.878   1.00 81.34  ?  159  ILE C CG1   1 
ATOM   4810  C  CG2   . ILE C  2  159  ? 45.835  -30.805 55.155   1.00 68.75  ?  159  ILE C CG2   1 
ATOM   4811  C  CD1   . ILE C  2  159  ? 42.893  -31.172 54.482   1.00 90.17  ?  159  ILE C CD1   1 
ATOM   4812  N  N     . ALA C  2  160  ? 47.145  -33.873 55.804   1.00 81.82  ?  160  ALA C N     1 
ATOM   4813  C  CA    . ALA C  2  160  ? 48.436  -34.328 56.300   1.00 73.37  ?  160  ALA C CA    1 
ATOM   4814  C  C     . ALA C  2  160  ? 49.509  -33.284 56.015   1.00 75.54  ?  160  ALA C C     1 
ATOM   4815  O  O     . ALA C  2  160  ? 49.806  -32.985 54.858   1.00 80.62  ?  160  ALA C O     1 
ATOM   4816  C  CB    . ALA C  2  160  ? 48.806  -35.655 55.665   1.00 76.64  ?  160  ALA C CB    1 
ATOM   4817  N  N     . SER C  2  161  ? 50.085  -32.731 57.075   1.00 79.93  ?  161  SER C N     1 
ATOM   4818  C  CA    . SER C  2  161  ? 51.112  -31.707 56.937   1.00 84.95  ?  161  SER C CA    1 
ATOM   4819  C  C     . SER C  2  161  ? 52.495  -32.264 57.244   1.00 81.05  ?  161  SER C C     1 
ATOM   4820  O  O     . SER C  2  161  ? 52.715  -32.867 58.297   1.00 83.08  ?  161  SER C O     1 
ATOM   4821  C  CB    . SER C  2  161  ? 50.813  -30.519 57.855   1.00 89.13  ?  161  SER C CB    1 
ATOM   4822  O  OG    . SER C  2  161  ? 49.561  -29.931 57.545   1.00 89.47  ?  161  SER C OG    1 
ATOM   4823  N  N     . ILE C  2  162  ? 53.422  -32.069 56.312   1.00 80.13  ?  162  ILE C N     1 
ATOM   4824  C  CA    . ILE C  2  162  ? 54.813  -32.447 56.524   1.00 85.17  ?  162  ILE C CA    1 
ATOM   4825  C  C     . ILE C  2  162  ? 55.646  -31.193 56.763   1.00 82.52  ?  162  ILE C C     1 
ATOM   4826  O  O     . ILE C  2  162  ? 55.888  -30.411 55.843   1.00 80.64  ?  162  ILE C O     1 
ATOM   4827  C  CB    . ILE C  2  162  ? 55.374  -33.215 55.318   1.00 84.29  ?  162  ILE C CB    1 
ATOM   4828  C  CG1   . ILE C  2  162  ? 54.532  -34.466 55.052   1.00 85.78  ?  162  ILE C CG1   1 
ATOM   4829  C  CG2   . ILE C  2  162  ? 56.828  -33.584 55.554   1.00 85.77  ?  162  ILE C CG2   1 
ATOM   4830  C  CD1   . ILE C  2  162  ? 54.971  -35.252 53.838   1.00 89.93  ?  162  ILE C CD1   1 
ATOM   4831  N  N     . ILE C  2  163  ? 56.081  -31.010 58.005   1.00 71.07  ?  163  ILE C N     1 
ATOM   4832  C  CA    . ILE C  2  163  ? 56.763  -29.785 58.406   1.00 74.23  ?  163  ILE C CA    1 
ATOM   4833  C  C     . ILE C  2  163  ? 58.245  -29.992 58.713   1.00 73.88  ?  163  ILE C C     1 
ATOM   4834  O  O     . ILE C  2  163  ? 58.596  -30.856 59.510   1.00 68.30  ?  163  ILE C O     1 
ATOM   4835  C  CB    . ILE C  2  163  ? 56.071  -29.130 59.618   1.00 80.62  ?  163  ILE C CB    1 
ATOM   4836  C  CG1   . ILE C  2  163  ? 54.579  -28.942 59.336   1.00 81.85  ?  163  ILE C CG1   1 
ATOM   4837  C  CG2   . ILE C  2  163  ? 56.722  -27.798 59.951   1.00 79.38  ?  163  ILE C CG2   1 
ATOM   4838  C  CD1   . ILE C  2  163  ? 53.827  -28.255 60.453   1.00 74.96  ?  163  ILE C CD1   1 
ATOM   4839  N  N     . PRO C  2  164  ? 59.118  -29.221 58.046   1.00 81.36  ?  164  PRO C N     1 
ATOM   4840  C  CA    . PRO C  2  164  ? 60.547  -29.159 58.368   1.00 77.87  ?  164  PRO C CA    1 
ATOM   4841  C  C     . PRO C  2  164  ? 60.841  -28.044 59.367   1.00 73.87  ?  164  PRO C C     1 
ATOM   4842  O  O     . PRO C  2  164  ? 59.917  -27.373 59.822   1.00 79.52  ?  164  PRO C O     1 
ATOM   4843  C  CB    . PRO C  2  164  ? 61.178  -28.821 57.021   1.00 83.87  ?  164  PRO C CB    1 
ATOM   4844  C  CG    . PRO C  2  164  ? 60.158  -27.962 56.366   1.00 82.60  ?  164  PRO C CG    1 
ATOM   4845  C  CD    . PRO C  2  164  ? 58.806  -28.469 56.818   1.00 85.73  ?  164  PRO C CD    1 
ATOM   4846  N  N     . LEU C  2  165  ? 62.113  -27.852 59.701   1.00 76.58  ?  165  LEU C N     1 
ATOM   4847  C  CA    . LEU C  2  165  ? 62.522  -26.758 60.577   1.00 77.90  ?  165  LEU C CA    1 
ATOM   4848  C  C     . LEU C  2  165  ? 62.307  -25.415 59.876   1.00 76.97  ?  165  LEU C C     1 
ATOM   4849  O  O     . LEU C  2  165  ? 62.226  -25.366 58.648   1.00 72.89  ?  165  LEU C O     1 
ATOM   4850  C  CB    . LEU C  2  165  ? 63.993  -26.917 60.970   1.00 76.07  ?  165  LEU C CB    1 
ATOM   4851  C  CG    . LEU C  2  165  ? 64.418  -28.097 61.841   1.00 78.13  ?  165  LEU C CG    1 
ATOM   4852  C  CD1   . LEU C  2  165  ? 65.913  -28.324 61.705   1.00 78.92  ?  165  LEU C CD1   1 
ATOM   4853  C  CD2   . LEU C  2  165  ? 64.053  -27.845 63.293   1.00 73.64  ?  165  LEU C CD2   1 
ATOM   4854  N  N     . PRO C  2  166  ? 62.200  -24.323 60.655   1.00 78.82  ?  166  PRO C N     1 
ATOM   4855  C  CA    . PRO C  2  166  ? 62.037  -22.975 60.093   1.00 77.39  ?  166  PRO C CA    1 
ATOM   4856  C  C     . PRO C  2  166  ? 63.152  -22.579 59.124   1.00 73.57  ?  166  PRO C C     1 
ATOM   4857  O  O     . PRO C  2  166  ? 64.333  -22.721 59.444   1.00 76.27  ?  166  PRO C O     1 
ATOM   4858  C  CB    . PRO C  2  166  ? 62.076  -22.079 61.332   1.00 72.09  ?  166  PRO C CB    1 
ATOM   4859  C  CG    . PRO C  2  166  ? 61.535  -22.938 62.415   1.00 75.69  ?  166  PRO C CG    1 
ATOM   4860  C  CD    . PRO C  2  166  ? 62.040  -24.323 62.121   1.00 79.58  ?  166  PRO C CD    1 
ATOM   4861  N  N     . LYS C  2  167  ? 62.756  -22.093 57.948   1.00 69.09  ?  167  LYS C N     1 
ATOM   4862  C  CA    . LYS C  2  167  ? 63.675  -21.687 56.879   1.00 77.96  ?  167  LYS C CA    1 
ATOM   4863  C  C     . LYS C  2  167  ? 64.593  -22.822 56.428   1.00 84.13  ?  167  LYS C C     1 
ATOM   4864  O  O     . LYS C  2  167  ? 65.653  -22.591 55.846   1.00 81.18  ?  167  LYS C O     1 
ATOM   4865  C  CB    . LYS C  2  167  ? 64.486  -20.450 57.277   1.00 73.75  ?  167  LYS C CB    1 
ATOM   4866  C  CG    . LYS C  2  167  ? 63.654  -19.184 57.391   1.00 71.59  ?  167  LYS C CG    1 
ATOM   4867  C  CD    . LYS C  2  167  ? 64.530  -17.944 57.434   1.00 70.09  ?  167  LYS C CD    1 
ATOM   4868  C  CE    . LYS C  2  167  ? 63.689  -16.678 57.393   1.00 81.03  ?  167  LYS C CE    1 
ATOM   4869  N  NZ    . LYS C  2  167  ? 64.530  -15.452 57.313   1.00 89.44  ?  167  LYS C NZ    1 
ATOM   4870  N  N     . ARG C  2  168  ? 64.164  -24.046 56.708   1.00 85.30  ?  168  ARG C N     1 
ATOM   4871  C  CA    . ARG C  2  168  ? 64.823  -25.254 56.228   1.00 88.03  ?  168  ARG C CA    1 
ATOM   4872  C  C     . ARG C  2  168  ? 64.155  -25.786 54.964   1.00 85.83  ?  168  ARG C C     1 
ATOM   4873  O  O     . ARG C  2  168  ? 64.403  -26.912 54.547   1.00 89.34  ?  168  ARG C O     1 
ATOM   4874  C  CB    . ARG C  2  168  ? 64.951  -26.311 57.325   1.00 88.69  ?  168  ARG C CB    1 
ATOM   4875  C  CG    . ARG C  2  168  ? 65.992  -25.954 58.389   1.00 94.46  ?  168  ARG C CG    1 
ATOM   4876  C  CD    . ARG C  2  168  ? 67.426  -26.264 57.962   1.00 99.46  ?  168  ARG C CD    1 
ATOM   4877  N  NE    . ARG C  2  168  ? 67.954  -25.324 56.976   1.00 98.92  ?  168  ARG C NE    1 
ATOM   4878  C  CZ    . ARG C  2  168  ? 69.202  -25.346 56.518   1.00 93.84  ?  168  ARG C CZ    1 
ATOM   4879  N  NH1   . ARG C  2  168  ? 70.055  -26.260 56.961   1.00 97.89  ?  168  ARG C NH1   1 
ATOM   4880  N  NH2   . ARG C  2  168  ? 69.597  -24.453 55.619   1.00 80.74  ?  168  ARG C NH2   1 
ATOM   4881  N  N     . GLY C  2  169  ? 63.280  -24.973 54.382   1.00 87.55  ?  169  GLY C N     1 
ATOM   4882  C  CA    . GLY C  2  169  ? 62.487  -25.380 53.236   1.00 92.36  ?  169  GLY C CA    1 
ATOM   4883  C  C     . GLY C  2  169  ? 60.998  -25.459 53.510   1.00 97.70  ?  169  GLY C C     1 
ATOM   4884  O  O     . GLY C  2  169  ? 60.564  -25.388 54.659   1.00 103.85 ?  169  GLY C O     1 
ATOM   4885  N  N     . PRO C  2  170  ? 60.204  -25.590 52.437   1.00 97.55  ?  170  PRO C N     1 
ATOM   4886  C  CA    . PRO C  2  170  ? 58.755  -25.350 52.410   1.00 96.08  ?  170  PRO C CA    1 
ATOM   4887  C  C     . PRO C  2  170  ? 57.904  -26.382 53.144   1.00 91.51  ?  170  PRO C C     1 
ATOM   4888  O  O     . PRO C  2  170  ? 58.296  -27.541 53.283   1.00 87.18  ?  170  PRO C O     1 
ATOM   4889  C  CB    . PRO C  2  170  ? 58.434  -25.397 50.915   1.00 98.23  ?  170  PRO C CB    1 
ATOM   4890  C  CG    . PRO C  2  170  ? 59.439  -26.343 50.363   1.00 94.44  ?  170  PRO C CG    1 
ATOM   4891  C  CD    . PRO C  2  170  ? 60.700  -26.081 51.138   1.00 88.10  ?  170  PRO C CD    1 
ATOM   4892  N  N     . TRP C  2  171  ? 56.736  -25.941 53.604   1.00 84.70  ?  171  TRP C N     1 
ATOM   4893  C  CA    . TRP C  2  171  ? 55.734  -26.839 54.162   1.00 87.82  ?  171  TRP C CA    1 
ATOM   4894  C  C     . TRP C  2  171  ? 55.030  -27.560 53.021   1.00 87.98  ?  171  TRP C C     1 
ATOM   4895  O  O     . TRP C  2  171  ? 54.854  -27.001 51.939   1.00 91.33  ?  171  TRP C O     1 
ATOM   4896  C  CB    . TRP C  2  171  ? 54.709  -26.066 54.999   1.00 89.89  ?  171  TRP C CB    1 
ATOM   4897  C  CG    . TRP C  2  171  ? 55.242  -25.537 56.298   1.00 96.92  ?  171  TRP C CG    1 
ATOM   4898  C  CD1   . TRP C  2  171  ? 56.552  -25.387 56.650   1.00 98.23  ?  171  TRP C CD1   1 
ATOM   4899  C  CD2   . TRP C  2  171  ? 54.472  -25.098 57.426   1.00 95.92  ?  171  TRP C CD2   1 
ATOM   4900  N  NE1   . TRP C  2  171  ? 56.646  -24.877 57.923   1.00 88.77  ?  171  TRP C NE1   1 
ATOM   4901  C  CE2   . TRP C  2  171  ? 55.383  -24.691 58.421   1.00 90.21  ?  171  TRP C CE2   1 
ATOM   4902  C  CE3   . TRP C  2  171  ? 53.101  -25.006 57.687   1.00 92.46  ?  171  TRP C CE3   1 
ATOM   4903  C  CZ2   . TRP C  2  171  ? 54.968  -24.202 59.659   1.00 81.98  ?  171  TRP C CZ2   1 
ATOM   4904  C  CZ3   . TRP C  2  171  ? 52.690  -24.520 58.917   1.00 89.01  ?  171  TRP C CZ3   1 
ATOM   4905  C  CH2   . TRP C  2  171  ? 53.621  -24.124 59.886   1.00 83.96  ?  171  TRP C CH2   1 
ATOM   4906  N  N     . ILE C  2  172  ? 54.626  -28.802 53.265   1.00 86.21  ?  172  ILE C N     1 
ATOM   4907  C  CA    . ILE C  2  172  ? 53.982  -29.611 52.235   1.00 90.27  ?  172  ILE C CA    1 
ATOM   4908  C  C     . ILE C  2  172  ? 52.644  -30.157 52.724   1.00 87.72  ?  172  ILE C C     1 
ATOM   4909  O  O     . ILE C  2  172  ? 52.583  -30.826 53.757   1.00 86.65  ?  172  ILE C O     1 
ATOM   4910  C  CB    . ILE C  2  172  ? 54.884  -30.783 51.806   1.00 98.61  ?  172  ILE C CB    1 
ATOM   4911  C  CG1   . ILE C  2  172  ? 56.219  -30.257 51.270   1.00 94.10  ?  172  ILE C CG1   1 
ATOM   4912  C  CG2   . ILE C  2  172  ? 54.183  -31.642 50.769   1.00 95.88  ?  172  ILE C CG2   1 
ATOM   4913  C  CD1   . ILE C  2  172  ? 57.147  -31.336 50.766   1.00 89.13  ?  172  ILE C CD1   1 
ATOM   4914  N  N     . ASP C  2  173  ? 51.572  -29.879 51.984   1.00 85.73  ?  173  ASP C N     1 
ATOM   4915  C  CA    . ASP C  2  173  ? 50.240  -30.296 52.431   1.00 89.05  ?  173  ASP C CA    1 
ATOM   4916  C  C     . ASP C  2  173  ? 49.551  -31.312 51.517   1.00 92.42  ?  173  ASP C C     1 
ATOM   4917  O  O     . ASP C  2  173  ? 49.206  -31.005 50.378   1.00 97.74  ?  173  ASP C O     1 
ATOM   4918  C  CB    . ASP C  2  173  ? 49.332  -29.080 52.649   1.00 94.96  ?  173  ASP C CB    1 
ATOM   4919  C  CG    . ASP C  2  173  ? 49.594  -28.384 53.971   1.00 91.96  ?  173  ASP C CG    1 
ATOM   4920  O  OD1   . ASP C  2  173  ? 49.056  -28.843 55.001   1.00 89.96  ?  173  ASP C OD1   1 
ATOM   4921  O  OD2   . ASP C  2  173  ? 50.336  -27.378 53.981   1.00 90.21  ?  173  ASP C OD2   1 
ATOM   4922  N  N     . LEU C  2  174  ? 49.335  -32.517 52.035   1.00 80.34  ?  174  LEU C N     1 
ATOM   4923  C  CA    . LEU C  2  174  ? 48.636  -33.561 51.289   1.00 85.71  ?  174  LEU C CA    1 
ATOM   4924  C  C     . LEU C  2  174  ? 47.181  -33.669 51.735   1.00 92.51  ?  174  LEU C C     1 
ATOM   4925  O  O     . LEU C  2  174  ? 46.893  -33.675 52.931   1.00 96.82  ?  174  LEU C O     1 
ATOM   4926  C  CB    . LEU C  2  174  ? 49.330  -34.914 51.471   1.00 77.89  ?  174  LEU C CB    1 
ATOM   4927  C  CG    . LEU C  2  174  ? 50.493  -35.279 50.544   1.00 84.94  ?  174  LEU C CG    1 
ATOM   4928  C  CD1   . LEU C  2  174  ? 51.650  -34.299 50.669   1.00 85.44  ?  174  LEU C CD1   1 
ATOM   4929  C  CD2   . LEU C  2  174  ? 50.960  -36.697 50.834   1.00 90.32  ?  174  LEU C CD2   1 
ATOM   4930  N  N     . GLU C  2  175  ? 46.264  -33.759 50.775   1.00 100.65 ?  175  GLU C N     1 
ATOM   4931  C  CA    . GLU C  2  175  ? 44.845  -33.894 51.102   1.00 96.02  ?  175  GLU C CA    1 
ATOM   4932  C  C     . GLU C  2  175  ? 44.053  -34.570 49.990   1.00 102.24 ?  175  GLU C C     1 
ATOM   4933  O  O     . GLU C  2  175  ? 44.522  -34.682 48.858   1.00 104.07 ?  175  GLU C O     1 
ATOM   4934  C  CB    . GLU C  2  175  ? 44.221  -32.531 51.418   1.00 93.31  ?  175  GLU C CB    1 
ATOM   4935  C  CG    . GLU C  2  175  ? 44.119  -31.598 50.221   1.00 102.70 ?  175  GLU C CG    1 
ATOM   4936  C  CD    . GLU C  2  175  ? 43.127  -30.470 50.439   1.00 97.57  ?  175  GLU C CD    1 
ATOM   4937  O  OE1   . GLU C  2  175  ? 43.270  -29.416 49.782   1.00 93.57  ?  175  GLU C OE1   1 
ATOM   4938  O  OE2   . GLU C  2  175  ? 42.200  -30.640 51.259   1.00 90.03  ?  175  GLU C OE2   1 
ATOM   4939  N  N     . VAL C  2  176  ? 42.849  -35.025 50.322   1.00 105.45 ?  176  VAL C N     1 
ATOM   4940  C  CA    . VAL C  2  176  ? 41.951  -35.603 49.330   1.00 116.76 ?  176  VAL C CA    1 
ATOM   4941  C  C     . VAL C  2  176  ? 40.883  -34.589 48.932   1.00 120.58 ?  176  VAL C C     1 
ATOM   4942  O  O     . VAL C  2  176  ? 40.001  -34.255 49.724   1.00 115.89 ?  176  VAL C O     1 
ATOM   4943  C  CB    . VAL C  2  176  ? 41.270  -36.882 49.854   1.00 102.70 ?  176  VAL C CB    1 
ATOM   4944  C  CG1   . VAL C  2  176  ? 40.317  -37.440 48.809   1.00 95.99  ?  176  VAL C CG1   1 
ATOM   4945  C  CG2   . VAL C  2  176  ? 42.314  -37.919 50.238   1.00 95.47  ?  176  VAL C CG2   1 
ATOM   4946  N  N     . GLU C  2  177  ? 40.972  -34.105 47.697   1.00 120.56 ?  177  GLU C N     1 
ATOM   4947  C  CA    . GLU C  2  177  ? 40.042  -33.103 47.189   1.00 112.16 ?  177  GLU C CA    1 
ATOM   4948  C  C     . GLU C  2  177  ? 38.741  -33.749 46.706   1.00 113.14 ?  177  GLU C C     1 
ATOM   4949  O  O     . GLU C  2  177  ? 38.745  -34.902 46.275   1.00 113.15 ?  177  GLU C O     1 
ATOM   4950  C  CB    . GLU C  2  177  ? 40.707  -32.285 46.077   1.00 103.26 ?  177  GLU C CB    1 
ATOM   4951  C  CG    . GLU C  2  177  ? 41.794  -31.352 46.590   1.00 106.88 ?  177  GLU C CG    1 
ATOM   4952  C  CD    . GLU C  2  177  ? 42.430  -30.525 45.491   1.00 121.08 ?  177  GLU C CD    1 
ATOM   4953  O  OE1   . GLU C  2  177  ? 42.174  -30.814 44.303   1.00 127.76 ?  177  GLU C OE1   1 
ATOM   4954  O  OE2   . GLU C  2  177  ? 43.187  -29.586 45.818   1.00 111.11 ?  177  GLU C OE2   1 
ATOM   4955  N  N     . PRO C  2  178  ? 37.622  -33.005 46.786   1.00 111.48 ?  178  PRO C N     1 
ATOM   4956  C  CA    . PRO C  2  178  ? 36.284  -33.510 46.448   1.00 109.28 ?  178  PRO C CA    1 
ATOM   4957  C  C     . PRO C  2  178  ? 36.172  -34.159 45.068   1.00 114.36 ?  178  PRO C C     1 
ATOM   4958  O  O     . PRO C  2  178  ? 35.328  -35.036 44.886   1.00 110.73 ?  178  PRO C O     1 
ATOM   4959  C  CB    . PRO C  2  178  ? 35.402  -32.252 46.513   1.00 108.77 ?  178  PRO C CB    1 
ATOM   4960  C  CG    . PRO C  2  178  ? 36.353  -31.092 46.539   1.00 108.12 ?  178  PRO C CG    1 
ATOM   4961  C  CD    . PRO C  2  178  ? 37.565  -31.604 47.236   1.00 112.97 ?  178  PRO C CD    1 
ATOM   4962  N  N     . ASN C  2  179  ? 37.005  -33.744 44.116   1.00 117.86 ?  179  ASN C N     1 
ATOM   4963  C  CA    . ASN C  2  179  ? 36.958  -34.318 42.773   1.00 110.56 ?  179  ASN C CA    1 
ATOM   4964  C  C     . ASN C  2  179  ? 37.442  -35.768 42.738   1.00 106.90 ?  179  ASN C C     1 
ATOM   4965  O  O     . ASN C  2  179  ? 37.319  -36.450 41.720   1.00 102.08 ?  179  ASN C O     1 
ATOM   4966  C  CB    . ASN C  2  179  ? 37.733  -33.455 41.773   1.00 102.58 ?  179  ASN C CB    1 
ATOM   4967  C  CG    . ASN C  2  179  ? 39.231  -33.654 41.865   1.00 104.66 ?  179  ASN C CG    1 
ATOM   4968  O  OD1   . ASN C  2  179  ? 39.813  -34.415 41.094   1.00 96.89  ?  179  ASN C OD1   1 
ATOM   4969  N  ND2   . ASN C  2  179  ? 39.864  -32.965 42.807   1.00 111.86 ?  179  ASN C ND2   1 
ATOM   4970  N  N     . GLY C  2  180  ? 37.995  -36.230 43.856   1.00 109.53 ?  180  GLY C N     1 
ATOM   4971  C  CA    . GLY C  2  180  ? 38.345  -37.628 44.020   1.00 104.77 ?  180  GLY C CA    1 
ATOM   4972  C  C     . GLY C  2  180  ? 39.827  -37.949 43.983   1.00 105.65 ?  180  GLY C C     1 
ATOM   4973  O  O     . GLY C  2  180  ? 40.232  -39.033 44.399   1.00 101.62 ?  180  GLY C O     1 
ATOM   4974  N  N     . VAL C  2  181  ? 40.642  -37.015 43.501   1.00 114.55 ?  181  VAL C N     1 
ATOM   4975  C  CA    . VAL C  2  181  ? 42.079  -37.256 43.388   1.00 114.51 ?  181  VAL C CA    1 
ATOM   4976  C  C     . VAL C  2  181  ? 42.825  -36.936 44.682   1.00 114.39 ?  181  VAL C C     1 
ATOM   4977  O  O     . VAL C  2  181  ? 42.225  -36.517 45.672   1.00 109.84 ?  181  VAL C O     1 
ATOM   4978  C  CB    . VAL C  2  181  ? 42.714  -36.444 42.236   1.00 105.85 ?  181  VAL C CB    1 
ATOM   4979  C  CG1   . VAL C  2  181  ? 42.039  -36.774 40.913   1.00 100.50 ?  181  VAL C CG1   1 
ATOM   4980  C  CG2   . VAL C  2  181  ? 42.641  -34.953 42.529   1.00 105.82 ?  181  VAL C CG2   1 
ATOM   4981  N  N     . VAL C  2  182  ? 44.138  -37.142 44.662   1.00 115.75 ?  182  VAL C N     1 
ATOM   4982  C  CA    . VAL C  2  182  ? 44.990  -36.805 45.797   1.00 106.92 ?  182  VAL C CA    1 
ATOM   4983  C  C     . VAL C  2  182  ? 45.884  -35.613 45.459   1.00 104.48 ?  182  VAL C C     1 
ATOM   4984  O  O     . VAL C  2  182  ? 46.641  -35.644 44.488   1.00 102.50 ?  182  VAL C O     1 
ATOM   4985  C  CB    . VAL C  2  182  ? 45.848  -38.010 46.248   1.00 102.97 ?  182  VAL C CB    1 
ATOM   4986  C  CG1   . VAL C  2  182  ? 46.471  -38.716 45.047   1.00 112.43 ?  182  VAL C CG1   1 
ATOM   4987  C  CG2   . VAL C  2  182  ? 46.914  -37.567 47.237   1.00 105.10 ?  182  VAL C CG2   1 
ATOM   4988  N  N     . SER C  2  183  ? 45.786  -34.558 46.262   1.00 98.25  ?  183  SER C N     1 
ATOM   4989  C  CA    . SER C  2  183  ? 46.500  -33.320 45.972   1.00 102.85 ?  183  SER C CA    1 
ATOM   4990  C  C     . SER C  2  183  ? 47.611  -33.013 46.971   1.00 102.51 ?  183  SER C C     1 
ATOM   4991  O  O     . SER C  2  183  ? 47.509  -33.320 48.162   1.00 101.53 ?  183  SER C O     1 
ATOM   4992  C  CB    . SER C  2  183  ? 45.525  -32.144 45.901   1.00 102.00 ?  183  SER C CB    1 
ATOM   4993  O  OG    . SER C  2  183  ? 44.892  -31.934 47.149   1.00 105.81 ?  183  SER C OG    1 
ATOM   4994  N  N     . MET C  2  184  ? 48.669  -32.392 46.458   1.00 99.86  ?  184  MET C N     1 
ATOM   4995  C  CA    . MET C  2  184  ? 49.824  -32.000 47.250   1.00 91.67  ?  184  MET C CA    1 
ATOM   4996  C  C     . MET C  2  184  ? 50.121  -30.522 47.012   1.00 100.08 ?  184  MET C C     1 
ATOM   4997  O  O     . MET C  2  184  ? 50.039  -30.037 45.878   1.00 108.82 ?  184  MET C O     1 
ATOM   4998  C  CB    . MET C  2  184  ? 51.031  -32.859 46.868   1.00 98.91  ?  184  MET C CB    1 
ATOM   4999  C  CG    . MET C  2  184  ? 52.366  -32.386 47.417   1.00 100.58 ?  184  MET C CG    1 
ATOM   5000  S  SD    . MET C  2  184  ? 53.703  -33.450 46.843   1.00 110.00 ?  184  MET C SD    1 
ATOM   5001  C  CE    . MET C  2  184  ? 55.146  -32.558 47.409   1.00 83.71  ?  184  MET C CE    1 
ATOM   5002  N  N     . LYS C  2  185  ? 50.457  -29.810 48.085   1.00 93.64  ?  185  LYS C N     1 
ATOM   5003  C  CA    . LYS C  2  185  ? 50.712  -28.377 48.015   1.00 98.52  ?  185  LYS C CA    1 
ATOM   5004  C  C     . LYS C  2  185  ? 52.118  -28.028 48.485   1.00 91.49  ?  185  LYS C C     1 
ATOM   5005  O  O     . LYS C  2  185  ? 52.507  -28.349 49.616   1.00 95.59  ?  185  LYS C O     1 
ATOM   5006  C  CB    . LYS C  2  185  ? 49.689  -27.602 48.848   1.00 99.87  ?  185  LYS C CB    1 
ATOM   5007  C  CG    . LYS C  2  185  ? 49.849  -26.088 48.768   1.00 97.29  ?  185  LYS C CG    1 
ATOM   5008  C  CD    . LYS C  2  185  ? 49.170  -25.389 49.936   1.00 90.43  ?  185  LYS C CD    1 
ATOM   5009  C  CE    . LYS C  2  185  ? 47.692  -25.735 50.014   1.00 88.29  ?  185  LYS C CE    1 
ATOM   5010  N  NZ    . LYS C  2  185  ? 47.042  -25.115 51.203   1.00 72.02  ?  185  LYS C NZ    1 
ATOM   5011  N  N     . VAL C  2  186  ? 52.865  -27.373 47.599   1.00 80.24  ?  186  VAL C N     1 
ATOM   5012  C  CA    . VAL C  2  186  ? 54.200  -26.863 47.888   1.00 84.17  ?  186  VAL C CA    1 
ATOM   5013  C  C     . VAL C  2  186  ? 54.332  -25.456 47.317   1.00 95.99  ?  186  VAL C C     1 
ATOM   5014  O  O     . VAL C  2  186  ? 54.079  -25.242 46.130   1.00 101.32 ?  186  VAL C O     1 
ATOM   5015  C  CB    . VAL C  2  186  ? 55.290  -27.746 47.258   1.00 84.51  ?  186  VAL C CB    1 
ATOM   5016  C  CG1   . VAL C  2  186  ? 56.644  -27.053 47.320   1.00 85.51  ?  186  VAL C CG1   1 
ATOM   5017  C  CG2   . VAL C  2  186  ? 55.344  -29.089 47.952   1.00 92.22  ?  186  VAL C CG2   1 
ATOM   5018  N  N     . ASN C  2  187  ? 54.733  -24.507 48.161   1.00 102.93 ?  187  ASN C N     1 
ATOM   5019  C  CA    . ASN C  2  187  ? 54.839  -23.100 47.773   1.00 103.09 ?  187  ASN C CA    1 
ATOM   5020  C  C     . ASN C  2  187  ? 53.530  -22.555 47.206   1.00 103.90 ?  187  ASN C C     1 
ATOM   5021  O  O     . ASN C  2  187  ? 53.531  -21.810 46.224   1.00 96.50  ?  187  ASN C O     1 
ATOM   5022  C  CB    . ASN C  2  187  ? 55.985  -22.885 46.778   1.00 97.52  ?  187  ASN C CB    1 
ATOM   5023  C  CG    . ASN C  2  187  ? 57.344  -23.188 47.377   1.00 103.63 ?  187  ASN C CG    1 
ATOM   5024  O  OD1   . ASN C  2  187  ? 58.063  -24.068 46.903   1.00 101.85 ?  187  ASN C OD1   1 
ATOM   5025  N  ND2   . ASN C  2  187  ? 57.705  -22.455 48.425   1.00 106.56 ?  187  ASN C ND2   1 
ATOM   5026  N  N     . LYS C  2  188  ? 52.423  -22.940 47.836   1.00 106.26 ?  188  LYS C N     1 
ATOM   5027  C  CA    . LYS C  2  188  ? 51.081  -22.552 47.405   1.00 101.54 ?  188  LYS C CA    1 
ATOM   5028  C  C     . LYS C  2  188  ? 50.774  -22.983 45.970   1.00 107.36 ?  188  LYS C C     1 
ATOM   5029  O  O     . LYS C  2  188  ? 50.204  -22.220 45.190   1.00 105.15 ?  188  LYS C O     1 
ATOM   5030  C  CB    . LYS C  2  188  ? 50.856  -21.046 47.584   1.00 110.81 ?  188  LYS C CB    1 
ATOM   5031  C  CG    . LYS C  2  188  ? 50.898  -20.583 49.033   1.00 113.18 ?  188  LYS C CG    1 
ATOM   5032  C  CD    . LYS C  2  188  ? 50.695  -19.078 49.147   1.00 111.43 ?  188  LYS C CD    1 
ATOM   5033  C  CE    . LYS C  2  188  ? 51.819  -18.310 48.468   1.00 117.52 ?  188  LYS C CE    1 
ATOM   5034  N  NZ    . LYS C  2  188  ? 53.148  -18.607 49.072   1.00 117.26 ?  188  LYS C NZ    1 
ATOM   5035  N  N     . ARG C  2  189  ? 51.159  -24.211 45.632   1.00 108.65 ?  189  ARG C N     1 
ATOM   5036  C  CA    . ARG C  2  189  ? 50.834  -24.797 44.336   1.00 97.58  ?  189  ARG C CA    1 
ATOM   5037  C  C     . ARG C  2  189  ? 50.254  -26.194 44.523   1.00 97.58  ?  189  ARG C C     1 
ATOM   5038  O  O     . ARG C  2  189  ? 50.934  -27.095 45.012   1.00 97.32  ?  189  ARG C O     1 
ATOM   5039  C  CB    . ARG C  2  189  ? 52.075  -24.871 43.445   1.00 91.11  ?  189  ARG C CB    1 
ATOM   5040  C  CG    . ARG C  2  189  ? 52.584  -23.528 42.951   1.00 93.75  ?  189  ARG C CG    1 
ATOM   5041  C  CD    . ARG C  2  189  ? 53.858  -23.704 42.140   1.00 103.20 ?  189  ARG C CD    1 
ATOM   5042  N  NE    . ARG C  2  189  ? 54.314  -22.451 41.545   1.00 107.20 ?  189  ARG C NE    1 
ATOM   5043  C  CZ    . ARG C  2  189  ? 54.035  -22.070 40.303   1.00 112.17 ?  189  ARG C CZ    1 
ATOM   5044  N  NH1   . ARG C  2  189  ? 53.299  -22.846 39.518   1.00 109.09 ?  189  ARG C NH1   1 
ATOM   5045  N  NH2   . ARG C  2  189  ? 54.493  -20.914 39.843   1.00 117.72 ?  189  ARG C NH2   1 
ATOM   5046  N  N     . LYS C  2  190  ? 48.998  -26.370 44.126   1.00 101.38 ?  190  LYS C N     1 
ATOM   5047  C  CA    . LYS C  2  190  ? 48.331  -27.662 44.252   1.00 101.54 ?  190  LYS C CA    1 
ATOM   5048  C  C     . LYS C  2  190  ? 48.496  -28.502 42.990   1.00 109.38 ?  190  LYS C C     1 
ATOM   5049  O  O     . LYS C  2  190  ? 48.163  -28.058 41.891   1.00 110.10 ?  190  LYS C O     1 
ATOM   5050  C  CB    . LYS C  2  190  ? 46.842  -27.474 44.555   1.00 95.61  ?  190  LYS C CB    1 
ATOM   5051  C  CG    . LYS C  2  190  ? 46.542  -26.865 45.914   1.00 96.36  ?  190  LYS C CG    1 
ATOM   5052  C  CD    . LYS C  2  190  ? 45.041  -26.814 46.163   1.00 100.17 ?  190  LYS C CD    1 
ATOM   5053  C  CE    . LYS C  2  190  ? 44.721  -26.261 47.542   1.00 101.90 ?  190  LYS C CE    1 
ATOM   5054  N  NZ    . LYS C  2  190  ? 43.254  -26.238 47.800   1.00 92.70  ?  190  LYS C NZ    1 
ATOM   5055  N  N     . PHE C  2  191  ? 49.011  -29.717 43.150   1.00 109.65 ?  191  PHE C N     1 
ATOM   5056  C  CA    . PHE C  2  191  ? 49.148  -30.632 42.019   1.00 110.08 ?  191  PHE C CA    1 
ATOM   5057  C  C     . PHE C  2  191  ? 48.909  -32.078 42.452   1.00 108.19 ?  191  PHE C C     1 
ATOM   5058  O  O     . PHE C  2  191  ? 49.157  -32.427 43.605   1.00 108.51 ?  191  PHE C O     1 
ATOM   5059  C  CB    . PHE C  2  191  ? 50.523  -30.473 41.353   1.00 114.38 ?  191  PHE C CB    1 
ATOM   5060  C  CG    . PHE C  2  191  ? 51.670  -30.970 42.188   1.00 122.63 ?  191  PHE C CG    1 
ATOM   5061  C  CD1   . PHE C  2  191  ? 52.241  -30.162 43.158   1.00 122.83 ?  191  PHE C CD1   1 
ATOM   5062  C  CD2   . PHE C  2  191  ? 52.191  -32.239 41.989   1.00 123.00 ?  191  PHE C CD2   1 
ATOM   5063  C  CE1   . PHE C  2  191  ? 53.300  -30.615 43.924   1.00 120.63 ?  191  PHE C CE1   1 
ATOM   5064  C  CE2   . PHE C  2  191  ? 53.250  -32.698 42.751   1.00 123.57 ?  191  PHE C CE2   1 
ATOM   5065  C  CZ    . PHE C  2  191  ? 53.806  -31.884 43.718   1.00 122.53 ?  191  PHE C CZ    1 
ATOM   5066  N  N     . PRO C  2  192  ? 48.413  -32.920 41.528   1.00 107.99 ?  192  PRO C N     1 
ATOM   5067  C  CA    . PRO C  2  192  ? 48.167  -34.334 41.839   1.00 102.81 ?  192  PRO C CA    1 
ATOM   5068  C  C     . PRO C  2  192  ? 49.433  -35.050 42.301   1.00 104.25 ?  192  PRO C C     1 
ATOM   5069  O  O     . PRO C  2  192  ? 50.488  -34.911 41.684   1.00 100.54 ?  192  PRO C O     1 
ATOM   5070  C  CB    . PRO C  2  192  ? 47.678  -34.911 40.503   1.00 96.01  ?  192  PRO C CB    1 
ATOM   5071  C  CG    . PRO C  2  192  ? 48.102  -33.920 39.466   1.00 86.87  ?  192  PRO C CG    1 
ATOM   5072  C  CD    . PRO C  2  192  ? 48.036  -32.593 40.144   1.00 98.78  ?  192  PRO C CD    1 
ATOM   5073  N  N     . LEU C  2  193  ? 49.314  -35.808 43.387   1.00 106.32 ?  193  LEU C N     1 
ATOM   5074  C  CA    . LEU C  2  193  ? 50.456  -36.473 44.004   1.00 114.41 ?  193  LEU C CA    1 
ATOM   5075  C  C     . LEU C  2  193  ? 51.015  -37.588 43.123   1.00 113.59 ?  193  LEU C C     1 
ATOM   5076  O  O     . LEU C  2  193  ? 52.191  -37.940 43.222   1.00 110.30 ?  193  LEU C O     1 
ATOM   5077  C  CB    . LEU C  2  193  ? 50.055  -37.032 45.372   1.00 111.56 ?  193  LEU C CB    1 
ATOM   5078  C  CG    . LEU C  2  193  ? 51.141  -37.681 46.231   1.00 103.95 ?  193  LEU C CG    1 
ATOM   5079  C  CD1   . LEU C  2  193  ? 52.238  -36.683 46.557   1.00 98.16  ?  193  LEU C CD1   1 
ATOM   5080  C  CD2   . LEU C  2  193  ? 50.540  -38.252 47.503   1.00 93.24  ?  193  LEU C CD2   1 
ATOM   5081  N  N     . VAL C  2  194  ? 50.163  -38.127 42.255   1.00 111.95 ?  194  VAL C N     1 
ATOM   5082  C  CA    . VAL C  2  194  ? 50.527  -39.247 41.392   1.00 109.30 ?  194  VAL C CA    1 
ATOM   5083  C  C     . VAL C  2  194  ? 51.742  -38.941 40.516   1.00 111.94 ?  194  VAL C C     1 
ATOM   5084  O  O     . VAL C  2  194  ? 52.550  -39.826 40.231   1.00 112.19 ?  194  VAL C O     1 
ATOM   5085  C  CB    . VAL C  2  194  ? 49.347  -39.653 40.494   1.00 112.76 ?  194  VAL C CB    1 
ATOM   5086  C  CG1   . VAL C  2  194  ? 49.591  -41.023 39.884   1.00 118.11 ?  194  VAL C CG1   1 
ATOM   5087  C  CG2   . VAL C  2  194  ? 48.054  -39.646 41.294   1.00 115.51 ?  194  VAL C CG2   1 
ATOM   5088  N  N     . LEU C  2  195  ? 51.864  -37.685 40.097   1.00 117.73 ?  195  LEU C N     1 
ATOM   5089  C  CA    . LEU C  2  195  ? 52.991  -37.245 39.278   1.00 123.21 ?  195  LEU C CA    1 
ATOM   5090  C  C     . LEU C  2  195  ? 54.314  -37.427 40.018   1.00 123.51 ?  195  LEU C C     1 
ATOM   5091  O  O     . LEU C  2  195  ? 55.230  -38.093 39.524   1.00 123.29 ?  195  LEU C O     1 
ATOM   5092  C  CB    . LEU C  2  195  ? 52.817  -35.777 38.878   1.00 118.11 ?  195  LEU C CB    1 
ATOM   5093  C  CG    . LEU C  2  195  ? 53.870  -35.182 37.941   1.00 116.89 ?  195  LEU C CG    1 
ATOM   5094  C  CD1   . LEU C  2  195  ? 53.807  -35.847 36.579   1.00 115.75 ?  195  LEU C CD1   1 
ATOM   5095  C  CD2   . LEU C  2  195  ? 53.689  -33.677 37.813   1.00 113.98 ?  195  LEU C CD2   1 
ATOM   5096  N  N     . LEU C  2  196  ? 54.405  -36.833 41.204   1.00 121.15 ?  196  LEU C N     1 
ATOM   5097  C  CA    . LEU C  2  196  ? 55.601  -36.943 42.029   1.00 116.75 ?  196  LEU C CA    1 
ATOM   5098  C  C     . LEU C  2  196  ? 55.862  -38.395 42.415   1.00 113.38 ?  196  LEU C C     1 
ATOM   5099  O  O     . LEU C  2  196  ? 57.009  -38.836 42.454   1.00 116.55 ?  196  LEU C O     1 
ATOM   5100  C  CB    . LEU C  2  196  ? 55.478  -36.079 43.285   1.00 120.66 ?  196  LEU C CB    1 
ATOM   5101  C  CG    . LEU C  2  196  ? 56.734  -36.012 44.156   1.00 117.27 ?  196  LEU C CG    1 
ATOM   5102  C  CD1   . LEU C  2  196  ? 57.851  -35.270 43.437   1.00 110.83 ?  196  LEU C CD1   1 
ATOM   5103  C  CD2   . LEU C  2  196  ? 56.436  -35.370 45.499   1.00 106.61 ?  196  LEU C CD2   1 
ATOM   5104  N  N     . LEU C  2  197  ? 54.791  -39.132 42.697   1.00 107.53 ?  197  LEU C N     1 
ATOM   5105  C  CA    . LEU C  2  197  ? 54.908  -40.554 43.000   1.00 109.17 ?  197  LEU C CA    1 
ATOM   5106  C  C     . LEU C  2  197  ? 55.555  -41.299 41.837   1.00 114.83 ?  197  LEU C C     1 
ATOM   5107  O  O     . LEU C  2  197  ? 56.342  -42.222 42.041   1.00 117.55 ?  197  LEU C O     1 
ATOM   5108  C  CB    . LEU C  2  197  ? 53.539  -41.157 43.319   1.00 118.12 ?  197  LEU C CB    1 
ATOM   5109  C  CG    . LEU C  2  197  ? 52.898  -40.722 44.638   1.00 117.35 ?  197  LEU C CG    1 
ATOM   5110  C  CD1   . LEU C  2  197  ? 51.550  -41.401 44.830   1.00 120.79 ?  197  LEU C CD1   1 
ATOM   5111  C  CD2   . LEU C  2  197  ? 53.823  -41.016 45.809   1.00 111.95 ?  197  LEU C CD2   1 
ATOM   5112  N  N     . ARG C  2  198  ? 55.226  -40.885 40.617   1.00 114.06 ?  198  ARG C N     1 
ATOM   5113  C  CA    . ARG C  2  198  ? 55.828  -41.471 39.427   1.00 119.39 ?  198  ARG C CA    1 
ATOM   5114  C  C     . ARG C  2  198  ? 57.290  -41.055 39.310   1.00 117.44 ?  198  ARG C C     1 
ATOM   5115  O  O     . ARG C  2  198  ? 58.133  -41.838 38.870   1.00 126.19 ?  198  ARG C O     1 
ATOM   5116  C  CB    . ARG C  2  198  ? 55.061  -41.055 38.170   1.00 122.46 ?  198  ARG C CB    1 
ATOM   5117  C  CG    . ARG C  2  198  ? 55.521  -41.753 36.897   1.00 127.80 ?  198  ARG C CG    1 
ATOM   5118  C  CD    . ARG C  2  198  ? 55.233  -43.247 36.948   1.00 132.36 ?  198  ARG C CD    1 
ATOM   5119  N  NE    . ARG C  2  198  ? 55.643  -43.930 35.723   1.00 129.93 ?  198  ARG C NE    1 
ATOM   5120  C  CZ    . ARG C  2  198  ? 56.804  -44.559 35.569   1.00 123.45 ?  198  ARG C CZ    1 
ATOM   5121  N  NH1   . ARG C  2  198  ? 57.092  -45.152 34.419   1.00 121.11 ?  198  ARG C NH1   1 
ATOM   5122  N  NH2   . ARG C  2  198  ? 57.677  -44.598 36.566   1.00 119.34 ?  198  ARG C NH2   1 
ATOM   5123  N  N     . VAL C  2  199  ? 57.584  -39.819 39.704   1.00 108.99 ?  199  VAL C N     1 
ATOM   5124  C  CA    . VAL C  2  199  ? 58.954  -39.311 39.672   1.00 114.23 ?  199  VAL C CA    1 
ATOM   5125  C  C     . VAL C  2  199  ? 59.865  -40.102 40.613   1.00 115.09 ?  199  VAL C C     1 
ATOM   5126  O  O     . VAL C  2  199  ? 61.011  -40.403 40.277   1.00 110.09 ?  199  VAL C O     1 
ATOM   5127  C  CB    . VAL C  2  199  ? 59.011  -37.809 40.031   1.00 115.34 ?  199  VAL C CB    1 
ATOM   5128  C  CG1   . VAL C  2  199  ? 60.453  -37.325 40.097   1.00 111.85 ?  199  VAL C CG1   1 
ATOM   5129  C  CG2   . VAL C  2  199  ? 58.220  -36.992 39.022   1.00 112.03 ?  199  VAL C CG2   1 
ATOM   5130  N  N     . LEU C  2  200  ? 59.342  -40.451 41.785   1.00 119.00 ?  200  LEU C N     1 
ATOM   5131  C  CA    . LEU C  2  200  ? 60.110  -41.208 42.772   1.00 118.38 ?  200  LEU C CA    1 
ATOM   5132  C  C     . LEU C  2  200  ? 60.309  -42.668 42.364   1.00 115.29 ?  200  LEU C C     1 
ATOM   5133  O  O     . LEU C  2  200  ? 61.042  -43.409 43.021   1.00 114.73 ?  200  LEU C O     1 
ATOM   5134  C  CB    . LEU C  2  200  ? 59.459  -41.123 44.157   1.00 124.19 ?  200  LEU C CB    1 
ATOM   5135  C  CG    . LEU C  2  200  ? 59.881  -39.956 45.059   1.00 121.06 ?  200  LEU C CG    1 
ATOM   5136  C  CD1   . LEU C  2  200  ? 61.395  -39.896 45.186   1.00 120.03 ?  200  LEU C CD1   1 
ATOM   5137  C  CD2   . LEU C  2  200  ? 59.336  -38.627 44.565   1.00 109.17 ?  200  LEU C CD2   1 
ATOM   5138  N  N     . GLY C  2  201  ? 59.653  -43.077 41.282   1.00 116.50 ?  201  GLY C N     1 
ATOM   5139  C  CA    . GLY C  2  201  ? 59.850  -44.404 40.729   1.00 117.68 ?  201  GLY C CA    1 
ATOM   5140  C  C     . GLY C  2  201  ? 58.724  -45.385 40.991   1.00 111.83 ?  201  GLY C C     1 
ATOM   5141  O  O     . GLY C  2  201  ? 58.815  -46.551 40.609   1.00 122.16 ?  201  GLY C O     1 
ATOM   5142  N  N     . TYR C  2  202  ? 57.662  -44.923 41.641   1.00 112.31 ?  202  TYR C N     1 
ATOM   5143  C  CA    . TYR C  2  202  ? 56.532  -45.796 41.946   1.00 120.24 ?  202  TYR C CA    1 
ATOM   5144  C  C     . TYR C  2  202  ? 55.747  -46.186 40.699   1.00 120.85 ?  202  TYR C C     1 
ATOM   5145  O  O     . TYR C  2  202  ? 55.554  -45.377 39.790   1.00 108.65 ?  202  TYR C O     1 
ATOM   5146  C  CB    . TYR C  2  202  ? 55.606  -45.156 42.983   1.00 122.95 ?  202  TYR C CB    1 
ATOM   5147  C  CG    . TYR C  2  202  ? 56.182  -45.148 44.379   1.00 124.31 ?  202  TYR C CG    1 
ATOM   5148  C  CD1   . TYR C  2  202  ? 56.056  -46.255 45.208   1.00 121.07 ?  202  TYR C CD1   1 
ATOM   5149  C  CD2   . TYR C  2  202  ? 56.855  -44.036 44.868   1.00 119.27 ?  202  TYR C CD2   1 
ATOM   5150  C  CE1   . TYR C  2  202  ? 56.583  -46.255 46.483   1.00 121.15 ?  202  TYR C CE1   1 
ATOM   5151  C  CE2   . TYR C  2  202  ? 57.386  -44.026 46.143   1.00 119.07 ?  202  TYR C CE2   1 
ATOM   5152  C  CZ    . TYR C  2  202  ? 57.246  -45.139 46.946   1.00 120.49 ?  202  TYR C CZ    1 
ATOM   5153  O  OH    . TYR C  2  202  ? 57.771  -45.138 48.217   1.00 113.90 ?  202  TYR C OH    1 
ATOM   5154  N  N     . ASP C  2  203  ? 55.298  -47.437 40.670   1.00 127.30 ?  203  ASP C N     1 
ATOM   5155  C  CA    . ASP C  2  203  ? 54.519  -47.957 39.555   1.00 132.71 ?  203  ASP C CA    1 
ATOM   5156  C  C     . ASP C  2  203  ? 53.112  -48.299 40.034   1.00 129.14 ?  203  ASP C C     1 
ATOM   5157  O  O     . ASP C  2  203  ? 52.900  -48.552 41.221   1.00 125.63 ?  203  ASP C O     1 
ATOM   5158  C  CB    . ASP C  2  203  ? 55.197  -49.194 38.959   1.00 132.89 ?  203  ASP C CB    1 
ATOM   5159  C  CG    . ASP C  2  203  ? 54.514  -49.686 37.696   1.00 131.47 ?  203  ASP C CG    1 
ATOM   5160  O  OD1   . ASP C  2  203  ? 54.830  -49.166 36.605   1.00 127.55 ?  203  ASP C OD1   1 
ATOM   5161  O  OD2   . ASP C  2  203  ? 53.663  -50.596 37.794   1.00 126.14 ?  203  ASP C OD2   1 
ATOM   5162  N  N     . GLN C  2  204  ? 52.159  -48.293 39.106   1.00 127.06 ?  204  GLN C N     1 
ATOM   5163  C  CA    . GLN C  2  204  ? 50.756  -48.555 39.416   1.00 123.53 ?  204  GLN C CA    1 
ATOM   5164  C  C     . GLN C  2  204  ? 50.556  -49.867 40.173   1.00 122.41 ?  204  GLN C C     1 
ATOM   5165  O  O     . GLN C  2  204  ? 49.680  -49.966 41.030   1.00 120.06 ?  204  GLN C O     1 
ATOM   5166  C  CB    . GLN C  2  204  ? 49.922  -48.549 38.132   1.00 120.46 ?  204  GLN C CB    1 
ATOM   5167  C  CG    . GLN C  2  204  ? 48.431  -48.734 38.350   1.00 115.55 ?  204  GLN C CG    1 
ATOM   5168  C  CD    . GLN C  2  204  ? 47.638  -48.604 37.066   1.00 119.25 ?  204  GLN C CD    1 
ATOM   5169  O  OE1   . GLN C  2  204  ? 48.144  -48.112 36.057   1.00 115.78 ?  204  GLN C OE1   1 
ATOM   5170  N  NE2   . GLN C  2  204  ? 46.387  -49.049 37.096   1.00 121.41 ?  204  GLN C NE2   1 
ATOM   5171  N  N     . GLU C  2  205  ? 51.379  -50.862 39.858   1.00 125.57 ?  205  GLU C N     1 
ATOM   5172  C  CA    . GLU C  2  205  ? 51.326  -52.161 40.522   1.00 126.88 ?  205  GLU C CA    1 
ATOM   5173  C  C     . GLU C  2  205  ? 51.592  -52.024 42.019   1.00 127.54 ?  205  GLU C C     1 
ATOM   5174  O  O     . GLU C  2  205  ? 50.777  -52.438 42.851   1.00 127.32 ?  205  GLU C O     1 
ATOM   5175  C  CB    . GLU C  2  205  ? 52.360  -53.105 39.903   1.00 129.22 ?  205  GLU C CB    1 
ATOM   5176  C  CG    . GLU C  2  205  ? 52.293  -54.538 40.407   1.00 125.48 ?  205  GLU C CG    1 
ATOM   5177  C  CD    . GLU C  2  205  ? 51.489  -55.441 39.491   1.00 121.72 ?  205  GLU C CD    1 
ATOM   5178  O  OE1   . GLU C  2  205  ? 51.192  -55.021 38.352   1.00 119.13 ?  205  GLU C OE1   1 
ATOM   5179  O  OE2   . GLU C  2  205  ? 51.156  -56.570 39.908   1.00 115.61 ?  205  GLU C OE2   1 
ATOM   5180  N  N     . THR C  2  206  ? 52.739  -51.434 42.346   1.00 129.45 ?  206  THR C N     1 
ATOM   5181  C  CA    . THR C  2  206  ? 53.171  -51.258 43.729   1.00 135.83 ?  206  THR C CA    1 
ATOM   5182  C  C     . THR C  2  206  ? 52.172  -50.435 44.539   1.00 138.59 ?  206  THR C C     1 
ATOM   5183  O  O     . THR C  2  206  ? 51.830  -50.789 45.669   1.00 138.31 ?  206  THR C O     1 
ATOM   5184  C  CB    . THR C  2  206  ? 54.553  -50.577 43.797   1.00 125.63 ?  206  THR C CB    1 
ATOM   5185  O  OG1   . THR C  2  206  ? 55.485  -51.294 42.978   1.00 111.63 ?  206  THR C OG1   1 
ATOM   5186  C  CG2   . THR C  2  206  ? 55.065  -50.538 45.230   1.00 125.40 ?  206  THR C CG2   1 
ATOM   5187  N  N     . LEU C  2  207  ? 51.704  -49.338 43.954   1.00 132.60 ?  207  LEU C N     1 
ATOM   5188  C  CA    . LEU C  2  207  ? 50.745  -48.468 44.624   1.00 127.73 ?  207  LEU C CA    1 
ATOM   5189  C  C     . LEU C  2  207  ? 49.394  -49.160 44.810   1.00 131.43 ?  207  LEU C C     1 
ATOM   5190  O  O     . LEU C  2  207  ? 48.703  -48.930 45.804   1.00 135.06 ?  207  LEU C O     1 
ATOM   5191  C  CB    . LEU C  2  207  ? 50.585  -47.155 43.854   1.00 121.75 ?  207  LEU C CB    1 
ATOM   5192  C  CG    . LEU C  2  207  ? 51.868  -46.326 43.727   1.00 126.83 ?  207  LEU C CG    1 
ATOM   5193  C  CD1   . LEU C  2  207  ? 51.647  -45.089 42.869   1.00 118.22 ?  207  LEU C CD1   1 
ATOM   5194  C  CD2   . LEU C  2  207  ? 52.396  -45.940 45.101   1.00 124.45 ?  207  LEU C CD2   1 
ATOM   5195  N  N     . ALA C  2  208  ? 49.029  -50.016 43.859   1.00 128.76 ?  208  ALA C N     1 
ATOM   5196  C  CA    . ALA C  2  208  ? 47.774  -50.757 43.945   1.00 125.67 ?  208  ALA C CA    1 
ATOM   5197  C  C     . ALA C  2  208  ? 47.817  -51.815 45.042   1.00 124.24 ?  208  ALA C C     1 
ATOM   5198  O  O     . ALA C  2  208  ? 46.865  -51.957 45.809   1.00 114.55 ?  208  ALA C O     1 
ATOM   5199  C  CB    . ALA C  2  208  ? 47.426  -51.394 42.607   1.00 127.99 ?  208  ALA C CB    1 
ATOM   5200  N  N     . ARG C  2  209  ? 48.916  -52.561 45.116   1.00 129.72 ?  209  ARG C N     1 
ATOM   5201  C  CA    . ARG C  2  209  ? 49.040  -53.592 46.145   1.00 133.00 ?  209  ARG C CA    1 
ATOM   5202  C  C     . ARG C  2  209  ? 49.222  -52.986 47.536   1.00 128.92 ?  209  ARG C C     1 
ATOM   5203  O  O     . ARG C  2  209  ? 48.733  -53.532 48.526   1.00 121.09 ?  209  ARG C O     1 
ATOM   5204  C  CB    . ARG C  2  209  ? 50.180  -54.568 45.828   1.00 131.75 ?  209  ARG C CB    1 
ATOM   5205  C  CG    . ARG C  2  209  ? 51.532  -53.916 45.603   1.00 128.55 ?  209  ARG C CG    1 
ATOM   5206  C  CD    . ARG C  2  209  ? 52.652  -54.942 45.567   1.00 126.82 ?  209  ARG C CD    1 
ATOM   5207  N  NE    . ARG C  2  209  ? 52.983  -55.432 46.902   1.00 128.16 ?  209  ARG C NE    1 
ATOM   5208  C  CZ    . ARG C  2  209  ? 53.939  -54.918 47.669   1.00 125.61 ?  209  ARG C CZ    1 
ATOM   5209  N  NH1   . ARG C  2  209  ? 54.664  -53.896 47.233   1.00 119.03 ?  209  ARG C NH1   1 
ATOM   5210  N  NH2   . ARG C  2  209  ? 54.173  -55.425 48.873   1.00 117.49 ?  209  ARG C NH2   1 
ATOM   5211  N  N     . GLU C  2  210  ? 49.924  -51.860 47.605   1.00 127.28 ?  210  GLU C N     1 
ATOM   5212  C  CA    . GLU C  2  210  ? 50.175  -51.199 48.881   1.00 124.79 ?  210  GLU C CA    1 
ATOM   5213  C  C     . GLU C  2  210  ? 48.932  -50.494 49.428   1.00 125.26 ?  210  GLU C C     1 
ATOM   5214  O  O     . GLU C  2  210  ? 48.536  -50.714 50.573   1.00 118.85 ?  210  GLU C O     1 
ATOM   5215  C  CB    . GLU C  2  210  ? 51.321  -50.193 48.741   1.00 125.30 ?  210  GLU C CB    1 
ATOM   5216  C  CG    . GLU C  2  210  ? 51.936  -49.743 50.058   1.00 128.96 ?  210  GLU C CG    1 
ATOM   5217  C  CD    . GLU C  2  210  ? 52.935  -50.743 50.608   1.00 131.13 ?  210  GLU C CD    1 
ATOM   5218  O  OE1   . GLU C  2  210  ? 53.270  -51.710 49.891   1.00 132.99 ?  210  GLU C OE1   1 
ATOM   5219  O  OE2   . GLU C  2  210  ? 53.388  -50.561 51.758   1.00 123.79 ?  210  GLU C OE2   1 
ATOM   5220  N  N     . LEU C  2  211  ? 48.321  -49.648 48.601   1.00 128.15 ?  211  LEU C N     1 
ATOM   5221  C  CA    . LEU C  2  211  ? 47.223  -48.787 49.046   1.00 122.01 ?  211  LEU C CA    1 
ATOM   5222  C  C     . LEU C  2  211  ? 45.818  -49.317 48.733   1.00 116.34 ?  211  LEU C C     1 
ATOM   5223  O  O     . LEU C  2  211  ? 44.823  -48.653 49.022   1.00 106.71 ?  211  LEU C O     1 
ATOM   5224  C  CB    . LEU C  2  211  ? 47.393  -47.372 48.480   1.00 123.58 ?  211  LEU C CB    1 
ATOM   5225  C  CG    . LEU C  2  211  ? 48.205  -46.361 49.301   1.00 120.94 ?  211  LEU C CG    1 
ATOM   5226  C  CD1   . LEU C  2  211  ? 49.562  -46.912 49.714   1.00 121.78 ?  211  LEU C CD1   1 
ATOM   5227  C  CD2   . LEU C  2  211  ? 48.378  -45.069 48.519   1.00 112.24 ?  211  LEU C CD2   1 
ATOM   5228  N  N     . GLY C  2  212  ? 45.739  -50.506 48.145   1.00 120.46 ?  212  GLY C N     1 
ATOM   5229  C  CA    . GLY C  2  212  ? 44.466  -51.051 47.705   1.00 115.15 ?  212  GLY C CA    1 
ATOM   5230  C  C     . GLY C  2  212  ? 43.536  -51.517 48.811   1.00 108.74 ?  212  GLY C C     1 
ATOM   5231  O  O     . GLY C  2  212  ? 42.372  -51.830 48.557   1.00 99.76  ?  212  GLY C O     1 
ATOM   5232  N  N     . ALA C  2  213  ? 44.041  -51.558 50.040   1.00 105.93 ?  213  ALA C N     1 
ATOM   5233  C  CA    . ALA C  2  213  ? 43.262  -52.047 51.175   1.00 106.59 ?  213  ALA C CA    1 
ATOM   5234  C  C     . ALA C  2  213  ? 42.052  -51.164 51.477   1.00 107.58 ?  213  ALA C C     1 
ATOM   5235  O  O     . ALA C  2  213  ? 40.988  -51.660 51.849   1.00 103.01 ?  213  ALA C O     1 
ATOM   5236  C  CB    . ALA C  2  213  ? 44.146  -52.178 52.408   1.00 95.82  ?  213  ALA C CB    1 
ATOM   5237  N  N     . TYR C  2  214  ? 42.220  -49.856 51.313   1.00 113.17 ?  214  TYR C N     1 
ATOM   5238  C  CA    . TYR C  2  214  ? 41.155  -48.900 51.603   1.00 112.90 ?  214  TYR C CA    1 
ATOM   5239  C  C     . TYR C  2  214  ? 40.247  -48.711 50.390   1.00 109.09 ?  214  TYR C C     1 
ATOM   5240  O  O     . TYR C  2  214  ? 40.726  -48.545 49.267   1.00 107.81 ?  214  TYR C O     1 
ATOM   5241  C  CB    . TYR C  2  214  ? 41.757  -47.563 52.038   1.00 111.48 ?  214  TYR C CB    1 
ATOM   5242  C  CG    . TYR C  2  214  ? 42.997  -47.715 52.893   1.00 116.30 ?  214  TYR C CG    1 
ATOM   5243  C  CD1   . TYR C  2  214  ? 42.909  -48.142 54.212   1.00 112.82 ?  214  TYR C CD1   1 
ATOM   5244  C  CD2   . TYR C  2  214  ? 44.257  -47.436 52.378   1.00 116.16 ?  214  TYR C CD2   1 
ATOM   5245  C  CE1   . TYR C  2  214  ? 44.042  -48.287 54.995   1.00 108.60 ?  214  TYR C CE1   1 
ATOM   5246  C  CE2   . TYR C  2  214  ? 45.395  -47.575 53.154   1.00 111.03 ?  214  TYR C CE2   1 
ATOM   5247  C  CZ    . TYR C  2  214  ? 45.282  -48.000 54.461   1.00 106.83 ?  214  TYR C CZ    1 
ATOM   5248  O  OH    . TYR C  2  214  ? 46.411  -48.140 55.235   1.00 96.17  ?  214  TYR C OH    1 
ATOM   5249  N  N     . GLY C  2  215  ? 38.937  -48.737 50.620   1.00 106.33 ?  215  GLY C N     1 
ATOM   5250  C  CA    . GLY C  2  215  ? 37.978  -48.693 49.530   1.00 108.35 ?  215  GLY C CA    1 
ATOM   5251  C  C     . GLY C  2  215  ? 37.977  -47.396 48.743   1.00 114.14 ?  215  GLY C C     1 
ATOM   5252  O  O     . GLY C  2  215  ? 37.745  -46.321 49.292   1.00 114.55 ?  215  GLY C O     1 
ATOM   5253  N  N     . GLU C  2  216  ? 38.243  -47.523 47.445   1.00 118.29 ?  216  GLU C N     1 
ATOM   5254  C  CA    . GLU C  2  216  ? 38.225  -46.426 46.467   1.00 125.08 ?  216  GLU C CA    1 
ATOM   5255  C  C     . GLU C  2  216  ? 38.968  -45.148 46.877   1.00 126.59 ?  216  GLU C C     1 
ATOM   5256  O  O     . GLU C  2  216  ? 38.633  -44.054 46.419   1.00 123.94 ?  216  GLU C O     1 
ATOM   5257  C  CB    . GLU C  2  216  ? 36.793  -46.115 45.988   1.00 131.71 ?  216  GLU C CB    1 
ATOM   5258  C  CG    . GLU C  2  216  ? 35.881  -45.436 47.006   1.00 132.75 ?  216  GLU C CG    1 
ATOM   5259  C  CD    . GLU C  2  216  ? 34.493  -45.164 46.456   1.00 135.81 ?  216  GLU C CD    1 
ATOM   5260  O  OE1   . GLU C  2  216  ? 34.151  -45.730 45.396   1.00 142.70 ?  216  GLU C OE1   1 
ATOM   5261  O  OE2   . GLU C  2  216  ? 33.745  -44.384 47.082   1.00 128.00 ?  216  GLU C OE2   1 
ATOM   5262  N  N     . LEU C  2  217  ? 39.986  -45.290 47.719   1.00 128.24 ?  217  LEU C N     1 
ATOM   5263  C  CA    . LEU C  2  217  ? 40.905  -44.189 47.990   1.00 124.82 ?  217  LEU C CA    1 
ATOM   5264  C  C     . LEU C  2  217  ? 41.979  -44.136 46.913   1.00 123.77 ?  217  LEU C C     1 
ATOM   5265  O  O     . LEU C  2  217  ? 42.351  -43.065 46.433   1.00 120.27 ?  217  LEU C O     1 
ATOM   5266  C  CB    . LEU C  2  217  ? 41.546  -44.323 49.375   1.00 116.46 ?  217  LEU C CB    1 
ATOM   5267  C  CG    . LEU C  2  217  ? 40.816  -43.675 50.558   1.00 106.04 ?  217  LEU C CG    1 
ATOM   5268  C  CD1   . LEU C  2  217  ? 40.317  -42.282 50.192   1.00 91.17  ?  217  LEU C CD1   1 
ATOM   5269  C  CD2   . LEU C  2  217  ? 39.678  -44.549 51.062   1.00 106.71 ?  217  LEU C CD2   1 
ATOM   5270  N  N     . VAL C  2  218  ? 42.466  -45.315 46.538   1.00 122.55 ?  218  VAL C N     1 
ATOM   5271  C  CA    . VAL C  2  218  ? 43.552  -45.442 45.577   1.00 120.49 ?  218  VAL C CA    1 
ATOM   5272  C  C     . VAL C  2  218  ? 43.047  -45.214 44.152   1.00 126.38 ?  218  VAL C C     1 
ATOM   5273  O  O     . VAL C  2  218  ? 43.831  -44.958 43.238   1.00 124.22 ?  218  VAL C O     1 
ATOM   5274  C  CB    . VAL C  2  218  ? 44.235  -46.826 45.699   1.00 115.88 ?  218  VAL C CB    1 
ATOM   5275  C  CG1   . VAL C  2  218  ? 43.315  -47.927 45.187   1.00 119.54 ?  218  VAL C CG1   1 
ATOM   5276  C  CG2   . VAL C  2  218  ? 45.572  -46.844 44.967   1.00 116.97 ?  218  VAL C CG2   1 
ATOM   5277  N  N     . GLN C  2  219  ? 41.731  -45.291 43.971   1.00 127.30 ?  219  GLN C N     1 
ATOM   5278  C  CA    . GLN C  2  219  ? 41.129  -45.088 42.656   1.00 128.83 ?  219  GLN C CA    1 
ATOM   5279  C  C     . GLN C  2  219  ? 41.295  -43.653 42.166   1.00 133.43 ?  219  GLN C C     1 
ATOM   5280  O  O     . GLN C  2  219  ? 41.327  -43.398 40.961   1.00 136.26 ?  219  GLN C O     1 
ATOM   5281  C  CB    . GLN C  2  219  ? 39.651  -45.484 42.668   1.00 122.92 ?  219  GLN C CB    1 
ATOM   5282  C  CG    . GLN C  2  219  ? 39.420  -46.983 42.738   1.00 115.99 ?  219  GLN C CG    1 
ATOM   5283  C  CD    . GLN C  2  219  ? 40.042  -47.722 41.567   1.00 119.38 ?  219  GLN C CD    1 
ATOM   5284  O  OE1   . GLN C  2  219  ? 40.614  -48.799 41.732   1.00 125.46 ?  219  GLN C OE1   1 
ATOM   5285  N  NE2   . GLN C  2  219  ? 39.929  -47.146 40.374   1.00 115.14 ?  219  GLN C NE2   1 
ATOM   5286  N  N     . GLY C  2  220  ? 41.400  -42.718 43.105   1.00 128.16 ?  220  GLY C N     1 
ATOM   5287  C  CA    . GLY C  2  220  ? 41.653  -41.330 42.769   1.00 121.29 ?  220  GLY C CA    1 
ATOM   5288  C  C     . GLY C  2  220  ? 43.132  -41.097 42.538   1.00 124.61 ?  220  GLY C C     1 
ATOM   5289  O  O     . GLY C  2  220  ? 43.543  -40.040 42.058   1.00 126.02 ?  220  GLY C O     1 
ATOM   5290  N  N     . LEU C  2  221  ? 43.933  -42.097 42.888   1.00 126.82 ?  221  LEU C N     1 
ATOM   5291  C  CA    . LEU C  2  221  ? 45.374  -42.044 42.691   1.00 131.50 ?  221  LEU C CA    1 
ATOM   5292  C  C     . LEU C  2  221  ? 45.736  -42.668 41.343   1.00 131.52 ?  221  LEU C C     1 
ATOM   5293  O  O     . LEU C  2  221  ? 46.896  -42.661 40.931   1.00 130.89 ?  221  LEU C O     1 
ATOM   5294  C  CB    . LEU C  2  221  ? 46.083  -42.769 43.840   1.00 127.33 ?  221  LEU C CB    1 
ATOM   5295  C  CG    . LEU C  2  221  ? 47.602  -42.652 43.983   1.00 128.34 ?  221  LEU C CG    1 
ATOM   5296  C  CD1   . LEU C  2  221  ? 47.967  -42.331 45.418   1.00 111.48 ?  221  LEU C CD1   1 
ATOM   5297  C  CD2   . LEU C  2  221  ? 48.276  -43.939 43.539   1.00 138.08 ?  221  LEU C CD2   1 
ATOM   5298  N  N     . MET C  2  222  ? 44.730  -43.190 40.649   1.00 129.69 ?  222  MET C N     1 
ATOM   5299  C  CA    . MET C  2  222  ? 44.956  -43.854 39.370   1.00 123.03 ?  222  MET C CA    1 
ATOM   5300  C  C     . MET C  2  222  ? 44.802  -42.893 38.197   1.00 123.83 ?  222  MET C C     1 
ATOM   5301  O  O     . MET C  2  222  ? 43.701  -42.426 37.902   1.00 119.13 ?  222  MET C O     1 
ATOM   5302  C  CB    . MET C  2  222  ? 43.992  -45.030 39.198   1.00 119.91 ?  222  MET C CB    1 
ATOM   5303  C  CG    . MET C  2  222  ? 44.149  -46.130 40.235   1.00 123.61 ?  222  MET C CG    1 
ATOM   5304  S  SD    . MET C  2  222  ? 45.774  -46.909 40.193   1.00 144.02 ?  222  MET C SD    1 
ATOM   5305  C  CE    . MET C  2  222  ? 45.583  -48.156 41.464   1.00 123.40 ?  222  MET C CE    1 
ATOM   5306  N  N     . ASP C  2  223  ? 45.915  -42.603 37.533   1.00 126.72 ?  223  ASP C N     1 
ATOM   5307  C  CA    . ASP C  2  223  ? 45.901  -41.802 36.316   1.00 126.38 ?  223  ASP C CA    1 
ATOM   5308  C  C     . ASP C  2  223  ? 46.773  -42.474 35.261   1.00 131.92 ?  223  ASP C C     1 
ATOM   5309  O  O     . ASP C  2  223  ? 47.983  -42.608 35.440   1.00 126.57 ?  223  ASP C O     1 
ATOM   5310  C  CB    . ASP C  2  223  ? 46.398  -40.384 36.597   1.00 116.93 ?  223  ASP C CB    1 
ATOM   5311  C  CG    . ASP C  2  223  ? 46.127  -39.433 35.447   1.00 117.57 ?  223  ASP C CG    1 
ATOM   5312  O  OD1   . ASP C  2  223  ? 46.941  -39.392 34.502   1.00 120.88 ?  223  ASP C OD1   1 
ATOM   5313  O  OD2   . ASP C  2  223  ? 45.098  -38.726 35.489   1.00 110.04 ?  223  ASP C OD2   1 
ATOM   5314  N  N     . GLU C  2  224  ? 46.153  -42.887 34.161   1.00 134.74 ?  224  GLU C N     1 
ATOM   5315  C  CA    . GLU C  2  224  ? 46.848  -43.650 33.128   1.00 129.47 ?  224  GLU C CA    1 
ATOM   5316  C  C     . GLU C  2  224  ? 47.893  -42.827 32.377   1.00 128.01 ?  224  GLU C C     1 
ATOM   5317  O  O     . GLU C  2  224  ? 48.896  -43.367 31.912   1.00 125.16 ?  224  GLU C O     1 
ATOM   5318  C  CB    . GLU C  2  224  ? 45.851  -44.269 32.140   1.00 129.69 ?  224  GLU C CB    1 
ATOM   5319  C  CG    . GLU C  2  224  ? 44.972  -43.263 31.406   1.00 131.28 ?  224  GLU C CG    1 
ATOM   5320  C  CD    . GLU C  2  224  ? 43.816  -42.764 32.252   1.00 137.63 ?  224  GLU C CD    1 
ATOM   5321  O  OE1   . GLU C  2  224  ? 42.993  -43.598 32.686   1.00 141.55 ?  224  GLU C OE1   1 
ATOM   5322  O  OE2   . GLU C  2  224  ? 43.736  -41.540 32.490   1.00 131.78 ?  224  GLU C OE2   1 
ATOM   5323  N  N     . SER C  2  225  ? 47.658  -41.524 32.264   1.00 127.24 ?  225  SER C N     1 
ATOM   5324  C  CA    . SER C  2  225  ? 48.572  -40.645 31.539   1.00 126.40 ?  225  SER C CA    1 
ATOM   5325  C  C     . SER C  2  225  ? 49.893  -40.463 32.282   1.00 133.39 ?  225  SER C C     1 
ATOM   5326  O  O     . SER C  2  225  ? 50.927  -40.197 31.670   1.00 134.78 ?  225  SER C O     1 
ATOM   5327  C  CB    . SER C  2  225  ? 47.920  -39.285 31.274   1.00 113.52 ?  225  SER C CB    1 
ATOM   5328  O  OG    . SER C  2  225  ? 47.596  -38.626 32.485   1.00 116.86 ?  225  SER C OG    1 
ATOM   5329  N  N     . VAL C  2  226  ? 49.852  -40.609 33.603   1.00 132.81 ?  226  VAL C N     1 
ATOM   5330  C  CA    . VAL C  2  226  ? 51.046  -40.461 34.428   1.00 134.28 ?  226  VAL C CA    1 
ATOM   5331  C  C     . VAL C  2  226  ? 51.922  -41.712 34.367   1.00 130.81 ?  226  VAL C C     1 
ATOM   5332  O  O     . VAL C  2  226  ? 53.148  -41.620 34.294   1.00 131.47 ?  226  VAL C O     1 
ATOM   5333  C  CB    . VAL C  2  226  ? 50.683  -40.145 35.894   1.00 134.00 ?  226  VAL C CB    1 
ATOM   5334  C  CG1   . VAL C  2  226  ? 51.940  -39.944 36.723   1.00 130.91 ?  226  VAL C CG1   1 
ATOM   5335  C  CG2   . VAL C  2  226  ? 49.800  -38.911 35.965   1.00 123.28 ?  226  VAL C CG2   1 
ATOM   5336  N  N     . PHE C  2  227  ? 51.287  -42.880 34.391   1.00 124.53 ?  227  PHE C N     1 
ATOM   5337  C  CA    . PHE C  2  227  ? 52.015  -44.144 34.316   1.00 126.17 ?  227  PHE C CA    1 
ATOM   5338  C  C     . PHE C  2  227  ? 52.431  -44.474 32.885   1.00 129.78 ?  227  PHE C C     1 
ATOM   5339  O  O     . PHE C  2  227  ? 53.175  -45.426 32.651   1.00 127.24 ?  227  PHE C O     1 
ATOM   5340  C  CB    . PHE C  2  227  ? 51.179  -45.288 34.894   1.00 126.20 ?  227  PHE C CB    1 
ATOM   5341  C  CG    . PHE C  2  227  ? 50.866  -45.132 36.353   1.00 132.45 ?  227  PHE C CG    1 
ATOM   5342  C  CD1   . PHE C  2  227  ? 51.870  -45.219 37.303   1.00 134.31 ?  227  PHE C CD1   1 
ATOM   5343  C  CD2   . PHE C  2  227  ? 49.568  -44.908 36.776   1.00 129.92 ?  227  PHE C CD2   1 
ATOM   5344  C  CE1   . PHE C  2  227  ? 51.586  -45.078 38.648   1.00 133.53 ?  227  PHE C CE1   1 
ATOM   5345  C  CE2   . PHE C  2  227  ? 49.275  -44.767 38.119   1.00 128.86 ?  227  PHE C CE2   1 
ATOM   5346  C  CZ    . PHE C  2  227  ? 50.286  -44.852 39.056   1.00 132.92 ?  227  PHE C CZ    1 
ATOM   5347  N  N     . ALA C  2  228  ? 51.948  -43.682 31.933   1.00 130.98 ?  228  ALA C N     1 
ATOM   5348  C  CA    . ALA C  2  228  ? 52.268  -43.893 30.525   1.00 129.47 ?  228  ALA C CA    1 
ATOM   5349  C  C     . ALA C  2  228  ? 53.607  -43.261 30.164   1.00 132.09 ?  228  ALA C C     1 
ATOM   5350  O  O     . ALA C  2  228  ? 54.066  -43.365 29.027   1.00 132.86 ?  228  ALA C O     1 
ATOM   5351  C  CB    . ALA C  2  228  ? 51.164  -43.337 29.639   1.00 119.69 ?  228  ALA C CB    1 
ATOM   5352  N  N     . MET C  2  229  ? 54.229  -42.604 31.138   1.00 133.49 ?  229  MET C N     1 
ATOM   5353  C  CA    . MET C  2  229  ? 55.509  -41.946 30.912   1.00 131.13 ?  229  MET C CA    1 
ATOM   5354  C  C     . MET C  2  229  ? 56.538  -42.300 31.980   1.00 128.63 ?  229  MET C C     1 
ATOM   5355  O  O     . MET C  2  229  ? 56.201  -42.511 33.146   1.00 122.21 ?  229  MET C O     1 
ATOM   5356  C  CB    . MET C  2  229  ? 55.328  -40.428 30.836   1.00 131.50 ?  229  MET C CB    1 
ATOM   5357  C  CG    . MET C  2  229  ? 54.670  -39.816 32.062   1.00 132.86 ?  229  MET C CG    1 
ATOM   5358  S  SD    . MET C  2  229  ? 54.475  -38.028 31.932   1.00 144.52 ?  229  MET C SD    1 
ATOM   5359  C  CE    . MET C  2  229  ? 53.563  -37.678 33.431   1.00 124.91 ?  229  MET C CE    1 
ATOM   5360  N  N     . ARG C  2  230  ? 57.798  -42.364 31.562   1.00 130.18 ?  230  ARG C N     1 
ATOM   5361  C  CA    . ARG C  2  230  ? 58.914  -42.617 32.463   1.00 126.42 ?  230  ARG C CA    1 
ATOM   5362  C  C     . ARG C  2  230  ? 59.058  -41.456 33.448   1.00 120.14 ?  230  ARG C C     1 
ATOM   5363  O  O     . ARG C  2  230  ? 58.562  -40.360 33.185   1.00 115.44 ?  230  ARG C O     1 
ATOM   5364  C  CB    . ARG C  2  230  ? 60.194  -42.807 31.644   1.00 124.75 ?  230  ARG C CB    1 
ATOM   5365  C  CG    . ARG C  2  230  ? 60.179  -44.058 30.775   1.00 111.67 ?  230  ARG C CG    1 
ATOM   5366  C  CD    . ARG C  2  230  ? 61.051  -43.904 29.539   1.00 102.84 ?  230  ARG C CD    1 
ATOM   5367  N  NE    . ARG C  2  230  ? 62.429  -43.552 29.869   1.00 114.92 ?  230  ARG C NE    1 
ATOM   5368  C  CZ    . ARG C  2  230  ? 63.080  -42.518 29.346   1.00 114.03 ?  230  ARG C CZ    1 
ATOM   5369  N  NH1   . ARG C  2  230  ? 62.480  -41.731 28.463   1.00 111.17 ?  230  ARG C NH1   1 
ATOM   5370  N  NH2   . ARG C  2  230  ? 64.334  -42.271 29.703   1.00 110.40 ?  230  ARG C NH2   1 
ATOM   5371  N  N     . PRO C  2  231  ? 59.727  -41.694 34.591   1.00 122.11 ?  231  PRO C N     1 
ATOM   5372  C  CA    . PRO C  2  231  ? 59.922  -40.649 35.606   1.00 121.31 ?  231  PRO C CA    1 
ATOM   5373  C  C     . PRO C  2  231  ? 60.574  -39.375 35.064   1.00 118.22 ?  231  PRO C C     1 
ATOM   5374  O  O     . PRO C  2  231  ? 60.425  -38.316 35.671   1.00 116.82 ?  231  PRO C O     1 
ATOM   5375  C  CB    . PRO C  2  231  ? 60.851  -41.324 36.617   1.00 122.13 ?  231  PRO C CB    1 
ATOM   5376  C  CG    . PRO C  2  231  ? 60.513  -42.765 36.515   1.00 118.02 ?  231  PRO C CG    1 
ATOM   5377  C  CD    . PRO C  2  231  ? 60.208  -43.007 35.062   1.00 119.75 ?  231  PRO C CD    1 
ATOM   5378  N  N     . GLU C  2  232  ? 61.282  -39.484 33.943   1.00 120.45 ?  232  GLU C N     1 
ATOM   5379  C  CA    . GLU C  2  232  ? 61.904  -38.330 33.298   1.00 119.21 ?  232  GLU C CA    1 
ATOM   5380  C  C     . GLU C  2  232  ? 60.874  -37.291 32.864   1.00 121.31 ?  232  GLU C C     1 
ATOM   5381  O  O     . GLU C  2  232  ? 60.962  -36.117 33.233   1.00 121.49 ?  232  GLU C O     1 
ATOM   5382  C  CB    . GLU C  2  232  ? 62.711  -38.778 32.079   1.00 116.14 ?  232  GLU C CB    1 
ATOM   5383  C  CG    . GLU C  2  232  ? 63.121  -37.637 31.163   1.00 120.25 ?  232  GLU C CG    1 
ATOM   5384  C  CD    . GLU C  2  232  ? 63.136  -38.041 29.701   1.00 127.32 ?  232  GLU C CD    1 
ATOM   5385  O  OE1   . GLU C  2  232  ? 62.883  -39.228 29.408   1.00 130.52 ?  232  GLU C OE1   1 
ATOM   5386  O  OE2   . GLU C  2  232  ? 63.393  -37.168 28.845   1.00 122.35 ?  232  GLU C OE2   1 
ATOM   5387  N  N     . GLU C  2  233  ? 59.903  -37.732 32.070   1.00 125.49 ?  233  GLU C N     1 
ATOM   5388  C  CA    . GLU C  2  233  ? 58.873  -36.846 31.539   1.00 126.56 ?  233  GLU C CA    1 
ATOM   5389  C  C     . GLU C  2  233  ? 57.997  -36.286 32.655   1.00 125.46 ?  233  GLU C C     1 
ATOM   5390  O  O     . GLU C  2  233  ? 57.537  -35.145 32.585   1.00 119.14 ?  233  GLU C O     1 
ATOM   5391  C  CB    . GLU C  2  233  ? 58.018  -37.587 30.508   1.00 133.92 ?  233  GLU C CB    1 
ATOM   5392  C  CG    . GLU C  2  233  ? 58.828  -38.255 29.407   1.00 128.05 ?  233  GLU C CG    1 
ATOM   5393  C  CD    . GLU C  2  233  ? 57.966  -39.028 28.427   1.00 122.66 ?  233  GLU C CD    1 
ATOM   5394  O  OE1   . GLU C  2  233  ? 56.740  -38.793 28.395   1.00 116.89 ?  233  GLU C OE1   1 
ATOM   5395  O  OE2   . GLU C  2  233  ? 58.516  -39.873 27.691   1.00 118.36 ?  233  GLU C OE2   1 
ATOM   5396  N  N     . ALA C  2  234  ? 57.771  -37.098 33.684   1.00 124.90 ?  234  ALA C N     1 
ATOM   5397  C  CA    . ALA C  2  234  ? 57.012  -36.667 34.851   1.00 118.94 ?  234  ALA C CA    1 
ATOM   5398  C  C     . ALA C  2  234  ? 57.773  -35.579 35.601   1.00 115.12 ?  234  ALA C C     1 
ATOM   5399  O  O     . ALA C  2  234  ? 57.181  -34.620 36.097   1.00 109.89 ?  234  ALA C O     1 
ATOM   5400  C  CB    . ALA C  2  234  ? 56.734  -37.849 35.764   1.00 112.70 ?  234  ALA C CB    1 
ATOM   5401  N  N     . LEU C  2  235  ? 59.092  -35.738 35.673   1.00 120.02 ?  235  LEU C N     1 
ATOM   5402  C  CA    . LEU C  2  235  ? 59.963  -34.764 36.323   1.00 118.48 ?  235  LEU C CA    1 
ATOM   5403  C  C     . LEU C  2  235  ? 59.970  -33.446 35.557   1.00 119.66 ?  235  LEU C C     1 
ATOM   5404  O  O     . LEU C  2  235  ? 59.922  -32.370 36.155   1.00 113.86 ?  235  LEU C O     1 
ATOM   5405  C  CB    . LEU C  2  235  ? 61.389  -35.312 36.426   1.00 116.73 ?  235  LEU C CB    1 
ATOM   5406  C  CG    . LEU C  2  235  ? 62.438  -34.442 37.124   1.00 103.07 ?  235  LEU C CG    1 
ATOM   5407  C  CD1   . LEU C  2  235  ? 62.147  -34.348 38.610   1.00 102.50 ?  235  LEU C CD1   1 
ATOM   5408  C  CD2   . LEU C  2  235  ? 63.841  -34.982 36.881   1.00 99.81  ?  235  LEU C CD2   1 
ATOM   5409  N  N     . ILE C  2  236  ? 60.035  -33.537 34.231   1.00 128.80 ?  236  ILE C N     1 
ATOM   5410  C  CA    . ILE C  2  236  ? 60.032  -32.351 33.378   1.00 127.54 ?  236  ILE C CA    1 
ATOM   5411  C  C     . ILE C  2  236  ? 58.695  -31.611 33.454   1.00 124.04 ?  236  ILE C C     1 
ATOM   5412  O  O     . ILE C  2  236  ? 58.661  -30.382 33.572   1.00 122.59 ?  236  ILE C O     1 
ATOM   5413  C  CB    . ILE C  2  236  ? 60.382  -32.703 31.911   1.00 121.79 ?  236  ILE C CB    1 
ATOM   5414  C  CG1   . ILE C  2  236  ? 61.885  -32.959 31.774   1.00 112.03 ?  236  ILE C CG1   1 
ATOM   5415  C  CG2   . ILE C  2  236  ? 59.961  -31.588 30.968   1.00 114.61 ?  236  ILE C CG2   1 
ATOM   5416  C  CD1   . ILE C  2  236  ? 62.345  -33.171 30.348   1.00 101.54 ?  236  ILE C CD1   1 
ATOM   5417  N  N     . ARG C  2  237  ? 57.597  -32.361 33.399   1.00 121.91 ?  237  ARG C N     1 
ATOM   5418  C  CA    . ARG C  2  237  ? 56.268  -31.772 33.530   1.00 120.75 ?  237  ARG C CA    1 
ATOM   5419  C  C     . ARG C  2  237  ? 56.088  -31.118 34.896   1.00 116.89 ?  237  ARG C C     1 
ATOM   5420  O  O     . ARG C  2  237  ? 55.526  -30.030 35.001   1.00 111.56 ?  237  ARG C O     1 
ATOM   5421  C  CB    . ARG C  2  237  ? 55.175  -32.818 33.303   1.00 125.66 ?  237  ARG C CB    1 
ATOM   5422  C  CG    . ARG C  2  237  ? 53.780  -32.309 33.633   1.00 122.27 ?  237  ARG C CG    1 
ATOM   5423  C  CD    . ARG C  2  237  ? 52.707  -33.341 33.336   1.00 122.15 ?  237  ARG C CD    1 
ATOM   5424  N  NE    . ARG C  2  237  ? 51.412  -32.937 33.878   1.00 122.45 ?  237  ARG C NE    1 
ATOM   5425  C  CZ    . ARG C  2  237  ? 50.559  -32.127 33.258   1.00 119.35 ?  237  ARG C CZ    1 
ATOM   5426  N  NH1   . ARG C  2  237  ? 49.404  -31.814 33.830   1.00 112.35 ?  237  ARG C NH1   1 
ATOM   5427  N  NH2   . ARG C  2  237  ? 50.861  -31.627 32.068   1.00 121.40 ?  237  ARG C NH2   1 
ATOM   5428  N  N     . LEU C  2  238  ? 56.571  -31.786 35.939   1.00 118.13 ?  238  LEU C N     1 
ATOM   5429  C  CA    . LEU C  2  238  ? 56.515  -31.232 37.287   1.00 116.68 ?  238  LEU C CA    1 
ATOM   5430  C  C     . LEU C  2  238  ? 57.325  -29.942 37.360   1.00 118.39 ?  238  LEU C C     1 
ATOM   5431  O  O     . LEU C  2  238  ? 56.935  -28.986 38.034   1.00 118.86 ?  238  LEU C O     1 
ATOM   5432  C  CB    . LEU C  2  238  ? 57.041  -32.243 38.307   1.00 113.49 ?  238  LEU C CB    1 
ATOM   5433  C  CG    . LEU C  2  238  ? 57.015  -31.799 39.771   1.00 112.51 ?  238  LEU C CG    1 
ATOM   5434  C  CD1   . LEU C  2  238  ? 55.591  -31.514 40.224   1.00 107.75 ?  238  LEU C CD1   1 
ATOM   5435  C  CD2   . LEU C  2  238  ? 57.665  -32.848 40.657   1.00 116.16 ?  238  LEU C CD2   1 
ATOM   5436  N  N     . PHE C  2  239  ? 58.451  -29.921 36.653   1.00 119.69 ?  239  PHE C N     1 
ATOM   5437  C  CA    . PHE C  2  239  ? 59.306  -28.742 36.600   1.00 119.83 ?  239  PHE C CA    1 
ATOM   5438  C  C     . PHE C  2  239  ? 58.606  -27.580 35.900   1.00 122.63 ?  239  PHE C C     1 
ATOM   5439  O  O     . PHE C  2  239  ? 58.733  -26.429 36.321   1.00 116.21 ?  239  PHE C O     1 
ATOM   5440  C  CB    . PHE C  2  239  ? 60.629  -29.066 35.901   1.00 112.59 ?  239  PHE C CB    1 
ATOM   5441  C  CG    . PHE C  2  239  ? 61.591  -27.912 35.857   1.00 107.94 ?  239  PHE C CG    1 
ATOM   5442  C  CD1   . PHE C  2  239  ? 62.390  -27.618 36.949   1.00 111.69 ?  239  PHE C CD1   1 
ATOM   5443  C  CD2   . PHE C  2  239  ? 61.700  -27.125 34.722   1.00 106.97 ?  239  PHE C CD2   1 
ATOM   5444  C  CE1   . PHE C  2  239  ? 63.278  -26.559 36.911   1.00 109.76 ?  239  PHE C CE1   1 
ATOM   5445  C  CE2   . PHE C  2  239  ? 62.585  -26.064 34.678   1.00 103.50 ?  239  PHE C CE2   1 
ATOM   5446  C  CZ    . PHE C  2  239  ? 63.375  -25.781 35.774   1.00 103.62 ?  239  PHE C CZ    1 
ATOM   5447  N  N     . THR C  2  240  ? 57.867  -27.878 34.834   1.00 129.36 ?  240  THR C N     1 
ATOM   5448  C  CA    . THR C  2  240  ? 57.151  -26.833 34.107   1.00 126.27 ?  240  THR C CA    1 
ATOM   5449  C  C     . THR C  2  240  ? 55.904  -26.386 34.870   1.00 121.54 ?  240  THR C C     1 
ATOM   5450  O  O     . THR C  2  240  ? 55.385  -25.294 34.640   1.00 118.43 ?  240  THR C O     1 
ATOM   5451  C  CB    . THR C  2  240  ? 56.785  -27.259 32.662   1.00 125.03 ?  240  THR C CB    1 
ATOM   5452  O  OG1   . THR C  2  240  ? 56.724  -26.100 31.821   1.00 127.55 ?  240  THR C OG1   1 
ATOM   5453  C  CG2   . THR C  2  240  ? 55.447  -27.983 32.620   1.00 112.39 ?  240  THR C CG2   1 
ATOM   5454  N  N     . LEU C  2  241  ? 55.432  -27.234 35.780   1.00 122.72 ?  241  LEU C N     1 
ATOM   5455  C  CA    . LEU C  2  241  ? 54.313  -26.880 36.647   1.00 123.06 ?  241  LEU C CA    1 
ATOM   5456  C  C     . LEU C  2  241  ? 54.768  -25.951 37.767   1.00 123.74 ?  241  LEU C C     1 
ATOM   5457  O  O     . LEU C  2  241  ? 54.116  -24.948 38.059   1.00 119.38 ?  241  LEU C O     1 
ATOM   5458  C  CB    . LEU C  2  241  ? 53.667  -28.133 37.243   1.00 115.00 ?  241  LEU C CB    1 
ATOM   5459  C  CG    . LEU C  2  241  ? 52.833  -29.007 36.306   1.00 110.55 ?  241  LEU C CG    1 
ATOM   5460  C  CD1   . LEU C  2  241  ? 52.280  -30.210 37.054   1.00 99.20  ?  241  LEU C CD1   1 
ATOM   5461  C  CD2   . LEU C  2  241  ? 51.711  -28.200 35.673   1.00 108.49 ?  241  LEU C CD2   1 
ATOM   5462  N  N     . LEU C  2  242  ? 55.891  -26.293 38.392   1.00 124.15 ?  242  LEU C N     1 
ATOM   5463  C  CA    . LEU C  2  242  ? 56.410  -25.516 39.513   1.00 122.57 ?  242  LEU C CA    1 
ATOM   5464  C  C     . LEU C  2  242  ? 57.092  -24.229 39.055   1.00 120.62 ?  242  LEU C C     1 
ATOM   5465  O  O     . LEU C  2  242  ? 57.089  -23.229 39.773   1.00 118.14 ?  242  LEU C O     1 
ATOM   5466  C  CB    . LEU C  2  242  ? 57.383  -26.354 40.347   1.00 120.13 ?  242  LEU C CB    1 
ATOM   5467  C  CG    . LEU C  2  242  ? 56.823  -27.602 41.033   1.00 116.90 ?  242  LEU C CG    1 
ATOM   5468  C  CD1   . LEU C  2  242  ? 57.908  -28.304 41.837   1.00 104.52 ?  242  LEU C CD1   1 
ATOM   5469  C  CD2   . LEU C  2  242  ? 55.638  -27.250 41.918   1.00 107.31 ?  242  LEU C CD2   1 
ATOM   5470  N  N     . ARG C  2  243  ? 57.674  -24.257 37.860   1.00 121.25 ?  243  ARG C N     1 
ATOM   5471  C  CA    . ARG C  2  243  ? 58.424  -23.111 37.354   1.00 122.60 ?  243  ARG C CA    1 
ATOM   5472  C  C     . ARG C  2  243  ? 58.085  -22.769 35.904   1.00 124.89 ?  243  ARG C C     1 
ATOM   5473  O  O     . ARG C  2  243  ? 58.791  -23.183 34.984   1.00 123.80 ?  243  ARG C O     1 
ATOM   5474  C  CB    . ARG C  2  243  ? 59.930  -23.360 37.490   1.00 118.59 ?  243  ARG C CB    1 
ATOM   5475  C  CG    . ARG C  2  243  ? 60.424  -23.469 38.925   1.00 116.60 ?  243  ARG C CG    1 
ATOM   5476  C  CD    . ARG C  2  243  ? 60.301  -22.140 39.651   1.00 115.64 ?  243  ARG C CD    1 
ATOM   5477  N  NE    . ARG C  2  243  ? 61.091  -21.098 39.003   1.00 120.96 ?  243  ARG C NE    1 
ATOM   5478  C  CZ    . ARG C  2  243  ? 62.343  -20.796 39.328   1.00 108.94 ?  243  ARG C CZ    1 
ATOM   5479  N  NH1   . ARG C  2  243  ? 62.982  -19.834 38.677   1.00 100.48 ?  243  ARG C NH1   1 
ATOM   5480  N  NH2   . ARG C  2  243  ? 62.958  -21.454 40.302   1.00 98.77  ?  243  ARG C NH2   1 
ATOM   5481  N  N     . PRO C  2  244  ? 56.996  -22.011 35.694   1.00 125.68 ?  244  PRO C N     1 
ATOM   5482  C  CA    . PRO C  2  244  ? 56.651  -21.530 34.352   1.00 117.05 ?  244  PRO C CA    1 
ATOM   5483  C  C     . PRO C  2  244  ? 57.588  -20.410 33.903   1.00 111.99 ?  244  PRO C C     1 
ATOM   5484  O  O     . PRO C  2  244  ? 57.972  -19.567 34.714   1.00 113.40 ?  244  PRO C O     1 
ATOM   5485  C  CB    . PRO C  2  244  ? 55.229  -20.995 34.530   1.00 104.64 ?  244  PRO C CB    1 
ATOM   5486  C  CG    . PRO C  2  244  ? 55.159  -20.598 35.963   1.00 104.05 ?  244  PRO C CG    1 
ATOM   5487  C  CD    . PRO C  2  244  ? 56.008  -21.592 36.704   1.00 118.41 ?  244  PRO C CD    1 
ATOM   5488  N  N     . GLY C  2  245  ? 57.950  -20.405 32.625   1.00 105.89 ?  245  GLY C N     1 
ATOM   5489  C  CA    . GLY C  2  245  ? 58.837  -19.388 32.087   1.00 106.19 ?  245  GLY C CA    1 
ATOM   5490  C  C     . GLY C  2  245  ? 60.268  -19.872 31.956   1.00 113.01 ?  245  GLY C C     1 
ATOM   5491  O  O     . GLY C  2  245  ? 61.054  -19.318 31.187   1.00 109.22 ?  245  GLY C O     1 
ATOM   5492  N  N     . ASP C  2  246  ? 60.606  -20.910 32.714   1.00 119.75 ?  246  ASP C N     1 
ATOM   5493  C  CA    . ASP C  2  246  ? 61.933  -21.513 32.651   1.00 116.48 ?  246  ASP C CA    1 
ATOM   5494  C  C     . ASP C  2  246  ? 61.924  -22.729 31.732   1.00 111.18 ?  246  ASP C C     1 
ATOM   5495  O  O     . ASP C  2  246  ? 61.045  -23.586 31.847   1.00 103.49 ?  246  ASP C O     1 
ATOM   5496  C  CB    . ASP C  2  246  ? 62.410  -21.917 34.048   1.00 118.27 ?  246  ASP C CB    1 
ATOM   5497  C  CG    . ASP C  2  246  ? 62.560  -20.731 34.982   1.00 123.49 ?  246  ASP C CG    1 
ATOM   5498  O  OD1   . ASP C  2  246  ? 62.795  -19.608 34.489   1.00 123.66 ?  246  ASP C OD1   1 
ATOM   5499  O  OD2   . ASP C  2  246  ? 62.445  -20.923 36.211   1.00 121.71 ?  246  ASP C OD2   1 
ATOM   5500  N  N     . PRO C  2  247  ? 62.896  -22.805 30.809   1.00 110.72 ?  247  PRO C N     1 
ATOM   5501  C  CA    . PRO C  2  247  ? 62.991  -23.961 29.910   1.00 111.97 ?  247  PRO C CA    1 
ATOM   5502  C  C     . PRO C  2  247  ? 63.223  -25.253 30.691   1.00 115.06 ?  247  PRO C C     1 
ATOM   5503  O  O     . PRO C  2  247  ? 64.134  -25.315 31.517   1.00 118.00 ?  247  PRO C O     1 
ATOM   5504  C  CB    . PRO C  2  247  ? 64.209  -23.631 29.039   1.00 100.82 ?  247  PRO C CB    1 
ATOM   5505  C  CG    . PRO C  2  247  ? 64.991  -22.627 29.825   1.00 96.24  ?  247  PRO C CG    1 
ATOM   5506  C  CD    . PRO C  2  247  ? 63.973  -21.828 30.574   1.00 95.60  ?  247  PRO C CD    1 
ATOM   5507  N  N     . PRO C  2  248  ? 62.398  -26.279 30.431   1.00 113.45 ?  248  PRO C N     1 
ATOM   5508  C  CA    . PRO C  2  248  ? 62.429  -27.546 31.171   1.00 117.05 ?  248  PRO C CA    1 
ATOM   5509  C  C     . PRO C  2  248  ? 63.577  -28.469 30.765   1.00 116.84 ?  248  PRO C C     1 
ATOM   5510  O  O     . PRO C  2  248  ? 63.349  -29.469 30.081   1.00 110.83 ?  248  PRO C O     1 
ATOM   5511  C  CB    . PRO C  2  248  ? 61.084  -28.193 30.810   1.00 116.30 ?  248  PRO C CB    1 
ATOM   5512  C  CG    . PRO C  2  248  ? 60.246  -27.084 30.235   1.00 109.93 ?  248  PRO C CG    1 
ATOM   5513  C  CD    . PRO C  2  248  ? 61.223  -26.192 29.550   1.00 104.78 ?  248  PRO C CD    1 
ATOM   5514  N  N     . LYS C  2  249  ? 64.793  -28.139 31.191   1.00 115.60 ?  249  LYS C N     1 
ATOM   5515  C  CA    . LYS C  2  249  ? 65.951  -28.994 30.947   1.00 116.00 ?  249  LYS C CA    1 
ATOM   5516  C  C     . LYS C  2  249  ? 66.088  -30.044 32.045   1.00 125.43 ?  249  LYS C C     1 
ATOM   5517  O  O     . LYS C  2  249  ? 65.820  -29.765 33.212   1.00 124.85 ?  249  LYS C O     1 
ATOM   5518  C  CB    . LYS C  2  249  ? 67.232  -28.162 30.855   1.00 102.06 ?  249  LYS C CB    1 
ATOM   5519  C  CG    . LYS C  2  249  ? 67.341  -27.316 29.599   1.00 92.24  ?  249  LYS C CG    1 
ATOM   5520  C  CD    . LYS C  2  249  ? 68.746  -26.753 29.446   1.00 89.82  ?  249  LYS C CD    1 
ATOM   5521  C  CE    . LYS C  2  249  ? 69.782  -27.869 29.430   1.00 94.85  ?  249  LYS C CE    1 
ATOM   5522  N  NZ    . LYS C  2  249  ? 71.175  -27.350 29.347   1.00 88.37  ?  249  LYS C NZ    1 
ATOM   5523  N  N     . ARG C  2  250  ? 66.507  -31.247 31.663   1.00 125.87 ?  250  ARG C N     1 
ATOM   5524  C  CA    . ARG C  2  250  ? 66.640  -32.363 32.598   1.00 120.23 ?  250  ARG C CA    1 
ATOM   5525  C  C     . ARG C  2  250  ? 67.597  -32.065 33.751   1.00 125.65 ?  250  ARG C C     1 
ATOM   5526  O  O     . ARG C  2  250  ? 67.273  -32.300 34.919   1.00 124.18 ?  250  ARG C O     1 
ATOM   5527  C  CB    . ARG C  2  250  ? 67.087  -33.626 31.859   1.00 111.44 ?  250  ARG C CB    1 
ATOM   5528  C  CG    . ARG C  2  250  ? 65.975  -34.632 31.633   1.00 112.53 ?  250  ARG C CG    1 
ATOM   5529  C  CD    . ARG C  2  250  ? 65.413  -35.118 32.958   1.00 109.17 ?  250  ARG C CD    1 
ATOM   5530  N  NE    . ARG C  2  250  ? 65.551  -36.562 33.112   1.00 105.17 ?  250  ARG C NE    1 
ATOM   5531  C  CZ    . ARG C  2  250  ? 66.593  -37.159 33.681   1.00 106.65 ?  250  ARG C CZ    1 
ATOM   5532  N  NH1   . ARG C  2  250  ? 67.598  -36.436 34.157   1.00 100.86 ?  250  ARG C NH1   1 
ATOM   5533  N  NH2   . ARG C  2  250  ? 66.630  -38.482 33.775   1.00 104.79 ?  250  ARG C NH2   1 
ATOM   5534  N  N     . ASP C  2  251  ? 68.774  -31.548 33.412   1.00 126.99 ?  251  ASP C N     1 
ATOM   5535  C  CA    . ASP C  2  251  ? 69.791  -31.209 34.405   1.00 123.53 ?  251  ASP C CA    1 
ATOM   5536  C  C     . ASP C  2  251  ? 69.318  -30.146 35.402   1.00 124.17 ?  251  ASP C C     1 
ATOM   5537  O  O     . ASP C  2  251  ? 69.600  -30.233 36.602   1.00 128.57 ?  251  ASP C O     1 
ATOM   5538  C  CB    . ASP C  2  251  ? 71.091  -30.772 33.716   1.00 114.47 ?  251  ASP C CB    1 
ATOM   5539  C  CG    . ASP C  2  251  ? 70.856  -29.764 32.600   1.00 113.85 ?  251  ASP C CG    1 
ATOM   5540  O  OD1   . ASP C  2  251  ? 69.877  -28.993 32.681   1.00 117.98 ?  251  ASP C OD1   1 
ATOM   5541  O  OD2   . ASP C  2  251  ? 71.655  -29.743 31.639   1.00 97.86  ?  251  ASP C OD2   1 
ATOM   5542  N  N     . LYS C  2  252  ? 68.593  -29.148 34.905   1.00 116.84 ?  252  LYS C N     1 
ATOM   5543  C  CA    . LYS C  2  252  ? 68.073  -28.095 35.769   1.00 112.68 ?  252  LYS C CA    1 
ATOM   5544  C  C     . LYS C  2  252  ? 66.834  -28.570 36.526   1.00 119.24 ?  252  LYS C C     1 
ATOM   5545  O  O     . LYS C  2  252  ? 66.528  -28.072 37.611   1.00 117.51 ?  252  LYS C O     1 
ATOM   5546  C  CB    . LYS C  2  252  ? 67.758  -26.831 34.967   1.00 100.33 ?  252  LYS C CB    1 
ATOM   5547  C  CG    . LYS C  2  252  ? 67.909  -25.549 35.773   1.00 89.91  ?  252  LYS C CG    1 
ATOM   5548  C  CD    . LYS C  2  252  ? 66.752  -24.601 35.529   1.00 86.33  ?  252  LYS C CD    1 
ATOM   5549  C  CE    . LYS C  2  252  ? 66.612  -24.268 34.055   1.00 84.11  ?  252  LYS C CE    1 
ATOM   5550  N  NZ    . LYS C  2  252  ? 65.452  -23.369 33.810   1.00 95.07  ?  252  LYS C NZ    1 
ATOM   5551  N  N     . ALA C  2  253  ? 66.123  -29.534 35.944   1.00 120.81 ?  253  ALA C N     1 
ATOM   5552  C  CA    . ALA C  2  253  ? 64.964  -30.141 36.592   1.00 116.11 ?  253  ALA C CA    1 
ATOM   5553  C  C     . ALA C  2  253  ? 65.410  -30.904 37.828   1.00 115.81 ?  253  ALA C C     1 
ATOM   5554  O  O     . ALA C  2  253  ? 64.811  -30.785 38.899   1.00 117.47 ?  253  ALA C O     1 
ATOM   5555  C  CB    . ALA C  2  253  ? 64.241  -31.072 35.632   1.00 112.05 ?  253  ALA C CB    1 
ATOM   5556  N  N     . VAL C  2  254  ? 66.465  -31.695 37.663   1.00 120.87 ?  254  VAL C N     1 
ATOM   5557  C  CA    . VAL C  2  254  ? 67.077  -32.401 38.780   1.00 121.86 ?  254  VAL C CA    1 
ATOM   5558  C  C     . VAL C  2  254  ? 67.654  -31.401 39.777   1.00 120.42 ?  254  VAL C C     1 
ATOM   5559  O  O     . VAL C  2  254  ? 67.466  -31.540 40.983   1.00 120.15 ?  254  VAL C O     1 
ATOM   5560  C  CB    . VAL C  2  254  ? 68.192  -33.351 38.307   1.00 121.46 ?  254  VAL C CB    1 
ATOM   5561  C  CG1   . VAL C  2  254  ? 68.891  -33.992 39.498   1.00 115.17 ?  254  VAL C CG1   1 
ATOM   5562  C  CG2   . VAL C  2  254  ? 67.625  -34.413 37.378   1.00 118.15 ?  254  VAL C CG2   1 
ATOM   5563  N  N     . ALA C  2  255  ? 68.342  -30.383 39.262   1.00 119.77 ?  255  ALA C N     1 
ATOM   5564  C  CA    . ALA C  2  255  ? 68.959  -29.367 40.115   1.00 114.91 ?  255  ALA C CA    1 
ATOM   5565  C  C     . ALA C  2  255  ? 67.929  -28.597 40.939   1.00 120.59 ?  255  ALA C C     1 
ATOM   5566  O  O     . ALA C  2  255  ? 68.254  -28.023 41.979   1.00 116.31 ?  255  ALA C O     1 
ATOM   5567  C  CB    . ALA C  2  255  ? 69.798  -28.412 39.282   1.00 94.06  ?  255  ALA C CB    1 
ATOM   5568  N  N     . TYR C  2  256  ? 66.688  -28.584 40.467   1.00 118.96 ?  256  TYR C N     1 
ATOM   5569  C  CA    . TYR C  2  256  ? 65.604  -27.918 41.179   1.00 111.12 ?  256  TYR C CA    1 
ATOM   5570  C  C     . TYR C  2  256  ? 64.904  -28.858 42.158   1.00 105.93 ?  256  TYR C C     1 
ATOM   5571  O  O     . TYR C  2  256  ? 64.917  -28.626 43.366   1.00 105.82 ?  256  TYR C O     1 
ATOM   5572  C  CB    . TYR C  2  256  ? 64.600  -27.318 40.195   1.00 111.25 ?  256  TYR C CB    1 
ATOM   5573  C  CG    . TYR C  2  256  ? 63.434  -26.627 40.860   1.00 110.09 ?  256  TYR C CG    1 
ATOM   5574  C  CD1   . TYR C  2  256  ? 63.637  -25.552 41.718   1.00 108.40 ?  256  TYR C CD1   1 
ATOM   5575  C  CD2   . TYR C  2  256  ? 62.130  -27.042 40.625   1.00 109.04 ?  256  TYR C CD2   1 
ATOM   5576  C  CE1   . TYR C  2  256  ? 62.574  -24.915 42.328   1.00 108.51 ?  256  TYR C CE1   1 
ATOM   5577  C  CE2   . TYR C  2  256  ? 61.060  -26.411 41.229   1.00 109.59 ?  256  TYR C CE2   1 
ATOM   5578  C  CZ    . TYR C  2  256  ? 61.288  -25.349 42.079   1.00 110.28 ?  256  TYR C CZ    1 
ATOM   5579  O  OH    . TYR C  2  256  ? 60.226  -24.717 42.683   1.00 106.23 ?  256  TYR C OH    1 
ATOM   5580  N  N     . VAL C  2  257  ? 64.290  -29.912 41.627   1.00 105.06 ?  257  VAL C N     1 
ATOM   5581  C  CA    . VAL C  2  257  ? 63.535  -30.864 42.440   1.00 101.06 ?  257  VAL C CA    1 
ATOM   5582  C  C     . VAL C  2  257  ? 64.377  -31.531 43.532   1.00 107.07 ?  257  VAL C C     1 
ATOM   5583  O  O     . VAL C  2  257  ? 63.915  -31.687 44.660   1.00 104.56 ?  257  VAL C O     1 
ATOM   5584  C  CB    . VAL C  2  257  ? 62.860  -31.941 41.567   1.00 97.62  ?  257  VAL C CB    1 
ATOM   5585  C  CG1   . VAL C  2  257  ? 62.062  -32.908 42.428   1.00 83.67  ?  257  VAL C CG1   1 
ATOM   5586  C  CG2   . VAL C  2  257  ? 61.961  -31.284 40.532   1.00 108.17 ?  257  VAL C CG2   1 
ATOM   5587  N  N     . TYR C  2  258  ? 65.607  -31.917 43.203   1.00 115.19 ?  258  TYR C N     1 
ATOM   5588  C  CA    . TYR C  2  258  ? 66.501  -32.503 44.202   1.00 119.13 ?  258  TYR C CA    1 
ATOM   5589  C  C     . TYR C  2  258  ? 66.903  -31.478 45.258   1.00 119.11 ?  258  TYR C C     1 
ATOM   5590  O  O     . TYR C  2  258  ? 67.007  -31.799 46.439   1.00 117.79 ?  258  TYR C O     1 
ATOM   5591  C  CB    . TYR C  2  258  ? 67.748  -33.109 43.547   1.00 118.47 ?  258  TYR C CB    1 
ATOM   5592  C  CG    . TYR C  2  258  ? 69.013  -32.985 44.372   1.00 115.08 ?  258  TYR C CG    1 
ATOM   5593  C  CD1   . TYR C  2  258  ? 69.293  -33.886 45.391   1.00 112.72 ?  258  TYR C CD1   1 
ATOM   5594  C  CD2   . TYR C  2  258  ? 69.934  -31.972 44.123   1.00 112.18 ?  258  TYR C CD2   1 
ATOM   5595  C  CE1   . TYR C  2  258  ? 70.448  -33.779 46.145   1.00 107.76 ?  258  TYR C CE1   1 
ATOM   5596  C  CE2   . TYR C  2  258  ? 71.092  -31.857 44.872   1.00 106.12 ?  258  TYR C CE2   1 
ATOM   5597  C  CZ    . TYR C  2  258  ? 71.344  -32.764 45.880   1.00 99.33  ?  258  TYR C CZ    1 
ATOM   5598  O  OH    . TYR C  2  258  ? 72.494  -32.655 46.627   1.00 89.41  ?  258  TYR C OH    1 
ATOM   5599  N  N     . GLY C  2  259  ? 67.138  -30.245 44.826   1.00 116.73 ?  259  GLY C N     1 
ATOM   5600  C  CA    . GLY C  2  259  ? 67.500  -29.187 45.750   1.00 113.73 ?  259  GLY C CA    1 
ATOM   5601  C  C     . GLY C  2  259  ? 66.386  -28.924 46.743   1.00 109.33 ?  259  GLY C C     1 
ATOM   5602  O  O     . GLY C  2  259  ? 66.627  -28.768 47.940   1.00 108.65 ?  259  GLY C O     1 
ATOM   5603  N  N     . LEU C  2  260  ? 65.159  -28.880 46.237   1.00 105.10 ?  260  LEU C N     1 
ATOM   5604  C  CA    . LEU C  2  260  ? 63.989  -28.597 47.056   1.00 104.30 ?  260  LEU C CA    1 
ATOM   5605  C  C     . LEU C  2  260  ? 63.593  -29.752 47.979   1.00 105.05 ?  260  LEU C C     1 
ATOM   5606  O  O     . LEU C  2  260  ? 63.484  -29.577 49.193   1.00 107.51 ?  260  LEU C O     1 
ATOM   5607  C  CB    . LEU C  2  260  ? 62.807  -28.235 46.153   1.00 101.77 ?  260  LEU C CB    1 
ATOM   5608  C  CG    . LEU C  2  260  ? 61.528  -27.741 46.829   1.00 98.76  ?  260  LEU C CG    1 
ATOM   5609  C  CD1   . LEU C  2  260  ? 61.725  -26.338 47.386   1.00 102.66 ?  260  LEU C CD1   1 
ATOM   5610  C  CD2   . LEU C  2  260  ? 60.356  -27.784 45.858   1.00 95.15  ?  260  LEU C CD2   1 
ATOM   5611  N  N     . ILE C  2  261  ? 63.376  -30.927 47.394   1.00 103.92 ?  261  ILE C N     1 
ATOM   5612  C  CA    . ILE C  2  261  ? 62.791  -32.056 48.115   1.00 91.63  ?  261  ILE C CA    1 
ATOM   5613  C  C     . ILE C  2  261  ? 63.796  -33.087 48.642   1.00 96.03  ?  261  ILE C C     1 
ATOM   5614  O  O     . ILE C  2  261  ? 63.421  -34.009 49.369   1.00 96.91  ?  261  ILE C O     1 
ATOM   5615  C  CB    . ILE C  2  261  ? 61.759  -32.780 47.217   1.00 88.34  ?  261  ILE C CB    1 
ATOM   5616  C  CG1   . ILE C  2  261  ? 60.605  -33.345 48.044   1.00 88.34  ?  261  ILE C CG1   1 
ATOM   5617  C  CG2   . ILE C  2  261  ? 62.427  -33.870 46.381   1.00 89.95  ?  261  ILE C CG2   1 
ATOM   5618  C  CD1   . ILE C  2  261  ? 59.491  -33.899 47.190   1.00 89.41  ?  261  ILE C CD1   1 
ATOM   5619  N  N     . ALA C  2  262  ? 65.070  -32.921 48.302   1.00 99.70  ?  262  ALA C N     1 
ATOM   5620  C  CA    . ALA C  2  262  ? 66.070  -33.949 48.598   1.00 102.80 ?  262  ALA C CA    1 
ATOM   5621  C  C     . ALA C  2  262  ? 67.311  -33.436 49.331   1.00 104.33 ?  262  ALA C C     1 
ATOM   5622  O  O     . ALA C  2  262  ? 67.623  -33.902 50.424   1.00 98.07  ?  262  ALA C O     1 
ATOM   5623  C  CB    . ALA C  2  262  ? 66.458  -34.713 47.333   1.00 105.56 ?  262  ALA C CB    1 
ATOM   5624  N  N     . ASP C  2  263  ? 68.026  -32.506 48.702   1.00 107.40 ?  263  ASP C N     1 
ATOM   5625  C  CA    . ASP C  2  263  ? 69.297  -31.997 49.218   1.00 102.26 ?  263  ASP C CA    1 
ATOM   5626  C  C     . ASP C  2  263  ? 69.197  -31.546 50.677   1.00 101.67 ?  263  ASP C C     1 
ATOM   5627  O  O     . ASP C  2  263  ? 68.400  -30.667 51.007   1.00 96.33  ?  263  ASP C O     1 
ATOM   5628  C  CB    . ASP C  2  263  ? 69.767  -30.831 48.339   1.00 100.48 ?  263  ASP C CB    1 
ATOM   5629  C  CG    . ASP C  2  263  ? 71.104  -30.262 48.776   1.00 96.79  ?  263  ASP C CG    1 
ATOM   5630  O  OD1   . ASP C  2  263  ? 72.005  -31.048 49.133   1.00 98.05  ?  263  ASP C OD1   1 
ATOM   5631  O  OD2   . ASP C  2  263  ? 71.254  -29.022 48.754   1.00 90.27  ?  263  ASP C OD2   1 
ATOM   5632  N  N     . PRO C  2  264  ? 70.012  -32.158 51.554   1.00 100.47 ?  264  PRO C N     1 
ATOM   5633  C  CA    . PRO C  2  264  ? 70.018  -31.894 52.999   1.00 96.50  ?  264  PRO C CA    1 
ATOM   5634  C  C     . PRO C  2  264  ? 70.547  -30.510 53.368   1.00 96.48  ?  264  PRO C C     1 
ATOM   5635  O  O     . PRO C  2  264  ? 70.196  -29.985 54.425   1.00 97.90  ?  264  PRO C O     1 
ATOM   5636  C  CB    . PRO C  2  264  ? 70.945  -32.983 53.550   1.00 87.84  ?  264  PRO C CB    1 
ATOM   5637  C  CG    . PRO C  2  264  ? 71.811  -33.359 52.403   1.00 92.22  ?  264  PRO C CG    1 
ATOM   5638  C  CD    . PRO C  2  264  ? 70.937  -33.246 51.193   1.00 93.32  ?  264  PRO C CD    1 
ATOM   5639  N  N     . ARG C  2  265  ? 71.378  -29.929 52.509   1.00 96.06  ?  265  ARG C N     1 
ATOM   5640  C  CA    . ARG C  2  265  ? 71.919  -28.596 52.757   1.00 96.96  ?  265  ARG C CA    1 
ATOM   5641  C  C     . ARG C  2  265  ? 70.871  -27.520 52.480   1.00 96.37  ?  265  ARG C C     1 
ATOM   5642  O  O     . ARG C  2  265  ? 71.084  -26.341 52.762   1.00 88.72  ?  265  ARG C O     1 
ATOM   5643  C  CB    . ARG C  2  265  ? 73.182  -28.362 51.924   1.00 93.58  ?  265  ARG C CB    1 
ATOM   5644  C  CG    . ARG C  2  265  ? 74.338  -29.270 52.318   1.00 96.26  ?  265  ARG C CG    1 
ATOM   5645  C  CD    . ARG C  2  265  ? 74.971  -29.935 51.106   1.00 101.53 ?  265  ARG C CD    1 
ATOM   5646  N  NE    . ARG C  2  265  ? 75.838  -29.026 50.364   1.00 99.11  ?  265  ARG C NE    1 
ATOM   5647  C  CZ    . ARG C  2  265  ? 77.153  -28.941 50.541   1.00 91.86  ?  265  ARG C CZ    1 
ATOM   5648  N  NH1   . ARG C  2  265  ? 77.755  -29.713 51.436   1.00 78.81  ?  265  ARG C NH1   1 
ATOM   5649  N  NH2   . ARG C  2  265  ? 77.866  -28.086 49.821   1.00 87.92  ?  265  ARG C NH2   1 
ATOM   5650  N  N     . ARG C  2  266  ? 69.738  -27.942 51.924   1.00 99.98  ?  266  ARG C N     1 
ATOM   5651  C  CA    . ARG C  2  266  ? 68.596  -27.059 51.723   1.00 95.68  ?  266  ARG C CA    1 
ATOM   5652  C  C     . ARG C  2  266  ? 67.414  -27.503 52.579   1.00 92.13  ?  266  ARG C C     1 
ATOM   5653  O  O     . ARG C  2  266  ? 66.981  -26.775 53.472   1.00 87.68  ?  266  ARG C O     1 
ATOM   5654  C  CB    . ARG C  2  266  ? 68.190  -27.009 50.251   1.00 97.48  ?  266  ARG C CB    1 
ATOM   5655  C  CG    . ARG C  2  266  ? 69.082  -26.135 49.386   1.00 107.14 ?  266  ARG C CG    1 
ATOM   5656  C  CD    . ARG C  2  266  ? 68.462  -25.930 48.016   1.00 112.54 ?  266  ARG C CD    1 
ATOM   5657  N  NE    . ARG C  2  266  ? 67.104  -25.403 48.116   1.00 112.45 ?  266  ARG C NE    1 
ATOM   5658  C  CZ    . ARG C  2  266  ? 66.280  -25.257 47.084   1.00 121.93 ?  266  ARG C CZ    1 
ATOM   5659  N  NH1   . ARG C  2  266  ? 65.060  -24.769 47.270   1.00 120.29 ?  266  ARG C NH1   1 
ATOM   5660  N  NH2   . ARG C  2  266  ? 66.673  -25.600 45.865   1.00 123.68 ?  266  ARG C NH2   1 
ATOM   5661  N  N     . TYR C  2  267  ? 66.894  -28.695 52.301   1.00 90.64  ?  267  TYR C N     1 
ATOM   5662  C  CA    . TYR C  2  267  ? 65.776  -29.232 53.071   1.00 93.91  ?  267  TYR C CA    1 
ATOM   5663  C  C     . TYR C  2  267  ? 66.249  -30.104 54.231   1.00 91.92  ?  267  TYR C C     1 
ATOM   5664  O  O     . TYR C  2  267  ? 66.842  -31.163 54.023   1.00 94.46  ?  267  TYR C O     1 
ATOM   5665  C  CB    . TYR C  2  267  ? 64.814  -30.020 52.179   1.00 96.85  ?  267  TYR C CB    1 
ATOM   5666  C  CG    . TYR C  2  267  ? 63.524  -30.401 52.873   1.00 89.08  ?  267  TYR C CG    1 
ATOM   5667  C  CD1   . TYR C  2  267  ? 63.438  -31.556 53.640   1.00 92.01  ?  267  TYR C CD1   1 
ATOM   5668  C  CD2   . TYR C  2  267  ? 62.393  -29.602 52.766   1.00 83.52  ?  267  TYR C CD2   1 
ATOM   5669  C  CE1   . TYR C  2  267  ? 62.269  -31.902 54.281   1.00 90.84  ?  267  TYR C CE1   1 
ATOM   5670  C  CE2   . TYR C  2  267  ? 61.214  -29.943 53.401   1.00 89.05  ?  267  TYR C CE2   1 
ATOM   5671  C  CZ    . TYR C  2  267  ? 61.158  -31.096 54.156   1.00 91.01  ?  267  TYR C CZ    1 
ATOM   5672  O  OH    . TYR C  2  267  ? 59.987  -31.443 54.792   1.00 89.11  ?  267  TYR C OH    1 
ATOM   5673  N  N     . ASP C  2  268  ? 65.970  -29.658 55.452   1.00 90.01  ?  268  ASP C N     1 
ATOM   5674  C  CA    . ASP C  2  268  ? 66.370  -30.400 56.641   1.00 96.01  ?  268  ASP C CA    1 
ATOM   5675  C  C     . ASP C  2  268  ? 65.243  -30.467 57.672   1.00 89.52  ?  268  ASP C C     1 
ATOM   5676  O  O     . ASP C  2  268  ? 64.802  -29.441 58.190   1.00 86.67  ?  268  ASP C O     1 
ATOM   5677  C  CB    . ASP C  2  268  ? 67.617  -29.752 57.257   1.00 96.57  ?  268  ASP C CB    1 
ATOM   5678  C  CG    . ASP C  2  268  ? 68.162  -30.529 58.441   1.00 96.07  ?  268  ASP C CG    1 
ATOM   5679  O  OD1   . ASP C  2  268  ? 68.003  -31.766 58.468   1.00 95.14  ?  268  ASP C OD1   1 
ATOM   5680  O  OD2   . ASP C  2  268  ? 68.760  -29.900 59.341   1.00 85.58  ?  268  ASP C OD2   1 
ATOM   5681  N  N     . LEU C  2  269  ? 64.779  -31.678 57.968   1.00 89.46  ?  269  LEU C N     1 
ATOM   5682  C  CA    . LEU C  2  269  ? 63.870  -31.892 59.090   1.00 83.83  ?  269  LEU C CA    1 
ATOM   5683  C  C     . LEU C  2  269  ? 64.678  -31.817 60.375   1.00 87.94  ?  269  LEU C C     1 
ATOM   5684  O  O     . LEU C  2  269  ? 65.898  -31.971 60.357   1.00 91.74  ?  269  LEU C O     1 
ATOM   5685  C  CB    . LEU C  2  269  ? 63.188  -33.259 59.006   1.00 83.21  ?  269  LEU C CB    1 
ATOM   5686  C  CG    . LEU C  2  269  ? 62.177  -33.543 57.894   1.00 88.41  ?  269  LEU C CG    1 
ATOM   5687  C  CD1   . LEU C  2  269  ? 61.826  -35.023 57.881   1.00 83.86  ?  269  LEU C CD1   1 
ATOM   5688  C  CD2   . LEU C  2  269  ? 60.927  -32.705 58.070   1.00 88.23  ?  269  LEU C CD2   1 
ATOM   5689  N  N     . GLY C  2  270  ? 64.003  -31.575 61.492   1.00 85.16  ?  270  GLY C N     1 
ATOM   5690  C  CA    . GLY C  2  270  ? 64.668  -31.615 62.780   1.00 93.74  ?  270  GLY C CA    1 
ATOM   5691  C  C     . GLY C  2  270  ? 65.045  -33.039 63.137   1.00 92.23  ?  270  GLY C C     1 
ATOM   5692  O  O     . GLY C  2  270  ? 64.450  -33.989 62.624   1.00 89.28  ?  270  GLY C O     1 
ATOM   5693  N  N     . GLU C  2  271  ? 66.043  -33.193 64.002   1.00 77.09  ?  271  GLU C N     1 
ATOM   5694  C  CA    . GLU C  2  271  ? 66.401  -34.509 64.515   1.00 80.15  ?  271  GLU C CA    1 
ATOM   5695  C  C     . GLU C  2  271  ? 65.220  -35.023 65.327   1.00 83.15  ?  271  GLU C C     1 
ATOM   5696  O  O     . GLU C  2  271  ? 64.843  -36.197 65.242   1.00 76.73  ?  271  GLU C O     1 
ATOM   5697  C  CB    . GLU C  2  271  ? 67.651  -34.421 65.391   1.00 88.86  ?  271  GLU C CB    1 
ATOM   5698  C  CG    . GLU C  2  271  ? 68.225  -35.769 65.805   1.00 93.23  ?  271  GLU C CG    1 
ATOM   5699  C  CD    . GLU C  2  271  ? 68.959  -36.468 64.674   1.00 98.30  ?  271  GLU C CD    1 
ATOM   5700  O  OE1   . GLU C  2  271  ? 69.347  -35.787 63.700   1.00 88.70  ?  271  GLU C OE1   1 
ATOM   5701  O  OE2   . GLU C  2  271  ? 69.150  -37.699 64.761   1.00 100.00 ?  271  GLU C OE2   1 
ATOM   5702  N  N     . ALA C  2  272  ? 64.632  -34.119 66.105   1.00 77.08  ?  272  ALA C N     1 
ATOM   5703  C  CA    . ALA C  2  272  ? 63.409  -34.409 66.835   1.00 79.49  ?  272  ALA C CA    1 
ATOM   5704  C  C     . ALA C  2  272  ? 62.255  -34.563 65.852   1.00 80.77  ?  272  ALA C C     1 
ATOM   5705  O  O     . ALA C  2  272  ? 61.297  -35.285 66.116   1.00 79.99  ?  272  ALA C O     1 
ATOM   5706  C  CB    . ALA C  2  272  ? 63.114  -33.304 67.836   1.00 79.91  ?  272  ALA C CB    1 
ATOM   5707  N  N     . GLY C  2  273  ? 62.356  -33.875 64.717   1.00 79.45  ?  273  GLY C N     1 
ATOM   5708  C  CA    . GLY C  2  273  ? 61.371  -33.996 63.656   1.00 80.04  ?  273  GLY C CA    1 
ATOM   5709  C  C     . GLY C  2  273  ? 61.491  -35.335 62.955   1.00 85.00  ?  273  GLY C C     1 
ATOM   5710  O  O     . GLY C  2  273  ? 60.488  -35.968 62.617   1.00 83.87  ?  273  GLY C O     1 
ATOM   5711  N  N     . ARG C  2  274  ? 62.730  -35.762 62.732   1.00 80.30  ?  274  ARG C N     1 
ATOM   5712  C  CA    . ARG C  2  274  ? 63.002  -37.079 62.176   1.00 74.47  ?  274  ARG C CA    1 
ATOM   5713  C  C     . ARG C  2  274  ? 62.458  -38.163 63.101   1.00 80.16  ?  274  ARG C C     1 
ATOM   5714  O  O     . ARG C  2  274  ? 61.811  -39.109 62.647   1.00 87.06  ?  274  ARG C O     1 
ATOM   5715  C  CB    . ARG C  2  274  ? 64.506  -37.262 61.958   1.00 84.44  ?  274  ARG C CB    1 
ATOM   5716  C  CG    . ARG C  2  274  ? 64.943  -38.695 61.700   1.00 87.03  ?  274  ARG C CG    1 
ATOM   5717  C  CD    . ARG C  2  274  ? 66.418  -38.755 61.329   1.00 88.28  ?  274  ARG C CD    1 
ATOM   5718  N  NE    . ARG C  2  274  ? 66.974  -40.097 61.475   1.00 99.97  ?  274  ARG C NE    1 
ATOM   5719  C  CZ    . ARG C  2  274  ? 67.646  -40.515 62.544   1.00 101.17 ?  274  ARG C CZ    1 
ATOM   5720  N  NH1   . ARG C  2  274  ? 67.850  -39.694 63.565   1.00 94.02  ?  274  ARG C NH1   1 
ATOM   5721  N  NH2   . ARG C  2  274  ? 68.117  -41.754 62.591   1.00 102.37 ?  274  ARG C NH2   1 
ATOM   5722  N  N     . TYR C  2  275  ? 62.708  -38.013 64.399   1.00 80.42  ?  275  TYR C N     1 
ATOM   5723  C  CA    . TYR C  2  275  ? 62.209  -38.968 65.385   1.00 89.12  ?  275  TYR C CA    1 
ATOM   5724  C  C     . TYR C  2  275  ? 60.682  -38.961 65.463   1.00 91.19  ?  275  TYR C C     1 
ATOM   5725  O  O     . TYR C  2  275  ? 60.057  -40.003 65.668   1.00 84.89  ?  275  TYR C O     1 
ATOM   5726  C  CB    . TYR C  2  275  ? 62.813  -38.693 66.763   1.00 86.63  ?  275  TYR C CB    1 
ATOM   5727  C  CG    . TYR C  2  275  ? 62.279  -39.599 67.850   1.00 104.12 ?  275  TYR C CG    1 
ATOM   5728  C  CD1   . TYR C  2  275  ? 62.377  -40.980 67.738   1.00 106.68 ?  275  TYR C CD1   1 
ATOM   5729  C  CD2   . TYR C  2  275  ? 61.685  -39.074 68.991   1.00 100.60 ?  275  TYR C CD2   1 
ATOM   5730  C  CE1   . TYR C  2  275  ? 61.892  -41.814 68.729   1.00 105.50 ?  275  TYR C CE1   1 
ATOM   5731  C  CE2   . TYR C  2  275  ? 61.198  -39.900 69.988   1.00 101.73 ?  275  TYR C CE2   1 
ATOM   5732  C  CZ    . TYR C  2  275  ? 61.304  -41.268 69.852   1.00 104.45 ?  275  TYR C CZ    1 
ATOM   5733  O  OH    . TYR C  2  275  ? 60.822  -42.094 70.841   1.00 103.23 ?  275  TYR C OH    1 
ATOM   5734  N  N     . LYS C  2  276  ? 60.093  -37.779 65.306   1.00 92.62  ?  276  LYS C N     1 
ATOM   5735  C  CA    . LYS C  2  276  ? 58.642  -37.633 65.264   1.00 98.13  ?  276  LYS C CA    1 
ATOM   5736  C  C     . LYS C  2  276  ? 58.069  -38.402 64.082   1.00 97.36  ?  276  LYS C C     1 
ATOM   5737  O  O     . LYS C  2  276  ? 57.079  -39.125 64.216   1.00 93.79  ?  276  LYS C O     1 
ATOM   5738  C  CB    . LYS C  2  276  ? 58.252  -36.156 65.158   1.00 94.07  ?  276  LYS C CB    1 
ATOM   5739  C  CG    . LYS C  2  276  ? 58.082  -35.446 66.494   1.00 83.38  ?  276  LYS C CG    1 
ATOM   5740  C  CD    . LYS C  2  276  ? 56.724  -35.743 67.108   1.00 79.11  ?  276  LYS C CD    1 
ATOM   5741  C  CE    . LYS C  2  276  ? 55.599  -35.232 66.219   1.00 80.52  ?  276  LYS C CE    1 
ATOM   5742  N  NZ    . LYS C  2  276  ? 54.252  -35.545 66.775   1.00 69.84  ?  276  LYS C NZ    1 
ATOM   5743  N  N     . ALA C  2  277  ? 58.699  -38.235 62.923   1.00 88.63  ?  277  ALA C N     1 
ATOM   5744  C  CA    . ALA C  2  277  ? 58.284  -38.937 61.715   1.00 90.03  ?  277  ALA C CA    1 
ATOM   5745  C  C     . ALA C  2  277  ? 58.393  -40.445 61.906   1.00 88.69  ?  277  ALA C C     1 
ATOM   5746  O  O     . ALA C  2  277  ? 57.484  -41.190 61.543   1.00 92.51  ?  277  ALA C O     1 
ATOM   5747  C  CB    . ALA C  2  277  ? 59.120  -38.487 60.526   1.00 83.25  ?  277  ALA C CB    1 
ATOM   5748  N  N     . GLU C  2  278  ? 59.504  -40.885 62.489   1.00 80.85  ?  278  GLU C N     1 
ATOM   5749  C  CA    . GLU C  2  278  ? 59.733  -42.305 62.729   1.00 87.71  ?  278  GLU C CA    1 
ATOM   5750  C  C     . GLU C  2  278  ? 58.700  -42.909 63.677   1.00 97.76  ?  278  GLU C C     1 
ATOM   5751  O  O     . GLU C  2  278  ? 58.208  -44.013 63.449   1.00 95.55  ?  278  GLU C O     1 
ATOM   5752  C  CB    . GLU C  2  278  ? 61.140  -42.538 63.282   1.00 94.57  ?  278  GLU C CB    1 
ATOM   5753  C  CG    . GLU C  2  278  ? 62.255  -42.256 62.292   1.00 95.41  ?  278  GLU C CG    1 
ATOM   5754  C  CD    . GLU C  2  278  ? 63.630  -42.474 62.893   1.00 104.99 ?  278  GLU C CD    1 
ATOM   5755  O  OE1   . GLU C  2  278  ? 63.714  -43.082 63.982   1.00 106.51 ?  278  GLU C OE1   1 
ATOM   5756  O  OE2   . GLU C  2  278  ? 64.625  -42.033 62.279   1.00 101.91 ?  278  GLU C OE2   1 
ATOM   5757  N  N     . GLU C  2  279  ? 58.375  -42.182 64.741   1.00 97.79  ?  279  GLU C N     1 
ATOM   5758  C  CA    . GLU C  2  279  ? 57.453  -42.692 65.749   1.00 94.37  ?  279  GLU C CA    1 
ATOM   5759  C  C     . GLU C  2  279  ? 56.010  -42.689 65.252   1.00 93.73  ?  279  GLU C C     1 
ATOM   5760  O  O     . GLU C  2  279  ? 55.273  -43.654 65.456   1.00 91.07  ?  279  GLU C O     1 
ATOM   5761  C  CB    . GLU C  2  279  ? 57.570  -41.886 67.045   1.00 98.37  ?  279  GLU C CB    1 
ATOM   5762  C  CG    . GLU C  2  279  ? 56.946  -42.565 68.257   1.00 111.05 ?  279  GLU C CG    1 
ATOM   5763  C  CD    . GLU C  2  279  ? 57.678  -43.835 68.662   1.00 114.81 ?  279  GLU C CD    1 
ATOM   5764  O  OE1   . GLU C  2  279  ? 57.062  -44.690 69.334   1.00 101.31 ?  279  GLU C OE1   1 
ATOM   5765  O  OE2   . GLU C  2  279  ? 58.870  -43.976 68.315   1.00 115.27 ?  279  GLU C OE2   1 
ATOM   5766  N  N     . LYS C  2  280  ? 55.615  -41.602 64.597   1.00 92.18  ?  280  LYS C N     1 
ATOM   5767  C  CA    . LYS C  2  280  ? 54.252  -41.470 64.095   1.00 95.31  ?  280  LYS C CA    1 
ATOM   5768  C  C     . LYS C  2  280  ? 53.977  -42.396 62.913   1.00 93.79  ?  280  LYS C C     1 
ATOM   5769  O  O     . LYS C  2  280  ? 53.000  -43.146 62.917   1.00 92.47  ?  280  LYS C O     1 
ATOM   5770  C  CB    . LYS C  2  280  ? 53.959  -40.017 63.710   1.00 102.06 ?  280  LYS C CB    1 
ATOM   5771  C  CG    . LYS C  2  280  ? 52.570  -39.792 63.125   1.00 104.67 ?  280  LYS C CG    1 
ATOM   5772  C  CD    . LYS C  2  280  ? 51.476  -40.243 64.084   1.00 101.47 ?  280  LYS C CD    1 
ATOM   5773  C  CE    . LYS C  2  280  ? 51.495  -39.436 65.374   1.00 102.12 ?  280  LYS C CE    1 
ATOM   5774  N  NZ    . LYS C  2  280  ? 50.467  -39.914 66.340   1.00 92.49  ?  280  LYS C NZ    1 
ATOM   5775  N  N     . LEU C  2  281  ? 54.842  -42.344 61.905   1.00 91.73  ?  281  LEU C N     1 
ATOM   5776  C  CA    . LEU C  2  281  ? 54.645  -43.129 60.689   1.00 100.36 ?  281  LEU C CA    1 
ATOM   5777  C  C     . LEU C  2  281  ? 54.968  -44.607 60.894   1.00 106.81 ?  281  LEU C C     1 
ATOM   5778  O  O     . LEU C  2  281  ? 54.370  -45.475 60.256   1.00 109.60 ?  281  LEU C O     1 
ATOM   5779  C  CB    . LEU C  2  281  ? 55.480  -42.561 59.538   1.00 95.12  ?  281  LEU C CB    1 
ATOM   5780  C  CG    . LEU C  2  281  ? 55.208  -41.108 59.140   1.00 91.53  ?  281  LEU C CG    1 
ATOM   5781  C  CD1   . LEU C  2  281  ? 56.197  -40.645 58.082   1.00 84.00  ?  281  LEU C CD1   1 
ATOM   5782  C  CD2   . LEU C  2  281  ? 53.777  -40.941 58.648   1.00 94.28  ?  281  LEU C CD2   1 
ATOM   5783  N  N     . GLY C  2  282  ? 55.911  -44.890 61.788   1.00 106.89 ?  282  GLY C N     1 
ATOM   5784  C  CA    . GLY C  2  282  ? 56.330  -46.258 62.042   1.00 110.74 ?  282  GLY C CA    1 
ATOM   5785  C  C     . GLY C  2  282  ? 57.423  -46.724 61.097   1.00 102.17 ?  282  GLY C C     1 
ATOM   5786  O  O     . GLY C  2  282  ? 57.533  -47.914 60.801   1.00 91.09  ?  282  GLY C O     1 
ATOM   5787  N  N     . ILE C  2  283  ? 58.230  -45.781 60.621   1.00 101.64 ?  283  ILE C N     1 
ATOM   5788  C  CA    . ILE C  2  283  ? 59.293  -46.083 59.667   1.00 96.61  ?  283  ILE C CA    1 
ATOM   5789  C  C     . ILE C  2  283  ? 60.653  -45.600 60.163   1.00 93.89  ?  283  ILE C C     1 
ATOM   5790  O  O     . ILE C  2  283  ? 60.782  -45.122 61.290   1.00 89.06  ?  283  ILE C O     1 
ATOM   5791  C  CB    . ILE C  2  283  ? 59.020  -45.432 58.298   1.00 88.06  ?  283  ILE C CB    1 
ATOM   5792  C  CG1   . ILE C  2  283  ? 59.101  -43.907 58.410   1.00 86.70  ?  283  ILE C CG1   1 
ATOM   5793  C  CG2   . ILE C  2  283  ? 57.664  -45.867 57.761   1.00 87.60  ?  283  ILE C CG2   1 
ATOM   5794  C  CD1   . ILE C  2  283  ? 59.073  -43.192 57.080   1.00 92.00  ?  283  ILE C CD1   1 
ATOM   5795  N  N     . ARG C  2  284  ? 61.668  -45.741 59.315   1.00 94.19  ?  284  ARG C N     1 
ATOM   5796  C  CA    . ARG C  2  284  ? 63.003  -45.240 59.620   1.00 95.63  ?  284  ARG C CA    1 
ATOM   5797  C  C     . ARG C  2  284  ? 63.556  -44.397 58.474   1.00 91.98  ?  284  ARG C C     1 
ATOM   5798  O  O     . ARG C  2  284  ? 63.697  -44.873 57.348   1.00 86.22  ?  284  ARG C O     1 
ATOM   5799  C  CB    . ARG C  2  284  ? 63.959  -46.391 59.945   1.00 96.79  ?  284  ARG C CB    1 
ATOM   5800  C  CG    . ARG C  2  284  ? 65.425  -45.982 60.040   1.00 99.71  ?  284  ARG C CG    1 
ATOM   5801  C  CD    . ARG C  2  284  ? 65.635  -44.847 61.035   1.00 104.13 ?  284  ARG C CD    1 
ATOM   5802  N  NE    . ARG C  2  284  ? 65.411  -45.263 62.416   1.00 116.13 ?  284  ARG C NE    1 
ATOM   5803  C  CZ    . ARG C  2  284  ? 66.372  -45.360 63.329   1.00 113.29 ?  284  ARG C CZ    1 
ATOM   5804  N  NH1   . ARG C  2  284  ? 66.081  -45.747 64.564   1.00 111.30 ?  284  ARG C NH1   1 
ATOM   5805  N  NH2   . ARG C  2  284  ? 67.624  -45.062 63.008   1.00 104.46 ?  284  ARG C NH2   1 
ATOM   5806  N  N     . LEU C  2  285  ? 63.870  -43.143 58.778   1.00 99.21  ?  285  LEU C N     1 
ATOM   5807  C  CA    . LEU C  2  285  ? 64.431  -42.221 57.799   1.00 97.23  ?  285  LEU C CA    1 
ATOM   5808  C  C     . LEU C  2  285  ? 65.924  -42.460 57.613   1.00 91.72  ?  285  LEU C C     1 
ATOM   5809  O  O     . LEU C  2  285  ? 66.670  -42.553 58.589   1.00 89.48  ?  285  LEU C O     1 
ATOM   5810  C  CB    . LEU C  2  285  ? 64.194  -40.777 58.245   1.00 101.50 ?  285  LEU C CB    1 
ATOM   5811  C  CG    . LEU C  2  285  ? 63.076  -39.985 57.565   1.00 91.81  ?  285  LEU C CG    1 
ATOM   5812  C  CD1   . LEU C  2  285  ? 63.435  -39.706 56.116   1.00 91.47  ?  285  LEU C CD1   1 
ATOM   5813  C  CD2   . LEU C  2  285  ? 61.751  -40.724 57.664   1.00 90.08  ?  285  LEU C CD2   1 
ATOM   5814  N  N     . SER C  2  286  ? 66.355  -42.572 56.360   1.00 93.85  ?  286  SER C N     1 
ATOM   5815  C  CA    . SER C  2  286  ? 67.776  -42.686 56.058   1.00 102.31 ?  286  SER C CA    1 
ATOM   5816  C  C     . SER C  2  286  ? 68.494  -41.420 56.504   1.00 105.46 ?  286  SER C C     1 
ATOM   5817  O  O     . SER C  2  286  ? 69.402  -41.464 57.334   1.00 108.03 ?  286  SER C O     1 
ATOM   5818  C  CB    . SER C  2  286  ? 67.990  -42.904 54.559   1.00 105.16 ?  286  SER C CB    1 
ATOM   5819  O  OG    . SER C  2  286  ? 69.368  -42.875 54.229   1.00 101.35 ?  286  SER C OG    1 
ATOM   5820  N  N     . GLY C  2  287  ? 68.077  -40.291 55.943   1.00 111.47 ?  287  GLY C N     1 
ATOM   5821  C  CA    . GLY C  2  287  ? 68.566  -38.994 56.367   1.00 106.05 ?  287  GLY C CA    1 
ATOM   5822  C  C     . GLY C  2  287  ? 67.489  -38.206 57.086   1.00 107.17 ?  287  GLY C C     1 
ATOM   5823  O  O     . GLY C  2  287  ? 66.512  -38.768 57.577   1.00 102.82 ?  287  GLY C O     1 
ATOM   5824  N  N     . ARG C  2  288  ? 67.672  -36.893 57.147   1.00 107.71 ?  288  ARG C N     1 
ATOM   5825  C  CA    . ARG C  2  288  ? 66.657  -36.001 57.692   1.00 99.47  ?  288  ARG C CA    1 
ATOM   5826  C  C     . ARG C  2  288  ? 65.781  -35.430 56.581   1.00 102.96 ?  288  ARG C C     1 
ATOM   5827  O  O     . ARG C  2  288  ? 64.956  -34.554 56.817   1.00 97.34  ?  288  ARG C O     1 
ATOM   5828  C  CB    . ARG C  2  288  ? 67.295  -34.881 58.517   1.00 90.09  ?  288  ARG C CB    1 
ATOM   5829  C  CG    . ARG C  2  288  ? 67.843  -35.343 59.858   1.00 84.50  ?  288  ARG C CG    1 
ATOM   5830  C  CD    . ARG C  2  288  ? 68.281  -34.166 60.715   1.00 93.11  ?  288  ARG C CD    1 
ATOM   5831  N  NE    . ARG C  2  288  ? 69.411  -33.450 60.132   1.00 86.00  ?  288  ARG C NE    1 
ATOM   5832  C  CZ    . ARG C  2  288  ? 70.680  -33.658 60.469   1.00 87.99  ?  288  ARG C CZ    1 
ATOM   5833  N  NH1   . ARG C  2  288  ? 70.983  -34.561 61.392   1.00 86.90  ?  288  ARG C NH1   1 
ATOM   5834  N  NH2   . ARG C  2  288  ? 71.646  -32.962 59.886   1.00 84.17  ?  288  ARG C NH2   1 
ATOM   5835  N  N     . THR C  2  289  ? 65.980  -35.921 55.363   1.00 112.00 ?  289  THR C N     1 
ATOM   5836  C  CA    . THR C  2  289  ? 65.270  -35.399 54.200   1.00 110.42 ?  289  THR C CA    1 
ATOM   5837  C  C     . THR C  2  289  ? 64.163  -36.341 53.725   1.00 106.40 ?  289  THR C C     1 
ATOM   5838  O  O     . THR C  2  289  ? 64.280  -37.561 53.850   1.00 102.20 ?  289  THR C O     1 
ATOM   5839  C  CB    . THR C  2  289  ? 66.243  -35.135 53.042   1.00 108.32 ?  289  THR C CB    1 
ATOM   5840  O  OG1   . THR C  2  289  ? 66.703  -36.382 52.506   1.00 105.90 ?  289  THR C OG1   1 
ATOM   5841  C  CG2   . THR C  2  289  ? 67.435  -34.337 53.538   1.00 98.75  ?  289  THR C CG2   1 
ATOM   5842  N  N     . LEU C  2  290  ? 63.090  -35.764 53.188   1.00 102.83 ?  290  LEU C N     1 
ATOM   5843  C  CA    . LEU C  2  290  ? 61.946  -36.538 52.704   1.00 108.21 ?  290  LEU C CA    1 
ATOM   5844  C  C     . LEU C  2  290  ? 62.330  -37.473 51.563   1.00 113.67 ?  290  LEU C C     1 
ATOM   5845  O  O     . LEU C  2  290  ? 61.940  -38.640 51.545   1.00 110.16 ?  290  LEU C O     1 
ATOM   5846  C  CB    . LEU C  2  290  ? 60.824  -35.610 52.234   1.00 104.83 ?  290  LEU C CB    1 
ATOM   5847  C  CG    . LEU C  2  290  ? 60.361  -34.501 53.179   1.00 101.10 ?  290  LEU C CG    1 
ATOM   5848  C  CD1   . LEU C  2  290  ? 59.158  -33.777 52.600   1.00 104.70 ?  290  LEU C CD1   1 
ATOM   5849  C  CD2   . LEU C  2  290  ? 60.052  -35.043 54.562   1.00 93.46  ?  290  LEU C CD2   1 
ATOM   5850  N  N     . ALA C  2  291  ? 63.083  -36.946 50.604   1.00 114.54 ?  291  ALA C N     1 
ATOM   5851  C  CA    . ALA C  2  291  ? 63.534  -37.732 49.464   1.00 108.91 ?  291  ALA C CA    1 
ATOM   5852  C  C     . ALA C  2  291  ? 65.056  -37.724 49.387   1.00 107.08 ?  291  ALA C C     1 
ATOM   5853  O  O     . ALA C  2  291  ? 65.708  -36.833 49.932   1.00 99.85  ?  291  ALA C O     1 
ATOM   5854  C  CB    . ALA C  2  291  ? 62.933  -37.189 48.178   1.00 103.33 ?  291  ALA C CB    1 
ATOM   5855  N  N     . ARG C  2  292  ? 65.622  -38.720 48.714   1.00 119.63 ?  292  ARG C N     1 
ATOM   5856  C  CA    . ARG C  2  292  ? 67.072  -38.800 48.570   1.00 117.08 ?  292  ARG C CA    1 
ATOM   5857  C  C     . ARG C  2  292  ? 67.485  -39.142 47.142   1.00 115.52 ?  292  ARG C C     1 
ATOM   5858  O  O     . ARG C  2  292  ? 66.875  -39.995 46.496   1.00 123.46 ?  292  ARG C O     1 
ATOM   5859  C  CB    . ARG C  2  292  ? 67.659  -39.816 49.555   1.00 111.38 ?  292  ARG C CB    1 
ATOM   5860  C  CG    . ARG C  2  292  ? 67.058  -41.209 49.453   1.00 103.66 ?  292  ARG C CG    1 
ATOM   5861  C  CD    . ARG C  2  292  ? 67.792  -42.193 50.347   1.00 107.38 ?  292  ARG C CD    1 
ATOM   5862  N  NE    . ARG C  2  292  ? 67.279  -43.552 50.198   1.00 120.86 ?  292  ARG C NE    1 
ATOM   5863  C  CZ    . ARG C  2  292  ? 67.805  -44.619 50.792   1.00 120.78 ?  292  ARG C CZ    1 
ATOM   5864  N  NH1   . ARG C  2  292  ? 68.865  -44.489 51.578   1.00 110.17 ?  292  ARG C NH1   1 
ATOM   5865  N  NH2   . ARG C  2  292  ? 67.270  -45.817 50.599   1.00 119.03 ?  292  ARG C NH2   1 
ATOM   5866  N  N     . PHE C  2  293  ? 68.520  -38.468 46.652   1.00 107.97 ?  293  PHE C N     1 
ATOM   5867  C  CA    . PHE C  2  293  ? 69.042  -38.741 45.319   1.00 118.30 ?  293  PHE C CA    1 
ATOM   5868  C  C     . PHE C  2  293  ? 70.057  -39.877 45.373   1.00 130.95 ?  293  PHE C C     1 
ATOM   5869  O  O     . PHE C  2  293  ? 71.092  -39.767 46.031   1.00 129.18 ?  293  PHE C O     1 
ATOM   5870  C  CB    . PHE C  2  293  ? 69.678  -37.485 44.719   1.00 115.64 ?  293  PHE C CB    1 
ATOM   5871  C  CG    . PHE C  2  293  ? 70.324  -37.710 43.380   1.00 119.55 ?  293  PHE C CG    1 
ATOM   5872  C  CD1   . PHE C  2  293  ? 69.551  -37.888 42.244   1.00 117.47 ?  293  PHE C CD1   1 
ATOM   5873  C  CD2   . PHE C  2  293  ? 71.703  -37.737 43.256   1.00 120.25 ?  293  PHE C CD2   1 
ATOM   5874  C  CE1   . PHE C  2  293  ? 70.142  -38.093 41.010   1.00 115.97 ?  293  PHE C CE1   1 
ATOM   5875  C  CE2   . PHE C  2  293  ? 72.300  -37.941 42.025   1.00 117.77 ?  293  PHE C CE2   1 
ATOM   5876  C  CZ    . PHE C  2  293  ? 71.517  -38.119 40.901   1.00 115.56 ?  293  PHE C CZ    1 
ATOM   5877  N  N     . GLU C  2  294  ? 69.751  -40.968 44.679   1.00 136.79 ?  294  GLU C N     1 
ATOM   5878  C  CA    . GLU C  2  294  ? 70.608  -42.147 44.688   1.00 132.57 ?  294  GLU C CA    1 
ATOM   5879  C  C     . GLU C  2  294  ? 70.555  -42.879 43.349   1.00 134.14 ?  294  GLU C C     1 
ATOM   5880  O  O     . GLU C  2  294  ? 69.491  -42.990 42.741   1.00 132.28 ?  294  GLU C O     1 
ATOM   5881  C  CB    . GLU C  2  294  ? 70.187  -43.085 45.821   1.00 121.05 ?  294  GLU C CB    1 
ATOM   5882  C  CG    . GLU C  2  294  ? 71.088  -44.289 46.013   1.00 121.68 ?  294  GLU C CG    1 
ATOM   5883  C  CD    . GLU C  2  294  ? 70.601  -45.201 47.121   1.00 123.88 ?  294  GLU C CD    1 
ATOM   5884  O  OE1   . GLU C  2  294  ? 69.550  -44.895 47.722   1.00 119.69 ?  294  GLU C OE1   1 
ATOM   5885  O  OE2   . GLU C  2  294  ? 71.268  -46.222 47.390   1.00 128.52 ?  294  GLU C OE2   1 
ATOM   5886  N  N     . ASP C  2  295  ? 71.708  -43.372 42.902   1.00 132.51 ?  295  ASP C N     1 
ATOM   5887  C  CA    . ASP C  2  295  ? 71.816  -44.144 41.662   1.00 123.93 ?  295  ASP C CA    1 
ATOM   5888  C  C     . ASP C  2  295  ? 71.283  -43.412 40.430   1.00 119.34 ?  295  ASP C C     1 
ATOM   5889  O  O     . ASP C  2  295  ? 70.744  -44.034 39.515   1.00 118.06 ?  295  ASP C O     1 
ATOM   5890  C  CB    . ASP C  2  295  ? 71.129  -45.507 41.807   1.00 120.44 ?  295  ASP C CB    1 
ATOM   5891  C  CG    . ASP C  2  295  ? 71.864  -46.432 42.758   1.00 125.22 ?  295  ASP C CG    1 
ATOM   5892  O  OD1   . ASP C  2  295  ? 72.624  -45.929 43.612   1.00 125.61 ?  295  ASP C OD1   1 
ATOM   5893  O  OD2   . ASP C  2  295  ? 71.679  -47.663 42.654   1.00 121.10 ?  295  ASP C OD2   1 
ATOM   5894  N  N     . GLY C  2  296  ? 71.434  -42.091 40.413   1.00 116.60 ?  296  GLY C N     1 
ATOM   5895  C  CA    . GLY C  2  296  ? 71.010  -41.290 39.279   1.00 119.01 ?  296  GLY C CA    1 
ATOM   5896  C  C     . GLY C  2  296  ? 69.508  -41.100 39.188   1.00 125.46 ?  296  GLY C C     1 
ATOM   5897  O  O     . GLY C  2  296  ? 69.003  -40.547 38.211   1.00 127.37 ?  296  GLY C O     1 
ATOM   5898  N  N     . GLU C  2  297  ? 68.789  -41.561 40.207   1.00 125.60 ?  297  GLU C N     1 
ATOM   5899  C  CA    . GLU C  2  297  ? 67.340  -41.406 40.257   1.00 121.23 ?  297  GLU C CA    1 
ATOM   5900  C  C     . GLU C  2  297  ? 66.904  -40.860 41.614   1.00 119.94 ?  297  GLU C C     1 
ATOM   5901  O  O     . GLU C  2  297  ? 67.734  -40.625 42.492   1.00 119.16 ?  297  GLU C O     1 
ATOM   5902  C  CB    . GLU C  2  297  ? 66.645  -42.741 39.972   1.00 110.01 ?  297  GLU C CB    1 
ATOM   5903  C  CG    . GLU C  2  297  ? 67.070  -43.873 40.894   1.00 110.38 ?  297  GLU C CG    1 
ATOM   5904  C  CD    . GLU C  2  297  ? 66.359  -45.177 40.590   1.00 106.73 ?  297  GLU C CD    1 
ATOM   5905  O  OE1   . GLU C  2  297  ? 66.763  -46.219 41.146   1.00 105.77 ?  297  GLU C OE1   1 
ATOM   5906  O  OE2   . GLU C  2  297  ? 65.394  -45.160 39.798   1.00 101.76 ?  297  GLU C OE2   1 
ATOM   5907  N  N     . PHE C  2  298  ? 65.601  -40.656 41.781   1.00 115.86 ?  298  PHE C N     1 
ATOM   5908  C  CA    . PHE C  2  298  ? 65.064  -40.161 43.044   1.00 111.68 ?  298  PHE C CA    1 
ATOM   5909  C  C     . PHE C  2  298  ? 64.422  -41.298 43.833   1.00 108.29 ?  298  PHE C C     1 
ATOM   5910  O  O     . PHE C  2  298  ? 63.676  -42.104 43.276   1.00 98.90  ?  298  PHE C O     1 
ATOM   5911  C  CB    . PHE C  2  298  ? 64.036  -39.049 42.808   1.00 104.92 ?  298  PHE C CB    1 
ATOM   5912  C  CG    . PHE C  2  298  ? 64.632  -37.748 42.335   1.00 101.53 ?  298  PHE C CG    1 
ATOM   5913  C  CD1   . PHE C  2  298  ? 65.999  -37.611 42.153   1.00 105.51 ?  298  PHE C CD1   1 
ATOM   5914  C  CD2   . PHE C  2  298  ? 63.816  -36.656 42.084   1.00 101.86 ?  298  PHE C CD2   1 
ATOM   5915  C  CE1   . PHE C  2  298  ? 66.539  -36.413 41.719   1.00 108.45 ?  298  PHE C CE1   1 
ATOM   5916  C  CE2   . PHE C  2  298  ? 64.351  -35.456 41.652   1.00 107.42 ?  298  PHE C CE2   1 
ATOM   5917  C  CZ    . PHE C  2  298  ? 65.714  -35.335 41.470   1.00 106.02 ?  298  PHE C CZ    1 
ATOM   5918  N  N     . LYS C  2  299  ? 64.710  -41.362 45.130   1.00 109.01 ?  299  LYS C N     1 
ATOM   5919  C  CA    . LYS C  2  299  ? 64.126  -42.398 45.975   1.00 107.39 ?  299  LYS C CA    1 
ATOM   5920  C  C     . LYS C  2  299  ? 63.423  -41.827 47.207   1.00 110.47 ?  299  LYS C C     1 
ATOM   5921  O  O     . LYS C  2  299  ? 63.984  -41.011 47.944   1.00 104.33 ?  299  LYS C O     1 
ATOM   5922  C  CB    . LYS C  2  299  ? 65.175  -43.437 46.381   1.00 107.14 ?  299  LYS C CB    1 
ATOM   5923  C  CG    . LYS C  2  299  ? 64.580  -44.785 46.768   1.00 110.40 ?  299  LYS C CG    1 
ATOM   5924  C  CD    . LYS C  2  299  ? 63.736  -45.362 45.636   1.00 100.15 ?  299  LYS C CD    1 
ATOM   5925  C  CE    . LYS C  2  299  ? 62.257  -45.411 46.002   1.00 91.40  ?  299  LYS C CE    1 
ATOM   5926  N  NZ    . LYS C  2  299  ? 61.407  -45.800 44.843   1.00 82.36  ?  299  LYS C NZ    1 
ATOM   5927  N  N     . ASP C  2  300  ? 62.186  -42.270 47.410   1.00 113.67 ?  300  ASP C N     1 
ATOM   5928  C  CA    . ASP C  2  300  ? 61.323  -41.765 48.473   1.00 112.89 ?  300  ASP C CA    1 
ATOM   5929  C  C     . ASP C  2  300  ? 61.625  -42.363 49.846   1.00 119.12 ?  300  ASP C C     1 
ATOM   5930  O  O     . ASP C  2  300  ? 62.092  -43.496 49.955   1.00 123.10 ?  300  ASP C O     1 
ATOM   5931  C  CB    . ASP C  2  300  ? 59.853  -42.002 48.106   1.00 115.04 ?  300  ASP C CB    1 
ATOM   5932  C  CG    . ASP C  2  300  ? 59.015  -42.449 49.291   1.00 113.40 ?  300  ASP C CG    1 
ATOM   5933  O  OD1   . ASP C  2  300  ? 58.830  -43.672 49.467   1.00 110.75 ?  300  ASP C OD1   1 
ATOM   5934  O  OD2   . ASP C  2  300  ? 58.546  -41.577 50.051   1.00 113.81 ?  300  ASP C OD2   1 
ATOM   5935  N  N     . GLU C  2  301  ? 61.355  -41.581 50.887   1.00 114.14 ?  301  GLU C N     1 
ATOM   5936  C  CA    . GLU C  2  301  ? 61.422  -42.057 52.263   1.00 110.76 ?  301  GLU C CA    1 
ATOM   5937  C  C     . GLU C  2  301  ? 60.102  -41.802 52.987   1.00 108.28 ?  301  GLU C C     1 
ATOM   5938  O  O     . GLU C  2  301  ? 59.427  -42.736 53.423   1.00 100.83 ?  301  GLU C O     1 
ATOM   5939  C  CB    . GLU C  2  301  ? 62.568  -41.382 53.015   1.00 109.28 ?  301  GLU C CB    1 
ATOM   5940  C  CG    . GLU C  2  301  ? 63.943  -41.950 52.706   1.00 113.53 ?  301  GLU C CG    1 
ATOM   5941  C  CD    . GLU C  2  301  ? 64.204  -43.263 53.420   1.00 113.61 ?  301  GLU C CD    1 
ATOM   5942  O  OE1   . GLU C  2  301  ? 63.413  -43.625 54.317   1.00 107.64 ?  301  GLU C OE1   1 
ATOM   5943  O  OE2   . GLU C  2  301  ? 65.204  -43.933 53.085   1.00 111.78 ?  301  GLU C OE2   1 
ATOM   5944  N  N     . VAL C  2  302  ? 59.752  -40.527 53.118   1.00 108.07 ?  302  VAL C N     1 
ATOM   5945  C  CA    . VAL C  2  302  ? 58.593  -40.099 53.898   1.00 107.83 ?  302  VAL C CA    1 
ATOM   5946  C  C     . VAL C  2  302  ? 57.238  -40.218 53.179   1.00 103.97 ?  302  VAL C C     1 
ATOM   5947  O  O     . VAL C  2  302  ? 56.229  -40.575 53.796   1.00 100.31 ?  302  VAL C O     1 
ATOM   5948  C  CB    . VAL C  2  302  ? 58.794  -38.645 54.396   1.00 93.42  ?  302  VAL C CB    1 
ATOM   5949  C  CG1   . VAL C  2  302  ? 57.622  -38.195 55.249   1.00 93.89  ?  302  VAL C CG1   1 
ATOM   5950  C  CG2   . VAL C  2  302  ? 60.091  -38.542 55.178   1.00 92.74  ?  302  VAL C CG2   1 
ATOM   5951  N  N     . PHE C  2  303  ? 57.227  -39.938 51.877   1.00 102.79 ?  303  PHE C N     1 
ATOM   5952  C  CA    . PHE C  2  303  ? 55.980  -39.793 51.116   1.00 91.15  ?  303  PHE C CA    1 
ATOM   5953  C  C     . PHE C  2  303  ? 55.012  -40.976 51.155   1.00 87.71  ?  303  PHE C C     1 
ATOM   5954  O  O     . PHE C  2  303  ? 53.838  -40.801 51.481   1.00 90.34  ?  303  PHE C O     1 
ATOM   5955  C  CB    . PHE C  2  303  ? 56.271  -39.394 49.668   1.00 82.60  ?  303  PHE C CB    1 
ATOM   5956  C  CG    . PHE C  2  303  ? 56.530  -37.931 49.494   1.00 86.74  ?  303  PHE C CG    1 
ATOM   5957  C  CD1   . PHE C  2  303  ? 57.805  -37.416 49.650   1.00 92.36  ?  303  PHE C CD1   1 
ATOM   5958  C  CD2   . PHE C  2  303  ? 55.494  -37.065 49.188   1.00 88.97  ?  303  PHE C CD2   1 
ATOM   5959  C  CE1   . PHE C  2  303  ? 58.043  -36.067 49.498   1.00 91.76  ?  303  PHE C CE1   1 
ATOM   5960  C  CE2   . PHE C  2  303  ? 55.725  -35.715 49.033   1.00 92.30  ?  303  PHE C CE2   1 
ATOM   5961  C  CZ    . PHE C  2  303  ? 57.001  -35.214 49.188   1.00 86.90  ?  303  PHE C CZ    1 
ATOM   5962  N  N     . LEU C  2  304  ? 55.487  -42.166 50.805   1.00 84.73  ?  304  LEU C N     1 
ATOM   5963  C  CA    . LEU C  2  304  ? 54.621  -43.345 50.821   1.00 95.36  ?  304  LEU C CA    1 
ATOM   5964  C  C     . LEU C  2  304  ? 54.046  -43.676 52.208   1.00 93.11  ?  304  LEU C C     1 
ATOM   5965  O  O     . LEU C  2  304  ? 52.853  -43.960 52.318   1.00 89.76  ?  304  LEU C O     1 
ATOM   5966  C  CB    . LEU C  2  304  ? 55.313  -44.568 50.202   1.00 103.81 ?  304  LEU C CB    1 
ATOM   5967  C  CG    . LEU C  2  304  ? 54.476  -45.851 50.151   1.00 103.07 ?  304  LEU C CG    1 
ATOM   5968  C  CD1   . LEU C  2  304  ? 53.274  -45.683 49.230   1.00 100.20 ?  304  LEU C CD1   1 
ATOM   5969  C  CD2   . LEU C  2  304  ? 55.323  -47.043 49.727   1.00 105.84 ?  304  LEU C CD2   1 
ATOM   5970  N  N     . PRO C  2  305  ? 54.881  -43.650 53.267   1.00 88.17  ?  305  PRO C N     1 
ATOM   5971  C  CA    . PRO C  2  305  ? 54.299  -43.878 54.595   1.00 92.59  ?  305  PRO C CA    1 
ATOM   5972  C  C     . PRO C  2  305  ? 53.307  -42.792 55.012   1.00 95.99  ?  305  PRO C C     1 
ATOM   5973  O  O     . PRO C  2  305  ? 52.294  -43.104 55.642   1.00 94.84  ?  305  PRO C O     1 
ATOM   5974  C  CB    . PRO C  2  305  ? 55.520  -43.855 55.517   1.00 89.63  ?  305  PRO C CB    1 
ATOM   5975  C  CG    . PRO C  2  305  ? 56.649  -44.256 54.648   1.00 92.19  ?  305  PRO C CG    1 
ATOM   5976  C  CD    . PRO C  2  305  ? 56.355  -43.645 53.318   1.00 86.09  ?  305  PRO C CD    1 
ATOM   5977  N  N     . THR C  2  306  ? 53.602  -41.539 54.671   1.00 96.45  ?  306  THR C N     1 
ATOM   5978  C  CA    . THR C  2  306  ? 52.704  -40.429 54.982   1.00 91.38  ?  306  THR C CA    1 
ATOM   5979  C  C     . THR C  2  306  ? 51.348  -40.614 54.309   1.00 97.04  ?  306  THR C C     1 
ATOM   5980  O  O     . THR C  2  306  ? 50.301  -40.479 54.944   1.00 95.68  ?  306  THR C O     1 
ATOM   5981  C  CB    . THR C  2  306  ? 53.302  -39.078 54.542   1.00 84.12  ?  306  THR C CB    1 
ATOM   5982  O  OG1   . THR C  2  306  ? 54.470  -38.794 55.321   1.00 83.85  ?  306  THR C OG1   1 
ATOM   5983  C  CG2   . THR C  2  306  ? 52.293  -37.957 54.731   1.00 83.98  ?  306  THR C CG2   1 
ATOM   5984  N  N     . LEU C  2  307  ? 51.382  -40.929 53.018   1.00 98.53  ?  307  LEU C N     1 
ATOM   5985  C  CA    . LEU C  2  307  ? 50.170  -41.153 52.238   1.00 93.99  ?  307  LEU C CA    1 
ATOM   5986  C  C     . LEU C  2  307  ? 49.402  -42.369 52.749   1.00 93.76  ?  307  LEU C C     1 
ATOM   5987  O  O     . LEU C  2  307  ? 48.169  -42.377 52.769   1.00 96.50  ?  307  LEU C O     1 
ATOM   5988  C  CB    . LEU C  2  307  ? 50.530  -41.334 50.763   1.00 90.10  ?  307  LEU C CB    1 
ATOM   5989  C  CG    . LEU C  2  307  ? 49.392  -41.621 49.786   1.00 101.08 ?  307  LEU C CG    1 
ATOM   5990  C  CD1   . LEU C  2  307  ? 48.345  -40.520 49.836   1.00 107.18 ?  307  LEU C CD1   1 
ATOM   5991  C  CD2   . LEU C  2  307  ? 49.949  -41.774 48.383   1.00 102.49 ?  307  LEU C CD2   1 
ATOM   5992  N  N     . ARG C  2  308  ? 50.143  -43.391 53.164   1.00 92.40  ?  308  ARG C N     1 
ATOM   5993  C  CA    . ARG C  2  308  ? 49.551  -44.600 53.721   1.00 93.06  ?  308  ARG C CA    1 
ATOM   5994  C  C     . ARG C  2  308  ? 48.788  -44.267 54.999   1.00 91.67  ?  308  ARG C C     1 
ATOM   5995  O  O     . ARG C  2  308  ? 47.651  -44.703 55.182   1.00 93.23  ?  308  ARG C O     1 
ATOM   5996  C  CB    . ARG C  2  308  ? 50.641  -45.645 53.994   1.00 92.30  ?  308  ARG C CB    1 
ATOM   5997  C  CG    . ARG C  2  308  ? 50.137  -47.059 54.283   1.00 87.66  ?  308  ARG C CG    1 
ATOM   5998  C  CD    . ARG C  2  308  ? 49.833  -47.258 55.759   1.00 86.68  ?  308  ARG C CD    1 
ATOM   5999  N  NE    . ARG C  2  308  ? 50.924  -46.779 56.602   1.00 101.12 ?  308  ARG C NE    1 
ATOM   6000  C  CZ    . ARG C  2  308  ? 50.823  -46.579 57.912   1.00 107.67 ?  308  ARG C CZ    1 
ATOM   6001  N  NH1   . ARG C  2  308  ? 49.675  -46.813 58.533   1.00 100.87 ?  308  ARG C NH1   1 
ATOM   6002  N  NH2   . ARG C  2  308  ? 51.868  -46.140 58.602   1.00 101.26 ?  308  ARG C NH2   1 
ATOM   6003  N  N     . TYR C  2  309  ? 49.420  -43.494 55.877   1.00 93.21  ?  309  TYR C N     1 
ATOM   6004  C  CA    . TYR C  2  309  ? 48.799  -43.097 57.137   1.00 99.98  ?  309  TYR C CA    1 
ATOM   6005  C  C     . TYR C  2  309  ? 47.583  -42.218 56.871   1.00 96.25  ?  309  TYR C C     1 
ATOM   6006  O  O     . TYR C  2  309  ? 46.571  -42.319 57.564   1.00 91.22  ?  309  TYR C O     1 
ATOM   6007  C  CB    . TYR C  2  309  ? 49.805  -42.353 58.021   1.00 104.58 ?  309  TYR C CB    1 
ATOM   6008  C  CG    . TYR C  2  309  ? 49.438  -42.304 59.493   1.00 110.97 ?  309  TYR C CG    1 
ATOM   6009  C  CD1   . TYR C  2  309  ? 48.402  -41.496 59.949   1.00 106.42 ?  309  TYR C CD1   1 
ATOM   6010  C  CD2   . TYR C  2  309  ? 50.139  -43.057 60.428   1.00 106.97 ?  309  TYR C CD2   1 
ATOM   6011  C  CE1   . TYR C  2  309  ? 48.070  -41.446 61.290   1.00 103.23 ?  309  TYR C CE1   1 
ATOM   6012  C  CE2   . TYR C  2  309  ? 49.813  -43.012 61.772   1.00 103.70 ?  309  TYR C CE2   1 
ATOM   6013  C  CZ    . TYR C  2  309  ? 48.777  -42.205 62.197   1.00 100.67 ?  309  TYR C CZ    1 
ATOM   6014  O  OH    . TYR C  2  309  ? 48.447  -42.155 63.532   1.00 94.62  ?  309  TYR C OH    1 
ATOM   6015  N  N     . LEU C  2  310  ? 47.692  -41.355 55.865   1.00 97.76  ?  310  LEU C N     1 
ATOM   6016  C  CA    . LEU C  2  310  ? 46.598  -40.469 55.488   1.00 92.54  ?  310  LEU C CA    1 
ATOM   6017  C  C     . LEU C  2  310  ? 45.377  -41.267 55.047   1.00 91.23  ?  310  LEU C C     1 
ATOM   6018  O  O     . LEU C  2  310  ? 44.268  -41.043 55.534   1.00 90.85  ?  310  LEU C O     1 
ATOM   6019  C  CB    . LEU C  2  310  ? 47.038  -39.521 54.371   1.00 91.05  ?  310  LEU C CB    1 
ATOM   6020  C  CG    . LEU C  2  310  ? 45.981  -38.541 53.856   1.00 88.97  ?  310  LEU C CG    1 
ATOM   6021  C  CD1   . LEU C  2  310  ? 45.486  -37.648 54.983   1.00 91.61  ?  310  LEU C CD1   1 
ATOM   6022  C  CD2   . LEU C  2  310  ? 46.534  -37.708 52.709   1.00 85.62  ?  310  LEU C CD2   1 
ATOM   6023  N  N     . PHE C  2  311  ? 45.589  -42.201 54.125   1.00 94.75  ?  311  PHE C N     1 
ATOM   6024  C  CA    . PHE C  2  311  ? 44.502  -43.046 53.640   1.00 103.52 ?  311  PHE C CA    1 
ATOM   6025  C  C     . PHE C  2  311  ? 43.930  -43.918 54.754   1.00 104.59 ?  311  PHE C C     1 
ATOM   6026  O  O     . PHE C  2  311  ? 42.723  -44.160 54.807   1.00 111.49 ?  311  PHE C O     1 
ATOM   6027  C  CB    . PHE C  2  311  ? 44.965  -43.918 52.471   1.00 105.55 ?  311  PHE C CB    1 
ATOM   6028  C  CG    . PHE C  2  311  ? 44.998  -43.200 51.150   1.00 107.42 ?  311  PHE C CG    1 
ATOM   6029  C  CD1   . PHE C  2  311  ? 44.658  -41.859 51.064   1.00 107.93 ?  311  PHE C CD1   1 
ATOM   6030  C  CD2   . PHE C  2  311  ? 45.352  -43.870 49.991   1.00 104.37 ?  311  PHE C CD2   1 
ATOM   6031  C  CE1   . PHE C  2  311  ? 44.683  -41.199 49.849   1.00 108.34 ?  311  PHE C CE1   1 
ATOM   6032  C  CE2   . PHE C  2  311  ? 45.377  -43.215 48.773   1.00 107.10 ?  311  PHE C CE2   1 
ATOM   6033  C  CZ    . PHE C  2  311  ? 45.043  -41.878 48.703   1.00 109.36 ?  311  PHE C CZ    1 
ATOM   6034  N  N     . ALA C  2  312  ? 44.802  -44.385 55.642   1.00 97.39  ?  312  ALA C N     1 
ATOM   6035  C  CA    . ALA C  2  312  ? 44.383  -45.231 56.754   1.00 99.59  ?  312  ALA C CA    1 
ATOM   6036  C  C     . ALA C  2  312  ? 43.481  -44.470 57.722   1.00 106.02 ?  312  ALA C C     1 
ATOM   6037  O  O     . ALA C  2  312  ? 42.452  -44.982 58.160   1.00 104.76 ?  312  ALA C O     1 
ATOM   6038  C  CB    . ALA C  2  312  ? 45.594  -45.791 57.482   1.00 95.40  ?  312  ALA C CB    1 
ATOM   6039  N  N     . LEU C  2  313  ? 43.875  -43.243 58.047   1.00 103.81 ?  313  LEU C N     1 
ATOM   6040  C  CA    . LEU C  2  313  ? 43.098  -42.400 58.946   1.00 104.76 ?  313  LEU C CA    1 
ATOM   6041  C  C     . LEU C  2  313  ? 41.783  -41.980 58.299   1.00 99.58  ?  313  LEU C C     1 
ATOM   6042  O  O     . LEU C  2  313  ? 40.741  -41.950 58.955   1.00 99.10  ?  313  LEU C O     1 
ATOM   6043  C  CB    . LEU C  2  313  ? 43.905  -41.164 59.353   1.00 107.66 ?  313  LEU C CB    1 
ATOM   6044  C  CG    . LEU C  2  313  ? 43.219  -40.172 60.296   1.00 100.21 ?  313  LEU C CG    1 
ATOM   6045  C  CD1   . LEU C  2  313  ? 42.822  -40.851 61.598   1.00 93.69  ?  313  LEU C CD1   1 
ATOM   6046  C  CD2   . LEU C  2  313  ? 44.118  -38.975 60.563   1.00 88.66  ?  313  LEU C CD2   1 
ATOM   6047  N  N     . THR C  2  314  ? 41.837  -41.660 57.010   1.00 94.47  ?  314  THR C N     1 
ATOM   6048  C  CA    . THR C  2  314  ? 40.650  -41.231 56.278   1.00 96.89  ?  314  THR C CA    1 
ATOM   6049  C  C     . THR C  2  314  ? 39.629  -42.360 56.176   1.00 98.28  ?  314  THR C C     1 
ATOM   6050  O  O     . THR C  2  314  ? 38.424  -42.134 56.292   1.00 95.56  ?  314  THR C O     1 
ATOM   6051  C  CB    . THR C  2  314  ? 41.007  -40.736 54.862   1.00 90.77  ?  314  THR C CB    1 
ATOM   6052  O  OG1   . THR C  2  314  ? 42.070  -39.779 54.941   1.00 92.53  ?  314  THR C OG1   1 
ATOM   6053  C  CG2   . THR C  2  314  ? 39.797  -40.092 54.199   1.00 89.22  ?  314  THR C CG2   1 
ATOM   6054  N  N     . ALA C  2  315  ? 40.120  -43.578 55.967   1.00 96.88  ?  315  ALA C N     1 
ATOM   6055  C  CA    . ALA C  2  315  ? 39.249  -44.742 55.846   1.00 103.64 ?  315  ALA C CA    1 
ATOM   6056  C  C     . ALA C  2  315  ? 38.588  -45.093 57.177   1.00 101.87 ?  315  ALA C C     1 
ATOM   6057  O  O     . ALA C  2  315  ? 37.548  -45.750 57.210   1.00 102.73 ?  315  ALA C O     1 
ATOM   6058  C  CB    . ALA C  2  315  ? 40.025  -45.935 55.307   1.00 103.23 ?  315  ALA C CB    1 
ATOM   6059  N  N     . GLY C  2  316  ? 39.196  -44.648 58.271   1.00 90.80  ?  316  GLY C N     1 
ATOM   6060  C  CA    . GLY C  2  316  ? 38.676  -44.933 59.595   1.00 95.18  ?  316  GLY C CA    1 
ATOM   6061  C  C     . GLY C  2  316  ? 39.343  -46.139 60.227   1.00 102.75 ?  316  GLY C C     1 
ATOM   6062  O  O     . GLY C  2  316  ? 38.829  -46.713 61.187   1.00 100.55 ?  316  GLY C O     1 
ATOM   6063  N  N     . VAL C  2  317  ? 40.491  -46.525 59.680   1.00 105.64 ?  317  VAL C N     1 
ATOM   6064  C  CA    . VAL C  2  317  ? 41.245  -47.665 60.192   1.00 103.27 ?  317  VAL C CA    1 
ATOM   6065  C  C     . VAL C  2  317  ? 41.806  -47.383 61.583   1.00 96.04  ?  317  VAL C C     1 
ATOM   6066  O  O     . VAL C  2  317  ? 42.540  -46.412 61.774   1.00 90.42  ?  317  VAL C O     1 
ATOM   6067  C  CB    . VAL C  2  317  ? 42.403  -48.042 59.248   1.00 101.63 ?  317  VAL C CB    1 
ATOM   6068  C  CG1   . VAL C  2  317  ? 43.229  -49.172 59.842   1.00 98.12  ?  317  VAL C CG1   1 
ATOM   6069  C  CG2   . VAL C  2  317  ? 41.866  -48.426 57.876   1.00 103.14 ?  317  VAL C CG2   1 
ATOM   6070  N  N     . PRO C  2  318  ? 41.458  -48.238 62.559   1.00 92.87  ?  318  PRO C N     1 
ATOM   6071  C  CA    . PRO C  2  318  ? 41.906  -48.122 63.952   1.00 90.37  ?  318  PRO C CA    1 
ATOM   6072  C  C     . PRO C  2  318  ? 43.427  -48.071 64.066   1.00 92.97  ?  318  PRO C C     1 
ATOM   6073  O  O     . PRO C  2  318  ? 44.131  -48.614 63.215   1.00 89.60  ?  318  PRO C O     1 
ATOM   6074  C  CB    . PRO C  2  318  ? 41.375  -49.405 64.594   1.00 66.79  ?  318  PRO C CB    1 
ATOM   6075  C  CG    . PRO C  2  318  ? 40.184  -49.757 63.781   1.00 74.66  ?  318  PRO C CG    1 
ATOM   6076  C  CD    . PRO C  2  318  ? 40.531  -49.368 62.375   1.00 87.43  ?  318  PRO C CD    1 
ATOM   6077  N  N     . GLY C  2  319  ? 43.921  -47.417 65.113   1.00 92.68  ?  319  GLY C N     1 
ATOM   6078  C  CA    . GLY C  2  319  ? 45.349  -47.252 65.303   1.00 84.33  ?  319  GLY C CA    1 
ATOM   6079  C  C     . GLY C  2  319  ? 45.823  -45.911 64.780   1.00 85.82  ?  319  GLY C C     1 
ATOM   6080  O  O     . GLY C  2  319  ? 47.004  -45.578 64.870   1.00 80.05  ?  319  GLY C O     1 
ATOM   6081  N  N     . HIS C  2  320  ? 44.892  -45.138 64.229   1.00 93.96  ?  320  HIS C N     1 
ATOM   6082  C  CA    . HIS C  2  320  ? 45.209  -43.824 63.683   1.00 98.32  ?  320  HIS C CA    1 
ATOM   6083  C  C     . HIS C  2  320  ? 44.348  -42.739 64.322   1.00 96.86  ?  320  HIS C C     1 
ATOM   6084  O  O     . HIS C  2  320  ? 43.127  -42.872 64.413   1.00 93.66  ?  320  HIS C O     1 
ATOM   6085  C  CB    . HIS C  2  320  ? 45.024  -43.814 62.164   1.00 102.85 ?  320  HIS C CB    1 
ATOM   6086  C  CG    . HIS C  2  320  ? 45.878  -44.813 61.446   1.00 100.55 ?  320  HIS C CG    1 
ATOM   6087  N  ND1   . HIS C  2  320  ? 45.598  -46.160 61.437   1.00 98.87  ?  320  HIS C ND1   1 
ATOM   6088  C  CD2   . HIS C  2  320  ? 47.007  -44.655 60.714   1.00 94.15  ?  320  HIS C CD2   1 
ATOM   6089  C  CE1   . HIS C  2  320  ? 46.519  -46.794 60.729   1.00 100.59 ?  320  HIS C CE1   1 
ATOM   6090  N  NE2   . HIS C  2  320  ? 47.383  -45.903 60.281   1.00 94.27  ?  320  HIS C NE2   1 
ATOM   6091  N  N     . GLU C  2  321  ? 44.995  -41.665 64.762   1.00 91.50  ?  321  GLU C N     1 
ATOM   6092  C  CA    . GLU C  2  321  ? 44.294  -40.555 65.396   1.00 89.20  ?  321  GLU C CA    1 
ATOM   6093  C  C     . GLU C  2  321  ? 44.935  -39.222 65.025   1.00 93.51  ?  321  GLU C C     1 
ATOM   6094  O  O     . GLU C  2  321  ? 46.115  -39.164 64.677   1.00 90.09  ?  321  GLU C O     1 
ATOM   6095  C  CB    . GLU C  2  321  ? 44.281  -40.730 66.915   1.00 86.41  ?  321  GLU C CB    1 
ATOM   6096  C  CG    . GLU C  2  321  ? 45.663  -40.755 67.547   1.00 83.31  ?  321  GLU C CG    1 
ATOM   6097  C  CD    . GLU C  2  321  ? 45.619  -41.057 69.032   1.00 85.01  ?  321  GLU C CD    1 
ATOM   6098  O  OE1   . GLU C  2  321  ? 44.537  -41.429 69.534   1.00 85.12  ?  321  GLU C OE1   1 
ATOM   6099  O  OE2   . GLU C  2  321  ? 46.667  -40.923 69.698   1.00 78.47  ?  321  GLU C OE2   1 
ATOM   6100  N  N     . VAL C  2  322  ? 44.150  -38.154 65.103   1.00 86.35  ?  322  VAL C N     1 
ATOM   6101  C  CA    . VAL C  2  322  ? 44.630  -36.823 64.753   1.00 76.24  ?  322  VAL C CA    1 
ATOM   6102  C  C     . VAL C  2  322  ? 45.578  -36.268 65.811   1.00 69.92  ?  322  VAL C C     1 
ATOM   6103  O  O     . VAL C  2  322  ? 45.571  -36.710 66.960   1.00 61.05  ?  322  VAL C O     1 
ATOM   6104  C  CB    . VAL C  2  322  ? 43.463  -35.840 64.544   1.00 77.07  ?  322  VAL C CB    1 
ATOM   6105  C  CG1   . VAL C  2  322  ? 42.643  -36.246 63.329   1.00 84.27  ?  322  VAL C CG1   1 
ATOM   6106  C  CG2   . VAL C  2  322  ? 42.591  -35.780 65.787   1.00 85.86  ?  322  VAL C CG2   1 
ATOM   6107  N  N     . ASP C  2  323  ? 46.396  -35.299 65.411   1.00 77.15  ?  323  ASP C N     1 
ATOM   6108  C  CA    . ASP C  2  323  ? 47.373  -34.693 66.309   1.00 72.02  ?  323  ASP C CA    1 
ATOM   6109  C  C     . ASP C  2  323  ? 46.894  -33.356 66.866   1.00 62.58  ?  323  ASP C C     1 
ATOM   6110  O  O     . ASP C  2  323  ? 46.300  -32.550 66.150   1.00 58.11  ?  323  ASP C O     1 
ATOM   6111  C  CB    . ASP C  2  323  ? 48.710  -34.490 65.587   1.00 71.33  ?  323  ASP C CB    1 
ATOM   6112  C  CG    . ASP C  2  323  ? 49.414  -35.798 65.276   1.00 80.89  ?  323  ASP C CG    1 
ATOM   6113  O  OD1   . ASP C  2  323  ? 50.175  -36.284 66.141   1.00 80.97  ?  323  ASP C OD1   1 
ATOM   6114  O  OD2   . ASP C  2  323  ? 49.216  -36.333 64.165   1.00 85.30  ?  323  ASP C OD2   1 
ATOM   6115  N  N     . ASP C  2  324  ? 47.159  -33.128 68.149   1.00 58.81  ?  324  ASP C N     1 
ATOM   6116  C  CA    . ASP C  2  324  ? 46.931  -31.826 68.759   1.00 52.89  ?  324  ASP C CA    1 
ATOM   6117  C  C     . ASP C  2  324  ? 48.174  -30.988 68.492   1.00 49.59  ?  324  ASP C C     1 
ATOM   6118  O  O     . ASP C  2  324  ? 49.267  -31.331 68.936   1.00 54.53  ?  324  ASP C O     1 
ATOM   6119  C  CB    . ASP C  2  324  ? 46.704  -31.980 70.265   1.00 54.46  ?  324  ASP C CB    1 
ATOM   6120  C  CG    . ASP C  2  324  ? 46.236  -30.693 70.931   1.00 57.39  ?  324  ASP C CG    1 
ATOM   6121  O  OD1   . ASP C  2  324  ? 46.448  -29.599 70.365   1.00 57.64  ?  324  ASP C OD1   1 
ATOM   6122  O  OD2   . ASP C  2  324  ? 45.657  -30.778 72.035   1.00 47.01  ?  324  ASP C OD2   1 
ATOM   6123  N  N     . ILE C  2  325  ? 48.007  -29.888 67.767   1.00 47.11  ?  325  ILE C N     1 
ATOM   6124  C  CA    . ILE C  2  325  ? 49.148  -29.082 67.348   1.00 53.66  ?  325  ILE C CA    1 
ATOM   6125  C  C     . ILE C  2  325  ? 49.755  -28.288 68.502   1.00 52.58  ?  325  ILE C C     1 
ATOM   6126  O  O     . ILE C  2  325  ? 50.927  -27.917 68.459   1.00 51.23  ?  325  ILE C O     1 
ATOM   6127  C  CB    . ILE C  2  325  ? 48.779  -28.130 66.192   1.00 58.85  ?  325  ILE C CB    1 
ATOM   6128  C  CG1   . ILE C  2  325  ? 47.695  -27.144 66.631   1.00 72.20  ?  325  ILE C CG1   1 
ATOM   6129  C  CG2   . ILE C  2  325  ? 48.316  -28.924 64.980   1.00 52.58  ?  325  ILE C CG2   1 
ATOM   6130  C  CD1   . ILE C  2  325  ? 47.281  -26.167 65.552   1.00 74.16  ?  325  ILE C CD1   1 
ATOM   6131  N  N     . ASP C  2  326  ? 48.953  -28.027 69.529   1.00 56.19  ?  326  ASP C N     1 
ATOM   6132  C  CA    . ASP C  2  326  ? 49.425  -27.283 70.693   1.00 62.32  ?  326  ASP C CA    1 
ATOM   6133  C  C     . ASP C  2  326  ? 49.858  -28.200 71.835   1.00 59.08  ?  326  ASP C C     1 
ATOM   6134  O  O     . ASP C  2  326  ? 50.304  -27.732 72.884   1.00 51.59  ?  326  ASP C O     1 
ATOM   6135  C  CB    . ASP C  2  326  ? 48.364  -26.288 71.163   1.00 63.98  ?  326  ASP C CB    1 
ATOM   6136  C  CG    . ASP C  2  326  ? 48.111  -25.192 70.148   1.00 66.77  ?  326  ASP C CG    1 
ATOM   6137  O  OD1   . ASP C  2  326  ? 48.892  -24.218 70.118   1.00 60.93  ?  326  ASP C OD1   1 
ATOM   6138  O  OD2   . ASP C  2  326  ? 47.135  -25.307 69.375   1.00 77.81  ?  326  ASP C OD2   1 
ATOM   6139  N  N     . HIS C  2  327  ? 49.713  -29.505 71.622   1.00 59.59  ?  327  HIS C N     1 
ATOM   6140  C  CA    . HIS C  2  327  ? 50.207  -30.509 72.556   1.00 53.86  ?  327  HIS C CA    1 
ATOM   6141  C  C     . HIS C  2  327  ? 51.713  -30.323 72.700   1.00 55.97  ?  327  HIS C C     1 
ATOM   6142  O  O     . HIS C  2  327  ? 52.424  -30.206 71.702   1.00 54.81  ?  327  HIS C O     1 
ATOM   6143  C  CB    . HIS C  2  327  ? 49.893  -31.906 72.016   1.00 50.12  ?  327  HIS C CB    1 
ATOM   6144  C  CG    . HIS C  2  327  ? 50.153  -33.013 72.985   1.00 48.25  ?  327  HIS C CG    1 
ATOM   6145  N  ND1   . HIS C  2  327  ? 51.415  -33.526 73.215   1.00 44.90  ?  327  HIS C ND1   1 
ATOM   6146  C  CD2   . HIS C  2  327  ? 49.313  -33.733 73.768   1.00 52.73  ?  327  HIS C CD2   1 
ATOM   6147  C  CE1   . HIS C  2  327  ? 51.339  -34.498 74.101   1.00 47.80  ?  327  HIS C CE1   1 
ATOM   6148  N  NE2   . HIS C  2  327  ? 50.072  -34.644 74.456   1.00 48.00  ?  327  HIS C NE2   1 
ATOM   6149  N  N     . LEU C  2  328  ? 52.198  -30.284 73.938   1.00 55.13  ?  328  LEU C N     1 
ATOM   6150  C  CA    . LEU C  2  328  ? 53.610  -29.992 74.189   1.00 54.58  ?  328  LEU C CA    1 
ATOM   6151  C  C     . LEU C  2  328  ? 54.561  -31.047 73.628   1.00 54.91  ?  328  LEU C C     1 
ATOM   6152  O  O     . LEU C  2  328  ? 55.773  -30.840 73.583   1.00 50.77  ?  328  LEU C O     1 
ATOM   6153  C  CB    . LEU C  2  328  ? 53.872  -29.762 75.680   1.00 48.37  ?  328  LEU C CB    1 
ATOM   6154  C  CG    . LEU C  2  328  ? 53.709  -28.317 76.157   1.00 44.03  ?  328  LEU C CG    1 
ATOM   6155  C  CD1   . LEU C  2  328  ? 54.119  -28.181 77.615   1.00 46.66  ?  328  LEU C CD1   1 
ATOM   6156  C  CD2   . LEU C  2  328  ? 54.520  -27.373 75.282   1.00 36.47  ?  328  LEU C CD2   1 
ATOM   6157  N  N     . GLY C  2  329  ? 54.006  -32.180 73.210   1.00 51.63  ?  329  GLY C N     1 
ATOM   6158  C  CA    . GLY C  2  329  ? 54.781  -33.185 72.511   1.00 58.59  ?  329  GLY C CA    1 
ATOM   6159  C  C     . GLY C  2  329  ? 55.098  -32.725 71.101   1.00 59.52  ?  329  GLY C C     1 
ATOM   6160  O  O     . GLY C  2  329  ? 56.137  -33.073 70.541   1.00 62.94  ?  329  GLY C O     1 
ATOM   6161  N  N     . ASN C  2  330  ? 54.192  -31.939 70.525   1.00 51.71  ?  330  ASN C N     1 
ATOM   6162  C  CA    . ASN C  2  330  ? 54.359  -31.432 69.166   1.00 51.47  ?  330  ASN C CA    1 
ATOM   6163  C  C     . ASN C  2  330  ? 54.953  -30.024 69.109   1.00 55.17  ?  330  ASN C C     1 
ATOM   6164  O  O     . ASN C  2  330  ? 55.098  -29.445 68.030   1.00 49.71  ?  330  ASN C O     1 
ATOM   6165  C  CB    . ASN C  2  330  ? 53.029  -31.483 68.410   1.00 48.01  ?  330  ASN C CB    1 
ATOM   6166  C  CG    . ASN C  2  330  ? 52.369  -32.845 68.491   1.00 51.95  ?  330  ASN C CG    1 
ATOM   6167  O  OD1   . ASN C  2  330  ? 53.031  -33.858 68.716   1.00 57.69  ?  330  ASN C OD1   1 
ATOM   6168  N  ND2   . ASN C  2  330  ? 51.055  -32.876 68.308   1.00 59.11  ?  330  ASN C ND2   1 
ATOM   6169  N  N     . ARG C  2  331  ? 55.279  -29.472 70.273   1.00 54.59  ?  331  ARG C N     1 
ATOM   6170  C  CA    . ARG C  2  331  ? 55.935  -28.170 70.346   1.00 55.88  ?  331  ARG C CA    1 
ATOM   6171  C  C     . ARG C  2  331  ? 57.263  -28.283 71.086   1.00 50.34  ?  331  ARG C C     1 
ATOM   6172  O  O     . ARG C  2  331  ? 57.333  -28.872 72.164   1.00 49.43  ?  331  ARG C O     1 
ATOM   6173  C  CB    . ARG C  2  331  ? 55.036  -27.141 71.037   1.00 54.38  ?  331  ARG C CB    1 
ATOM   6174  C  CG    . ARG C  2  331  ? 53.726  -26.859 70.316   1.00 55.36  ?  331  ARG C CG    1 
ATOM   6175  C  CD    . ARG C  2  331  ? 52.886  -25.835 71.071   1.00 50.61  ?  331  ARG C CD    1 
ATOM   6176  N  NE    . ARG C  2  331  ? 53.481  -24.500 71.045   1.00 46.95  ?  331  ARG C NE    1 
ATOM   6177  C  CZ    . ARG C  2  331  ? 53.052  -23.477 71.778   1.00 42.53  ?  331  ARG C CZ    1 
ATOM   6178  N  NH1   . ARG C  2  331  ? 52.027  -23.636 72.605   1.00 40.42  ?  331  ARG C NH1   1 
ATOM   6179  N  NH2   . ARG C  2  331  ? 53.651  -22.296 71.692   1.00 31.71  ?  331  ARG C NH2   1 
ATOM   6180  N  N     . ARG C  2  332  ? 58.318  -27.722 70.505   1.00 45.18  ?  332  ARG C N     1 
ATOM   6181  C  CA    . ARG C  2  332  ? 59.639  -27.804 71.120   1.00 46.83  ?  332  ARG C CA    1 
ATOM   6182  C  C     . ARG C  2  332  ? 60.234  -26.429 71.409   1.00 48.45  ?  332  ARG C C     1 
ATOM   6183  O  O     . ARG C  2  332  ? 59.644  -25.399 71.075   1.00 44.30  ?  332  ARG C O     1 
ATOM   6184  C  CB    . ARG C  2  332  ? 60.592  -28.622 70.242   1.00 55.03  ?  332  ARG C CB    1 
ATOM   6185  C  CG    . ARG C  2  332  ? 60.750  -28.092 68.826   1.00 50.95  ?  332  ARG C CG    1 
ATOM   6186  C  CD    . ARG C  2  332  ? 61.706  -28.952 68.012   1.00 48.14  ?  332  ARG C CD    1 
ATOM   6187  N  NE    . ARG C  2  332  ? 63.049  -28.978 68.585   1.00 45.09  ?  332  ARG C NE    1 
ATOM   6188  C  CZ    . ARG C  2  332  ? 64.013  -28.115 68.278   1.00 42.27  ?  332  ARG C CZ    1 
ATOM   6189  N  NH1   . ARG C  2  332  ? 63.788  -27.148 67.398   1.00 36.97  ?  332  ARG C NH1   1 
ATOM   6190  N  NH2   . ARG C  2  332  ? 65.204  -28.218 68.850   1.00 39.17  ?  332  ARG C NH2   1 
ATOM   6191  N  N     . ILE C  2  333  ? 61.414  -26.425 72.021   1.00 44.94  ?  333  ILE C N     1 
ATOM   6192  C  CA    . ILE C  2  333  ? 62.075  -25.187 72.410   1.00 40.06  ?  333  ILE C CA    1 
ATOM   6193  C  C     . ILE C  2  333  ? 63.405  -25.018 71.694   1.00 41.35  ?  333  ILE C C     1 
ATOM   6194  O  O     . ILE C  2  333  ? 64.262  -25.900 71.740   1.00 48.41  ?  333  ILE C O     1 
ATOM   6195  C  CB    . ILE C  2  333  ? 62.351  -25.149 73.923   1.00 43.42  ?  333  ILE C CB    1 
ATOM   6196  C  CG1   . ILE C  2  333  ? 61.088  -25.488 74.711   1.00 38.42  ?  333  ILE C CG1   1 
ATOM   6197  C  CG2   . ILE C  2  333  ? 62.898  -23.786 74.331   1.00 42.00  ?  333  ILE C CG2   1 
ATOM   6198  C  CD1   . ILE C  2  333  ? 60.008  -24.445 74.606   1.00 37.94  ?  333  ILE C CD1   1 
ATOM   6199  N  N     . ARG C  2  334  ? 63.574  -23.878 71.036   1.00 39.83  ?  334  ARG C N     1 
ATOM   6200  C  CA    . ARG C  2  334  ? 64.856  -23.524 70.454   1.00 46.13  ?  334  ARG C CA    1 
ATOM   6201  C  C     . ARG C  2  334  ? 65.599  -22.676 71.470   1.00 47.46  ?  334  ARG C C     1 
ATOM   6202  O  O     . ARG C  2  334  ? 65.213  -21.538 71.744   1.00 52.60  ?  334  ARG C O     1 
ATOM   6203  C  CB    . ARG C  2  334  ? 64.667  -22.728 69.164   1.00 43.04  ?  334  ARG C CB    1 
ATOM   6204  C  CG    . ARG C  2  334  ? 63.605  -23.282 68.234   1.00 50.19  ?  334  ARG C CG    1 
ATOM   6205  C  CD    . ARG C  2  334  ? 63.596  -22.526 66.919   1.00 50.99  ?  334  ARG C CD    1 
ATOM   6206  N  NE    . ARG C  2  334  ? 64.783  -22.818 66.123   1.00 52.59  ?  334  ARG C NE    1 
ATOM   6207  C  CZ    . ARG C  2  334  ? 65.168  -22.107 65.069   1.00 57.60  ?  334  ARG C CZ    1 
ATOM   6208  N  NH1   . ARG C  2  334  ? 64.462  -21.051 64.687   1.00 53.72  ?  334  ARG C NH1   1 
ATOM   6209  N  NH2   . ARG C  2  334  ? 66.263  -22.449 64.403   1.00 55.47  ?  334  ARG C NH2   1 
ATOM   6210  N  N     . THR C  2  335  ? 66.667  -23.235 72.027   1.00 48.84  ?  335  THR C N     1 
ATOM   6211  C  CA    . THR C  2  335  ? 67.441  -22.543 73.044   1.00 44.12  ?  335  THR C CA    1 
ATOM   6212  C  C     . THR C  2  335  ? 68.427  -21.588 72.386   1.00 48.45  ?  335  THR C C     1 
ATOM   6213  O  O     . THR C  2  335  ? 68.457  -21.468 71.161   1.00 53.35  ?  335  THR C O     1 
ATOM   6214  C  CB    . THR C  2  335  ? 68.199  -23.534 73.933   1.00 40.96  ?  335  THR C CB    1 
ATOM   6215  O  OG1   . THR C  2  335  ? 69.171  -24.232 73.145   1.00 49.75  ?  335  THR C OG1   1 
ATOM   6216  C  CG2   . THR C  2  335  ? 67.237  -24.539 74.546   1.00 38.64  ?  335  THR C CG2   1 
ATOM   6217  N  N     . VAL C  2  336  ? 69.225  -20.908 73.203   1.00 49.40  ?  336  VAL C N     1 
ATOM   6218  C  CA    . VAL C  2  336  ? 70.196  -19.936 72.709   1.00 49.81  ?  336  VAL C CA    1 
ATOM   6219  C  C     . VAL C  2  336  ? 71.193  -20.577 71.740   1.00 57.65  ?  336  VAL C C     1 
ATOM   6220  O  O     . VAL C  2  336  ? 71.493  -20.024 70.672   1.00 55.37  ?  336  VAL C O     1 
ATOM   6221  C  CB    . VAL C  2  336  ? 70.942  -19.249 73.879   1.00 44.36  ?  336  VAL C CB    1 
ATOM   6222  C  CG1   . VAL C  2  336  ? 71.298  -20.262 74.963   1.00 44.50  ?  336  VAL C CG1   1 
ATOM   6223  C  CG2   . VAL C  2  336  ? 72.178  -18.511 73.381   1.00 39.87  ?  336  VAL C CG2   1 
ATOM   6224  N  N     . GLY C  2  337  ? 71.684  -21.755 72.113   1.00 52.59  ?  337  GLY C N     1 
ATOM   6225  C  CA    . GLY C  2  337  ? 72.636  -22.484 71.300   1.00 55.68  ?  337  GLY C CA    1 
ATOM   6226  C  C     . GLY C  2  337  ? 72.100  -22.826 69.924   1.00 55.52  ?  337  GLY C C     1 
ATOM   6227  O  O     . GLY C  2  337  ? 72.828  -22.747 68.938   1.00 57.76  ?  337  GLY C O     1 
ATOM   6228  N  N     . GLU C  2  338  ? 70.826  -23.199 69.857   1.00 48.21  ?  338  GLU C N     1 
ATOM   6229  C  CA    . GLU C  2  338  ? 70.207  -23.587 68.595   1.00 43.85  ?  338  GLU C CA    1 
ATOM   6230  C  C     . GLU C  2  338  ? 70.011  -22.392 67.667   1.00 46.17  ?  338  GLU C C     1 
ATOM   6231  O  O     . GLU C  2  338  ? 70.284  -22.475 66.467   1.00 52.93  ?  338  GLU C O     1 
ATOM   6232  C  CB    . GLU C  2  338  ? 68.872  -24.291 68.845   1.00 35.50  ?  338  GLU C CB    1 
ATOM   6233  C  CG    . GLU C  2  338  ? 68.155  -24.728 67.579   1.00 39.83  ?  338  GLU C CG    1 
ATOM   6234  C  CD    . GLU C  2  338  ? 67.037  -25.714 67.859   1.00 50.57  ?  338  GLU C CD    1 
ATOM   6235  O  OE1   . GLU C  2  338  ? 67.127  -26.442 68.871   1.00 43.01  ?  338  GLU C OE1   1 
ATOM   6236  O  OE2   . GLU C  2  338  ? 66.069  -25.761 67.070   1.00 54.90  ?  338  GLU C OE2   1 
ATOM   6237  N  N     . LEU C  2  339  ? 69.537  -21.284 68.228   1.00 42.49  ?  339  LEU C N     1 
ATOM   6238  C  CA    . LEU C  2  339  ? 69.323  -20.065 67.458   1.00 43.29  ?  339  LEU C CA    1 
ATOM   6239  C  C     . LEU C  2  339  ? 70.646  -19.548 66.911   1.00 54.63  ?  339  LEU C C     1 
ATOM   6240  O  O     . LEU C  2  339  ? 70.769  -19.251 65.714   1.00 64.22  ?  339  LEU C O     1 
ATOM   6241  C  CB    . LEU C  2  339  ? 68.667  -18.995 68.328   1.00 44.03  ?  339  LEU C CB    1 
ATOM   6242  C  CG    . LEU C  2  339  ? 67.320  -19.349 68.960   1.00 49.17  ?  339  LEU C CG    1 
ATOM   6243  C  CD1   . LEU C  2  339  ? 66.812  -18.196 69.810   1.00 42.76  ?  339  LEU C CD1   1 
ATOM   6244  C  CD2   . LEU C  2  339  ? 66.308  -19.719 67.887   1.00 50.89  ?  339  LEU C CD2   1 
ATOM   6245  N  N     . MET C  2  340  ? 71.635  -19.453 67.796   1.00 59.13  ?  340  MET C N     1 
ATOM   6246  C  CA    . MET C  2  340  ? 72.971  -19.019 67.406   1.00 62.34  ?  340  MET C CA    1 
ATOM   6247  C  C     . MET C  2  340  ? 73.549  -19.958 66.344   1.00 65.33  ?  340  MET C C     1 
ATOM   6248  O  O     . MET C  2  340  ? 74.197  -19.513 65.397   1.00 64.43  ?  340  MET C O     1 
ATOM   6249  C  CB    . MET C  2  340  ? 73.886  -18.951 68.632   1.00 52.29  ?  340  MET C CB    1 
ATOM   6250  C  CG    . MET C  2  340  ? 75.113  -18.063 68.469   1.00 51.03  ?  340  MET C CG    1 
ATOM   6251  S  SD    . MET C  2  340  ? 76.425  -18.806 67.478   1.00 77.60  ?  340  MET C SD    1 
ATOM   6252  C  CE    . MET C  2  340  ? 76.560  -20.415 68.257   1.00 52.85  ?  340  MET C CE    1 
ATOM   6253  N  N     . THR C  2  341  ? 73.299  -21.255 66.508   1.00 59.64  ?  341  THR C N     1 
ATOM   6254  C  CA    . THR C  2  341  ? 73.740  -22.266 65.551   1.00 48.38  ?  341  THR C CA    1 
ATOM   6255  C  C     . THR C  2  341  ? 73.162  -22.016 64.165   1.00 58.10  ?  341  THR C C     1 
ATOM   6256  O  O     . THR C  2  341  ? 73.890  -22.015 63.173   1.00 61.50  ?  341  THR C O     1 
ATOM   6257  C  CB    . THR C  2  341  ? 73.330  -23.680 66.001   1.00 50.07  ?  341  THR C CB    1 
ATOM   6258  O  OG1   . THR C  2  341  ? 73.984  -23.998 67.235   1.00 55.40  ?  341  THR C OG1   1 
ATOM   6259  C  CG2   . THR C  2  341  ? 73.708  -24.712 64.951   1.00 56.62  ?  341  THR C CG2   1 
ATOM   6260  N  N     . ASP C  2  342  ? 71.851  -21.804 64.100   1.00 54.51  ?  342  ASP C N     1 
ATOM   6261  C  CA    . ASP C  2  342  ? 71.187  -21.564 62.823   1.00 53.53  ?  342  ASP C CA    1 
ATOM   6262  C  C     . ASP C  2  342  ? 71.647  -20.265 62.165   1.00 54.80  ?  342  ASP C C     1 
ATOM   6263  O  O     . ASP C  2  342  ? 71.833  -20.213 60.946   1.00 62.62  ?  342  ASP C O     1 
ATOM   6264  C  CB    . ASP C  2  342  ? 69.666  -21.589 62.981   1.00 54.48  ?  342  ASP C CB    1 
ATOM   6265  C  CG    . ASP C  2  342  ? 69.121  -22.998 63.126   1.00 70.74  ?  342  ASP C CG    1 
ATOM   6266  O  OD1   . ASP C  2  342  ? 69.846  -23.866 63.660   1.00 68.90  ?  342  ASP C OD1   1 
ATOM   6267  O  OD2   . ASP C  2  342  ? 67.970  -23.239 62.702   1.00 67.45  ?  342  ASP C OD2   1 
ATOM   6268  N  N     . GLN C  2  343  ? 71.841  -19.221 62.965   1.00 47.04  ?  343  GLN C N     1 
ATOM   6269  C  CA    . GLN C  2  343  ? 72.381  -17.977 62.422   1.00 52.41  ?  343  GLN C CA    1 
ATOM   6270  C  C     . GLN C  2  343  ? 73.812  -18.176 61.924   1.00 61.32  ?  343  GLN C C     1 
ATOM   6271  O  O     . GLN C  2  343  ? 74.259  -17.506 60.985   1.00 64.53  ?  343  GLN C O     1 
ATOM   6272  C  CB    . GLN C  2  343  ? 72.306  -16.843 63.445   1.00 53.43  ?  343  GLN C CB    1 
ATOM   6273  C  CG    . GLN C  2  343  ? 70.965  -16.127 63.460   1.00 53.66  ?  343  GLN C CG    1 
ATOM   6274  C  CD    . GLN C  2  343  ? 70.665  -15.421 62.150   1.00 49.95  ?  343  GLN C CD    1 
ATOM   6275  O  OE1   . GLN C  2  343  ? 69.666  -15.710 61.489   1.00 47.27  ?  343  GLN C OE1   1 
ATOM   6276  N  NE2   . GLN C  2  343  ? 71.528  -14.484 61.770   1.00 41.65  ?  343  GLN C NE2   1 
ATOM   6277  N  N     . PHE C  2  344  ? 74.520  -19.114 62.547   1.00 64.92  ?  344  PHE C N     1 
ATOM   6278  C  CA    . PHE C  2  344  ? 75.872  -19.451 62.118   1.00 69.16  ?  344  PHE C CA    1 
ATOM   6279  C  C     . PHE C  2  344  ? 75.849  -20.211 60.795   1.00 70.12  ?  344  PHE C C     1 
ATOM   6280  O  O     . PHE C  2  344  ? 76.729  -20.025 59.960   1.00 74.16  ?  344  PHE C O     1 
ATOM   6281  C  CB    . PHE C  2  344  ? 76.612  -20.260 63.188   1.00 69.27  ?  344  PHE C CB    1 
ATOM   6282  C  CG    . PHE C  2  344  ? 78.107  -20.247 63.026   1.00 68.18  ?  344  PHE C CG    1 
ATOM   6283  C  CD1   . PHE C  2  344  ? 78.738  -21.156 62.194   1.00 76.61  ?  344  PHE C CD1   1 
ATOM   6284  C  CD2   . PHE C  2  344  ? 78.879  -19.316 63.700   1.00 67.33  ?  344  PHE C CD2   1 
ATOM   6285  C  CE1   . PHE C  2  344  ? 80.111  -21.138 62.038   1.00 69.45  ?  344  PHE C CE1   1 
ATOM   6286  C  CE2   . PHE C  2  344  ? 80.253  -19.295 63.549   1.00 65.84  ?  344  PHE C CE2   1 
ATOM   6287  C  CZ    . PHE C  2  344  ? 80.869  -20.207 62.716   1.00 56.91  ?  344  PHE C CZ    1 
ATOM   6288  N  N     . ARG C  2  345  ? 74.848  -21.067 60.610   1.00 68.68  ?  345  ARG C N     1 
ATOM   6289  C  CA    . ARG C  2  345  ? 74.682  -21.784 59.348   1.00 62.31  ?  345  ARG C CA    1 
ATOM   6290  C  C     . ARG C  2  345  ? 74.354  -20.803 58.233   1.00 61.14  ?  345  ARG C C     1 
ATOM   6291  O  O     . ARG C  2  345  ? 74.900  -20.892 57.131   1.00 66.03  ?  345  ARG C O     1 
ATOM   6292  C  CB    . ARG C  2  345  ? 73.574  -22.831 59.454   1.00 50.34  ?  345  ARG C CB    1 
ATOM   6293  C  CG    . ARG C  2  345  ? 73.816  -23.894 60.506   1.00 56.40  ?  345  ARG C CG    1 
ATOM   6294  C  CD    . ARG C  2  345  ? 72.750  -24.972 60.446   1.00 63.64  ?  345  ARG C CD    1 
ATOM   6295  N  NE    . ARG C  2  345  ? 72.883  -25.931 61.537   1.00 69.13  ?  345  ARG C NE    1 
ATOM   6296  C  CZ    . ARG C  2  345  ? 72.123  -27.012 61.677   1.00 79.87  ?  345  ARG C CZ    1 
ATOM   6297  N  NH1   . ARG C  2  345  ? 72.314  -27.831 62.703   1.00 72.39  ?  345  ARG C NH1   1 
ATOM   6298  N  NH2   . ARG C  2  345  ? 71.172  -27.276 60.791   1.00 86.24  ?  345  ARG C NH2   1 
ATOM   6299  N  N     . VAL C  2  346  ? 73.457  -19.866 58.531   1.00 61.47  ?  346  VAL C N     1 
ATOM   6300  C  CA    . VAL C  2  346  ? 73.066  -18.837 57.574   1.00 63.37  ?  346  VAL C CA    1 
ATOM   6301  C  C     . VAL C  2  346  ? 74.254  -17.969 57.168   1.00 63.40  ?  346  VAL C C     1 
ATOM   6302  O  O     . VAL C  2  346  ? 74.454  -17.687 55.985   1.00 62.83  ?  346  VAL C O     1 
ATOM   6303  C  CB    . VAL C  2  346  ? 71.941  -17.941 58.135   1.00 61.28  ?  346  VAL C CB    1 
ATOM   6304  C  CG1   . VAL C  2  346  ? 71.729  -16.720 57.248   1.00 57.96  ?  346  VAL C CG1   1 
ATOM   6305  C  CG2   . VAL C  2  346  ? 70.649  -18.736 58.280   1.00 49.06  ?  346  VAL C CG2   1 
ATOM   6306  N  N     . GLY C  2  347  ? 75.046  -17.555 58.153   1.00 70.69  ?  347  GLY C N     1 
ATOM   6307  C  CA    . GLY C  2  347  ? 76.205  -16.722 57.885   1.00 77.42  ?  347  GLY C CA    1 
ATOM   6308  C  C     . GLY C  2  347  ? 77.354  -17.451 57.215   1.00 76.43  ?  347  GLY C C     1 
ATOM   6309  O  O     . GLY C  2  347  ? 78.137  -16.848 56.478   1.00 71.95  ?  347  GLY C O     1 
ATOM   6310  N  N     . LEU C  2  348  ? 77.462  -18.750 57.480   1.00 69.84  ?  348  LEU C N     1 
ATOM   6311  C  CA    . LEU C  2  348  ? 78.522  -19.570 56.904   1.00 68.37  ?  348  LEU C CA    1 
ATOM   6312  C  C     . LEU C  2  348  ? 78.196  -19.988 55.475   1.00 73.61  ?  348  LEU C C     1 
ATOM   6313  O  O     . LEU C  2  348  ? 79.094  -20.208 54.665   1.00 78.95  ?  348  LEU C O     1 
ATOM   6314  C  CB    . LEU C  2  348  ? 78.779  -20.804 57.770   1.00 69.45  ?  348  LEU C CB    1 
ATOM   6315  C  CG    . LEU C  2  348  ? 80.114  -21.520 57.568   1.00 72.05  ?  348  LEU C CG    1 
ATOM   6316  C  CD1   . LEU C  2  348  ? 81.270  -20.545 57.736   1.00 63.12  ?  348  LEU C CD1   1 
ATOM   6317  C  CD2   . LEU C  2  348  ? 80.241  -22.673 58.547   1.00 62.50  ?  348  LEU C CD2   1 
ATOM   6318  N  N     . ALA C  2  349  ? 76.908  -20.106 55.170   1.00 71.71  ?  349  ALA C N     1 
ATOM   6319  C  CA    . ALA C  2  349  ? 76.480  -20.437 53.817   1.00 61.34  ?  349  ALA C CA    1 
ATOM   6320  C  C     . ALA C  2  349  ? 76.843  -19.315 52.846   1.00 65.85  ?  349  ALA C C     1 
ATOM   6321  O  O     . ALA C  2  349  ? 77.035  -19.552 51.654   1.00 70.05  ?  349  ALA C O     1 
ATOM   6322  C  CB    . ALA C  2  349  ? 74.988  -20.713 53.783   1.00 54.03  ?  349  ALA C CB    1 
ATOM   6323  N  N     . ARG C  2  350  ? 76.942  -18.095 53.367   1.00 68.34  ?  350  ARG C N     1 
ATOM   6324  C  CA    . ARG C  2  350  ? 77.298  -16.935 52.556   1.00 77.86  ?  350  ARG C CA    1 
ATOM   6325  C  C     . ARG C  2  350  ? 78.789  -16.915 52.239   1.00 81.55  ?  350  ARG C C     1 
ATOM   6326  O  O     . ARG C  2  350  ? 79.225  -16.238 51.307   1.00 82.74  ?  350  ARG C O     1 
ATOM   6327  C  CB    . ARG C  2  350  ? 76.903  -15.639 53.266   1.00 79.55  ?  350  ARG C CB    1 
ATOM   6328  C  CG    . ARG C  2  350  ? 75.423  -15.531 53.591   1.00 75.71  ?  350  ARG C CG    1 
ATOM   6329  C  CD    . ARG C  2  350  ? 75.123  -14.243 54.339   1.00 81.85  ?  350  ARG C CD    1 
ATOM   6330  N  NE    . ARG C  2  350  ? 73.737  -14.184 54.792   1.00 80.30  ?  350  ARG C NE    1 
ATOM   6331  C  CZ    . ARG C  2  350  ? 73.237  -13.202 55.536   1.00 72.80  ?  350  ARG C CZ    1 
ATOM   6332  N  NH1   . ARG C  2  350  ? 74.013  -12.194 55.913   1.00 69.39  ?  350  ARG C NH1   1 
ATOM   6333  N  NH2   . ARG C  2  350  ? 71.964  -13.230 55.903   1.00 69.20  ?  350  ARG C NH2   1 
ATOM   6334  N  N     . LEU C  2  351  ? 79.566  -17.654 53.026   1.00 81.67  ?  351  LEU C N     1 
ATOM   6335  C  CA    . LEU C  2  351  ? 81.001  -17.773 52.801   1.00 84.34  ?  351  LEU C CA    1 
ATOM   6336  C  C     . LEU C  2  351  ? 81.240  -18.495 51.480   1.00 90.74  ?  351  LEU C C     1 
ATOM   6337  O  O     . LEU C  2  351  ? 82.200  -18.205 50.759   1.00 96.54  ?  351  LEU C O     1 
ATOM   6338  C  CB    . LEU C  2  351  ? 81.650  -18.555 53.946   1.00 80.17  ?  351  LEU C CB    1 
ATOM   6339  C  CG    . LEU C  2  351  ? 83.113  -18.276 54.297   1.00 83.40  ?  351  LEU C CG    1 
ATOM   6340  C  CD1   . LEU C  2  351  ? 83.228  -17.020 55.141   1.00 71.70  ?  351  LEU C CD1   1 
ATOM   6341  C  CD2   . LEU C  2  351  ? 83.727  -19.465 55.018   1.00 74.74  ?  351  LEU C CD2   1 
ATOM   6342  N  N     . ALA C  2  352  ? 80.345  -19.429 51.168   1.00 89.70  ?  352  ALA C N     1 
ATOM   6343  C  CA    . ALA C  2  352  ? 80.437  -20.234 49.955   1.00 86.18  ?  352  ALA C CA    1 
ATOM   6344  C  C     . ALA C  2  352  ? 80.431  -19.381 48.690   1.00 84.43  ?  352  ALA C C     1 
ATOM   6345  O  O     . ALA C  2  352  ? 81.187  -19.649 47.757   1.00 89.92  ?  352  ALA C O     1 
ATOM   6346  C  CB    . ALA C  2  352  ? 79.309  -21.258 49.912   1.00 75.36  ?  352  ALA C CB    1 
ATOM   6347  N  N     . ARG C  2  353  ? 79.582  -18.357 48.663   1.00 84.11  ?  353  ARG C N     1 
ATOM   6348  C  CA    . ARG C  2  353  ? 79.495  -17.473 47.504   1.00 97.37  ?  353  ARG C CA    1 
ATOM   6349  C  C     . ARG C  2  353  ? 80.830  -16.785 47.237   1.00 101.96 ?  353  ARG C C     1 
ATOM   6350  O  O     . ARG C  2  353  ? 81.296  -16.737 46.098   1.00 101.97 ?  353  ARG C O     1 
ATOM   6351  C  CB    . ARG C  2  353  ? 78.396  -16.424 47.689   1.00 98.45  ?  353  ARG C CB    1 
ATOM   6352  C  CG    . ARG C  2  353  ? 78.175  -15.555 46.456   1.00 101.38 ?  353  ARG C CG    1 
ATOM   6353  C  CD    . ARG C  2  353  ? 77.174  -14.438 46.713   1.00 103.05 ?  353  ARG C CD    1 
ATOM   6354  N  NE    . ARG C  2  353  ? 76.815  -13.738 45.481   1.00 102.94 ?  353  ARG C NE    1 
ATOM   6355  C  CZ    . ARG C  2  353  ? 77.476  -12.694 44.990   1.00 89.94  ?  353  ARG C CZ    1 
ATOM   6356  N  NH1   . ARG C  2  353  ? 78.540  -12.219 45.625   1.00 81.56  ?  353  ARG C NH1   1 
ATOM   6357  N  NH2   . ARG C  2  353  ? 77.074  -12.124 43.861   1.00 70.82  ?  353  ARG C NH2   1 
ATOM   6358  N  N     . GLY C  2  354  ? 81.438  -16.259 48.295   1.00 99.78  ?  354  GLY C N     1 
ATOM   6359  C  CA    . GLY C  2  354  ? 82.731  -15.609 48.191   1.00 99.04  ?  354  GLY C CA    1 
ATOM   6360  C  C     . GLY C  2  354  ? 83.816  -16.575 47.759   1.00 100.73 ?  354  GLY C C     1 
ATOM   6361  O  O     . GLY C  2  354  ? 84.632  -16.257 46.890   1.00 105.04 ?  354  GLY C O     1 
ATOM   6362  N  N     . VAL C  2  355  ? 83.820  -17.760 48.364   1.00 95.39  ?  355  VAL C N     1 
ATOM   6363  C  CA    . VAL C  2  355  ? 84.803  -18.786 48.028   1.00 97.95  ?  355  VAL C CA    1 
ATOM   6364  C  C     . VAL C  2  355  ? 84.739  -19.179 46.552   1.00 100.71 ?  355  VAL C C     1 
ATOM   6365  O  O     . VAL C  2  355  ? 85.759  -19.185 45.863   1.00 102.48 ?  355  VAL C O     1 
ATOM   6366  C  CB    . VAL C  2  355  ? 84.646  -20.042 48.910   1.00 87.76  ?  355  VAL C CB    1 
ATOM   6367  C  CG1   . VAL C  2  355  ? 85.521  -21.171 48.390   1.00 86.52  ?  355  VAL C CG1   1 
ATOM   6368  C  CG2   . VAL C  2  355  ? 84.996  -19.720 50.354   1.00 88.41  ?  355  VAL C CG2   1 
ATOM   6369  N  N     . ARG C  2  356  ? 83.541  -19.494 46.068   1.00 92.12  ?  356  ARG C N     1 
ATOM   6370  C  CA    . ARG C  2  356  ? 83.362  -19.889 44.673   1.00 87.84  ?  356  ARG C CA    1 
ATOM   6371  C  C     . ARG C  2  356  ? 83.656  -18.736 43.716   1.00 94.90  ?  356  ARG C C     1 
ATOM   6372  O  O     . ARG C  2  356  ? 84.218  -18.940 42.637   1.00 100.38 ?  356  ARG C O     1 
ATOM   6373  C  CB    . ARG C  2  356  ? 81.948  -20.421 44.442   1.00 74.77  ?  356  ARG C CB    1 
ATOM   6374  C  CG    . ARG C  2  356  ? 81.584  -21.603 45.323   1.00 80.15  ?  356  ARG C CG    1 
ATOM   6375  C  CD    . ARG C  2  356  ? 80.134  -22.018 45.134   1.00 90.50  ?  356  ARG C CD    1 
ATOM   6376  N  NE    . ARG C  2  356  ? 79.594  -22.669 46.326   1.00 93.55  ?  356  ARG C NE    1 
ATOM   6377  C  CZ    . ARG C  2  356  ? 79.662  -23.975 46.564   1.00 88.59  ?  356  ARG C CZ    1 
ATOM   6378  N  NH1   . ARG C  2  356  ? 79.142  -24.473 47.677   1.00 82.40  ?  356  ARG C NH1   1 
ATOM   6379  N  NH2   . ARG C  2  356  ? 80.250  -24.782 45.692   1.00 91.84  ?  356  ARG C NH2   1 
ATOM   6380  N  N     . GLU C  2  357  ? 83.277  -17.525 44.120   1.00 94.28  ?  357  GLU C N     1 
ATOM   6381  C  CA    . GLU C  2  357  ? 83.542  -16.332 43.320   1.00 104.12 ?  357  GLU C CA    1 
ATOM   6382  C  C     . GLU C  2  357  ? 85.039  -16.121 43.124   1.00 105.49 ?  357  GLU C C     1 
ATOM   6383  O  O     . GLU C  2  357  ? 85.496  -15.844 42.014   1.00 110.81 ?  357  GLU C O     1 
ATOM   6384  C  CB    . GLU C  2  357  ? 82.926  -15.092 43.970   1.00 110.32 ?  357  GLU C CB    1 
ATOM   6385  C  CG    . GLU C  2  357  ? 83.342  -13.781 43.317   1.00 112.94 ?  357  GLU C CG    1 
ATOM   6386  C  CD    . GLU C  2  357  ? 82.806  -12.567 44.050   1.00 110.24 ?  357  GLU C CD    1 
ATOM   6387  O  OE1   . GLU C  2  357  ? 83.384  -11.471 43.888   1.00 101.95 ?  357  GLU C OE1   1 
ATOM   6388  O  OE2   . GLU C  2  357  ? 81.805  -12.707 44.785   1.00 115.55 ?  357  GLU C OE2   1 
ATOM   6389  N  N     . ARG C  2  358  ? 85.798  -16.259 44.206   1.00 106.06 ?  358  ARG C N     1 
ATOM   6390  C  CA    . ARG C  2  358  ? 87.246  -16.087 44.146   1.00 110.12 ?  358  ARG C CA    1 
ATOM   6391  C  C     . ARG C  2  358  ? 87.931  -17.322 43.559   1.00 106.92 ?  358  ARG C C     1 
ATOM   6392  O  O     . ARG C  2  358  ? 89.109  -17.279 43.206   1.00 102.24 ?  358  ARG C O     1 
ATOM   6393  C  CB    . ARG C  2  358  ? 87.802  -15.760 45.533   1.00 107.79 ?  358  ARG C CB    1 
ATOM   6394  C  CG    . ARG C  2  358  ? 87.175  -14.523 46.156   1.00 100.02 ?  358  ARG C CG    1 
ATOM   6395  C  CD    . ARG C  2  358  ? 87.498  -14.412 47.635   1.00 99.52  ?  358  ARG C CD    1 
ATOM   6396  N  NE    . ARG C  2  358  ? 86.464  -13.677 48.357   1.00 96.42  ?  358  ARG C NE    1 
ATOM   6397  C  CZ    . ARG C  2  358  ? 86.457  -12.358 48.519   1.00 98.35  ?  358  ARG C CZ    1 
ATOM   6398  N  NH1   . ARG C  2  358  ? 87.435  -11.620 48.012   1.00 96.80  ?  358  ARG C NH1   1 
ATOM   6399  N  NH2   . ARG C  2  358  ? 85.472  -11.777 49.190   1.00 94.96  ?  358  ARG C NH2   1 
ATOM   6400  N  N     . MET C  2  359  ? 87.185  -18.419 43.460   1.00 104.84 ?  359  MET C N     1 
ATOM   6401  C  CA    . MET C  2  359  ? 87.672  -19.633 42.813   1.00 98.71  ?  359  MET C CA    1 
ATOM   6402  C  C     . MET C  2  359  ? 87.591  -19.507 41.296   1.00 105.04 ?  359  MET C C     1 
ATOM   6403  O  O     . MET C  2  359  ? 88.487  -19.949 40.575   1.00 105.92 ?  359  MET C O     1 
ATOM   6404  C  CB    . MET C  2  359  ? 86.857  -20.847 43.265   1.00 86.59  ?  359  MET C CB    1 
ATOM   6405  C  CG    . MET C  2  359  ? 87.401  -21.554 44.493   1.00 86.69  ?  359  MET C CG    1 
ATOM   6406  S  SD    . MET C  2  359  ? 86.298  -22.865 45.056   1.00 86.67  ?  359  MET C SD    1 
ATOM   6407  C  CE    . MET C  2  359  ? 86.008  -23.748 43.525   1.00 87.44  ?  359  MET C CE    1 
ATOM   6408  N  N     . LEU C  2  360  ? 86.507  -18.902 40.821   1.00 104.14 ?  360  LEU C N     1 
ATOM   6409  C  CA    . LEU C  2  360  ? 86.253  -18.776 39.388   1.00 98.77  ?  360  LEU C CA    1 
ATOM   6410  C  C     . LEU C  2  360  ? 87.208  -17.809 38.692   1.00 99.64  ?  360  LEU C C     1 
ATOM   6411  O  O     . LEU C  2  360  ? 87.556  -18.001 37.527   1.00 103.42 ?  360  LEU C O     1 
ATOM   6412  C  CB    . LEU C  2  360  ? 84.806  -18.343 39.141   1.00 94.22  ?  360  LEU C CB    1 
ATOM   6413  C  CG    . LEU C  2  360  ? 83.716  -19.416 39.034   1.00 97.75  ?  360  LEU C CG    1 
ATOM   6414  C  CD1   . LEU C  2  360  ? 84.154  -20.745 39.637   1.00 82.66  ?  360  LEU C CD1   1 
ATOM   6415  C  CD2   . LEU C  2  360  ? 82.438  -18.922 39.696   1.00 99.59  ?  360  LEU C CD2   1 
ATOM   6416  N  N     . MET C  2  361  ? 87.634  -16.773 39.408   1.00 98.46  ?  361  MET C N     1 
ATOM   6417  C  CA    . MET C  2  361  ? 88.455  -15.725 38.810   1.00 100.99 ?  361  MET C CA    1 
ATOM   6418  C  C     . MET C  2  361  ? 89.749  -15.484 39.580   1.00 115.49 ?  361  MET C C     1 
ATOM   6419  O  O     . MET C  2  361  ? 89.908  -15.942 40.711   1.00 120.06 ?  361  MET C O     1 
ATOM   6420  C  CB    . MET C  2  361  ? 87.661  -14.423 38.685   1.00 102.14 ?  361  MET C CB    1 
ATOM   6421  C  CG    . MET C  2  361  ? 86.453  -14.522 37.770   1.00 96.38  ?  361  MET C CG    1 
ATOM   6422  S  SD    . MET C  2  361  ? 85.590  -12.951 37.587   1.00 110.39 ?  361  MET C SD    1 
ATOM   6423  C  CE    . MET C  2  361  ? 86.908  -11.918 36.948   1.00 86.76  ?  361  MET C CE    1 
ATOM   6424  N  N     . GLY C  2  362  ? 90.672  -14.762 38.952   1.00 122.56 ?  362  GLY C N     1 
ATOM   6425  C  CA    . GLY C  2  362  ? 91.989  -14.544 39.518   1.00 116.98 ?  362  GLY C CA    1 
ATOM   6426  C  C     . GLY C  2  362  ? 92.944  -15.624 39.050   1.00 126.82 ?  362  GLY C C     1 
ATOM   6427  O  O     . GLY C  2  362  ? 92.755  -16.207 37.982   1.00 128.54 ?  362  GLY C O     1 
ATOM   6428  N  N     . SER C  2  363  ? 93.971  -15.894 39.847   1.00 128.18 ?  363  SER C N     1 
ATOM   6429  C  CA    . SER C  2  363  ? 94.930  -16.940 39.515   1.00 128.85 ?  363  SER C CA    1 
ATOM   6430  C  C     . SER C  2  363  ? 94.530  -18.258 40.168   1.00 124.73 ?  363  SER C C     1 
ATOM   6431  O  O     . SER C  2  363  ? 94.554  -18.383 41.391   1.00 129.15 ?  363  SER C O     1 
ATOM   6432  C  CB    . SER C  2  363  ? 96.338  -16.540 39.962   1.00 116.79 ?  363  SER C CB    1 
ATOM   6433  O  OG    . SER C  2  363  ? 96.758  -15.346 39.327   1.00 111.43 ?  363  SER C OG    1 
ATOM   6434  N  N     . GLU C  2  364  ? 94.164  -19.240 39.349   1.00 120.65 ?  364  GLU C N     1 
ATOM   6435  C  CA    . GLU C  2  364  ? 93.799  -20.560 39.852   1.00 118.49 ?  364  GLU C CA    1 
ATOM   6436  C  C     . GLU C  2  364  ? 95.045  -21.283 40.352   1.00 119.34 ?  364  GLU C C     1 
ATOM   6437  O  O     . GLU C  2  364  ? 94.957  -22.246 41.114   1.00 111.14 ?  364  GLU C O     1 
ATOM   6438  C  CB    . GLU C  2  364  ? 93.106  -21.380 38.758   1.00 117.87 ?  364  GLU C CB    1 
ATOM   6439  C  CG    . GLU C  2  364  ? 92.315  -22.582 39.267   1.00 117.12 ?  364  GLU C CG    1 
ATOM   6440  C  CD    . GLU C  2  364  ? 93.052  -23.900 39.093   1.00 101.54 ?  364  GLU C CD    1 
ATOM   6441  O  OE1   . GLU C  2  364  ? 94.289  -23.879 38.918   1.00 104.20 ?  364  GLU C OE1   1 
ATOM   6442  O  OE2   . GLU C  2  364  ? 92.388  -24.960 39.124   1.00 87.51  ?  364  GLU C OE2   1 
ATOM   6443  N  N     . ASP C  2  365  ? 96.206  -20.793 39.928   1.00 122.42 ?  365  ASP C N     1 
ATOM   6444  C  CA    . ASP C  2  365  ? 97.482  -21.371 40.326   1.00 125.22 ?  365  ASP C CA    1 
ATOM   6445  C  C     . ASP C  2  365  ? 97.785  -21.004 41.774   1.00 125.55 ?  365  ASP C C     1 
ATOM   6446  O  O     . ASP C  2  365  ? 97.868  -21.878 42.638   1.00 119.39 ?  365  ASP C O     1 
ATOM   6447  C  CB    . ASP C  2  365  ? 98.603  -20.881 39.406   1.00 116.21 ?  365  ASP C CB    1 
ATOM   6448  C  CG    . ASP C  2  365  ? 99.838  -21.763 39.465   1.00 111.60 ?  365  ASP C CG    1 
ATOM   6449  O  OD1   . ASP C  2  365  ? 100.082 -22.391 40.517   1.00 109.08 ?  365  ASP C OD1   1 
ATOM   6450  O  OD2   . ASP C  2  365  ? 100.566 -21.829 38.452   1.00 108.52 ?  365  ASP C OD2   1 
ATOM   6451  N  N     . SER C  2  366  ? 97.950  -19.712 42.038   1.00 124.76 ?  366  SER C N     1 
ATOM   6452  C  CA    . SER C  2  366  ? 98.234  -19.259 43.392   1.00 123.02 ?  366  SER C CA    1 
ATOM   6453  C  C     . SER C  2  366  ? 96.947  -18.890 44.119   1.00 120.07 ?  366  SER C C     1 
ATOM   6454  O  O     . SER C  2  366  ? 96.323  -17.869 43.828   1.00 117.12 ?  366  SER C O     1 
ATOM   6455  C  CB    . SER C  2  366  ? 99.176  -18.054 43.362   1.00 120.36 ?  366  SER C CB    1 
ATOM   6456  O  OG    . SER C  2  366  ? 98.597  -16.974 42.648   1.00 116.45 ?  366  SER C OG    1 
ATOM   6457  N  N     . LEU C  2  367  ? 96.571  -19.728 45.079   1.00 118.74 ?  367  LEU C N     1 
ATOM   6458  C  CA    . LEU C  2  367  ? 95.397  -19.499 45.910   1.00 119.87 ?  367  LEU C CA    1 
ATOM   6459  C  C     . LEU C  2  367  ? 95.592  -20.135 47.277   1.00 118.31 ?  367  LEU C C     1 
ATOM   6460  O  O     . LEU C  2  367  ? 96.192  -21.203 47.395   1.00 118.38 ?  367  LEU C O     1 
ATOM   6461  C  CB    . LEU C  2  367  ? 94.137  -20.067 45.252   1.00 115.73 ?  367  LEU C CB    1 
ATOM   6462  C  CG    . LEU C  2  367  ? 93.406  -19.182 44.241   1.00 108.80 ?  367  LEU C CG    1 
ATOM   6463  C  CD1   . LEU C  2  367  ? 92.128  -19.855 43.760   1.00 100.54 ?  367  LEU C CD1   1 
ATOM   6464  C  CD2   . LEU C  2  367  ? 93.109  -17.813 44.835   1.00 89.75  ?  367  LEU C CD2   1 
ATOM   6465  N  N     . THR C  2  368  ? 95.077  -19.476 48.308   1.00 113.52 ?  368  THR C N     1 
ATOM   6466  C  CA    . THR C  2  368  ? 95.124  -20.006 49.663   1.00 112.91 ?  368  THR C CA    1 
ATOM   6467  C  C     . THR C  2  368  ? 93.742  -19.880 50.288   1.00 110.28 ?  368  THR C C     1 
ATOM   6468  O  O     . THR C  2  368  ? 92.936  -19.060 49.846   1.00 109.39 ?  368  THR C O     1 
ATOM   6469  C  CB    . THR C  2  368  ? 96.146  -19.245 50.535   1.00 108.60 ?  368  THR C CB    1 
ATOM   6470  O  OG1   . THR C  2  368  ? 95.850  -17.843 50.510   1.00 111.64 ?  368  THR C OG1   1 
ATOM   6471  C  CG2   . THR C  2  368  ? 97.563  -19.470 50.028   1.00 105.34 ?  368  THR C CG2   1 
ATOM   6472  N  N     . PRO C  2  369  ? 93.453  -20.700 51.312   1.00 103.95 ?  369  PRO C N     1 
ATOM   6473  C  CA    . PRO C  2  369  ? 92.206  -20.534 52.068   1.00 95.75  ?  369  PRO C CA    1 
ATOM   6474  C  C     . PRO C  2  369  ? 92.106  -19.140 52.685   1.00 94.13  ?  369  PRO C C     1 
ATOM   6475  O  O     . PRO C  2  369  ? 91.011  -18.692 53.022   1.00 101.56 ?  369  PRO C O     1 
ATOM   6476  C  CB    . PRO C  2  369  ? 92.324  -21.594 53.164   1.00 92.39  ?  369  PRO C CB    1 
ATOM   6477  C  CG    . PRO C  2  369  ? 93.181  -22.650 52.562   1.00 96.08  ?  369  PRO C CG    1 
ATOM   6478  C  CD    . PRO C  2  369  ? 94.182  -21.917 51.714   1.00 99.96  ?  369  PRO C CD    1 
ATOM   6479  N  N     . ALA C  2  370  ? 93.245  -18.467 52.827   1.00 90.78  ?  370  ALA C N     1 
ATOM   6480  C  CA    . ALA C  2  370  ? 93.282  -17.100 53.330   1.00 90.50  ?  370  ALA C CA    1 
ATOM   6481  C  C     . ALA C  2  370  ? 92.716  -16.120 52.307   1.00 94.86  ?  370  ALA C C     1 
ATOM   6482  O  O     . ALA C  2  370  ? 91.997  -15.185 52.661   1.00 97.28  ?  370  ALA C O     1 
ATOM   6483  C  CB    . ALA C  2  370  ? 94.706  -16.716 53.699   1.00 87.80  ?  370  ALA C CB    1 
ATOM   6484  N  N     . LYS C  2  371  ? 93.045  -16.337 51.037   1.00 99.78  ?  371  LYS C N     1 
ATOM   6485  C  CA    . LYS C  2  371  ? 92.577  -15.465 49.963   1.00 102.23 ?  371  LYS C CA    1 
ATOM   6486  C  C     . LYS C  2  371  ? 91.127  -15.754 49.586   1.00 97.30  ?  371  LYS C C     1 
ATOM   6487  O  O     . LYS C  2  371  ? 90.399  -14.860 49.155   1.00 94.24  ?  371  LYS C O     1 
ATOM   6488  C  CB    . LYS C  2  371  ? 93.471  -15.606 48.728   1.00 104.40 ?  371  LYS C CB    1 
ATOM   6489  C  CG    . LYS C  2  371  ? 94.900  -15.128 48.927   1.00 104.28 ?  371  LYS C CG    1 
ATOM   6490  C  CD    . LYS C  2  371  ? 95.717  -15.312 47.657   1.00 117.94 ?  371  LYS C CD    1 
ATOM   6491  C  CE    . LYS C  2  371  ? 97.153  -14.850 47.842   1.00 113.25 ?  371  LYS C CE    1 
ATOM   6492  N  NZ    . LYS C  2  371  ? 97.965  -15.067 46.612   1.00 105.17 ?  371  LYS C NZ    1 
ATOM   6493  N  N     . LEU C  2  372  ? 90.714  -17.007 49.749   1.00 95.16  ?  372  LEU C N     1 
ATOM   6494  C  CA    . LEU C  2  372  ? 89.370  -17.430 49.369   1.00 99.85  ?  372  LEU C CA    1 
ATOM   6495  C  C     . LEU C  2  372  ? 88.308  -17.013 50.381   1.00 101.63 ?  372  LEU C C     1 
ATOM   6496  O  O     . LEU C  2  372  ? 87.213  -16.590 50.007   1.00 95.10  ?  372  LEU C O     1 
ATOM   6497  C  CB    . LEU C  2  372  ? 89.321  -18.947 49.175   1.00 98.85  ?  372  LEU C CB    1 
ATOM   6498  C  CG    . LEU C  2  372  ? 90.157  -19.534 48.038   1.00 90.53  ?  372  LEU C CG    1 
ATOM   6499  C  CD1   . LEU C  2  372  ? 89.969  -21.042 47.968   1.00 90.73  ?  372  LEU C CD1   1 
ATOM   6500  C  CD2   . LEU C  2  372  ? 89.791  -18.882 46.715   1.00 93.24  ?  372  LEU C CD2   1 
ATOM   6501  N  N     . VAL C  2  373  ? 88.634  -17.135 51.664   1.00 101.51 ?  373  VAL C N     1 
ATOM   6502  C  CA    . VAL C  2  373  ? 87.649  -16.922 52.717   1.00 89.67  ?  373  VAL C CA    1 
ATOM   6503  C  C     . VAL C  2  373  ? 87.561  -15.470 53.174   1.00 89.38  ?  373  VAL C C     1 
ATOM   6504  O  O     . VAL C  2  373  ? 88.529  -14.902 53.680   1.00 79.26  ?  373  VAL C O     1 
ATOM   6505  C  CB    . VAL C  2  373  ? 87.914  -17.827 53.939   1.00 73.82  ?  373  VAL C CB    1 
ATOM   6506  C  CG1   . VAL C  2  373  ? 86.955  -17.486 55.070   1.00 74.11  ?  373  VAL C CG1   1 
ATOM   6507  C  CG2   . VAL C  2  373  ? 87.784  -19.291 53.547   1.00 73.53  ?  373  VAL C CG2   1 
ATOM   6508  N  N     . ASN C  2  374  ? 86.387  -14.878 52.985   1.00 91.50  ?  374  ASN C N     1 
ATOM   6509  C  CA    . ASN C  2  374  ? 86.096  -13.559 53.527   1.00 85.04  ?  374  ASN C CA    1 
ATOM   6510  C  C     . ASN C  2  374  ? 85.145  -13.712 54.711   1.00 92.11  ?  374  ASN C C     1 
ATOM   6511  O  O     . ASN C  2  374  ? 83.978  -14.050 54.527   1.00 94.96  ?  374  ASN C O     1 
ATOM   6512  C  CB    . ASN C  2  374  ? 85.475  -12.665 52.451   1.00 79.24  ?  374  ASN C CB    1 
ATOM   6513  C  CG    . ASN C  2  374  ? 85.446  -11.200 52.852   1.00 85.18  ?  374  ASN C CG    1 
ATOM   6514  O  OD1   . ASN C  2  374  ? 85.260  -10.867 54.022   1.00 93.04  ?  374  ASN C OD1   1 
ATOM   6515  N  ND2   . ASN C  2  374  ? 85.641  -10.317 51.879   1.00 87.08  ?  374  ASN C ND2   1 
ATOM   6516  N  N     . SER C  2  375  ? 85.645  -13.450 55.917   1.00 86.20  ?  375  SER C N     1 
ATOM   6517  C  CA    . SER C  2  375  ? 84.899  -13.706 57.154   1.00 82.67  ?  375  SER C CA    1 
ATOM   6518  C  C     . SER C  2  375  ? 83.759  -12.722 57.414   1.00 86.95  ?  375  SER C C     1 
ATOM   6519  O  O     . SER C  2  375  ? 82.829  -13.028 58.165   1.00 82.70  ?  375  SER C O     1 
ATOM   6520  C  CB    . SER C  2  375  ? 85.857  -13.705 58.349   1.00 80.49  ?  375  SER C CB    1 
ATOM   6521  O  OG    . SER C  2  375  ? 86.493  -12.447 58.478   1.00 81.58  ?  375  SER C OG    1 
ATOM   6522  N  N     . ARG C  2  376  ? 83.836  -11.557 56.774   1.00 89.50  ?  376  ARG C N     1 
ATOM   6523  C  CA    . ARG C  2  376  ? 82.896  -10.450 56.996   1.00 79.96  ?  376  ARG C CA    1 
ATOM   6524  C  C     . ARG C  2  376  ? 81.387  -10.806 57.101   1.00 75.94  ?  376  ARG C C     1 
ATOM   6525  O  O     . ARG C  2  376  ? 80.727  -10.343 58.042   1.00 75.09  ?  376  ARG C O     1 
ATOM   6526  C  CB    . ARG C  2  376  ? 83.142  -9.304  55.992   1.00 79.01  ?  376  ARG C CB    1 
ATOM   6527  C  CG    . ARG C  2  376  ? 84.103  -8.218  56.479   1.00 88.10  ?  376  ARG C CG    1 
ATOM   6528  C  CD    . ARG C  2  376  ? 85.514  -8.746  56.644   1.00 93.42  ?  376  ARG C CD    1 
ATOM   6529  N  NE    . ARG C  2  376  ? 86.439  -7.698  57.065   1.00 87.67  ?  376  ARG C NE    1 
ATOM   6530  C  CZ    . ARG C  2  376  ? 86.778  -7.462  58.328   1.00 89.47  ?  376  ARG C CZ    1 
ATOM   6531  N  NH1   . ARG C  2  376  ? 86.270  -8.204  59.304   1.00 86.37  ?  376  ARG C NH1   1 
ATOM   6532  N  NH2   . ARG C  2  376  ? 87.628  -6.485  58.617   1.00 90.98  ?  376  ARG C NH2   1 
ATOM   6533  N  N     . PRO C  2  377  ? 80.845  -11.622 56.157   1.00 75.67  ?  377  PRO C N     1 
ATOM   6534  C  CA    . PRO C  2  377  ? 79.435  -12.033 56.256   1.00 79.12  ?  377  PRO C CA    1 
ATOM   6535  C  C     . PRO C  2  377  ? 79.127  -12.832 57.529   1.00 76.92  ?  377  PRO C C     1 
ATOM   6536  O  O     . PRO C  2  377  ? 78.093  -12.603 58.167   1.00 85.04  ?  377  PRO C O     1 
ATOM   6537  C  CB    . PRO C  2  377  ? 79.228  -12.894 54.993   1.00 79.76  ?  377  PRO C CB    1 
ATOM   6538  C  CG    . PRO C  2  377  ? 80.608  -13.280 54.542   1.00 73.71  ?  377  PRO C CG    1 
ATOM   6539  C  CD    . PRO C  2  377  ? 81.457  -12.107 54.907   1.00 73.01  ?  377  PRO C CD    1 
ATOM   6540  N  N     . LEU C  2  378  ? 80.022  -13.744 57.897   1.00 67.97  ?  378  LEU C N     1 
ATOM   6541  C  CA    . LEU C  2  378  ? 79.798  -14.608 59.053   1.00 67.73  ?  378  LEU C CA    1 
ATOM   6542  C  C     . LEU C  2  378  ? 79.768  -13.773 60.312   1.00 69.57  ?  378  LEU C C     1 
ATOM   6543  O  O     . LEU C  2  378  ? 78.831  -13.867 61.105   1.00 70.31  ?  378  LEU C O     1 
ATOM   6544  C  CB    . LEU C  2  378  ? 80.884  -15.674 59.169   1.00 61.38  ?  378  LEU C CB    1 
ATOM   6545  C  CG    . LEU C  2  378  ? 80.726  -16.659 60.333   1.00 55.32  ?  378  LEU C CG    1 
ATOM   6546  C  CD1   . LEU C  2  378  ? 79.412  -17.420 60.267   1.00 52.85  ?  378  LEU C CD1   1 
ATOM   6547  C  CD2   . LEU C  2  378  ? 81.873  -17.631 60.340   1.00 64.79  ?  378  LEU C CD2   1 
ATOM   6548  N  N     . GLU C  2  379  ? 80.806  -12.957 60.481   1.00 70.53  ?  379  GLU C N     1 
ATOM   6549  C  CA    . GLU C  2  379  ? 80.860  -11.975 61.553   1.00 65.90  ?  379  GLU C CA    1 
ATOM   6550  C  C     . GLU C  2  379  ? 79.565  -11.177 61.559   1.00 69.09  ?  379  GLU C C     1 
ATOM   6551  O  O     . GLU C  2  379  ? 79.012  -10.911 62.615   1.00 77.88  ?  379  GLU C O     1 
ATOM   6552  C  CB    . GLU C  2  379  ? 82.077  -11.037 61.396   1.00 74.05  ?  379  GLU C CB    1 
ATOM   6553  C  CG    . GLU C  2  379  ? 83.429  -11.774 61.373   1.00 83.77  ?  379  GLU C CG    1 
ATOM   6554  C  CD    . GLU C  2  379  ? 84.629  -10.862 61.188   1.00 86.74  ?  379  GLU C CD    1 
ATOM   6555  O  OE1   . GLU C  2  379  ? 84.963  -10.538 60.030   1.00 82.14  ?  379  GLU C OE1   1 
ATOM   6556  O  OE2   . GLU C  2  379  ? 85.254  -10.489 62.200   1.00 90.20  ?  379  GLU C OE2   1 
ATOM   6557  N  N     . ALA C  2  380  ? 79.065  -10.823 60.376   1.00 75.23  ?  380  ALA C N     1 
ATOM   6558  C  CA    . ALA C  2  380  ? 77.948  -9.882  60.300   1.00 71.11  ?  380  ALA C CA    1 
ATOM   6559  C  C     . ALA C  2  380  ? 76.650  -10.595 60.602   1.00 70.23  ?  380  ALA C C     1 
ATOM   6560  O  O     . ALA C  2  380  ? 75.626  -9.970  60.854   1.00 74.84  ?  380  ALA C O     1 
ATOM   6561  C  CB    . ALA C  2  380  ? 77.894  -9.192  58.930   1.00 58.03  ?  380  ALA C CB    1 
ATOM   6562  N  N     . ALA C  2  381  ? 76.722  -11.920 60.570   1.00 64.88  ?  381  ALA C N     1 
ATOM   6563  C  CA    . ALA C  2  381  ? 75.580  -12.774 60.826   1.00 62.46  ?  381  ALA C CA    1 
ATOM   6564  C  C     . ALA C  2  381  ? 75.379  -12.846 62.325   1.00 66.94  ?  381  ALA C C     1 
ATOM   6565  O  O     . ALA C  2  381  ? 74.368  -12.381 62.849   1.00 74.75  ?  381  ALA C O     1 
ATOM   6566  C  CB    . ALA C  2  381  ? 75.814  -14.165 60.241   1.00 63.73  ?  381  ALA C CB    1 
ATOM   6567  N  N     . ILE C  2  382  ? 76.370  -13.408 63.008   1.00 68.31  ?  382  ILE C N     1 
ATOM   6568  C  CA    . ILE C  2  382  ? 76.347  -13.536 64.460   1.00 68.21  ?  382  ILE C CA    1 
ATOM   6569  C  C     . ILE C  2  382  ? 76.143  -12.207 65.179   1.00 63.67  ?  382  ILE C C     1 
ATOM   6570  O  O     . ILE C  2  382  ? 75.351  -12.129 66.124   1.00 62.13  ?  382  ILE C O     1 
ATOM   6571  C  CB    . ILE C  2  382  ? 77.619  -14.228 64.983   1.00 64.04  ?  382  ILE C CB    1 
ATOM   6572  C  CG1   . ILE C  2  382  ? 77.307  -15.697 65.255   1.00 55.85  ?  382  ILE C CG1   1 
ATOM   6573  C  CG2   . ILE C  2  382  ? 78.131  -13.552 66.253   1.00 65.90  ?  382  ILE C CG2   1 
ATOM   6574  C  CD1   . ILE C  2  382  ? 76.772  -16.459 64.048   1.00 56.80  ?  382  ILE C CD1   1 
ATOM   6575  N  N     . ARG C  2  383  ? 76.843  -11.168 64.721   1.00 58.45  ?  383  ARG C N     1 
ATOM   6576  C  CA    . ARG C  2  383  ? 76.679  -9.821  65.268   1.00 62.67  ?  383  ARG C CA    1 
ATOM   6577  C  C     . ARG C  2  383  ? 75.236  -9.342  65.088   1.00 69.08  ?  383  ARG C C     1 
ATOM   6578  O  O     . ARG C  2  383  ? 74.675  -8.683  65.963   1.00 68.40  ?  383  ARG C O     1 
ATOM   6579  C  CB    . ARG C  2  383  ? 77.645  -8.827  64.610   1.00 58.19  ?  383  ARG C CB    1 
ATOM   6580  C  CG    . ARG C  2  383  ? 77.586  -7.432  65.234   1.00 60.96  ?  383  ARG C CG    1 
ATOM   6581  C  CD    . ARG C  2  383  ? 78.842  -6.632  64.966   1.00 65.12  ?  383  ARG C CD    1 
ATOM   6582  N  NE    . ARG C  2  383  ? 79.236  -6.700  63.564   1.00 78.58  ?  383  ARG C NE    1 
ATOM   6583  C  CZ    . ARG C  2  383  ? 80.251  -6.020  63.044   1.00 90.21  ?  383  ARG C CZ    1 
ATOM   6584  N  NH1   . ARG C  2  383  ? 80.971  -5.215  63.814   1.00 85.82  ?  383  ARG C NH1   1 
ATOM   6585  N  NH2   . ARG C  2  383  ? 80.543  -6.142  61.756   1.00 87.38  ?  383  ARG C NH2   1 
ATOM   6586  N  N     . GLU C  2  384  ? 74.637  -9.679  63.947   1.00 73.62  ?  384  GLU C N     1 
ATOM   6587  C  CA    . GLU C  2  384  ? 73.243  -9.332  63.687   1.00 69.82  ?  384  GLU C CA    1 
ATOM   6588  C  C     . GLU C  2  384  ? 72.312  -10.087 64.631   1.00 68.65  ?  384  GLU C C     1 
ATOM   6589  O  O     . GLU C  2  384  ? 71.240  -9.595  64.976   1.00 70.58  ?  384  GLU C O     1 
ATOM   6590  C  CB    . GLU C  2  384  ? 72.870  -9.605  62.223   1.00 74.83  ?  384  GLU C CB    1 
ATOM   6591  C  CG    . GLU C  2  384  ? 71.475  -9.142  61.834   1.00 87.97  ?  384  GLU C CG    1 
ATOM   6592  C  CD    . GLU C  2  384  ? 71.345  -7.630  61.724   1.00 92.45  ?  384  GLU C CD    1 
ATOM   6593  O  OE1   . GLU C  2  384  ? 72.381  -6.929  61.681   1.00 82.51  ?  384  GLU C OE1   1 
ATOM   6594  O  OE2   . GLU C  2  384  ? 70.193  -7.146  61.674   1.00 92.97  ?  384  GLU C OE2   1 
ATOM   6595  N  N     . PHE C  2  385  ? 72.735  -11.270 65.067   1.00 55.50  ?  385  PHE C N     1 
ATOM   6596  C  CA    . PHE C  2  385  ? 71.907  -12.096 65.939   1.00 46.33  ?  385  PHE C CA    1 
ATOM   6597  C  C     . PHE C  2  385  ? 71.935  -11.616 67.386   1.00 57.57  ?  385  PHE C C     1 
ATOM   6598  O  O     . PHE C  2  385  ? 70.913  -11.588 68.067   1.00 60.18  ?  385  PHE C O     1 
ATOM   6599  C  CB    . PHE C  2  385  ? 72.355  -13.553 65.855   1.00 43.44  ?  385  PHE C CB    1 
ATOM   6600  C  CG    . PHE C  2  385  ? 71.736  -14.435 66.892   1.00 37.59  ?  385  PHE C CG    1 
ATOM   6601  C  CD1   . PHE C  2  385  ? 70.475  -14.970 66.700   1.00 39.70  ?  385  PHE C CD1   1 
ATOM   6602  C  CD2   . PHE C  2  385  ? 72.416  -14.731 68.059   1.00 39.21  ?  385  PHE C CD2   1 
ATOM   6603  C  CE1   . PHE C  2  385  ? 69.903  -15.783 67.654   1.00 43.90  ?  385  PHE C CE1   1 
ATOM   6604  C  CE2   . PHE C  2  385  ? 71.850  -15.539 69.018   1.00 50.53  ?  385  PHE C CE2   1 
ATOM   6605  C  CZ    . PHE C  2  385  ? 70.590  -16.069 68.816   1.00 50.05  ?  385  PHE C CZ    1 
ATOM   6606  N  N     . PHE C  2  386  ? 73.118  -11.254 67.859   1.00 57.50  ?  386  PHE C N     1 
ATOM   6607  C  CA    . PHE C  2  386  ? 73.263  -10.782 69.226   1.00 57.17  ?  386  PHE C CA    1 
ATOM   6608  C  C     . PHE C  2  386  ? 72.827  -9.324  69.403   1.00 52.34  ?  386  PHE C C     1 
ATOM   6609  O  O     . PHE C  2  386  ? 72.101  -8.998  70.347   1.00 58.19  ?  386  PHE C O     1 
ATOM   6610  C  CB    . PHE C  2  386  ? 74.692  -11.018 69.724   1.00 58.32  ?  386  PHE C CB    1 
ATOM   6611  C  CG    . PHE C  2  386  ? 74.969  -12.455 70.104   1.00 57.17  ?  386  PHE C CG    1 
ATOM   6612  C  CD1   . PHE C  2  386  ? 74.717  -12.899 71.393   1.00 50.88  ?  386  PHE C CD1   1 
ATOM   6613  C  CD2   . PHE C  2  386  ? 75.474  -13.359 69.179   1.00 55.66  ?  386  PHE C CD2   1 
ATOM   6614  C  CE1   . PHE C  2  386  ? 74.963  -14.213 71.756   1.00 43.57  ?  386  PHE C CE1   1 
ATOM   6615  C  CE2   . PHE C  2  386  ? 75.724  -14.677 69.538   1.00 51.84  ?  386  PHE C CE2   1 
ATOM   6616  C  CZ    . PHE C  2  386  ? 75.466  -15.102 70.829   1.00 46.29  ?  386  PHE C CZ    1 
ATOM   6617  N  N     . SER C  2  387  ? 73.267  -8.448  68.505   1.00 51.82  ?  387  SER C N     1 
ATOM   6618  C  CA    . SER C  2  387  ? 72.919  -7.029  68.618   1.00 67.39  ?  387  SER C CA    1 
ATOM   6619  C  C     . SER C  2  387  ? 71.467  -6.693  68.254   1.00 61.67  ?  387  SER C C     1 
ATOM   6620  O  O     . SER C  2  387  ? 70.729  -6.127  69.065   1.00 58.64  ?  387  SER C O     1 
ATOM   6621  C  CB    . SER C  2  387  ? 73.876  -6.169  67.784   1.00 67.18  ?  387  SER C CB    1 
ATOM   6622  O  OG    . SER C  2  387  ? 75.205  -6.260  68.275   1.00 60.77  ?  387  SER C OG    1 
ATOM   6623  N  N     . ARG C  2  388  ? 71.063  -7.046  67.037   1.00 60.29  ?  388  ARG C N     1 
ATOM   6624  C  CA    . ARG C  2  388  ? 69.775  -6.594  66.505   1.00 54.76  ?  388  ARG C CA    1 
ATOM   6625  C  C     . ARG C  2  388  ? 68.573  -7.555  66.529   1.00 53.47  ?  388  ARG C C     1 
ATOM   6626  O  O     . ARG C  2  388  ? 67.481  -7.164  66.118   1.00 61.60  ?  388  ARG C O     1 
ATOM   6627  C  CB    . ARG C  2  388  ? 69.957  -6.006  65.100   1.00 64.14  ?  388  ARG C CB    1 
ATOM   6628  C  CG    . ARG C  2  388  ? 70.236  -4.509  65.092   1.00 69.64  ?  388  ARG C CG    1 
ATOM   6629  C  CD    . ARG C  2  388  ? 70.842  -4.063  63.774   1.00 83.09  ?  388  ARG C CD    1 
ATOM   6630  N  NE    . ARG C  2  388  ? 72.235  -4.485  63.656   1.00 96.97  ?  388  ARG C NE    1 
ATOM   6631  C  CZ    . ARG C  2  388  ? 73.273  -3.736  64.015   1.00 91.07  ?  388  ARG C CZ    1 
ATOM   6632  N  NH1   . ARG C  2  388  ? 73.077  -2.520  64.509   1.00 87.21  ?  388  ARG C NH1   1 
ATOM   6633  N  NH2   . ARG C  2  388  ? 74.508  -4.200  63.877   1.00 82.60  ?  388  ARG C NH2   1 
ATOM   6634  N  N     . SER C  2  389  ? 68.744  -8.788  66.998   1.00 43.64  ?  389  SER C N     1 
ATOM   6635  C  CA    . SER C  2  389  ? 67.642  -9.751  66.905   1.00 45.88  ?  389  SER C CA    1 
ATOM   6636  C  C     . SER C  2  389  ? 66.514  -9.506  67.907   1.00 50.40  ?  389  SER C C     1 
ATOM   6637  O  O     . SER C  2  389  ? 66.606  -8.632  68.767   1.00 51.57  ?  389  SER C O     1 
ATOM   6638  C  CB    . SER C  2  389  ? 68.151  -11.188 67.040   1.00 45.34  ?  389  SER C CB    1 
ATOM   6639  O  OG    . SER C  2  389  ? 67.079  -12.112 67.152   1.00 43.84  ?  389  SER C OG    1 
ATOM   6640  N  N     . GLN C  2  390  ? 65.452  -10.297 67.784   1.00 55.21  ?  390  GLN C N     1 
ATOM   6641  C  CA    . GLN C  2  390  ? 64.286  -10.178 68.652   1.00 58.89  ?  390  GLN C CA    1 
ATOM   6642  C  C     . GLN C  2  390  ? 64.491  -10.898 69.979   1.00 56.21  ?  390  GLN C C     1 
ATOM   6643  O  O     . GLN C  2  390  ? 64.133  -10.384 71.038   1.00 58.46  ?  390  GLN C O     1 
ATOM   6644  C  CB    . GLN C  2  390  ? 63.037  -10.720 67.950   1.00 68.33  ?  390  GLN C CB    1 
ATOM   6645  C  CG    . GLN C  2  390  ? 61.775  -10.704 68.804   1.00 67.54  ?  390  GLN C CG    1 
ATOM   6646  C  CD    . GLN C  2  390  ? 61.230  -9.306  69.025   1.00 75.08  ?  390  GLN C CD    1 
ATOM   6647  O  OE1   . GLN C  2  390  ? 60.553  -9.040  70.019   1.00 77.70  ?  390  GLN C OE1   1 
ATOM   6648  N  NE2   . GLN C  2  390  ? 61.517  -8.404  68.093   1.00 73.54  ?  390  GLN C NE2   1 
ATOM   6649  N  N     . LEU C  2  391  ? 65.072  -12.091 69.913   1.00 43.42  ?  391  LEU C N     1 
ATOM   6650  C  CA    . LEU C  2  391  ? 65.220  -12.931 71.093   1.00 43.95  ?  391  LEU C CA    1 
ATOM   6651  C  C     . LEU C  2  391  ? 66.446  -12.547 71.905   1.00 40.13  ?  391  LEU C C     1 
ATOM   6652  O  O     . LEU C  2  391  ? 66.677  -13.081 72.990   1.00 32.28  ?  391  LEU C O     1 
ATOM   6653  C  CB    . LEU C  2  391  ? 65.285  -14.397 70.688   1.00 38.99  ?  391  LEU C CB    1 
ATOM   6654  C  CG    . LEU C  2  391  ? 64.095  -14.811 69.829   1.00 43.16  ?  391  LEU C CG    1 
ATOM   6655  C  CD1   . LEU C  2  391  ? 64.563  -15.326 68.477   1.00 57.92  ?  391  LEU C CD1   1 
ATOM   6656  C  CD2   . LEU C  2  391  ? 63.263  -15.846 70.556   1.00 41.86  ?  391  LEU C CD2   1 
ATOM   6657  N  N     . SER C  2  392  ? 67.228  -11.616 71.372   1.00 39.54  ?  392  SER C N     1 
ATOM   6658  C  CA    . SER C  2  392  ? 68.337  -11.048 72.115   1.00 43.98  ?  392  SER C CA    1 
ATOM   6659  C  C     . SER C  2  392  ? 67.823  -9.806  72.810   1.00 48.35  ?  392  SER C C     1 
ATOM   6660  O  O     . SER C  2  392  ? 67.512  -8.805  72.163   1.00 53.28  ?  392  SER C O     1 
ATOM   6661  C  CB    . SER C  2  392  ? 69.483  -10.674 71.176   1.00 53.38  ?  392  SER C CB    1 
ATOM   6662  O  OG    . SER C  2  392  ? 70.515  -10.004 71.881   1.00 47.28  ?  392  SER C OG    1 
ATOM   6663  N  N     . GLN C  2  393  ? 67.736  -9.868  74.132   1.00 48.66  ?  393  GLN C N     1 
ATOM   6664  C  CA    . GLN C  2  393  ? 67.139  -8.778  74.887   1.00 48.15  ?  393  GLN C CA    1 
ATOM   6665  C  C     . GLN C  2  393  ? 68.112  -8.174  75.885   1.00 49.95  ?  393  GLN C C     1 
ATOM   6666  O  O     . GLN C  2  393  ? 69.005  -8.859  76.391   1.00 48.91  ?  393  GLN C O     1 
ATOM   6667  C  CB    . GLN C  2  393  ? 65.875  -9.255  75.602   1.00 36.54  ?  393  GLN C CB    1 
ATOM   6668  C  CG    . GLN C  2  393  ? 64.781  -9.723  74.659   1.00 33.33  ?  393  GLN C CG    1 
ATOM   6669  C  CD    . GLN C  2  393  ? 63.594  -10.305 75.392   1.00 32.45  ?  393  GLN C CD    1 
ATOM   6670  O  OE1   . GLN C  2  393  ? 63.620  -10.461 76.612   1.00 33.81  ?  393  GLN C OE1   1 
ATOM   6671  N  NE2   . GLN C  2  393  ? 62.542  -10.632 74.650   1.00 42.88  ?  393  GLN C NE2   1 
ATOM   6672  N  N     . PHE C  2  394  ? 67.936  -6.882  76.145   1.00 51.76  ?  394  PHE C N     1 
ATOM   6673  C  CA    . PHE C  2  394  ? 68.680  -6.190  77.182   1.00 43.50  ?  394  PHE C CA    1 
ATOM   6674  C  C     . PHE C  2  394  ? 68.415  -6.965  78.460   1.00 45.87  ?  394  PHE C C     1 
ATOM   6675  O  O     . PHE C  2  394  ? 67.260  -7.147  78.847   1.00 56.34  ?  394  PHE C O     1 
ATOM   6676  C  CB    . PHE C  2  394  ? 68.137  -4.767  77.317   1.00 47.61  ?  394  PHE C CB    1 
ATOM   6677  C  CG    . PHE C  2  394  ? 69.183  -3.732  77.615   1.00 55.00  ?  394  PHE C CG    1 
ATOM   6678  C  CD1   . PHE C  2  394  ? 70.110  -3.368  76.652   1.00 59.88  ?  394  PHE C CD1   1 
ATOM   6679  C  CD2   . PHE C  2  394  ? 69.216  -3.097  78.846   1.00 54.10  ?  394  PHE C CD2   1 
ATOM   6680  C  CE1   . PHE C  2  394  ? 71.068  -2.405  76.920   1.00 67.12  ?  394  PHE C CE1   1 
ATOM   6681  C  CE2   . PHE C  2  394  ? 70.169  -2.132  79.120   1.00 54.99  ?  394  PHE C CE2   1 
ATOM   6682  C  CZ    . PHE C  2  394  ? 71.096  -1.786  78.156   1.00 69.50  ?  394  PHE C CZ    1 
ATOM   6683  N  N     . LYS C  2  395  ? 69.474  -7.431  79.112   1.00 47.80  ?  395  LYS C N     1 
ATOM   6684  C  CA    . LYS C  2  395  ? 69.309  -8.271  80.292   1.00 47.44  ?  395  LYS C CA    1 
ATOM   6685  C  C     . LYS C  2  395  ? 68.686  -7.459  81.408   1.00 50.55  ?  395  LYS C C     1 
ATOM   6686  O  O     . LYS C  2  395  ? 69.185  -6.389  81.758   1.00 53.72  ?  395  LYS C O     1 
ATOM   6687  C  CB    . LYS C  2  395  ? 70.649  -8.843  80.757   1.00 48.83  ?  395  LYS C CB    1 
ATOM   6688  C  CG    . LYS C  2  395  ? 70.565  -9.608  82.070   1.00 41.98  ?  395  LYS C CG    1 
ATOM   6689  C  CD    . LYS C  2  395  ? 71.945  -9.998  82.577   1.00 52.49  ?  395  LYS C CD    1 
ATOM   6690  C  CE    . LYS C  2  395  ? 71.861  -10.717 83.914   1.00 52.39  ?  395  LYS C CE    1 
ATOM   6691  N  NZ    . LYS C  2  395  ? 73.206  -11.078 84.443   1.00 56.18  ?  395  LYS C NZ    1 
ATOM   6692  N  N     . ASP C  2  396  ? 67.596  -7.965  81.973   1.00 47.51  ?  396  ASP C N     1 
ATOM   6693  C  CA    . ASP C  2  396  ? 66.940  -7.241  83.043   1.00 46.51  ?  396  ASP C CA    1 
ATOM   6694  C  C     . ASP C  2  396  ? 67.489  -7.732  84.366   1.00 46.46  ?  396  ASP C C     1 
ATOM   6695  O  O     . ASP C  2  396  ? 67.177  -8.837  84.814   1.00 40.20  ?  396  ASP C O     1 
ATOM   6696  C  CB    . ASP C  2  396  ? 65.427  -7.477  82.988   1.00 48.42  ?  396  ASP C CB    1 
ATOM   6697  C  CG    . ASP C  2  396  ? 64.718  -7.076  84.275   1.00 57.63  ?  396  ASP C CG    1 
ATOM   6698  O  OD1   . ASP C  2  396  ? 65.061  -6.022  84.851   1.00 64.06  ?  396  ASP C OD1   1 
ATOM   6699  O  OD2   . ASP C  2  396  ? 63.815  -7.822  84.714   1.00 47.60  ?  396  ASP C OD2   1 
ATOM   6700  N  N     . GLU C  2  397  ? 68.319  -6.903  84.988   1.00 46.35  ?  397  GLU C N     1 
ATOM   6701  C  CA    . GLU C  2  397  ? 68.662  -7.107  86.377   1.00 48.18  ?  397  GLU C CA    1 
ATOM   6702  C  C     . GLU C  2  397  ? 68.209  -5.895  87.172   1.00 55.92  ?  397  GLU C C     1 
ATOM   6703  O  O     . GLU C  2  397  ? 68.902  -4.878  87.218   1.00 54.69  ?  397  GLU C O     1 
ATOM   6704  C  CB    . GLU C  2  397  ? 70.178  -7.275  86.499   1.00 53.17  ?  397  GLU C CB    1 
ATOM   6705  C  CG    . GLU C  2  397  ? 70.965  -6.444  85.484   1.00 55.49  ?  397  GLU C CG    1 
ATOM   6706  C  CD    . GLU C  2  397  ? 72.461  -6.695  85.536   1.00 57.45  ?  397  GLU C CD    1 
ATOM   6707  O  OE1   . GLU C  2  397  ? 72.877  -7.721  86.115   1.00 59.16  ?  397  GLU C OE1   1 
ATOM   6708  O  OE2   . GLU C  2  397  ? 73.221  -5.863  84.994   1.00 43.41  ?  397  GLU C OE2   1 
ATOM   6709  N  N     . THR C  2  398  ? 67.052  -6.002  87.814   1.00 57.74  ?  398  THR C N     1 
ATOM   6710  C  CA    . THR C  2  398  ? 66.710  -5.091  88.888   1.00 52.48  ?  398  THR C CA    1 
ATOM   6711  C  C     . THR C  2  398  ? 67.301  -5.712  90.137   1.00 43.73  ?  398  THR C C     1 
ATOM   6712  O  O     . THR C  2  398  ? 67.959  -5.057  90.942   1.00 37.28  ?  398  THR C O     1 
ATOM   6713  C  CB    . THR C  2  398  ? 65.189  -4.936  89.028   1.00 52.37  ?  398  THR C CB    1 
ATOM   6714  O  OG1   . THR C  2  398  ? 64.629  -4.552  87.765   1.00 48.67  ?  398  THR C OG1   1 
ATOM   6715  C  CG2   . THR C  2  398  ? 64.854  -3.878  90.068   1.00 50.05  ?  398  THR C CG2   1 
ATOM   6716  N  N     . ASN C  2  399  ? 67.069  -7.016  90.242   1.00 37.70  ?  399  ASN C N     1 
ATOM   6717  C  CA    . ASN C  2  399  ? 67.532  -7.852  91.334   1.00 37.69  ?  399  ASN C CA    1 
ATOM   6718  C  C     . ASN C  2  399  ? 67.816  -9.231  90.748   1.00 37.10  ?  399  ASN C C     1 
ATOM   6719  O  O     . ASN C  2  399  ? 67.308  -9.552  89.675   1.00 37.07  ?  399  ASN C O     1 
ATOM   6720  C  CB    . ASN C  2  399  ? 66.465  -7.931  92.426   1.00 34.75  ?  399  ASN C CB    1 
ATOM   6721  C  CG    . ASN C  2  399  ? 65.157  -8.491  91.918   1.00 34.61  ?  399  ASN C CG    1 
ATOM   6722  O  OD1   . ASN C  2  399  ? 64.947  -9.703  91.914   1.00 39.79  ?  399  ASN C OD1   1 
ATOM   6723  N  ND2   . ASN C  2  399  ? 64.267  -7.608  91.482   1.00 31.85  ?  399  ASN C ND2   1 
ATOM   6724  N  N     . PRO C  2  400  ? 68.636  -10.043 91.436   1.00 37.32  ?  400  PRO C N     1 
ATOM   6725  C  CA    . PRO C  2  400  ? 69.037  -11.373 90.962   1.00 40.42  ?  400  PRO C CA    1 
ATOM   6726  C  C     . PRO C  2  400  ? 67.888  -12.222 90.412   1.00 35.68  ?  400  PRO C C     1 
ATOM   6727  O  O     . PRO C  2  400  ? 68.069  -12.900 89.398   1.00 39.87  ?  400  PRO C O     1 
ATOM   6728  C  CB    . PRO C  2  400  ? 69.583  -12.037 92.231   1.00 47.17  ?  400  PRO C CB    1 
ATOM   6729  C  CG    . PRO C  2  400  ? 69.923  -10.905 93.177   1.00 51.99  ?  400  PRO C CG    1 
ATOM   6730  C  CD    . PRO C  2  400  ? 69.459  -9.610  92.577   1.00 41.50  ?  400  PRO C CD    1 
ATOM   6731  N  N     . LEU C  2  401  ? 66.730  -12.179 91.065   1.00 29.69  ?  401  LEU C N     1 
ATOM   6732  C  CA    . LEU C  2  401  ? 65.588  -12.984 90.640   1.00 32.97  ?  401  LEU C CA    1 
ATOM   6733  C  C     . LEU C  2  401  ? 65.099  -12.602 89.245   1.00 33.98  ?  401  LEU C C     1 
ATOM   6734  O  O     . LEU C  2  401  ? 64.670  -13.461 88.471   1.00 31.03  ?  401  LEU C O     1 
ATOM   6735  C  CB    . LEU C  2  401  ? 64.443  -12.879 91.647   1.00 25.25  ?  401  LEU C CB    1 
ATOM   6736  C  CG    . LEU C  2  401  ? 63.183  -13.678 91.310   1.00 22.57  ?  401  LEU C CG    1 
ATOM   6737  C  CD1   . LEU C  2  401  ? 63.498  -15.160 91.161   1.00 22.88  ?  401  LEU C CD1   1 
ATOM   6738  C  CD2   . LEU C  2  401  ? 62.118  -13.458 92.367   1.00 32.72  ?  401  LEU C CD2   1 
ATOM   6739  N  N     . SER C  2  402  ? 65.165  -11.313 88.928   1.00 31.29  ?  402  SER C N     1 
ATOM   6740  C  CA    . SER C  2  402  ? 64.755  -10.832 87.613   1.00 38.27  ?  402  SER C CA    1 
ATOM   6741  C  C     . SER C  2  402  ? 65.653  -11.397 86.514   1.00 41.05  ?  402  SER C C     1 
ATOM   6742  O  O     . SER C  2  402  ? 65.177  -11.784 85.444   1.00 46.63  ?  402  SER C O     1 
ATOM   6743  C  CB    . SER C  2  402  ? 64.740  -9.300  87.573   1.00 44.73  ?  402  SER C CB    1 
ATOM   6744  O  OG    . SER C  2  402  ? 65.918  -8.753  88.141   1.00 43.77  ?  402  SER C OG    1 
ATOM   6745  N  N     . SER C  2  403  ? 66.952  -11.447 86.791   1.00 38.45  ?  403  SER C N     1 
ATOM   6746  C  CA    . SER C  2  403  ? 67.916  -12.015 85.856   1.00 35.66  ?  403  SER C CA    1 
ATOM   6747  C  C     . SER C  2  403  ? 67.706  -13.515 85.713   1.00 31.97  ?  403  SER C C     1 
ATOM   6748  O  O     . SER C  2  403  ? 67.764  -14.057 84.610   1.00 35.80  ?  403  SER C O     1 
ATOM   6749  C  CB    . SER C  2  403  ? 69.344  -11.735 86.324   1.00 47.84  ?  403  SER C CB    1 
ATOM   6750  O  OG    . SER C  2  403  ? 69.604  -10.344 86.355   1.00 50.85  ?  403  SER C OG    1 
ATOM   6751  N  N     . LEU C  2  404  ? 67.467  -14.179 86.838   1.00 32.77  ?  404  LEU C N     1 
ATOM   6752  C  CA    . LEU C  2  404  ? 67.225  -15.616 86.842   1.00 29.96  ?  404  LEU C CA    1 
ATOM   6753  C  C     . LEU C  2  404  ? 65.987  -15.978 86.029   1.00 29.76  ?  404  LEU C C     1 
ATOM   6754  O  O     . LEU C  2  404  ? 65.967  -16.989 85.328   1.00 30.17  ?  404  LEU C O     1 
ATOM   6755  C  CB    . LEU C  2  404  ? 67.069  -16.123 88.276   1.00 35.72  ?  404  LEU C CB    1 
ATOM   6756  C  CG    . LEU C  2  404  ? 66.656  -17.587 88.433   1.00 32.30  ?  404  LEU C CG    1 
ATOM   6757  C  CD1   . LEU C  2  404  ? 67.722  -18.500 87.858   1.00 38.93  ?  404  LEU C CD1   1 
ATOM   6758  C  CD2   . LEU C  2  404  ? 66.388  -17.913 89.892   1.00 42.42  ?  404  LEU C CD2   1 
ATOM   6759  N  N     . ARG C  2  405  ? 64.952  -15.150 86.132   1.00 32.93  ?  405  ARG C N     1 
ATOM   6760  C  CA    . ARG C  2  405  ? 63.698  -15.416 85.435   1.00 40.48  ?  405  ARG C CA    1 
ATOM   6761  C  C     . ARG C  2  405  ? 63.752  -15.003 83.964   1.00 36.58  ?  405  ARG C C     1 
ATOM   6762  O  O     . ARG C  2  405  ? 63.041  -15.563 83.128   1.00 32.40  ?  405  ARG C O     1 
ATOM   6763  C  CB    . ARG C  2  405  ? 62.525  -14.737 86.150   1.00 37.45  ?  405  ARG C CB    1 
ATOM   6764  C  CG    . ARG C  2  405  ? 62.123  -13.389 85.580   1.00 33.97  ?  405  ARG C CG    1 
ATOM   6765  C  CD    . ARG C  2  405  ? 60.689  -13.430 85.083   1.00 35.14  ?  405  ARG C CD    1 
ATOM   6766  N  NE    . ARG C  2  405  ? 60.211  -12.117 84.665   1.00 35.18  ?  405  ARG C NE    1 
ATOM   6767  C  CZ    . ARG C  2  405  ? 58.941  -11.841 84.386   1.00 38.45  ?  405  ARG C CZ    1 
ATOM   6768  N  NH1   . ARG C  2  405  ? 58.019  -12.789 84.487   1.00 39.60  ?  405  ARG C NH1   1 
ATOM   6769  N  NH2   . ARG C  2  405  ? 58.592  -10.618 84.013   1.00 44.15  ?  405  ARG C NH2   1 
ATOM   6770  N  N     . HIS C  2  406  ? 64.599  -14.025 83.656   1.00 38.64  ?  406  HIS C N     1 
ATOM   6771  C  CA    . HIS C  2  406  ? 64.740  -13.533 82.289   1.00 37.68  ?  406  HIS C CA    1 
ATOM   6772  C  C     . HIS C  2  406  ? 65.300  -14.622 81.383   1.00 32.60  ?  406  HIS C C     1 
ATOM   6773  O  O     . HIS C  2  406  ? 64.962  -14.707 80.202   1.00 28.58  ?  406  HIS C O     1 
ATOM   6774  C  CB    . HIS C  2  406  ? 65.658  -12.310 82.260   1.00 28.47  ?  406  HIS C CB    1 
ATOM   6775  C  CG    . HIS C  2  406  ? 65.630  -11.564 80.964   1.00 23.52  ?  406  HIS C CG    1 
ATOM   6776  N  ND1   . HIS C  2  406  ? 66.481  -10.513 80.694   1.00 33.34  ?  406  HIS C ND1   1 
ATOM   6777  C  CD2   . HIS C  2  406  ? 64.852  -11.709 79.867   1.00 22.99  ?  406  HIS C CD2   1 
ATOM   6778  C  CE1   . HIS C  2  406  ? 66.230  -10.046 79.485   1.00 34.73  ?  406  HIS C CE1   1 
ATOM   6779  N  NE2   . HIS C  2  406  ? 65.245  -10.755 78.960   1.00 31.26  ?  406  HIS C NE2   1 
ATOM   6780  N  N     . LYS C  2  407  ? 66.161  -15.455 81.951   1.00 32.14  ?  407  LYS C N     1 
ATOM   6781  C  CA    . LYS C  2  407  ? 66.807  -16.519 81.201   1.00 35.18  ?  407  LYS C CA    1 
ATOM   6782  C  C     . LYS C  2  407  ? 65.896  -17.736 81.069   1.00 34.56  ?  407  LYS C C     1 
ATOM   6783  O  O     . LYS C  2  407  ? 66.092  -18.579 80.195   1.00 43.02  ?  407  LYS C O     1 
ATOM   6784  C  CB    . LYS C  2  407  ? 68.130  -16.893 81.871   1.00 34.49  ?  407  LYS C CB    1 
ATOM   6785  C  CG    . LYS C  2  407  ? 69.087  -15.714 81.990   1.00 36.47  ?  407  LYS C CG    1 
ATOM   6786  C  CD    . LYS C  2  407  ? 70.107  -15.912 83.097   1.00 40.41  ?  407  LYS C CD    1 
ATOM   6787  C  CE    . LYS C  2  407  ? 70.958  -14.662 83.277   1.00 38.99  ?  407  LYS C CE    1 
ATOM   6788  N  NZ    . LYS C  2  407  ? 71.874  -14.773 84.445   1.00 47.50  ?  407  LYS C NZ    1 
ATOM   6789  N  N     . ARG C  2  408  ? 64.895  -17.818 81.937   1.00 23.25  ?  408  ARG C N     1 
ATOM   6790  C  CA    . ARG C  2  408  ? 63.967  -18.943 81.924   1.00 25.44  ?  408  ARG C CA    1 
ATOM   6791  C  C     . ARG C  2  408  ? 62.701  -18.657 81.117   1.00 34.94  ?  408  ARG C C     1 
ATOM   6792  O  O     . ARG C  2  408  ? 61.775  -19.469 81.096   1.00 35.44  ?  408  ARG C O     1 
ATOM   6793  C  CB    . ARG C  2  408  ? 63.621  -19.368 83.350   1.00 30.97  ?  408  ARG C CB    1 
ATOM   6794  C  CG    . ARG C  2  408  ? 64.824  -19.845 84.146   1.00 33.08  ?  408  ARG C CG    1 
ATOM   6795  C  CD    . ARG C  2  408  ? 64.440  -20.221 85.567   1.00 33.54  ?  408  ARG C CD    1 
ATOM   6796  N  NE    . ARG C  2  408  ? 63.405  -21.250 85.597   1.00 32.92  ?  408  ARG C NE    1 
ATOM   6797  C  CZ    . ARG C  2  408  ? 63.649  -22.555 85.607   1.00 36.15  ?  408  ARG C CZ    1 
ATOM   6798  N  NH1   . ARG C  2  408  ? 64.898  -22.998 85.590   1.00 39.32  ?  408  ARG C NH1   1 
ATOM   6799  N  NH2   . ARG C  2  408  ? 62.645  -23.420 85.636   1.00 35.81  ?  408  ARG C NH2   1 
ATOM   6800  N  N     . ARG C  2  409  ? 62.661  -17.497 80.467   1.00 37.55  ?  409  ARG C N     1 
ATOM   6801  C  CA    . ARG C  2  409  ? 61.516  -17.110 79.642   1.00 40.88  ?  409  ARG C CA    1 
ATOM   6802  C  C     . ARG C  2  409  ? 61.341  -18.020 78.428   1.00 40.69  ?  409  ARG C C     1 
ATOM   6803  O  O     . ARG C  2  409  ? 62.317  -18.452 77.814   1.00 41.97  ?  409  ARG C O     1 
ATOM   6804  C  CB    . ARG C  2  409  ? 61.656  -15.661 79.165   1.00 42.21  ?  409  ARG C CB    1 
ATOM   6805  C  CG    . ARG C  2  409  ? 61.713  -14.619 80.273   1.00 53.84  ?  409  ARG C CG    1 
ATOM   6806  C  CD    . ARG C  2  409  ? 60.423  -13.813 80.362   1.00 47.40  ?  409  ARG C CD    1 
ATOM   6807  N  NE    . ARG C  2  409  ? 59.329  -14.581 80.952   1.00 53.31  ?  409  ARG C NE    1 
ATOM   6808  C  CZ    . ARG C  2  409  ? 58.143  -14.070 81.265   1.00 47.57  ?  409  ARG C CZ    1 
ATOM   6809  N  NH1   . ARG C  2  409  ? 57.893  -12.785 81.044   1.00 42.26  ?  409  ARG C NH1   1 
ATOM   6810  N  NH2   . ARG C  2  409  ? 57.206  -14.843 81.800   1.00 41.92  ?  409  ARG C NH2   1 
ATOM   6811  N  N     . ILE C  2  410  ? 60.087  -18.298 78.084   1.00 40.11  ?  410  ILE C N     1 
ATOM   6812  C  CA    . ILE C  2  410  ? 59.757  -19.068 76.890   1.00 33.78  ?  410  ILE C CA    1 
ATOM   6813  C  C     . ILE C  2  410  ? 58.828  -18.256 75.992   1.00 39.37  ?  410  ILE C C     1 
ATOM   6814  O  O     . ILE C  2  410  ? 57.700  -17.948 76.375   1.00 43.86  ?  410  ILE C O     1 
ATOM   6815  C  CB    . ILE C  2  410  ? 59.069  -20.395 77.249   1.00 27.91  ?  410  ILE C CB    1 
ATOM   6816  C  CG1   . ILE C  2  410  ? 59.983  -21.250 78.127   1.00 27.10  ?  410  ILE C CG1   1 
ATOM   6817  C  CG2   . ILE C  2  410  ? 58.678  -21.146 75.991   1.00 26.39  ?  410  ILE C CG2   1 
ATOM   6818  C  CD1   . ILE C  2  410  ? 59.377  -22.579 78.519   1.00 26.52  ?  410  ILE C CD1   1 
ATOM   6819  N  N     . SER C  2  411  ? 59.301  -17.914 74.798   1.00 39.42  ?  411  SER C N     1 
ATOM   6820  C  CA    . SER C  2  411  ? 58.548  -17.045 73.897   1.00 34.93  ?  411  SER C CA    1 
ATOM   6821  C  C     . SER C  2  411  ? 58.069  -17.754 72.632   1.00 35.77  ?  411  SER C C     1 
ATOM   6822  O  O     . SER C  2  411  ? 58.780  -18.579 72.063   1.00 41.48  ?  411  SER C O     1 
ATOM   6823  C  CB    . SER C  2  411  ? 59.387  -15.826 73.512   1.00 29.36  ?  411  SER C CB    1 
ATOM   6824  O  OG    . SER C  2  411  ? 58.733  -15.057 72.519   1.00 31.74  ?  411  SER C OG    1 
ATOM   6825  N  N     . ALA C  2  412  ? 56.855  -17.428 72.202   1.00 38.51  ?  412  ALA C N     1 
ATOM   6826  C  CA    . ALA C  2  412  ? 56.336  -17.926 70.935   1.00 36.47  ?  412  ALA C CA    1 
ATOM   6827  C  C     . ALA C  2  412  ? 56.548  -16.894 69.833   1.00 46.36  ?  412  ALA C C     1 
ATOM   6828  O  O     . ALA C  2  412  ? 56.221  -17.135 68.671   1.00 52.86  ?  412  ALA C O     1 
ATOM   6829  C  CB    . ALA C  2  412  ? 54.864  -18.273 71.063   1.00 34.44  ?  412  ALA C CB    1 
ATOM   6830  N  N     . LEU C  2  413  ? 57.104  -15.745 70.208   1.00 43.84  ?  413  LEU C N     1 
ATOM   6831  C  CA    . LEU C  2  413  ? 57.337  -14.651 69.269   1.00 44.32  ?  413  LEU C CA    1 
ATOM   6832  C  C     . LEU C  2  413  ? 58.717  -14.747 68.626   1.00 53.10  ?  413  LEU C C     1 
ATOM   6833  O  O     . LEU C  2  413  ? 59.420  -15.742 68.792   1.00 60.06  ?  413  LEU C O     1 
ATOM   6834  C  CB    . LEU C  2  413  ? 57.195  -13.303 69.977   1.00 52.67  ?  413  LEU C CB    1 
ATOM   6835  C  CG    . LEU C  2  413  ? 55.840  -12.990 70.613   1.00 54.03  ?  413  LEU C CG    1 
ATOM   6836  C  CD1   . LEU C  2  413  ? 55.870  -11.626 71.289   1.00 50.51  ?  413  LEU C CD1   1 
ATOM   6837  C  CD2   . LEU C  2  413  ? 54.735  -13.052 69.571   1.00 58.32  ?  413  LEU C CD2   1 
ATOM   6838  N  N     . GLY C  2  414  ? 59.096  -13.706 67.891   1.00 54.31  ?  414  GLY C N     1 
ATOM   6839  C  CA    . GLY C  2  414  ? 60.402  -13.652 67.258   1.00 60.20  ?  414  GLY C CA    1 
ATOM   6840  C  C     . GLY C  2  414  ? 60.432  -14.282 65.878   1.00 76.94  ?  414  GLY C C     1 
ATOM   6841  O  O     . GLY C  2  414  ? 59.422  -14.810 65.409   1.00 73.70  ?  414  GLY C O     1 
ATOM   6842  N  N     . PRO C  2  415  ? 61.598  -14.224 65.213   1.00 77.88  ?  415  PRO C N     1 
ATOM   6843  C  CA    . PRO C  2  415  ? 61.798  -14.815 63.885   1.00 68.18  ?  415  PRO C CA    1 
ATOM   6844  C  C     . PRO C  2  415  ? 61.600  -16.328 63.902   1.00 68.92  ?  415  PRO C C     1 
ATOM   6845  O  O     . PRO C  2  415  ? 62.149  -17.013 64.766   1.00 64.69  ?  415  PRO C O     1 
ATOM   6846  C  CB    . PRO C  2  415  ? 63.261  -14.482 63.572   1.00 67.12  ?  415  PRO C CB    1 
ATOM   6847  C  CG    . PRO C  2  415  ? 63.579  -13.304 64.431   1.00 59.81  ?  415  PRO C CG    1 
ATOM   6848  C  CD    . PRO C  2  415  ? 62.801  -13.520 65.688   1.00 66.29  ?  415  PRO C CD    1 
ATOM   6849  N  N     . GLY C  2  416  ? 60.821  -16.838 62.954   1.00 73.86  ?  416  GLY C N     1 
ATOM   6850  C  CA    . GLY C  2  416  ? 60.533  -18.259 62.883   1.00 73.33  ?  416  GLY C CA    1 
ATOM   6851  C  C     . GLY C  2  416  ? 59.325  -18.644 63.716   1.00 73.91  ?  416  GLY C C     1 
ATOM   6852  O  O     . GLY C  2  416  ? 58.813  -19.759 63.610   1.00 64.12  ?  416  GLY C O     1 
ATOM   6853  N  N     . GLY C  2  417  ? 58.873  -17.714 64.552   1.00 72.53  ?  417  GLY C N     1 
ATOM   6854  C  CA    . GLY C  2  417  ? 57.728  -17.949 65.411   1.00 73.53  ?  417  GLY C CA    1 
ATOM   6855  C  C     . GLY C  2  417  ? 56.486  -17.202 64.965   1.00 80.37  ?  417  GLY C C     1 
ATOM   6856  O  O     . GLY C  2  417  ? 56.420  -16.691 63.846   1.00 70.41  ?  417  GLY C O     1 
ATOM   6857  N  N     . LEU C  2  418  ? 55.499  -17.133 65.853   1.00 78.42  ?  418  LEU C N     1 
ATOM   6858  C  CA    . LEU C  2  418  ? 54.236  -16.470 65.555   1.00 64.28  ?  418  LEU C CA    1 
ATOM   6859  C  C     . LEU C  2  418  ? 54.380  -14.955 65.521   1.00 69.88  ?  418  LEU C C     1 
ATOM   6860  O  O     . LEU C  2  418  ? 55.284  -14.389 66.136   1.00 67.01  ?  418  LEU C O     1 
ATOM   6861  C  CB    . LEU C  2  418  ? 53.178  -16.843 66.596   1.00 49.91  ?  418  LEU C CB    1 
ATOM   6862  C  CG    . LEU C  2  418  ? 52.744  -18.305 66.675   1.00 59.93  ?  418  LEU C CG    1 
ATOM   6863  C  CD1   . LEU C  2  418  ? 51.729  -18.495 67.791   1.00 53.67  ?  418  LEU C CD1   1 
ATOM   6864  C  CD2   . LEU C  2  418  ? 52.173  -18.764 65.343   1.00 66.36  ?  418  LEU C CD2   1 
ATOM   6865  N  N     . THR C  2  419  ? 53.478  -14.309 64.792   1.00 81.14  ?  419  THR C N     1 
ATOM   6866  C  CA    . THR C  2  419  ? 53.354  -12.860 64.823   1.00 83.85  ?  419  THR C CA    1 
ATOM   6867  C  C     . THR C  2  419  ? 52.115  -12.537 65.648   1.00 84.69  ?  419  THR C C     1 
ATOM   6868  O  O     . THR C  2  419  ? 51.134  -13.282 65.616   1.00 80.03  ?  419  THR C O     1 
ATOM   6869  C  CB    . THR C  2  419  ? 53.209  -12.271 63.402   1.00 88.41  ?  419  THR C CB    1 
ATOM   6870  O  OG1   . THR C  2  419  ? 54.275  -12.749 62.571   1.00 82.18  ?  419  THR C OG1   1 
ATOM   6871  C  CG2   . THR C  2  419  ? 53.245  -10.748 63.439   1.00 71.33  ?  419  THR C CG2   1 
ATOM   6872  N  N     . ARG C  2  420  ? 52.162  -11.442 66.401   1.00 89.12  ?  420  ARG C N     1 
ATOM   6873  C  CA    . ARG C  2  420  ? 51.040  -11.057 67.248   1.00 82.76  ?  420  ARG C CA    1 
ATOM   6874  C  C     . ARG C  2  420  ? 49.838  -10.687 66.385   1.00 96.03  ?  420  ARG C C     1 
ATOM   6875  O  O     . ARG C  2  420  ? 49.992  -10.384 65.200   1.00 110.57 ?  420  ARG C O     1 
ATOM   6876  C  CB    . ARG C  2  420  ? 51.424  -9.889  68.158   1.00 73.49  ?  420  ARG C CB    1 
ATOM   6877  C  CG    . ARG C  2  420  ? 50.531  -9.734  69.379   1.00 70.63  ?  420  ARG C CG    1 
ATOM   6878  C  CD    . ARG C  2  420  ? 50.884  -8.482  70.157   1.00 67.88  ?  420  ARG C CD    1 
ATOM   6879  N  NE    . ARG C  2  420  ? 52.311  -8.421  70.459   1.00 73.58  ?  420  ARG C NE    1 
ATOM   6880  C  CZ    . ARG C  2  420  ? 52.897  -7.408  71.089   1.00 82.40  ?  420  ARG C CZ    1 
ATOM   6881  N  NH1   . ARG C  2  420  ? 54.203  -7.436  71.321   1.00 88.18  ?  420  ARG C NH1   1 
ATOM   6882  N  NH2   . ARG C  2  420  ? 52.178  -6.366  71.486   1.00 73.03  ?  420  ARG C NH2   1 
ATOM   6883  N  N     . GLU C  2  421  ? 48.648  -10.747 66.983   1.00 90.90  ?  421  GLU C N     1 
ATOM   6884  C  CA    . GLU C  2  421  ? 47.369  -10.511 66.302   1.00 99.80  ?  421  GLU C CA    1 
ATOM   6885  C  C     . GLU C  2  421  ? 47.017  -11.631 65.321   1.00 99.53  ?  421  GLU C C     1 
ATOM   6886  O  O     . GLU C  2  421  ? 45.886  -11.716 64.841   1.00 100.95 ?  421  GLU C O     1 
ATOM   6887  C  CB    . GLU C  2  421  ? 47.338  -9.146  65.603   1.00 103.95 ?  421  GLU C CB    1 
ATOM   6888  C  CG    . GLU C  2  421  ? 47.690  -7.974  66.505   1.00 106.60 ?  421  GLU C CG    1 
ATOM   6889  C  CD    . GLU C  2  421  ? 47.916  -6.692  65.728   1.00 120.39 ?  421  GLU C CD    1 
ATOM   6890  O  OE1   . GLU C  2  421  ? 48.236  -5.661  66.357   1.00 119.53 ?  421  GLU C OE1   1 
ATOM   6891  O  OE2   . GLU C  2  421  ? 47.776  -6.715  64.486   1.00 106.96 ?  421  GLU C OE2   1 
ATOM   6892  N  N     . ARG C  2  422  ? 47.994  -12.484 65.027   1.00 94.40  ?  422  ARG C N     1 
ATOM   6893  C  CA    . ARG C  2  422  ? 47.763  -13.688 64.244   1.00 95.47  ?  422  ARG C CA    1 
ATOM   6894  C  C     . ARG C  2  422  ? 47.586  -14.852 65.206   1.00 99.84  ?  422  ARG C C     1 
ATOM   6895  O  O     . ARG C  2  422  ? 47.332  -15.984 64.794   1.00 101.71 ?  422  ARG C O     1 
ATOM   6896  C  CB    . ARG C  2  422  ? 48.948  -13.960 63.316   1.00 91.61  ?  422  ARG C CB    1 
ATOM   6897  C  CG    . ARG C  2  422  ? 49.558  -12.713 62.695   1.00 93.00  ?  422  ARG C CG    1 
ATOM   6898  C  CD    . ARG C  2  422  ? 48.561  -11.970 61.823   1.00 99.74  ?  422  ARG C CD    1 
ATOM   6899  N  NE    . ARG C  2  422  ? 49.125  -10.734 61.290   1.00 101.65 ?  422  ARG C NE    1 
ATOM   6900  C  CZ    . ARG C  2  422  ? 49.792  -10.650 60.144   1.00 105.39 ?  422  ARG C CZ    1 
ATOM   6901  N  NH1   . ARG C  2  422  ? 49.982  -11.734 59.405   1.00 106.96 ?  422  ARG C NH1   1 
ATOM   6902  N  NH2   . ARG C  2  422  ? 50.271  -9.482  59.736   1.00 104.31 ?  422  ARG C NH2   1 
ATOM   6903  N  N     . ALA C  2  423  ? 47.726  -14.559 66.496   1.00 91.53  ?  423  ALA C N     1 
ATOM   6904  C  CA    . ALA C  2  423  ? 47.649  -15.580 67.532   1.00 81.72  ?  423  ALA C CA    1 
ATOM   6905  C  C     . ALA C  2  423  ? 46.249  -15.671 68.129   1.00 76.10  ?  423  ALA C C     1 
ATOM   6906  O  O     . ALA C  2  423  ? 45.786  -14.746 68.799   1.00 63.69  ?  423  ALA C O     1 
ATOM   6907  C  CB    . ALA C  2  423  ? 48.674  -15.303 68.622   1.00 60.76  ?  423  ALA C CB    1 
ATOM   6908  N  N     . GLY C  2  424  ? 45.582  -16.794 67.883   1.00 79.73  ?  424  GLY C N     1 
ATOM   6909  C  CA    . GLY C  2  424  ? 44.254  -17.028 68.417   1.00 81.61  ?  424  GLY C CA    1 
ATOM   6910  C  C     . GLY C  2  424  ? 44.311  -17.562 69.834   1.00 79.97  ?  424  GLY C C     1 
ATOM   6911  O  O     . GLY C  2  424  ? 45.381  -17.621 70.437   1.00 76.67  ?  424  GLY C O     1 
ATOM   6912  N  N     . PHE C  2  425  ? 43.159  -17.958 70.363   1.00 74.29  ?  425  PHE C N     1 
ATOM   6913  C  CA    . PHE C  2  425  ? 43.079  -18.476 71.724   1.00 66.38  ?  425  PHE C CA    1 
ATOM   6914  C  C     . PHE C  2  425  ? 43.842  -19.788 71.879   1.00 62.96  ?  425  PHE C C     1 
ATOM   6915  O  O     . PHE C  2  425  ? 44.300  -20.121 72.972   1.00 64.64  ?  425  PHE C O     1 
ATOM   6916  C  CB    . PHE C  2  425  ? 41.618  -18.673 72.136   1.00 67.94  ?  425  PHE C CB    1 
ATOM   6917  C  CG    . PHE C  2  425  ? 40.818  -17.402 72.157   1.00 66.75  ?  425  PHE C CG    1 
ATOM   6918  C  CD1   . PHE C  2  425  ? 40.164  -16.961 71.019   1.00 71.26  ?  425  PHE C CD1   1 
ATOM   6919  C  CD2   . PHE C  2  425  ? 40.720  -16.649 73.314   1.00 67.10  ?  425  PHE C CD2   1 
ATOM   6920  C  CE1   . PHE C  2  425  ? 39.428  -15.792 71.035   1.00 77.97  ?  425  PHE C CE1   1 
ATOM   6921  C  CE2   . PHE C  2  425  ? 39.985  -15.479 73.337   1.00 61.93  ?  425  PHE C CE2   1 
ATOM   6922  C  CZ    . PHE C  2  425  ? 39.338  -15.051 72.196   1.00 65.74  ?  425  PHE C CZ    1 
ATOM   6923  N  N     . ASP C  2  426  ? 43.979  -20.521 70.778   1.00 60.82  ?  426  ASP C N     1 
ATOM   6924  C  CA    . ASP C  2  426  ? 44.585  -21.850 70.792   1.00 59.57  ?  426  ASP C CA    1 
ATOM   6925  C  C     . ASP C  2  426  ? 46.006  -21.869 71.351   1.00 54.19  ?  426  ASP C C     1 
ATOM   6926  O  O     . ASP C  2  426  ? 46.314  -22.652 72.251   1.00 55.59  ?  426  ASP C O     1 
ATOM   6927  C  CB    . ASP C  2  426  ? 44.567  -22.460 69.387   1.00 68.42  ?  426  ASP C CB    1 
ATOM   6928  C  CG    . ASP C  2  426  ? 43.160  -22.662 68.858   1.00 80.52  ?  426  ASP C CG    1 
ATOM   6929  O  OD1   . ASP C  2  426  ? 42.222  -22.750 69.678   1.00 85.00  ?  426  ASP C OD1   1 
ATOM   6930  O  OD2   . ASP C  2  426  ? 42.992  -22.739 67.622   1.00 71.21  ?  426  ASP C OD2   1 
ATOM   6931  N  N     . VAL C  2  427  ? 46.867  -21.006 70.820   1.00 47.37  ?  427  VAL C N     1 
ATOM   6932  C  CA    . VAL C  2  427  ? 48.270  -20.984 71.226   1.00 48.73  ?  427  VAL C CA    1 
ATOM   6933  C  C     . VAL C  2  427  ? 48.486  -20.322 72.586   1.00 47.08  ?  427  VAL C C     1 
ATOM   6934  O  O     . VAL C  2  427  ? 49.446  -20.636 73.290   1.00 42.00  ?  427  VAL C O     1 
ATOM   6935  C  CB    . VAL C  2  427  ? 49.160  -20.286 70.173   1.00 44.24  ?  427  VAL C CB    1 
ATOM   6936  C  CG1   . VAL C  2  427  ? 49.270  -21.139 68.919   1.00 60.64  ?  427  VAL C CG1   1 
ATOM   6937  C  CG2   . VAL C  2  427  ? 48.617  -18.904 69.844   1.00 50.45  ?  427  VAL C CG2   1 
ATOM   6938  N  N     . ARG C  2  428  ? 47.590  -19.410 72.952   1.00 49.43  ?  428  ARG C N     1 
ATOM   6939  C  CA    . ARG C  2  428  ? 47.727  -18.662 74.197   1.00 40.26  ?  428  ARG C CA    1 
ATOM   6940  C  C     . ARG C  2  428  ? 47.133  -19.433 75.367   1.00 39.65  ?  428  ARG C C     1 
ATOM   6941  O  O     . ARG C  2  428  ? 47.371  -19.101 76.528   1.00 39.52  ?  428  ARG C O     1 
ATOM   6942  C  CB    . ARG C  2  428  ? 47.046  -17.300 74.072   1.00 32.83  ?  428  ARG C CB    1 
ATOM   6943  C  CG    . ARG C  2  428  ? 47.279  -16.623 72.735   1.00 42.86  ?  428  ARG C CG    1 
ATOM   6944  C  CD    . ARG C  2  428  ? 46.508  -15.324 72.639   1.00 36.85  ?  428  ARG C CD    1 
ATOM   6945  N  NE    . ARG C  2  428  ? 47.163  -14.260 73.390   1.00 34.39  ?  428  ARG C NE    1 
ATOM   6946  C  CZ    . ARG C  2  428  ? 47.753  -13.210 72.833   1.00 31.24  ?  428  ARG C CZ    1 
ATOM   6947  N  NH1   . ARG C  2  428  ? 47.759  -13.072 71.513   1.00 25.00  ?  428  ARG C NH1   1 
ATOM   6948  N  NH2   . ARG C  2  428  ? 48.327  -12.292 73.598   1.00 30.89  ?  428  ARG C NH2   1 
ATOM   6949  N  N     . ASP C  2  429  ? 46.373  -20.476 75.051   1.00 34.45  ?  429  ASP C N     1 
ATOM   6950  C  CA    . ASP C  2  429  ? 45.715  -21.287 76.065   1.00 37.80  ?  429  ASP C CA    1 
ATOM   6951  C  C     . ASP C  2  429  ? 46.721  -22.039 76.920   1.00 38.27  ?  429  ASP C C     1 
ATOM   6952  O  O     . ASP C  2  429  ? 47.878  -22.207 76.536   1.00 44.00  ?  429  ASP C O     1 
ATOM   6953  C  CB    . ASP C  2  429  ? 44.763  -22.292 75.411   1.00 48.30  ?  429  ASP C CB    1 
ATOM   6954  C  CG    . ASP C  2  429  ? 43.332  -21.799 75.369   1.00 60.83  ?  429  ASP C CG    1 
ATOM   6955  O  OD1   . ASP C  2  429  ? 42.919  -21.088 76.310   1.00 61.93  ?  429  ASP C OD1   1 
ATOM   6956  O  OD2   . ASP C  2  429  ? 42.619  -22.125 74.396   1.00 66.47  ?  429  ASP C OD2   1 
ATOM   6957  N  N     . VAL C  2  430  ? 46.276  -22.477 78.091   1.00 38.86  ?  430  VAL C N     1 
ATOM   6958  C  CA    . VAL C  2  430  ? 47.071  -23.373 78.913   1.00 35.45  ?  430  VAL C CA    1 
ATOM   6959  C  C     . VAL C  2  430  ? 46.675  -24.803 78.570   1.00 39.06  ?  430  VAL C C     1 
ATOM   6960  O  O     . VAL C  2  430  ? 45.555  -25.232 78.851   1.00 37.55  ?  430  VAL C O     1 
ATOM   6961  C  CB    . VAL C  2  430  ? 46.839  -23.118 80.411   1.00 29.20  ?  430  VAL C CB    1 
ATOM   6962  C  CG1   . VAL C  2  430  ? 47.501  -24.201 81.247   1.00 33.45  ?  430  VAL C CG1   1 
ATOM   6963  C  CG2   . VAL C  2  430  ? 47.360  -21.743 80.798   1.00 33.34  ?  430  VAL C CG2   1 
ATOM   6964  N  N     . HIS C  2  431  ? 47.592  -25.533 77.945   1.00 38.37  ?  431  HIS C N     1 
ATOM   6965  C  CA    . HIS C  2  431  ? 47.323  -26.905 77.535   1.00 43.74  ?  431  HIS C CA    1 
ATOM   6966  C  C     . HIS C  2  431  ? 47.461  -27.848 78.725   1.00 41.79  ?  431  HIS C C     1 
ATOM   6967  O  O     . HIS C  2  431  ? 48.232  -27.584 79.648   1.00 38.83  ?  431  HIS C O     1 
ATOM   6968  C  CB    . HIS C  2  431  ? 48.268  -27.326 76.405   1.00 45.84  ?  431  HIS C CB    1 
ATOM   6969  C  CG    . HIS C  2  431  ? 47.735  -28.431 75.547   1.00 50.06  ?  431  HIS C CG    1 
ATOM   6970  N  ND1   . HIS C  2  431  ? 47.627  -29.734 75.988   1.00 51.53  ?  431  HIS C ND1   1 
ATOM   6971  C  CD2   . HIS C  2  431  ? 47.285  -28.430 74.270   1.00 56.54  ?  431  HIS C CD2   1 
ATOM   6972  C  CE1   . HIS C  2  431  ? 47.130  -30.484 75.023   1.00 53.04  ?  431  HIS C CE1   1 
ATOM   6973  N  NE2   . HIS C  2  431  ? 46.913  -29.718 73.968   1.00 57.72  ?  431  HIS C NE2   1 
ATOM   6974  N  N     . ARG C  2  432  ? 46.715  -28.948 78.693   1.00 38.71  ?  432  ARG C N     1 
ATOM   6975  C  CA    . ARG C  2  432  ? 46.745  -29.943 79.761   1.00 37.37  ?  432  ARG C CA    1 
ATOM   6976  C  C     . ARG C  2  432  ? 48.134  -30.557 79.944   1.00 42.71  ?  432  ARG C C     1 
ATOM   6977  O  O     . ARG C  2  432  ? 48.424  -31.160 80.977   1.00 43.07  ?  432  ARG C O     1 
ATOM   6978  C  CB    . ARG C  2  432  ? 45.733  -31.049 79.473   1.00 38.96  ?  432  ARG C CB    1 
ATOM   6979  C  CG    . ARG C  2  432  ? 46.006  -31.794 78.179   1.00 47.52  ?  432  ARG C CG    1 
ATOM   6980  C  CD    . ARG C  2  432  ? 45.109  -33.008 78.036   1.00 58.33  ?  432  ARG C CD    1 
ATOM   6981  N  NE    . ARG C  2  432  ? 45.474  -33.820 76.878   1.00 64.02  ?  432  ARG C NE    1 
ATOM   6982  C  CZ    . ARG C  2  432  ? 46.440  -34.733 76.881   1.00 67.59  ?  432  ARG C CZ    1 
ATOM   6983  N  NH1   . ARG C  2  432  ? 47.146  -34.949 77.983   1.00 69.66  ?  432  ARG C NH1   1 
ATOM   6984  N  NH2   . ARG C  2  432  ? 46.703  -35.427 75.782   1.00 66.60  ?  432  ARG C NH2   1 
ATOM   6985  N  N     . THR C  2  433  ? 48.986  -30.406 78.934   1.00 43.23  ?  433  THR C N     1 
ATOM   6986  C  CA    . THR C  2  433  ? 50.336  -30.952 78.979   1.00 38.94  ?  433  THR C CA    1 
ATOM   6987  C  C     . THR C  2  433  ? 51.348  -29.936 79.498   1.00 41.43  ?  433  THR C C     1 
ATOM   6988  O  O     . THR C  2  433  ? 52.543  -30.220 79.556   1.00 48.49  ?  433  THR C O     1 
ATOM   6989  C  CB    . THR C  2  433  ? 50.796  -31.454 77.595   1.00 43.29  ?  433  THR C CB    1 
ATOM   6990  O  OG1   . THR C  2  433  ? 50.848  -30.358 76.673   1.00 35.85  ?  433  THR C OG1   1 
ATOM   6991  C  CG2   . THR C  2  433  ? 49.841  -32.513 77.071   1.00 49.97  ?  433  THR C CG2   1 
ATOM   6992  N  N     . HIS C  2  434  ? 50.871  -28.752 79.873   1.00 37.58  ?  434  HIS C N     1 
ATOM   6993  C  CA    . HIS C  2  434  ? 51.744  -27.739 80.458   1.00 39.46  ?  434  HIS C CA    1 
ATOM   6994  C  C     . HIS C  2  434  ? 52.072  -28.075 81.909   1.00 38.46  ?  434  HIS C C     1 
ATOM   6995  O  O     . HIS C  2  434  ? 52.893  -27.407 82.541   1.00 31.25  ?  434  HIS C O     1 
ATOM   6996  C  CB    . HIS C  2  434  ? 51.113  -26.349 80.370   1.00 40.78  ?  434  HIS C CB    1 
ATOM   6997  C  CG    . HIS C  2  434  ? 51.188  -25.737 79.003   1.00 42.31  ?  434  HIS C CG    1 
ATOM   6998  N  ND1   . HIS C  2  434  ? 51.294  -24.376 78.807   1.00 43.65  ?  434  HIS C ND1   1 
ATOM   6999  C  CD2   . HIS C  2  434  ? 51.173  -26.298 77.776   1.00 43.50  ?  434  HIS C CD2   1 
ATOM   7000  C  CE1   . HIS C  2  434  ? 51.340  -24.128 77.510   1.00 43.35  ?  434  HIS C CE1   1 
ATOM   7001  N  NE2   . HIS C  2  434  ? 51.267  -25.273 76.860   1.00 38.99  ?  434  HIS C NE2   1 
ATOM   7002  N  N     . TYR C  2  435  ? 51.415  -29.109 82.427   1.00 32.37  ?  435  TYR C N     1 
ATOM   7003  C  CA    . TYR C  2  435  ? 51.647  -29.582 83.784   1.00 30.68  ?  435  TYR C CA    1 
ATOM   7004  C  C     . TYR C  2  435  ? 53.117  -29.947 83.966   1.00 37.57  ?  435  TYR C C     1 
ATOM   7005  O  O     . TYR C  2  435  ? 53.662  -30.764 83.226   1.00 37.04  ?  435  TYR C O     1 
ATOM   7006  C  CB    . TYR C  2  435  ? 50.770  -30.807 84.052   1.00 28.24  ?  435  TYR C CB    1 
ATOM   7007  C  CG    . TYR C  2  435  ? 50.585  -31.161 85.513   1.00 36.48  ?  435  TYR C CG    1 
ATOM   7008  C  CD1   . TYR C  2  435  ? 51.655  -31.582 86.291   1.00 44.21  ?  435  TYR C CD1   1 
ATOM   7009  C  CD2   . TYR C  2  435  ? 49.331  -31.102 86.105   1.00 37.82  ?  435  TYR C CD2   1 
ATOM   7010  C  CE1   . TYR C  2  435  ? 51.486  -31.916 87.621   1.00 41.44  ?  435  TYR C CE1   1 
ATOM   7011  C  CE2   . TYR C  2  435  ? 49.151  -31.436 87.435   1.00 41.93  ?  435  TYR C CE2   1 
ATOM   7012  C  CZ    . TYR C  2  435  ? 50.232  -31.843 88.187   1.00 40.29  ?  435  TYR C CZ    1 
ATOM   7013  O  OH    . TYR C  2  435  ? 50.061  -32.177 89.511   1.00 46.39  ?  435  TYR C OH    1 
ATOM   7014  N  N     . GLY C  2  436  ? 53.754  -29.335 84.959   1.00 43.65  ?  436  GLY C N     1 
ATOM   7015  C  CA    . GLY C  2  436  ? 55.139  -29.631 85.279   1.00 45.41  ?  436  GLY C CA    1 
ATOM   7016  C  C     . GLY C  2  436  ? 56.157  -29.055 84.312   1.00 41.15  ?  436  GLY C C     1 
ATOM   7017  O  O     . GLY C  2  436  ? 57.359  -29.097 84.573   1.00 49.72  ?  436  GLY C O     1 
ATOM   7018  N  N     . ARG C  2  437  ? 55.681  -28.507 83.199   1.00 27.40  ?  437  ARG C N     1 
ATOM   7019  C  CA    . ARG C  2  437  ? 56.564  -28.038 82.136   1.00 33.92  ?  437  ARG C CA    1 
ATOM   7020  C  C     . ARG C  2  437  ? 56.555  -26.519 81.997   1.00 41.95  ?  437  ARG C C     1 
ATOM   7021  O  O     . ARG C  2  437  ? 57.581  -25.860 82.175   1.00 34.77  ?  437  ARG C O     1 
ATOM   7022  C  CB    . ARG C  2  437  ? 56.192  -28.705 80.811   1.00 39.28  ?  437  ARG C CB    1 
ATOM   7023  C  CG    . ARG C  2  437  ? 56.413  -30.205 80.822   1.00 43.36  ?  437  ARG C CG    1 
ATOM   7024  C  CD    . ARG C  2  437  ? 55.827  -30.887 79.602   1.00 41.02  ?  437  ARG C CD    1 
ATOM   7025  N  NE    . ARG C  2  437  ? 55.893  -32.339 79.733   1.00 38.61  ?  437  ARG C NE    1 
ATOM   7026  C  CZ    . ARG C  2  437  ? 54.989  -33.068 80.378   1.00 43.35  ?  437  ARG C CZ    1 
ATOM   7027  N  NH1   . ARG C  2  437  ? 53.946  -32.482 80.947   1.00 39.36  ?  437  ARG C NH1   1 
ATOM   7028  N  NH2   . ARG C  2  437  ? 55.125  -34.384 80.457   1.00 53.78  ?  437  ARG C NH2   1 
ATOM   7029  N  N     . ILE C  2  438  ? 55.396  -25.971 81.653   1.00 48.79  ?  438  ILE C N     1 
ATOM   7030  C  CA    . ILE C  2  438  ? 55.238  -24.528 81.538   1.00 40.02  ?  438  ILE C CA    1 
ATOM   7031  C  C     . ILE C  2  438  ? 54.291  -24.011 82.619   1.00 39.61  ?  438  ILE C C     1 
ATOM   7032  O  O     . ILE C  2  438  ? 53.253  -24.618 82.890   1.00 36.01  ?  438  ILE C O     1 
ATOM   7033  C  CB    . ILE C  2  438  ? 54.734  -24.131 80.135   1.00 45.17  ?  438  ILE C CB    1 
ATOM   7034  C  CG1   . ILE C  2  438  ? 55.816  -24.406 79.089   1.00 43.18  ?  438  ILE C CG1   1 
ATOM   7035  C  CG2   . ILE C  2  438  ? 54.341  -22.670 80.096   1.00 47.79  ?  438  ILE C CG2   1 
ATOM   7036  C  CD1   . ILE C  2  438  ? 55.446  -23.959 77.693   1.00 38.57  ?  438  ILE C CD1   1 
ATOM   7037  N  N     . CYS C  2  439  ? 54.662  -22.897 83.241   1.00 39.16  ?  439  CYS C N     1 
ATOM   7038  C  CA    . CYS C  2  439  ? 53.879  -22.324 84.330   1.00 39.85  ?  439  CYS C CA    1 
ATOM   7039  C  C     . CYS C  2  439  ? 52.541  -21.769 83.849   1.00 37.40  ?  439  CYS C C     1 
ATOM   7040  O  O     . CYS C  2  439  ? 52.505  -20.881 82.995   1.00 34.20  ?  439  CYS C O     1 
ATOM   7041  C  CB    . CYS C  2  439  ? 54.676  -21.224 85.031   1.00 40.72  ?  439  CYS C CB    1 
ATOM   7042  S  SG    . CYS C  2  439  ? 53.905  -20.591 86.534   1.00 36.33  ?  439  CYS C SG    1 
ATOM   7043  N  N     . PRO C  2  440  ? 51.435  -22.300 84.398   1.00 38.62  ?  440  PRO C N     1 
ATOM   7044  C  CA    . PRO C  2  440  ? 50.071  -21.859 84.086   1.00 33.70  ?  440  PRO C CA    1 
ATOM   7045  C  C     . PRO C  2  440  ? 49.773  -20.478 84.660   1.00 31.25  ?  440  PRO C C     1 
ATOM   7046  O  O     . PRO C  2  440  ? 48.832  -19.817 84.224   1.00 38.07  ?  440  PRO C O     1 
ATOM   7047  C  CB    . PRO C  2  440  ? 49.203  -22.911 84.776   1.00 23.59  ?  440  PRO C CB    1 
ATOM   7048  C  CG    . PRO C  2  440  ? 50.027  -23.363 85.924   1.00 27.83  ?  440  PRO C CG    1 
ATOM   7049  C  CD    . PRO C  2  440  ? 51.447  -23.351 85.430   1.00 33.35  ?  440  PRO C CD    1 
ATOM   7050  N  N     . VAL C  2  441  ? 50.573  -20.054 85.633   1.00 29.18  ?  441  VAL C N     1 
ATOM   7051  C  CA    . VAL C  2  441  ? 50.357  -18.780 86.310   1.00 25.15  ?  441  VAL C CA    1 
ATOM   7052  C  C     . VAL C  2  441  ? 51.131  -17.626 85.674   1.00 28.60  ?  441  VAL C C     1 
ATOM   7053  O  O     . VAL C  2  441  ? 50.531  -16.671 85.184   1.00 37.51  ?  441  VAL C O     1 
ATOM   7054  C  CB    . VAL C  2  441  ? 50.698  -18.867 87.809   1.00 23.50  ?  441  VAL C CB    1 
ATOM   7055  C  CG1   . VAL C  2  441  ? 50.635  -17.491 88.448   1.00 21.49  ?  441  VAL C CG1   1 
ATOM   7056  C  CG2   . VAL C  2  441  ? 49.752  -19.827 88.510   1.00 23.93  ?  441  VAL C CG2   1 
ATOM   7057  N  N     . GLU C  2  442  ? 52.458  -17.714 85.677   1.00 22.09  ?  442  GLU C N     1 
ATOM   7058  C  CA    . GLU C  2  442  ? 53.292  -16.584 85.277   1.00 27.04  ?  442  GLU C CA    1 
ATOM   7059  C  C     . GLU C  2  442  ? 53.261  -16.332 83.771   1.00 31.74  ?  442  GLU C C     1 
ATOM   7060  O  O     . GLU C  2  442  ? 53.634  -17.195 82.974   1.00 41.04  ?  442  GLU C O     1 
ATOM   7061  C  CB    . GLU C  2  442  ? 54.734  -16.804 85.743   1.00 31.64  ?  442  GLU C CB    1 
ATOM   7062  C  CG    . GLU C  2  442  ? 55.712  -15.715 85.324   1.00 32.94  ?  442  GLU C CG    1 
ATOM   7063  C  CD    . GLU C  2  442  ? 57.123  -15.979 85.825   1.00 33.55  ?  442  GLU C CD    1 
ATOM   7064  O  OE1   . GLU C  2  442  ? 57.305  -16.928 86.617   1.00 31.74  ?  442  GLU C OE1   1 
ATOM   7065  O  OE2   . GLU C  2  442  ? 58.050  -15.241 85.428   1.00 30.39  ?  442  GLU C OE2   1 
ATOM   7066  N  N     . THR C  2  443  ? 52.833  -15.124 83.409   1.00 30.88  ?  443  THR C N     1 
ATOM   7067  C  CA    . THR C  2  443  ? 52.694  -14.681 82.023   1.00 30.97  ?  443  THR C CA    1 
ATOM   7068  C  C     . THR C  2  443  ? 52.177  -13.242 82.026   1.00 30.30  ?  443  THR C C     1 
ATOM   7069  O  O     . THR C  2  443  ? 51.344  -12.885 82.859   1.00 29.30  ?  443  THR C O     1 
ATOM   7070  C  CB    . THR C  2  443  ? 51.732  -15.585 81.211   1.00 28.58  ?  443  THR C CB    1 
ATOM   7071  O  OG1   . THR C  2  443  ? 51.539  -15.037 79.902   1.00 25.40  ?  443  THR C OG1   1 
ATOM   7072  C  CG2   . THR C  2  443  ? 50.386  -15.713 81.907   1.00 25.68  ?  443  THR C CG2   1 
ATOM   7073  N  N     . PRO C  2  444  ? 52.683  -12.404 81.106   1.00 31.66  ?  444  PRO C N     1 
ATOM   7074  C  CA    . PRO C  2  444  ? 52.320  -10.983 81.036   1.00 32.67  ?  444  PRO C CA    1 
ATOM   7075  C  C     . PRO C  2  444  ? 50.819  -10.729 80.905   1.00 38.98  ?  444  PRO C C     1 
ATOM   7076  O  O     . PRO C  2  444  ? 50.086  -11.556 80.362   1.00 42.29  ?  444  PRO C O     1 
ATOM   7077  C  CB    . PRO C  2  444  ? 53.031  -10.509 79.766   1.00 23.32  ?  444  PRO C CB    1 
ATOM   7078  C  CG    . PRO C  2  444  ? 54.198  -11.408 79.640   1.00 28.10  ?  444  PRO C CG    1 
ATOM   7079  C  CD    . PRO C  2  444  ? 53.736  -12.747 80.134   1.00 31.29  ?  444  PRO C CD    1 
ATOM   7080  N  N     . GLU C  2  445  ? 50.375  -9.587  81.418   1.00 35.88  ?  445  GLU C N     1 
ATOM   7081  C  CA    . GLU C  2  445  ? 49.006  -9.136  81.222   1.00 32.68  ?  445  GLU C CA    1 
ATOM   7082  C  C     . GLU C  2  445  ? 48.950  -8.340  79.927   1.00 38.34  ?  445  GLU C C     1 
ATOM   7083  O  O     . GLU C  2  445  ? 49.903  -7.644  79.580   1.00 37.83  ?  445  GLU C O     1 
ATOM   7084  C  CB    . GLU C  2  445  ? 48.555  -8.247  82.379   1.00 39.85  ?  445  GLU C CB    1 
ATOM   7085  C  CG    . GLU C  2  445  ? 48.904  -8.770  83.757   1.00 42.16  ?  445  GLU C CG    1 
ATOM   7086  C  CD    . GLU C  2  445  ? 48.567  -7.772  84.849   1.00 59.58  ?  445  GLU C CD    1 
ATOM   7087  O  OE1   . GLU C  2  445  ? 47.540  -7.072  84.719   1.00 50.15  ?  445  GLU C OE1   1 
ATOM   7088  O  OE2   . GLU C  2  445  ? 49.335  -7.679  85.831   1.00 68.27  ?  445  GLU C OE2   1 
ATOM   7089  N  N     . GLY C  2  446  ? 47.835  -8.440  79.213   1.00 39.19  ?  446  GLY C N     1 
ATOM   7090  C  CA    . GLY C  2  446  ? 47.673  -7.698  77.977   1.00 37.04  ?  446  GLY C CA    1 
ATOM   7091  C  C     . GLY C  2  446  ? 48.031  -8.482  76.731   1.00 37.92  ?  446  GLY C C     1 
ATOM   7092  O  O     . GLY C  2  446  ? 47.970  -9.710  76.721   1.00 35.23  ?  446  GLY C O     1 
ATOM   7093  N  N     . ALA C  2  447  ? 48.415  -7.761  75.682   1.00 38.76  ?  447  ALA C N     1 
ATOM   7094  C  CA    . ALA C  2  447  ? 48.570  -8.327  74.343   1.00 37.85  ?  447  ALA C CA    1 
ATOM   7095  C  C     . ALA C  2  447  ? 49.524  -9.516  74.251   1.00 39.57  ?  447  ALA C C     1 
ATOM   7096  O  O     . ALA C  2  447  ? 49.463  -10.289 73.295   1.00 41.17  ?  447  ALA C O     1 
ATOM   7097  C  CB    . ALA C  2  447  ? 48.989  -7.239  73.360   1.00 53.57  ?  447  ALA C CB    1 
ATOM   7098  N  N     . ASN C  2  448  ? 50.403  -9.663  75.236   1.00 37.75  ?  448  ASN C N     1 
ATOM   7099  C  CA    . ASN C  2  448  ? 51.379  -10.748 75.218   1.00 37.65  ?  448  ASN C CA    1 
ATOM   7100  C  C     . ASN C  2  448  ? 50.947  -11.995 75.982   1.00 34.01  ?  448  ASN C C     1 
ATOM   7101  O  O     . ASN C  2  448  ? 51.711  -12.954 76.080   1.00 38.15  ?  448  ASN C O     1 
ATOM   7102  C  CB    . ASN C  2  448  ? 52.736  -10.265 75.735   1.00 37.66  ?  448  ASN C CB    1 
ATOM   7103  C  CG    . ASN C  2  448  ? 53.496  -9.454  74.705   1.00 48.41  ?  448  ASN C CG    1 
ATOM   7104  O  OD1   . ASN C  2  448  ? 53.448  -9.748  73.510   1.00 46.52  ?  448  ASN C OD1   1 
ATOM   7105  N  ND2   . ASN C  2  448  ? 54.201  -8.427  75.164   1.00 62.30  ?  448  ASN C ND2   1 
ATOM   7106  N  N     . ILE C  2  449  ? 49.732  -11.983 76.523   1.00 29.61  ?  449  ILE C N     1 
ATOM   7107  C  CA    . ILE C  2  449  ? 49.277  -13.090 77.361   1.00 27.88  ?  449  ILE C CA    1 
ATOM   7108  C  C     . ILE C  2  449  ? 49.275  -14.425 76.616   1.00 32.72  ?  449  ILE C C     1 
ATOM   7109  O  O     . ILE C  2  449  ? 48.738  -14.542 75.514   1.00 35.99  ?  449  ILE C O     1 
ATOM   7110  C  CB    . ILE C  2  449  ? 47.892  -12.817 78.004   1.00 25.86  ?  449  ILE C CB    1 
ATOM   7111  C  CG1   . ILE C  2  449  ? 47.520  -13.952 78.959   1.00 25.87  ?  449  ILE C CG1   1 
ATOM   7112  C  CG2   . ILE C  2  449  ? 46.816  -12.632 76.945   1.00 32.32  ?  449  ILE C CG2   1 
ATOM   7113  C  CD1   . ILE C  2  449  ? 46.182  -13.774 79.628   1.00 26.04  ?  449  ILE C CD1   1 
ATOM   7114  N  N     . GLY C  2  450  ? 49.923  -15.419 77.214   1.00 34.59  ?  450  GLY C N     1 
ATOM   7115  C  CA    . GLY C  2  450  ? 49.962  -16.760 76.663   1.00 37.51  ?  450  GLY C CA    1 
ATOM   7116  C  C     . GLY C  2  450  ? 51.104  -16.957 75.686   1.00 33.36  ?  450  GLY C C     1 
ATOM   7117  O  O     . GLY C  2  450  ? 51.551  -18.081 75.457   1.00 33.79  ?  450  GLY C O     1 
ATOM   7118  N  N     . LEU C  2  451  ? 51.578  -15.858 75.110   1.00 30.41  ?  451  LEU C N     1 
ATOM   7119  C  CA    . LEU C  2  451  ? 52.693  -15.906 74.174   1.00 35.03  ?  451  LEU C CA    1 
ATOM   7120  C  C     . LEU C  2  451  ? 54.009  -16.026 74.928   1.00 38.42  ?  451  LEU C C     1 
ATOM   7121  O  O     . LEU C  2  451  ? 54.855  -16.856 74.597   1.00 45.28  ?  451  LEU C O     1 
ATOM   7122  C  CB    . LEU C  2  451  ? 52.701  -14.661 73.286   1.00 35.46  ?  451  LEU C CB    1 
ATOM   7123  C  CG    . LEU C  2  451  ? 51.418  -14.428 72.486   1.00 33.38  ?  451  LEU C CG    1 
ATOM   7124  C  CD1   . LEU C  2  451  ? 51.575  -13.244 71.545   1.00 37.69  ?  451  LEU C CD1   1 
ATOM   7125  C  CD2   . LEU C  2  451  ? 51.024  -15.684 71.721   1.00 31.06  ?  451  LEU C CD2   1 
ATOM   7126  N  N     . ILE C  2  452  ? 54.170  -15.191 75.949   1.00 35.23  ?  452  ILE C N     1 
ATOM   7127  C  CA    . ILE C  2  452  ? 55.343  -15.252 76.807   1.00 30.93  ?  452  ILE C CA    1 
ATOM   7128  C  C     . ILE C  2  452  ? 55.000  -16.021 78.075   1.00 34.11  ?  452  ILE C C     1 
ATOM   7129  O  O     . ILE C  2  452  ? 54.164  -15.592 78.870   1.00 30.81  ?  452  ILE C O     1 
ATOM   7130  C  CB    . ILE C  2  452  ? 55.846  -13.849 77.188   1.00 25.37  ?  452  ILE C CB    1 
ATOM   7131  C  CG1   . ILE C  2  452  ? 55.976  -12.968 75.945   1.00 25.63  ?  452  ILE C CG1   1 
ATOM   7132  C  CG2   . ILE C  2  452  ? 57.171  -13.940 77.922   1.00 27.80  ?  452  ILE C CG2   1 
ATOM   7133  C  CD1   . ILE C  2  452  ? 56.945  -13.499 74.923   1.00 33.54  ?  452  ILE C CD1   1 
ATOM   7134  N  N     . THR C  2  453  ? 55.635  -17.172 78.250   1.00 39.26  ?  453  THR C N     1 
ATOM   7135  C  CA    . THR C  2  453  ? 55.419  -17.984 79.438   1.00 44.84  ?  453  THR C CA    1 
ATOM   7136  C  C     . THR C  2  453  ? 56.742  -18.241 80.148   1.00 42.66  ?  453  THR C C     1 
ATOM   7137  O  O     . THR C  2  453  ? 57.784  -17.731 79.735   1.00 38.34  ?  453  THR C O     1 
ATOM   7138  C  CB    . THR C  2  453  ? 54.722  -19.313 79.096   1.00 39.26  ?  453  THR C CB    1 
ATOM   7139  O  OG1   . THR C  2  453  ? 55.412  -19.961 78.020   1.00 32.00  ?  453  THR C OG1   1 
ATOM   7140  C  CG2   . THR C  2  453  ? 53.280  -19.062 78.682   1.00 33.59  ?  453  THR C CG2   1 
ATOM   7141  N  N     . SER C  2  454  ? 56.704  -19.022 81.221   1.00 39.19  ?  454  SER C N     1 
ATOM   7142  C  CA    . SER C  2  454  ? 57.914  -19.278 81.989   1.00 38.87  ?  454  SER C CA    1 
ATOM   7143  C  C     . SER C  2  454  ? 58.134  -20.768 82.223   1.00 40.49  ?  454  SER C C     1 
ATOM   7144  O  O     . SER C  2  454  ? 57.183  -21.536 82.379   1.00 39.08  ?  454  SER C O     1 
ATOM   7145  C  CB    . SER C  2  454  ? 57.878  -18.522 83.319   1.00 40.67  ?  454  SER C CB    1 
ATOM   7146  O  OG    . SER C  2  454  ? 59.171  -18.442 83.894   1.00 42.84  ?  454  SER C OG    1 
ATOM   7147  N  N     . LEU C  2  455  ? 59.402  -21.164 82.235   1.00 36.66  ?  455  LEU C N     1 
ATOM   7148  C  CA    . LEU C  2  455  ? 59.782  -22.553 82.454   1.00 35.09  ?  455  LEU C CA    1 
ATOM   7149  C  C     . LEU C  2  455  ? 59.503  -22.969 83.895   1.00 39.62  ?  455  LEU C C     1 
ATOM   7150  O  O     . LEU C  2  455  ? 59.778  -22.217 84.831   1.00 44.50  ?  455  LEU C O     1 
ATOM   7151  C  CB    . LEU C  2  455  ? 61.264  -22.742 82.128   1.00 30.76  ?  455  LEU C CB    1 
ATOM   7152  C  CG    . LEU C  2  455  ? 61.843  -24.150 82.258   1.00 33.08  ?  455  LEU C CG    1 
ATOM   7153  C  CD1   . LEU C  2  455  ? 61.116  -25.116 81.336   1.00 33.04  ?  455  LEU C CD1   1 
ATOM   7154  C  CD2   . LEU C  2  455  ? 63.332  -24.134 81.960   1.00 30.86  ?  455  LEU C CD2   1 
ATOM   7155  N  N     . ALA C  2  456  ? 58.956  -24.168 84.071   1.00 30.72  ?  456  ALA C N     1 
ATOM   7156  C  CA    . ALA C  2  456  ? 58.672  -24.683 85.405   1.00 33.41  ?  456  ALA C CA    1 
ATOM   7157  C  C     . ALA C  2  456  ? 59.963  -24.958 86.168   1.00 41.72  ?  456  ALA C C     1 
ATOM   7158  O  O     . ALA C  2  456  ? 61.033  -25.081 85.571   1.00 39.06  ?  456  ALA C O     1 
ATOM   7159  C  CB    . ALA C  2  456  ? 57.822  -25.936 85.326   1.00 35.00  ?  456  ALA C CB    1 
ATOM   7160  N  N     . ALA C  2  457  ? 59.858  -25.039 87.491   1.00 46.77  ?  457  ALA C N     1 
ATOM   7161  C  CA    . ALA C  2  457  ? 61.023  -25.235 88.349   1.00 50.45  ?  457  ALA C CA    1 
ATOM   7162  C  C     . ALA C  2  457  ? 61.749  -26.552 88.077   1.00 58.88  ?  457  ALA C C     1 
ATOM   7163  O  O     . ALA C  2  457  ? 62.942  -26.558 87.766   1.00 53.40  ?  457  ALA C O     1 
ATOM   7164  C  CB    . ALA C  2  457  ? 60.619  -25.142 89.816   1.00 42.02  ?  457  ALA C CB    1 
ATOM   7165  N  N     . TYR C  2  458  ? 61.027  -27.664 88.185   1.00 54.86  ?  458  TYR C N     1 
ATOM   7166  C  CA    . TYR C  2  458  ? 61.626  -28.982 87.996   1.00 53.63  ?  458  TYR C CA    1 
ATOM   7167  C  C     . TYR C  2  458  ? 61.709  -29.388 86.527   1.00 52.85  ?  458  TYR C C     1 
ATOM   7168  O  O     . TYR C  2  458  ? 62.257  -30.440 86.199   1.00 68.35  ?  458  TYR C O     1 
ATOM   7169  C  CB    . TYR C  2  458  ? 60.863  -30.046 88.789   1.00 50.90  ?  458  TYR C CB    1 
ATOM   7170  C  CG    . TYR C  2  458  ? 61.259  -30.138 90.247   1.00 60.68  ?  458  TYR C CG    1 
ATOM   7171  C  CD1   . TYR C  2  458  ? 62.392  -30.843 90.636   1.00 66.81  ?  458  TYR C CD1   1 
ATOM   7172  C  CD2   . TYR C  2  458  ? 60.495  -29.531 91.235   1.00 61.93  ?  458  TYR C CD2   1 
ATOM   7173  C  CE1   . TYR C  2  458  ? 62.756  -30.934 91.967   1.00 62.85  ?  458  TYR C CE1   1 
ATOM   7174  C  CE2   . TYR C  2  458  ? 60.852  -29.618 92.571   1.00 54.34  ?  458  TYR C CE2   1 
ATOM   7175  C  CZ    . TYR C  2  458  ? 61.983  -30.320 92.930   1.00 57.92  ?  458  TYR C CZ    1 
ATOM   7176  O  OH    . TYR C  2  458  ? 62.341  -30.409 94.255   1.00 58.81  ?  458  TYR C OH    1 
ATOM   7177  N  N     . ALA C  2  459  ? 61.167  -28.557 85.645   1.00 42.24  ?  459  ALA C N     1 
ATOM   7178  C  CA    . ALA C  2  459  ? 61.169  -28.864 84.218   1.00 53.49  ?  459  ALA C CA    1 
ATOM   7179  C  C     . ALA C  2  459  ? 62.563  -28.761 83.604   1.00 53.45  ?  459  ALA C C     1 
ATOM   7180  O  O     . ALA C  2  459  ? 63.314  -27.829 83.891   1.00 44.75  ?  459  ALA C O     1 
ATOM   7181  C  CB    . ALA C  2  459  ? 60.197  -27.960 83.478   1.00 52.03  ?  459  ALA C CB    1 
ATOM   7182  N  N     . ARG C  2  460  ? 62.898  -29.731 82.758   1.00 62.95  ?  460  ARG C N     1 
ATOM   7183  C  CA    . ARG C  2  460  ? 64.165  -29.729 82.034   1.00 59.54  ?  460  ARG C CA    1 
ATOM   7184  C  C     . ARG C  2  460  ? 63.938  -29.980 80.546   1.00 57.19  ?  460  ARG C C     1 
ATOM   7185  O  O     . ARG C  2  460  ? 62.985  -30.656 80.157   1.00 48.97  ?  460  ARG C O     1 
ATOM   7186  C  CB    . ARG C  2  460  ? 65.122  -30.777 82.609   1.00 65.60  ?  460  ARG C CB    1 
ATOM   7187  C  CG    . ARG C  2  460  ? 65.670  -30.429 83.985   1.00 75.86  ?  460  ARG C CG    1 
ATOM   7188  C  CD    . ARG C  2  460  ? 66.572  -31.528 84.532   1.00 67.70  ?  460  ARG C CD    1 
ATOM   7189  N  NE    . ARG C  2  460  ? 67.715  -31.800 83.668   1.00 64.51  ?  460  ARG C NE    1 
ATOM   7190  C  CZ    . ARG C  2  460  ? 68.937  -31.322 83.876   1.00 64.79  ?  460  ARG C CZ    1 
ATOM   7191  N  NH1   . ARG C  2  460  ? 69.176  -30.543 84.923   1.00 57.37  ?  460  ARG C NH1   1 
ATOM   7192  N  NH2   . ARG C  2  460  ? 69.920  -31.619 83.038   1.00 71.57  ?  460  ARG C NH2   1 
ATOM   7193  N  N     . VAL C  2  461  ? 64.817  -29.427 79.719   1.00 55.64  ?  461  VAL C N     1 
ATOM   7194  C  CA    . VAL C  2  461  ? 64.701  -29.566 78.272   1.00 63.48  ?  461  VAL C CA    1 
ATOM   7195  C  C     . VAL C  2  461  ? 65.814  -30.445 77.709   1.00 73.49  ?  461  VAL C C     1 
ATOM   7196  O  O     . VAL C  2  461  ? 66.996  -30.150 77.887   1.00 75.88  ?  461  VAL C O     1 
ATOM   7197  C  CB    . VAL C  2  461  ? 64.737  -28.191 77.579   1.00 68.96  ?  461  VAL C CB    1 
ATOM   7198  C  CG1   . VAL C  2  461  ? 64.826  -28.352 76.067   1.00 68.95  ?  461  VAL C CG1   1 
ATOM   7199  C  CG2   . VAL C  2  461  ? 63.515  -27.373 77.967   1.00 61.68  ?  461  VAL C CG2   1 
ATOM   7200  N  N     . ASP C  2  462  ? 65.431  -31.522 77.028   1.00 71.99  ?  462  ASP C N     1 
ATOM   7201  C  CA    . ASP C  2  462  ? 66.405  -32.447 76.455   1.00 74.88  ?  462  ASP C CA    1 
ATOM   7202  C  C     . ASP C  2  462  ? 67.090  -31.877 75.213   1.00 72.75  ?  462  ASP C C     1 
ATOM   7203  O  O     . ASP C  2  462  ? 66.843  -30.736 74.821   1.00 69.06  ?  462  ASP C O     1 
ATOM   7204  C  CB    . ASP C  2  462  ? 65.765  -33.807 76.146   1.00 69.50  ?  462  ASP C CB    1 
ATOM   7205  C  CG    . ASP C  2  462  ? 64.524  -33.694 75.275   1.00 69.32  ?  462  ASP C CG    1 
ATOM   7206  O  OD1   . ASP C  2  462  ? 64.410  -32.722 74.501   1.00 69.07  ?  462  ASP C OD1   1 
ATOM   7207  O  OD2   . ASP C  2  462  ? 63.659  -34.591 75.362   1.00 69.19  ?  462  ASP C OD2   1 
ATOM   7208  N  N     . GLU C  2  463  ? 67.950  -32.683 74.598   1.00 70.70  ?  463  GLU C N     1 
ATOM   7209  C  CA    . GLU C  2  463  ? 68.693  -32.255 73.420   1.00 68.75  ?  463  GLU C CA    1 
ATOM   7210  C  C     . GLU C  2  463  ? 67.793  -32.179 72.191   1.00 68.46  ?  463  GLU C C     1 
ATOM   7211  O  O     . GLU C  2  463  ? 68.159  -31.580 71.179   1.00 56.61  ?  463  GLU C O     1 
ATOM   7212  C  CB    . GLU C  2  463  ? 69.867  -33.199 73.161   1.00 82.06  ?  463  GLU C CB    1 
ATOM   7213  C  CG    . GLU C  2  463  ? 70.856  -33.280 74.313   1.00 90.31  ?  463  GLU C CG    1 
ATOM   7214  C  CD    . GLU C  2  463  ? 71.985  -34.258 74.050   1.00 100.36 ?  463  GLU C CD    1 
ATOM   7215  O  OE1   . GLU C  2  463  ? 71.962  -34.927 72.995   1.00 100.45 ?  463  GLU C OE1   1 
ATOM   7216  O  OE2   . GLU C  2  463  ? 72.895  -34.357 74.900   1.00 99.26  ?  463  GLU C OE2   1 
ATOM   7217  N  N     . LEU C  2  464  ? 66.616  -32.790 72.286   1.00 74.70  ?  464  LEU C N     1 
ATOM   7218  C  CA    . LEU C  2  464  ? 65.651  -32.779 71.192   1.00 73.13  ?  464  LEU C CA    1 
ATOM   7219  C  C     . LEU C  2  464  ? 64.865  -31.468 71.151   1.00 69.69  ?  464  LEU C C     1 
ATOM   7220  O  O     . LEU C  2  464  ? 64.315  -31.098 70.113   1.00 60.78  ?  464  LEU C O     1 
ATOM   7221  C  CB    . LEU C  2  464  ? 64.685  -33.965 71.305   1.00 71.16  ?  464  LEU C CB    1 
ATOM   7222  C  CG    . LEU C  2  464  ? 65.191  -35.374 70.976   1.00 66.58  ?  464  LEU C CG    1 
ATOM   7223  C  CD1   . LEU C  2  464  ? 66.093  -35.932 72.072   1.00 63.50  ?  464  LEU C CD1   1 
ATOM   7224  C  CD2   . LEU C  2  464  ? 64.017  -36.309 70.720   1.00 67.86  ?  464  LEU C CD2   1 
ATOM   7225  N  N     . GLY C  2  465  ? 64.821  -30.771 72.283   1.00 69.16  ?  465  GLY C N     1 
ATOM   7226  C  CA    . GLY C  2  465  ? 64.114  -29.505 72.376   1.00 54.58  ?  465  GLY C CA    1 
ATOM   7227  C  C     . GLY C  2  465  ? 62.784  -29.594 73.104   1.00 56.23  ?  465  GLY C C     1 
ATOM   7228  O  O     . GLY C  2  465  ? 62.127  -28.578 73.335   1.00 47.56  ?  465  GLY C O     1 
ATOM   7229  N  N     . PHE C  2  466  ? 62.381  -30.811 73.461   1.00 57.48  ?  466  PHE C N     1 
ATOM   7230  C  CA    . PHE C  2  466  ? 61.131  -31.022 74.188   1.00 53.14  ?  466  PHE C CA    1 
ATOM   7231  C  C     . PHE C  2  466  ? 61.305  -30.717 75.672   1.00 58.31  ?  466  PHE C C     1 
ATOM   7232  O  O     . PHE C  2  466  ? 62.404  -30.835 76.213   1.00 61.87  ?  466  PHE C O     1 
ATOM   7233  C  CB    . PHE C  2  466  ? 60.630  -32.460 74.017   1.00 50.99  ?  466  PHE C CB    1 
ATOM   7234  C  CG    . PHE C  2  466  ? 60.156  -32.784 72.626   1.00 54.00  ?  466  PHE C CG    1 
ATOM   7235  C  CD1   . PHE C  2  466  ? 60.088  -31.803 71.650   1.00 53.70  ?  466  PHE C CD1   1 
ATOM   7236  C  CD2   . PHE C  2  466  ? 59.767  -34.073 72.301   1.00 62.97  ?  466  PHE C CD2   1 
ATOM   7237  C  CE1   . PHE C  2  466  ? 59.652  -32.104 70.374   1.00 57.69  ?  466  PHE C CE1   1 
ATOM   7238  C  CE2   . PHE C  2  466  ? 59.327  -34.381 71.027   1.00 62.94  ?  466  PHE C CE2   1 
ATOM   7239  C  CZ    . PHE C  2  466  ? 59.270  -33.394 70.063   1.00 69.04  ?  466  PHE C CZ    1 
ATOM   7240  N  N     . ILE C  2  467  ? 60.215  -30.329 76.328   1.00 58.75  ?  467  ILE C N     1 
ATOM   7241  C  CA    . ILE C  2  467  ? 60.246  -30.066 77.762   1.00 53.64  ?  467  ILE C CA    1 
ATOM   7242  C  C     . ILE C  2  467  ? 59.745  -31.278 78.537   1.00 53.04  ?  467  ILE C C     1 
ATOM   7243  O  O     . ILE C  2  467  ? 58.662  -31.798 78.262   1.00 45.27  ?  467  ILE C O     1 
ATOM   7244  C  CB    . ILE C  2  467  ? 59.396  -28.839 78.138   1.00 49.62  ?  467  ILE C CB    1 
ATOM   7245  C  CG1   . ILE C  2  467  ? 59.793  -27.633 77.287   1.00 42.00  ?  467  ILE C CG1   1 
ATOM   7246  C  CG2   . ILE C  2  467  ? 59.555  -28.518 79.613   1.00 48.69  ?  467  ILE C CG2   1 
ATOM   7247  C  CD1   . ILE C  2  467  ? 59.030  -26.373 77.624   1.00 35.52  ?  467  ILE C CD1   1 
ATOM   7248  N  N     . ARG C  2  468  ? 60.538  -31.726 79.505   1.00 54.76  ?  468  ARG C N     1 
ATOM   7249  C  CA    . ARG C  2  468  ? 60.190  -32.906 80.286   1.00 52.55  ?  468  ARG C CA    1 
ATOM   7250  C  C     . ARG C  2  468  ? 60.280  -32.664 81.792   1.00 47.22  ?  468  ARG C C     1 
ATOM   7251  O  O     . ARG C  2  468  ? 61.155  -31.942 82.268   1.00 45.28  ?  468  ARG C O     1 
ATOM   7252  C  CB    . ARG C  2  468  ? 61.052  -34.101 79.866   1.00 59.37  ?  468  ARG C CB    1 
ATOM   7253  C  CG    . ARG C  2  468  ? 62.528  -33.785 79.697   1.00 66.22  ?  468  ARG C CG    1 
ATOM   7254  C  CD    . ARG C  2  468  ? 63.130  -34.580 78.547   1.00 68.97  ?  468  ARG C CD    1 
ATOM   7255  N  NE    . ARG C  2  468  ? 62.882  -36.013 78.677   1.00 81.55  ?  468  ARG C NE    1 
ATOM   7256  C  CZ    . ARG C  2  468  ? 63.221  -36.917 77.763   1.00 68.50  ?  468  ARG C CZ    1 
ATOM   7257  N  NH1   . ARG C  2  468  ? 63.823  -36.537 76.644   1.00 53.43  ?  468  ARG C NH1   1 
ATOM   7258  N  NH2   . ARG C  2  468  ? 62.955  -38.201 77.966   1.00 60.74  ?  468  ARG C NH2   1 
ATOM   7259  N  N     . THR C  2  469  ? 59.363  -33.280 82.532   1.00 44.46  ?  469  THR C N     1 
ATOM   7260  C  CA    . THR C  2  469  ? 59.253  -33.074 83.972   1.00 51.99  ?  469  THR C CA    1 
ATOM   7261  C  C     . THR C  2  469  ? 59.365  -34.401 84.724   1.00 58.81  ?  469  THR C C     1 
ATOM   7262  O  O     . THR C  2  469  ? 58.880  -35.429 84.249   1.00 57.21  ?  469  THR C O     1 
ATOM   7263  C  CB    . THR C  2  469  ? 57.920  -32.370 84.323   1.00 58.86  ?  469  THR C CB    1 
ATOM   7264  O  OG1   . THR C  2  469  ? 57.670  -32.467 85.731   1.00 62.92  ?  469  THR C OG1   1 
ATOM   7265  C  CG2   . THR C  2  469  ? 56.763  -33.003 83.564   1.00 54.04  ?  469  THR C CG2   1 
ATOM   7266  N  N     . PRO C  2  470  ? 60.013  -34.382 85.903   1.00 61.38  ?  470  PRO C N     1 
ATOM   7267  C  CA    . PRO C  2  470  ? 60.284  -35.588 86.697   1.00 61.03  ?  470  PRO C CA    1 
ATOM   7268  C  C     . PRO C  2  470  ? 59.039  -36.247 87.291   1.00 52.82  ?  470  PRO C C     1 
ATOM   7269  O  O     . PRO C  2  470  ? 58.079  -35.562 87.642   1.00 51.56  ?  470  PRO C O     1 
ATOM   7270  C  CB    . PRO C  2  470  ? 61.165  -35.066 87.840   1.00 57.80  ?  470  PRO C CB    1 
ATOM   7271  C  CG    . PRO C  2  470  ? 61.676  -33.751 87.386   1.00 56.82  ?  470  PRO C CG    1 
ATOM   7272  C  CD    . PRO C  2  470  ? 60.617  -33.183 86.508   1.00 56.95  ?  470  PRO C CD    1 
ATOM   7273  N  N     . TYR C  2  471  ? 59.073  -37.573 87.400   1.00 59.19  ?  471  TYR C N     1 
ATOM   7274  C  CA    . TYR C  2  471  ? 58.046  -38.332 88.111   1.00 59.71  ?  471  TYR C CA    1 
ATOM   7275  C  C     . TYR C  2  471  ? 58.666  -39.566 88.764   1.00 70.77  ?  471  TYR C C     1 
ATOM   7276  O  O     . TYR C  2  471  ? 59.588  -40.170 88.216   1.00 71.32  ?  471  TYR C O     1 
ATOM   7277  C  CB    . TYR C  2  471  ? 56.923  -38.765 87.167   1.00 61.11  ?  471  TYR C CB    1 
ATOM   7278  C  CG    . TYR C  2  471  ? 56.134  -37.631 86.552   1.00 63.63  ?  471  TYR C CG    1 
ATOM   7279  C  CD1   . TYR C  2  471  ? 55.061  -37.060 87.224   1.00 64.46  ?  471  TYR C CD1   1 
ATOM   7280  C  CD2   . TYR C  2  471  ? 56.453  -37.140 85.292   1.00 58.73  ?  471  TYR C CD2   1 
ATOM   7281  C  CE1   . TYR C  2  471  ? 54.334  -36.027 86.661   1.00 65.09  ?  471  TYR C CE1   1 
ATOM   7282  C  CE2   . TYR C  2  471  ? 55.732  -36.112 84.721   1.00 53.47  ?  471  TYR C CE2   1 
ATOM   7283  C  CZ    . TYR C  2  471  ? 54.674  -35.556 85.409   1.00 59.54  ?  471  TYR C CZ    1 
ATOM   7284  O  OH    . TYR C  2  471  ? 53.955  -34.529 84.842   1.00 52.75  ?  471  TYR C OH    1 
ATOM   7285  N  N     . ARG C  2  472  ? 58.158  -39.940 89.935   1.00 76.06  ?  472  ARG C N     1 
ATOM   7286  C  CA    . ARG C  2  472  ? 58.647  -41.124 90.636   1.00 77.15  ?  472  ARG C CA    1 
ATOM   7287  C  C     . ARG C  2  472  ? 57.861  -42.368 90.240   1.00 77.23  ?  472  ARG C C     1 
ATOM   7288  O  O     . ARG C  2  472  ? 56.637  -42.331 90.146   1.00 68.48  ?  472  ARG C O     1 
ATOM   7289  C  CB    . ARG C  2  472  ? 58.568  -40.930 92.153   1.00 74.44  ?  472  ARG C CB    1 
ATOM   7290  C  CG    . ARG C  2  472  ? 59.415  -39.791 92.686   1.00 61.74  ?  472  ARG C CG    1 
ATOM   7291  C  CD    . ARG C  2  472  ? 59.810  -40.032 94.136   1.00 72.22  ?  472  ARG C CD    1 
ATOM   7292  N  NE    . ARG C  2  472  ? 58.660  -40.181 95.022   1.00 81.70  ?  472  ARG C NE    1 
ATOM   7293  C  CZ    . ARG C  2  472  ? 58.752  -40.284 96.344   1.00 84.82  ?  472  ARG C CZ    1 
ATOM   7294  N  NH1   . ARG C  2  472  ? 59.941  -40.248 96.932   1.00 72.77  ?  472  ARG C NH1   1 
ATOM   7295  N  NH2   . ARG C  2  472  ? 57.656  -40.418 97.080   1.00 80.60  ?  472  ARG C NH2   1 
ATOM   7296  N  N     . ARG C  2  473  ? 58.569  -43.472 90.020   1.00 72.76  ?  473  ARG C N     1 
ATOM   7297  C  CA    . ARG C  2  473  ? 57.926  -44.725 89.639   1.00 70.15  ?  473  ARG C CA    1 
ATOM   7298  C  C     . ARG C  2  473  ? 57.210  -45.375 90.822   1.00 70.47  ?  473  ARG C C     1 
ATOM   7299  O  O     . ARG C  2  473  ? 57.740  -45.425 91.931   1.00 73.63  ?  473  ARG C O     1 
ATOM   7300  C  CB    . ARG C  2  473  ? 58.950  -45.695 89.041   1.00 75.10  ?  473  ARG C CB    1 
ATOM   7301  C  CG    . ARG C  2  473  ? 58.381  -47.063 88.693   1.00 80.50  ?  473  ARG C CG    1 
ATOM   7302  C  CD    . ARG C  2  473  ? 59.396  -47.920 87.954   1.00 72.70  ?  473  ARG C CD    1 
ATOM   7303  N  NE    . ARG C  2  473  ? 59.738  -47.355 86.652   1.00 63.60  ?  473  ARG C NE    1 
ATOM   7304  C  CZ    . ARG C  2  473  ? 59.055  -47.588 85.536   1.00 67.07  ?  473  ARG C CZ    1 
ATOM   7305  N  NH1   . ARG C  2  473  ? 57.988  -48.376 85.560   1.00 57.81  ?  473  ARG C NH1   1 
ATOM   7306  N  NH2   . ARG C  2  473  ? 59.438  -47.032 84.394   1.00 64.96  ?  473  ARG C NH2   1 
ATOM   7307  N  N     . VAL C  2  474  ? 55.999  -45.866 90.576   1.00 66.02  ?  474  VAL C N     1 
ATOM   7308  C  CA    . VAL C  2  474  ? 55.220  -46.546 91.604   1.00 68.38  ?  474  VAL C CA    1 
ATOM   7309  C  C     . VAL C  2  474  ? 54.903  -47.976 91.180   1.00 79.47  ?  474  VAL C C     1 
ATOM   7310  O  O     . VAL C  2  474  ? 54.269  -48.199 90.149   1.00 77.32  ?  474  VAL C O     1 
ATOM   7311  C  CB    . VAL C  2  474  ? 53.903  -45.807 91.894   1.00 67.26  ?  474  VAL C CB    1 
ATOM   7312  C  CG1   . VAL C  2  474  ? 53.057  -46.597 92.884   1.00 67.11  ?  474  VAL C CG1   1 
ATOM   7313  C  CG2   . VAL C  2  474  ? 54.186  -44.408 92.417   1.00 66.12  ?  474  VAL C CG2   1 
ATOM   7314  N  N     . VAL C  2  475  ? 55.345  -48.941 91.981   1.00 87.22  ?  475  VAL C N     1 
ATOM   7315  C  CA    . VAL C  2  475  ? 55.148  -50.351 91.659   1.00 81.43  ?  475  VAL C CA    1 
ATOM   7316  C  C     . VAL C  2  475  ? 54.311  -51.071 92.716   1.00 77.49  ?  475  VAL C C     1 
ATOM   7317  O  O     . VAL C  2  475  ? 54.747  -51.243 93.855   1.00 70.42  ?  475  VAL C O     1 
ATOM   7318  C  CB    . VAL C  2  475  ? 56.496  -51.083 91.504   1.00 74.49  ?  475  VAL C CB    1 
ATOM   7319  C  CG1   . VAL C  2  475  ? 56.269  -52.527 91.082   1.00 75.66  ?  475  VAL C CG1   1 
ATOM   7320  C  CG2   . VAL C  2  475  ? 57.381  -50.361 90.498   1.00 71.85  ?  475  VAL C CG2   1 
ATOM   7321  N  N     . GLY C  2  476  ? 53.109  -51.490 92.326   1.00 73.12  ?  476  GLY C N     1 
ATOM   7322  C  CA    . GLY C  2  476  ? 52.231  -52.253 93.196   1.00 66.62  ?  476  GLY C CA    1 
ATOM   7323  C  C     . GLY C  2  476  ? 51.803  -51.538 94.465   1.00 78.43  ?  476  GLY C C     1 
ATOM   7324  O  O     . GLY C  2  476  ? 51.445  -52.175 95.456   1.00 72.86  ?  476  GLY C O     1 
ATOM   7325  N  N     . GLY C  2  477  ? 51.839  -50.210 94.436   1.00 86.94  ?  477  GLY C N     1 
ATOM   7326  C  CA    . GLY C  2  477  ? 51.465  -49.415 95.592   1.00 81.18  ?  477  GLY C CA    1 
ATOM   7327  C  C     . GLY C  2  477  ? 52.672  -48.925 96.367   1.00 75.43  ?  477  GLY C C     1 
ATOM   7328  O  O     . GLY C  2  477  ? 52.537  -48.210 97.359   1.00 76.28  ?  477  GLY C O     1 
ATOM   7329  N  N     . VAL C  2  478  ? 53.858  -49.311 95.911   1.00 66.06  ?  478  VAL C N     1 
ATOM   7330  C  CA    . VAL C  2  478  ? 55.096  -48.898 96.560   1.00 70.40  ?  478  VAL C CA    1 
ATOM   7331  C  C     . VAL C  2  478  ? 55.812  -47.839 95.734   1.00 72.98  ?  478  VAL C C     1 
ATOM   7332  O  O     . VAL C  2  478  ? 56.250  -48.102 94.613   1.00 74.59  ?  478  VAL C O     1 
ATOM   7333  C  CB    . VAL C  2  478  ? 56.044  -50.089 96.779   1.00 78.04  ?  478  VAL C CB    1 
ATOM   7334  C  CG1   . VAL C  2  478  ? 57.351  -49.618 97.402   1.00 73.46  ?  478  VAL C CG1   1 
ATOM   7335  C  CG2   . VAL C  2  478  ? 55.379  -51.143 97.649   1.00 86.52  ?  478  VAL C CG2   1 
ATOM   7336  N  N     . VAL C  2  479  ? 55.936  -46.641 96.295   1.00 73.80  ?  479  VAL C N     1 
ATOM   7337  C  CA    . VAL C  2  479  ? 56.579  -45.538 95.597   1.00 69.47  ?  479  VAL C CA    1 
ATOM   7338  C  C     . VAL C  2  479  ? 58.088  -45.613 95.782   1.00 67.42  ?  479  VAL C C     1 
ATOM   7339  O  O     . VAL C  2  479  ? 58.589  -45.534 96.904   1.00 76.80  ?  479  VAL C O     1 
ATOM   7340  C  CB    . VAL C  2  479  ? 56.076  -44.180 96.116   1.00 65.59  ?  479  VAL C CB    1 
ATOM   7341  C  CG1   . VAL C  2  479  ? 56.642  -43.048 95.273   1.00 67.83  ?  479  VAL C CG1   1 
ATOM   7342  C  CG2   . VAL C  2  479  ? 54.556  -44.142 96.118   1.00 63.25  ?  479  VAL C CG2   1 
ATOM   7343  N  N     . THR C  2  480  ? 58.811  -45.763 94.678   1.00 59.46  ?  480  THR C N     1 
ATOM   7344  C  CA    . THR C  2  480  ? 60.261  -45.881 94.734   1.00 66.80  ?  480  THR C CA    1 
ATOM   7345  C  C     . THR C  2  480  ? 60.912  -44.508 94.702   1.00 70.67  ?  480  THR C C     1 
ATOM   7346  O  O     . THR C  2  480  ? 60.228  -43.488 94.622   1.00 71.94  ?  480  THR C O     1 
ATOM   7347  C  CB    . THR C  2  480  ? 60.806  -46.708 93.558   1.00 71.50  ?  480  THR C CB    1 
ATOM   7348  O  OG1   . THR C  2  480  ? 60.782  -45.917 92.362   1.00 67.48  ?  480  THR C OG1   1 
ATOM   7349  C  CG2   . THR C  2  480  ? 59.971  -47.964 93.357   1.00 74.26  ?  480  THR C CG2   1 
ATOM   7350  N  N     . ASP C  2  481  ? 62.238  -44.488 94.771   1.00 77.26  ?  481  ASP C N     1 
ATOM   7351  C  CA    . ASP C  2  481  ? 62.992  -43.244 94.677   1.00 81.12  ?  481  ASP C CA    1 
ATOM   7352  C  C     . ASP C  2  481  ? 63.482  -42.998 93.253   1.00 78.65  ?  481  ASP C C     1 
ATOM   7353  O  O     . ASP C  2  481  ? 64.186  -42.023 92.991   1.00 76.47  ?  481  ASP C O     1 
ATOM   7354  C  CB    . ASP C  2  481  ? 64.165  -43.241 95.659   1.00 90.14  ?  481  ASP C CB    1 
ATOM   7355  C  CG    . ASP C  2  481  ? 63.716  -43.097 97.103   1.00 101.43 ?  481  ASP C CG    1 
ATOM   7356  O  OD1   . ASP C  2  481  ? 62.678  -42.444 97.343   1.00 93.71  ?  481  ASP C OD1   1 
ATOM   7357  O  OD2   . ASP C  2  481  ? 64.402  -43.635 97.998   1.00 111.00 ?  481  ASP C OD2   1 
ATOM   7358  N  N     . GLU C  2  482  ? 63.106  -43.888 92.338   1.00 80.48  ?  482  GLU C N     1 
ATOM   7359  C  CA    . GLU C  2  482  ? 63.511  -43.763 90.941   1.00 84.88  ?  482  GLU C CA    1 
ATOM   7360  C  C     . GLU C  2  482  ? 62.826  -42.574 90.275   1.00 79.62  ?  482  GLU C C     1 
ATOM   7361  O  O     . GLU C  2  482  ? 61.598  -42.470 90.275   1.00 72.68  ?  482  GLU C O     1 
ATOM   7362  C  CB    . GLU C  2  482  ? 63.194  -45.044 90.167   1.00 82.30  ?  482  GLU C CB    1 
ATOM   7363  C  CG    . GLU C  2  482  ? 63.586  -44.985 88.697   1.00 81.72  ?  482  GLU C CG    1 
ATOM   7364  C  CD    . GLU C  2  482  ? 63.067  -46.167 87.900   1.00 82.05  ?  482  GLU C CD    1 
ATOM   7365  O  OE1   . GLU C  2  482  ? 63.248  -46.177 86.664   1.00 63.25  ?  482  GLU C OE1   1 
ATOM   7366  O  OE2   . GLU C  2  482  ? 62.476  -47.084 88.509   1.00 83.95  ?  482  GLU C OE2   1 
ATOM   7367  N  N     . VAL C  2  483  ? 63.627  -41.684 89.699   1.00 73.12  ?  483  VAL C N     1 
ATOM   7368  C  CA    . VAL C  2  483  ? 63.107  -40.473 89.076   1.00 72.09  ?  483  VAL C CA    1 
ATOM   7369  C  C     . VAL C  2  483  ? 63.257  -40.504 87.559   1.00 66.86  ?  483  VAL C C     1 
ATOM   7370  O  O     . VAL C  2  483  ? 64.370  -40.500 87.031   1.00 49.13  ?  483  VAL C O     1 
ATOM   7371  C  CB    . VAL C  2  483  ? 63.806  -39.218 89.627   1.00 73.33  ?  483  VAL C CB    1 
ATOM   7372  C  CG1   . VAL C  2  483  ? 63.270  -37.970 88.944   1.00 74.42  ?  483  VAL C CG1   1 
ATOM   7373  C  CG2   . VAL C  2  483  ? 63.620  -39.130 91.131   1.00 74.12  ?  483  VAL C CG2   1 
ATOM   7374  N  N     . VAL C  2  484  ? 62.125  -40.526 86.863   1.00 71.67  ?  484  VAL C N     1 
ATOM   7375  C  CA    . VAL C  2  484  ? 62.118  -40.570 85.407   1.00 65.53  ?  484  VAL C CA    1 
ATOM   7376  C  C     . VAL C  2  484  ? 61.616  -39.256 84.815   1.00 62.28  ?  484  VAL C C     1 
ATOM   7377  O  O     . VAL C  2  484  ? 60.554  -38.758 85.191   1.00 57.99  ?  484  VAL C O     1 
ATOM   7378  C  CB    . VAL C  2  484  ? 61.232  -41.718 84.886   1.00 61.03  ?  484  VAL C CB    1 
ATOM   7379  C  CG1   . VAL C  2  484  ? 61.287  -41.785 83.368   1.00 56.51  ?  484  VAL C CG1   1 
ATOM   7380  C  CG2   . VAL C  2  484  ? 61.664  -43.040 85.499   1.00 69.04  ?  484  VAL C CG2   1 
ATOM   7381  N  N     . TYR C  2  485  ? 62.393  -38.698 83.892   1.00 58.77  ?  485  TYR C N     1 
ATOM   7382  C  CA    . TYR C  2  485  ? 61.986  -37.504 83.163   1.00 59.01  ?  485  TYR C CA    1 
ATOM   7383  C  C     . TYR C  2  485  ? 61.161  -37.884 81.939   1.00 71.49  ?  485  TYR C C     1 
ATOM   7384  O  O     . TYR C  2  485  ? 61.594  -38.688 81.112   1.00 81.53  ?  485  TYR C O     1 
ATOM   7385  C  CB    . TYR C  2  485  ? 63.211  -36.695 82.739   1.00 60.79  ?  485  TYR C CB    1 
ATOM   7386  C  CG    . TYR C  2  485  ? 63.784  -35.837 83.840   1.00 71.97  ?  485  TYR C CG    1 
ATOM   7387  C  CD1   . TYR C  2  485  ? 64.616  -36.379 84.811   1.00 81.18  ?  485  TYR C CD1   1 
ATOM   7388  C  CD2   . TYR C  2  485  ? 63.495  -34.482 83.907   1.00 74.73  ?  485  TYR C CD2   1 
ATOM   7389  C  CE1   . TYR C  2  485  ? 65.142  -35.593 85.820   1.00 81.01  ?  485  TYR C CE1   1 
ATOM   7390  C  CE2   . TYR C  2  485  ? 64.015  -33.691 84.908   1.00 72.03  ?  485  TYR C CE2   1 
ATOM   7391  C  CZ    . TYR C  2  485  ? 64.838  -34.249 85.863   1.00 73.40  ?  485  TYR C CZ    1 
ATOM   7392  O  OH    . TYR C  2  485  ? 65.357  -33.459 86.864   1.00 65.42  ?  485  TYR C OH    1 
ATOM   7393  N  N     . MET C  2  486  ? 59.973  -37.300 81.825   1.00 63.35  ?  486  MET C N     1 
ATOM   7394  C  CA    . MET C  2  486  ? 59.053  -37.650 80.750   1.00 55.90  ?  486  MET C CA    1 
ATOM   7395  C  C     . MET C  2  486  ? 58.561  -36.442 79.970   1.00 53.37  ?  486  MET C C     1 
ATOM   7396  O  O     . MET C  2  486  ? 58.194  -35.423 80.551   1.00 58.37  ?  486  MET C O     1 
ATOM   7397  C  CB    . MET C  2  486  ? 57.848  -38.401 81.312   1.00 47.79  ?  486  MET C CB    1 
ATOM   7398  C  CG    . MET C  2  486  ? 58.089  -39.871 81.554   1.00 48.96  ?  486  MET C CG    1 
ATOM   7399  S  SD    . MET C  2  486  ? 56.612  -40.665 82.202   1.00 55.68  ?  486  MET C SD    1 
ATOM   7400  C  CE    . MET C  2  486  ? 56.772  -40.304 83.944   1.00 60.30  ?  486  MET C CE    1 
ATOM   7401  N  N     . THR C  2  487  ? 58.543  -36.568 78.647   1.00 52.56  ?  487  THR C N     1 
ATOM   7402  C  CA    . THR C  2  487  ? 57.895  -35.573 77.807   1.00 54.48  ?  487  THR C CA    1 
ATOM   7403  C  C     . THR C  2  487  ? 56.388  -35.783 77.894   1.00 55.71  ?  487  THR C C     1 
ATOM   7404  O  O     . THR C  2  487  ? 55.921  -36.700 78.573   1.00 53.80  ?  487  THR C O     1 
ATOM   7405  C  CB    . THR C  2  487  ? 58.337  -35.686 76.338   1.00 59.26  ?  487  THR C CB    1 
ATOM   7406  O  OG1   . THR C  2  487  ? 57.878  -36.928 75.789   1.00 61.04  ?  487  THR C OG1   1 
ATOM   7407  C  CG2   . THR C  2  487  ? 59.854  -35.611 76.229   1.00 58.48  ?  487  THR C CG2   1 
ATOM   7408  N  N     . ALA C  2  488  ? 55.631  -34.940 77.201   1.00 51.42  ?  488  ALA C N     1 
ATOM   7409  C  CA    . ALA C  2  488  ? 54.173  -34.988 77.268   1.00 54.52  ?  488  ALA C CA    1 
ATOM   7410  C  C     . ALA C  2  488  ? 53.608  -36.311 76.748   1.00 63.49  ?  488  ALA C C     1 
ATOM   7411  O  O     . ALA C  2  488  ? 52.719  -36.905 77.367   1.00 59.80  ?  488  ALA C O     1 
ATOM   7412  C  CB    . ALA C  2  488  ? 53.573  -33.814 76.513   1.00 51.12  ?  488  ALA C CB    1 
ATOM   7413  N  N     . THR C  2  489  ? 54.134  -36.768 75.615   1.00 63.48  ?  489  THR C N     1 
ATOM   7414  C  CA    . THR C  2  489  ? 53.686  -38.014 75.001   1.00 56.48  ?  489  THR C CA    1 
ATOM   7415  C  C     . THR C  2  489  ? 53.902  -39.207 75.928   1.00 58.92  ?  489  THR C C     1 
ATOM   7416  O  O     . THR C  2  489  ? 53.026  -40.065 76.063   1.00 54.79  ?  489  THR C O     1 
ATOM   7417  C  CB    . THR C  2  489  ? 54.400  -38.272 73.661   1.00 51.45  ?  489  THR C CB    1 
ATOM   7418  O  OG1   . THR C  2  489  ? 55.818  -38.231 73.859   1.00 64.39  ?  489  THR C OG1   1 
ATOM   7419  C  CG2   . THR C  2  489  ? 54.006  -37.217 72.638   1.00 46.54  ?  489  THR C CG2   1 
ATOM   7420  N  N     . GLU C  2  490  ? 55.069  -39.254 76.565   1.00 53.51  ?  490  GLU C N     1 
ATOM   7421  C  CA    . GLU C  2  490  ? 55.371  -40.301 77.532   1.00 54.93  ?  490  GLU C CA    1 
ATOM   7422  C  C     . GLU C  2  490  ? 54.412  -40.209 78.711   1.00 58.84  ?  490  GLU C C     1 
ATOM   7423  O  O     . GLU C  2  490  ? 53.927  -41.222 79.214   1.00 66.99  ?  490  GLU C O     1 
ATOM   7424  C  CB    . GLU C  2  490  ? 56.811  -40.183 78.033   1.00 58.78  ?  490  GLU C CB    1 
ATOM   7425  C  CG    . GLU C  2  490  ? 57.876  -40.321 76.956   1.00 59.46  ?  490  GLU C CG    1 
ATOM   7426  C  CD    . GLU C  2  490  ? 59.282  -40.339 77.534   1.00 70.25  ?  490  GLU C CD    1 
ATOM   7427  O  OE1   . GLU C  2  490  ? 59.442  -40.767 78.698   1.00 65.92  ?  490  GLU C OE1   1 
ATOM   7428  O  OE2   . GLU C  2  490  ? 60.226  -39.922 76.829   1.00 62.99  ?  490  GLU C OE2   1 
ATOM   7429  N  N     . GLU C  2  491  ? 54.144  -38.980 79.141   1.00 52.04  ?  491  GLU C N     1 
ATOM   7430  C  CA    . GLU C  2  491  ? 53.250  -38.723 80.264   1.00 56.10  ?  491  GLU C CA    1 
ATOM   7431  C  C     . GLU C  2  491  ? 51.839  -39.244 79.993   1.00 61.83  ?  491  GLU C C     1 
ATOM   7432  O  O     . GLU C  2  491  ? 51.175  -39.760 80.895   1.00 56.98  ?  491  GLU C O     1 
ATOM   7433  C  CB    . GLU C  2  491  ? 53.214  -37.226 80.572   1.00 62.00  ?  491  GLU C CB    1 
ATOM   7434  C  CG    . GLU C  2  491  ? 52.218  -36.821 81.646   1.00 60.62  ?  491  GLU C CG    1 
ATOM   7435  C  CD    . GLU C  2  491  ? 52.244  -35.333 81.930   1.00 54.68  ?  491  GLU C CD    1 
ATOM   7436  O  OE1   . GLU C  2  491  ? 51.172  -34.696 81.863   1.00 54.67  ?  491  GLU C OE1   1 
ATOM   7437  O  OE2   . GLU C  2  491  ? 53.336  -34.801 82.224   1.00 53.24  ?  491  GLU C OE2   1 
ATOM   7438  N  N     . ASP C  2  492  ? 51.392  -39.117 78.746   1.00 66.26  ?  492  ASP C N     1 
ATOM   7439  C  CA    . ASP C  2  492  ? 50.053  -39.563 78.361   1.00 74.42  ?  492  ASP C CA    1 
ATOM   7440  C  C     . ASP C  2  492  ? 49.852  -41.070 78.526   1.00 68.21  ?  492  ASP C C     1 
ATOM   7441  O  O     . ASP C  2  492  ? 48.719  -41.547 78.610   1.00 56.59  ?  492  ASP C O     1 
ATOM   7442  C  CB    . ASP C  2  492  ? 49.743  -39.153 76.918   1.00 70.53  ?  492  ASP C CB    1 
ATOM   7443  C  CG    . ASP C  2  492  ? 49.437  -37.672 76.783   1.00 72.10  ?  492  ASP C CG    1 
ATOM   7444  O  OD1   . ASP C  2  492  ? 49.907  -36.886 77.633   1.00 65.66  ?  492  ASP C OD1   1 
ATOM   7445  O  OD2   . ASP C  2  492  ? 48.727  -37.294 75.827   1.00 77.28  ?  492  ASP C OD2   1 
ATOM   7446  N  N     . ARG C  2  493  ? 50.953  -41.812 78.577   1.00 68.73  ?  493  ARG C N     1 
ATOM   7447  C  CA    . ARG C  2  493  ? 50.895  -43.269 78.632   1.00 68.82  ?  493  ARG C CA    1 
ATOM   7448  C  C     . ARG C  2  493  ? 50.404  -43.804 79.976   1.00 73.55  ?  493  ARG C C     1 
ATOM   7449  O  O     . ARG C  2  493  ? 49.615  -44.749 80.023   1.00 72.65  ?  493  ARG C O     1 
ATOM   7450  C  CB    . ARG C  2  493  ? 52.265  -43.872 78.306   1.00 62.39  ?  493  ARG C CB    1 
ATOM   7451  C  CG    . ARG C  2  493  ? 52.861  -43.393 76.993   1.00 68.64  ?  493  ARG C CG    1 
ATOM   7452  C  CD    . ARG C  2  493  ? 54.188  -44.080 76.691   1.00 75.43  ?  493  ARG C CD    1 
ATOM   7453  N  NE    . ARG C  2  493  ? 54.025  -45.506 76.421   1.00 88.93  ?  493  ARG C NE    1 
ATOM   7454  C  CZ    . ARG C  2  493  ? 54.652  -46.473 77.085   1.00 78.39  ?  493  ARG C CZ    1 
ATOM   7455  N  NH1   . ARG C  2  493  ? 55.495  -46.173 78.063   1.00 63.20  ?  493  ARG C NH1   1 
ATOM   7456  N  NH2   . ARG C  2  493  ? 54.439  -47.743 76.767   1.00 78.51  ?  493  ARG C NH2   1 
ATOM   7457  N  N     . TYR C  2  494  ? 50.866  -43.198 81.066   1.00 75.84  ?  494  TYR C N     1 
ATOM   7458  C  CA    . TYR C  2  494  ? 50.639  -43.759 82.396   1.00 75.96  ?  494  TYR C CA    1 
ATOM   7459  C  C     . TYR C  2  494  ? 49.538  -43.057 83.189   1.00 70.62  ?  494  TYR C C     1 
ATOM   7460  O  O     . TYR C  2  494  ? 48.940  -42.083 82.730   1.00 67.37  ?  494  TYR C O     1 
ATOM   7461  C  CB    . TYR C  2  494  ? 51.941  -43.742 83.204   1.00 65.91  ?  494  TYR C CB    1 
ATOM   7462  C  CG    . TYR C  2  494  ? 53.162  -44.140 82.407   1.00 66.21  ?  494  TYR C CG    1 
ATOM   7463  C  CD1   . TYR C  2  494  ? 53.493  -45.475 82.224   1.00 69.55  ?  494  TYR C CD1   1 
ATOM   7464  C  CD2   . TYR C  2  494  ? 53.985  -43.178 81.838   1.00 65.56  ?  494  TYR C CD2   1 
ATOM   7465  C  CE1   . TYR C  2  494  ? 54.610  -45.842 81.495   1.00 81.80  ?  494  TYR C CE1   1 
ATOM   7466  C  CE2   . TYR C  2  494  ? 55.102  -43.535 81.107   1.00 70.08  ?  494  TYR C CE2   1 
ATOM   7467  C  CZ    . TYR C  2  494  ? 55.411  -44.866 80.939   1.00 77.48  ?  494  TYR C CZ    1 
ATOM   7468  O  OH    . TYR C  2  494  ? 56.525  -45.219 80.211   1.00 73.23  ?  494  TYR C OH    1 
ATOM   7469  N  N     . THR C  2  495  ? 49.287  -43.574 84.389   1.00 61.25  ?  495  THR C N     1 
ATOM   7470  C  CA    . THR C  2  495  ? 48.335  -42.990 85.323   1.00 59.37  ?  495  THR C CA    1 
ATOM   7471  C  C     . THR C  2  495  ? 49.112  -42.345 86.465   1.00 57.55  ?  495  THR C C     1 
ATOM   7472  O  O     . THR C  2  495  ? 49.724  -43.044 87.272   1.00 61.09  ?  495  THR C O     1 
ATOM   7473  C  CB    . THR C  2  495  ? 47.401  -44.070 85.903   1.00 53.01  ?  495  THR C CB    1 
ATOM   7474  O  OG1   . THR C  2  495  ? 46.652  -44.677 84.844   1.00 53.41  ?  495  THR C OG1   1 
ATOM   7475  C  CG2   . THR C  2  495  ? 46.444  -43.468 86.921   1.00 54.15  ?  495  THR C CG2   1 
ATOM   7476  N  N     . ILE C  2  496  ? 49.091  -41.017 86.540   1.00 55.91  ?  496  ILE C N     1 
ATOM   7477  C  CA    . ILE C  2  496  ? 49.947  -40.320 87.501   1.00 49.26  ?  496  ILE C CA    1 
ATOM   7478  C  C     . ILE C  2  496  ? 49.202  -39.767 88.715   1.00 52.02  ?  496  ILE C C     1 
ATOM   7479  O  O     . ILE C  2  496  ? 48.355  -38.885 88.590   1.00 58.29  ?  496  ILE C O     1 
ATOM   7480  C  CB    . ILE C  2  496  ? 50.752  -39.191 86.828   1.00 50.93  ?  496  ILE C CB    1 
ATOM   7481  C  CG1   . ILE C  2  496  ? 51.609  -39.757 85.694   1.00 50.42  ?  496  ILE C CG1   1 
ATOM   7482  C  CG2   . ILE C  2  496  ? 51.620  -38.475 87.850   1.00 52.79  ?  496  ILE C CG2   1 
ATOM   7483  C  CD1   . ILE C  2  496  ? 52.476  -38.728 85.005   1.00 43.49  ?  496  ILE C CD1   1 
ATOM   7484  N  N     . ALA C  2  497  ? 49.534  -40.292 89.891   1.00 60.28  ?  497  ALA C N     1 
ATOM   7485  C  CA    . ALA C  2  497  ? 48.921  -39.854 91.142   1.00 61.76  ?  497  ALA C CA    1 
ATOM   7486  C  C     . ALA C  2  497  ? 49.530  -38.551 91.649   1.00 61.58  ?  497  ALA C C     1 
ATOM   7487  O  O     . ALA C  2  497  ? 50.684  -38.238 91.355   1.00 55.35  ?  497  ALA C O     1 
ATOM   7488  C  CB    . ALA C  2  497  ? 49.036  -40.941 92.199   1.00 60.67  ?  497  ALA C CB    1 
ATOM   7489  N  N     . GLN C  2  498  ? 48.748  -37.800 92.419   1.00 65.54  ?  498  GLN C N     1 
ATOM   7490  C  CA    . GLN C  2  498  ? 49.198  -36.525 92.970   1.00 64.77  ?  498  GLN C CA    1 
ATOM   7491  C  C     . GLN C  2  498  ? 50.214  -36.711 94.094   1.00 60.97  ?  498  GLN C C     1 
ATOM   7492  O  O     . GLN C  2  498  ? 50.236  -37.745 94.762   1.00 63.43  ?  498  GLN C O     1 
ATOM   7493  C  CB    . GLN C  2  498  ? 48.007  -35.700 93.463   1.00 62.73  ?  498  GLN C CB    1 
ATOM   7494  C  CG    . GLN C  2  498  ? 47.123  -35.160 92.350   1.00 53.60  ?  498  GLN C CG    1 
ATOM   7495  C  CD    . GLN C  2  498  ? 47.846  -34.158 91.469   1.00 51.60  ?  498  GLN C CD    1 
ATOM   7496  O  OE1   . GLN C  2  498  ? 48.772  -33.479 91.912   1.00 46.49  ?  498  GLN C OE1   1 
ATOM   7497  N  NE2   . GLN C  2  498  ? 47.428  -34.066 90.212   1.00 49.75  ?  498  GLN C NE2   1 
ATOM   7498  N  N     . ALA C  2  499  ? 51.045  -35.694 94.303   1.00 60.18  ?  499  ALA C N     1 
ATOM   7499  C  CA    . ALA C  2  499  ? 52.122  -35.760 95.286   1.00 66.35  ?  499  ALA C CA    1 
ATOM   7500  C  C     . ALA C  2  499  ? 51.624  -35.633 96.725   1.00 71.29  ?  499  ALA C C     1 
ATOM   7501  O  O     . ALA C  2  499  ? 52.383  -35.851 97.670   1.00 74.03  ?  499  ALA C O     1 
ATOM   7502  C  CB    . ALA C  2  499  ? 53.173  -34.697 94.990   1.00 61.14  ?  499  ALA C CB    1 
ATOM   7503  N  N     . ASN C  2  500  ? 50.353  -35.281 96.888   1.00 64.26  ?  500  ASN C N     1 
ATOM   7504  C  CA    . ASN C  2  500  ? 49.774  -35.117 98.218   1.00 61.76  ?  500  ASN C CA    1 
ATOM   7505  C  C     . ASN C  2  500  ? 49.167  -36.416 98.739   1.00 71.27  ?  500  ASN C C     1 
ATOM   7506  O  O     . ASN C  2  500  ? 48.548  -36.439 99.803   1.00 80.49  ?  500  ASN C O     1 
ATOM   7507  C  CB    . ASN C  2  500  ? 48.723  -34.006 98.224   1.00 60.40  ?  500  ASN C CB    1 
ATOM   7508  C  CG    . ASN C  2  500  ? 47.389  -34.458 97.661   1.00 69.21  ?  500  ASN C CG    1 
ATOM   7509  O  OD1   . ASN C  2  500  ? 47.333  -35.180 96.666   1.00 75.36  ?  500  ASN C OD1   1 
ATOM   7510  N  ND2   . ASN C  2  500  ? 46.306  -34.041 98.304   1.00 63.26  ?  500  ASN C ND2   1 
ATOM   7511  N  N     . THR C  2  501  ? 49.335  -37.487 97.970   1.00 63.73  ?  501  THR C N     1 
ATOM   7512  C  CA    . THR C  2  501  ? 48.828  -38.801 98.344   1.00 65.56  ?  501  THR C CA    1 
ATOM   7513  C  C     . THR C  2  501  ? 49.436  -39.266 99.663   1.00 69.79  ?  501  THR C C     1 
ATOM   7514  O  O     . THR C  2  501  ? 50.656  -39.239 99.829   1.00 61.31  ?  501  THR C O     1 
ATOM   7515  C  CB    . THR C  2  501  ? 49.140  -39.844 97.256   1.00 65.65  ?  501  THR C CB    1 
ATOM   7516  O  OG1   . THR C  2  501  ? 48.657  -39.378 95.990   1.00 65.45  ?  501  THR C OG1   1 
ATOM   7517  C  CG2   . THR C  2  501  ? 48.486  -41.177 97.586   1.00 69.40  ?  501  THR C CG2   1 
ATOM   7518  N  N     . PRO C  2  502  ? 48.581  -39.684 100.612  1.00 76.00  ?  502  PRO C N     1 
ATOM   7519  C  CA    . PRO C  2  502  ? 49.013  -40.190 101.920  1.00 75.14  ?  502  PRO C CA    1 
ATOM   7520  C  C     . PRO C  2  502  ? 49.953  -41.387 101.794  1.00 79.53  ?  502  PRO C C     1 
ATOM   7521  O  O     . PRO C  2  502  ? 49.653  -42.334 101.067  1.00 76.82  ?  502  PRO C O     1 
ATOM   7522  C  CB    . PRO C  2  502  ? 47.699  -40.626 102.575  1.00 76.42  ?  502  PRO C CB    1 
ATOM   7523  C  CG    . PRO C  2  502  ? 46.659  -39.788 101.922  1.00 74.14  ?  502  PRO C CG    1 
ATOM   7524  C  CD    . PRO C  2  502  ? 47.113  -39.622 100.503  1.00 71.31  ?  502  PRO C CD    1 
ATOM   7525  N  N     . LEU C  2  503  ? 51.075  -41.341 102.507  1.00 84.42  ?  503  LEU C N     1 
ATOM   7526  C  CA    . LEU C  2  503  ? 52.070  -42.405 102.443  1.00 83.67  ?  503  LEU C CA    1 
ATOM   7527  C  C     . LEU C  2  503  ? 52.505  -42.871 103.830  1.00 97.25  ?  503  LEU C C     1 
ATOM   7528  O  O     . LEU C  2  503  ? 52.949  -42.069 104.652  1.00 99.89  ?  503  LEU C O     1 
ATOM   7529  C  CB    . LEU C  2  503  ? 53.304  -41.938 101.664  1.00 75.94  ?  503  LEU C CB    1 
ATOM   7530  C  CG    . LEU C  2  503  ? 53.140  -41.558 100.192  1.00 80.66  ?  503  LEU C CG    1 
ATOM   7531  C  CD1   . LEU C  2  503  ? 54.474  -41.123 99.602   1.00 60.59  ?  503  LEU C CD1   1 
ATOM   7532  C  CD2   . LEU C  2  503  ? 52.556  -42.716 99.402   1.00 80.69  ?  503  LEU C CD2   1 
ATOM   7533  N  N     . GLU C  2  504  ? 52.380  -44.171 104.083  1.00 99.90  ?  504  GLU C N     1 
ATOM   7534  C  CA    . GLU C  2  504  ? 52.994  -44.773 105.260  1.00 94.42  ?  504  GLU C CA    1 
ATOM   7535  C  C     . GLU C  2  504  ? 54.272  -45.474 104.808  1.00 92.21  ?  504  GLU C C     1 
ATOM   7536  O  O     . GLU C  2  504  ? 54.229  -46.506 104.136  1.00 80.81  ?  504  GLU C O     1 
ATOM   7537  C  CB    . GLU C  2  504  ? 52.036  -45.749 105.952  1.00 87.35  ?  504  GLU C CB    1 
ATOM   7538  C  CG    . GLU C  2  504  ? 51.289  -46.688 105.012  1.00 101.40 ?  504  GLU C CG    1 
ATOM   7539  C  CD    . GLU C  2  504  ? 50.492  -47.748 105.752  1.00 112.65 ?  504  GLU C CD    1 
ATOM   7540  O  OE1   . GLU C  2  504  ? 50.341  -47.630 106.987  1.00 113.90 ?  504  GLU C OE1   1 
ATOM   7541  O  OE2   . GLU C  2  504  ? 50.020  -48.702 105.098  1.00 109.11 ?  504  GLU C OE2   1 
ATOM   7542  N  N     . GLY C  2  505  ? 55.413  -44.906 105.180  1.00 94.14  ?  505  GLY C N     1 
ATOM   7543  C  CA    . GLY C  2  505  ? 56.675  -45.325 104.603  1.00 95.12  ?  505  GLY C CA    1 
ATOM   7544  C  C     . GLY C  2  505  ? 56.675  -44.971 103.128  1.00 93.58  ?  505  GLY C C     1 
ATOM   7545  O  O     . GLY C  2  505  ? 56.364  -43.839 102.758  1.00 92.01  ?  505  GLY C O     1 
ATOM   7546  N  N     . ASN C  2  506  ? 57.022  -45.934 102.281  1.00 89.69  ?  506  ASN C N     1 
ATOM   7547  C  CA    . ASN C  2  506  ? 56.966  -45.729 100.837  1.00 78.97  ?  506  ASN C CA    1 
ATOM   7548  C  C     . ASN C  2  506  ? 55.683  -46.264 100.198  1.00 79.37  ?  506  ASN C C     1 
ATOM   7549  O  O     . ASN C  2  506  ? 55.520  -46.210 98.979   1.00 85.45  ?  506  ASN C O     1 
ATOM   7550  C  CB    . ASN C  2  506  ? 58.201  -46.323 100.154  1.00 82.77  ?  506  ASN C CB    1 
ATOM   7551  C  CG    . ASN C  2  506  ? 59.484  -45.621 100.559  1.00 89.95  ?  506  ASN C CG    1 
ATOM   7552  O  OD1   . ASN C  2  506  ? 59.887  -44.632 99.944   1.00 81.42  ?  506  ASN C OD1   1 
ATOM   7553  N  ND2   . ASN C  2  506  ? 60.133  -46.129 101.601  1.00 99.68  ?  506  ASN C ND2   1 
ATOM   7554  N  N     . ARG C  2  507  ? 54.778  -46.780 101.024  1.00 72.17  ?  507  ARG C N     1 
ATOM   7555  C  CA    . ARG C  2  507  ? 53.536  -47.367 100.528  1.00 84.97  ?  507  ARG C CA    1 
ATOM   7556  C  C     . ARG C  2  507  ? 52.352  -46.402 100.637  1.00 86.35  ?  507  ARG C C     1 
ATOM   7557  O  O     . ARG C  2  507  ? 52.241  -45.647 101.602  1.00 87.26  ?  507  ARG C O     1 
ATOM   7558  C  CB    . ARG C  2  507  ? 53.231  -48.671 101.273  1.00 97.90  ?  507  ARG C CB    1 
ATOM   7559  C  CG    . ARG C  2  507  ? 52.031  -49.439 100.737  1.00 97.28  ?  507  ARG C CG    1 
ATOM   7560  C  CD    . ARG C  2  507  ? 51.812  -50.732 101.508  1.00 110.80 ?  507  ARG C CD    1 
ATOM   7561  N  NE    . ARG C  2  507  ? 52.947  -51.644 101.383  1.00 117.50 ?  507  ARG C NE    1 
ATOM   7562  C  CZ    . ARG C  2  507  ? 53.071  -52.555 100.423  1.00 112.03 ?  507  ARG C CZ    1 
ATOM   7563  N  NH1   . ARG C  2  507  ? 52.128  -52.679 99.498   1.00 105.98 ?  507  ARG C NH1   1 
ATOM   7564  N  NH2   . ARG C  2  507  ? 54.137  -53.342 100.387  1.00 109.61 ?  507  ARG C NH2   1 
ATOM   7565  N  N     . ILE C  2  508  ? 51.473  -46.435 99.639   1.00 84.60  ?  508  ILE C N     1 
ATOM   7566  C  CA    . ILE C  2  508  ? 50.283  -45.586 99.621   1.00 79.17  ?  508  ILE C CA    1 
ATOM   7567  C  C     . ILE C  2  508  ? 49.263  -46.032 100.668  1.00 80.98  ?  508  ILE C C     1 
ATOM   7568  O  O     . ILE C  2  508  ? 48.831  -47.184 100.675  1.00 83.70  ?  508  ILE C O     1 
ATOM   7569  C  CB    . ILE C  2  508  ? 49.626  -45.585 98.226   1.00 76.34  ?  508  ILE C CB    1 
ATOM   7570  C  CG1   . ILE C  2  508  ? 50.582  -44.983 97.191   1.00 67.66  ?  508  ILE C CG1   1 
ATOM   7571  C  CG2   . ILE C  2  508  ? 48.308  -44.825 98.252   1.00 81.05  ?  508  ILE C CG2   1 
ATOM   7572  C  CD1   . ILE C  2  508  ? 50.023  -44.940 95.787   1.00 62.25  ?  508  ILE C CD1   1 
ATOM   7573  N  N     . ALA C  2  509  ? 48.880  -45.111 101.549  1.00 78.75  ?  509  ALA C N     1 
ATOM   7574  C  CA    . ALA C  2  509  ? 47.995  -45.437 102.666  1.00 82.98  ?  509  ALA C CA    1 
ATOM   7575  C  C     . ALA C  2  509  ? 46.509  -45.227 102.367  1.00 81.51  ?  509  ALA C C     1 
ATOM   7576  O  O     . ALA C  2  509  ? 45.652  -45.614 103.161  1.00 79.72  ?  509  ALA C O     1 
ATOM   7577  C  CB    . ALA C  2  509  ? 48.402  -44.650 103.906  1.00 73.42  ?  509  ALA C CB    1 
ATOM   7578  N  N     . ALA C  2  510  ? 46.206  -44.620 101.224  1.00 80.05  ?  510  ALA C N     1 
ATOM   7579  C  CA    . ALA C  2  510  ? 44.822  -44.306 100.876  1.00 82.61  ?  510  ALA C CA    1 
ATOM   7580  C  C     . ALA C  2  510  ? 44.231  -45.320 99.901   1.00 83.39  ?  510  ALA C C     1 
ATOM   7581  O  O     . ALA C  2  510  ? 44.886  -45.720 98.939   1.00 83.28  ?  510  ALA C O     1 
ATOM   7582  C  CB    . ALA C  2  510  ? 44.726  -42.898 100.305  1.00 81.72  ?  510  ALA C CB    1 
ATOM   7583  N  N     . GLU C  2  511  ? 42.990  -45.729 100.152  1.00 79.99  ?  511  GLU C N     1 
ATOM   7584  C  CA    . GLU C  2  511  ? 42.309  -46.686 99.284   1.00 87.09  ?  511  GLU C CA    1 
ATOM   7585  C  C     . GLU C  2  511  ? 41.953  -46.066 97.937   1.00 89.55  ?  511  GLU C C     1 
ATOM   7586  O  O     . GLU C  2  511  ? 42.187  -46.662 96.887   1.00 90.13  ?  511  GLU C O     1 
ATOM   7587  C  CB    . GLU C  2  511  ? 41.052  -47.241 99.958   1.00 82.99  ?  511  GLU C CB    1 
ATOM   7588  C  CG    . GLU C  2  511  ? 40.216  -48.143 99.057   1.00 95.00  ?  511  GLU C CG    1 
ATOM   7589  C  CD    . GLU C  2  511  ? 41.009  -49.309 98.490   1.00 110.23 ?  511  GLU C CD    1 
ATOM   7590  O  OE1   . GLU C  2  511  ? 41.808  -49.910 99.240   1.00 119.45 ?  511  GLU C OE1   1 
ATOM   7591  O  OE2   . GLU C  2  511  ? 40.837  -49.621 97.292   1.00 99.96  ?  511  GLU C OE2   1 
ATOM   7592  N  N     . ARG C  2  512  ? 41.380  -44.868 97.972   1.00 85.02  ?  512  ARG C N     1 
ATOM   7593  C  CA    . ARG C  2  512  ? 41.077  -44.145 96.744   1.00 81.16  ?  512  ARG C CA    1 
ATOM   7594  C  C     . ARG C  2  512  ? 42.040  -42.977 96.555   1.00 79.64  ?  512  ARG C C     1 
ATOM   7595  O  O     . ARG C  2  512  ? 42.006  -41.999 97.301   1.00 84.32  ?  512  ARG C O     1 
ATOM   7596  C  CB    . ARG C  2  512  ? 39.621  -43.672 96.733   1.00 81.12  ?  512  ARG C CB    1 
ATOM   7597  C  CG    . ARG C  2  512  ? 38.887  -43.865 98.051   1.00 77.03  ?  512  ARG C CG    1 
ATOM   7598  C  CD    . ARG C  2  512  ? 37.381  -43.806 97.846   1.00 71.03  ?  512  ARG C CD    1 
ATOM   7599  N  NE    . ARG C  2  512  ? 36.996  -42.708 96.964   1.00 79.04  ?  512  ARG C NE    1 
ATOM   7600  C  CZ    . ARG C  2  512  ? 36.742  -41.470 97.375   1.00 78.13  ?  512  ARG C CZ    1 
ATOM   7601  N  NH1   . ARG C  2  512  ? 36.831  -41.164 98.662   1.00 85.28  ?  512  ARG C NH1   1 
ATOM   7602  N  NH2   . ARG C  2  512  ? 36.400  -40.536 96.498   1.00 67.49  ?  512  ARG C NH2   1 
ATOM   7603  N  N     . VAL C  2  513  ? 42.901  -43.096 95.550   1.00 73.57  ?  513  VAL C N     1 
ATOM   7604  C  CA    . VAL C  2  513  ? 43.946  -42.112 95.297   1.00 73.48  ?  513  VAL C CA    1 
ATOM   7605  C  C     . VAL C  2  513  ? 43.620  -41.242 94.082   1.00 77.29  ?  513  VAL C C     1 
ATOM   7606  O  O     . VAL C  2  513  ? 43.161  -41.739 93.051   1.00 72.83  ?  513  VAL C O     1 
ATOM   7607  C  CB    . VAL C  2  513  ? 45.320  -42.801 95.112   1.00 66.11  ?  513  VAL C CB    1 
ATOM   7608  C  CG1   . VAL C  2  513  ? 45.208  -43.960 94.136   1.00 76.01  ?  513  VAL C CG1   1 
ATOM   7609  C  CG2   . VAL C  2  513  ? 46.378  -41.807 94.657   1.00 68.39  ?  513  VAL C CG2   1 
ATOM   7610  N  N     . VAL C  2  514  ? 43.850  -39.939 94.218   1.00 77.90  ?  514  VAL C N     1 
ATOM   7611  C  CA    . VAL C  2  514  ? 43.604  -38.995 93.137   1.00 66.85  ?  514  VAL C CA    1 
ATOM   7612  C  C     . VAL C  2  514  ? 44.733  -39.047 92.117   1.00 61.67  ?  514  VAL C C     1 
ATOM   7613  O  O     . VAL C  2  514  ? 45.895  -38.805 92.449   1.00 57.59  ?  514  VAL C O     1 
ATOM   7614  C  CB    . VAL C  2  514  ? 43.485  -37.556 93.671   1.00 61.79  ?  514  VAL C CB    1 
ATOM   7615  C  CG1   . VAL C  2  514  ? 43.442  -36.562 92.521   1.00 65.38  ?  514  VAL C CG1   1 
ATOM   7616  C  CG2   . VAL C  2  514  ? 42.258  -37.417 94.559   1.00 54.93  ?  514  VAL C CG2   1 
ATOM   7617  N  N     . ALA C  2  515  ? 44.387  -39.362 90.874   1.00 62.33  ?  515  ALA C N     1 
ATOM   7618  C  CA    . ALA C  2  515  ? 45.380  -39.448 89.811   1.00 63.12  ?  515  ALA C CA    1 
ATOM   7619  C  C     . ALA C  2  515  ? 44.854  -38.845 88.516   1.00 59.26  ?  515  ALA C C     1 
ATOM   7620  O  O     . ALA C  2  515  ? 43.724  -38.365 88.457   1.00 61.41  ?  515  ALA C O     1 
ATOM   7621  C  CB    . ALA C  2  515  ? 45.800  -40.891 89.592   1.00 62.46  ?  515  ALA C CB    1 
ATOM   7622  N  N     . ARG C  2  516  ? 45.680  -38.870 87.477   1.00 55.99  ?  516  ARG C N     1 
ATOM   7623  C  CA    . ARG C  2  516  ? 45.279  -38.335 86.184   1.00 62.21  ?  516  ARG C CA    1 
ATOM   7624  C  C     . ARG C  2  516  ? 45.801  -39.179 85.022   1.00 64.39  ?  516  ARG C C     1 
ATOM   7625  O  O     . ARG C  2  516  ? 46.938  -39.668 85.047   1.00 60.99  ?  516  ARG C O     1 
ATOM   7626  C  CB    . ARG C  2  516  ? 45.715  -36.871 86.042   1.00 55.30  ?  516  ARG C CB    1 
ATOM   7627  C  CG    . ARG C  2  516  ? 47.198  -36.628 86.271   1.00 51.97  ?  516  ARG C CG    1 
ATOM   7628  C  CD    . ARG C  2  516  ? 47.525  -35.142 86.275   1.00 38.85  ?  516  ARG C CD    1 
ATOM   7629  N  NE    . ARG C  2  516  ? 48.963  -34.909 86.378   1.00 39.11  ?  516  ARG C NE    1 
ATOM   7630  C  CZ    . ARG C  2  516  ? 49.774  -34.788 85.332   1.00 46.12  ?  516  ARG C CZ    1 
ATOM   7631  N  NH1   . ARG C  2  516  ? 49.289  -34.873 84.100   1.00 49.13  ?  516  ARG C NH1   1 
ATOM   7632  N  NH2   . ARG C  2  516  ? 51.071  -34.583 85.514   1.00 42.52  ?  516  ARG C NH2   1 
ATOM   7633  N  N     . ARG C  2  517  ? 44.942  -39.358 84.022   1.00 63.67  ?  517  ARG C N     1 
ATOM   7634  C  CA    . ARG C  2  517  ? 45.277  -40.077 82.799   1.00 58.22  ?  517  ARG C CA    1 
ATOM   7635  C  C     . ARG C  2  517  ? 45.091  -39.154 81.601   1.00 58.54  ?  517  ARG C C     1 
ATOM   7636  O  O     . ARG C  2  517  ? 43.967  -38.760 81.282   1.00 59.08  ?  517  ARG C O     1 
ATOM   7637  C  CB    . ARG C  2  517  ? 44.389  -41.313 82.653   1.00 64.15  ?  517  ARG C CB    1 
ATOM   7638  C  CG    . ARG C  2  517  ? 44.589  -42.347 83.749   1.00 66.68  ?  517  ARG C CG    1 
ATOM   7639  C  CD    . ARG C  2  517  ? 43.468  -43.373 83.765   1.00 61.25  ?  517  ARG C CD    1 
ATOM   7640  N  NE    . ARG C  2  517  ? 43.716  -44.426 84.746   1.00 52.02  ?  517  ARG C NE    1 
ATOM   7641  C  CZ    . ARG C  2  517  ? 42.807  -45.312 85.137   1.00 58.65  ?  517  ARG C CZ    1 
ATOM   7642  N  NH1   . ARG C  2  517  ? 41.579  -45.272 84.638   1.00 57.93  ?  517  ARG C NH1   1 
ATOM   7643  N  NH2   . ARG C  2  517  ? 43.125  -46.236 86.034   1.00 67.36  ?  517  ARG C NH2   1 
ATOM   7644  N  N     . LYS C  2  518  ? 46.199  -38.823 80.941   1.00 63.60  ?  518  LYS C N     1 
ATOM   7645  C  CA    . LYS C  2  518  ? 46.222  -37.820 79.874   1.00 66.63  ?  518  LYS C CA    1 
ATOM   7646  C  C     . LYS C  2  518  ? 45.655  -36.483 80.344   1.00 63.19  ?  518  LYS C C     1 
ATOM   7647  O  O     . LYS C  2  518  ? 44.987  -35.779 79.588   1.00 51.80  ?  518  LYS C O     1 
ATOM   7648  C  CB    . LYS C  2  518  ? 45.486  -38.305 78.620   1.00 65.76  ?  518  LYS C CB    1 
ATOM   7649  C  CG    . LYS C  2  518  ? 46.074  -39.552 77.982   1.00 64.40  ?  518  LYS C CG    1 
ATOM   7650  C  CD    . LYS C  2  518  ? 45.624  -39.684 76.535   1.00 64.09  ?  518  LYS C CD    1 
ATOM   7651  C  CE    . LYS C  2  518  ? 45.513  -41.140 76.118   1.00 55.90  ?  518  LYS C CE    1 
ATOM   7652  N  NZ    . LYS C  2  518  ? 44.402  -41.826 76.836   1.00 54.67  ?  518  LYS C NZ    1 
ATOM   7653  N  N     . GLY C  2  519  ? 45.920  -36.148 81.603   1.00 64.06  ?  519  GLY C N     1 
ATOM   7654  C  CA    . GLY C  2  519  ? 45.501  -34.880 82.170   1.00 58.45  ?  519  GLY C CA    1 
ATOM   7655  C  C     . GLY C  2  519  ? 44.125  -34.910 82.806   1.00 54.88  ?  519  GLY C C     1 
ATOM   7656  O  O     . GLY C  2  519  ? 43.815  -34.082 83.662   1.00 51.78  ?  519  GLY C O     1 
ATOM   7657  N  N     . GLU C  2  520  ? 43.300  -35.870 82.401   1.00 49.66  ?  520  GLU C N     1 
ATOM   7658  C  CA    . GLU C  2  520  ? 41.931  -35.950 82.894   1.00 55.21  ?  520  GLU C CA    1 
ATOM   7659  C  C     . GLU C  2  520  ? 41.893  -36.475 84.327   1.00 59.55  ?  520  GLU C C     1 
ATOM   7660  O  O     . GLU C  2  520  ? 42.350  -37.586 84.594   1.00 69.86  ?  520  GLU C O     1 
ATOM   7661  C  CB    . GLU C  2  520  ? 41.081  -36.837 81.981   1.00 62.57  ?  520  GLU C CB    1 
ATOM   7662  C  CG    . GLU C  2  520  ? 39.580  -36.699 82.199   1.00 69.76  ?  520  GLU C CG    1 
ATOM   7663  C  CD    . GLU C  2  520  ? 39.051  -35.335 81.787   1.00 78.23  ?  520  GLU C CD    1 
ATOM   7664  O  OE1   . GLU C  2  520  ? 38.006  -34.912 82.328   1.00 75.06  ?  520  GLU C OE1   1 
ATOM   7665  O  OE2   . GLU C  2  520  ? 39.676  -34.686 80.920   1.00 67.87  ?  520  GLU C OE2   1 
ATOM   7666  N  N     . PRO C  2  521  ? 41.351  -35.670 85.254   1.00 60.47  ?  521  PRO C N     1 
ATOM   7667  C  CA    . PRO C  2  521  ? 41.263  -36.044 86.671   1.00 63.55  ?  521  PRO C CA    1 
ATOM   7668  C  C     . PRO C  2  521  ? 40.413  -37.293 86.884   1.00 65.85  ?  521  PRO C C     1 
ATOM   7669  O  O     . PRO C  2  521  ? 39.292  -37.379 86.379   1.00 55.28  ?  521  PRO C O     1 
ATOM   7670  C  CB    . PRO C  2  521  ? 40.585  -34.829 87.312   1.00 55.79  ?  521  PRO C CB    1 
ATOM   7671  C  CG    . PRO C  2  521  ? 40.875  -33.700 86.387   1.00 53.70  ?  521  PRO C CG    1 
ATOM   7672  C  CD    . PRO C  2  521  ? 40.853  -34.305 85.017   1.00 63.36  ?  521  PRO C CD    1 
ATOM   7673  N  N     . VAL C  2  522  ? 40.953  -38.248 87.633   1.00 68.19  ?  522  VAL C N     1 
ATOM   7674  C  CA    . VAL C  2  522  ? 40.274  -39.514 87.868   1.00 67.94  ?  522  VAL C CA    1 
ATOM   7675  C  C     . VAL C  2  522  ? 40.657  -40.100 89.231   1.00 69.74  ?  522  VAL C C     1 
ATOM   7676  O  O     . VAL C  2  522  ? 41.800  -39.972 89.677   1.00 66.83  ?  522  VAL C O     1 
ATOM   7677  C  CB    . VAL C  2  522  ? 40.584  -40.522 86.732   1.00 69.51  ?  522  VAL C CB    1 
ATOM   7678  C  CG1   . VAL C  2  522  ? 42.088  -40.749 86.608   1.00 59.85  ?  522  VAL C CG1   1 
ATOM   7679  C  CG2   . VAL C  2  522  ? 39.839  -41.837 86.941   1.00 70.91  ?  522  VAL C CG2   1 
ATOM   7680  N  N     . ILE C  2  523  ? 39.691  -40.727 89.894   1.00 71.24  ?  523  ILE C N     1 
ATOM   7681  C  CA    . ILE C  2  523  ? 39.939  -41.385 91.170   1.00 67.13  ?  523  ILE C CA    1 
ATOM   7682  C  C     . ILE C  2  523  ? 40.206  -42.878 90.954   1.00 76.29  ?  523  ILE C C     1 
ATOM   7683  O  O     . ILE C  2  523  ? 39.432  -43.569 90.288   1.00 80.16  ?  523  ILE C O     1 
ATOM   7684  C  CB    . ILE C  2  523  ? 38.776  -41.148 92.168   1.00 70.10  ?  523  ILE C CB    1 
ATOM   7685  C  CG1   . ILE C  2  523  ? 39.101  -41.757 93.532   1.00 82.63  ?  523  ILE C CG1   1 
ATOM   7686  C  CG2   . ILE C  2  523  ? 37.447  -41.660 91.610   1.00 63.84  ?  523  ILE C CG2   1 
ATOM   7687  C  CD1   . ILE C  2  523  ? 40.186  -41.013 94.276   1.00 78.93  ?  523  ILE C CD1   1 
ATOM   7688  N  N     . VAL C  2  524  ? 41.317  -43.368 91.497   1.00 76.33  ?  524  VAL C N     1 
ATOM   7689  C  CA    . VAL C  2  524  ? 41.766  -44.734 91.218   1.00 76.51  ?  524  VAL C CA    1 
ATOM   7690  C  C     . VAL C  2  524  ? 42.212  -45.498 92.463   1.00 83.08  ?  524  VAL C C     1 
ATOM   7691  O  O     . VAL C  2  524  ? 42.030  -45.041 93.591   1.00 84.06  ?  524  VAL C O     1 
ATOM   7692  C  CB    . VAL C  2  524  ? 42.914  -44.764 90.184   1.00 66.45  ?  524  VAL C CB    1 
ATOM   7693  C  CG1   . VAL C  2  524  ? 42.414  -44.344 88.810   1.00 69.25  ?  524  VAL C CG1   1 
ATOM   7694  C  CG2   . VAL C  2  524  ? 44.062  -43.881 90.637   1.00 71.45  ?  524  VAL C CG2   1 
ATOM   7695  N  N     . SER C  2  525  ? 42.792  -46.674 92.236   1.00 85.07  ?  525  SER C N     1 
ATOM   7696  C  CA    . SER C  2  525  ? 43.286  -47.527 93.309   1.00 81.74  ?  525  SER C CA    1 
ATOM   7697  C  C     . SER C  2  525  ? 44.813  -47.587 93.215   1.00 77.18  ?  525  SER C C     1 
ATOM   7698  O  O     . SER C  2  525  ? 45.368  -47.466 92.122   1.00 74.44  ?  525  SER C O     1 
ATOM   7699  C  CB    . SER C  2  525  ? 42.682  -48.929 93.165   1.00 80.75  ?  525  SER C CB    1 
ATOM   7700  O  OG    . SER C  2  525  ? 42.824  -49.693 94.350   1.00 75.88  ?  525  SER C OG    1 
ATOM   7701  N  N     . PRO C  2  526  ? 45.498  -47.767 94.360   1.00 78.21  ?  526  PRO C N     1 
ATOM   7702  C  CA    . PRO C  2  526  ? 46.968  -47.756 94.418   1.00 75.61  ?  526  PRO C CA    1 
ATOM   7703  C  C     . PRO C  2  526  ? 47.644  -48.786 93.514   1.00 84.74  ?  526  PRO C C     1 
ATOM   7704  O  O     . PRO C  2  526  ? 48.824  -48.631 93.194   1.00 78.06  ?  526  PRO C O     1 
ATOM   7705  C  CB    . PRO C  2  526  ? 47.258  -48.082 95.885   1.00 72.56  ?  526  PRO C CB    1 
ATOM   7706  C  CG    . PRO C  2  526  ? 46.071  -47.581 96.613   1.00 74.32  ?  526  PRO C CG    1 
ATOM   7707  C  CD    . PRO C  2  526  ? 44.904  -47.841 95.707   1.00 77.22  ?  526  PRO C CD    1 
ATOM   7708  N  N     . GLU C  2  527  ? 46.913  -49.823 93.115   1.00 94.37  ?  527  GLU C N     1 
ATOM   7709  C  CA    . GLU C  2  527  ? 47.455  -50.829 92.209   1.00 86.39  ?  527  GLU C CA    1 
ATOM   7710  C  C     . GLU C  2  527  ? 47.605  -50.264 90.802   1.00 83.79  ?  527  GLU C C     1 
ATOM   7711  O  O     . GLU C  2  527  ? 48.469  -50.695 90.038   1.00 85.17  ?  527  GLU C O     1 
ATOM   7712  C  CB    . GLU C  2  527  ? 46.566  -52.076 92.180   1.00 83.62  ?  527  GLU C CB    1 
ATOM   7713  C  CG    . GLU C  2  527  ? 46.558  -52.881 93.473   1.00 93.35  ?  527  GLU C CG    1 
ATOM   7714  C  CD    . GLU C  2  527  ? 45.645  -52.289 94.530   1.00 93.32  ?  527  GLU C CD    1 
ATOM   7715  O  OE1   . GLU C  2  527  ? 44.761  -51.482 94.171   1.00 86.95  ?  527  GLU C OE1   1 
ATOM   7716  O  OE2   . GLU C  2  527  ? 45.813  -52.632 95.720   1.00 96.17  ?  527  GLU C OE2   1 
ATOM   7717  N  N     . GLU C  2  528  ? 46.763  -49.290 90.470   1.00 80.40  ?  528  GLU C N     1 
ATOM   7718  C  CA    . GLU C  2  528  ? 46.724  -48.731 89.124   1.00 72.56  ?  528  GLU C CA    1 
ATOM   7719  C  C     . GLU C  2  528  ? 47.692  -47.565 88.950   1.00 68.86  ?  528  GLU C C     1 
ATOM   7720  O  O     . GLU C  2  528  ? 47.846  -47.040 87.847   1.00 70.69  ?  528  GLU C O     1 
ATOM   7721  C  CB    . GLU C  2  528  ? 45.304  -48.280 88.780   1.00 67.82  ?  528  GLU C CB    1 
ATOM   7722  C  CG    . GLU C  2  528  ? 44.230  -49.299 89.125   1.00 78.80  ?  528  GLU C CG    1 
ATOM   7723  C  CD    . GLU C  2  528  ? 42.845  -48.853 88.697   1.00 82.87  ?  528  GLU C CD    1 
ATOM   7724  O  OE1   . GLU C  2  528  ? 41.900  -48.995 89.502   1.00 81.07  ?  528  GLU C OE1   1 
ATOM   7725  O  OE2   . GLU C  2  528  ? 42.701  -48.368 87.554   1.00 77.17  ?  528  GLU C OE2   1 
ATOM   7726  N  N     . VAL C  2  529  ? 48.345  -47.164 90.036   1.00 70.72  ?  529  VAL C N     1 
ATOM   7727  C  CA    . VAL C  2  529  ? 49.239  -46.013 89.992   1.00 69.93  ?  529  VAL C CA    1 
ATOM   7728  C  C     . VAL C  2  529  ? 50.602  -46.394 89.420   1.00 64.70  ?  529  VAL C C     1 
ATOM   7729  O  O     . VAL C  2  529  ? 51.335  -47.188 90.010   1.00 72.40  ?  529  VAL C O     1 
ATOM   7730  C  CB    . VAL C  2  529  ? 49.433  -45.432 91.404   1.00 64.42  ?  529  VAL C CB    1 
ATOM   7731  C  CG1   . VAL C  2  529  ? 50.464  -44.325 91.390   1.00 60.16  ?  529  VAL C CG1   1 
ATOM   7732  C  CG2   . VAL C  2  529  ? 48.108  -44.934 91.958   1.00 59.11  ?  529  VAL C CG2   1 
ATOM   7733  N  N     . GLU C  2  530  ? 50.937  -45.822 88.266   1.00 56.45  ?  530  GLU C N     1 
ATOM   7734  C  CA    . GLU C  2  530  ? 52.221  -46.095 87.626   1.00 65.01  ?  530  GLU C CA    1 
ATOM   7735  C  C     . GLU C  2  530  ? 53.307  -45.057 87.923   1.00 66.38  ?  530  GLU C C     1 
ATOM   7736  O  O     . GLU C  2  530  ? 54.485  -45.301 87.662   1.00 63.35  ?  530  GLU C O     1 
ATOM   7737  C  CB    . GLU C  2  530  ? 52.028  -46.246 86.115   1.00 64.25  ?  530  GLU C CB    1 
ATOM   7738  C  CG    . GLU C  2  530  ? 50.903  -47.201 85.743   1.00 66.52  ?  530  GLU C CG    1 
ATOM   7739  C  CD    . GLU C  2  530  ? 50.655  -47.265 84.249   1.00 72.82  ?  530  GLU C CD    1 
ATOM   7740  O  OE1   . GLU C  2  530  ? 49.494  -47.066 83.830   1.00 69.66  ?  530  GLU C OE1   1 
ATOM   7741  O  OE2   . GLU C  2  530  ? 51.616  -47.520 83.494   1.00 70.87  ?  530  GLU C OE2   1 
ATOM   7742  N  N     . PHE C  2  531  ? 52.912  -43.920 88.491   1.00 69.56  ?  531  PHE C N     1 
ATOM   7743  C  CA    . PHE C  2  531  ? 53.847  -42.830 88.781   1.00 65.61  ?  531  PHE C CA    1 
ATOM   7744  C  C     . PHE C  2  531  ? 53.305  -41.878 89.845   1.00 67.16  ?  531  PHE C C     1 
ATOM   7745  O  O     . PHE C  2  531  ? 52.169  -42.011 90.294   1.00 59.58  ?  531  PHE C O     1 
ATOM   7746  C  CB    . PHE C  2  531  ? 54.161  -42.024 87.514   1.00 60.13  ?  531  PHE C CB    1 
ATOM   7747  C  CG    . PHE C  2  531  ? 55.235  -42.627 86.650   1.00 74.12  ?  531  PHE C CG    1 
ATOM   7748  C  CD1   . PHE C  2  531  ? 56.568  -42.539 87.016   1.00 76.36  ?  531  PHE C CD1   1 
ATOM   7749  C  CD2   . PHE C  2  531  ? 54.914  -43.262 85.460   1.00 76.14  ?  531  PHE C CD2   1 
ATOM   7750  C  CE1   . PHE C  2  531  ? 57.561  -43.087 86.221   1.00 72.95  ?  531  PHE C CE1   1 
ATOM   7751  C  CE2   . PHE C  2  531  ? 55.901  -43.813 84.661   1.00 70.46  ?  531  PHE C CE2   1 
ATOM   7752  C  CZ    . PHE C  2  531  ? 57.226  -43.723 85.042   1.00 65.68  ?  531  PHE C CZ    1 
ATOM   7753  N  N     . MET C  2  532  ? 54.123  -40.904 90.230   1.00 66.63  ?  532  MET C N     1 
ATOM   7754  C  CA    . MET C  2  532  ? 53.709  -39.889 91.192   1.00 60.32  ?  532  MET C CA    1 
ATOM   7755  C  C     . MET C  2  532  ? 54.500  -38.602 90.983   1.00 60.21  ?  532  MET C C     1 
ATOM   7756  O  O     . MET C  2  532  ? 55.653  -38.637 90.558   1.00 61.47  ?  532  MET C O     1 
ATOM   7757  C  CB    . MET C  2  532  ? 53.877  -40.403 92.626   1.00 64.43  ?  532  MET C CB    1 
ATOM   7758  C  CG    . MET C  2  532  ? 53.456  -39.416 93.705   1.00 59.92  ?  532  MET C CG    1 
ATOM   7759  S  SD    . MET C  2  532  ? 53.297  -40.165 95.336   1.00 64.41  ?  532  MET C SD    1 
ATOM   7760  C  CE    . MET C  2  532  ? 51.888  -41.241 95.075   1.00 57.88  ?  532  MET C CE    1 
ATOM   7761  N  N     . ASP C  2  533  ? 53.875  -37.467 91.275   1.00 66.95  ?  533  ASP C N     1 
ATOM   7762  C  CA    . ASP C  2  533  ? 54.547  -36.179 91.166   1.00 65.50  ?  533  ASP C CA    1 
ATOM   7763  C  C     . ASP C  2  533  ? 55.635  -36.036 92.227   1.00 56.60  ?  533  ASP C C     1 
ATOM   7764  O  O     . ASP C  2  533  ? 55.468  -36.474 93.366   1.00 51.04  ?  533  ASP C O     1 
ATOM   7765  C  CB    . ASP C  2  533  ? 53.537  -35.036 91.288   1.00 63.48  ?  533  ASP C CB    1 
ATOM   7766  C  CG    . ASP C  2  533  ? 52.489  -35.066 90.192   1.00 63.03  ?  533  ASP C CG    1 
ATOM   7767  O  OD1   . ASP C  2  533  ? 52.781  -34.578 89.080   1.00 59.77  ?  533  ASP C OD1   1 
ATOM   7768  O  OD2   . ASP C  2  533  ? 51.374  -35.572 90.442   1.00 62.89  ?  533  ASP C OD2   1 
ATOM   7769  N  N     . VAL C  2  534  ? 56.751  -35.428 91.840   1.00 50.82  ?  534  VAL C N     1 
ATOM   7770  C  CA    . VAL C  2  534  ? 57.854  -35.176 92.759   1.00 53.84  ?  534  VAL C CA    1 
ATOM   7771  C  C     . VAL C  2  534  ? 57.436  -34.186 93.842   1.00 64.52  ?  534  VAL C C     1 
ATOM   7772  O  O     . VAL C  2  534  ? 57.771  -34.355 95.017   1.00 70.52  ?  534  VAL C O     1 
ATOM   7773  C  CB    . VAL C  2  534  ? 59.083  -34.621 92.010   1.00 56.09  ?  534  VAL C CB    1 
ATOM   7774  C  CG1   . VAL C  2  534  ? 60.151  -34.154 92.989   1.00 62.63  ?  534  VAL C CG1   1 
ATOM   7775  C  CG2   . VAL C  2  534  ? 59.642  -35.668 91.063   1.00 58.56  ?  534  VAL C CG2   1 
ATOM   7776  N  N     . SER C  2  535  ? 56.676  -33.173 93.435   1.00 65.79  ?  535  SER C N     1 
ATOM   7777  C  CA    . SER C  2  535  ? 56.312  -32.061 94.306   1.00 57.41  ?  535  SER C CA    1 
ATOM   7778  C  C     . SER C  2  535  ? 55.377  -31.113 93.565   1.00 53.42  ?  535  SER C C     1 
ATOM   7779  O  O     . SER C  2  535  ? 55.418  -31.038 92.338   1.00 50.93  ?  535  SER C O     1 
ATOM   7780  C  CB    . SER C  2  535  ? 57.570  -31.299 94.733   1.00 57.26  ?  535  SER C CB    1 
ATOM   7781  O  OG    . SER C  2  535  ? 57.254  -30.138 95.482   1.00 53.06  ?  535  SER C OG    1 
ATOM   7782  N  N     . PRO C  2  536  ? 54.519  -30.393 94.305   1.00 48.72  ?  536  PRO C N     1 
ATOM   7783  C  CA    . PRO C  2  536  ? 53.684  -29.354 93.693   1.00 43.83  ?  536  PRO C CA    1 
ATOM   7784  C  C     . PRO C  2  536  ? 54.540  -28.288 93.014   1.00 42.69  ?  536  PRO C C     1 
ATOM   7785  O  O     . PRO C  2  536  ? 54.109  -27.677 92.032   1.00 42.85  ?  536  PRO C O     1 
ATOM   7786  C  CB    . PRO C  2  536  ? 52.954  -28.749 94.893   1.00 47.39  ?  536  PRO C CB    1 
ATOM   7787  C  CG    . PRO C  2  536  ? 52.892  -29.854 95.885   1.00 49.36  ?  536  PRO C CG    1 
ATOM   7788  C  CD    . PRO C  2  536  ? 54.172  -30.618 95.720   1.00 50.97  ?  536  PRO C CD    1 
ATOM   7789  N  N     . LYS C  2  537  ? 55.748  -28.089 93.534   1.00 42.22  ?  537  LYS C N     1 
ATOM   7790  C  CA    . LYS C  2  537  ? 56.676  -27.086 93.020   1.00 39.89  ?  537  LYS C CA    1 
ATOM   7791  C  C     . LYS C  2  537  ? 56.903  -27.184 91.513   1.00 40.11  ?  537  LYS C C     1 
ATOM   7792  O  O     . LYS C  2  537  ? 57.095  -26.169 90.845   1.00 44.70  ?  537  LYS C O     1 
ATOM   7793  C  CB    . LYS C  2  537  ? 58.022  -27.179 93.746   1.00 38.65  ?  537  LYS C CB    1 
ATOM   7794  C  CG    . LYS C  2  537  ? 57.955  -26.929 95.243   1.00 46.98  ?  537  LYS C CG    1 
ATOM   7795  C  CD    . LYS C  2  537  ? 59.346  -26.943 95.864   1.00 48.89  ?  537  LYS C CD    1 
ATOM   7796  C  CE    . LYS C  2  537  ? 59.286  -26.758 97.374   1.00 64.83  ?  537  LYS C CE    1 
ATOM   7797  N  NZ    . LYS C  2  537  ? 58.644  -25.470 97.761   1.00 71.59  ?  537  LYS C NZ    1 
ATOM   7798  N  N     . GLN C  2  538  ? 56.876  -28.403 90.983   1.00 42.89  ?  538  GLN C N     1 
ATOM   7799  C  CA    . GLN C  2  538  ? 57.154  -28.625 89.567   1.00 48.15  ?  538  GLN C CA    1 
ATOM   7800  C  C     . GLN C  2  538  ? 56.083  -28.022 88.665   1.00 47.44  ?  538  GLN C C     1 
ATOM   7801  O  O     . GLN C  2  538  ? 56.342  -27.742 87.496   1.00 45.78  ?  538  GLN C O     1 
ATOM   7802  C  CB    . GLN C  2  538  ? 57.306  -30.119 89.266   1.00 57.57  ?  538  GLN C CB    1 
ATOM   7803  C  CG    . GLN C  2  538  ? 56.005  -30.905 89.286   1.00 49.81  ?  538  GLN C CG    1 
ATOM   7804  C  CD    . GLN C  2  538  ? 56.217  -32.385 89.035   1.00 60.80  ?  538  GLN C CD    1 
ATOM   7805  O  OE1   . GLN C  2  538  ? 55.343  -33.206 89.316   1.00 54.33  ?  538  GLN C OE1   1 
ATOM   7806  N  NE2   . GLN C  2  538  ? 57.383  -32.733 88.501   1.00 62.10  ?  538  GLN C NE2   1 
ATOM   7807  N  N     . VAL C  2  539  ? 54.887  -27.820 89.212   1.00 44.77  ?  539  VAL C N     1 
ATOM   7808  C  CA    . VAL C  2  539  ? 53.766  -27.310 88.428   1.00 33.31  ?  539  VAL C CA    1 
ATOM   7809  C  C     . VAL C  2  539  ? 53.941  -25.827 88.097   1.00 32.95  ?  539  VAL C C     1 
ATOM   7810  O  O     . VAL C  2  539  ? 53.438  -25.342 87.083   1.00 39.57  ?  539  VAL C O     1 
ATOM   7811  C  CB    . VAL C  2  539  ? 52.424  -27.532 89.162   1.00 26.29  ?  539  VAL C CB    1 
ATOM   7812  C  CG1   . VAL C  2  539  ? 51.251  -27.127 88.285   1.00 28.07  ?  539  VAL C CG1   1 
ATOM   7813  C  CG2   . VAL C  2  539  ? 52.289  -28.986 89.577   1.00 34.51  ?  539  VAL C CG2   1 
ATOM   7814  N  N     . PHE C  2  540  ? 54.685  -25.117 88.939   1.00 29.41  ?  540  PHE C N     1 
ATOM   7815  C  CA    . PHE C  2  540  ? 54.799  -23.668 88.814   1.00 28.42  ?  540  PHE C CA    1 
ATOM   7816  C  C     . PHE C  2  540  ? 56.237  -23.204 88.606   1.00 25.03  ?  540  PHE C C     1 
ATOM   7817  O  O     . PHE C  2  540  ? 57.184  -23.929 88.901   1.00 28.57  ?  540  PHE C O     1 
ATOM   7818  C  CB    . PHE C  2  540  ? 54.195  -22.989 90.045   1.00 32.67  ?  540  PHE C CB    1 
ATOM   7819  C  CG    . PHE C  2  540  ? 52.781  -23.407 90.330   1.00 32.00  ?  540  PHE C CG    1 
ATOM   7820  C  CD1   . PHE C  2  540  ? 51.716  -22.727 89.766   1.00 32.63  ?  540  PHE C CD1   1 
ATOM   7821  C  CD2   . PHE C  2  540  ? 52.518  -24.489 91.153   1.00 32.01  ?  540  PHE C CD2   1 
ATOM   7822  C  CE1   . PHE C  2  540  ? 50.415  -23.113 90.023   1.00 32.21  ?  540  PHE C CE1   1 
ATOM   7823  C  CE2   . PHE C  2  540  ? 51.219  -24.881 91.411   1.00 32.69  ?  540  PHE C CE2   1 
ATOM   7824  C  CZ    . PHE C  2  540  ? 50.166  -24.192 90.847   1.00 31.25  ?  540  PHE C CZ    1 
ATOM   7825  N  N     . SER C  2  541  ? 56.389  -21.986 88.098   1.00 26.91  ?  541  SER C N     1 
ATOM   7826  C  CA    . SER C  2  541  ? 57.706  -21.424 87.820   1.00 32.94  ?  541  SER C CA    1 
ATOM   7827  C  C     . SER C  2  541  ? 58.432  -21.031 89.100   1.00 30.42  ?  541  SER C C     1 
ATOM   7828  O  O     . SER C  2  541  ? 57.916  -21.219 90.201   1.00 27.45  ?  541  SER C O     1 
ATOM   7829  C  CB    . SER C  2  541  ? 57.581  -20.204 86.906   1.00 37.39  ?  541  SER C CB    1 
ATOM   7830  O  OG    . SER C  2  541  ? 56.907  -19.144 87.562   1.00 33.57  ?  541  SER C OG    1 
ATOM   7831  N  N     . VAL C  2  542  ? 59.631  -20.479 88.947   1.00 32.46  ?  542  VAL C N     1 
ATOM   7832  C  CA    . VAL C  2  542  ? 60.440  -20.068 90.089   1.00 34.55  ?  542  VAL C CA    1 
ATOM   7833  C  C     . VAL C  2  542  ? 59.761  -18.949 90.870   1.00 38.79  ?  542  VAL C C     1 
ATOM   7834  O  O     . VAL C  2  542  ? 59.647  -19.019 92.094   1.00 46.41  ?  542  VAL C O     1 
ATOM   7835  C  CB    . VAL C  2  542  ? 61.849  -19.608 89.653   1.00 37.66  ?  542  VAL C CB    1 
ATOM   7836  C  CG1   . VAL C  2  542  ? 62.611  -19.014 90.830   1.00 37.34  ?  542  VAL C CG1   1 
ATOM   7837  C  CG2   . VAL C  2  542  ? 62.620  -20.769 89.043   1.00 40.48  ?  542  VAL C CG2   1 
ATOM   7838  N  N     . ASN C  2  543  ? 59.307  -17.923 90.156   1.00 32.33  ?  543  ASN C N     1 
ATOM   7839  C  CA    . ASN C  2  543  ? 58.642  -16.783 90.779   1.00 27.37  ?  543  ASN C CA    1 
ATOM   7840  C  C     . ASN C  2  543  ? 57.361  -17.183 91.503   1.00 29.35  ?  543  ASN C C     1 
ATOM   7841  O  O     . ASN C  2  543  ? 57.119  -16.767 92.636   1.00 30.89  ?  543  ASN C O     1 
ATOM   7842  C  CB    . ASN C  2  543  ? 58.327  -15.715 89.734   1.00 27.07  ?  543  ASN C CB    1 
ATOM   7843  C  CG    . ASN C  2  543  ? 59.557  -15.251 88.986   1.00 31.65  ?  543  ASN C CG    1 
ATOM   7844  O  OD1   . ASN C  2  543  ? 60.010  -15.905 88.046   1.00 35.68  ?  543  ASN C OD1   1 
ATOM   7845  N  ND2   . ASN C  2  543  ? 60.102  -14.110 89.394   1.00 26.68  ?  543  ASN C ND2   1 
ATOM   7846  N  N     . THR C  2  544  ? 56.545  -17.995 90.838   1.00 28.32  ?  544  THR C N     1 
ATOM   7847  C  CA    . THR C  2  544  ? 55.279  -18.447 91.400   1.00 23.01  ?  544  THR C CA    1 
ATOM   7848  C  C     . THR C  2  544  ? 55.511  -19.312 92.636   1.00 27.79  ?  544  THR C C     1 
ATOM   7849  O  O     . THR C  2  544  ? 54.696  -19.328 93.559   1.00 32.96  ?  544  THR C O     1 
ATOM   7850  C  CB    . THR C  2  544  ? 54.463  -19.229 90.355   1.00 23.44  ?  544  THR C CB    1 
ATOM   7851  O  OG1   . THR C  2  544  ? 54.331  -18.437 89.169   1.00 26.88  ?  544  THR C OG1   1 
ATOM   7852  C  CG2   . THR C  2  544  ? 53.080  -19.564 90.885   1.00 27.65  ?  544  THR C CG2   1 
ATOM   7853  N  N     . ASN C  2  545  ? 56.637  -20.018 92.657   1.00 33.44  ?  545  ASN C N     1 
ATOM   7854  C  CA    . ASN C  2  545  ? 56.986  -20.867 93.792   1.00 38.42  ?  545  ASN C CA    1 
ATOM   7855  C  C     . ASN C  2  545  ? 57.421  -20.087 95.027   1.00 39.50  ?  545  ASN C C     1 
ATOM   7856  O  O     . ASN C  2  545  ? 57.590  -20.660 96.100   1.00 41.93  ?  545  ASN C O     1 
ATOM   7857  C  CB    . ASN C  2  545  ? 58.071  -21.869 93.403   1.00 29.24  ?  545  ASN C CB    1 
ATOM   7858  C  CG    . ASN C  2  545  ? 57.510  -23.083 92.705   1.00 33.67  ?  545  ASN C CG    1 
ATOM   7859  O  OD1   . ASN C  2  545  ? 56.935  -23.963 93.341   1.00 32.34  ?  545  ASN C OD1   1 
ATOM   7860  N  ND2   . ASN C  2  545  ? 57.675  -23.141 91.390   1.00 35.29  ?  545  ASN C ND2   1 
ATOM   7861  N  N     . LEU C  2  546  ? 57.604  -18.782 94.869   1.00 34.09  ?  546  LEU C N     1 
ATOM   7862  C  CA    . LEU C  2  546  ? 58.023  -17.929 95.973   1.00 32.54  ?  546  LEU C CA    1 
ATOM   7863  C  C     . LEU C  2  546  ? 56.827  -17.302 96.685   1.00 38.53  ?  546  LEU C C     1 
ATOM   7864  O  O     . LEU C  2  546  ? 56.989  -16.469 97.576   1.00 37.31  ?  546  LEU C O     1 
ATOM   7865  C  CB    . LEU C  2  546  ? 58.989  -16.853 95.479   1.00 29.65  ?  546  LEU C CB    1 
ATOM   7866  C  CG    . LEU C  2  546  ? 60.300  -17.418 94.929   1.00 31.76  ?  546  LEU C CG    1 
ATOM   7867  C  CD1   . LEU C  2  546  ? 61.215  -16.311 94.435   1.00 32.33  ?  546  LEU C CD1   1 
ATOM   7868  C  CD2   . LEU C  2  546  ? 60.993  -18.261 95.987   1.00 36.01  ?  546  LEU C CD2   1 
ATOM   7869  N  N     . ILE C  2  547  ? 55.627  -17.703 96.278   1.00 37.01  ?  547  ILE C N     1 
ATOM   7870  C  CA    . ILE C  2  547  ? 54.402  -17.193 96.880   1.00 32.77  ?  547  ILE C CA    1 
ATOM   7871  C  C     . ILE C  2  547  ? 53.832  -18.186 97.888   1.00 34.08  ?  547  ILE C C     1 
ATOM   7872  O  O     . ILE C  2  547  ? 53.285  -19.220 97.505   1.00 40.18  ?  547  ILE C O     1 
ATOM   7873  C  CB    . ILE C  2  547  ? 53.333  -16.911 95.805   1.00 26.80  ?  547  ILE C CB    1 
ATOM   7874  C  CG1   . ILE C  2  547  ? 53.884  -15.959 94.742   1.00 29.33  ?  547  ILE C CG1   1 
ATOM   7875  C  CG2   . ILE C  2  547  ? 52.068  -16.347 96.437   1.00 27.96  ?  547  ILE C CG2   1 
ATOM   7876  C  CD1   . ILE C  2  547  ? 52.917  -15.677 93.612   1.00 30.76  ?  547  ILE C CD1   1 
ATOM   7877  N  N     . PRO C  2  548  ? 53.951  -17.870 99.186   1.00 28.10  ?  548  PRO C N     1 
ATOM   7878  C  CA    . PRO C  2  548  ? 53.388  -18.733 100.231  1.00 25.86  ?  548  PRO C CA    1 
ATOM   7879  C  C     . PRO C  2  548  ? 51.864  -18.684 100.212  1.00 27.55  ?  548  PRO C C     1 
ATOM   7880  O  O     . PRO C  2  548  ? 51.303  -17.679 99.780   1.00 35.00  ?  548  PRO C O     1 
ATOM   7881  C  CB    . PRO C  2  548  ? 53.929  -18.113 101.522  1.00 26.91  ?  548  PRO C CB    1 
ATOM   7882  C  CG    . PRO C  2  548  ? 54.199  -16.688 101.176  1.00 28.31  ?  548  PRO C CG    1 
ATOM   7883  C  CD    . PRO C  2  548  ? 54.641  -16.695 99.745   1.00 27.68  ?  548  PRO C CD    1 
ATOM   7884  N  N     . PHE C  2  549  ? 51.215  -19.753 100.668  1.00 24.94  ?  549  PHE C N     1 
ATOM   7885  C  CA    . PHE C  2  549  ? 49.755  -19.848 100.658  1.00 29.52  ?  549  PHE C CA    1 
ATOM   7886  C  C     . PHE C  2  549  ? 49.174  -19.602 99.267   1.00 33.67  ?  549  PHE C C     1 
ATOM   7887  O  O     . PHE C  2  549  ? 48.127  -18.969 99.123   1.00 30.49  ?  549  PHE C O     1 
ATOM   7888  C  CB    . PHE C  2  549  ? 49.131  -18.877 101.665  1.00 26.46  ?  549  PHE C CB    1 
ATOM   7889  C  CG    . PHE C  2  549  ? 49.557  -19.118 103.085  1.00 25.13  ?  549  PHE C CG    1 
ATOM   7890  C  CD1   . PHE C  2  549  ? 49.002  -20.150 103.822  1.00 25.81  ?  549  PHE C CD1   1 
ATOM   7891  C  CD2   . PHE C  2  549  ? 50.504  -18.305 103.685  1.00 24.47  ?  549  PHE C CD2   1 
ATOM   7892  C  CE1   . PHE C  2  549  ? 49.389  -20.371 105.129  1.00 29.21  ?  549  PHE C CE1   1 
ATOM   7893  C  CE2   . PHE C  2  549  ? 50.896  -18.520 104.991  1.00 21.57  ?  549  PHE C CE2   1 
ATOM   7894  C  CZ    . PHE C  2  549  ? 50.338  -19.554 105.714  1.00 28.33  ?  549  PHE C CZ    1 
ATOM   7895  N  N     . LEU C  2  550  ? 49.864  -20.108 98.249   1.00 37.36  ?  550  LEU C N     1 
ATOM   7896  C  CA    . LEU C  2  550  ? 49.457  -19.931 96.858   1.00 29.44  ?  550  LEU C CA    1 
ATOM   7897  C  C     . LEU C  2  550  ? 48.104  -20.581 96.568   1.00 29.95  ?  550  LEU C C     1 
ATOM   7898  O  O     . LEU C  2  550  ? 47.387  -20.162 95.661   1.00 35.46  ?  550  LEU C O     1 
ATOM   7899  C  CB    . LEU C  2  550  ? 50.526  -20.506 95.927   1.00 31.09  ?  550  LEU C CB    1 
ATOM   7900  C  CG    . LEU C  2  550  ? 50.295  -20.417 94.419   1.00 31.37  ?  550  LEU C CG    1 
ATOM   7901  C  CD1   . LEU C  2  550  ? 50.294  -18.968 93.962   1.00 35.95  ?  550  LEU C CD1   1 
ATOM   7902  C  CD2   . LEU C  2  550  ? 51.345  -21.223 93.669   1.00 30.23  ?  550  LEU C CD2   1 
ATOM   7903  N  N     . GLU C  2  551  ? 47.758  -21.601 97.345   1.00 26.58  ?  551  GLU C N     1 
ATOM   7904  C  CA    . GLU C  2  551  ? 46.503  -22.318 97.153   1.00 31.22  ?  551  GLU C CA    1 
ATOM   7905  C  C     . GLU C  2  551  ? 45.299  -21.494 97.602   1.00 35.76  ?  551  GLU C C     1 
ATOM   7906  O  O     . GLU C  2  551  ? 44.154  -21.836 97.302   1.00 34.30  ?  551  GLU C O     1 
ATOM   7907  C  CB    . GLU C  2  551  ? 46.529  -23.653 97.902   1.00 41.45  ?  551  GLU C CB    1 
ATOM   7908  C  CG    . GLU C  2  551  ? 46.577  -23.532 99.422   1.00 42.98  ?  551  GLU C CG    1 
ATOM   7909  C  CD    . GLU C  2  551  ? 47.972  -23.247 99.958   1.00 39.22  ?  551  GLU C CD    1 
ATOM   7910  O  OE1   . GLU C  2  551  ? 48.153  -23.290 101.194  1.00 39.26  ?  551  GLU C OE1   1 
ATOM   7911  O  OE2   . GLU C  2  551  ? 48.886  -22.981 99.149   1.00 36.12  ?  551  GLU C OE2   1 
ATOM   7912  N  N     . HIS C  2  552  ? 45.560  -20.417 98.335   1.00 39.49  ?  552  HIS C N     1 
ATOM   7913  C  CA    . HIS C  2  552  ? 44.496  -19.542 98.814   1.00 37.85  ?  552  HIS C CA    1 
ATOM   7914  C  C     . HIS C  2  552  ? 44.295  -18.316 97.922   1.00 28.46  ?  552  HIS C C     1 
ATOM   7915  O  O     . HIS C  2  552  ? 43.409  -17.499 98.172   1.00 28.36  ?  552  HIS C O     1 
ATOM   7916  C  CB    . HIS C  2  552  ? 44.765  -19.113 100.261  1.00 37.37  ?  552  HIS C CB    1 
ATOM   7917  C  CG    . HIS C  2  552  ? 44.870  -20.257 101.222  1.00 39.60  ?  552  HIS C CG    1 
ATOM   7918  N  ND1   . HIS C  2  552  ? 43.777  -20.983 101.641  1.00 38.70  ?  552  HIS C ND1   1 
ATOM   7919  C  CD2   . HIS C  2  552  ? 45.943  -20.799 101.849  1.00 33.64  ?  552  HIS C CD2   1 
ATOM   7920  C  CE1   . HIS C  2  552  ? 44.168  -21.923 102.483  1.00 34.17  ?  552  HIS C CE1   1 
ATOM   7921  N  NE2   . HIS C  2  552  ? 45.479  -21.831 102.626  1.00 37.92  ?  552  HIS C NE2   1 
ATOM   7922  N  N     . ASP C  2  553  ? 45.115  -18.191 96.882   1.00 24.28  ?  553  ASP C N     1 
ATOM   7923  C  CA    . ASP C  2  553  ? 45.039  -17.039 95.984   1.00 25.60  ?  553  ASP C CA    1 
ATOM   7924  C  C     . ASP C  2  553  ? 44.401  -17.374 94.637   1.00 30.63  ?  553  ASP C C     1 
ATOM   7925  O  O     . ASP C  2  553  ? 44.589  -18.467 94.103   1.00 37.06  ?  553  ASP C O     1 
ATOM   7926  C  CB    . ASP C  2  553  ? 46.430  -16.439 95.753   1.00 23.69  ?  553  ASP C CB    1 
ATOM   7927  C  CG    . ASP C  2  553  ? 47.015  -15.823 97.007   1.00 30.51  ?  553  ASP C CG    1 
ATOM   7928  O  OD1   . ASP C  2  553  ? 46.273  -15.687 98.001   1.00 35.72  ?  553  ASP C OD1   1 
ATOM   7929  O  OD2   . ASP C  2  553  ? 48.213  -15.463 96.995   1.00 27.11  ?  553  ASP C OD2   1 
ATOM   7930  N  N     . ASP C  2  554  ? 43.644  -16.426 94.094   1.00 23.89  ?  554  ASP C N     1 
ATOM   7931  C  CA    . ASP C  2  554  ? 43.116  -16.560 92.744   1.00 22.09  ?  554  ASP C CA    1 
ATOM   7932  C  C     . ASP C  2  554  ? 44.278  -16.469 91.765   1.00 26.77  ?  554  ASP C C     1 
ATOM   7933  O  O     . ASP C  2  554  ? 45.221  -15.707 91.983   1.00 24.63  ?  554  ASP C O     1 
ATOM   7934  C  CB    . ASP C  2  554  ? 42.088  -15.465 92.452   1.00 29.03  ?  554  ASP C CB    1 
ATOM   7935  C  CG    . ASP C  2  554  ? 41.437  -15.618 91.086   1.00 32.76  ?  554  ASP C CG    1 
ATOM   7936  O  OD1   . ASP C  2  554  ? 42.001  -15.114 90.091   1.00 34.48  ?  554  ASP C OD1   1 
ATOM   7937  O  OD2   . ASP C  2  554  ? 40.357  -16.240 91.007   1.00 32.10  ?  554  ASP C OD2   1 
ATOM   7938  N  N     . ALA C  2  555  ? 44.204  -17.250 90.691   1.00 31.40  ?  555  ALA C N     1 
ATOM   7939  C  CA    . ALA C  2  555  ? 45.282  -17.328 89.708   1.00 26.99  ?  555  ALA C CA    1 
ATOM   7940  C  C     . ALA C  2  555  ? 45.669  -15.965 89.132   1.00 24.29  ?  555  ALA C C     1 
ATOM   7941  O  O     . ALA C  2  555  ? 46.847  -15.698 88.888   1.00 21.26  ?  555  ALA C O     1 
ATOM   7942  C  CB    . ALA C  2  555  ? 44.900  -18.287 88.590   1.00 23.44  ?  555  ALA C CB    1 
ATOM   7943  N  N     . ASN C  2  556  ? 44.675  -15.106 88.932   1.00 25.65  ?  556  ASN C N     1 
ATOM   7944  C  CA    . ASN C  2  556  ? 44.898  -13.798 88.322   1.00 27.74  ?  556  ASN C CA    1 
ATOM   7945  C  C     . ASN C  2  556  ? 45.766  -12.864 89.165   1.00 26.29  ?  556  ASN C C     1 
ATOM   7946  O  O     . ASN C  2  556  ? 46.596  -12.127 88.631   1.00 22.76  ?  556  ASN C O     1 
ATOM   7947  C  CB    . ASN C  2  556  ? 43.561  -13.129 87.993   1.00 28.42  ?  556  ASN C CB    1 
ATOM   7948  C  CG    . ASN C  2  556  ? 42.725  -13.946 87.028   1.00 32.18  ?  556  ASN C CG    1 
ATOM   7949  O  OD1   . ASN C  2  556  ? 42.761  -13.725 85.816   1.00 27.58  ?  556  ASN C OD1   1 
ATOM   7950  N  ND2   . ASN C  2  556  ? 41.969  -14.902 87.560   1.00 30.31  ?  556  ASN C ND2   1 
ATOM   7951  N  N     . ARG C  2  557  ? 45.562  -12.885 90.478   1.00 27.35  ?  557  ARG C N     1 
ATOM   7952  C  CA    . ARG C  2  557  ? 46.381  -12.083 91.384   1.00 30.08  ?  557  ARG C CA    1 
ATOM   7953  C  C     . ARG C  2  557  ? 47.718  -12.757 91.676   1.00 28.31  ?  557  ARG C C     1 
ATOM   7954  O  O     . ARG C  2  557  ? 48.728  -12.087 91.905   1.00 27.99  ?  557  ARG C O     1 
ATOM   7955  C  CB    . ARG C  2  557  ? 45.624  -11.777 92.678   1.00 30.92  ?  557  ARG C CB    1 
ATOM   7956  C  CG    . ARG C  2  557  ? 44.605  -10.661 92.528   1.00 23.53  ?  557  ARG C CG    1 
ATOM   7957  C  CD    . ARG C  2  557  ? 45.293  -9.345  92.201   1.00 22.91  ?  557  ARG C CD    1 
ATOM   7958  N  NE    . ARG C  2  557  ? 44.368  -8.364  91.644   1.00 22.07  ?  557  ARG C NE    1 
ATOM   7959  C  CZ    . ARG C  2  557  ? 44.630  -7.065  91.536   1.00 22.39  ?  557  ARG C CZ    1 
ATOM   7960  N  NH1   . ARG C  2  557  ? 45.793  -6.584  91.955   1.00 19.65  ?  557  ARG C NH1   1 
ATOM   7961  N  NH2   . ARG C  2  557  ? 43.726  -6.246  91.015   1.00 21.63  ?  557  ARG C NH2   1 
ATOM   7962  N  N     . ALA C  2  558  ? 47.715  -14.087 91.667   1.00 24.66  ?  558  ALA C N     1 
ATOM   7963  C  CA    . ALA C  2  558  ? 48.941  -14.857 91.817   1.00 23.48  ?  558  ALA C CA    1 
ATOM   7964  C  C     . ALA C  2  558  ? 49.894  -14.524 90.677   1.00 23.42  ?  558  ALA C C     1 
ATOM   7965  O  O     . ALA C  2  558  ? 51.108  -14.478 90.861   1.00 26.46  ?  558  ALA C O     1 
ATOM   7966  C  CB    . ALA C  2  558  ? 48.633  -16.344 91.833   1.00 22.65  ?  558  ALA C CB    1 
ATOM   7967  N  N     . LEU C  2  559  ? 49.325  -14.290 89.499   1.00 19.75  ?  559  LEU C N     1 
ATOM   7968  C  CA    . LEU C  2  559  ? 50.088  -13.890 88.325   1.00 18.90  ?  559  LEU C CA    1 
ATOM   7969  C  C     . LEU C  2  559  ? 50.837  -12.587 88.579   1.00 22.45  ?  559  LEU C C     1 
ATOM   7970  O  O     . LEU C  2  559  ? 52.032  -12.483 88.300   1.00 25.89  ?  559  LEU C O     1 
ATOM   7971  C  CB    . LEU C  2  559  ? 49.145  -13.739 87.128   1.00 21.17  ?  559  LEU C CB    1 
ATOM   7972  C  CG    . LEU C  2  559  ? 49.695  -13.395 85.745   1.00 18.60  ?  559  LEU C CG    1 
ATOM   7973  C  CD1   . LEU C  2  559  ? 48.778  -13.980 84.693   1.00 20.70  ?  559  LEU C CD1   1 
ATOM   7974  C  CD2   . LEU C  2  559  ? 49.814  -11.892 85.549   1.00 26.25  ?  559  LEU C CD2   1 
ATOM   7975  N  N     . MET C  2  560  ? 50.123  -11.594 89.101   1.00 27.37  ?  560  MET C N     1 
ATOM   7976  C  CA    . MET C  2  560  ? 50.712  -10.289 89.381   1.00 30.67  ?  560  MET C CA    1 
ATOM   7977  C  C     . MET C  2  560  ? 51.769  -10.387 90.471   1.00 28.28  ?  560  MET C C     1 
ATOM   7978  O  O     . MET C  2  560  ? 52.842  -9.793  90.360   1.00 25.29  ?  560  MET C O     1 
ATOM   7979  C  CB    . MET C  2  560  ? 49.638  -9.285  89.798   1.00 30.76  ?  560  MET C CB    1 
ATOM   7980  C  CG    . MET C  2  560  ? 48.605  -8.986  88.732   1.00 28.71  ?  560  MET C CG    1 
ATOM   7981  S  SD    . MET C  2  560  ? 47.490  -7.668  89.245   1.00 31.58  ?  560  MET C SD    1 
ATOM   7982  C  CE    . MET C  2  560  ? 46.362  -7.619  87.854   1.00 43.78  ?  560  MET C CE    1 
ATOM   7983  N  N     . GLY C  2  561  ? 51.456  -11.133 91.526   1.00 27.89  ?  561  GLY C N     1 
ATOM   7984  C  CA    . GLY C  2  561  ? 52.398  -11.340 92.609   1.00 29.34  ?  561  GLY C CA    1 
ATOM   7985  C  C     . GLY C  2  561  ? 53.673  -11.959 92.077   1.00 33.16  ?  561  GLY C C     1 
ATOM   7986  O  O     . GLY C  2  561  ? 54.777  -11.585 92.473   1.00 34.52  ?  561  GLY C O     1 
ATOM   7987  N  N     . SER C  2  562  ? 53.508  -12.901 91.156   1.00 29.02  ?  562  SER C N     1 
ATOM   7988  C  CA    . SER C  2  562  ? 54.630  -13.581 90.529   1.00 24.66  ?  562  SER C CA    1 
ATOM   7989  C  C     . SER C  2  562  ? 55.479  -12.612 89.714   1.00 22.13  ?  562  SER C C     1 
ATOM   7990  O  O     . SER C  2  562  ? 56.690  -12.524 89.907   1.00 29.63  ?  562  SER C O     1 
ATOM   7991  C  CB    . SER C  2  562  ? 54.123  -14.716 89.639   1.00 24.04  ?  562  SER C CB    1 
ATOM   7992  O  OG    . SER C  2  562  ? 55.195  -15.397 89.015   1.00 27.25  ?  562  SER C OG    1 
ATOM   7993  N  N     . ASN C  2  563  ? 54.835  -11.878 88.813   1.00 25.04  ?  563  ASN C N     1 
ATOM   7994  C  CA    . ASN C  2  563  ? 55.551  -10.984 87.903   1.00 33.84  ?  563  ASN C CA    1 
ATOM   7995  C  C     . ASN C  2  563  ? 56.205  -9.775  88.574   1.00 31.78  ?  563  ASN C C     1 
ATOM   7996  O  O     . ASN C  2  563  ? 57.232  -9.283  88.107   1.00 30.51  ?  563  ASN C O     1 
ATOM   7997  C  CB    . ASN C  2  563  ? 54.634  -10.515 86.768   1.00 33.52  ?  563  ASN C CB    1 
ATOM   7998  C  CG    . ASN C  2  563  ? 54.354  -11.607 85.752   1.00 37.67  ?  563  ASN C CG    1 
ATOM   7999  O  OD1   . ASN C  2  563  ? 54.460  -12.796 86.056   1.00 38.43  ?  563  ASN C OD1   1 
ATOM   8000  N  ND2   . ASN C  2  563  ? 53.998  -11.207 84.537   1.00 42.01  ?  563  ASN C ND2   1 
ATOM   8001  N  N     . MET C  2  564  ? 55.614  -9.300  89.665   1.00 33.14  ?  564  MET C N     1 
ATOM   8002  C  CA    . MET C  2  564  ? 56.093  -8.081  90.313   1.00 32.38  ?  564  MET C CA    1 
ATOM   8003  C  C     . MET C  2  564  ? 57.365  -8.274  91.134   1.00 35.46  ?  564  MET C C     1 
ATOM   8004  O  O     . MET C  2  564  ? 58.023  -7.299  91.498   1.00 35.23  ?  564  MET C O     1 
ATOM   8005  C  CB    . MET C  2  564  ? 54.999  -7.467  91.187   1.00 28.22  ?  564  MET C CB    1 
ATOM   8006  C  CG    . MET C  2  564  ? 53.912  -6.763  90.406   1.00 28.81  ?  564  MET C CG    1 
ATOM   8007  S  SD    . MET C  2  564  ? 52.702  -5.994  91.494   1.00 29.65  ?  564  MET C SD    1 
ATOM   8008  C  CE    . MET C  2  564  ? 52.097  -7.422  92.394   1.00 23.61  ?  564  MET C CE    1 
ATOM   8009  N  N     . GLN C  2  565  ? 57.710  -9.523  91.428   1.00 35.33  ?  565  GLN C N     1 
ATOM   8010  C  CA    . GLN C  2  565  ? 58.906  -9.807  92.214   1.00 27.40  ?  565  GLN C CA    1 
ATOM   8011  C  C     . GLN C  2  565  ? 60.175  -9.466  91.443   1.00 22.26  ?  565  GLN C C     1 
ATOM   8012  O  O     . GLN C  2  565  ? 61.205  -9.149  92.034   1.00 22.11  ?  565  GLN C O     1 
ATOM   8013  C  CB    . GLN C  2  565  ? 58.928  -11.270 92.663   1.00 20.53  ?  565  GLN C CB    1 
ATOM   8014  C  CG    . GLN C  2  565  ? 57.750  -11.651 93.531   1.00 24.52  ?  565  GLN C CG    1 
ATOM   8015  C  CD    . GLN C  2  565  ? 57.937  -12.990 94.213   1.00 33.32  ?  565  GLN C CD    1 
ATOM   8016  O  OE1   . GLN C  2  565  ? 58.735  -13.119 95.142   1.00 33.52  ?  565  GLN C OE1   1 
ATOM   8017  N  NE2   . GLN C  2  565  ? 57.197  -13.995 93.758   1.00 32.85  ?  565  GLN C NE2   1 
ATOM   8018  N  N     . THR C  2  566  ? 60.090  -9.523  90.119   1.00 22.94  ?  566  THR C N     1 
ATOM   8019  C  CA    . THR C  2  566  ? 61.227  -9.189  89.273   1.00 27.74  ?  566  THR C CA    1 
ATOM   8020  C  C     . THR C  2  566  ? 61.388  -7.677  89.185   1.00 32.60  ?  566  THR C C     1 
ATOM   8021  O  O     . THR C  2  566  ? 62.407  -7.176  88.706   1.00 38.34  ?  566  THR C O     1 
ATOM   8022  C  CB    . THR C  2  566  ? 61.067  -9.769  87.855   1.00 26.07  ?  566  THR C CB    1 
ATOM   8023  O  OG1   . THR C  2  566  ? 60.283  -8.879  87.052   1.00 22.00  ?  566  THR C OG1   1 
ATOM   8024  C  CG2   . THR C  2  566  ? 60.396  -11.132 87.914   1.00 24.96  ?  566  THR C CG2   1 
ATOM   8025  N  N     . GLN C  2  567  ? 60.370  -6.956  89.644   1.00 29.75  ?  567  GLN C N     1 
ATOM   8026  C  CA    . GLN C  2  567  ? 60.388  -5.498  89.635   1.00 30.28  ?  567  GLN C CA    1 
ATOM   8027  C  C     . GLN C  2  567  ? 60.844  -4.942  90.982   1.00 28.87  ?  567  GLN C C     1 
ATOM   8028  O  O     . GLN C  2  567  ? 60.905  -3.729  91.175   1.00 27.11  ?  567  GLN C O     1 
ATOM   8029  C  CB    . GLN C  2  567  ? 59.005  -4.952  89.272   1.00 31.07  ?  567  GLN C CB    1 
ATOM   8030  C  CG    . GLN C  2  567  ? 58.456  -5.493  87.958   1.00 37.49  ?  567  GLN C CG    1 
ATOM   8031  C  CD    . GLN C  2  567  ? 57.046  -5.013  87.663   1.00 42.18  ?  567  GLN C CD    1 
ATOM   8032  O  OE1   . GLN C  2  567  ? 56.664  -3.902  88.031   1.00 44.56  ?  567  GLN C OE1   1 
ATOM   8033  N  NE2   . GLN C  2  567  ? 56.264  -5.855  86.998   1.00 49.34  ?  567  GLN C NE2   1 
ATOM   8034  N  N     . ALA C  2  568  ? 61.171  -5.840  91.907   1.00 30.63  ?  568  ALA C N     1 
ATOM   8035  C  CA    . ALA C  2  568  ? 61.580  -5.450  93.255   1.00 27.99  ?  568  ALA C CA    1 
ATOM   8036  C  C     . ALA C  2  568  ? 62.979  -4.838  93.292   1.00 27.49  ?  568  ALA C C     1 
ATOM   8037  O  O     . ALA C  2  568  ? 63.947  -5.442  92.831   1.00 34.36  ?  568  ALA C O     1 
ATOM   8038  C  CB    . ALA C  2  568  ? 61.498  -6.644  94.197   1.00 27.79  ?  568  ALA C CB    1 
ATOM   8039  N  N     . VAL C  2  569  ? 63.075  -3.639  93.857   1.00 26.64  ?  569  VAL C N     1 
ATOM   8040  C  CA    . VAL C  2  569  ? 64.345  -2.932  93.978   1.00 26.53  ?  569  VAL C CA    1 
ATOM   8041  C  C     . VAL C  2  569  ? 65.131  -3.428  95.188   1.00 32.86  ?  569  VAL C C     1 
ATOM   8042  O  O     . VAL C  2  569  ? 64.565  -3.597  96.268   1.00 39.05  ?  569  VAL C O     1 
ATOM   8043  C  CB    . VAL C  2  569  ? 64.117  -1.411  94.122   1.00 31.79  ?  569  VAL C CB    1 
ATOM   8044  C  CG1   . VAL C  2  569  ? 65.441  -0.673  94.220   1.00 34.02  ?  569  VAL C CG1   1 
ATOM   8045  C  CG2   . VAL C  2  569  ? 63.301  -0.884  92.955   1.00 34.19  ?  569  VAL C CG2   1 
ATOM   8046  N  N     . PRO C  2  570  ? 66.438  -3.678  95.005   1.00 43.94  ?  570  PRO C N     1 
ATOM   8047  C  CA    . PRO C  2  570  ? 67.324  -4.040  96.118   1.00 40.42  ?  570  PRO C CA    1 
ATOM   8048  C  C     . PRO C  2  570  ? 67.408  -2.926  97.154   1.00 39.23  ?  570  PRO C C     1 
ATOM   8049  O  O     . PRO C  2  570  ? 67.622  -1.765  96.801   1.00 32.85  ?  570  PRO C O     1 
ATOM   8050  C  CB    . PRO C  2  570  ? 68.684  -4.216  95.436   1.00 32.56  ?  570  PRO C CB    1 
ATOM   8051  C  CG    . PRO C  2  570  ? 68.357  -4.556  94.033   1.00 34.44  ?  570  PRO C CG    1 
ATOM   8052  C  CD    . PRO C  2  570  ? 67.129  -3.762  93.708   1.00 38.31  ?  570  PRO C CD    1 
ATOM   8053  N  N     . LEU C  2  571  ? 67.244  -3.286  98.422   1.00 46.91  ?  571  LEU C N     1 
ATOM   8054  C  CA    . LEU C  2  571  ? 67.315  -2.320  99.509   1.00 39.45  ?  571  LEU C CA    1 
ATOM   8055  C  C     . LEU C  2  571  ? 68.579  -2.546  100.330  1.00 41.75  ?  571  LEU C C     1 
ATOM   8056  O  O     . LEU C  2  571  ? 69.061  -3.675  100.448  1.00 35.44  ?  571  LEU C O     1 
ATOM   8057  C  CB    . LEU C  2  571  ? 66.081  -2.435  100.402  1.00 34.27  ?  571  LEU C CB    1 
ATOM   8058  C  CG    . LEU C  2  571  ? 64.732  -2.327  99.690   1.00 31.47  ?  571  LEU C CG    1 
ATOM   8059  C  CD1   . LEU C  2  571  ? 63.591  -2.612  100.654  1.00 29.13  ?  571  LEU C CD1   1 
ATOM   8060  C  CD2   . LEU C  2  571  ? 64.575  -0.955  99.055   1.00 34.68  ?  571  LEU C CD2   1 
ATOM   8061  N  N     . ILE C  2  572  ? 69.116  -1.467  100.889  1.00 40.79  ?  572  ILE C N     1 
ATOM   8062  C  CA    . ILE C  2  572  ? 70.325  -1.551  101.699  1.00 42.96  ?  572  ILE C CA    1 
ATOM   8063  C  C     . ILE C  2  572  ? 70.085  -2.367  102.969  1.00 41.56  ?  572  ILE C C     1 
ATOM   8064  O  O     . ILE C  2  572  ? 70.980  -3.058  103.455  1.00 50.40  ?  572  ILE C O     1 
ATOM   8065  C  CB    . ILE C  2  572  ? 70.869  -0.147  102.052  1.00 37.69  ?  572  ILE C CB    1 
ATOM   8066  C  CG1   . ILE C  2  572  ? 69.791  0.698   102.733  1.00 48.03  ?  572  ILE C CG1   1 
ATOM   8067  C  CG2   . ILE C  2  572  ? 71.356  0.563   100.800  1.00 32.59  ?  572  ILE C CG2   1 
ATOM   8068  C  CD1   . ILE C  2  572  ? 70.212  2.131   103.000  1.00 43.31  ?  572  ILE C CD1   1 
ATOM   8069  N  N     . ARG C  2  573  ? 68.870  -2.278  103.498  1.00 35.73  ?  573  ARG C N     1 
ATOM   8070  C  CA    . ARG C  2  573  ? 68.488  -2.987  104.715  1.00 36.27  ?  573  ARG C CA    1 
ATOM   8071  C  C     . ARG C  2  573  ? 67.757  -4.308  104.461  1.00 31.72  ?  573  ARG C C     1 
ATOM   8072  O  O     . ARG C  2  573  ? 67.269  -4.936  105.401  1.00 35.40  ?  573  ARG C O     1 
ATOM   8073  C  CB    . ARG C  2  573  ? 67.657  -2.080  105.624  1.00 38.14  ?  573  ARG C CB    1 
ATOM   8074  C  CG    . ARG C  2  573  ? 68.321  -0.747  105.918  1.00 37.15  ?  573  ARG C CG    1 
ATOM   8075  C  CD    . ARG C  2  573  ? 67.868  -0.190  107.252  1.00 38.15  ?  573  ARG C CD    1 
ATOM   8076  N  NE    . ARG C  2  573  ? 68.330  -1.014  108.365  1.00 47.42  ?  573  ARG C NE    1 
ATOM   8077  C  CZ    . ARG C  2  573  ? 67.990  -0.813  109.634  1.00 46.96  ?  573  ARG C CZ    1 
ATOM   8078  N  NH1   . ARG C  2  573  ? 67.179  0.186   109.955  1.00 43.14  ?  573  ARG C NH1   1 
ATOM   8079  N  NH2   . ARG C  2  573  ? 68.458  -1.613  110.583  1.00 49.29  ?  573  ARG C NH2   1 
ATOM   8080  N  N     . ALA C  2  574  ? 67.688  -4.716  103.196  1.00 29.55  ?  574  ALA C N     1 
ATOM   8081  C  CA    . ALA C  2  574  ? 66.788  -5.786  102.751  1.00 33.29  ?  574  ALA C CA    1 
ATOM   8082  C  C     . ALA C  2  574  ? 66.841  -7.058  103.596  1.00 30.72  ?  574  ALA C C     1 
ATOM   8083  O  O     . ALA C  2  574  ? 67.912  -7.515  103.994  1.00 35.89  ?  574  ALA C O     1 
ATOM   8084  C  CB    . ALA C  2  574  ? 67.047  -6.117  101.283  1.00 31.33  ?  574  ALA C CB    1 
ATOM   8085  N  N     . GLN C  2  575  ? 65.665  -7.613  103.869  1.00 27.82  ?  575  GLN C N     1 
ATOM   8086  C  CA    . GLN C  2  575  ? 65.529  -8.770  104.745  1.00 31.96  ?  575  GLN C CA    1 
ATOM   8087  C  C     . GLN C  2  575  ? 64.620  -9.836  104.138  1.00 29.05  ?  575  GLN C C     1 
ATOM   8088  O  O     . GLN C  2  575  ? 63.658  -9.519  103.442  1.00 32.91  ?  575  GLN C O     1 
ATOM   8089  C  CB    . GLN C  2  575  ? 64.978  -8.329  106.103  1.00 40.81  ?  575  GLN C CB    1 
ATOM   8090  C  CG    . GLN C  2  575  ? 63.790  -7.380  106.003  1.00 35.83  ?  575  GLN C CG    1 
ATOM   8091  C  CD    . GLN C  2  575  ? 63.254  -6.960  107.359  1.00 36.79  ?  575  GLN C CD    1 
ATOM   8092  O  OE1   . GLN C  2  575  ? 62.766  -5.842  107.527  1.00 30.66  ?  575  GLN C OE1   1 
ATOM   8093  N  NE2   . GLN C  2  575  ? 63.338  -7.860  108.334  1.00 40.17  ?  575  GLN C NE2   1 
ATOM   8094  N  N     . ALA C  2  576  ? 64.937  -11.100 104.397  1.00 32.79  ?  576  ALA C N     1 
ATOM   8095  C  CA    . ALA C  2  576  ? 64.131  -12.211 103.905  1.00 30.39  ?  576  ALA C CA    1 
ATOM   8096  C  C     . ALA C  2  576  ? 62.756  -12.201 104.566  1.00 30.48  ?  576  ALA C C     1 
ATOM   8097  O  O     . ALA C  2  576  ? 62.622  -11.764 105.708  1.00 37.37  ?  576  ALA C O     1 
ATOM   8098  C  CB    . ALA C  2  576  ? 64.840  -13.531 104.167  1.00 40.41  ?  576  ALA C CB    1 
ATOM   8099  N  N     . PRO C  2  577  ? 61.728  -12.676 103.844  1.00 32.09  ?  577  PRO C N     1 
ATOM   8100  C  CA    . PRO C  2  577  ? 60.348  -12.696 104.349  1.00 41.50  ?  577  PRO C CA    1 
ATOM   8101  C  C     . PRO C  2  577  ? 60.179  -13.532 105.618  1.00 35.87  ?  577  PRO C C     1 
ATOM   8102  O  O     . PRO C  2  577  ? 60.892  -14.517 105.804  1.00 39.14  ?  577  PRO C O     1 
ATOM   8103  C  CB    . PRO C  2  577  ? 59.565  -13.338 103.198  1.00 41.43  ?  577  PRO C CB    1 
ATOM   8104  C  CG    . PRO C  2  577  ? 60.382  -13.067 101.987  1.00 38.74  ?  577  PRO C CG    1 
ATOM   8105  C  CD    . PRO C  2  577  ? 61.807  -13.133 102.446  1.00 34.02  ?  577  PRO C CD    1 
ATOM   8106  N  N     . VAL C  2  578  ? 59.243  -13.134 106.475  1.00 33.26  ?  578  VAL C N     1 
ATOM   8107  C  CA    . VAL C  2  578  ? 58.940  -13.882 107.690  1.00 30.71  ?  578  VAL C CA    1 
ATOM   8108  C  C     . VAL C  2  578  ? 58.376  -15.256 107.342  1.00 36.72  ?  578  VAL C C     1 
ATOM   8109  O  O     . VAL C  2  578  ? 58.784  -16.271 107.907  1.00 41.37  ?  578  VAL C O     1 
ATOM   8110  C  CB    . VAL C  2  578  ? 57.942  -13.124 108.587  1.00 25.39  ?  578  VAL C CB    1 
ATOM   8111  C  CG1   . VAL C  2  578  ? 57.393  -14.036 109.673  1.00 35.72  ?  578  VAL C CG1   1 
ATOM   8112  C  CG2   . VAL C  2  578  ? 58.605  -11.899 109.198  1.00 26.56  ?  578  VAL C CG2   1 
ATOM   8113  N  N     . VAL C  2  579  ? 57.435  -15.282 106.405  1.00 35.24  ?  579  VAL C N     1 
ATOM   8114  C  CA    . VAL C  2  579  ? 56.907  -16.541 105.903  1.00 33.91  ?  579  VAL C CA    1 
ATOM   8115  C  C     . VAL C  2  579  ? 57.467  -16.796 104.512  1.00 39.79  ?  579  VAL C C     1 
ATOM   8116  O  O     . VAL C  2  579  ? 57.093  -16.122 103.552  1.00 38.67  ?  579  VAL C O     1 
ATOM   8117  C  CB    . VAL C  2  579  ? 55.374  -16.515 105.823  1.00 27.17  ?  579  VAL C CB    1 
ATOM   8118  C  CG1   . VAL C  2  579  ? 54.844  -17.875 105.400  1.00 28.03  ?  579  VAL C CG1   1 
ATOM   8119  C  CG2   . VAL C  2  579  ? 54.782  -16.097 107.159  1.00 32.82  ?  579  VAL C CG2   1 
ATOM   8120  N  N     . MET C  2  580  ? 58.369  -17.766 104.404  1.00 44.57  ?  580  MET C N     1 
ATOM   8121  C  CA    . MET C  2  580  ? 58.956  -18.098 103.114  1.00 37.54  ?  580  MET C CA    1 
ATOM   8122  C  C     . MET C  2  580  ? 58.396  -19.403 102.564  1.00 33.21  ?  580  MET C C     1 
ATOM   8123  O  O     . MET C  2  580  ? 57.644  -20.105 103.242  1.00 26.23  ?  580  MET C O     1 
ATOM   8124  C  CB    . MET C  2  580  ? 60.475  -18.199 103.250  1.00 37.79  ?  580  MET C CB    1 
ATOM   8125  C  CG    . MET C  2  580  ? 61.140  -16.907 103.693  1.00 40.58  ?  580  MET C CG    1 
ATOM   8126  S  SD    . MET C  2  580  ? 62.850  -17.135 104.220  1.00 42.43  ?  580  MET C SD    1 
ATOM   8127  C  CE    . MET C  2  580  ? 62.626  -18.244 105.607  1.00 41.54  ?  580  MET C CE    1 
ATOM   8128  N  N     . THR C  2  581  ? 58.771  -19.723 101.330  1.00 32.24  ?  581  THR C N     1 
ATOM   8129  C  CA    . THR C  2  581  ? 58.414  -21.002 100.728  1.00 38.37  ?  581  THR C CA    1 
ATOM   8130  C  C     . THR C  2  581  ? 59.531  -22.032 100.861  1.00 38.47  ?  581  THR C C     1 
ATOM   8131  O  O     . THR C  2  581  ? 59.335  -23.213 100.574  1.00 40.09  ?  581  THR C O     1 
ATOM   8132  C  CB    . THR C  2  581  ? 58.039  -20.837 99.249   1.00 46.74  ?  581  THR C CB    1 
ATOM   8133  O  OG1   . THR C  2  581  ? 59.145  -20.269 98.536   1.00 50.91  ?  581  THR C OG1   1 
ATOM   8134  C  CG2   . THR C  2  581  ? 56.829  -19.923 99.110   1.00 40.44  ?  581  THR C CG2   1 
ATOM   8135  N  N     . GLY C  2  582  ? 60.701  -21.577 101.299  1.00 38.57  ?  582  GLY C N     1 
ATOM   8136  C  CA    . GLY C  2  582  ? 61.858  -22.444 101.438  1.00 49.82  ?  582  GLY C CA    1 
ATOM   8137  C  C     . GLY C  2  582  ? 62.710  -22.537 100.184  1.00 50.54  ?  582  GLY C C     1 
ATOM   8138  O  O     . GLY C  2  582  ? 63.716  -23.246 100.156  1.00 57.27  ?  582  GLY C O     1 
ATOM   8139  N  N     . LEU C  2  583  ? 62.306  -21.824 99.140   1.00 42.72  ?  583  LEU C N     1 
ATOM   8140  C  CA    . LEU C  2  583  ? 63.043  -21.829 97.884   1.00 42.67  ?  583  LEU C CA    1 
ATOM   8141  C  C     . LEU C  2  583  ? 63.997  -20.640 97.796   1.00 45.39  ?  583  LEU C C     1 
ATOM   8142  O  O     . LEU C  2  583  ? 64.676  -20.454 96.787   1.00 50.47  ?  583  LEU C O     1 
ATOM   8143  C  CB    . LEU C  2  583  ? 62.073  -21.797 96.702   1.00 49.99  ?  583  LEU C CB    1 
ATOM   8144  C  CG    . LEU C  2  583  ? 62.463  -22.612 95.468   1.00 53.34  ?  583  LEU C CG    1 
ATOM   8145  C  CD1   . LEU C  2  583  ? 62.224  -24.093 95.721   1.00 60.20  ?  583  LEU C CD1   1 
ATOM   8146  C  CD2   . LEU C  2  583  ? 61.703  -22.140 94.237   1.00 44.13  ?  583  LEU C CD2   1 
ATOM   8147  N  N     . GLU C  2  584  ? 64.047  -19.843 98.859   1.00 40.86  ?  584  GLU C N     1 
ATOM   8148  C  CA    . GLU C  2  584  ? 64.726  -18.546 98.821   1.00 43.94  ?  584  GLU C CA    1 
ATOM   8149  C  C     . GLU C  2  584  ? 66.245  -18.601 98.662   1.00 48.49  ?  584  GLU C C     1 
ATOM   8150  O  O     . GLU C  2  584  ? 66.840  -17.681 98.104   1.00 46.47  ?  584  GLU C O     1 
ATOM   8151  C  CB    . GLU C  2  584  ? 64.357  -17.706 100.050  1.00 39.78  ?  584  GLU C CB    1 
ATOM   8152  C  CG    . GLU C  2  584  ? 62.960  -17.096 100.001  1.00 40.50  ?  584  GLU C CG    1 
ATOM   8153  C  CD    . GLU C  2  584  ? 61.849  -18.126 100.144  1.00 48.78  ?  584  GLU C CD    1 
ATOM   8154  O  OE1   . GLU C  2  584  ? 60.666  -17.751 99.983   1.00 44.57  ?  584  GLU C OE1   1 
ATOM   8155  O  OE2   . GLU C  2  584  ? 62.152  -19.306 100.425  1.00 46.45  ?  584  GLU C OE2   1 
ATOM   8156  N  N     . GLU C  2  585  ? 66.873  -19.664 99.152   1.00 55.73  ?  585  GLU C N     1 
ATOM   8157  C  CA    . GLU C  2  585  ? 68.330  -19.775 99.075   1.00 55.48  ?  585  GLU C CA    1 
ATOM   8158  C  C     . GLU C  2  585  ? 68.829  -20.224 97.703   1.00 46.34  ?  585  GLU C C     1 
ATOM   8159  O  O     . GLU C  2  585  ? 69.816  -19.691 97.190   1.00 41.96  ?  585  GLU C O     1 
ATOM   8160  C  CB    . GLU C  2  585  ? 68.865  -20.700 100.171  1.00 56.76  ?  585  GLU C CB    1 
ATOM   8161  C  CG    . GLU C  2  585  ? 68.873  -20.064 101.549  1.00 57.65  ?  585  GLU C CG    1 
ATOM   8162  C  CD    . GLU C  2  585  ? 69.411  -20.992 102.618  1.00 75.60  ?  585  GLU C CD    1 
ATOM   8163  O  OE1   . GLU C  2  585  ? 68.999  -22.171 102.646  1.00 80.87  ?  585  GLU C OE1   1 
ATOM   8164  O  OE2   . GLU C  2  585  ? 70.249  -20.541 103.429  1.00 76.62  ?  585  GLU C OE2   1 
ATOM   8165  N  N     . ARG C  2  586  ? 68.141  -21.202 97.119   1.00 47.34  ?  586  ARG C N     1 
ATOM   8166  C  CA    . ARG C  2  586  ? 68.491  -21.721 95.801   1.00 47.64  ?  586  ARG C CA    1 
ATOM   8167  C  C     . ARG C  2  586  ? 68.503  -20.606 94.762   1.00 47.25  ?  586  ARG C C     1 
ATOM   8168  O  O     . ARG C  2  586  ? 69.365  -20.570 93.880   1.00 51.71  ?  586  ARG C O     1 
ATOM   8169  C  CB    . ARG C  2  586  ? 67.504  -22.813 95.380   1.00 47.86  ?  586  ARG C CB    1 
ATOM   8170  C  CG    . ARG C  2  586  ? 67.558  -24.074 96.232   1.00 48.54  ?  586  ARG C CG    1 
ATOM   8171  C  CD    . ARG C  2  586  ? 68.745  -24.958 95.862   1.00 54.13  ?  586  ARG C CD    1 
ATOM   8172  N  NE    . ARG C  2  586  ? 68.610  -25.543 94.528   1.00 44.60  ?  586  ARG C NE    1 
ATOM   8173  C  CZ    . ARG C  2  586  ? 69.265  -25.115 93.453   1.00 39.55  ?  586  ARG C CZ    1 
ATOM   8174  N  NH1   . ARG C  2  586  ? 69.080  -25.707 92.280   1.00 33.68  ?  586  ARG C NH1   1 
ATOM   8175  N  NH2   . ARG C  2  586  ? 70.109  -24.097 93.550   1.00 34.24  ?  586  ARG C NH2   1 
ATOM   8176  N  N     . VAL C  2  587  ? 67.541  -19.696 94.881   1.00 46.51  ?  587  VAL C N     1 
ATOM   8177  C  CA    . VAL C  2  587  ? 67.437  -18.556 93.980   1.00 45.89  ?  587  VAL C CA    1 
ATOM   8178  C  C     . VAL C  2  587  ? 68.678  -17.672 94.061   1.00 45.29  ?  587  VAL C C     1 
ATOM   8179  O  O     . VAL C  2  587  ? 69.184  -17.208 93.041   1.00 49.47  ?  587  VAL C O     1 
ATOM   8180  C  CB    . VAL C  2  587  ? 66.183  -17.712 94.287   1.00 43.07  ?  587  VAL C CB    1 
ATOM   8181  C  CG1   . VAL C  2  587  ? 66.125  -16.490 93.383   1.00 36.00  ?  587  VAL C CG1   1 
ATOM   8182  C  CG2   . VAL C  2  587  ? 64.927  -18.557 94.130   1.00 43.62  ?  587  VAL C CG2   1 
ATOM   8183  N  N     . VAL C  2  588  ? 69.171  -17.453 95.276   1.00 49.43  ?  588  VAL C N     1 
ATOM   8184  C  CA    . VAL C  2  588  ? 70.357  -16.625 95.479   1.00 54.41  ?  588  VAL C CA    1 
ATOM   8185  C  C     . VAL C  2  588  ? 71.616  -17.338 94.992   1.00 52.30  ?  588  VAL C C     1 
ATOM   8186  O  O     . VAL C  2  588  ? 72.531  -16.709 94.454   1.00 46.69  ?  588  VAL C O     1 
ATOM   8187  C  CB    . VAL C  2  588  ? 70.531  -16.229 96.958   1.00 49.28  ?  588  VAL C CB    1 
ATOM   8188  C  CG1   . VAL C  2  588  ? 71.662  -15.226 97.111   1.00 50.71  ?  588  VAL C CG1   1 
ATOM   8189  C  CG2   . VAL C  2  588  ? 69.246  -15.646 97.499   1.00 45.39  ?  588  VAL C CG2   1 
ATOM   8190  N  N     . ARG C  2  589  ? 71.658  -18.654 95.179   1.00 46.98  ?  589  ARG C N     1 
ATOM   8191  C  CA    . ARG C  2  589  ? 72.796  -19.446 94.726   1.00 50.91  ?  589  ARG C CA    1 
ATOM   8192  C  C     . ARG C  2  589  ? 72.921  -19.453 93.204   1.00 54.13  ?  589  ARG C C     1 
ATOM   8193  O  O     . ARG C  2  589  ? 73.963  -19.088 92.656   1.00 50.57  ?  589  ARG C O     1 
ATOM   8194  C  CB    . ARG C  2  589  ? 72.701  -20.884 95.245   1.00 52.45  ?  589  ARG C CB    1 
ATOM   8195  C  CG    . ARG C  2  589  ? 73.083  -21.044 96.706   1.00 62.61  ?  589  ARG C CG    1 
ATOM   8196  C  CD    . ARG C  2  589  ? 73.215  -22.511 97.084   1.00 61.92  ?  589  ARG C CD    1 
ATOM   8197  N  NE    . ARG C  2  589  ? 73.815  -22.680 98.405   1.00 64.81  ?  589  ARG C NE    1 
ATOM   8198  C  CZ    . ARG C  2  589  ? 75.125  -22.713 98.630   1.00 65.72  ?  589  ARG C CZ    1 
ATOM   8199  N  NH1   . ARG C  2  589  ? 75.978  -22.587 97.621   1.00 58.01  ?  589  ARG C NH1   1 
ATOM   8200  N  NH2   . ARG C  2  589  ? 75.584  -22.870 99.864   1.00 66.93  ?  589  ARG C NH2   1 
ATOM   8201  N  N     . ASP C  2  590  ? 71.851  -19.858 92.527   1.00 44.24  ?  590  ASP C N     1 
ATOM   8202  C  CA    . ASP C  2  590  ? 71.875  -20.000 91.075   1.00 37.36  ?  590  ASP C CA    1 
ATOM   8203  C  C     . ASP C  2  590  ? 72.059  -18.667 90.354   1.00 50.51  ?  590  ASP C C     1 
ATOM   8204  O  O     . ASP C  2  590  ? 72.646  -18.616 89.273   1.00 60.03  ?  590  ASP C O     1 
ATOM   8205  C  CB    . ASP C  2  590  ? 70.608  -20.700 90.586   1.00 35.59  ?  590  ASP C CB    1 
ATOM   8206  C  CG    . ASP C  2  590  ? 70.481  -22.109 91.127   1.00 41.04  ?  590  ASP C CG    1 
ATOM   8207  O  OD1   . ASP C  2  590  ? 71.019  -22.375 92.222   1.00 41.16  ?  590  ASP C OD1   1 
ATOM   8208  O  OD2   . ASP C  2  590  ? 69.843  -22.950 90.459   1.00 44.67  ?  590  ASP C OD2   1 
ATOM   8209  N  N     . SER C  2  591  ? 71.563  -17.591 90.955   1.00 47.63  ?  591  SER C N     1 
ATOM   8210  C  CA    . SER C  2  591  ? 71.677  -16.267 90.354   1.00 55.36  ?  591  SER C CA    1 
ATOM   8211  C  C     . SER C  2  591  ? 73.086  -15.703 90.504   1.00 59.72  ?  591  SER C C     1 
ATOM   8212  O  O     . SER C  2  591  ? 73.407  -14.658 89.935   1.00 63.62  ?  591  SER C O     1 
ATOM   8213  C  CB    . SER C  2  591  ? 70.660  -15.304 90.969   1.00 57.15  ?  591  SER C CB    1 
ATOM   8214  O  OG    . SER C  2  591  ? 70.903  -15.126 92.354   1.00 63.69  ?  591  SER C OG    1 
ATOM   8215  N  N     . LEU C  2  592  ? 73.912  -16.398 91.282   1.00 59.99  ?  592  LEU C N     1 
ATOM   8216  C  CA    . LEU C  2  592  ? 75.305  -16.012 91.505   1.00 67.11  ?  592  LEU C CA    1 
ATOM   8217  C  C     . LEU C  2  592  ? 75.441  -14.613 92.106   1.00 65.05  ?  592  LEU C C     1 
ATOM   8218  O  O     . LEU C  2  592  ? 76.448  -13.935 91.899   1.00 63.37  ?  592  LEU C O     1 
ATOM   8219  C  CB    . LEU C  2  592  ? 76.116  -16.120 90.210   1.00 57.82  ?  592  LEU C CB    1 
ATOM   8220  C  CG    . LEU C  2  592  ? 76.103  -17.491 89.533   1.00 54.41  ?  592  LEU C CG    1 
ATOM   8221  C  CD1   . LEU C  2  592  ? 76.939  -17.467 88.265   1.00 56.08  ?  592  LEU C CD1   1 
ATOM   8222  C  CD2   . LEU C  2  592  ? 76.599  -18.566 90.487   1.00 53.65  ?  592  LEU C CD2   1 
ATOM   8223  N  N     . ALA C  2  593  ? 74.418  -14.184 92.839   1.00 61.27  ?  593  ALA C N     1 
ATOM   8224  C  CA    . ALA C  2  593  ? 74.471  -12.913 93.549   1.00 70.81  ?  593  ALA C CA    1 
ATOM   8225  C  C     . ALA C  2  593  ? 75.415  -13.018 94.742   1.00 79.31  ?  593  ALA C C     1 
ATOM   8226  O  O     . ALA C  2  593  ? 76.343  -12.222 94.890   1.00 74.62  ?  593  ALA C O     1 
ATOM   8227  C  CB    . ALA C  2  593  ? 73.079  -12.504 94.007   1.00 53.13  ?  593  ALA C CB    1 
ATOM   8228  N  N     . ALA C  2  594  ? 75.169  -14.014 95.588   1.00 70.54  ?  594  ALA C N     1 
ATOM   8229  C  CA    . ALA C  2  594  ? 75.992  -14.250 96.767   1.00 61.76  ?  594  ALA C CA    1 
ATOM   8230  C  C     . ALA C  2  594  ? 77.306  -14.942 96.416   1.00 63.71  ?  594  ALA C C     1 
ATOM   8231  O  O     . ALA C  2  594  ? 77.417  -15.601 95.382   1.00 59.78  ?  594  ALA C O     1 
ATOM   8232  C  CB    . ALA C  2  594  ? 75.222  -15.060 97.797   1.00 51.79  ?  594  ALA C CB    1 
ATOM   8233  N  N     . LEU C  2  595  ? 78.297  -14.782 97.287   1.00 66.94  ?  595  LEU C N     1 
ATOM   8234  C  CA    . LEU C  2  595  ? 79.587  -15.440 97.126   1.00 60.20  ?  595  LEU C CA    1 
ATOM   8235  C  C     . LEU C  2  595  ? 79.733  -16.574 98.137   1.00 59.26  ?  595  LEU C C     1 
ATOM   8236  O  O     . LEU C  2  595  ? 79.400  -16.414 99.312   1.00 55.15  ?  595  LEU C O     1 
ATOM   8237  C  CB    . LEU C  2  595  ? 80.719  -14.428 97.299   1.00 60.65  ?  595  LEU C CB    1 
ATOM   8238  C  CG    . LEU C  2  595  ? 82.148  -14.970 97.291   1.00 65.61  ?  595  LEU C CG    1 
ATOM   8239  C  CD1   . LEU C  2  595  ? 82.452  -15.671 95.977   1.00 77.61  ?  595  LEU C CD1   1 
ATOM   8240  C  CD2   . LEU C  2  595  ? 83.134  -13.843 97.544   1.00 70.01  ?  595  LEU C CD2   1 
ATOM   8241  N  N     . TYR C  2  596  ? 80.230  -17.719 97.678   1.00 60.94  ?  596  TYR C N     1 
ATOM   8242  C  CA    . TYR C  2  596  ? 80.335  -18.898 98.532   1.00 66.57  ?  596  TYR C CA    1 
ATOM   8243  C  C     . TYR C  2  596  ? 81.753  -19.463 98.574   1.00 78.12  ?  596  TYR C C     1 
ATOM   8244  O  O     . TYR C  2  596  ? 82.583  -19.154 97.717   1.00 75.79  ?  596  TYR C O     1 
ATOM   8245  C  CB    . TYR C  2  596  ? 79.343  -19.972 98.079   1.00 62.99  ?  596  TYR C CB    1 
ATOM   8246  C  CG    . TYR C  2  596  ? 77.915  -19.483 98.021   1.00 59.39  ?  596  TYR C CG    1 
ATOM   8247  C  CD1   . TYR C  2  596  ? 77.385  -18.964 96.846   1.00 56.76  ?  596  TYR C CD1   1 
ATOM   8248  C  CD2   . TYR C  2  596  ? 77.099  -19.531 99.143   1.00 63.92  ?  596  TYR C CD2   1 
ATOM   8249  C  CE1   . TYR C  2  596  ? 76.081  -18.510 96.790   1.00 54.94  ?  596  TYR C CE1   1 
ATOM   8250  C  CE2   . TYR C  2  596  ? 75.793  -19.080 99.096   1.00 66.51  ?  596  TYR C CE2   1 
ATOM   8251  C  CZ    . TYR C  2  596  ? 75.289  -18.571 97.917   1.00 59.61  ?  596  TYR C CZ    1 
ATOM   8252  O  OH    . TYR C  2  596  ? 73.989  -18.122 97.869   1.00 55.14  ?  596  TYR C OH    1 
ATOM   8253  N  N     . ALA C  2  597  ? 82.021  -20.292 99.580   1.00 84.86  ?  597  ALA C N     1 
ATOM   8254  C  CA    . ALA C  2  597  ? 83.344  -20.880 99.772   1.00 83.51  ?  597  ALA C CA    1 
ATOM   8255  C  C     . ALA C  2  597  ? 83.544  -22.130 98.919   1.00 92.50  ?  597  ALA C C     1 
ATOM   8256  O  O     . ALA C  2  597  ? 82.633  -22.946 98.771   1.00 94.25  ?  597  ALA C O     1 
ATOM   8257  C  CB    . ALA C  2  597  ? 83.572  -21.197 101.242  1.00 83.76  ?  597  ALA C CB    1 
ATOM   8258  N  N     . GLU C  2  598  ? 84.746  -22.276 98.367   1.00 89.49  ?  598  GLU C N     1 
ATOM   8259  C  CA    . GLU C  2  598  ? 85.065  -23.391 97.479   1.00 93.99  ?  598  GLU C CA    1 
ATOM   8260  C  C     . GLU C  2  598  ? 85.142  -24.731 98.212   1.00 93.44  ?  598  GLU C C     1 
ATOM   8261  O  O     . GLU C  2  598  ? 84.476  -25.695 97.832   1.00 88.74  ?  598  GLU C O     1 
ATOM   8262  C  CB    . GLU C  2  598  ? 86.382  -23.120 96.746   1.00 90.90  ?  598  GLU C CB    1 
ATOM   8263  C  CG    . GLU C  2  598  ? 86.805  -24.221 95.785   1.00 102.18 ?  598  GLU C CG    1 
ATOM   8264  C  CD    . GLU C  2  598  ? 85.926  -24.293 94.552   1.00 112.82 ?  598  GLU C CD    1 
ATOM   8265  O  OE1   . GLU C  2  598  ? 85.289  -23.273 94.212   1.00 114.46 ?  598  GLU C OE1   1 
ATOM   8266  O  OE2   . GLU C  2  598  ? 85.872  -25.370 93.921   1.00 114.17 ?  598  GLU C OE2   1 
ATOM   8267  N  N     . GLU C  2  599  ? 85.956  -24.783 99.262   1.00 89.47  ?  599  GLU C N     1 
ATOM   8268  C  CA    . GLU C  2  599  ? 86.166  -26.013 100.020  1.00 99.55  ?  599  GLU C CA    1 
ATOM   8269  C  C     . GLU C  2  599  ? 86.223  -25.687 101.513  1.00 97.10  ?  599  GLU C C     1 
ATOM   8270  O  O     . GLU C  2  599  ? 86.080  -24.528 101.903  1.00 95.29  ?  599  GLU C O     1 
ATOM   8271  C  CB    . GLU C  2  599  ? 87.466  -26.691 99.566   1.00 101.45 ?  599  GLU C CB    1 
ATOM   8272  C  CG    . GLU C  2  599  ? 87.553  -28.191 99.847   1.00 100.32 ?  599  GLU C CG    1 
ATOM   8273  C  CD    . GLU C  2  599  ? 86.588  -29.010 99.009   1.00 100.43 ?  599  GLU C CD    1 
ATOM   8274  O  OE1   . GLU C  2  599  ? 86.219  -28.555 97.905   1.00 102.90 ?  599  GLU C OE1   1 
ATOM   8275  O  OE2   . GLU C  2  599  ? 86.199  -30.110 99.455   1.00 90.51  ?  599  GLU C OE2   1 
ATOM   8276  N  N     . ASP C  2  600  ? 86.418  -26.707 102.344  1.00 94.00  ?  600  ASP C N     1 
ATOM   8277  C  CA    . ASP C  2  600  ? 86.584  -26.506 103.779  1.00 89.52  ?  600  ASP C CA    1 
ATOM   8278  C  C     . ASP C  2  600  ? 87.836  -25.678 104.043  1.00 94.39  ?  600  ASP C C     1 
ATOM   8279  O  O     . ASP C  2  600  ? 88.893  -25.938 103.466  1.00 100.08 ?  600  ASP C O     1 
ATOM   8280  C  CB    . ASP C  2  600  ? 86.688  -27.851 104.502  1.00 86.44  ?  600  ASP C CB    1 
ATOM   8281  C  CG    . ASP C  2  600  ? 85.463  -28.720 104.301  1.00 84.44  ?  600  ASP C CG    1 
ATOM   8282  O  OD1   . ASP C  2  600  ? 85.406  -29.444 103.284  1.00 86.59  ?  600  ASP C OD1   1 
ATOM   8283  O  OD2   . ASP C  2  600  ? 84.559  -28.686 105.163  1.00 72.28  ?  600  ASP C OD2   1 
ATOM   8284  N  N     . GLY C  2  601  ? 87.717  -24.677 104.909  1.00 87.74  ?  601  GLY C N     1 
ATOM   8285  C  CA    . GLY C  2  601  ? 88.845  -23.817 105.216  1.00 84.27  ?  601  GLY C CA    1 
ATOM   8286  C  C     . GLY C  2  601  ? 88.582  -22.799 106.308  1.00 71.69  ?  601  GLY C C     1 
ATOM   8287  O  O     . GLY C  2  601  ? 87.604  -22.892 107.048  1.00 70.18  ?  601  GLY C O     1 
ATOM   8288  N  N     . GLU C  2  602  ? 89.474  -21.819 106.403  1.00 69.81  ?  602  GLU C N     1 
ATOM   8289  C  CA    . GLU C  2  602  ? 89.385  -20.777 107.415  1.00 71.61  ?  602  GLU C CA    1 
ATOM   8290  C  C     . GLU C  2  602  ? 89.661  -19.423 106.779  1.00 64.44  ?  602  GLU C C     1 
ATOM   8291  O  O     . GLU C  2  602  ? 90.625  -19.269 106.030  1.00 63.50  ?  602  GLU C O     1 
ATOM   8292  C  CB    . GLU C  2  602  ? 90.390  -21.043 108.538  1.00 90.41  ?  602  GLU C CB    1 
ATOM   8293  C  CG    . GLU C  2  602  ? 90.560  -19.892 109.518  1.00 87.97  ?  602  GLU C CG    1 
ATOM   8294  C  CD    . GLU C  2  602  ? 91.608  -20.179 110.577  1.00 87.99  ?  602  GLU C CD    1 
ATOM   8295  O  OE1   . GLU C  2  602  ? 92.077  -21.334 110.655  1.00 90.03  ?  602  GLU C OE1   1 
ATOM   8296  O  OE2   . GLU C  2  602  ? 91.964  -19.249 111.331  1.00 82.44  ?  602  GLU C OE2   1 
ATOM   8297  N  N     . VAL C  2  603  ? 88.815  -18.443 107.075  1.00 66.60  ?  603  VAL C N     1 
ATOM   8298  C  CA    . VAL C  2  603  ? 88.955  -17.126 106.469  1.00 68.24  ?  603  VAL C CA    1 
ATOM   8299  C  C     . VAL C  2  603  ? 90.171  -16.391 107.018  1.00 62.66  ?  603  VAL C C     1 
ATOM   8300  O  O     . VAL C  2  603  ? 90.295  -16.185 108.225  1.00 64.51  ?  603  VAL C O     1 
ATOM   8301  C  CB    . VAL C  2  603  ? 87.701  -16.264 106.695  1.00 65.20  ?  603  VAL C CB    1 
ATOM   8302  C  CG1   . VAL C  2  603  ? 87.854  -14.924 105.998  1.00 58.45  ?  603  VAL C CG1   1 
ATOM   8303  C  CG2   . VAL C  2  603  ? 86.464  -16.990 106.193  1.00 66.49  ?  603  VAL C CG2   1 
ATOM   8304  N  N     . ALA C  2  604  ? 91.070  -16.005 106.119  1.00 60.77  ?  604  ALA C N     1 
ATOM   8305  C  CA    . ALA C  2  604  ? 92.266  -15.261 106.493  1.00 58.74  ?  604  ALA C CA    1 
ATOM   8306  C  C     . ALA C  2  604  ? 91.990  -13.769 106.652  1.00 58.69  ?  604  ALA C C     1 
ATOM   8307  O  O     . ALA C  2  604  ? 92.460  -13.137 107.598  1.00 61.26  ?  604  ALA C O     1 
ATOM   8308  C  CB    . ALA C  2  604  ? 93.371  -15.490 105.472  1.00 63.40  ?  604  ALA C CB    1 
ATOM   8309  N  N     . LYS C  2  605  ? 91.224  -13.211 105.721  1.00 66.91  ?  605  LYS C N     1 
ATOM   8310  C  CA    . LYS C  2  605  ? 91.005  -11.771 105.677  1.00 71.35  ?  605  LYS C CA    1 
ATOM   8311  C  C     . LYS C  2  605  ? 89.566  -11.394 105.324  1.00 76.47  ?  605  LYS C C     1 
ATOM   8312  O  O     . LYS C  2  605  ? 88.965  -11.967 104.413  1.00 74.19  ?  605  LYS C O     1 
ATOM   8313  C  CB    . LYS C  2  605  ? 91.966  -11.119 104.677  1.00 63.35  ?  605  LYS C CB    1 
ATOM   8314  C  CG    . LYS C  2  605  ? 93.429  -11.150 105.089  1.00 59.77  ?  605  LYS C CG    1 
ATOM   8315  C  CD    . LYS C  2  605  ? 94.298  -10.437 104.066  1.00 68.73  ?  605  LYS C CD    1 
ATOM   8316  C  CE    . LYS C  2  605  ? 95.747  -10.356 104.519  1.00 70.47  ?  605  LYS C CE    1 
ATOM   8317  N  NZ    . LYS C  2  605  ? 96.586  -9.591  103.553  1.00 65.09  ?  605  LYS C NZ    1 
ATOM   8318  N  N     . VAL C  2  606  ? 89.026  -10.422 106.053  1.00 79.31  ?  606  VAL C N     1 
ATOM   8319  C  CA    . VAL C  2  606  ? 87.709  -9.867  105.758  1.00 69.17  ?  606  VAL C CA    1 
ATOM   8320  C  C     . VAL C  2  606  ? 87.782  -8.346  105.678  1.00 70.93  ?  606  VAL C C     1 
ATOM   8321  O  O     . VAL C  2  606  ? 88.125  -7.676  106.653  1.00 68.55  ?  606  VAL C O     1 
ATOM   8322  C  CB    . VAL C  2  606  ? 86.663  -10.261 106.818  1.00 68.04  ?  606  VAL C CB    1 
ATOM   8323  C  CG1   . VAL C  2  606  ? 85.382  -9.461  106.622  1.00 55.74  ?  606  VAL C CG1   1 
ATOM   8324  C  CG2   . VAL C  2  606  ? 86.380  -11.752 106.756  1.00 66.94  ?  606  VAL C CG2   1 
ATOM   8325  N  N     . ASP C  2  607  ? 87.457  -7.809  104.509  1.00 71.55  ?  607  ASP C N     1 
ATOM   8326  C  CA    . ASP C  2  607  ? 87.479  -6.371  104.293  1.00 64.17  ?  607  ASP C CA    1 
ATOM   8327  C  C     . ASP C  2  607  ? 86.250  -5.977  103.482  1.00 63.82  ?  607  ASP C C     1 
ATOM   8328  O  O     . ASP C  2  607  ? 85.449  -6.832  103.106  1.00 66.54  ?  607  ASP C O     1 
ATOM   8329  C  CB    . ASP C  2  607  ? 88.760  -5.975  103.556  1.00 64.39  ?  607  ASP C CB    1 
ATOM   8330  C  CG    . ASP C  2  607  ? 89.029  -4.485  103.605  1.00 68.80  ?  607  ASP C CG    1 
ATOM   8331  O  OD1   . ASP C  2  607  ? 88.562  -3.829  104.559  1.00 72.65  ?  607  ASP C OD1   1 
ATOM   8332  O  OD2   . ASP C  2  607  ? 89.703  -3.969  102.688  1.00 66.11  ?  607  ASP C OD2   1 
ATOM   8333  N  N     . GLY C  2  608  ? 86.099  -4.685  103.216  1.00 61.33  ?  608  GLY C N     1 
ATOM   8334  C  CA    . GLY C  2  608  ? 84.986  -4.204  102.422  1.00 58.04  ?  608  GLY C CA    1 
ATOM   8335  C  C     . GLY C  2  608  ? 85.107  -4.596  100.962  1.00 60.50  ?  608  GLY C C     1 
ATOM   8336  O  O     . GLY C  2  608  ? 84.128  -5.010  100.342  1.00 61.70  ?  608  GLY C O     1 
ATOM   8337  N  N     . ASN C  2  609  ? 86.311  -4.467  100.412  1.00 57.47  ?  609  ASN C N     1 
ATOM   8338  C  CA    . ASN C  2  609  ? 86.524  -4.708  98.988   1.00 47.94  ?  609  ASN C CA    1 
ATOM   8339  C  C     . ASN C  2  609  ? 86.900  -6.140  98.597   1.00 50.07  ?  609  ASN C C     1 
ATOM   8340  O  O     . ASN C  2  609  ? 86.836  -6.493  97.420   1.00 52.90  ?  609  ASN C O     1 
ATOM   8341  C  CB    . ASN C  2  609  ? 87.571  -3.732  98.447   1.00 42.84  ?  609  ASN C CB    1 
ATOM   8342  C  CG    . ASN C  2  609  ? 87.244  -2.292  98.779   1.00 45.96  ?  609  ASN C CG    1 
ATOM   8343  O  OD1   . ASN C  2  609  ? 86.076  -1.920  98.885   1.00 59.81  ?  609  ASN C OD1   1 
ATOM   8344  N  ND2   . ASN C  2  609  ? 88.276  -1.473  98.950   1.00 46.40  ?  609  ASN C ND2   1 
ATOM   8345  N  N     . ARG C  2  610  ? 87.281  -6.964  99.569   1.00 44.99  ?  610  ARG C N     1 
ATOM   8346  C  CA    . ARG C  2  610  ? 87.681  -8.338  99.263   1.00 55.08  ?  610  ARG C CA    1 
ATOM   8347  C  C     . ARG C  2  610  ? 87.600  -9.278  100.463  1.00 55.05  ?  610  ARG C C     1 
ATOM   8348  O  O     . ARG C  2  610  ? 87.560  -8.836  101.611  1.00 65.26  ?  610  ARG C O     1 
ATOM   8349  C  CB    . ARG C  2  610  ? 89.097  -8.377  98.672   1.00 62.17  ?  610  ARG C CB    1 
ATOM   8350  C  CG    . ARG C  2  610  ? 90.210  -8.488  99.706   1.00 67.66  ?  610  ARG C CG    1 
ATOM   8351  C  CD    . ARG C  2  610  ? 90.401  -7.190  100.473  1.00 74.24  ?  610  ARG C CD    1 
ATOM   8352  N  NE    . ARG C  2  610  ? 91.001  -7.412  101.786  1.00 72.00  ?  610  ARG C NE    1 
ATOM   8353  C  CZ    . ARG C  2  610  ? 92.307  -7.400  102.029  1.00 73.75  ?  610  ARG C CZ    1 
ATOM   8354  N  NH1   . ARG C  2  610  ? 92.753  -7.611  103.260  1.00 75.07  ?  610  ARG C NH1   1 
ATOM   8355  N  NH2   . ARG C  2  610  ? 93.166  -7.178  101.044  1.00 77.44  ?  610  ARG C NH2   1 
ATOM   8356  N  N     . ILE C  2  611  ? 87.580  -10.577 100.184  1.00 49.32  ?  611  ILE C N     1 
ATOM   8357  C  CA    . ILE C  2  611  ? 87.637  -11.596 101.227  1.00 59.30  ?  611  ILE C CA    1 
ATOM   8358  C  C     . ILE C  2  611  ? 88.674  -12.659 100.877  1.00 69.65  ?  611  ILE C C     1 
ATOM   8359  O  O     . ILE C  2  611  ? 88.552  -13.345 99.861   1.00 72.86  ?  611  ILE C O     1 
ATOM   8360  C  CB    . ILE C  2  611  ? 86.273  -12.278 101.440  1.00 57.40  ?  611  ILE C CB    1 
ATOM   8361  C  CG1   . ILE C  2  611  ? 85.270  -11.293 102.042  1.00 60.44  ?  611  ILE C CG1   1 
ATOM   8362  C  CG2   . ILE C  2  611  ? 86.420  -13.495 102.341  1.00 57.72  ?  611  ILE C CG2   1 
ATOM   8363  C  CD1   . ILE C  2  611  ? 83.916  -11.906 102.331  1.00 69.03  ?  611  ILE C CD1   1 
ATOM   8364  N  N     . VAL C  2  612  ? 89.694  -12.791 101.720  1.00 72.40  ?  612  VAL C N     1 
ATOM   8365  C  CA    . VAL C  2  612  ? 90.754  -13.766 101.484  1.00 64.94  ?  612  VAL C CA    1 
ATOM   8366  C  C     . VAL C  2  612  ? 90.542  -15.031 102.311  1.00 62.85  ?  612  VAL C C     1 
ATOM   8367  O  O     . VAL C  2  612  ? 90.587  -14.998 103.539  1.00 66.12  ?  612  VAL C O     1 
ATOM   8368  C  CB    . VAL C  2  612  ? 92.146  -13.182 101.793  1.00 62.32  ?  612  VAL C CB    1 
ATOM   8369  C  CG1   . VAL C  2  612  ? 93.220  -14.238 101.596  1.00 70.84  ?  612  VAL C CG1   1 
ATOM   8370  C  CG2   . VAL C  2  612  ? 92.419  -11.965 100.922  1.00 59.70  ?  612  VAL C CG2   1 
ATOM   8371  N  N     . VAL C  2  613  ? 90.313  -16.145 101.626  1.00 67.65  ?  613  VAL C N     1 
ATOM   8372  C  CA    . VAL C  2  613  ? 90.075  -17.420 102.287  1.00 71.24  ?  613  VAL C CA    1 
ATOM   8373  C  C     . VAL C  2  613  ? 91.261  -18.365 102.117  1.00 82.25  ?  613  VAL C C     1 
ATOM   8374  O  O     . VAL C  2  613  ? 91.792  -18.527 101.013  1.00 84.39  ?  613  VAL C O     1 
ATOM   8375  C  CB    . VAL C  2  613  ? 88.810  -18.106 101.737  1.00 70.31  ?  613  VAL C CB    1 
ATOM   8376  C  CG1   . VAL C  2  613  ? 88.506  -19.376 102.519  1.00 68.12  ?  613  VAL C CG1   1 
ATOM   8377  C  CG2   . VAL C  2  613  ? 87.631  -17.150 101.786  1.00 77.58  ?  613  VAL C CG2   1 
ATOM   8378  N  N     . ARG C  2  614  ? 91.679  -18.974 103.223  1.00 84.77  ?  614  ARG C N     1 
ATOM   8379  C  CA    . ARG C  2  614  ? 92.698  -20.014 103.188  1.00 92.63  ?  614  ARG C CA    1 
ATOM   8380  C  C     . ARG C  2  614  ? 92.049  -21.384 103.342  1.00 88.83  ?  614  ARG C C     1 
ATOM   8381  O  O     . ARG C  2  614  ? 91.549  -21.736 104.412  1.00 88.65  ?  614  ARG C O     1 
ATOM   8382  C  CB    . ARG C  2  614  ? 93.747  -19.786 104.281  1.00 97.21  ?  614  ARG C CB    1 
ATOM   8383  C  CG    . ARG C  2  614  ? 94.627  -20.997 104.565  1.00 104.58 ?  614  ARG C CG    1 
ATOM   8384  C  CD    . ARG C  2  614  ? 95.891  -20.607 105.313  1.00 101.53 ?  614  ARG C CD    1 
ATOM   8385  N  NE    . ARG C  2  614  ? 96.861  -19.966 104.430  1.00 105.85 ?  614  ARG C NE    1 
ATOM   8386  C  CZ    . ARG C  2  614  ? 97.779  -20.624 103.730  1.00 100.43 ?  614  ARG C CZ    1 
ATOM   8387  N  NH1   . ARG C  2  614  ? 98.622  -19.962 102.949  1.00 91.33  ?  614  ARG C NH1   1 
ATOM   8388  N  NH2   . ARG C  2  614  ? 97.855  -21.945 103.811  1.00 99.34  ?  614  ARG C NH2   1 
ATOM   8389  N  N     . TYR C  2  615  ? 92.045  -22.145 102.255  1.00 86.09  ?  615  TYR C N     1 
ATOM   8390  C  CA    . TYR C  2  615  ? 91.475  -23.486 102.247  1.00 95.06  ?  615  TYR C CA    1 
ATOM   8391  C  C     . TYR C  2  615  ? 92.432  -24.526 102.827  1.00 103.24 ?  615  TYR C C     1 
ATOM   8392  O  O     . TYR C  2  615  ? 93.644  -24.311 102.864  1.00 103.10 ?  615  TYR C O     1 
ATOM   8393  C  CB    . TYR C  2  615  ? 91.012  -23.862 100.839  1.00 105.78 ?  615  TYR C CB    1 
ATOM   8394  C  CG    . TYR C  2  615  ? 89.919  -22.954 100.322  1.00 101.15 ?  615  TYR C CG    1 
ATOM   8395  C  CD1   . TYR C  2  615  ? 88.607  -23.105 100.752  1.00 94.07  ?  615  TYR C CD1   1 
ATOM   8396  C  CD2   . TYR C  2  615  ? 90.199  -21.938 99.417   1.00 89.42  ?  615  TYR C CD2   1 
ATOM   8397  C  CE1   . TYR C  2  615  ? 87.603  -22.276 100.291  1.00 93.28  ?  615  TYR C CE1   1 
ATOM   8398  C  CE2   . TYR C  2  615  ? 89.199  -21.103 98.949   1.00 90.96  ?  615  TYR C CE2   1 
ATOM   8399  C  CZ    . TYR C  2  615  ? 87.903  -21.277 99.389   1.00 97.19  ?  615  TYR C CZ    1 
ATOM   8400  O  OH    . TYR C  2  615  ? 86.901  -20.453 98.930   1.00 89.52  ?  615  TYR C OH    1 
ATOM   8401  N  N     . GLU C  2  616  ? 91.871  -25.642 103.290  1.00 102.73 ?  616  GLU C N     1 
ATOM   8402  C  CA    . GLU C  2  616  ? 92.627  -26.692 103.975  1.00 103.52 ?  616  GLU C CA    1 
ATOM   8403  C  C     . GLU C  2  616  ? 93.873  -27.173 103.227  1.00 107.45 ?  616  GLU C C     1 
ATOM   8404  O  O     . GLU C  2  616  ? 94.880  -27.517 103.849  1.00 104.24 ?  616  GLU C O     1 
ATOM   8405  C  CB    . GLU C  2  616  ? 91.718  -27.887 104.286  1.00 100.64 ?  616  GLU C CB    1 
ATOM   8406  C  CG    . GLU C  2  616  ? 91.142  -28.569 103.053  1.00 102.69 ?  616  GLU C CG    1 
ATOM   8407  C  CD    . GLU C  2  616  ? 90.500  -29.905 103.369  1.00 105.35 ?  616  GLU C CD    1 
ATOM   8408  O  OE1   . GLU C  2  616  ? 90.052  -30.097 104.519  1.00 101.42 ?  616  GLU C OE1   1 
ATOM   8409  O  OE2   . GLU C  2  616  ? 90.450  -30.768 102.466  1.00 103.11 ?  616  GLU C OE2   1 
ATOM   8410  N  N     . ASP C  2  617  ? 93.808  -27.194 101.898  1.00 104.96 ?  617  ASP C N     1 
ATOM   8411  C  CA    . ASP C  2  617  ? 94.927  -27.673 101.091  1.00 95.00  ?  617  ASP C CA    1 
ATOM   8412  C  C     . ASP C  2  617  ? 96.108  -26.704 101.120  1.00 94.36  ?  617  ASP C C     1 
ATOM   8413  O  O     . ASP C  2  617  ? 97.211  -27.044 100.691  1.00 90.99  ?  617  ASP C O     1 
ATOM   8414  C  CB    . ASP C  2  617  ? 94.484  -27.953 99.651   1.00 86.87  ?  617  ASP C CB    1 
ATOM   8415  C  CG    . ASP C  2  617  ? 93.923  -26.725 98.962   1.00 92.60  ?  617  ASP C CG    1 
ATOM   8416  O  OD1   . ASP C  2  617  ? 93.507  -25.782 99.666   1.00 98.97  ?  617  ASP C OD1   1 
ATOM   8417  O  OD2   . ASP C  2  617  ? 93.894  -26.708 97.714   1.00 91.75  ?  617  ASP C OD2   1 
ATOM   8418  N  N     . GLY C  2  618  ? 95.870  -25.499 101.628  1.00 95.16  ?  618  GLY C N     1 
ATOM   8419  C  CA    . GLY C  2  618  ? 96.934  -24.536 101.839  1.00 97.09  ?  618  GLY C CA    1 
ATOM   8420  C  C     . GLY C  2  618  ? 96.967  -23.379 100.859  1.00 104.19 ?  618  GLY C C     1 
ATOM   8421  O  O     . GLY C  2  618  ? 97.642  -22.379 101.103  1.00 105.77 ?  618  GLY C O     1 
ATOM   8422  N  N     . ARG C  2  619  ? 96.241  -23.502 99.752   1.00 98.43  ?  619  ARG C N     1 
ATOM   8423  C  CA    . ARG C  2  619  ? 96.243  -22.449 98.740   1.00 93.95  ?  619  ARG C CA    1 
ATOM   8424  C  C     . ARG C  2  619  ? 95.452  -21.226 99.203   1.00 92.62  ?  619  ARG C C     1 
ATOM   8425  O  O     . ARG C  2  619  ? 94.367  -21.351 99.774   1.00 94.65  ?  619  ARG C O     1 
ATOM   8426  C  CB    . ARG C  2  619  ? 95.729  -22.971 97.391   1.00 88.18  ?  619  ARG C CB    1 
ATOM   8427  C  CG    . ARG C  2  619  ? 94.254  -23.334 97.356   1.00 89.00  ?  619  ARG C CG    1 
ATOM   8428  C  CD    . ARG C  2  619  ? 93.878  -23.954 96.019   1.00 86.98  ?  619  ARG C CD    1 
ATOM   8429  N  NE    . ARG C  2  619  ? 92.434  -23.973 95.808   1.00 97.63  ?  619  ARG C NE    1 
ATOM   8430  C  CZ    . ARG C  2  619  ? 91.784  -23.117 95.026   1.00 102.99 ?  619  ARG C CZ    1 
ATOM   8431  N  NH1   . ARG C  2  619  ? 90.467  -23.205 94.893   1.00 101.56 ?  619  ARG C NH1   1 
ATOM   8432  N  NH2   . ARG C  2  619  ? 92.451  -22.177 94.371   1.00 90.34  ?  619  ARG C NH2   1 
ATOM   8433  N  N     . LEU C  2  620  ? 96.014  -20.045 98.968   1.00 83.61  ?  620  LEU C N     1 
ATOM   8434  C  CA    . LEU C  2  620  ? 95.392  -18.798 99.393   1.00 79.04  ?  620  LEU C CA    1 
ATOM   8435  C  C     . LEU C  2  620  ? 94.545  -18.220 98.265   1.00 83.45  ?  620  LEU C C     1 
ATOM   8436  O  O     . LEU C  2  620  ? 95.065  -17.879 97.202   1.00 78.71  ?  620  LEU C O     1 
ATOM   8437  C  CB    . LEU C  2  620  ? 96.464  -17.789 99.814   1.00 82.02  ?  620  LEU C CB    1 
ATOM   8438  C  CG    . LEU C  2  620  ? 96.008  -16.594 100.656  1.00 78.87  ?  620  LEU C CG    1 
ATOM   8439  C  CD1   . LEU C  2  620  ? 95.599  -17.053 102.048  1.00 81.34  ?  620  LEU C CD1   1 
ATOM   8440  C  CD2   . LEU C  2  620  ? 97.094  -15.530 100.732  1.00 44.15  ?  620  LEU C CD2   1 
ATOM   8441  N  N     . VAL C  2  621  ? 93.239  -18.110 98.496   1.00 87.44  ?  621  VAL C N     1 
ATOM   8442  C  CA    . VAL C  2  621  ? 92.332  -17.613 97.465   1.00 76.11  ?  621  VAL C CA    1 
ATOM   8443  C  C     . VAL C  2  621  ? 91.727  -16.268 97.843   1.00 65.46  ?  621  VAL C C     1 
ATOM   8444  O  O     . VAL C  2  621  ? 91.012  -16.161 98.835   1.00 71.62  ?  621  VAL C O     1 
ATOM   8445  C  CB    . VAL C  2  621  ? 91.191  -18.611 97.187   1.00 72.33  ?  621  VAL C CB    1 
ATOM   8446  C  CG1   . VAL C  2  621  ? 90.266  -18.067 96.110   1.00 72.79  ?  621  VAL C CG1   1 
ATOM   8447  C  CG2   . VAL C  2  621  ? 91.756  -19.961 96.778   1.00 85.01  ?  621  VAL C CG2   1 
ATOM   8448  N  N     . GLU C  2  622  ? 92.009  -15.242 97.047   1.00 62.79  ?  622  GLU C N     1 
ATOM   8449  C  CA    . GLU C  2  622  ? 91.460  -13.915 97.304   1.00 68.55  ?  622  GLU C CA    1 
ATOM   8450  C  C     . GLU C  2  622  ? 90.268  -13.609 96.400   1.00 82.06  ?  622  GLU C C     1 
ATOM   8451  O  O     . GLU C  2  622  ? 90.413  -13.501 95.182   1.00 83.47  ?  622  GLU C O     1 
ATOM   8452  C  CB    . GLU C  2  622  ? 92.536  -12.840 97.143   1.00 66.09  ?  622  GLU C CB    1 
ATOM   8453  C  CG    . GLU C  2  622  ? 92.004  -11.418 97.230   1.00 66.08  ?  622  GLU C CG    1 
ATOM   8454  C  CD    . GLU C  2  622  ? 93.109  -10.381 97.285   1.00 78.82  ?  622  GLU C CD    1 
ATOM   8455  O  OE1   . GLU C  2  622  ? 94.083  -10.588 98.040   1.00 76.53  ?  622  GLU C OE1   1 
ATOM   8456  O  OE2   . GLU C  2  622  ? 93.004  -9.360  96.573   1.00 76.88  ?  622  GLU C OE2   1 
ATOM   8457  N  N     . TYR C  2  623  ? 89.093  -13.470 97.008   1.00 82.05  ?  623  TYR C N     1 
ATOM   8458  C  CA    . TYR C  2  623  ? 87.878  -13.143 96.271   1.00 65.01  ?  623  TYR C CA    1 
ATOM   8459  C  C     . TYR C  2  623  ? 87.618  -11.642 96.280   1.00 63.37  ?  623  TYR C C     1 
ATOM   8460  O  O     . TYR C  2  623  ? 87.331  -11.066 97.331   1.00 63.61  ?  623  TYR C O     1 
ATOM   8461  C  CB    . TYR C  2  623  ? 86.672  -13.858 96.879   1.00 55.44  ?  623  TYR C CB    1 
ATOM   8462  C  CG    . TYR C  2  623  ? 86.736  -15.365 96.828   1.00 59.41  ?  623  TYR C CG    1 
ATOM   8463  C  CD1   . TYR C  2  623  ? 86.456  -16.051 95.654   1.00 68.39  ?  623  TYR C CD1   1 
ATOM   8464  C  CD2   . TYR C  2  623  ? 87.054  -16.104 97.959   1.00 60.65  ?  623  TYR C CD2   1 
ATOM   8465  C  CE1   . TYR C  2  623  ? 86.504  -17.431 95.604   1.00 69.54  ?  623  TYR C CE1   1 
ATOM   8466  C  CE2   . TYR C  2  623  ? 87.104  -17.485 97.919   1.00 63.44  ?  623  TYR C CE2   1 
ATOM   8467  C  CZ    . TYR C  2  623  ? 86.828  -18.142 96.738   1.00 70.43  ?  623  TYR C CZ    1 
ATOM   8468  O  OH    . TYR C  2  623  ? 86.876  -19.517 96.689   1.00 80.80  ?  623  TYR C OH    1 
ATOM   8469  N  N     . PRO C  2  624  ? 87.717  -11.000 95.107   1.00 63.12  ?  624  PRO C N     1 
ATOM   8470  C  CA    . PRO C  2  624  ? 87.374  -9.579  95.004   1.00 61.85  ?  624  PRO C CA    1 
ATOM   8471  C  C     . PRO C  2  624  ? 85.862  -9.395  95.070   1.00 70.72  ?  624  PRO C C     1 
ATOM   8472  O  O     . PRO C  2  624  ? 85.119  -10.269 94.621   1.00 69.00  ?  624  PRO C O     1 
ATOM   8473  C  CB    . PRO C  2  624  ? 87.901  -9.194  93.621   1.00 53.35  ?  624  PRO C CB    1 
ATOM   8474  C  CG    . PRO C  2  624  ? 87.851  -10.460 92.840   1.00 71.77  ?  624  PRO C CG    1 
ATOM   8475  C  CD    . PRO C  2  624  ? 88.159  -11.560 93.818   1.00 70.61  ?  624  PRO C CD    1 
ATOM   8476  N  N     . LEU C  2  625  ? 85.414  -8.278  95.632   1.00 65.53  ?  625  LEU C N     1 
ATOM   8477  C  CA    . LEU C  2  625  ? 83.986  -8.031  95.792   1.00 67.55  ?  625  LEU C CA    1 
ATOM   8478  C  C     . LEU C  2  625  ? 83.511  -6.866  94.930   1.00 66.54  ?  625  LEU C C     1 
ATOM   8479  O  O     . LEU C  2  625  ? 84.153  -5.815  94.880   1.00 54.89  ?  625  LEU C O     1 
ATOM   8480  C  CB    . LEU C  2  625  ? 83.647  -7.768  97.263   1.00 64.21  ?  625  LEU C CB    1 
ATOM   8481  C  CG    . LEU C  2  625  ? 83.904  -8.906  98.256   1.00 61.13  ?  625  LEU C CG    1 
ATOM   8482  C  CD1   . LEU C  2  625  ? 83.580  -8.467  99.677   1.00 47.59  ?  625  LEU C CD1   1 
ATOM   8483  C  CD2   . LEU C  2  625  ? 83.104  -10.146 97.879   1.00 52.55  ?  625  LEU C CD2   1 
ATOM   8484  N  N     . ARG C  2  626  ? 82.388  -7.064  94.246   1.00 65.74  ?  626  ARG C N     1 
ATOM   8485  C  CA    . ARG C  2  626  ? 81.761  -5.994  93.482   1.00 62.93  ?  626  ARG C CA    1 
ATOM   8486  C  C     . ARG C  2  626  ? 81.197  -4.972  94.459   1.00 63.40  ?  626  ARG C C     1 
ATOM   8487  O  O     . ARG C  2  626  ? 80.491  -5.331  95.399   1.00 61.47  ?  626  ARG C O     1 
ATOM   8488  C  CB    . ARG C  2  626  ? 80.651  -6.549  92.587   1.00 64.60  ?  626  ARG C CB    1 
ATOM   8489  C  CG    . ARG C  2  626  ? 80.856  -6.276  91.104   1.00 65.19  ?  626  ARG C CG    1 
ATOM   8490  C  CD    . ARG C  2  626  ? 79.746  -6.883  90.254   1.00 67.09  ?  626  ARG C CD    1 
ATOM   8491  N  NE    . ARG C  2  626  ? 79.740  -8.343  90.309   1.00 83.78  ?  626  ARG C NE    1 
ATOM   8492  C  CZ    . ARG C  2  626  ? 78.846  -9.065  90.979   1.00 87.72  ?  626  ARG C CZ    1 
ATOM   8493  N  NH1   . ARG C  2  626  ? 77.873  -8.463  91.651   1.00 78.47  ?  626  ARG C NH1   1 
ATOM   8494  N  NH2   . ARG C  2  626  ? 78.922  -10.390 90.971   1.00 77.81  ?  626  ARG C NH2   1 
ATOM   8495  N  N     . ARG C  2  627  ? 81.521  -3.700  94.246   1.00 67.87  ?  627  ARG C N     1 
ATOM   8496  C  CA    . ARG C  2  627  ? 81.119  -2.655  95.181   1.00 63.90  ?  627  ARG C CA    1 
ATOM   8497  C  C     . ARG C  2  627  ? 80.482  -1.459  94.481   1.00 66.68  ?  627  ARG C C     1 
ATOM   8498  O  O     . ARG C  2  627  ? 81.133  -0.771  93.692   1.00 69.57  ?  627  ARG C O     1 
ATOM   8499  C  CB    . ARG C  2  627  ? 82.322  -2.196  96.010   1.00 63.97  ?  627  ARG C CB    1 
ATOM   8500  C  CG    . ARG C  2  627  ? 82.079  -2.193  97.509   1.00 59.07  ?  627  ARG C CG    1 
ATOM   8501  C  CD    . ARG C  2  627  ? 81.681  -3.575  98.005   1.00 64.25  ?  627  ARG C CD    1 
ATOM   8502  N  NE    . ARG C  2  627  ? 81.578  -3.626  99.461   1.00 74.01  ?  627  ARG C NE    1 
ATOM   8503  C  CZ    . ARG C  2  627  ? 80.471  -3.353  100.143  1.00 69.41  ?  627  ARG C CZ    1 
ATOM   8504  N  NH1   . ARG C  2  627  ? 79.363  -3.008  99.501   1.00 67.70  ?  627  ARG C NH1   1 
ATOM   8505  N  NH2   . ARG C  2  627  ? 80.470  -3.426  101.467  1.00 66.05  ?  627  ARG C NH2   1 
ATOM   8506  N  N     . PHE C  2  628  ? 79.209  -1.220  94.787   1.00 63.01  ?  628  PHE C N     1 
ATOM   8507  C  CA    . PHE C  2  628  ? 78.459  -0.085  94.254   1.00 62.27  ?  628  PHE C CA    1 
ATOM   8508  C  C     . PHE C  2  628  ? 78.468  -0.036  92.726   1.00 61.45  ?  628  PHE C C     1 
ATOM   8509  O  O     . PHE C  2  628  ? 78.829  0.978   92.129   1.00 57.78  ?  628  PHE C O     1 
ATOM   8510  C  CB    . PHE C  2  628  ? 78.974  1.232   94.846   1.00 60.18  ?  628  PHE C CB    1 
ATOM   8511  C  CG    . PHE C  2  628  ? 78.784  1.343   96.336   1.00 64.16  ?  628  PHE C CG    1 
ATOM   8512  C  CD1   . PHE C  2  628  ? 77.675  1.989   96.860   1.00 57.00  ?  628  PHE C CD1   1 
ATOM   8513  C  CD2   . PHE C  2  628  ? 79.711  0.798   97.211   1.00 63.97  ?  628  PHE C CD2   1 
ATOM   8514  C  CE1   . PHE C  2  628  ? 77.497  2.092   98.228   1.00 50.74  ?  628  PHE C CE1   1 
ATOM   8515  C  CE2   . PHE C  2  628  ? 79.538  0.897   98.580   1.00 57.59  ?  628  PHE C CE2   1 
ATOM   8516  C  CZ    . PHE C  2  628  ? 78.430  1.544   99.089   1.00 54.73  ?  628  PHE C CZ    1 
ATOM   8517  N  N     . TYR C  2  629  ? 78.073  -1.143  92.104   1.00 62.76  ?  629  TYR C N     1 
ATOM   8518  C  CA    . TYR C  2  629  ? 78.024  -1.235  90.648   1.00 67.53  ?  629  TYR C CA    1 
ATOM   8519  C  C     . TYR C  2  629  ? 76.631  -0.943  90.103   1.00 61.93  ?  629  TYR C C     1 
ATOM   8520  O  O     . TYR C  2  629  ? 75.626  -1.340  90.691   1.00 64.91  ?  629  TYR C O     1 
ATOM   8521  C  CB    . TYR C  2  629  ? 78.489  -2.617  90.181   1.00 71.61  ?  629  TYR C CB    1 
ATOM   8522  C  CG    . TYR C  2  629  ? 79.989  -2.744  90.029   1.00 88.88  ?  629  TYR C CG    1 
ATOM   8523  C  CD1   . TYR C  2  629  ? 80.821  -2.755  91.142   1.00 82.17  ?  629  TYR C CD1   1 
ATOM   8524  C  CD2   . TYR C  2  629  ? 80.572  -2.858  88.773   1.00 94.41  ?  629  TYR C CD2   1 
ATOM   8525  C  CE1   . TYR C  2  629  ? 82.194  -2.873  91.008   1.00 80.56  ?  629  TYR C CE1   1 
ATOM   8526  C  CE2   . TYR C  2  629  ? 81.943  -2.977  88.629   1.00 98.39  ?  629  TYR C CE2   1 
ATOM   8527  C  CZ    . TYR C  2  629  ? 82.749  -2.983  89.750   1.00 94.60  ?  629  TYR C CZ    1 
ATOM   8528  O  OH    . TYR C  2  629  ? 84.113  -3.101  89.612   1.00 100.94 ?  629  TYR C OH    1 
ATOM   8529  N  N     . ARG C  2  630  ? 76.583  -0.246  88.973   1.00 55.54  ?  630  ARG C N     1 
ATOM   8530  C  CA    . ARG C  2  630  ? 75.322  0.083   88.322   1.00 49.93  ?  630  ARG C CA    1 
ATOM   8531  C  C     . ARG C  2  630  ? 74.883  -1.048  87.399   1.00 51.12  ?  630  ARG C C     1 
ATOM   8532  O  O     . ARG C  2  630  ? 75.696  -1.607  86.664   1.00 65.15  ?  630  ARG C O     1 
ATOM   8533  C  CB    . ARG C  2  630  ? 75.465  1.375   87.517   1.00 50.05  ?  630  ARG C CB    1 
ATOM   8534  C  CG    . ARG C  2  630  ? 74.200  1.804   86.795   1.00 45.64  ?  630  ARG C CG    1 
ATOM   8535  C  CD    . ARG C  2  630  ? 74.481  2.913   85.794   1.00 47.08  ?  630  ARG C CD    1 
ATOM   8536  N  NE    . ARG C  2  630  ? 73.249  3.445   85.218   1.00 50.30  ?  630  ARG C NE    1 
ATOM   8537  C  CZ    . ARG C  2  630  ? 72.614  2.905   84.184   1.00 49.59  ?  630  ARG C CZ    1 
ATOM   8538  N  NH1   . ARG C  2  630  ? 71.498  3.457   83.729   1.00 53.56  ?  630  ARG C NH1   1 
ATOM   8539  N  NH2   . ARG C  2  630  ? 73.093  1.812   83.605   1.00 50.67  ?  630  ARG C NH2   1 
ATOM   8540  N  N     . SER C  2  631  ? 73.598  -1.383  87.439   1.00 46.33  ?  631  SER C N     1 
ATOM   8541  C  CA    . SER C  2  631  ? 73.052  -2.411  86.561   1.00 51.97  ?  631  SER C CA    1 
ATOM   8542  C  C     . SER C  2  631  ? 72.452  -1.779  85.312   1.00 52.38  ?  631  SER C C     1 
ATOM   8543  O  O     . SER C  2  631  ? 72.524  -0.565  85.123   1.00 50.41  ?  631  SER C O     1 
ATOM   8544  C  CB    . SER C  2  631  ? 71.989  -3.234  87.289   1.00 50.51  ?  631  SER C CB    1 
ATOM   8545  O  OG    . SER C  2  631  ? 70.840  -2.451  87.565   1.00 47.30  ?  631  SER C OG    1 
ATOM   8546  N  N     . ASN C  2  632  ? 71.864  -2.611  84.459   1.00 52.24  ?  632  ASN C N     1 
ATOM   8547  C  CA    . ASN C  2  632  ? 71.183  -2.125  83.267   1.00 50.40  ?  632  ASN C CA    1 
ATOM   8548  C  C     . ASN C  2  632  ? 69.968  -1.287  83.642   1.00 53.82  ?  632  ASN C C     1 
ATOM   8549  O  O     . ASN C  2  632  ? 69.651  -0.298  82.981   1.00 53.26  ?  632  ASN C O     1 
ATOM   8550  C  CB    . ASN C  2  632  ? 70.751  -3.294  82.380   1.00 53.11  ?  632  ASN C CB    1 
ATOM   8551  C  CG    . ASN C  2  632  ? 71.927  -4.080  81.837   1.00 59.27  ?  632  ASN C CG    1 
ATOM   8552  O  OD1   . ASN C  2  632  ? 73.007  -3.532  81.618   1.00 61.75  ?  632  ASN C OD1   1 
ATOM   8553  N  ND2   . ASN C  2  632  ? 71.720  -5.374  81.614   1.00 50.84  ?  632  ASN C ND2   1 
ATOM   8554  N  N     . GLN C  2  633  ? 69.297  -1.692  84.716   1.00 50.09  ?  633  GLN C N     1 
ATOM   8555  C  CA    . GLN C  2  633  ? 68.084  -1.021  85.167   1.00 44.27  ?  633  GLN C CA    1 
ATOM   8556  C  C     . GLN C  2  633  ? 68.398  0.194   86.034   1.00 48.45  ?  633  GLN C C     1 
ATOM   8557  O  O     . GLN C  2  633  ? 67.528  1.025   86.291   1.00 55.11  ?  633  GLN C O     1 
ATOM   8558  C  CB    . GLN C  2  633  ? 67.176  -1.998  85.918   1.00 44.71  ?  633  GLN C CB    1 
ATOM   8559  C  CG    . GLN C  2  633  ? 66.339  -2.891  85.012   1.00 51.58  ?  633  GLN C CG    1 
ATOM   8560  C  CD    . GLN C  2  633  ? 67.181  -3.706  84.047   1.00 48.44  ?  633  GLN C CD    1 
ATOM   8561  O  OE1   . GLN C  2  633  ? 68.209  -4.270  84.423   1.00 45.30  ?  633  GLN C OE1   1 
ATOM   8562  N  NE2   . GLN C  2  633  ? 66.753  -3.761  82.790   1.00 44.95  ?  633  GLN C NE2   1 
ATOM   8563  N  N     . GLY C  2  634  ? 69.645  0.292   86.481   1.00 46.37  ?  634  GLY C N     1 
ATOM   8564  C  CA    . GLY C  2  634  ? 70.087  1.448   87.238   1.00 48.64  ?  634  GLY C CA    1 
ATOM   8565  C  C     . GLY C  2  634  ? 70.100  1.232   88.738   1.00 49.05  ?  634  GLY C C     1 
ATOM   8566  O  O     . GLY C  2  634  ? 70.272  2.181   89.504   1.00 51.84  ?  634  GLY C O     1 
ATOM   8567  N  N     . THR C  2  635  ? 69.922  -0.014  89.164   1.00 44.55  ?  635  THR C N     1 
ATOM   8568  C  CA    . THR C  2  635  ? 69.963  -0.339  90.584   1.00 44.27  ?  635  THR C CA    1 
ATOM   8569  C  C     . THR C  2  635  ? 71.404  -0.386  91.078   1.00 52.65  ?  635  THR C C     1 
ATOM   8570  O  O     . THR C  2  635  ? 72.333  -0.056  90.342   1.00 57.04  ?  635  THR C O     1 
ATOM   8571  C  CB    . THR C  2  635  ? 69.275  -1.686  90.887   1.00 42.62  ?  635  THR C CB    1 
ATOM   8572  O  OG1   . THR C  2  635  ? 69.915  -2.733  90.146   1.00 43.97  ?  635  THR C OG1   1 
ATOM   8573  C  CG2   . THR C  2  635  ? 67.803  -1.631  90.514   1.00 37.26  ?  635  THR C CG2   1 
ATOM   8574  N  N     . ALA C  2  636  ? 71.584  -0.791  92.330   1.00 59.85  ?  636  ALA C N     1 
ATOM   8575  C  CA    . ALA C  2  636  ? 72.917  -0.909  92.907   1.00 51.43  ?  636  ALA C CA    1 
ATOM   8576  C  C     . ALA C  2  636  ? 73.239  -2.364  93.225   1.00 53.60  ?  636  ALA C C     1 
ATOM   8577  O  O     . ALA C  2  636  ? 72.468  -3.049  93.897   1.00 51.83  ?  636  ALA C O     1 
ATOM   8578  C  CB    . ALA C  2  636  ? 73.032  -0.055  94.155   1.00 45.32  ?  636  ALA C CB    1 
ATOM   8579  N  N     . LEU C  2  637  ? 74.380  -2.833  92.732   1.00 58.36  ?  637  LEU C N     1 
ATOM   8580  C  CA    . LEU C  2  637  ? 74.822  -4.194  93.009   1.00 65.87  ?  637  LEU C CA    1 
ATOM   8581  C  C     . LEU C  2  637  ? 76.168  -4.204  93.723   1.00 68.94  ?  637  LEU C C     1 
ATOM   8582  O  O     . LEU C  2  637  ? 77.191  -3.842  93.140   1.00 68.72  ?  637  LEU C O     1 
ATOM   8583  C  CB    . LEU C  2  637  ? 74.914  -5.011  91.716   1.00 73.40  ?  637  LEU C CB    1 
ATOM   8584  C  CG    . LEU C  2  637  ? 73.637  -5.657  91.169   1.00 70.19  ?  637  LEU C CG    1 
ATOM   8585  C  CD1   . LEU C  2  637  ? 72.648  -4.620  90.653   1.00 60.31  ?  637  LEU C CD1   1 
ATOM   8586  C  CD2   . LEU C  2  637  ? 73.980  -6.666  90.083   1.00 63.05  ?  637  LEU C CD2   1 
ATOM   8587  N  N     . ASP C  2  638  ? 76.162  -4.619  94.986   1.00 67.22  ?  638  ASP C N     1 
ATOM   8588  C  CA    . ASP C  2  638  ? 77.403  -4.803  95.733   1.00 65.89  ?  638  ASP C CA    1 
ATOM   8589  C  C     . ASP C  2  638  ? 77.340  -5.983  96.697   1.00 64.13  ?  638  ASP C C     1 
ATOM   8590  O  O     . ASP C  2  638  ? 76.262  -6.491  97.011   1.00 57.74  ?  638  ASP C O     1 
ATOM   8591  C  CB    . ASP C  2  638  ? 77.826  -3.522  96.465   1.00 58.56  ?  638  ASP C CB    1 
ATOM   8592  C  CG    . ASP C  2  638  ? 76.732  -2.952  97.345   1.00 70.58  ?  638  ASP C CG    1 
ATOM   8593  O  OD1   . ASP C  2  638  ? 75.888  -3.726  97.845   1.00 79.08  ?  638  ASP C OD1   1 
ATOM   8594  O  OD2   . ASP C  2  638  ? 76.725  -1.718  97.542   1.00 64.35  ?  638  ASP C OD2   1 
ATOM   8595  N  N     . GLN C  2  639  ? 78.506  -6.411  97.164   1.00 64.92  ?  639  GLN C N     1 
ATOM   8596  C  CA    . GLN C  2  639  ? 78.600  -7.581  98.023   1.00 61.22  ?  639  GLN C CA    1 
ATOM   8597  C  C     . GLN C  2  639  ? 79.102  -7.227  99.421   1.00 61.25  ?  639  GLN C C     1 
ATOM   8598  O  O     . GLN C  2  639  ? 80.154  -6.608  99.579   1.00 61.16  ?  639  GLN C O     1 
ATOM   8599  C  CB    . GLN C  2  639  ? 79.492  -8.639  97.371   1.00 65.59  ?  639  GLN C CB    1 
ATOM   8600  C  CG    . GLN C  2  639  ? 78.882  -9.258  96.120   1.00 62.26  ?  639  GLN C CG    1 
ATOM   8601  C  CD    . GLN C  2  639  ? 79.925  -9.716  95.120   1.00 58.75  ?  639  GLN C CD    1 
ATOM   8602  O  OE1   . GLN C  2  639  ? 80.847  -8.973  94.783   1.00 51.80  ?  639  GLN C OE1   1 
ATOM   8603  N  NE2   . GLN C  2  639  ? 79.