data_5D9I
# 
_entry.id   5D9I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5D9I         
WWPDB D_1000212809 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5D9I 
_pdbx_database_status.recvd_initial_deposition_date   2015-08-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Meinke, G.'    1 ? 
'Bohm, A.'      2 ? 
'Bullock, P.A.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Virol.' 
_citation.journal_id_ASTM           JOVIAM 
_citation.journal_id_CSD            0825 
_citation.journal_id_ISSN           1098-5514 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            85 
_citation.language                  ? 
_citation.page_first                818 
_citation.page_last                 827 
_citation.title                     
'Structure-based analysis of the interaction between the simian virus 40 T-antigen origin binding domain and single-stranded DNA.' 
_citation.year                      2011 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1128/JVI.01738-10 
_citation.pdbx_database_id_PubMed   20980496 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Meinke, G.'          1 ? 
primary 'Phelan, P.J.'        2 ? 
primary 'Fradet-Turcotte, A.' 3 ? 
primary 'Bohm, A.'            4 ? 
primary 'Archambault, J.'     5 ? 
primary 'Bullock, P.A.'       6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   92.42 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5D9I 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     94.192 
_cell.length_a_esd                 ? 
_cell.length_b                     63.393 
_cell.length_b_esd                 ? 
_cell.length_c                     64.891 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5D9I 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Large T antigen'                                                                     15490.752 2   3.6.4.- ? 
'unp residues 131-260' ? 
2 polymer     man 
;DNA (5'-D(*GP*AP*GP*GP*AP*GP*GP*CP*TP*TP*TP*TP*TP*TP*GP*GP*AP*GP*GP*CP*C)-3')
;
6550.217  1   ?       ? ?                      ? 
3 polymer     man 
;DNA (5'-D(*AP*CP*TP*CP*CP*TP*CP*CP*GP*AP*AP*AP*AP*AP*AP*CP*CP*TP*CP*CP*GP*GP*A)-3')
;
6963.529  1   ?       ? ?                      ? 
4 non-polymer syn 1,2-ETHANEDIOL                                                                        62.068    2   ?       ? ? 
? 
5 non-polymer syn 'CALCIUM ION'                                                                         40.078    2   ?       ? ? 
? 
6 non-polymer syn 'ACETATE ION'                                                                         59.044    1   ?       ? ? 
? 
7 water       nat water                                                                                 18.015    230 ?       ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        LT-AG 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no yes 
;GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAI
NNYAQKL(CME)TFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPESS
;
;GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAI
NNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPESS
;
A,B ? 
2 polydeoxyribonucleotide no no  
;(DG)(DA)(DG)(DG)(DA)(DG)(DG)(DC)(DT)(DT)(DT)(DT)(DT)(DT)(DG)(DG)(DA)(DG)(DG)(DC)
(DC)
;
GAGGAGGCTTTTTTGGAGGCC X   ? 
3 polydeoxyribonucleotide no no  
;(DA)(DC)(DT)(DC)(DC)(DT)(DC)(DC)(DG)(DA)(DA)(DA)(DA)(DA)(DA)(DC)(DC)(DT)(DC)(DC)
(DG)(DG)(DA)
;
ACTCCTCCGAAAAAACCTCCGGA Y   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   LYS n 
1 4   VAL n 
1 5   GLU n 
1 6   ASP n 
1 7   PRO n 
1 8   LYS n 
1 9   ASP n 
1 10  PHE n 
1 11  PRO n 
1 12  SER n 
1 13  GLU n 
1 14  LEU n 
1 15  LEU n 
1 16  SER n 
1 17  PHE n 
1 18  LEU n 
1 19  SER n 
1 20  HIS n 
1 21  ALA n 
1 22  VAL n 
1 23  PHE n 
1 24  SER n 
1 25  ASN n 
1 26  ARG n 
1 27  THR n 
1 28  LEU n 
1 29  ALA n 
1 30  CYS n 
1 31  PHE n 
1 32  ALA n 
1 33  ILE n 
1 34  TYR n 
1 35  THR n 
1 36  THR n 
1 37  LYS n 
1 38  GLU n 
1 39  LYS n 
1 40  ALA n 
1 41  ALA n 
1 42  LEU n 
1 43  LEU n 
1 44  TYR n 
1 45  LYS n 
1 46  LYS n 
1 47  ILE n 
1 48  MET n 
1 49  GLU n 
1 50  LYS n 
1 51  TYR n 
1 52  SER n 
1 53  VAL n 
1 54  THR n 
1 55  PHE n 
1 56  ILE n 
1 57  SER n 
1 58  ARG n 
1 59  HIS n 
1 60  ASN n 
1 61  SER n 
1 62  TYR n 
1 63  ASN n 
1 64  HIS n 
1 65  ASN n 
1 66  ILE n 
1 67  LEU n 
1 68  PHE n 
1 69  PHE n 
1 70  LEU n 
1 71  THR n 
1 72  PRO n 
1 73  HIS n 
1 74  ARG n 
1 75  HIS n 
1 76  ARG n 
1 77  VAL n 
1 78  SER n 
1 79  ALA n 
1 80  ILE n 
1 81  ASN n 
1 82  ASN n 
1 83  TYR n 
1 84  ALA n 
1 85  GLN n 
1 86  LYS n 
1 87  LEU n 
1 88  CME n 
1 89  THR n 
1 90  PHE n 
1 91  SER n 
1 92  PHE n 
1 93  LEU n 
1 94  ILE n 
1 95  CYS n 
1 96  LYS n 
1 97  GLY n 
1 98  VAL n 
1 99  ASN n 
1 100 LYS n 
1 101 GLU n 
1 102 TYR n 
1 103 LEU n 
1 104 MET n 
1 105 TYR n 
1 106 SER n 
1 107 ALA n 
1 108 LEU n 
1 109 THR n 
1 110 ARG n 
1 111 ASP n 
1 112 PRO n 
1 113 PHE n 
1 114 SER n 
1 115 VAL n 
1 116 ILE n 
1 117 GLU n 
1 118 GLU n 
1 119 SER n 
1 120 LEU n 
1 121 PRO n 
1 122 GLY n 
1 123 GLY n 
1 124 LEU n 
1 125 LYS n 
1 126 GLU n 
1 127 HIS n 
1 128 ASP n 
1 129 PHE n 
1 130 ASN n 
1 131 PRO n 
1 132 GLU n 
1 133 SER n 
1 134 SER n 
2 1   DG  n 
2 2   DA  n 
2 3   DG  n 
2 4   DG  n 
2 5   DA  n 
2 6   DG  n 
2 7   DG  n 
2 8   DC  n 
2 9   DT  n 
2 10  DT  n 
2 11  DT  n 
2 12  DT  n 
2 13  DT  n 
2 14  DT  n 
2 15  DG  n 
2 16  DG  n 
2 17  DA  n 
2 18  DG  n 
2 19  DG  n 
2 20  DC  n 
2 21  DC  n 
3 1   DA  n 
3 2   DC  n 
3 3   DT  n 
3 4   DC  n 
3 5   DC  n 
3 6   DT  n 
3 7   DC  n 
3 8   DC  n 
3 9   DG  n 
3 10  DA  n 
3 11  DA  n 
3 12  DA  n 
3 13  DA  n 
3 14  DA  n 
3 15  DA  n 
3 16  DC  n 
3 17  DC  n 
3 18  DT  n 
3 19  DC  n 
3 20  DC  n 
3 21  DG  n 
3 22  DG  n 
3 23  DA  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 134 SV40 ? ? ? ? ? ? ? ? 'Simian virus 40'     10633 ? ? ? ? ? ? ? ? 'Escherichia coli'    
511693 ? ? ? ? ? ? BL21 ? ? ? ? ? ? ? ? ? 'GST fusion' ? pGEX-1lambdaT ? ? 
2 1 sample 'Biological sequence' 1 21  ?    ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'synthetic construct' 
32630  ? ? ? ? ? ? ?    ? ? ? ? ? ? ? ? ? ?            ? ?             ? ? 
3 1 sample 'Biological sequence' 1 23  ?    ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'synthetic construct' 
32630  ? ? ? ? ? ? ?    ? ? ? ? ? ? ? ? ? ?            ? ?             ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP LT_SV40 P03070 ? 1 
;KVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINN
YAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPE
;
131 
2 PDB 5D9I    5D9I   ? 2 ? 1   
3 PDB 5D9I    5D9I   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5D9I A 3 ? 132 ? P03070 131 ? 260 ? 131 260 
2 1 5D9I B 3 ? 132 ? P03070 131 ? 260 ? 131 260 
3 2 5D9I X 1 ? 21  ? 5D9I   1   ? 21  ? 1   21  
4 3 5D9I Y 1 ? 23  ? 5D9I   1   ? 23  ? 1   23  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5D9I GLY A 1   ? UNP P03070 ? ? 'expression tag' 129 1 
1 5D9I SER A 2   ? UNP P03070 ? ? 'expression tag' 130 2 
1 5D9I SER A 133 ? UNP P03070 ? ? 'expression tag' 261 3 
1 5D9I SER A 134 ? UNP P03070 ? ? 'expression tag' 262 4 
2 5D9I GLY B 1   ? UNP P03070 ? ? 'expression tag' 129 5 
2 5D9I SER B 2   ? UNP P03070 ? ? 'expression tag' 130 6 
2 5D9I SER B 133 ? UNP P03070 ? ? 'expression tag' 261 7 
2 5D9I SER B 134 ? UNP P03070 ? ? 'expression tag' 262 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                        ?                 'C2 H3 O2 -1'     59.044  
ALA 'L-peptide linking' y ALANINE                              ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                 'Ca 2'            40.078  
CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE'   ?                 'C5 H11 N O3 S2'  197.276 
CYS 'L-peptide linking' y CYSTEINE                             ?                 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                 'C10 H15 N2 O8 P' 322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                       'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                            ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ?                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5D9I 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.18 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         43.67 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM Tris, 300 mM NH4Cl, 28% polyethylene glycol [PEG] 4000, 20 mM CaCl2' 
_exptl_crystal_grow.pdbx_pH_range   8.5 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2009-03-31 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0809 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0809 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5D9I 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.70 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       37425 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             88.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.70 
_reflns_shell.d_res_low                   1.76 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        54.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            1.89 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -1.15 
_refine.aniso_B[2][2]                            -0.66 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -1.13 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               35.147 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.965 
_refine.correlation_coeff_Fo_to_Fc_free          0.945 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5D9I 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.70 
_refine.ls_d_res_low                             50.0 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     35570 
_refine.ls_number_reflns_R_free                  1895 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    88.70 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.18174 
_refine.ls_R_factor_R_free                       0.22257 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.17965 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2FUF 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.126 
_refine.pdbx_overall_ESU_R_Free                  0.123 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             5.940 
_refine.overall_SU_ML                            0.098 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2162 
_refine_hist.pdbx_number_atoms_nucleic_acid   896 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             230 
_refine_hist.number_atoms_total               3302 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.017  0.017  3314 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  2644 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.709  1.694  4678 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.479  3.000  6145 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.625  5.000  285  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 28.799 23.458 107  ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 12.164 15.000 389  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 12.281 15.000 10   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.110  0.200  469  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.012  0.020  3144 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  795  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.859  1.425  1105 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.855  1.423  1103 ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 2.483  2.126  1392 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.485  2.127  1393 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.744  1.784  2209 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.743  1.784  2209 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.097  2.606  3284 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 6.652  13.860 4077 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 6.606  13.568 4011 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_type 
'X-RAY DIFFRACTION' 1 1 1 ? 0.09 0.05 ? ? A 16448 'interatomic distance' 
'X-RAY DIFFRACTION' 2 1 2 ? 0.09 0.05 ? ? B 16448 'interatomic distance' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.698 
_refine_ls_shell.d_res_low                        1.742 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             72 
_refine_ls_shell.number_reflns_R_work             1541 
_refine_ls_shell.percent_reflns_obs               51.90 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.271 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.224 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 129 A 259 0 0 ? ? ? ? ? ? ? ? 1 ? 
2 B 129 B 259 0 0 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     5D9I 
_struct.title                        'SV40 Large T antigen origin binding domain bound to artificial DNA fork' 
_struct.pdbx_descriptor              'Large T antigen/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5D9I 
_struct_keywords.text            'origin binding domain, replication, sv40, replication-dna complex' 
_struct_keywords.pdbx_keywords   replication/dna 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
M N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 1   ? ASP A 6   ? GLY A 129 ASP A 134 1 ? 6  
HELX_P HELX_P2  AA2 PRO A 11  ? LEU A 18  ? PRO A 139 LEU A 146 5 ? 8  
HELX_P HELX_P3  AA3 THR A 36  ? SER A 52  ? THR A 164 SER A 180 1 ? 17 
HELX_P HELX_P4  AA4 ARG A 76  ? CME A 88  ? ARG A 204 CME A 216 1 ? 13 
HELX_P HELX_P5  AA5 LYS A 100 ? THR A 109 ? LYS A 228 THR A 237 1 ? 10 
HELX_P HELX_P6  AA6 LYS A 125 ? ASN A 130 ? LYS A 253 ASN A 258 5 ? 6  
HELX_P HELX_P7  AA7 SER B 2   ? ASP B 6   ? SER B 130 ASP B 134 1 ? 5  
HELX_P HELX_P8  AA8 PRO B 11  ? LEU B 18  ? PRO B 139 LEU B 146 5 ? 8  
HELX_P HELX_P9  AA9 THR B 36  ? SER B 52  ? THR B 164 SER B 180 1 ? 17 
HELX_P HELX_P10 AB1 VAL B 77  ? CME B 88  ? VAL B 205 CME B 216 1 ? 12 
HELX_P HELX_P11 AB2 LYS B 100 ? THR B 109 ? LYS B 228 THR B 237 1 ? 10 
HELX_P HELX_P12 AB3 LYS B 125 ? ASN B 130 ? LYS B 253 ASN B 258 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? A LEU 87 C   ? ? ? 1_555 A CME 88 N   ? ? A LEU 215 A CME 216 1_555 ? ? ? ? ? ? ?               1.327 ? 
covale2  covale both ? A CME 88 C   ? ? ? 1_555 A THR 89 N   ? ? A CME 216 A THR 217 1_555 ? ? ? ? ? ? ?               1.322 ? 
metalc1  metalc ?    ? B ALA 84 O   ? ? ? 1_555 F CA  .  CA  ? ? B ALA 212 B CA  301 1_555 ? ? ? ? ? ? ?               2.557 ? 
covale3  covale both ? B LEU 87 C   ? ? ? 1_555 B CME 88 N   ? ? B LEU 215 B CME 216 1_555 ? ? ? ? ? ? ?               1.318 ? 
metalc2  metalc ?    ? B CME 88 OH  ? ? ? 1_555 F CA  .  CA  ? ? B CME 216 B CA  301 1_555 ? ? ? ? ? ? ?               2.697 ? 
covale4  covale both ? B CME 88 C   ? ? ? 1_555 B THR 89 N   ? ? B CME 216 B THR 217 1_555 ? ? ? ? ? ? ?               1.323 ? 
metalc3  metalc ?    ? B CME 88 O   ? ? ? 1_555 F CA  .  CA  ? ? B CME 216 B CA  301 1_555 ? ? ? ? ? ? ?               2.826 ? 
metalc4  metalc ?    ? D DG  22 OP2 ? ? ? 1_555 H CA  .  CA  ? ? Y DG  22  Y CA  101 1_555 ? ? ? ? ? ? ?               2.354 ? 
metalc5  metalc ?    ? F CA  .  CA  ? ? ? 1_555 K HOH .  O   ? ? B CA  301 B HOH 433 1_555 ? ? ? ? ? ? ?               2.248 ? 
metalc6  metalc ?    ? H CA  .  CA  ? ? ? 1_555 M HOH .  O   ? ? Y CA  101 Y HOH 201 1_555 ? ? ? ? ? ? ?               2.440 ? 
covale5  covale none ? A ASN 63 OD1 ? ? ? 1_555 A HIS 73 ND1 B ? A ASN 191 A HIS 201 4_546 ? ? ? ? ? ? ?               1.480 ? 
metalc7  metalc ?    ? C DG  18 OP2 ? ? ? 1_555 H CA  .  CA  ? ? X DG  18  Y CA  101 1_565 ? ? ? ? ? ? ?               2.194 ? 
metalc8  metalc ?    ? C DG  19 O6  ? ? ? 1_555 H CA  .  CA  ? ? X DG  19  Y CA  101 1_565 ? ? ? ? ? ? ?               2.267 ? 
metalc9  metalc ?    ? H CA  .  CA  ? ? ? 1_555 L HOH .  O   ? ? Y CA  101 X HOH 120 1_545 ? ? ? ? ? ? ?               2.182 ? 
metalc10 metalc ?    ? H CA  .  CA  ? ? ? 1_555 L HOH .  O   ? ? Y CA  101 X HOH 112 1_545 ? ? ? ? ? ? ?               2.331 ? 
hydrog1  hydrog ?    ? C DA  2  N6  ? ? ? 1_555 D DG  21 N3  ? ? X DA  2   Y DG  21  1_555 ? ? ? ? ? ? TYPE_11_PAIR    ?     ? 
hydrog2  hydrog ?    ? C DA  2  N7  ? ? ? 1_555 D DG  21 N2  ? ? X DA  2   Y DG  21  1_555 ? ? ? ? ? ? TYPE_11_PAIR    ?     ? 
hydrog3  hydrog ?    ? C DG  3  N1  ? ? ? 1_555 D DC  20 N3  ? ? X DG  3   Y DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ?    ? C DG  3  N2  ? ? ? 1_555 D DC  20 O2  ? ? X DG  3   Y DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ?    ? C DG  3  O6  ? ? ? 1_555 D DC  20 N4  ? ? X DG  3   Y DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ?    ? C DG  4  N1  ? ? ? 1_555 D DC  19 N3  ? ? X DG  4   Y DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ?    ? C DG  4  N2  ? ? ? 1_555 D DC  19 O2  ? ? X DG  4   Y DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ?    ? C DG  4  O6  ? ? ? 1_555 D DC  19 N4  ? ? X DG  4   Y DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ?    ? C DA  5  N1  ? ? ? 1_555 D DT  18 N3  ? ? X DA  5   Y DT  18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ?    ? C DA  5  N6  ? ? ? 1_555 D DT  18 O4  ? ? X DA  5   Y DT  18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ?    ? C DG  6  N1  ? ? ? 1_555 D DC  17 N3  ? ? X DG  6   Y DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ?    ? C DG  6  N2  ? ? ? 1_555 D DC  17 O2  ? ? X DG  6   Y DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ?    ? C DG  6  O6  ? ? ? 1_555 D DC  17 N4  ? ? X DG  6   Y DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ?    ? C DG  7  N1  ? ? ? 1_555 D DC  16 N3  ? ? X DG  7   Y DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ?    ? C DG  7  N2  ? ? ? 1_555 D DC  16 O2  ? ? X DG  7   Y DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ?    ? C DG  7  O6  ? ? ? 1_555 D DC  16 N4  ? ? X DG  7   Y DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ?    ? C DC  8  N4  ? ? ? 1_555 D DA  15 N1  ? ? X DC  8   Y DA  15  1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ?     ? 
hydrog18 hydrog ?    ? C DT  9  N3  ? ? ? 1_555 D DA  14 N1  ? ? X DT  9   Y DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ?    ? C DT  9  O4  ? ? ? 1_555 D DA  14 N6  ? ? X DT  9   Y DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ?    ? C DT  10 N3  ? ? ? 1_555 D DA  13 N1  ? ? X DT  10  Y DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ?    ? C DT  10 O4  ? ? ? 1_555 D DA  13 N6  ? ? X DT  10  Y DA  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ?    ? C DT  11 N3  ? ? ? 1_555 D DA  12 N1  ? ? X DT  11  Y DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ?    ? C DT  11 O4  ? ? ? 1_555 D DA  12 N6  ? ? X DT  11  Y DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ?    ? C DT  12 N3  ? ? ? 1_555 D DA  11 N1  ? ? X DT  12  Y DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25 hydrog ?    ? C DT  12 O4  ? ? ? 1_555 D DA  11 N6  ? ? X DT  12  Y DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26 hydrog ?    ? C DT  13 N3  ? ? ? 1_555 D DA  10 N1  ? ? X DT  13  Y DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ?    ? C DT  13 O4  ? ? ? 1_555 D DA  10 N6  ? ? X DT  13  Y DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ?    ? C DT  14 N3  ? ? ? 1_555 D DG  9  O6  ? ? X DT  14  Y DG  9   1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     ? 
hydrog29 hydrog ?    ? C DT  14 O2  ? ? ? 1_555 D DG  9  N1  ? ? X DT  14  Y DG  9   1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     ? 
hydrog30 hydrog ?    ? C DG  15 N1  ? ? ? 1_555 D DC  8  N3  ? ? X DG  15  Y DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31 hydrog ?    ? C DG  15 N2  ? ? ? 1_555 D DC  8  O2  ? ? X DG  15  Y DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32 hydrog ?    ? C DG  15 O6  ? ? ? 1_555 D DC  8  N4  ? ? X DG  15  Y DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33 hydrog ?    ? C DG  16 N1  ? ? ? 1_555 D DC  7  N3  ? ? X DG  16  Y DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34 hydrog ?    ? C DG  16 N2  ? ? ? 1_555 D DC  7  O2  ? ? X DG  16  Y DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35 hydrog ?    ? C DG  16 O6  ? ? ? 1_555 D DC  7  N4  ? ? X DG  16  Y DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36 hydrog ?    ? C DA  17 N1  ? ? ? 1_555 D DT  6  N3  ? ? X DA  17  Y DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37 hydrog ?    ? C DA  17 N6  ? ? ? 1_555 D DT  6  O4  ? ? X DA  17  Y DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38 hydrog ?    ? C DG  18 N1  ? ? ? 1_555 D DC  5  N3  ? ? X DG  18  Y DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39 hydrog ?    ? C DG  18 N2  ? ? ? 1_555 D DC  5  O2  ? ? X DG  18  Y DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40 hydrog ?    ? C DG  18 O6  ? ? ? 1_555 D DC  5  N4  ? ? X DG  18  Y DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 111 A . ? ASP 239 A PRO 112 A ? PRO 240 A 1 4.70 
2 ASP 111 A . ? ASP 239 A PRO 112 A ? PRO 240 A 1 4.87 
3 ASP 111 B . ? ASP 239 B PRO 112 B ? PRO 240 B 1 6.37 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 93  ? GLY A 97  ? LEU A 221 GLY A 225 
AA1 2 LEU A 28  ? THR A 35  ? LEU A 156 THR A 163 
AA1 3 HIS A 64  ? HIS A 75  ? HIS A 192 HIS A 203 
AA1 4 PHE A 55  ? SER A 61  ? PHE A 183 SER A 189 
AA1 5 PHE A 113 ? GLU A 118 ? PHE A 241 GLU A 246 
AA2 1 LEU B 93  ? GLY B 97  ? LEU B 221 GLY B 225 
AA2 2 THR B 27  ? THR B 35  ? THR B 155 THR B 163 
AA2 3 HIS B 64  ? ARG B 76  ? HIS B 192 ARG B 204 
AA2 4 PHE B 55  ? SER B 61  ? PHE B 183 SER B 189 
AA2 5 PHE B 113 ? GLU B 118 ? PHE B 241 GLU B 246 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ILE A 94 ? O ILE A 222 N TYR A 34  ? N TYR A 162 
AA1 2 3 N ILE A 33 ? N ILE A 161 O LEU A 67  ? O LEU A 195 
AA1 3 4 O ILE A 66 ? O ILE A 194 N HIS A 59  ? N HIS A 187 
AA1 4 5 N ARG A 58 ? N ARG A 186 O ILE A 116 ? O ILE A 244 
AA2 1 2 O ILE B 94 ? O ILE B 222 N TYR B 34  ? N TYR B 162 
AA2 2 3 N ILE B 33 ? N ILE B 161 O LEU B 67  ? O LEU B 195 
AA2 3 4 O ILE B 66 ? O ILE B 194 N HIS B 59  ? N HIS B 187 
AA2 4 5 N ARG B 58 ? N ARG B 186 O ILE B 116 ? O ILE B 244 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A EDO 301 ? 4 'binding site for residue EDO A 301' 
AC2 Software B CA  301 ? 5 'binding site for residue CA B 301'  
AC3 Software B EDO 302 ? 5 'binding site for residue EDO B 302' 
AC4 Software Y CA  101 ? 6 'binding site for residue CA Y 101'  
AC5 Software Y ACT 102 ? 5 'binding site for residue ACT Y 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ASN A 81 ? ASN A 209 . ? 1_555 ? 
2  AC1 4 ILE A 94 ? ILE A 222 . ? 1_555 ? 
3  AC1 4 CYS A 95 ? CYS A 223 . ? 1_555 ? 
4  AC1 4 HOH J .  ? HOH A 413 . ? 1_555 ? 
5  AC2 5 LYS B 39 ? LYS B 167 . ? 1_555 ? 
6  AC2 5 ALA B 84 ? ALA B 212 . ? 1_555 ? 
7  AC2 5 GLN B 85 ? GLN B 213 . ? 1_555 ? 
8  AC2 5 CME B 88 ? CME B 216 . ? 1_555 ? 
9  AC2 5 HOH K .  ? HOH B 433 . ? 1_555 ? 
10 AC3 5 ASN B 81 ? ASN B 209 . ? 1_555 ? 
11 AC3 5 ILE B 94 ? ILE B 222 . ? 1_555 ? 
12 AC3 5 CYS B 95 ? CYS B 223 . ? 1_555 ? 
13 AC3 5 HOH K .  ? HOH B 436 . ? 1_555 ? 
14 AC3 5 HOH K .  ? HOH B 438 . ? 1_555 ? 
15 AC4 6 DG  C 18 ? DG  X 18  . ? 1_545 ? 
16 AC4 6 DG  C 19 ? DG  X 19  . ? 1_545 ? 
17 AC4 6 HOH L .  ? HOH X 112 . ? 1_545 ? 
18 AC4 6 HOH L .  ? HOH X 120 . ? 1_545 ? 
19 AC4 6 DG  D 22 ? DG  Y 22  . ? 1_555 ? 
20 AC4 6 HOH M .  ? HOH Y 201 . ? 1_555 ? 
21 AC5 5 ASN B 25 ? ASN B 153 . ? 1_555 ? 
22 AC5 5 DA  C 17 ? DA  X 17  . ? 1_545 ? 
23 AC5 5 DG  C 18 ? DG  X 18  . ? 1_545 ? 
24 AC5 5 DG  D 22 ? DG  Y 22  . ? 1_555 ? 
25 AC5 5 HOH M .  ? HOH Y 201 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5D9I 
_atom_sites.fract_transf_matrix[1][1]   0.010617 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000449 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015775 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015424 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 27.023 29.079  46.587  1.00 31.04  ? 129 GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 28.072 30.067  46.288  1.00 31.52  ? 129 GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 27.933 30.659  44.903  1.00 30.86  ? 129 GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 27.156 30.163  44.113  1.00 27.32  ? 129 GLY A O     1 
ATOM   5    N  N     A SER A 1 2   ? 28.648 31.762  44.628  0.50 29.85  ? 130 SER A N     1 
ATOM   6    N  N     B SER A 1 2   ? 28.642 31.760  44.637  0.50 29.18  ? 130 SER A N     1 
ATOM   7    C  CA    A SER A 1 2   ? 28.454 32.514  43.438  0.50 29.30  ? 130 SER A CA    1 
ATOM   8    C  CA    B SER A 1 2   ? 28.449 32.528  43.475  0.50 27.95  ? 130 SER A CA    1 
ATOM   9    C  C     A SER A 1 2   ? 28.603 31.699  42.150  0.50 27.34  ? 130 SER A C     1 
ATOM   10   C  C     B SER A 1 2   ? 28.620 31.720  42.153  0.50 26.78  ? 130 SER A C     1 
ATOM   11   O  O     A SER A 1 2   ? 27.847 31.902  41.225  0.50 26.24  ? 130 SER A O     1 
ATOM   12   O  O     B SER A 1 2   ? 27.853 31.908  41.229  0.50 25.67  ? 130 SER A O     1 
ATOM   13   C  CB    A SER A 1 2   ? 29.409 33.720  43.322  0.50 30.02  ? 130 SER A CB    1 
ATOM   14   C  CB    B SER A 1 2   ? 29.360 33.774  43.509  0.50 28.17  ? 130 SER A CB    1 
ATOM   15   O  OG    A SER A 1 2   ? 30.767 33.338  43.471  0.50 34.11  ? 130 SER A OG    1 
ATOM   16   O  OG    B SER A 1 2   ? 29.282 34.372  44.809  0.50 28.82  ? 130 SER A OG    1 
ATOM   17   N  N     . LYS A 1 3   ? 29.589 30.818  42.116  1.00 27.99  ? 131 LYS A N     1 
ATOM   18   C  CA    . LYS A 1 3   ? 29.842 30.015  40.873  1.00 26.87  ? 131 LYS A CA    1 
ATOM   19   C  C     . LYS A 1 3   ? 28.635 29.163  40.505  1.00 26.10  ? 131 LYS A C     1 
ATOM   20   O  O     . LYS A 1 3   ? 28.383 28.960  39.351  1.00 25.23  ? 131 LYS A O     1 
ATOM   21   C  CB    . LYS A 1 3   ? 31.091 29.167  40.979  1.00 26.80  ? 131 LYS A CB    1 
ATOM   22   C  CG    . LYS A 1 3   ? 32.379 30.012  40.939  1.00 28.08  ? 131 LYS A CG    1 
ATOM   23   C  CD    . LYS A 1 3   ? 33.617 29.167  40.974  1.00 29.57  ? 131 LYS A CD    1 
ATOM   24   C  CE    . LYS A 1 3   ? 34.888 29.998  41.017  1.00 30.85  ? 131 LYS A CE    1 
ATOM   25   N  NZ    . LYS A 1 3   ? 36.109 29.151  41.010  1.00 32.88  ? 131 LYS A NZ    1 
ATOM   26   N  N     . VAL A 1 4   ? 27.906 28.695  41.498  1.00 26.83  ? 132 VAL A N     1 
ATOM   27   C  CA    . VAL A 1 4   ? 26.744 27.809  41.283  1.00 27.62  ? 132 VAL A CA    1 
ATOM   28   C  C     . VAL A 1 4   ? 25.501 28.648  41.089  1.00 27.10  ? 132 VAL A C     1 
ATOM   29   O  O     . VAL A 1 4   ? 24.637 28.300  40.272  1.00 28.35  ? 132 VAL A O     1 
ATOM   30   C  CB    . VAL A 1 4   ? 26.555 26.906  42.524  1.00 27.63  ? 132 VAL A CB    1 
ATOM   31   C  CG1   . VAL A 1 4   ? 25.188 26.234  42.627  1.00 27.97  ? 132 VAL A CG1   1 
ATOM   32   C  CG2   . VAL A 1 4   ? 27.641 25.877  42.565  1.00 29.54  ? 132 VAL A CG2   1 
ATOM   33   N  N     . GLU A 1 5   ? 25.379 29.708  41.870  1.00 26.89  ? 133 GLU A N     1 
ATOM   34   C  CA    . GLU A 1 5   ? 24.133 30.488  41.918  1.00 26.82  ? 133 GLU A CA    1 
ATOM   35   C  C     . GLU A 1 5   ? 24.029 31.667  40.999  1.00 25.70  ? 133 GLU A C     1 
ATOM   36   O  O     . GLU A 1 5   ? 22.924 32.029  40.627  1.00 24.81  ? 133 GLU A O     1 
ATOM   37   C  CB    . GLU A 1 5   ? 23.900 31.014  43.338  1.00 29.80  ? 133 GLU A CB    1 
ATOM   38   C  CG    . GLU A 1 5   ? 23.869 29.926  44.388  1.00 33.97  ? 133 GLU A CG    1 
ATOM   39   C  CD    . GLU A 1 5   ? 23.805 30.525  45.788  1.00 40.95  ? 133 GLU A CD    1 
ATOM   40   O  OE1   . GLU A 1 5   ? 22.769 31.159  46.073  1.00 43.64  ? 133 GLU A OE1   1 
ATOM   41   O  OE2   . GLU A 1 5   ? 24.798 30.404  46.557  1.00 42.28  ? 133 GLU A OE2   1 
ATOM   42   N  N     . ASP A 1 6   ? 25.135 32.297  40.644  1.00 23.91  ? 134 ASP A N     1 
ATOM   43   C  CA    . ASP A 1 6   ? 25.045 33.550  39.908  1.00 24.07  ? 134 ASP A CA    1 
ATOM   44   C  C     . ASP A 1 6   ? 25.050 33.420  38.368  1.00 23.24  ? 134 ASP A C     1 
ATOM   45   O  O     . ASP A 1 6   ? 25.804 32.628  37.833  1.00 23.19  ? 134 ASP A O     1 
ATOM   46   C  CB    . ASP A 1 6   ? 26.234 34.423  40.271  1.00 25.60  ? 134 ASP A CB    1 
ATOM   47   C  CG    . ASP A 1 6   ? 26.193 34.940  41.707  1.00 29.24  ? 134 ASP A CG    1 
ATOM   48   O  OD1   . ASP A 1 6   ? 25.137 34.865  42.385  1.00 30.74  ? 134 ASP A OD1   1 
ATOM   49   O  OD2   . ASP A 1 6   ? 27.255 35.478  42.091  1.00 28.53  ? 134 ASP A OD2   1 
ATOM   50   N  N     . PRO A 1 7   ? 24.278 34.271  37.672  1.00 23.18  ? 135 PRO A N     1 
ATOM   51   C  CA    . PRO A 1 7   ? 24.483 34.410  36.247  1.00 23.22  ? 135 PRO A CA    1 
ATOM   52   C  C     . PRO A 1 7   ? 25.891 34.933  35.952  1.00 24.81  ? 135 PRO A C     1 
ATOM   53   O  O     . PRO A 1 7   ? 26.439 35.719  36.774  1.00 25.74  ? 135 PRO A O     1 
ATOM   54   C  CB    . PRO A 1 7   ? 23.440 35.432  35.829  1.00 23.51  ? 135 PRO A CB    1 
ATOM   55   C  CG    . PRO A 1 7   ? 22.357 35.278  36.808  1.00 25.55  ? 135 PRO A CG    1 
ATOM   56   C  CD    . PRO A 1 7   ? 23.056 34.971  38.105  1.00 24.56  ? 135 PRO A CD    1 
ATOM   57   N  N     . LYS A 1 8   ? 26.445 34.487  34.813  1.00 22.13  ? 136 LYS A N     1 
ATOM   58   C  CA    . LYS A 1 8   ? 27.782 34.852  34.419  1.00 22.97  ? 136 LYS A CA    1 
ATOM   59   C  C     . LYS A 1 8   ? 27.728 35.857  33.234  1.00 22.30  ? 136 LYS A C     1 
ATOM   60   O  O     . LYS A 1 8   ? 28.793 36.285  32.735  1.00 21.75  ? 136 LYS A O     1 
ATOM   61   C  CB    . LYS A 1 8   ? 28.626 33.664  34.028  1.00 25.23  ? 136 LYS A CB    1 
ATOM   62   C  CG    . LYS A 1 8   ? 28.678 32.542  35.105  1.00 24.64  ? 136 LYS A CG    1 
ATOM   63   C  CD    . LYS A 1 8   ? 29.095 33.042  36.504  1.00 25.12  ? 136 LYS A CD    1 
ATOM   64   C  CE    . LYS A 1 8   ? 29.261 31.902  37.518  1.00 26.11  ? 136 LYS A CE    1 
ATOM   65   N  NZ    . LYS A 1 8   ? 28.108 31.014  37.548  1.00 27.42  ? 136 LYS A NZ    1 
ATOM   66   N  N     . ASP A 1 9   ? 26.514 36.153  32.740  1.00 20.84  ? 137 ASP A N     1 
ATOM   67   C  CA    . ASP A 1 9   ? 26.326 36.998  31.596  1.00 22.05  ? 137 ASP A CA    1 
ATOM   68   C  C     . ASP A 1 9   ? 24.866 37.389  31.588  1.00 21.98  ? 137 ASP A C     1 
ATOM   69   O  O     . ASP A 1 9   ? 24.032 36.887  32.362  1.00 20.81  ? 137 ASP A O     1 
ATOM   70   C  CB    . ASP A 1 9   ? 26.665 36.268  30.265  1.00 22.96  ? 137 ASP A CB    1 
ATOM   71   C  CG    . ASP A 1 9   ? 27.091 37.195  29.160  1.00 27.92  ? 137 ASP A CG    1 
ATOM   72   O  OD1   . ASP A 1 9   ? 26.780 38.429  29.185  1.00 24.44  ? 137 ASP A OD1   1 
ATOM   73   O  OD2   . ASP A 1 9   ? 27.758 36.676  28.247  1.00 26.89  ? 137 ASP A OD2   1 
ATOM   74   N  N     . PHE A 1 10  ? 24.554 38.335  30.706  1.00 20.53  ? 138 PHE A N     1 
ATOM   75   C  CA    . PHE A 1 10  ? 23.125 38.652  30.429  1.00 19.70  ? 138 PHE A CA    1 
ATOM   76   C  C     . PHE A 1 10  ? 22.384 37.427  29.872  1.00 19.74  ? 138 PHE A C     1 
ATOM   77   O  O     . PHE A 1 10  ? 22.985 36.457  29.369  1.00 22.12  ? 138 PHE A O     1 
ATOM   78   C  CB    . PHE A 1 10  ? 22.999 39.808  29.406  1.00 20.74  ? 138 PHE A CB    1 
ATOM   79   C  CG    . PHE A 1 10  ? 23.217 41.134  30.003  1.00 17.34  ? 138 PHE A CG    1 
ATOM   80   C  CD1   . PHE A 1 10  ? 24.506 41.582  30.266  1.00 17.87  ? 138 PHE A CD1   1 
ATOM   81   C  CD2   . PHE A 1 10  ? 22.163 41.973  30.164  1.00 19.00  ? 138 PHE A CD2   1 
ATOM   82   C  CE1   . PHE A 1 10  ? 24.706 42.868  30.817  1.00 18.28  ? 138 PHE A CE1   1 
ATOM   83   C  CE2   . PHE A 1 10  ? 22.337 43.226  30.739  1.00 17.65  ? 138 PHE A CE2   1 
ATOM   84   C  CZ    . PHE A 1 10  ? 23.621 43.666  31.035  1.00 17.54  ? 138 PHE A CZ    1 
ATOM   85   N  N     . PRO A 1 11  ? 21.054 37.462  29.957  1.00 22.50  ? 139 PRO A N     1 
ATOM   86   C  CA    . PRO A 1 11  ? 20.268 36.456  29.353  1.00 22.42  ? 139 PRO A CA    1 
ATOM   87   C  C     . PRO A 1 11  ? 20.565 36.346  27.892  1.00 22.69  ? 139 PRO A C     1 
ATOM   88   O  O     . PRO A 1 11  ? 20.658 37.351  27.179  1.00 22.21  ? 139 PRO A O     1 
ATOM   89   C  CB    . PRO A 1 11  ? 18.826 36.912  29.586  1.00 22.41  ? 139 PRO A CB    1 
ATOM   90   C  CG    . PRO A 1 11  ? 18.904 37.759  30.817  1.00 22.31  ? 139 PRO A CG    1 
ATOM   91   C  CD    . PRO A 1 11  ? 20.235 38.405  30.717  1.00 21.86  ? 139 PRO A CD    1 
ATOM   92   N  N     . SER A 1 12  ? 20.540 35.112  27.429  1.00 21.48  ? 140 SER A N     1 
ATOM   93   C  CA    A SER A 1 12  ? 20.986 34.799  26.069  0.50 24.61  ? 140 SER A CA    1 
ATOM   94   C  CA    B SER A 1 12  ? 20.968 34.800  26.062  0.50 24.25  ? 140 SER A CA    1 
ATOM   95   C  C     . SER A 1 12  ? 20.163 35.557  25.032  1.00 23.91  ? 140 SER A C     1 
ATOM   96   O  O     . SER A 1 12  ? 20.665 35.906  23.953  1.00 26.80  ? 140 SER A O     1 
ATOM   97   C  CB    A SER A 1 12  ? 20.974 33.274  25.803  0.50 26.53  ? 140 SER A CB    1 
ATOM   98   C  CB    B SER A 1 12  ? 20.857 33.285  25.802  0.50 25.87  ? 140 SER A CB    1 
ATOM   99   O  OG    A SER A 1 12  ? 21.608 32.506  26.835  0.50 28.22  ? 140 SER A OG    1 
ATOM   100  O  OG    B SER A 1 12  ? 19.523 32.835  25.964  0.50 26.31  ? 140 SER A OG    1 
ATOM   101  N  N     . GLU A 1 13  ? 18.887 35.779  25.296  1.00 24.76  ? 141 GLU A N     1 
ATOM   102  C  CA    . GLU A 1 13  ? 18.027 36.533  24.374  1.00 28.66  ? 141 GLU A CA    1 
ATOM   103  C  C     . GLU A 1 13  ? 18.572 37.946  23.972  1.00 26.16  ? 141 GLU A C     1 
ATOM   104  O  O     . GLU A 1 13  ? 18.139 38.522  22.957  1.00 27.18  ? 141 GLU A O     1 
ATOM   105  C  CB    . GLU A 1 13  ? 16.701 36.867  25.092  1.00 31.91  ? 141 GLU A CB    1 
ATOM   106  C  CG    . GLU A 1 13  ? 15.764 35.735  25.338  1.00 35.19  ? 141 GLU A CG    1 
ATOM   107  C  CD    . GLU A 1 13  ? 15.958 35.061  26.701  1.00 44.31  ? 141 GLU A CD    1 
ATOM   108  O  OE1   . GLU A 1 13  ? 17.102 35.076  27.276  1.00 34.52  ? 141 GLU A OE1   1 
ATOM   109  O  OE2   . GLU A 1 13  ? 14.946 34.484  27.150  1.00 49.99  ? 141 GLU A OE2   1 
ATOM   110  N  N     . LEU A 1 14  ? 19.447 38.511  24.821  1.00 24.18  ? 142 LEU A N     1 
ATOM   111  C  CA    . LEU A 1 14  ? 19.928 39.897  24.703  1.00 21.05  ? 142 LEU A CA    1 
ATOM   112  C  C     . LEU A 1 14  ? 21.361 39.990  24.249  1.00 20.51  ? 142 LEU A C     1 
ATOM   113  O  O     . LEU A 1 14  ? 21.819 41.097  23.940  1.00 20.75  ? 142 LEU A O     1 
ATOM   114  C  CB    . LEU A 1 14  ? 19.811 40.670  26.067  1.00 18.66  ? 142 LEU A CB    1 
ATOM   115  C  CG    . LEU A 1 14  ? 18.407 40.613  26.636  1.00 19.98  ? 142 LEU A CG    1 
ATOM   116  C  CD1   . LEU A 1 14  ? 18.396 41.247  28.028  1.00 20.81  ? 142 LEU A CD1   1 
ATOM   117  C  CD2   . LEU A 1 14  ? 17.360 41.313  25.775  1.00 19.03  ? 142 LEU A CD2   1 
ATOM   118  N  N     . LEU A 1 15  ? 22.060 38.854  24.158  1.00 22.85  ? 143 LEU A N     1 
ATOM   119  C  CA    . LEU A 1 15  ? 23.533 38.911  23.944  1.00 22.48  ? 143 LEU A CA    1 
ATOM   120  C  C     . LEU A 1 15  ? 23.970 39.558  22.627  1.00 22.76  ? 143 LEU A C     1 
ATOM   121  O  O     . LEU A 1 15  ? 25.064 40.165  22.540  1.00 22.51  ? 143 LEU A O     1 
ATOM   122  C  CB    . LEU A 1 15  ? 24.160 37.526  24.072  1.00 24.02  ? 143 LEU A CB    1 
ATOM   123  C  CG    . LEU A 1 15  ? 24.126 36.924  25.486  1.00 24.76  ? 143 LEU A CG    1 
ATOM   124  C  CD1   . LEU A 1 15  ? 24.572 35.457  25.502  1.00 27.17  ? 143 LEU A CD1   1 
ATOM   125  C  CD2   . LEU A 1 15  ? 24.921 37.719  26.526  1.00 22.98  ? 143 LEU A CD2   1 
ATOM   126  N  N     . SER A 1 16  ? 23.167 39.403  21.593  1.00 21.86  ? 144 SER A N     1 
ATOM   127  C  CA    . SER A 1 16  ? 23.561 39.957  20.223  1.00 24.15  ? 144 SER A CA    1 
ATOM   128  C  C     . SER A 1 16  ? 23.468 41.461  20.215  1.00 20.96  ? 144 SER A C     1 
ATOM   129  O  O     . SER A 1 16  ? 23.901 42.102  19.250  1.00 23.94  ? 144 SER A O     1 
ATOM   130  C  CB    . SER A 1 16  ? 22.739 39.347  19.082  1.00 24.98  ? 144 SER A CB    1 
ATOM   131  O  OG    . SER A 1 16  ? 21.376 39.794  19.084  1.00 24.59  ? 144 SER A OG    1 
ATOM   132  N  N     . PHE A 1 17  ? 22.864 42.039  21.235  1.00 18.40  ? 145 PHE A N     1 
ATOM   133  C  CA    . PHE A 1 17  ? 22.707 43.468  21.298  1.00 18.75  ? 145 PHE A CA    1 
ATOM   134  C  C     . PHE A 1 17  ? 23.839 44.186  22.009  1.00 20.14  ? 145 PHE A C     1 
ATOM   135  O  O     . PHE A 1 17  ? 23.946 45.452  21.985  1.00 19.64  ? 145 PHE A O     1 
ATOM   136  C  CB    . PHE A 1 17  ? 21.386 43.893  21.915  1.00 18.67  ? 145 PHE A CB    1 
ATOM   137  C  CG    . PHE A 1 17  ? 20.178 43.220  21.337  1.00 20.90  ? 145 PHE A CG    1 
ATOM   138  C  CD1   . PHE A 1 17  ? 20.054 42.966  19.917  1.00 22.83  ? 145 PHE A CD1   1 
ATOM   139  C  CD2   . PHE A 1 17  ? 19.123 42.866  22.164  1.00 20.69  ? 145 PHE A CD2   1 
ATOM   140  C  CE1   . PHE A 1 17  ? 18.915 42.374  19.414  1.00 22.51  ? 145 PHE A CE1   1 
ATOM   141  C  CE2   . PHE A 1 17  ? 17.977 42.276  21.633  1.00 22.52  ? 145 PHE A CE2   1 
ATOM   142  C  CZ    . PHE A 1 17  ? 17.894 42.031  20.256  1.00 21.57  ? 145 PHE A CZ    1 
ATOM   143  N  N     . LEU A 1 18  ? 24.728 43.409  22.616  1.00 21.21  ? 146 LEU A N     1 
ATOM   144  C  CA    . LEU A 1 18  ? 25.689 43.938  23.587  1.00 20.80  ? 146 LEU A CA    1 
ATOM   145  C  C     . LEU A 1 18  ? 27.076 43.871  22.980  1.00 21.56  ? 146 LEU A C     1 
ATOM   146  O  O     . LEU A 1 18  ? 27.369 43.045  22.080  1.00 22.65  ? 146 LEU A O     1 
ATOM   147  C  CB    . LEU A 1 18  ? 25.644 43.114  24.892  1.00 20.26  ? 146 LEU A CB    1 
ATOM   148  C  CG    . LEU A 1 18  ? 24.266 43.108  25.555  1.00 19.85  ? 146 LEU A CG    1 
ATOM   149  C  CD1   . LEU A 1 18  ? 24.296 42.176  26.746  1.00 21.62  ? 146 LEU A CD1   1 
ATOM   150  C  CD2   . LEU A 1 18  ? 23.904 44.516  26.008  1.00 22.83  ? 146 LEU A CD2   1 
ATOM   151  N  N     . SER A 1 19  ? 27.933 44.763  23.481  1.00 19.08  ? 147 SER A N     1 
ATOM   152  C  CA    . SER A 1 19  ? 29.383 44.638  23.350  1.00 21.26  ? 147 SER A CA    1 
ATOM   153  C  C     . SER A 1 19  ? 29.905 43.741  24.442  1.00 23.60  ? 147 SER A C     1 
ATOM   154  O  O     . SER A 1 19  ? 29.615 43.955  25.639  1.00 21.73  ? 147 SER A O     1 
ATOM   155  C  CB    . SER A 1 19  ? 30.090 45.977  23.415  1.00 23.73  ? 147 SER A CB    1 
ATOM   156  O  OG    . SER A 1 19  ? 31.488 45.715  23.355  1.00 27.35  ? 147 SER A OG    1 
ATOM   157  N  N     . HIS A 1 20  ? 30.627 42.709  24.043  1.00 25.80  ? 148 HIS A N     1 
ATOM   158  C  CA    . HIS A 1 20  ? 31.279 41.807  24.988  1.00 26.90  ? 148 HIS A CA    1 
ATOM   159  C  C     . HIS A 1 20  ? 32.704 42.191  25.293  1.00 28.56  ? 148 HIS A C     1 
ATOM   160  O  O     . HIS A 1 20  ? 33.325 41.590  26.178  1.00 30.97  ? 148 HIS A O     1 
ATOM   161  C  CB    . HIS A 1 20  ? 31.165 40.344  24.455  1.00 26.75  ? 148 HIS A CB    1 
ATOM   162  C  CG    . HIS A 1 20  ? 29.755 40.015  24.132  1.00 27.39  ? 148 HIS A CG    1 
ATOM   163  N  ND1   . HIS A 1 20  ? 28.792 39.932  25.106  1.00 27.24  ? 148 HIS A ND1   1 
ATOM   164  C  CD2   . HIS A 1 20  ? 29.120 39.817  22.962  1.00 32.62  ? 148 HIS A CD2   1 
ATOM   165  C  CE1   . HIS A 1 20  ? 27.613 39.746  24.552  1.00 30.16  ? 148 HIS A CE1   1 
ATOM   166  N  NE2   . HIS A 1 20  ? 27.783 39.682  23.248  1.00 29.49  ? 148 HIS A NE2   1 
ATOM   167  N  N     . ALA A 1 21  ? 33.186 43.269  24.704  1.00 27.70  ? 149 ALA A N     1 
ATOM   168  C  CA    . ALA A 1 21  ? 34.583 43.720  24.929  1.00 29.38  ? 149 ALA A CA    1 
ATOM   169  C  C     . ALA A 1 21  ? 34.553 44.647  26.124  1.00 28.53  ? 149 ALA A C     1 
ATOM   170  O  O     . ALA A 1 21  ? 34.679 45.887  25.995  1.00 29.74  ? 149 ALA A O     1 
ATOM   171  C  CB    . ALA A 1 21  ? 35.112 44.455  23.657  1.00 29.21  ? 149 ALA A CB    1 
ATOM   172  N  N     . VAL A 1 22  ? 34.372 44.070  27.305  1.00 27.09  ? 150 VAL A N     1 
ATOM   173  C  CA    . VAL A 1 22  ? 34.189 44.854  28.528  1.00 27.13  ? 150 VAL A CA    1 
ATOM   174  C  C     . VAL A 1 22  ? 35.396 45.731  28.958  1.00 30.45  ? 150 VAL A C     1 
ATOM   175  O  O     . VAL A 1 22  ? 35.222 46.680  29.733  1.00 29.92  ? 150 VAL A O     1 
ATOM   176  C  CB    . VAL A 1 22  ? 33.736 43.968  29.729  1.00 28.93  ? 150 VAL A CB    1 
ATOM   177  C  CG1   . VAL A 1 22  ? 32.375 43.331  29.451  1.00 26.29  ? 150 VAL A CG1   1 
ATOM   178  C  CG2   . VAL A 1 22  ? 34.817 43.008  30.120  1.00 29.20  ? 150 VAL A CG2   1 
ATOM   179  N  N     . PHE A 1 23  ? 36.594 45.419  28.467  1.00 30.90  ? 151 PHE A N     1 
ATOM   180  C  CA    . PHE A 1 23  ? 37.812 46.233  28.700  1.00 33.13  ? 151 PHE A CA    1 
ATOM   181  C  C     . PHE A 1 23  ? 38.165 47.238  27.585  1.00 33.26  ? 151 PHE A C     1 
ATOM   182  O  O     . PHE A 1 23  ? 39.221 47.855  27.610  1.00 33.26  ? 151 PHE A O     1 
ATOM   183  C  CB    . PHE A 1 23  ? 39.003 45.292  28.899  1.00 35.92  ? 151 PHE A CB    1 
ATOM   184  C  CG    . PHE A 1 23  ? 38.750 44.236  29.947  1.00 37.68  ? 151 PHE A CG    1 
ATOM   185  C  CD1   . PHE A 1 23  ? 38.410 44.603  31.240  1.00 38.39  ? 151 PHE A CD1   1 
ATOM   186  C  CD2   . PHE A 1 23  ? 38.817 42.881  29.627  1.00 39.13  ? 151 PHE A CD2   1 
ATOM   187  C  CE1   . PHE A 1 23  ? 38.191 43.638  32.225  1.00 36.04  ? 151 PHE A CE1   1 
ATOM   188  C  CE2   . PHE A 1 23  ? 38.557 41.917  30.587  1.00 40.56  ? 151 PHE A CE2   1 
ATOM   189  C  CZ    . PHE A 1 23  ? 38.234 42.310  31.889  1.00 38.49  ? 151 PHE A CZ    1 
ATOM   190  N  N     . SER A 1 24  ? 37.255 47.448  26.651  1.00 30.24  ? 152 SER A N     1 
ATOM   191  C  CA    . SER A 1 24  ? 37.558 48.246  25.450  1.00 30.94  ? 152 SER A CA    1 
ATOM   192  C  C     . SER A 1 24  ? 37.787 49.719  25.802  1.00 29.59  ? 152 SER A C     1 
ATOM   193  O  O     . SER A 1 24  ? 37.142 50.259  26.700  1.00 28.55  ? 152 SER A O     1 
ATOM   194  C  CB    . SER A 1 24  ? 36.381 48.118  24.460  1.00 30.63  ? 152 SER A CB    1 
ATOM   195  O  OG    . SER A 1 24  ? 36.411 49.025  23.356  1.00 28.94  ? 152 SER A OG    1 
ATOM   196  N  N     . ASN A 1 25  ? 38.690 50.339  25.071  1.00 29.35  ? 153 ASN A N     1 
ATOM   197  C  CA    . ASN A 1 25  ? 38.837 51.827  25.068  1.00 32.10  ? 153 ASN A CA    1 
ATOM   198  C  C     . ASN A 1 25  ? 37.789 52.557  24.269  1.00 31.63  ? 153 ASN A C     1 
ATOM   199  O  O     . ASN A 1 25  ? 37.820 53.789  24.244  1.00 30.35  ? 153 ASN A O     1 
ATOM   200  C  CB    . ASN A 1 25  ? 40.187 52.258  24.471  1.00 32.47  ? 153 ASN A CB    1 
ATOM   201  C  CG    . ASN A 1 25  ? 41.358 51.539  25.095  1.00 36.61  ? 153 ASN A CG    1 
ATOM   202  O  OD1   . ASN A 1 25  ? 41.234 50.981  26.188  1.00 39.13  ? 153 ASN A OD1   1 
ATOM   203  N  ND2   . ASN A 1 25  ? 42.495 51.519  24.408  1.00 40.91  ? 153 ASN A ND2   1 
ATOM   204  N  N     . ARG A 1 26  ? 36.874 51.873  23.574  1.00 30.52  ? 154 ARG A N     1 
ATOM   205  C  CA    . ARG A 1 26  ? 35.961 52.614  22.686  1.00 32.12  ? 154 ARG A CA    1 
ATOM   206  C  C     . ARG A 1 26  ? 34.842 52.991  23.637  1.00 27.07  ? 154 ARG A C     1 
ATOM   207  O  O     . ARG A 1 26  ? 34.255 52.130  24.223  1.00 29.55  ? 154 ARG A O     1 
ATOM   208  C  CB    . ARG A 1 26  ? 35.446 51.819  21.463  1.00 34.04  ? 154 ARG A CB    1 
ATOM   209  C  CG    . ARG A 1 26  ? 34.217 52.515  20.804  1.00 33.74  ? 154 ARG A CG    1 
ATOM   210  C  CD    . ARG A 1 26  ? 33.696 51.764  19.568  1.00 36.50  ? 154 ARG A CD    1 
ATOM   211  N  NE    . ARG A 1 26  ? 33.048 50.473  19.897  1.00 36.05  ? 154 ARG A NE    1 
ATOM   212  C  CZ    . ARG A 1 26  ? 31.724 50.214  19.931  1.00 38.01  ? 154 ARG A CZ    1 
ATOM   213  N  NH1   . ARG A 1 26  ? 30.832 51.154  19.636  1.00 36.05  ? 154 ARG A NH1   1 
ATOM   214  N  NH2   . ARG A 1 26  ? 31.274 48.982  20.284  1.00 38.39  ? 154 ARG A NH2   1 
ATOM   215  N  N     . THR A 1 27  ? 34.608 54.284  23.832  1.00 23.21  ? 155 THR A N     1 
ATOM   216  C  CA    . THR A 1 27  ? 33.606 54.770  24.804  1.00 21.84  ? 155 THR A CA    1 
ATOM   217  C  C     . THR A 1 27  ? 32.233 54.637  24.154  1.00 21.36  ? 155 THR A C     1 
ATOM   218  O  O     . THR A 1 27  ? 32.111 54.618  22.896  1.00 24.23  ? 155 THR A O     1 
ATOM   219  C  CB    . THR A 1 27  ? 33.898 56.217  25.210  1.00 23.53  ? 155 THR A CB    1 
ATOM   220  O  OG1   . THR A 1 27  ? 33.840 57.063  24.040  1.00 25.62  ? 155 THR A OG1   1 
ATOM   221  C  CG2   . THR A 1 27  ? 35.291 56.323  25.861  1.00 27.00  ? 155 THR A CG2   1 
ATOM   222  N  N     . LEU A 1 28  ? 31.200 54.712  24.963  1.00 19.34  ? 156 LEU A N     1 
ATOM   223  C  CA    . LEU A 1 28  ? 29.826 54.514  24.550  1.00 19.14  ? 156 LEU A CA    1 
ATOM   224  C  C     . LEU A 1 28  ? 28.931 55.386  25.347  1.00 19.30  ? 156 LEU A C     1 
ATOM   225  O  O     . LEU A 1 28  ? 29.357 55.998  26.290  1.00 18.64  ? 156 LEU A O     1 
ATOM   226  C  CB    . LEU A 1 28  ? 29.413 53.027  24.793  1.00 20.89  ? 156 LEU A CB    1 
ATOM   227  C  CG    . LEU A 1 28  ? 30.178 51.952  24.067  1.00 24.87  ? 156 LEU A CG    1 
ATOM   228  C  CD1   . LEU A 1 28  ? 29.744 50.606  24.529  1.00 24.42  ? 156 LEU A CD1   1 
ATOM   229  C  CD2   . LEU A 1 28  ? 29.937 52.064  22.578  1.00 28.97  ? 156 LEU A CD2   1 
ATOM   230  N  N     . ALA A 1 29  ? 27.664 55.448  24.984  1.00 19.38  ? 157 ALA A N     1 
ATOM   231  C  CA    . ALA A 1 29  ? 26.711 56.239  25.711  1.00 17.23  ? 157 ALA A CA    1 
ATOM   232  C  C     . ALA A 1 29  ? 25.461 55.455  25.923  1.00 19.34  ? 157 ALA A C     1 
ATOM   233  O  O     . ALA A 1 29  ? 24.431 56.033  26.198  1.00 19.48  ? 157 ALA A O     1 
ATOM   234  C  CB    . ALA A 1 29  ? 26.394 57.485  24.863  1.00 20.31  ? 157 ALA A CB    1 
ATOM   235  N  N     . CYS A 1 30  ? 25.541 54.106  25.890  1.00 19.15  ? 158 CYS A N     1 
ATOM   236  C  CA    . CYS A 1 30  ? 24.392 53.290  26.141  1.00 19.48  ? 158 CYS A CA    1 
ATOM   237  C  C     . CYS A 1 30  ? 24.940 52.033  26.849  1.00 19.65  ? 158 CYS A C     1 
ATOM   238  O  O     . CYS A 1 30  ? 25.837 51.376  26.339  1.00 20.02  ? 158 CYS A O     1 
ATOM   239  C  CB    . CYS A 1 30  ? 23.681 52.777  24.871  1.00 19.72  ? 158 CYS A CB    1 
ATOM   240  S  SG    . CYS A 1 30  ? 22.110 51.961  25.283  1.00 21.43  ? 158 CYS A SG    1 
ATOM   241  N  N     . PHE A 1 31  ? 24.384 51.723  28.014  1.00 20.34  ? 159 PHE A N     1 
ATOM   242  C  CA    . PHE A 1 31  ? 24.863 50.634  28.860  1.00 20.94  ? 159 PHE A CA    1 
ATOM   243  C  C     . PHE A 1 31  ? 23.707 49.864  29.442  1.00 18.69  ? 159 PHE A C     1 
ATOM   244  O  O     . PHE A 1 31  ? 22.592 50.364  29.552  1.00 18.84  ? 159 PHE A O     1 
ATOM   245  C  CB    . PHE A 1 31  ? 25.740 51.173  29.973  1.00 20.75  ? 159 PHE A CB    1 
ATOM   246  C  CG    . PHE A 1 31  ? 26.827 52.113  29.504  1.00 20.72  ? 159 PHE A CG    1 
ATOM   247  C  CD1   . PHE A 1 31  ? 26.613 53.513  29.406  1.00 20.31  ? 159 PHE A CD1   1 
ATOM   248  C  CD2   . PHE A 1 31  ? 28.086 51.614  29.227  1.00 19.07  ? 159 PHE A CD2   1 
ATOM   249  C  CE1   . PHE A 1 31  ? 27.638 54.306  29.000  1.00 19.81  ? 159 PHE A CE1   1 
ATOM   250  C  CE2   . PHE A 1 31  ? 29.094 52.410  28.789  1.00 20.79  ? 159 PHE A CE2   1 
ATOM   251  C  CZ    . PHE A 1 31  ? 28.895 53.799  28.745  1.00 20.07  ? 159 PHE A CZ    1 
ATOM   252  N  N     . ALA A 1 32  ? 23.975 48.629  29.844  1.00 19.02  ? 160 ALA A N     1 
ATOM   253  C  CA    . ALA A 1 32  ? 23.025 47.816  30.533  1.00 20.55  ? 160 ALA A CA    1 
ATOM   254  C  C     . ALA A 1 32  ? 23.717 47.174  31.745  1.00 19.25  ? 160 ALA A C     1 
ATOM   255  O  O     . ALA A 1 32  ? 24.946 46.916  31.756  1.00 16.91  ? 160 ALA A O     1 
ATOM   256  C  CB    . ALA A 1 32  ? 22.431 46.733  29.655  1.00 21.12  ? 160 ALA A CB    1 
ATOM   257  N  N     . ILE A 1 33  ? 22.936 47.013  32.795  1.00 20.39  ? 161 ILE A N     1 
ATOM   258  C  CA    . ILE A 1 33  ? 23.356 46.330  34.037  1.00 19.86  ? 161 ILE A CA    1 
ATOM   259  C  C     . ILE A 1 33  ? 22.382 45.219  34.377  1.00 19.48  ? 161 ILE A C     1 
ATOM   260  O  O     . ILE A 1 33  ? 21.141 45.414  34.420  1.00 20.97  ? 161 ILE A O     1 
ATOM   261  C  CB    . ILE A 1 33  ? 23.521 47.291  35.229  1.00 19.68  ? 161 ILE A CB    1 
ATOM   262  C  CG1   . ILE A 1 33  ? 24.745 48.187  34.998  1.00 19.38  ? 161 ILE A CG1   1 
ATOM   263  C  CG2   . ILE A 1 33  ? 23.679 46.570  36.569  1.00 20.12  ? 161 ILE A CG2   1 
ATOM   264  C  CD1   . ILE A 1 33  ? 24.899 49.339  35.964  1.00 21.54  ? 161 ILE A CD1   1 
ATOM   265  N  N     . TYR A 1 34  ? 22.937 44.024  34.597  1.00 17.48  ? 162 TYR A N     1 
ATOM   266  C  CA    . TYR A 1 34  ? 22.158 42.887  35.058  1.00 18.53  ? 162 TYR A CA    1 
ATOM   267  C  C     . TYR A 1 34  ? 22.555 42.534  36.456  1.00 17.82  ? 162 TYR A C     1 
ATOM   268  O  O     . TYR A 1 34  ? 23.738 42.329  36.772  1.00 17.19  ? 162 TYR A O     1 
ATOM   269  C  CB    . TYR A 1 34  ? 22.440 41.692  34.158  1.00 17.73  ? 162 TYR A CB    1 
ATOM   270  C  CG    . TYR A 1 34  ? 21.676 40.428  34.387  1.00 19.09  ? 162 TYR A CG    1 
ATOM   271  C  CD1   . TYR A 1 34  ? 20.298 40.423  34.704  1.00 21.00  ? 162 TYR A CD1   1 
ATOM   272  C  CD2   . TYR A 1 34  ? 22.254 39.237  34.085  1.00 21.96  ? 162 TYR A CD2   1 
ATOM   273  C  CE1   . TYR A 1 34  ? 19.586 39.227  34.815  1.00 23.45  ? 162 TYR A CE1   1 
ATOM   274  C  CE2   . TYR A 1 34  ? 21.574 38.069  34.260  1.00 25.00  ? 162 TYR A CE2   1 
ATOM   275  C  CZ    . TYR A 1 34  ? 20.224 38.080  34.578  1.00 25.01  ? 162 TYR A CZ    1 
ATOM   276  O  OH    . TYR A 1 34  ? 19.611 36.825  34.641  1.00 29.74  ? 162 TYR A OH    1 
ATOM   277  N  N     . THR A 1 35  ? 21.577 42.545  37.308  1.00 19.80  ? 163 THR A N     1 
ATOM   278  C  CA    . THR A 1 35  ? 21.818 42.322  38.763  1.00 19.65  ? 163 THR A CA    1 
ATOM   279  C  C     . THR A 1 35  ? 20.567 41.893  39.481  1.00 20.88  ? 163 THR A C     1 
ATOM   280  O  O     . THR A 1 35  ? 19.521 41.715  38.867  1.00 20.39  ? 163 THR A O     1 
ATOM   281  C  CB    . THR A 1 35  ? 22.513 43.605  39.378  1.00 20.14  ? 163 THR A CB    1 
ATOM   282  O  OG1   . THR A 1 35  ? 23.029 43.300  40.700  1.00 20.82  ? 163 THR A OG1   1 
ATOM   283  C  CG2   . THR A 1 35  ? 21.621 44.858  39.449  1.00 22.36  ? 163 THR A CG2   1 
ATOM   284  N  N     . THR A 1 36  ? 20.635 41.802  40.834  1.00 20.96  ? 164 THR A N     1 
ATOM   285  C  CA    . THR A 1 36  ? 19.479 41.474  41.591  1.00 22.18  ? 164 THR A CA    1 
ATOM   286  C  C     . THR A 1 36  ? 18.449 42.590  41.630  1.00 22.57  ? 164 THR A C     1 
ATOM   287  O  O     . THR A 1 36  ? 18.741 43.794  41.419  1.00 22.34  ? 164 THR A O     1 
ATOM   288  C  CB    . THR A 1 36  ? 19.821 41.098  43.046  1.00 24.37  ? 164 THR A CB    1 
ATOM   289  O  OG1   . THR A 1 36  ? 20.382 42.253  43.686  1.00 22.05  ? 164 THR A OG1   1 
ATOM   290  C  CG2   . THR A 1 36  ? 20.761 39.924  43.071  1.00 24.70  ? 164 THR A CG2   1 
ATOM   291  N  N     . LYS A 1 37  ? 17.236 42.234  41.968  1.00 24.30  ? 165 LYS A N     1 
ATOM   292  C  CA    . LYS A 1 37  ? 16.196 43.208  42.077  1.00 26.26  ? 165 LYS A CA    1 
ATOM   293  C  C     . LYS A 1 37  ? 16.463 44.297  43.162  1.00 26.94  ? 165 LYS A C     1 
ATOM   294  O  O     . LYS A 1 37  ? 16.228 45.435  42.946  1.00 25.26  ? 165 LYS A O     1 
ATOM   295  C  CB    . LYS A 1 37  ? 14.862 42.541  42.301  1.00 20.00  ? 165 LYS A CB    1 
ATOM   296  C  CG    . LYS A 1 37  ? 13.786 43.557  42.502  1.00 20.00  ? 165 LYS A CG    1 
ATOM   297  C  CD    . LYS A 1 37  ? 12.412 43.022  42.177  1.00 20.00  ? 165 LYS A CD    1 
ATOM   298  C  CE    . LYS A 1 37  ? 11.785 43.680  40.953  1.00 20.00  ? 165 LYS A CE    1 
ATOM   299  N  NZ    . LYS A 1 37  ? 11.254 42.672  40.000  1.00 20.00  ? 165 LYS A NZ    1 
ATOM   300  N  N     . GLU A 1 38  ? 16.929 43.864  44.320  1.00 27.05  ? 166 GLU A N     1 
ATOM   301  C  CA    . GLU A 1 38  ? 17.319 44.707  45.444  1.00 30.41  ? 166 GLU A CA    1 
ATOM   302  C  C     . GLU A 1 38  ? 18.332 45.750  45.001  1.00 27.93  ? 166 GLU A C     1 
ATOM   303  O  O     . GLU A 1 38  ? 18.233 46.894  45.292  1.00 26.73  ? 166 GLU A O     1 
ATOM   304  C  CB    . GLU A 1 38  ? 18.005 43.841  46.564  1.00 31.34  ? 166 GLU A CB    1 
ATOM   305  C  CG    . GLU A 1 38  ? 18.855 42.644  46.033  1.00 37.80  ? 166 GLU A CG    1 
ATOM   306  C  CD    . GLU A 1 38  ? 19.947 42.002  46.940  1.00 45.60  ? 166 GLU A CD    1 
ATOM   307  O  OE1   . GLU A 1 38  ? 19.810 42.047  48.196  1.00 39.20  ? 166 GLU A OE1   1 
ATOM   308  O  OE2   . GLU A 1 38  ? 20.936 41.421  46.396  1.00 31.90  ? 166 GLU A OE2   1 
ATOM   309  N  N     . LYS A 1 39  ? 19.336 45.291  44.302  1.00 28.30  ? 167 LYS A N     1 
ATOM   310  C  CA    . LYS A 1 39  ? 20.424 46.153  43.876  1.00 27.60  ? 167 LYS A CA    1 
ATOM   311  C  C     . LYS A 1 39  ? 19.957 47.096  42.762  1.00 25.16  ? 167 LYS A C     1 
ATOM   312  O  O     . LYS A 1 39  ? 20.314 48.282  42.719  1.00 24.03  ? 167 LYS A O     1 
ATOM   313  C  CB    . LYS A 1 39  ? 21.660 45.325  43.457  1.00 26.18  ? 167 LYS A CB    1 
ATOM   314  C  CG    . LYS A 1 39  ? 22.305 44.552  44.593  1.00 28.30  ? 167 LYS A CG    1 
ATOM   315  C  CD    . LYS A 1 39  ? 23.408 43.618  44.099  1.00 28.41  ? 167 LYS A CD    1 
ATOM   316  C  CE    . LYS A 1 39  ? 24.571 44.336  43.432  1.00 29.21  ? 167 LYS A CE    1 
ATOM   317  N  NZ    . LYS A 1 39  ? 25.718 43.407  43.263  1.00 26.16  ? 167 LYS A NZ    1 
ATOM   318  N  N     . ALA A 1 40  ? 19.244 46.555  41.778  1.00 23.41  ? 168 ALA A N     1 
ATOM   319  C  CA    . ALA A 1 40  ? 18.777 47.355  40.634  1.00 21.82  ? 168 ALA A CA    1 
ATOM   320  C  C     . ALA A 1 40  ? 17.878 48.527  41.073  1.00 23.70  ? 168 ALA A C     1 
ATOM   321  O  O     . ALA A 1 40  ? 18.026 49.638  40.551  1.00 21.28  ? 168 ALA A O     1 
ATOM   322  C  CB    . ALA A 1 40  ? 18.068 46.485  39.608  1.00 23.07  ? 168 ALA A CB    1 
ATOM   323  N  N     . ALA A 1 41  ? 17.045 48.325  42.095  1.00 27.08  ? 169 ALA A N     1 
ATOM   324  C  CA    . ALA A 1 41  ? 16.118 49.353  42.573  1.00 29.04  ? 169 ALA A CA    1 
ATOM   325  C  C     . ALA A 1 41  ? 16.913 50.523  43.147  1.00 30.31  ? 169 ALA A C     1 
ATOM   326  O  O     . ALA A 1 41  ? 16.601 51.694  42.888  1.00 28.69  ? 169 ALA A O     1 
ATOM   327  C  CB    . ALA A 1 41  ? 15.189 48.804  43.645  1.00 32.93  ? 169 ALA A CB    1 
ATOM   328  N  N     . LEU A 1 42  ? 17.965 50.202  43.875  1.00 29.11  ? 170 LEU A N     1 
ATOM   329  C  CA    . LEU A 1 42  ? 18.847 51.275  44.441  1.00 32.13  ? 170 LEU A CA    1 
ATOM   330  C  C     . LEU A 1 42  ? 19.696 51.951  43.348  1.00 29.25  ? 170 LEU A C     1 
ATOM   331  O  O     . LEU A 1 42  ? 19.879 53.183  43.302  1.00 30.34  ? 170 LEU A O     1 
ATOM   332  C  CB    . LEU A 1 42  ? 19.718 50.726  45.582  1.00 37.03  ? 170 LEU A CB    1 
ATOM   333  C  CG    . LEU A 1 42  ? 19.035 50.740  46.980  1.00 49.27  ? 170 LEU A CG    1 
ATOM   334  C  CD1   . LEU A 1 42  ? 17.763 49.914  47.034  1.00 51.38  ? 170 LEU A CD1   1 
ATOM   335  C  CD2   . LEU A 1 42  ? 19.901 50.323  48.174  1.00 51.28  ? 170 LEU A CD2   1 
ATOM   336  N  N     . LEU A 1 43  ? 20.249 51.143  42.456  1.00 24.33  ? 171 LEU A N     1 
ATOM   337  C  CA    . LEU A 1 43  ? 21.143 51.618  41.411  1.00 25.09  ? 171 LEU A CA    1 
ATOM   338  C  C     . LEU A 1 43  ? 20.471 52.536  40.420  1.00 25.59  ? 171 LEU A C     1 
ATOM   339  O  O     . LEU A 1 43  ? 21.121 53.425  39.854  1.00 27.95  ? 171 LEU A O     1 
ATOM   340  C  CB    . LEU A 1 43  ? 21.701 50.454  40.591  1.00 28.53  ? 171 LEU A CB    1 
ATOM   341  C  CG    . LEU A 1 43  ? 23.121 50.047  40.783  1.00 35.91  ? 171 LEU A CG    1 
ATOM   342  C  CD1   . LEU A 1 43  ? 23.475 48.993  39.712  1.00 35.38  ? 171 LEU A CD1   1 
ATOM   343  C  CD2   . LEU A 1 43  ? 24.092 51.227  40.728  1.00 34.25  ? 171 LEU A CD2   1 
ATOM   344  N  N     . TYR A 1 44  ? 19.164 52.355  40.210  1.00 23.94  ? 172 TYR A N     1 
ATOM   345  C  CA    . TYR A 1 44  ? 18.395 53.168  39.309  1.00 22.94  ? 172 TYR A CA    1 
ATOM   346  C  C     . TYR A 1 44  ? 18.580 54.638  39.628  1.00 22.93  ? 172 TYR A C     1 
ATOM   347  O  O     . TYR A 1 44  ? 18.913 55.442  38.751  1.00 23.91  ? 172 TYR A O     1 
ATOM   348  C  CB    . TYR A 1 44  ? 16.905 52.811  39.476  1.00 24.59  ? 172 TYR A CB    1 
ATOM   349  C  CG    . TYR A 1 44  ? 15.939 53.586  38.592  1.00 25.52  ? 172 TYR A CG    1 
ATOM   350  C  CD1   . TYR A 1 44  ? 15.779 53.257  37.242  1.00 23.40  ? 172 TYR A CD1   1 
ATOM   351  C  CD2   . TYR A 1 44  ? 15.161 54.610  39.106  1.00 27.26  ? 172 TYR A CD2   1 
ATOM   352  C  CE1   . TYR A 1 44  ? 14.871 53.937  36.433  1.00 24.11  ? 172 TYR A CE1   1 
ATOM   353  C  CE2   . TYR A 1 44  ? 14.250 55.324  38.296  1.00 27.69  ? 172 TYR A CE2   1 
ATOM   354  C  CZ    . TYR A 1 44  ? 14.122 54.954  36.969  1.00 27.60  ? 172 TYR A CZ    1 
ATOM   355  O  OH    . TYR A 1 44  ? 13.228 55.604  36.203  1.00 27.35  ? 172 TYR A OH    1 
ATOM   356  N  N     . LYS A 1 45  ? 18.360 54.996  40.879  1.00 25.15  ? 173 LYS A N     1 
ATOM   357  C  CA    . LYS A 1 45  ? 18.551 56.394  41.269  1.00 28.87  ? 173 LYS A CA    1 
ATOM   358  C  C     . LYS A 1 45  ? 19.999 56.872  41.250  1.00 25.56  ? 173 LYS A C     1 
ATOM   359  O  O     . LYS A 1 45  ? 20.285 58.038  40.877  1.00 27.98  ? 173 LYS A O     1 
ATOM   360  C  CB    . LYS A 1 45  ? 17.942 56.638  42.631  1.00 37.19  ? 173 LYS A CB    1 
ATOM   361  C  CG    . LYS A 1 45  ? 16.472 56.343  42.662  1.00 49.17  ? 173 LYS A CG    1 
ATOM   362  C  CD    . LYS A 1 45  ? 15.988 55.705  43.977  1.00 62.28  ? 173 LYS A CD    1 
ATOM   363  C  CE    . LYS A 1 45  ? 14.451 55.541  44.024  1.00 64.07  ? 173 LYS A CE    1 
ATOM   364  N  NZ    . LYS A 1 45  ? 13.761 55.159  42.740  1.00 68.73  ? 173 LYS A NZ    1 
ATOM   365  N  N     . LYS A 1 46  ? 20.894 56.024  41.709  1.00 22.95  ? 174 LYS A N     1 
ATOM   366  C  CA    . LYS A 1 46  ? 22.317 56.330  41.780  1.00 24.21  ? 174 LYS A CA    1 
ATOM   367  C  C     . LYS A 1 46  ? 22.938 56.573  40.424  1.00 24.21  ? 174 LYS A C     1 
ATOM   368  O  O     . LYS A 1 46  ? 23.729 57.514  40.268  1.00 23.37  ? 174 LYS A O     1 
ATOM   369  C  CB    . LYS A 1 46  ? 23.060 55.235  42.504  1.00 27.58  ? 174 LYS A CB    1 
ATOM   370  C  CG    . LYS A 1 46  ? 22.731 55.155  44.017  1.00 32.80  ? 174 LYS A CG    1 
ATOM   371  C  CD    . LYS A 1 46  ? 23.273 56.350  44.752  1.00 41.66  ? 174 LYS A CD    1 
ATOM   372  C  CE    . LYS A 1 46  ? 23.190 56.183  46.252  1.00 49.60  ? 174 LYS A CE    1 
ATOM   373  N  NZ    . LYS A 1 46  ? 21.768 56.021  46.652  1.00 52.29  ? 174 LYS A NZ    1 
ATOM   374  N  N     . ILE A 1 47  ? 22.685 55.652  39.517  1.00 20.93  ? 175 ILE A N     1 
ATOM   375  C  CA    . ILE A 1 47  ? 23.112 55.834  38.087  1.00 22.00  ? 175 ILE A CA    1 
ATOM   376  C  C     . ILE A 1 47  ? 22.558 57.134  37.515  1.00 24.99  ? 175 ILE A C     1 
ATOM   377  O  O     . ILE A 1 47  ? 23.290 57.916  36.960  1.00 24.56  ? 175 ILE A O     1 
ATOM   378  C  CB    . ILE A 1 47  ? 22.713 54.658  37.191  1.00 22.60  ? 175 ILE A CB    1 
ATOM   379  C  CG1   . ILE A 1 47  ? 23.408 53.338  37.562  1.00 26.58  ? 175 ILE A CG1   1 
ATOM   380  C  CG2   . ILE A 1 47  ? 22.994 54.994  35.677  1.00 23.83  ? 175 ILE A CG2   1 
ATOM   381  C  CD1   . ILE A 1 47  ? 24.928 53.348  37.385  1.00 27.81  ? 175 ILE A CD1   1 
ATOM   382  N  N     . MET A 1 48  ? 21.249 57.336  37.647  1.00 23.64  ? 176 MET A N     1 
ATOM   383  C  CA    . MET A 1 48  ? 20.625 58.514  37.162  1.00 28.19  ? 176 MET A CA    1 
ATOM   384  C  C     . MET A 1 48  ? 21.378 59.769  37.617  1.00 29.21  ? 176 MET A C     1 
ATOM   385  O  O     . MET A 1 48  ? 21.680 60.659  36.766  1.00 31.89  ? 176 MET A O     1 
ATOM   386  C  CB    . MET A 1 48  ? 19.133 58.503  37.558  1.00 31.55  ? 176 MET A CB    1 
ATOM   387  C  CG    . MET A 1 48  ? 18.307 59.699  37.155  1.00 33.41  ? 176 MET A CG    1 
ATOM   388  S  SD    . MET A 1 48  ? 16.646 59.749  37.865  1.00 38.05  ? 176 MET A SD    1 
ATOM   389  C  CE    . MET A 1 48  ? 15.927 58.235  37.314  1.00 37.80  ? 176 MET A CE    1 
ATOM   390  N  N     . GLU A 1 49  ? 21.710 59.897  38.921  1.00 27.20  ? 177 GLU A N     1 
ATOM   391  C  CA    . GLU A 1 49  ? 22.466 61.011  39.469  1.00 34.33  ? 177 GLU A CA    1 
ATOM   392  C  C     . GLU A 1 49  ? 23.945 61.040  39.037  1.00 34.83  ? 177 GLU A C     1 
ATOM   393  O  O     . GLU A 1 49  ? 24.481 62.104  38.696  1.00 34.46  ? 177 GLU A O     1 
ATOM   394  C  CB    . GLU A 1 49  ? 22.500 60.992  40.991  1.00 35.22  ? 177 GLU A CB    1 
ATOM   395  C  CG    . GLU A 1 49  ? 21.164 61.149  41.698  1.00 47.75  ? 177 GLU A CG    1 
ATOM   396  C  CD    . GLU A 1 49  ? 21.137 60.670  43.179  1.00 56.73  ? 177 GLU A CD    1 
ATOM   397  O  OE1   . GLU A 1 49  ? 22.032 59.921  43.694  1.00 57.91  ? 177 GLU A OE1   1 
ATOM   398  O  OE2   . GLU A 1 49  ? 20.143 61.027  43.840  1.00 65.68  ? 177 GLU A OE2   1 
ATOM   399  N  N     . LYS A 1 50  ? 24.617 59.902  39.082  1.00 25.47  ? 178 LYS A N     1 
ATOM   400  C  CA    . LYS A 1 50  ? 26.078 59.900  38.883  1.00 24.74  ? 178 LYS A CA    1 
ATOM   401  C  C     . LYS A 1 50  ? 26.339 60.349  37.400  1.00 24.80  ? 178 LYS A C     1 
ATOM   402  O  O     . LYS A 1 50  ? 27.309 61.075  37.141  1.00 26.63  ? 178 LYS A O     1 
ATOM   403  C  CB    . LYS A 1 50  ? 26.622 58.498  39.066  1.00 25.24  ? 178 LYS A CB    1 
ATOM   404  C  CG    . LYS A 1 50  ? 28.066 58.269  38.675  1.00 26.65  ? 178 LYS A CG    1 
ATOM   405  C  CD    . LYS A 1 50  ? 29.067 59.068  39.440  1.00 29.89  ? 178 LYS A CD    1 
ATOM   406  C  CE    . LYS A 1 50  ? 30.476 58.601  39.097  1.00 31.63  ? 178 LYS A CE    1 
ATOM   407  N  NZ    . LYS A 1 50  ? 31.420 59.539  39.707  1.00 35.96  ? 178 LYS A NZ    1 
ATOM   408  N  N     . TYR A 1 51  ? 25.526 59.813  36.518  1.00 23.35  ? 179 TYR A N     1 
ATOM   409  C  CA    . TYR A 1 51  ? 25.767 59.915  35.047  1.00 22.05  ? 179 TYR A CA    1 
ATOM   410  C  C     . TYR A 1 51  ? 24.831 60.925  34.366  1.00 23.24  ? 179 TYR A C     1 
ATOM   411  O  O     . TYR A 1 51  ? 24.893 61.092  33.140  1.00 23.95  ? 179 TYR A O     1 
ATOM   412  C  CB    . TYR A 1 51  ? 25.804 58.519  34.402  1.00 20.03  ? 179 TYR A CB    1 
ATOM   413  C  CG    . TYR A 1 51  ? 27.016 57.755  34.851  1.00 20.12  ? 179 TYR A CG    1 
ATOM   414  C  CD1   . TYR A 1 51  ? 28.289 58.208  34.556  1.00 21.63  ? 179 TYR A CD1   1 
ATOM   415  C  CD2   . TYR A 1 51  ? 26.904 56.614  35.718  1.00 21.81  ? 179 TYR A CD2   1 
ATOM   416  C  CE1   . TYR A 1 51  ? 29.408 57.579  35.047  1.00 23.68  ? 179 TYR A CE1   1 
ATOM   417  C  CE2   . TYR A 1 51  ? 28.025 55.969  36.160  1.00 22.33  ? 179 TYR A CE2   1 
ATOM   418  C  CZ    . TYR A 1 51  ? 29.263 56.448  35.834  1.00 24.40  ? 179 TYR A CZ    1 
ATOM   419  O  OH    . TYR A 1 51  ? 30.374 55.803  36.283  1.00 24.96  ? 179 TYR A OH    1 
ATOM   420  N  N     . SER A 1 52  ? 24.039 61.654  35.148  1.00 23.56  ? 180 SER A N     1 
ATOM   421  C  CA    . SER A 1 52  ? 23.075 62.649  34.570  1.00 24.51  ? 180 SER A CA    1 
ATOM   422  C  C     . SER A 1 52  ? 22.402 62.102  33.300  1.00 24.95  ? 180 SER A C     1 
ATOM   423  O  O     . SER A 1 52  ? 22.416 62.697  32.222  1.00 24.33  ? 180 SER A O     1 
ATOM   424  C  CB    . SER A 1 52  ? 23.788 64.011  34.396  1.00 24.71  ? 180 SER A CB    1 
ATOM   425  O  OG    . SER A 1 52  ? 24.295 64.477  35.612  1.00 27.55  ? 180 SER A OG    1 
ATOM   426  N  N     . VAL A 1 53  ? 21.880 60.874  33.393  1.00 21.45  ? 181 VAL A N     1 
ATOM   427  C  CA    . VAL A 1 53  ? 21.375 60.149  32.229  1.00 21.52  ? 181 VAL A CA    1 
ATOM   428  C  C     . VAL A 1 53  ? 20.321 60.913  31.439  1.00 21.07  ? 181 VAL A C     1 
ATOM   429  O  O     . VAL A 1 53  ? 19.519 61.721  31.970  1.00 22.11  ? 181 VAL A O     1 
ATOM   430  C  CB    . VAL A 1 53  ? 20.851 58.728  32.585  1.00 20.72  ? 181 VAL A CB    1 
ATOM   431  C  CG1   . VAL A 1 53  ? 21.904 57.944  33.308  1.00 20.50  ? 181 VAL A CG1   1 
ATOM   432  C  CG2   . VAL A 1 53  ? 19.524 58.739  33.347  1.00 22.39  ? 181 VAL A CG2   1 
ATOM   433  N  N     . THR A 1 54  ? 20.419 60.775  30.096  1.00 20.40  ? 182 THR A N     1 
ATOM   434  C  CA    . THR A 1 54  ? 19.317 61.217  29.318  1.00 19.29  ? 182 THR A CA    1 
ATOM   435  C  C     . THR A 1 54  ? 18.049 60.393  29.535  1.00 17.92  ? 182 THR A C     1 
ATOM   436  O  O     . THR A 1 54  ? 16.904 60.915  29.340  1.00 20.04  ? 182 THR A O     1 
ATOM   437  C  CB    . THR A 1 54  ? 19.652 61.246  27.812  1.00 18.30  ? 182 THR A CB    1 
ATOM   438  O  OG1   . THR A 1 54  ? 19.847 59.879  27.397  1.00 18.23  ? 182 THR A OG1   1 
ATOM   439  C  CG2   . THR A 1 54  ? 20.929 62.021  27.561  1.00 19.82  ? 182 THR A CG2   1 
ATOM   440  N  N     . PHE A 1 55  ? 18.216 59.090  29.787  1.00 19.83  ? 183 PHE A N     1 
ATOM   441  C  CA    . PHE A 1 55  ? 17.105 58.216  29.941  1.00 19.83  ? 183 PHE A CA    1 
ATOM   442  C  C     . PHE A 1 55  ? 17.593 56.950  30.731  1.00 18.91  ? 183 PHE A C     1 
ATOM   443  O  O     . PHE A 1 55  ? 18.734 56.497  30.570  1.00 18.98  ? 183 PHE A O     1 
ATOM   444  C  CB    . PHE A 1 55  ? 16.640 57.680  28.563  1.00 21.04  ? 183 PHE A CB    1 
ATOM   445  C  CG    . PHE A 1 55  ? 15.517 56.681  28.676  1.00 21.17  ? 183 PHE A CG    1 
ATOM   446  C  CD1   . PHE A 1 55  ? 14.234 57.115  28.837  1.00 22.20  ? 183 PHE A CD1   1 
ATOM   447  C  CD2   . PHE A 1 55  ? 15.791 55.295  28.703  1.00 19.26  ? 183 PHE A CD2   1 
ATOM   448  C  CE1   . PHE A 1 55  ? 13.200 56.202  28.942  1.00 23.77  ? 183 PHE A CE1   1 
ATOM   449  C  CE2   . PHE A 1 55  ? 14.763 54.411  28.818  1.00 21.64  ? 183 PHE A CE2   1 
ATOM   450  C  CZ    . PHE A 1 55  ? 13.454 54.858  28.937  1.00 20.01  ? 183 PHE A CZ    1 
ATOM   451  N  N     . ILE A 1 56  ? 16.752 56.459  31.599  1.00 21.06  ? 184 ILE A N     1 
ATOM   452  C  CA    . ILE A 1 56  ? 17.015 55.145  32.329  1.00 19.72  ? 184 ILE A CA    1 
ATOM   453  C  C     . ILE A 1 56  ? 15.720 54.381  32.489  1.00 19.47  ? 184 ILE A C     1 
ATOM   454  O  O     . ILE A 1 56  ? 14.697 54.993  32.801  1.00 19.59  ? 184 ILE A O     1 
ATOM   455  C  CB    . ILE A 1 56  ? 17.778 55.334  33.669  1.00 19.76  ? 184 ILE A CB    1 
ATOM   456  C  CG1   . ILE A 1 56  ? 18.101 53.983  34.381  1.00 19.20  ? 184 ILE A CG1   1 
ATOM   457  C  CG2   . ILE A 1 56  ? 17.091 56.341  34.567  1.00 20.41  ? 184 ILE A CG2   1 
ATOM   458  C  CD1   . ILE A 1 56  ? 19.256 54.048  35.348  1.00 19.93  ? 184 ILE A CD1   1 
ATOM   459  N  N     . SER A 1 57  ? 15.802 53.028  32.423  1.00 19.35  ? 185 SER A N     1 
ATOM   460  C  CA    . SER A 1 57  ? 14.646 52.206  32.603  1.00 20.07  ? 185 SER A CA    1 
ATOM   461  C  C     . SER A 1 57  ? 15.126 50.960  33.366  1.00 19.73  ? 185 SER A C     1 
ATOM   462  O  O     . SER A 1 57  ? 16.301 50.563  33.263  1.00 19.54  ? 185 SER A O     1 
ATOM   463  C  CB    . SER A 1 57  ? 13.983 51.798  31.283  1.00 19.54  ? 185 SER A CB    1 
ATOM   464  O  OG    . SER A 1 57  ? 14.888 51.226  30.406  1.00 18.86  ? 185 SER A OG    1 
ATOM   465  N  N     . ARG A 1 58  ? 14.241 50.488  34.225  1.00 20.31  ? 186 ARG A N     1 
ATOM   466  C  CA    . ARG A 1 58  ? 14.479 49.273  35.040  1.00 19.26  ? 186 ARG A CA    1 
ATOM   467  C  C     . ARG A 1 58  ? 13.477 48.235  34.623  1.00 19.23  ? 186 ARG A C     1 
ATOM   468  O  O     . ARG A 1 58  ? 12.260 48.562  34.521  1.00 20.38  ? 186 ARG A O     1 
ATOM   469  C  CB    . ARG A 1 58  ? 14.410 49.582  36.545  1.00 18.77  ? 186 ARG A CB    1 
ATOM   470  C  CG    . ARG A 1 58  ? 14.689 48.336  37.391  1.00 19.12  ? 186 ARG A CG    1 
ATOM   471  C  CD    . ARG A 1 58  ? 14.971 48.681  38.865  1.00 21.81  ? 186 ARG A CD    1 
ATOM   472  N  NE    . ARG A 1 58  ? 13.860 49.258  39.596  1.00 25.60  ? 186 ARG A NE    1 
ATOM   473  C  CZ    . ARG A 1 58  ? 13.094 48.630  40.512  1.00 26.16  ? 186 ARG A CZ    1 
ATOM   474  N  NH1   . ARG A 1 58  ? 13.175 47.324  40.740  1.00 25.63  ? 186 ARG A NH1   1 
ATOM   475  N  NH2   . ARG A 1 58  ? 12.172 49.311  41.133  1.00 25.65  ? 186 ARG A NH2   1 
ATOM   476  N  N     . HIS A 1 59  ? 13.941 46.986  34.417  1.00 18.81  ? 187 HIS A N     1 
ATOM   477  C  CA    . HIS A 1 59  ? 13.149 45.963  33.782  1.00 19.01  ? 187 HIS A CA    1 
ATOM   478  C  C     . HIS A 1 59  ? 13.227 44.663  34.614  1.00 20.04  ? 187 HIS A C     1 
ATOM   479  O  O     . HIS A 1 59  ? 14.289 44.310  35.120  1.00 17.72  ? 187 HIS A O     1 
ATOM   480  C  CB    . HIS A 1 59  ? 13.674 45.621  32.397  1.00 19.63  ? 187 HIS A CB    1 
ATOM   481  C  CG    . HIS A 1 59  ? 13.752 46.794  31.488  1.00 20.56  ? 187 HIS A CG    1 
ATOM   482  N  ND1   . HIS A 1 59  ? 12.755 47.087  30.591  1.00 21.66  ? 187 HIS A ND1   1 
ATOM   483  C  CD2   . HIS A 1 59  ? 14.667 47.797  31.394  1.00 22.51  ? 187 HIS A CD2   1 
ATOM   484  C  CE1   . HIS A 1 59  ? 13.036 48.251  29.995  1.00 22.45  ? 187 HIS A CE1   1 
ATOM   485  N  NE2   . HIS A 1 59  ? 14.221 48.666  30.425  1.00 20.69  ? 187 HIS A NE2   1 
ATOM   486  N  N     A ASN A 1 60  ? 12.092 43.994  34.735  0.50 20.74  ? 188 ASN A N     1 
ATOM   487  N  N     B ASN A 1 60  ? 12.090 43.995  34.743  0.50 21.59  ? 188 ASN A N     1 
ATOM   488  C  CA    A ASN A 1 60  ? 12.042 42.615  35.217  0.50 22.04  ? 188 ASN A CA    1 
ATOM   489  C  CA    B ASN A 1 60  ? 12.076 42.624  35.268  0.50 23.71  ? 188 ASN A CA    1 
ATOM   490  C  C     A ASN A 1 60  ? 12.701 41.625  34.289  0.50 22.93  ? 188 ASN A C     1 
ATOM   491  C  C     B ASN A 1 60  ? 12.674 41.608  34.302  0.50 24.02  ? 188 ASN A C     1 
ATOM   492  O  O     A ASN A 1 60  ? 12.494 41.693  33.079  0.50 22.93  ? 188 ASN A O     1 
ATOM   493  O  O     B ASN A 1 60  ? 12.476 41.690  33.089  0.50 24.06  ? 188 ASN A O     1 
ATOM   494  C  CB    A ASN A 1 60  ? 10.573 42.170  35.240  0.50 23.99  ? 188 ASN A CB    1 
ATOM   495  C  CB    B ASN A 1 60  ? 10.673 42.211  35.703  0.50 27.51  ? 188 ASN A CB    1 
ATOM   496  C  CG    A ASN A 1 60  ? 9.736  42.854  36.284  0.50 25.60  ? 188 ASN A CG    1 
ATOM   497  C  CG    B ASN A 1 60  ? 10.706 41.329  36.956  0.50 30.61  ? 188 ASN A CG    1 
ATOM   498  O  OD1   A ASN A 1 60  ? 10.019 42.774  37.473  0.50 25.58  ? 188 ASN A OD1   1 
ATOM   499  O  OD1   B ASN A 1 60  ? 11.708 40.695  37.269  0.50 31.47  ? 188 ASN A OD1   1 
ATOM   500  N  ND2   A ASN A 1 60  ? 8.649  43.479  35.846  0.50 27.61  ? 188 ASN A ND2   1 
ATOM   501  N  ND2   B ASN A 1 60  ? 9.645  41.371  37.713  0.50 34.20  ? 188 ASN A ND2   1 
ATOM   502  N  N     . SER A 1 61  ? 13.449 40.673  34.850  1.00 25.49  ? 189 SER A N     1 
ATOM   503  C  CA    . SER A 1 61  ? 14.109 39.613  34.077  1.00 24.28  ? 189 SER A CA    1 
ATOM   504  C  C     . SER A 1 61  ? 14.040 38.389  34.993  1.00 26.72  ? 189 SER A C     1 
ATOM   505  O  O     . SER A 1 61  ? 14.995 38.098  35.723  1.00 27.02  ? 189 SER A O     1 
ATOM   506  C  CB    . SER A 1 61  ? 15.572 39.968  33.714  1.00 24.51  ? 189 SER A CB    1 
ATOM   507  O  OG    . SER A 1 61  ? 16.213 38.861  32.989  1.00 30.75  ? 189 SER A OG    1 
ATOM   508  N  N     . TYR A 1 62  ? 12.873 37.731  34.956  1.00 29.61  ? 190 TYR A N     1 
ATOM   509  C  CA    . TYR A 1 62  ? 12.555 36.552  35.777  1.00 34.85  ? 190 TYR A CA    1 
ATOM   510  C  C     . TYR A 1 62  ? 12.745 37.000  37.246  1.00 38.41  ? 190 TYR A C     1 
ATOM   511  O  O     . TYR A 1 62  ? 12.190 38.052  37.674  1.00 38.13  ? 190 TYR A O     1 
ATOM   512  C  CB    . TYR A 1 62  ? 13.389 35.321  35.301  1.00 37.20  ? 190 TYR A CB    1 
ATOM   513  C  CG    . TYR A 1 62  ? 13.416 34.964  33.754  1.00 41.73  ? 190 TYR A CG    1 
ATOM   514  C  CD1   . TYR A 1 62  ? 12.461 34.132  33.180  1.00 47.89  ? 190 TYR A CD1   1 
ATOM   515  C  CD2   . TYR A 1 62  ? 14.448 35.449  32.876  1.00 48.74  ? 190 TYR A CD2   1 
ATOM   516  C  CE1   . TYR A 1 62  ? 12.512 33.792  31.817  1.00 47.63  ? 190 TYR A CE1   1 
ATOM   517  C  CE2   . TYR A 1 62  ? 14.500 35.140  31.483  1.00 53.00  ? 190 TYR A CE2   1 
ATOM   518  C  CZ    . TYR A 1 62  ? 13.523 34.298  30.956  1.00 49.42  ? 190 TYR A CZ    1 
ATOM   519  O  OH    . TYR A 1 62  ? 13.546 33.916  29.582  1.00 50.10  ? 190 TYR A OH    1 
ATOM   520  N  N     . ASN A 1 63  ? 13.567 36.295  38.020  1.00 37.49  ? 191 ASN A N     1 
ATOM   521  C  CA    . ASN A 1 63  ? 13.872 36.709  39.428  1.00 40.24  ? 191 ASN A CA    1 
ATOM   522  C  C     . ASN A 1 63  ? 14.743 37.985  39.557  1.00 35.97  ? 191 ASN A C     1 
ATOM   523  O  O     . ASN A 1 63  ? 14.735 38.619  40.587  1.00 38.79  ? 191 ASN A O     1 
ATOM   524  C  CB    . ASN A 1 63  ? 14.463 35.523  40.288  1.00 42.36  ? 191 ASN A CB    1 
ATOM   525  C  CG    . ASN A 1 63  ? 15.615 34.742  39.606  1.00 47.49  ? 191 ASN A CG    1 
ATOM   526  O  OD1   . ASN A 1 63  ? 16.010 35.011  38.448  1.00 45.22  ? 191 ASN A OD1   1 
ATOM   527  N  ND2   . ASN A 1 63  ? 16.104 33.688  40.302  1.00 46.48  ? 191 ASN A ND2   1 
ATOM   528  N  N     . HIS A 1 64  ? 15.408 38.421  38.497  1.00 25.10  ? 192 HIS A N     1 
ATOM   529  C  CA    . HIS A 1 64  ? 16.378 39.461  38.589  1.00 23.61  ? 192 HIS A CA    1 
ATOM   530  C  C     . HIS A 1 64  ? 15.884 40.708  37.836  1.00 22.37  ? 192 HIS A C     1 
ATOM   531  O  O     . HIS A 1 64  ? 14.718 40.803  37.476  1.00 24.91  ? 192 HIS A O     1 
ATOM   532  C  CB    . HIS A 1 64  ? 17.745 39.017  38.095  1.00 22.55  ? 192 HIS A CB    1 
ATOM   533  C  CG    . HIS A 1 64  ? 18.310 37.864  38.835  1.00 24.34  ? 192 HIS A CG    1 
ATOM   534  N  ND1   . HIS A 1 64  ? 18.378 37.819  40.202  1.00 26.86  ? 192 HIS A ND1   1 
ATOM   535  C  CD2   . HIS A 1 64  ? 18.833 36.706  38.383  1.00 25.87  ? 192 HIS A CD2   1 
ATOM   536  C  CE1   . HIS A 1 64  ? 18.900 36.665  40.573  1.00 29.70  ? 192 HIS A CE1   1 
ATOM   537  N  NE2   . HIS A 1 64  ? 19.212 35.984  39.481  1.00 24.88  ? 192 HIS A NE2   1 
ATOM   538  N  N     . ASN A 1 65  ? 16.741 41.698  37.736  1.00 22.38  ? 193 ASN A N     1 
ATOM   539  C  CA    . ASN A 1 65  ? 16.410 42.952  37.005  1.00 20.34  ? 193 ASN A CA    1 
ATOM   540  C  C     . ASN A 1 65  ? 17.484 43.351  36.044  1.00 19.96  ? 193 ASN A C     1 
ATOM   541  O  O     . ASN A 1 65  ? 18.671 43.020  36.254  1.00 21.73  ? 193 ASN A O     1 
ATOM   542  C  CB    . ASN A 1 65  ? 16.316 44.096  38.024  1.00 20.14  ? 193 ASN A CB    1 
ATOM   543  C  CG    . ASN A 1 65  ? 14.933 44.312  38.677  1.00 22.49  ? 193 ASN A CG    1 
ATOM   544  O  OD1   . ASN A 1 65  ? 14.784 45.342  39.336  1.00 23.94  ? 193 ASN A OD1   1 
ATOM   545  N  ND2   . ASN A 1 65  ? 14.026 43.394  38.653  1.00 22.68  ? 193 ASN A ND2   1 
ATOM   546  N  N     . ILE A 1 66  ? 17.117 44.188  35.030  1.00 18.11  ? 194 ILE A N     1 
ATOM   547  C  CA    . ILE A 1 66  ? 18.078 44.784  34.158  1.00 18.18  ? 194 ILE A CA    1 
ATOM   548  C  C     . ILE A 1 66  ? 17.815 46.318  34.119  1.00 18.64  ? 194 ILE A C     1 
ATOM   549  O  O     . ILE A 1 66  ? 16.634 46.774  34.101  1.00 17.22  ? 194 ILE A O     1 
ATOM   550  C  CB    . ILE A 1 66  ? 18.018 44.185  32.723  1.00 19.38  ? 194 ILE A CB    1 
ATOM   551  C  CG1   . ILE A 1 66  ? 18.464 42.703  32.751  1.00 20.22  ? 194 ILE A CG1   1 
ATOM   552  C  CG2   . ILE A 1 66  ? 18.847 45.028  31.740  1.00 18.56  ? 194 ILE A CG2   1 
ATOM   553  C  CD1   . ILE A 1 66  ? 18.107 41.940  31.495  1.00 20.47  ? 194 ILE A CD1   1 
ATOM   554  N  N     . LEU A 1 67  ? 18.884 47.058  34.180  1.00 16.22  ? 195 LEU A N     1 
ATOM   555  C  CA    . LEU A 1 67  ? 18.848 48.514  33.931  1.00 19.54  ? 195 LEU A CA    1 
ATOM   556  C  C     . LEU A 1 67  ? 19.352 48.762  32.524  1.00 19.01  ? 195 LEU A C     1 
ATOM   557  O  O     . LEU A 1 67  ? 20.387 48.222  32.144  1.00 18.61  ? 195 LEU A O     1 
ATOM   558  C  CB    . LEU A 1 67  ? 19.702 49.311  34.928  1.00 20.33  ? 195 LEU A CB    1 
ATOM   559  C  CG    . LEU A 1 67  ? 19.358 49.181  36.435  1.00 22.23  ? 195 LEU A CG    1 
ATOM   560  C  CD1   . LEU A 1 67  ? 20.457 49.906  37.212  1.00 23.44  ? 195 LEU A CD1   1 
ATOM   561  C  CD2   . LEU A 1 67  ? 18.012 49.793  36.705  1.00 23.80  ? 195 LEU A CD2   1 
ATOM   562  N  N     . PHE A 1 68  ? 18.742 49.729  31.858  1.00 18.12  ? 196 PHE A N     1 
ATOM   563  C  CA    . PHE A 1 68  ? 19.110 50.155  30.519  1.00 18.18  ? 196 PHE A CA    1 
ATOM   564  C  C     . PHE A 1 68  ? 19.231 51.672  30.655  1.00 17.88  ? 196 PHE A C     1 
ATOM   565  O  O     . PHE A 1 68  ? 18.303 52.258  31.110  1.00 19.23  ? 196 PHE A O     1 
ATOM   566  C  CB    . PHE A 1 68  ? 17.992 49.809  29.568  1.00 20.05  ? 196 PHE A CB    1 
ATOM   567  C  CG    . PHE A 1 68  ? 18.160 50.423  28.193  1.00 18.77  ? 196 PHE A CG    1 
ATOM   568  C  CD1   . PHE A 1 68  ? 17.676 51.724  27.922  1.00 18.50  ? 196 PHE A CD1   1 
ATOM   569  C  CD2   . PHE A 1 68  ? 18.889 49.784  27.194  1.00 17.86  ? 196 PHE A CD2   1 
ATOM   570  C  CE1   . PHE A 1 68  ? 17.855 52.314  26.635  1.00 19.32  ? 196 PHE A CE1   1 
ATOM   571  C  CE2   . PHE A 1 68  ? 19.076 50.380  25.937  1.00 17.69  ? 196 PHE A CE2   1 
ATOM   572  C  CZ    . PHE A 1 68  ? 18.646 51.687  25.696  1.00 17.39  ? 196 PHE A CZ    1 
ATOM   573  N  N     . PHE A 1 69  ? 20.339 52.272  30.248  1.00 17.10  ? 197 PHE A N     1 
ATOM   574  C  CA    . PHE A 1 69  ? 20.495 53.750  30.315  1.00 18.18  ? 197 PHE A CA    1 
ATOM   575  C  C     . PHE A 1 69  ? 21.338 54.332  29.197  1.00 20.77  ? 197 PHE A C     1 
ATOM   576  O  O     . PHE A 1 69  ? 22.195 53.681  28.617  1.00 17.77  ? 197 PHE A O     1 
ATOM   577  C  CB    . PHE A 1 69  ? 20.891 54.186  31.743  1.00 17.07  ? 197 PHE A CB    1 
ATOM   578  C  CG    . PHE A 1 69  ? 22.117 53.563  32.241  1.00 17.85  ? 197 PHE A CG    1 
ATOM   579  C  CD1   . PHE A 1 69  ? 22.038 52.269  32.839  1.00 17.66  ? 197 PHE A CD1   1 
ATOM   580  C  CD2   . PHE A 1 69  ? 23.356 54.182  32.132  1.00 18.42  ? 197 PHE A CD2   1 
ATOM   581  C  CE1   . PHE A 1 69  ? 23.167 51.669  33.358  1.00 20.88  ? 197 PHE A CE1   1 
ATOM   582  C  CE2   . PHE A 1 69  ? 24.501 53.566  32.670  1.00 18.67  ? 197 PHE A CE2   1 
ATOM   583  C  CZ    . PHE A 1 69  ? 24.407 52.308  33.220  1.00 19.04  ? 197 PHE A CZ    1 
ATOM   584  N  N     . LEU A 1 70  ? 21.028 55.600  28.906  1.00 20.95  ? 198 LEU A N     1 
ATOM   585  C  CA    . LEU A 1 70  ? 21.641 56.422  27.939  1.00 22.33  ? 198 LEU A CA    1 
ATOM   586  C  C     . LEU A 1 70  ? 22.248 57.647  28.578  1.00 20.96  ? 198 LEU A C     1 
ATOM   587  O  O     . LEU A 1 70  ? 21.638 58.243  29.438  1.00 18.75  ? 198 LEU A O     1 
ATOM   588  C  CB    . LEU A 1 70  ? 20.604 56.821  26.875  1.00 23.58  ? 198 LEU A CB    1 
ATOM   589  C  CG    . LEU A 1 70  ? 20.114 55.710  25.957  1.00 20.99  ? 198 LEU A CG    1 
ATOM   590  C  CD1   . LEU A 1 70  ? 18.642 55.894  25.547  1.00 19.80  ? 198 LEU A CD1   1 
ATOM   591  C  CD2   . LEU A 1 70  ? 21.055 55.563  24.763  1.00 20.91  ? 198 LEU A CD2   1 
ATOM   592  N  N     . THR A 1 71  ? 23.518 57.951  28.271  1.00 21.28  ? 199 THR A N     1 
ATOM   593  C  CA    . THR A 1 71  ? 24.203 59.056  28.911  1.00 22.36  ? 199 THR A CA    1 
ATOM   594  C  C     . THR A 1 71  ? 24.422 60.222  27.935  1.00 21.36  ? 199 THR A C     1 
ATOM   595  O  O     . THR A 1 71  ? 24.487 60.063  26.721  1.00 22.71  ? 199 THR A O     1 
ATOM   596  C  CB    . THR A 1 71  ? 25.566 58.596  29.443  1.00 22.95  ? 199 THR A CB    1 
ATOM   597  O  OG1   . THR A 1 71  ? 26.258 57.955  28.380  1.00 21.90  ? 199 THR A OG1   1 
ATOM   598  C  CG2   . THR A 1 71  ? 25.390 57.549  30.545  1.00 22.16  ? 199 THR A CG2   1 
ATOM   599  N  N     . PRO A 1 72  ? 24.472 61.471  28.463  1.00 23.16  ? 200 PRO A N     1 
ATOM   600  C  CA    . PRO A 1 72  ? 24.649 62.619  27.634  1.00 23.02  ? 200 PRO A CA    1 
ATOM   601  C  C     . PRO A 1 72  ? 26.038 62.796  27.022  1.00 24.51  ? 200 PRO A C     1 
ATOM   602  O  O     . PRO A 1 72  ? 26.179 63.509  26.051  1.00 24.49  ? 200 PRO A O     1 
ATOM   603  C  CB    . PRO A 1 72  ? 24.359 63.778  28.610  1.00 23.73  ? 200 PRO A CB    1 
ATOM   604  C  CG    . PRO A 1 72  ? 24.624 63.255  29.941  1.00 23.96  ? 200 PRO A CG    1 
ATOM   605  C  CD    . PRO A 1 72  ? 24.272 61.797  29.888  1.00 23.49  ? 200 PRO A CD    1 
ATOM   606  N  N     A HIS A 1 73  ? 27.071 62.256  27.692  0.65 24.00  ? 201 HIS A N     1 
ATOM   607  N  N     B HIS A 1 73  ? 27.078 62.252  27.599  0.35 25.13  ? 201 HIS A N     1 
ATOM   608  C  CA    A HIS A 1 73  ? 28.443 62.142  27.227  0.65 24.97  ? 201 HIS A CA    1 
ATOM   609  C  CA    B HIS A 1 73  ? 28.329 62.163  26.827  0.35 27.85  ? 201 HIS A CA    1 
ATOM   610  C  C     A HIS A 1 73  ? 28.908 60.644  27.273  0.65 26.29  ? 201 HIS A C     1 
ATOM   611  C  C     B HIS A 1 73  ? 28.843 60.731  27.119  0.35 27.41  ? 201 HIS A C     1 
ATOM   612  O  O     A HIS A 1 73  ? 28.197 59.809  27.872  0.65 27.39  ? 201 HIS A O     1 
ATOM   613  O  O     B HIS A 1 73  ? 28.125 59.967  27.808  0.35 25.79  ? 201 HIS A O     1 
ATOM   614  C  CB    A HIS A 1 73  ? 29.410 63.141  27.880  0.65 27.61  ? 201 HIS A CB    1 
ATOM   615  C  CB    B HIS A 1 73  ? 29.250 63.361  27.054  0.35 33.18  ? 201 HIS A CB    1 
ATOM   616  C  CG    A HIS A 1 73  ? 29.672 63.028  29.363  0.65 30.48  ? 201 HIS A CG    1 
ATOM   617  C  CG    B HIS A 1 73  ? 28.552 64.506  27.764  0.35 35.59  ? 201 HIS A CG    1 
ATOM   618  N  ND1   A HIS A 1 73  ? 30.771 62.360  29.847  0.65 32.59  ? 201 HIS A ND1   1 
ATOM   619  N  ND1   B HIS A 1 73  ? 28.784 65.830  27.493  0.35 37.43  ? 201 HIS A ND1   1 
ATOM   620  C  CD2   A HIS A 1 73  ? 29.140 63.701  30.424  0.65 29.97  ? 201 HIS A CD2   1 
ATOM   621  C  CD2   B HIS A 1 73  ? 27.543 64.500  28.672  0.35 36.92  ? 201 HIS A CD2   1 
ATOM   622  C  CE1   A HIS A 1 73  ? 30.831 62.530  31.154  0.65 33.42  ? 201 HIS A CE1   1 
ATOM   623  C  CE1   B HIS A 1 73  ? 28.002 66.595  28.241  0.35 35.97  ? 201 HIS A CE1   1 
ATOM   624  N  NE2   A HIS A 1 73  ? 29.841 63.319  31.527  0.65 33.64  ? 201 HIS A NE2   1 
ATOM   625  N  NE2   B HIS A 1 73  ? 27.240 65.808  28.972  0.35 31.20  ? 201 HIS A NE2   1 
ATOM   626  N  N     . ARG A 1 74  ? 30.004 60.354  26.596  1.00 25.71  ? 202 ARG A N     1 
ATOM   627  C  CA    . ARG A 1 74  ? 30.435 58.937  26.508  1.00 24.48  ? 202 ARG A CA    1 
ATOM   628  C  C     . ARG A 1 74  ? 31.343 58.558  27.669  1.00 23.50  ? 202 ARG A C     1 
ATOM   629  O  O     . ARG A 1 74  ? 32.032 59.416  28.268  1.00 22.50  ? 202 ARG A O     1 
ATOM   630  C  CB    . ARG A 1 74  ? 31.137 58.701  25.177  1.00 28.08  ? 202 ARG A CB    1 
ATOM   631  C  CG    . ARG A 1 74  ? 30.187 59.020  24.017  1.00 31.35  ? 202 ARG A CG    1 
ATOM   632  C  CD    . ARG A 1 74  ? 30.850 59.086  22.685  1.00 39.59  ? 202 ARG A CD    1 
ATOM   633  N  NE    . ARG A 1 74  ? 31.201 57.775  22.209  1.00 42.35  ? 202 ARG A NE    1 
ATOM   634  C  CZ    . ARG A 1 74  ? 31.558 57.480  20.945  1.00 58.21  ? 202 ARG A CZ    1 
ATOM   635  N  NH1   . ARG A 1 74  ? 31.598 58.419  19.986  1.00 65.04  ? 202 ARG A NH1   1 
ATOM   636  N  NH2   . ARG A 1 74  ? 31.884 56.222  20.628  1.00 50.16  ? 202 ARG A NH2   1 
ATOM   637  N  N     . HIS A 1 75  ? 31.309 57.264  28.006  1.00 20.99  ? 203 HIS A N     1 
ATOM   638  C  CA    . HIS A 1 75  ? 32.134 56.630  29.050  1.00 24.88  ? 203 HIS A CA    1 
ATOM   639  C  C     . HIS A 1 75  ? 32.662 55.268  28.614  1.00 23.73  ? 203 HIS A C     1 
ATOM   640  O  O     . HIS A 1 75  ? 32.070 54.605  27.767  1.00 24.11  ? 203 HIS A O     1 
ATOM   641  C  CB    . HIS A 1 75  ? 31.282 56.381  30.316  1.00 22.32  ? 203 HIS A CB    1 
ATOM   642  C  CG    . HIS A 1 75  ? 30.567 57.612  30.767  1.00 23.37  ? 203 HIS A CG    1 
ATOM   643  N  ND1   . HIS A 1 75  ? 31.137 58.514  31.620  1.00 26.32  ? 203 HIS A ND1   1 
ATOM   644  C  CD2   . HIS A 1 75  ? 29.351 58.117  30.442  1.00 23.62  ? 203 HIS A CD2   1 
ATOM   645  C  CE1   . HIS A 1 75  ? 30.306 59.529  31.829  1.00 27.08  ? 203 HIS A CE1   1 
ATOM   646  N  NE2   . HIS A 1 75  ? 29.199 59.299  31.137  1.00 25.81  ? 203 HIS A NE2   1 
ATOM   647  N  N     . ARG A 1 76  ? 33.807 54.868  29.166  1.00 24.82  ? 204 ARG A N     1 
ATOM   648  C  CA    . ARG A 1 76  ? 34.236 53.504  29.094  1.00 24.34  ? 204 ARG A CA    1 
ATOM   649  C  C     . ARG A 1 76  ? 33.343 52.600  29.888  1.00 22.95  ? 204 ARG A C     1 
ATOM   650  O  O     . ARG A 1 76  ? 32.919 52.903  31.009  1.00 21.45  ? 204 ARG A O     1 
ATOM   651  C  CB    . ARG A 1 76  ? 35.671 53.296  29.651  1.00 29.30  ? 204 ARG A CB    1 
ATOM   652  C  CG    . ARG A 1 76  ? 36.832 53.883  28.901  1.00 34.38  ? 204 ARG A CG    1 
ATOM   653  C  CD    . ARG A 1 76  ? 38.134 53.635  29.736  1.00 42.30  ? 204 ARG A CD    1 
ATOM   654  N  NE    . ARG A 1 76  ? 38.360 52.189  29.924  1.00 51.66  ? 204 ARG A NE    1 
ATOM   655  C  CZ    . ARG A 1 76  ? 39.175 51.383  29.214  1.00 59.76  ? 204 ARG A CZ    1 
ATOM   656  N  NH1   . ARG A 1 76  ? 39.946 51.856  28.226  1.00 65.88  ? 204 ARG A NH1   1 
ATOM   657  N  NH2   . ARG A 1 76  ? 39.229 50.070  29.512  1.00 52.86  ? 204 ARG A NH2   1 
ATOM   658  N  N     . VAL A 1 77  ? 33.134 51.405  29.351  1.00 21.07  ? 205 VAL A N     1 
ATOM   659  C  CA    . VAL A 1 77  ? 32.363 50.439  30.073  1.00 22.75  ? 205 VAL A CA    1 
ATOM   660  C  C     . VAL A 1 77  ? 32.988 50.107  31.443  1.00 21.58  ? 205 VAL A C     1 
ATOM   661  O  O     . VAL A 1 77  ? 32.266 49.980  32.414  1.00 21.33  ? 205 VAL A O     1 
ATOM   662  C  CB    . VAL A 1 77  ? 32.177 49.165  29.235  1.00 22.05  ? 205 VAL A CB    1 
ATOM   663  C  CG1   . VAL A 1 77  ? 31.552 48.039  30.082  1.00 22.33  ? 205 VAL A CG1   1 
ATOM   664  C  CG2   . VAL A 1 77  ? 31.338 49.475  28.008  1.00 22.40  ? 205 VAL A CG2   1 
ATOM   665  N  N     . SER A 1 78  ? 34.331 50.059  31.538  1.00 21.14  ? 206 SER A N     1 
ATOM   666  C  CA    . SER A 1 78  ? 34.994 49.708  32.769  1.00 22.96  ? 206 SER A CA    1 
ATOM   667  C  C     . SER A 1 78  ? 34.749 50.774  33.861  1.00 24.14  ? 206 SER A C     1 
ATOM   668  O  O     . SER A 1 78  ? 34.657 50.439  35.040  1.00 23.57  ? 206 SER A O     1 
ATOM   669  C  CB    . SER A 1 78  ? 36.504 49.579  32.515  1.00 24.13  ? 206 SER A CB    1 
ATOM   670  O  OG    . SER A 1 78  ? 36.991 50.767  31.946  1.00 27.88  ? 206 SER A OG    1 
ATOM   671  N  N     . ALA A 1 79  ? 34.569 52.029  33.456  1.00 23.51  ? 207 ALA A N     1 
ATOM   672  C  CA    . ALA A 1 79  ? 34.235 53.088  34.358  1.00 23.51  ? 207 ALA A CA    1 
ATOM   673  C  C     . ALA A 1 79  ? 32.855 52.908  34.951  1.00 21.76  ? 207 ALA A C     1 
ATOM   674  O  O     . ALA A 1 79  ? 32.661 53.130  36.202  1.00 25.16  ? 207 ALA A O     1 
ATOM   675  C  CB    . ALA A 1 79  ? 34.317 54.467  33.646  1.00 25.28  ? 207 ALA A CB    1 
ATOM   676  N  N     . ILE A 1 80  ? 31.896 52.568  34.113  1.00 20.10  ? 208 ILE A N     1 
ATOM   677  C  CA    . ILE A 1 80  ? 30.528 52.409  34.569  1.00 20.64  ? 208 ILE A CA    1 
ATOM   678  C  C     . ILE A 1 80  ? 30.520 51.201  35.531  1.00 20.03  ? 208 ILE A C     1 
ATOM   679  O  O     . ILE A 1 80  ? 29.939 51.228  36.677  1.00 20.69  ? 208 ILE A O     1 
ATOM   680  C  CB    . ILE A 1 80  ? 29.565 52.177  33.414  1.00 20.07  ? 208 ILE A CB    1 
ATOM   681  C  CG1   . ILE A 1 80  ? 29.617 53.315  32.357  1.00 22.36  ? 208 ILE A CG1   1 
ATOM   682  C  CG2   . ILE A 1 80  ? 28.115 52.062  33.912  1.00 20.66  ? 208 ILE A CG2   1 
ATOM   683  C  CD1   . ILE A 1 80  ? 29.439 54.677  32.911  1.00 22.91  ? 208 ILE A CD1   1 
ATOM   684  N  N     . ASN A 1 81  ? 31.191 50.143  35.079  1.00 19.05  ? 209 ASN A N     1 
ATOM   685  C  CA    . ASN A 1 81  ? 31.226 48.918  35.888  1.00 21.90  ? 209 ASN A CA    1 
ATOM   686  C  C     . ASN A 1 81  ? 31.866 49.157  37.248  1.00 22.26  ? 209 ASN A C     1 
ATOM   687  O  O     . ASN A 1 81  ? 31.344 48.784  38.329  1.00 23.39  ? 209 ASN A O     1 
ATOM   688  C  CB    . ASN A 1 81  ? 32.004 47.867  35.195  1.00 20.71  ? 209 ASN A CB    1 
ATOM   689  C  CG    . ASN A 1 81  ? 31.978 46.536  35.944  1.00 21.66  ? 209 ASN A CG    1 
ATOM   690  O  OD1   . ASN A 1 81  ? 30.899 45.966  36.204  1.00 20.67  ? 209 ASN A OD1   1 
ATOM   691  N  ND2   . ASN A 1 81  ? 33.153 46.050  36.315  1.00 22.97  ? 209 ASN A ND2   1 
ATOM   692  N  N     . ASN A 1 82  ? 33.028 49.808  37.242  1.00 24.70  ? 210 ASN A N     1 
ATOM   693  C  CA    . ASN A 1 82  ? 33.694 50.071  38.493  1.00 28.35  ? 210 ASN A CA    1 
ATOM   694  C  C     . ASN A 1 82  ? 32.832 50.830  39.471  1.00 28.30  ? 210 ASN A C     1 
ATOM   695  O  O     . ASN A 1 82  ? 32.845 50.481  40.662  1.00 26.87  ? 210 ASN A O     1 
ATOM   696  C  CB    . ASN A 1 82  ? 34.972 50.809  38.274  1.00 30.57  ? 210 ASN A CB    1 
ATOM   697  C  CG    . ASN A 1 82  ? 35.771 50.975  39.535  1.00 35.31  ? 210 ASN A CG    1 
ATOM   698  O  OD1   . ASN A 1 82  ? 35.943 52.090  40.026  1.00 38.21  ? 210 ASN A OD1   1 
ATOM   699  N  ND2   . ASN A 1 82  ? 36.307 49.878  40.031  1.00 38.41  ? 210 ASN A ND2   1 
ATOM   700  N  N     . TYR A 1 83  ? 32.119 51.861  39.004  1.00 26.09  ? 211 TYR A N     1 
ATOM   701  C  CA    . TYR A 1 83  ? 31.213 52.645  39.856  1.00 26.48  ? 211 TYR A CA    1 
ATOM   702  C  C     . TYR A 1 83  ? 30.156 51.734  40.448  1.00 26.71  ? 211 TYR A C     1 
ATOM   703  O  O     . TYR A 1 83  ? 29.930 51.730  41.669  1.00 24.84  ? 211 TYR A O     1 
ATOM   704  C  CB    . TYR A 1 83  ? 30.551 53.808  39.079  1.00 25.20  ? 211 TYR A CB    1 
ATOM   705  C  CG    . TYR A 1 83  ? 29.463 54.474  39.871  1.00 24.79  ? 211 TYR A CG    1 
ATOM   706  C  CD1   . TYR A 1 83  ? 29.759 55.362  40.914  1.00 27.99  ? 211 TYR A CD1   1 
ATOM   707  C  CD2   . TYR A 1 83  ? 28.124 54.252  39.558  1.00 23.99  ? 211 TYR A CD2   1 
ATOM   708  C  CE1   . TYR A 1 83  ? 28.756 56.000  41.683  1.00 28.05  ? 211 TYR A CE1   1 
ATOM   709  C  CE2   . TYR A 1 83  ? 27.121 54.862  40.302  1.00 28.28  ? 211 TYR A CE2   1 
ATOM   710  C  CZ    . TYR A 1 83  ? 27.424 55.717  41.327  1.00 27.12  ? 211 TYR A CZ    1 
ATOM   711  O  OH    . TYR A 1 83  ? 26.414 56.287  42.032  1.00 31.50  ? 211 TYR A OH    1 
ATOM   712  N  N     . ALA A 1 84  ? 29.539 50.949  39.581  1.00 24.91  ? 212 ALA A N     1 
ATOM   713  C  CA    . ALA A 1 84  ? 28.424 50.093  40.008  1.00 25.75  ? 212 ALA A CA    1 
ATOM   714  C  C     . ALA A 1 84  ? 28.846 48.986  40.972  1.00 27.89  ? 212 ALA A C     1 
ATOM   715  O  O     . ALA A 1 84  ? 28.175 48.774  42.010  1.00 34.12  ? 212 ALA A O     1 
ATOM   716  C  CB    . ALA A 1 84  ? 27.738 49.485  38.803  1.00 24.42  ? 212 ALA A CB    1 
ATOM   717  N  N     . GLN A 1 85  ? 30.014 48.375  40.739  1.00 25.83  ? 213 GLN A N     1 
ATOM   718  C  CA    . GLN A 1 85  ? 30.465 47.259  41.573  1.00 27.49  ? 213 GLN A CA    1 
ATOM   719  C  C     . GLN A 1 85  ? 30.825 47.760  42.961  1.00 27.08  ? 213 GLN A C     1 
ATOM   720  O  O     . GLN A 1 85  ? 30.600 47.061  43.957  1.00 29.25  ? 213 GLN A O     1 
ATOM   721  C  CB    . GLN A 1 85  ? 31.690 46.585  40.980  1.00 27.95  ? 213 GLN A CB    1 
ATOM   722  C  CG    . GLN A 1 85  ? 31.494 45.952  39.628  1.00 26.02  ? 213 GLN A CG    1 
ATOM   723  C  CD    . GLN A 1 85  ? 30.726 44.636  39.671  1.00 26.83  ? 213 GLN A CD    1 
ATOM   724  O  OE1   . GLN A 1 85  ? 30.486 44.040  40.757  1.00 26.20  ? 213 GLN A OE1   1 
ATOM   725  N  NE2   . GLN A 1 85  ? 30.289 44.201  38.511  1.00 24.37  ? 213 GLN A NE2   1 
ATOM   726  N  N     . LYS A 1 86  ? 31.436 48.935  43.054  1.00 27.74  ? 214 LYS A N     1 
ATOM   727  C  CA    . LYS A 1 86  ? 31.925 49.394  44.361  1.00 30.44  ? 214 LYS A CA    1 
ATOM   728  C  C     . LYS A 1 86  ? 30.811 49.884  45.274  1.00 32.30  ? 214 LYS A C     1 
ATOM   729  O  O     . LYS A 1 86  ? 31.015 49.927  46.489  1.00 32.13  ? 214 LYS A O     1 
ATOM   730  C  CB    . LYS A 1 86  ? 33.017 50.459  44.234  1.00 34.93  ? 214 LYS A CB    1 
ATOM   731  C  CG    . LYS A 1 86  ? 34.331 49.944  43.632  1.00 41.15  ? 214 LYS A CG    1 
ATOM   732  C  CD    . LYS A 1 86  ? 35.353 51.094  43.532  1.00 50.95  ? 214 LYS A CD    1 
ATOM   733  C  CE    . LYS A 1 86  ? 36.811 50.611  43.243  1.00 61.20  ? 214 LYS A CE    1 
ATOM   734  N  NZ    . LYS A 1 86  ? 37.735 51.662  42.682  1.00 65.54  ? 214 LYS A NZ    1 
ATOM   735  N  N     . LEU A 1 87  ? 29.628 50.195  44.734  1.00 28.34  ? 215 LEU A N     1 
ATOM   736  C  CA    . LEU A 1 87  ? 28.559 50.717  45.593  1.00 29.95  ? 215 LEU A CA    1 
ATOM   737  C  C     . LEU A 1 87  ? 28.049 49.726  46.625  1.00 28.49  ? 215 LEU A C     1 
ATOM   738  O  O     . LEU A 1 87  ? 27.805 50.074  47.770  1.00 30.23  ? 215 LEU A O     1 
ATOM   739  C  CB    . LEU A 1 87  ? 27.387 51.228  44.773  1.00 27.38  ? 215 LEU A CB    1 
ATOM   740  C  CG    . LEU A 1 87  ? 27.475 52.563  44.087  1.00 28.05  ? 215 LEU A CG    1 
ATOM   741  C  CD1   . LEU A 1 87  ? 26.253 52.744  43.175  1.00 28.32  ? 215 LEU A CD1   1 
ATOM   742  C  CD2   . LEU A 1 87  ? 27.618 53.745  45.055  1.00 28.82  ? 215 LEU A CD2   1 
HETATM 743  N  N     . CME A 1 88  ? 27.832 48.498  46.172  1.00 29.86  ? 216 CME A N     1 
HETATM 744  C  CA    . CME A 1 88  ? 27.264 47.413  47.016  1.00 33.09  ? 216 CME A CA    1 
HETATM 745  C  CB    . CME A 1 88  ? 25.820 47.064  46.568  1.00 36.64  ? 216 CME A CB    1 
HETATM 746  S  SG    . CME A 1 88  ? 24.715 48.339  47.115  1.00 46.77  ? 216 CME A SG    1 
HETATM 747  S  SD    . CME A 1 88  ? 23.058 48.223  45.962  1.00 54.12  ? 216 CME A SD    1 
HETATM 748  C  CE    . CME A 1 88  ? 23.294 49.377  44.650  1.00 44.05  ? 216 CME A CE    1 
HETATM 749  C  CZ    . CME A 1 88  ? 24.566 49.072  43.871  1.00 40.31  ? 216 CME A CZ    1 
HETATM 750  O  OH    . CME A 1 88  ? 24.537 47.793  43.225  1.00 37.41  ? 216 CME A OH    1 
HETATM 751  C  C     . CME A 1 88  ? 28.105 46.213  46.774  1.00 32.76  ? 216 CME A C     1 
HETATM 752  O  O     . CME A 1 88  ? 28.163 45.744  45.653  1.00 34.17  ? 216 CME A O     1 
ATOM   753  N  N     . THR A 1 89  ? 28.761 45.710  47.806  1.00 31.43  ? 217 THR A N     1 
ATOM   754  C  CA    . THR A 1 89  ? 29.702 44.641  47.662  1.00 32.37  ? 217 THR A CA    1 
ATOM   755  C  C     . THR A 1 89  ? 29.137 43.259  47.942  1.00 33.28  ? 217 THR A C     1 
ATOM   756  O  O     . THR A 1 89  ? 29.791 42.444  48.529  1.00 43.52  ? 217 THR A O     1 
ATOM   757  C  CB    . THR A 1 89  ? 30.890 44.882  48.563  1.00 32.83  ? 217 THR A CB    1 
ATOM   758  O  OG1   . THR A 1 89  ? 30.451 44.942  49.941  1.00 32.86  ? 217 THR A OG1   1 
ATOM   759  C  CG2   . THR A 1 89  ? 31.567 46.173  48.136  1.00 34.14  ? 217 THR A CG2   1 
ATOM   760  N  N     . PHE A 1 90  ? 27.894 43.029  47.594  1.00 31.82  ? 218 PHE A N     1 
ATOM   761  C  CA    . PHE A 1 90  ? 27.289 41.674  47.684  1.00 30.58  ? 218 PHE A CA    1 
ATOM   762  C  C     . PHE A 1 90  ? 26.584 41.369  46.365  1.00 29.12  ? 218 PHE A C     1 
ATOM   763  O  O     . PHE A 1 90  ? 26.175 42.268  45.653  1.00 27.14  ? 218 PHE A O     1 
ATOM   764  C  CB    . PHE A 1 90  ? 26.289 41.660  48.825  1.00 31.85  ? 218 PHE A CB    1 
ATOM   765  C  CG    . PHE A 1 90  ? 25.349 42.808  48.800  1.00 31.58  ? 218 PHE A CG    1 
ATOM   766  C  CD1   . PHE A 1 90  ? 25.674 44.023  49.417  1.00 32.68  ? 218 PHE A CD1   1 
ATOM   767  C  CD2   . PHE A 1 90  ? 24.127 42.686  48.184  1.00 31.95  ? 218 PHE A CD2   1 
ATOM   768  C  CE1   . PHE A 1 90  ? 24.786 45.083  49.377  1.00 34.21  ? 218 PHE A CE1   1 
ATOM   769  C  CE2   . PHE A 1 90  ? 23.260 43.746  48.111  1.00 34.55  ? 218 PHE A CE2   1 
ATOM   770  C  CZ    . PHE A 1 90  ? 23.579 44.951  48.728  1.00 32.84  ? 218 PHE A CZ    1 
ATOM   771  N  N     . SER A 1 91  ? 26.480 40.091  46.041  1.00 30.04  ? 219 SER A N     1 
ATOM   772  C  CA    . SER A 1 91  ? 25.772 39.606  44.884  1.00 28.20  ? 219 SER A CA    1 
ATOM   773  C  C     . SER A 1 91  ? 26.351 39.975  43.539  1.00 27.73  ? 219 SER A C     1 
ATOM   774  O  O     . SER A 1 91  ? 27.231 40.825  43.430  1.00 26.19  ? 219 SER A O     1 
ATOM   775  C  CB    . SER A 1 91  ? 24.284 39.995  44.915  1.00 27.30  ? 219 SER A CB    1 
ATOM   776  O  OG    . SER A 1 91  ? 23.728 39.753  46.183  1.00 31.62  ? 219 SER A OG    1 
ATOM   777  N  N     . PHE A 1 92  ? 25.797 39.373  42.510  1.00 22.72  ? 220 PHE A N     1 
ATOM   778  C  CA    . PHE A 1 92  ? 26.324 39.526  41.189  1.00 21.07  ? 220 PHE A CA    1 
ATOM   779  C  C     . PHE A 1 92  ? 25.966 40.885  40.604  1.00 20.71  ? 220 PHE A C     1 
ATOM   780  O  O     . PHE A 1 92  ? 24.973 41.512  40.996  1.00 21.82  ? 220 PHE A O     1 
ATOM   781  C  CB    . PHE A 1 92  ? 25.892 38.375  40.237  1.00 20.97  ? 220 PHE A CB    1 
ATOM   782  C  CG    . PHE A 1 92  ? 24.580 38.575  39.582  1.00 19.20  ? 220 PHE A CG    1 
ATOM   783  C  CD1   . PHE A 1 92  ? 23.400 38.389  40.262  1.00 21.00  ? 220 PHE A CD1   1 
ATOM   784  C  CD2   . PHE A 1 92  ? 24.506 38.947  38.258  1.00 19.43  ? 220 PHE A CD2   1 
ATOM   785  C  CE1   . PHE A 1 92  ? 22.176 38.555  39.628  1.00 20.37  ? 220 PHE A CE1   1 
ATOM   786  C  CE2   . PHE A 1 92  ? 23.291 39.083  37.635  1.00 20.29  ? 220 PHE A CE2   1 
ATOM   787  C  CZ    . PHE A 1 92  ? 22.135 38.934  38.330  1.00 20.16  ? 220 PHE A CZ    1 
ATOM   788  N  N     . LEU A 1 93  ? 26.713 41.224  39.576  1.00 21.02  ? 221 LEU A N     1 
ATOM   789  C  CA    . LEU A 1 93  ? 26.452 42.386  38.769  1.00 19.59  ? 221 LEU A CA    1 
ATOM   790  C  C     . LEU A 1 93  ? 27.200 42.258  37.472  1.00 20.79  ? 221 LEU A C     1 
ATOM   791  O  O     . LEU A 1 93  ? 28.458 42.173  37.438  1.00 22.00  ? 221 LEU A O     1 
ATOM   792  C  CB    . LEU A 1 93  ? 26.738 43.682  39.485  1.00 21.69  ? 221 LEU A CB    1 
ATOM   793  C  CG    . LEU A 1 93  ? 26.238 44.928  38.777  1.00 22.06  ? 221 LEU A CG    1 
ATOM   794  C  CD1   . LEU A 1 93  ? 25.905 45.997  39.804  1.00 22.41  ? 221 LEU A CD1   1 
ATOM   795  C  CD2   . LEU A 1 93  ? 27.202 45.468  37.729  1.00 22.40  ? 221 LEU A CD2   1 
ATOM   796  N  N     . ILE A 1 94  ? 26.453 42.307  36.395  1.00 18.29  ? 222 ILE A N     1 
ATOM   797  C  CA    . ILE A 1 94  ? 27.055 42.238  35.029  1.00 19.61  ? 222 ILE A CA    1 
ATOM   798  C  C     . ILE A 1 94  ? 26.770 43.632  34.365  1.00 20.29  ? 222 ILE A C     1 
ATOM   799  O  O     . ILE A 1 94  ? 25.614 44.066  34.312  1.00 18.73  ? 222 ILE A O     1 
ATOM   800  C  CB    . ILE A 1 94  ? 26.439 41.189  34.118  1.00 19.84  ? 222 ILE A CB    1 
ATOM   801  C  CG1   . ILE A 1 94  ? 26.298 39.781  34.806  1.00 23.24  ? 222 ILE A CG1   1 
ATOM   802  C  CG2   . ILE A 1 94  ? 27.245 41.034  32.799  1.00 19.55  ? 222 ILE A CG2   1 
ATOM   803  C  CD1   . ILE A 1 94  ? 27.594 39.164  35.179  1.00 24.65  ? 222 ILE A CD1   1 
ATOM   804  N  N     . CYS A 1 95  ? 27.823 44.276  33.905  1.00 18.72  ? 223 CYS A N     1 
ATOM   805  C  CA    . CYS A 1 95  ? 27.717 45.550  33.180  1.00 20.52  ? 223 CYS A CA    1 
ATOM   806  C  C     . CYS A 1 95  ? 28.358 45.474  31.788  1.00 20.94  ? 223 CYS A C     1 
ATOM   807  O  O     . CYS A 1 95  ? 29.565 45.176  31.643  1.00 20.56  ? 223 CYS A O     1 
ATOM   808  C  CB    . CYS A 1 95  ? 28.403 46.586  33.974  1.00 19.44  ? 223 CYS A CB    1 
ATOM   809  S  SG    . CYS A 1 95  ? 28.364 48.288  33.268  1.00 24.21  ? 223 CYS A SG    1 
ATOM   810  N  N     . LYS A 1 96  ? 27.594 45.881  30.791  1.00 21.34  ? 224 LYS A N     1 
ATOM   811  C  CA    . LYS A 1 96  ? 28.056 45.812  29.375  1.00 20.79  ? 224 LYS A CA    1 
ATOM   812  C  C     . LYS A 1 96  ? 27.555 47.030  28.623  1.00 20.84  ? 224 LYS A C     1 
ATOM   813  O  O     . LYS A 1 96  ? 26.456 47.520  28.840  1.00 20.49  ? 224 LYS A O     1 
ATOM   814  C  CB    . LYS A 1 96  ? 27.652 44.537  28.665  1.00 19.96  ? 224 LYS A CB    1 
ATOM   815  C  CG    . LYS A 1 96  ? 28.477 43.334  29.119  1.00 20.99  ? 224 LYS A CG    1 
ATOM   816  C  CD    . LYS A 1 96  ? 28.173 42.028  28.389  1.00 22.11  ? 224 LYS A CD    1 
ATOM   817  C  CE    . LYS A 1 96  ? 29.217 40.984  28.744  1.00 25.51  ? 224 LYS A CE    1 
ATOM   818  N  NZ    . LYS A 1 96  ? 29.023 39.679  28.084  1.00 26.17  ? 224 LYS A NZ    1 
ATOM   819  N  N     . GLY A 1 97  ? 28.366 47.440  27.690  1.00 21.50  ? 225 GLY A N     1 
ATOM   820  C  CA    . GLY A 1 97  ? 27.953 48.402  26.701  1.00 21.16  ? 225 GLY A CA    1 
ATOM   821  C  C     . GLY A 1 97  ? 26.935 47.808  25.715  1.00 20.94  ? 225 GLY A C     1 
ATOM   822  O  O     . GLY A 1 97  ? 26.921 46.574  25.492  1.00 21.40  ? 225 GLY A O     1 
ATOM   823  N  N     . VAL A 1 98  ? 26.035 48.662  25.222  1.00 17.44  ? 226 VAL A N     1 
ATOM   824  C  CA    . VAL A 1 98  ? 24.955 48.244  24.316  1.00 16.99  ? 226 VAL A CA    1 
ATOM   825  C  C     . VAL A 1 98  ? 25.260 48.769  22.947  1.00 17.54  ? 226 VAL A C     1 
ATOM   826  O  O     . VAL A 1 98  ? 25.375 50.031  22.711  1.00 17.76  ? 226 VAL A O     1 
ATOM   827  C  CB    . VAL A 1 98  ? 23.586 48.712  24.807  1.00 17.80  ? 226 VAL A CB    1 
ATOM   828  C  CG1   . VAL A 1 98  ? 22.472 48.351  23.848  1.00 19.18  ? 226 VAL A CG1   1 
ATOM   829  C  CG2   . VAL A 1 98  ? 23.295 48.242  26.209  1.00 17.00  ? 226 VAL A CG2   1 
ATOM   830  N  N     . ASN A 1 99  ? 25.397 47.856  22.011  1.00 16.43  ? 227 ASN A N     1 
ATOM   831  C  CA    . ASN A 1 99  ? 25.604 48.262  20.563  1.00 18.06  ? 227 ASN A CA    1 
ATOM   832  C  C     . ASN A 1 99  ? 24.288 48.504  19.854  1.00 21.79  ? 227 ASN A C     1 
ATOM   833  O  O     . ASN A 1 99  ? 24.258 49.464  18.982  1.00 27.02  ? 227 ASN A O     1 
ATOM   834  C  CB    . ASN A 1 99  ? 26.324 47.234  19.807  1.00 19.48  ? 227 ASN A CB    1 
ATOM   835  C  CG    . ASN A 1 99  ? 27.815 47.175  20.094  1.00 22.81  ? 227 ASN A CG    1 
ATOM   836  O  OD1   . ASN A 1 99  ? 28.467 48.176  20.318  1.00 25.63  ? 227 ASN A OD1   1 
ATOM   837  N  ND2   . ASN A 1 99  ? 28.349 45.954  20.073  1.00 24.87  ? 227 ASN A ND2   1 
ATOM   838  N  N     . LYS A 1 100 ? 23.227 47.762  20.164  1.00 18.19  ? 228 LYS A N     1 
ATOM   839  C  CA    . LYS A 1 100 ? 21.926 47.850  19.396  1.00 18.91  ? 228 LYS A CA    1 
ATOM   840  C  C     . LYS A 1 100 ? 20.977 48.433  20.366  1.00 17.00  ? 228 LYS A C     1 
ATOM   841  O  O     . LYS A 1 100 ? 20.342 47.767  21.107  1.00 18.61  ? 228 LYS A O     1 
ATOM   842  C  CB    . LYS A 1 100 ? 21.481 46.523  18.826  1.00 19.10  ? 228 LYS A CB    1 
ATOM   843  C  CG    . LYS A 1 100 ? 22.577 45.735  18.136  1.00 23.49  ? 228 LYS A CG    1 
ATOM   844  C  CD    . LYS A 1 100 ? 23.066 46.264  16.793  1.00 24.29  ? 228 LYS A CD    1 
ATOM   845  C  CE    . LYS A 1 100 ? 23.981 45.171  16.242  1.00 30.69  ? 228 LYS A CE    1 
ATOM   846  N  NZ    . LYS A 1 100 ? 24.611 45.616  15.018  1.00 32.95  ? 228 LYS A NZ    1 
ATOM   847  N  N     . GLU A 1 101 ? 20.980 49.779  20.470  1.00 17.93  ? 229 GLU A N     1 
ATOM   848  C  CA    . GLU A 1 101 ? 20.386 50.447  21.620  1.00 17.97  ? 229 GLU A CA    1 
ATOM   849  C  C     . GLU A 1 101 ? 18.842 50.285  21.557  1.00 18.07  ? 229 GLU A C     1 
ATOM   850  O  O     . GLU A 1 101 ? 18.186 49.938  22.580  1.00 16.22  ? 229 GLU A O     1 
ATOM   851  C  CB    . GLU A 1 101 ? 20.755 51.991  21.600  1.00 18.08  ? 229 GLU A CB    1 
ATOM   852  C  CG    . GLU A 1 101 ? 22.239 52.201  21.663  1.00 19.51  ? 229 GLU A CG    1 
ATOM   853  C  CD    . GLU A 1 101 ? 22.864 52.562  20.362  1.00 28.08  ? 229 GLU A CD    1 
ATOM   854  O  OE1   . GLU A 1 101 ? 22.492 51.967  19.341  1.00 31.80  ? 229 GLU A OE1   1 
ATOM   855  O  OE2   . GLU A 1 101 ? 23.746 53.462  20.369  1.00 32.42  ? 229 GLU A OE2   1 
ATOM   856  N  N     . TYR A 1 102 ? 18.290 50.509  20.385  1.00 16.81  ? 230 TYR A N     1 
ATOM   857  C  CA    . TYR A 1 102 ? 16.815 50.388  20.207  1.00 16.85  ? 230 TYR A CA    1 
ATOM   858  C  C     . TYR A 1 102 ? 16.385 48.907  20.434  1.00 17.17  ? 230 TYR A C     1 
ATOM   859  O  O     . TYR A 1 102 ? 15.439 48.621  21.175  1.00 19.79  ? 230 TYR A O     1 
ATOM   860  C  CB    . TYR A 1 102 ? 16.291 50.931  18.898  1.00 16.37  ? 230 TYR A CB    1 
ATOM   861  C  CG    . TYR A 1 102 ? 14.846 50.461  18.661  1.00 16.37  ? 230 TYR A CG    1 
ATOM   862  C  CD1   . TYR A 1 102 ? 13.800 50.976  19.324  1.00 17.62  ? 230 TYR A CD1   1 
ATOM   863  C  CD2   . TYR A 1 102 ? 14.587 49.330  17.854  1.00 17.10  ? 230 TYR A CD2   1 
ATOM   864  C  CE1   . TYR A 1 102 ? 12.484 50.494  19.178  1.00 18.15  ? 230 TYR A CE1   1 
ATOM   865  C  CE2   . TYR A 1 102 ? 13.279 48.866  17.674  1.00 19.29  ? 230 TYR A CE2   1 
ATOM   866  C  CZ    . TYR A 1 102 ? 12.251 49.430  18.329  1.00 19.85  ? 230 TYR A CZ    1 
ATOM   867  O  OH    . TYR A 1 102 ? 10.976 48.934  18.184  1.00 22.17  ? 230 TYR A OH    1 
ATOM   868  N  N     . LEU A 1 103 ? 17.029 48.003  19.749  1.00 17.02  ? 231 LEU A N     1 
ATOM   869  C  CA    . LEU A 1 103 ? 16.630 46.605  19.856  1.00 19.23  ? 231 LEU A CA    1 
ATOM   870  C  C     . LEU A 1 103 ? 16.689 46.133  21.305  1.00 17.74  ? 231 LEU A C     1 
ATOM   871  O  O     . LEU A 1 103 ? 15.866 45.327  21.750  1.00 18.91  ? 231 LEU A O     1 
ATOM   872  C  CB    . LEU A 1 103 ? 17.481 45.724  18.995  1.00 18.66  ? 231 LEU A CB    1 
ATOM   873  C  CG    . LEU A 1 103 ? 17.249 45.883  17.490  1.00 19.85  ? 231 LEU A CG    1 
ATOM   874  C  CD1   . LEU A 1 103 ? 18.230 45.039  16.720  1.00 19.28  ? 231 LEU A CD1   1 
ATOM   875  C  CD2   . LEU A 1 103 ? 15.788 45.531  17.081  1.00 21.50  ? 231 LEU A CD2   1 
ATOM   876  N  N     . MET A 1 104 ? 17.749 46.526  21.989  1.00 18.05  ? 232 MET A N     1 
ATOM   877  C  CA    . MET A 1 104 ? 17.859 46.240  23.465  1.00 17.26  ? 232 MET A CA    1 
ATOM   878  C  C     . MET A 1 104 ? 16.705 46.708  24.260  1.00 17.83  ? 232 MET A C     1 
ATOM   879  O  O     . MET A 1 104 ? 16.073 45.936  24.995  1.00 17.99  ? 232 MET A O     1 
ATOM   880  C  CB    . MET A 1 104 ? 19.194 46.736  24.025  1.00 18.18  ? 232 MET A CB    1 
ATOM   881  C  CG    . MET A 1 104 ? 19.502 46.386  25.461  1.00 15.76  ? 232 MET A CG    1 
ATOM   882  S  SD    . MET A 1 104 ? 19.927 44.650  25.641  1.00 21.28  ? 232 MET A SD    1 
ATOM   883  C  CE    . MET A 1 104 ? 20.324 44.592  27.385  1.00 20.71  ? 232 MET A CE    1 
ATOM   884  N  N     . TYR A 1 105 ? 16.458 48.027  24.245  1.00 17.99  ? 233 TYR A N     1 
ATOM   885  C  CA    . TYR A 1 105 ? 15.353 48.607  25.013  1.00 18.78  ? 233 TYR A CA    1 
ATOM   886  C  C     . TYR A 1 105 ? 14.007 47.990  24.624  1.00 18.66  ? 233 TYR A C     1 
ATOM   887  O  O     . TYR A 1 105 ? 13.219 47.587  25.486  1.00 18.95  ? 233 TYR A O     1 
ATOM   888  C  CB    . TYR A 1 105 ? 15.295 50.163  24.828  1.00 18.16  ? 233 TYR A CB    1 
ATOM   889  C  CG    . TYR A 1 105 ? 14.052 50.791  25.437  1.00 18.57  ? 233 TYR A CG    1 
ATOM   890  C  CD1   . TYR A 1 105 ? 13.987 51.016  26.823  1.00 21.49  ? 233 TYR A CD1   1 
ATOM   891  C  CD2   . TYR A 1 105 ? 12.902 50.988  24.671  1.00 19.84  ? 233 TYR A CD2   1 
ATOM   892  C  CE1   . TYR A 1 105 ? 12.834 51.540  27.376  1.00 21.52  ? 233 TYR A CE1   1 
ATOM   893  C  CE2   . TYR A 1 105 ? 11.733 51.516  25.218  1.00 21.25  ? 233 TYR A CE2   1 
ATOM   894  C  CZ    . TYR A 1 105 ? 11.691 51.766  26.586  1.00 21.52  ? 233 TYR A CZ    1 
ATOM   895  O  OH    . TYR A 1 105 ? 10.570 52.295  27.159  1.00 22.70  ? 233 TYR A OH    1 
ATOM   896  N  N     . SER A 1 106 ? 13.819 47.767  23.334  1.00 18.65  ? 234 SER A N     1 
ATOM   897  C  CA    . SER A 1 106 ? 12.559 47.280  22.861  1.00 19.40  ? 234 SER A CA    1 
ATOM   898  C  C     . SER A 1 106 ? 12.330 45.836  23.368  1.00 19.54  ? 234 SER A C     1 
ATOM   899  O  O     . SER A 1 106 ? 11.228 45.496  23.785  1.00 21.67  ? 234 SER A O     1 
ATOM   900  C  CB    . SER A 1 106 ? 12.520 47.334  21.293  1.00 20.08  ? 234 SER A CB    1 
ATOM   901  O  OG    . SER A 1 106 ? 11.301 46.789  20.824  1.00 21.26  ? 234 SER A OG    1 
ATOM   902  N  N     . ALA A 1 107 ? 13.349 45.003  23.280  1.00 18.67  ? 235 ALA A N     1 
ATOM   903  C  CA    . ALA A 1 107 ? 13.229 43.617  23.779  1.00 19.51  ? 235 ALA A CA    1 
ATOM   904  C  C     . ALA A 1 107 ? 12.957 43.608  25.275  1.00 19.42  ? 235 ALA A C     1 
ATOM   905  O  O     . ALA A 1 107 ? 12.286 42.713  25.758  1.00 22.14  ? 235 ALA A O     1 
ATOM   906  C  CB    . ALA A 1 107 ? 14.488 42.833  23.463  1.00 20.45  ? 235 ALA A CB    1 
ATOM   907  N  N     . LEU A 1 108 ? 13.512 44.582  25.982  1.00 19.33  ? 236 LEU A N     1 
ATOM   908  C  CA    . LEU A 1 108 ? 13.322 44.716  27.475  1.00 19.41  ? 236 LEU A CA    1 
ATOM   909  C  C     . LEU A 1 108 ? 11.928 45.124  27.889  1.00 20.52  ? 236 LEU A C     1 
ATOM   910  O  O     . LEU A 1 108 ? 11.547 45.029  29.064  1.00 21.84  ? 236 LEU A O     1 
ATOM   911  C  CB    . LEU A 1 108 ? 14.351 45.617  28.056  1.00 18.72  ? 236 LEU A CB    1 
ATOM   912  C  CG    . LEU A 1 108 ? 15.766 45.079  28.120  1.00 19.88  ? 236 LEU A CG    1 
ATOM   913  C  CD1   . LEU A 1 108 ? 16.714 46.176  28.510  1.00 19.75  ? 236 LEU A CD1   1 
ATOM   914  C  CD2   . LEU A 1 108 ? 15.833 43.939  29.126  1.00 21.95  ? 236 LEU A CD2   1 
ATOM   915  N  N     . THR A 1 109 ? 11.140 45.567  26.945  1.00 22.21  ? 237 THR A N     1 
ATOM   916  C  CA    . THR A 1 109 ? 9.700  45.816  27.095  1.00 22.63  ? 237 THR A CA    1 
ATOM   917  C  C     . THR A 1 109 ? 8.763  44.729  26.850  1.00 25.68  ? 237 THR A C     1 
ATOM   918  O  O     . THR A 1 109 ? 7.563  44.938  27.093  1.00 27.37  ? 237 THR A O     1 
ATOM   919  C  CB    . THR A 1 109 ? 9.227  47.039  26.261  1.00 25.11  ? 237 THR A CB    1 
ATOM   920  O  OG1   . THR A 1 109 ? 9.159  46.708  24.855  1.00 25.98  ? 237 THR A OG1   1 
ATOM   921  C  CG2   . THR A 1 109 ? 10.123 48.195  26.489  1.00 23.22  ? 237 THR A CG2   1 
ATOM   922  N  N     . ARG A 1 110 ? 9.228  43.557  26.380  1.00 26.35  ? 238 ARG A N     1 
ATOM   923  C  CA    . ARG A 1 110 ? 8.340  42.480  25.973  1.00 27.40  ? 238 ARG A CA    1 
ATOM   924  C  C     . ARG A 1 110 ? 8.758  41.178  26.601  1.00 28.20  ? 238 ARG A C     1 
ATOM   925  O  O     . ARG A 1 110 ? 9.940  40.952  26.912  1.00 24.18  ? 238 ARG A O     1 
ATOM   926  C  CB    . ARG A 1 110 ? 8.362  42.285  24.432  1.00 30.04  ? 238 ARG A CB    1 
ATOM   927  C  CG    . ARG A 1 110 ? 7.787  43.445  23.646  1.00 36.07  ? 238 ARG A CG    1 
ATOM   928  C  CD    . ARG A 1 110 ? 7.661  43.063  22.158  1.00 39.46  ? 238 ARG A CD    1 
ATOM   929  N  NE    . ARG A 1 110 ? 8.960  42.647  21.647  1.00 43.09  ? 238 ARG A NE    1 
ATOM   930  C  CZ    . ARG A 1 110 ? 9.924  43.490  21.254  1.00 40.47  ? 238 ARG A CZ    1 
ATOM   931  N  NH1   . ARG A 1 110 ? 9.711  44.789  21.294  1.00 39.12  ? 238 ARG A NH1   1 
ATOM   932  N  NH2   . ARG A 1 110 ? 11.127 43.010  20.854  1.00 42.80  ? 238 ARG A NH2   1 
ATOM   933  N  N     A ASP A 1 111 ? 7.785  40.280  26.729  0.50 30.14  ? 239 ASP A N     1 
ATOM   934  N  N     B ASP A 1 111 ? 7.789  40.297  26.733  0.50 29.99  ? 239 ASP A N     1 
ATOM   935  C  CA    A ASP A 1 111 ? 8.034  38.903  27.206  0.50 33.11  ? 239 ASP A CA    1 
ATOM   936  C  CA    B ASP A 1 111 ? 8.041  38.942  27.189  0.50 33.14  ? 239 ASP A CA    1 
ATOM   937  C  C     A ASP A 1 111 ? 9.380  38.356  26.706  0.50 30.79  ? 239 ASP A C     1 
ATOM   938  C  C     B ASP A 1 111 ? 9.386  38.369  26.700  0.50 30.74  ? 239 ASP A C     1 
ATOM   939  O  O     A ASP A 1 111 ? 9.683  38.411  25.508  0.50 30.58  ? 239 ASP A O     1 
ATOM   940  O  O     B ASP A 1 111 ? 9.691  38.412  25.504  0.50 30.49  ? 239 ASP A O     1 
ATOM   941  C  CB    A ASP A 1 111 ? 6.915  37.935  26.773  0.50 35.61  ? 239 ASP A CB    1 
ATOM   942  C  CB    B ASP A 1 111 ? 6.922  38.046  26.688  0.50 35.49  ? 239 ASP A CB    1 
ATOM   943  C  CG    A ASP A 1 111 ? 5.642  38.091  27.597  0.50 37.42  ? 239 ASP A CG    1 
ATOM   944  C  CG    B ASP A 1 111 ? 6.828  36.793  27.481  0.50 37.03  ? 239 ASP A CG    1 
ATOM   945  O  OD1   A ASP A 1 111 ? 5.579  39.060  28.361  0.50 37.43  ? 239 ASP A OD1   1 
ATOM   946  O  OD1   B ASP A 1 111 ? 6.451  36.873  28.671  0.50 38.93  ? 239 ASP A OD1   1 
ATOM   947  O  OD2   A ASP A 1 111 ? 4.728  37.229  27.513  0.50 39.25  ? 239 ASP A OD2   1 
ATOM   948  O  OD2   B ASP A 1 111 ? 7.184  35.752  26.926  0.50 36.85  ? 239 ASP A OD2   1 
ATOM   949  N  N     . PRO A 1 112 ? 10.185 37.802  27.605  1.00 32.30  ? 240 PRO A N     1 
ATOM   950  C  CA    . PRO A 1 112 ? 9.949  37.544  29.015  1.00 29.89  ? 240 PRO A CA    1 
ATOM   951  C  C     . PRO A 1 112 ? 10.212 38.760  29.931  1.00 27.94  ? 240 PRO A C     1 
ATOM   952  O  O     . PRO A 1 112 ? 10.092 38.663  31.155  1.00 27.36  ? 240 PRO A O     1 
ATOM   953  C  CB    . PRO A 1 112 ? 10.923 36.421  29.292  1.00 32.54  ? 240 PRO A CB    1 
ATOM   954  C  CG    . PRO A 1 112 ? 12.089 36.778  28.421  1.00 31.36  ? 240 PRO A CG    1 
ATOM   955  C  CD    . PRO A 1 112 ? 11.486 37.254  27.159  1.00 31.94  ? 240 PRO A CD    1 
ATOM   956  N  N     . PHE A 1 113 ? 10.526 39.904  29.354  1.00 25.09  ? 241 PHE A N     1 
ATOM   957  C  CA    . PHE A 1 113 ? 10.897 41.095  30.104  1.00 24.94  ? 241 PHE A CA    1 
ATOM   958  C  C     . PHE A 1 113 ? 9.728  42.027  30.203  1.00 26.89  ? 241 PHE A C     1 
ATOM   959  O  O     . PHE A 1 113 ? 8.690  41.850  29.551  1.00 28.38  ? 241 PHE A O     1 
ATOM   960  C  CB    . PHE A 1 113 ? 12.097 41.827  29.495  1.00 23.36  ? 241 PHE A CB    1 
ATOM   961  C  CG    . PHE A 1 113 ? 13.256 40.920  29.192  1.00 25.66  ? 241 PHE A CG    1 
ATOM   962  C  CD1   . PHE A 1 113 ? 14.080 40.431  30.185  1.00 27.04  ? 241 PHE A CD1   1 
ATOM   963  C  CD2   . PHE A 1 113 ? 13.489 40.472  27.878  1.00 25.97  ? 241 PHE A CD2   1 
ATOM   964  C  CE1   . PHE A 1 113 ? 15.141 39.562  29.886  1.00 26.30  ? 241 PHE A CE1   1 
ATOM   965  C  CE2   . PHE A 1 113 ? 14.523 39.573  27.603  1.00 26.67  ? 241 PHE A CE2   1 
ATOM   966  C  CZ    . PHE A 1 113 ? 15.348 39.132  28.574  1.00 25.44  ? 241 PHE A CZ    1 
ATOM   967  N  N     . SER A 1 114 ? 9.852  42.995  31.121  1.00 25.66  ? 242 SER A N     1 
ATOM   968  C  CA    . SER A 1 114 ? 8.859  44.053  31.221  1.00 26.45  ? 242 SER A CA    1 
ATOM   969  C  C     . SER A 1 114 ? 9.440  45.271  31.902  1.00 25.99  ? 242 SER A C     1 
ATOM   970  O  O     . SER A 1 114 ? 10.451 45.165  32.636  1.00 26.00  ? 242 SER A O     1 
ATOM   971  C  CB    . SER A 1 114 ? 7.624  43.573  31.952  1.00 27.80  ? 242 SER A CB    1 
ATOM   972  O  OG    . SER A 1 114 ? 7.895  43.131  33.270  1.00 28.48  ? 242 SER A OG    1 
ATOM   973  N  N     . VAL A 1 115 ? 8.829  46.429  31.653  1.00 24.64  ? 243 VAL A N     1 
ATOM   974  C  CA    . VAL A 1 115 ? 9.254  47.672  32.309  1.00 24.75  ? 243 VAL A CA    1 
ATOM   975  C  C     . VAL A 1 115 ? 8.740  47.737  33.729  1.00 24.67  ? 243 VAL A C     1 
ATOM   976  O  O     . VAL A 1 115 ? 7.531  47.587  33.980  1.00 25.76  ? 243 VAL A O     1 
ATOM   977  C  CB    . VAL A 1 115 ? 8.766  48.920  31.546  1.00 26.98  ? 243 VAL A CB    1 
ATOM   978  C  CG1   . VAL A 1 115 ? 9.077  50.224  32.307  1.00 28.28  ? 243 VAL A CG1   1 
ATOM   979  C  CG2   . VAL A 1 115 ? 9.398  48.962  30.161  1.00 29.41  ? 243 VAL A CG2   1 
ATOM   980  N  N     . ILE A 1 116 ? 9.617  47.997  34.670  1.00 22.34  ? 244 ILE A N     1 
ATOM   981  C  CA    . ILE A 1 116 ? 9.193  48.259  36.063  1.00 24.27  ? 244 ILE A CA    1 
ATOM   982  C  C     . ILE A 1 116 ? 9.001  49.778  36.245  1.00 25.09  ? 244 ILE A C     1 
ATOM   983  O  O     . ILE A 1 116 ? 7.979  50.210  36.748  1.00 25.64  ? 244 ILE A O     1 
ATOM   984  C  CB    . ILE A 1 116 ? 10.215 47.726  37.053  1.00 23.50  ? 244 ILE A CB    1 
ATOM   985  C  CG1   . ILE A 1 116 ? 10.270 46.194  36.937  1.00 25.93  ? 244 ILE A CG1   1 
ATOM   986  C  CG2   . ILE A 1 116 ? 9.847  48.120  38.474  1.00 24.29  ? 244 ILE A CG2   1 
ATOM   987  C  CD1   . ILE A 1 116 ? 11.472 45.591  37.647  1.00 25.92  ? 244 ILE A CD1   1 
ATOM   988  N  N     . GLU A 1 117 ? 10.014 50.536  35.876  1.00 22.51  ? 245 GLU A N     1 
ATOM   989  C  CA    . GLU A 1 117 ? 9.927  52.014  35.971  1.00 23.57  ? 245 GLU A CA    1 
ATOM   990  C  C     . GLU A 1 117 ? 10.861 52.575  34.956  1.00 23.17  ? 245 GLU A C     1 
ATOM   991  O  O     . GLU A 1 117 ? 11.833 51.925  34.568  1.00 23.37  ? 245 GLU A O     1 
ATOM   992  C  CB    . GLU A 1 117 ? 10.265 52.494  37.422  1.00 24.89  ? 245 GLU A CB    1 
ATOM   993  C  CG    . GLU A 1 117 ? 11.675 52.129  37.896  1.00 23.19  ? 245 GLU A CG    1 
ATOM   994  C  CD    . GLU A 1 117 ? 12.022 52.526  39.320  1.00 25.28  ? 245 GLU A CD    1 
ATOM   995  O  OE1   . GLU A 1 117 ? 11.424 53.486  39.853  1.00 25.93  ? 245 GLU A OE1   1 
ATOM   996  O  OE2   . GLU A 1 117 ? 12.893 51.851  39.915  1.00 24.25  ? 245 GLU A OE2   1 
ATOM   997  N  N     . GLU A 1 118 ? 10.579 53.781  34.479  1.00 23.08  ? 246 GLU A N     1 
ATOM   998  C  CA    . GLU A 1 118 ? 11.490 54.463  33.544  1.00 22.32  ? 246 GLU A CA    1 
ATOM   999  C  C     . GLU A 1 118 ? 11.381 55.978  33.725  1.00 23.19  ? 246 GLU A C     1 
ATOM   1000 O  O     . GLU A 1 118 ? 10.433 56.486  34.303  1.00 23.65  ? 246 GLU A O     1 
ATOM   1001 C  CB    . GLU A 1 118 ? 11.278 54.090  32.094  1.00 22.24  ? 246 GLU A CB    1 
ATOM   1002 C  CG    . GLU A 1 118 ? 9.836  54.205  31.594  1.00 24.39  ? 246 GLU A CG    1 
ATOM   1003 C  CD    . GLU A 1 118 ? 9.609  53.477  30.252  1.00 23.89  ? 246 GLU A CD    1 
ATOM   1004 O  OE1   . GLU A 1 118 ? 10.571 52.980  29.645  1.00 22.87  ? 246 GLU A OE1   1 
ATOM   1005 O  OE2   . GLU A 1 118 ? 8.415  53.329  29.879  1.00 24.84  ? 246 GLU A OE2   1 
ATOM   1006 N  N     . SER A 1 119 ? 12.435 56.648  33.288  1.00 24.50  ? 247 SER A N     1 
ATOM   1007 C  CA    . SER A 1 119 ? 12.593 58.119  33.629  1.00 25.31  ? 247 SER A CA    1 
ATOM   1008 C  C     . SER A 1 119 ? 11.767 59.093  32.778  1.00 26.94  ? 247 SER A C     1 
ATOM   1009 O  O     . SER A 1 119 ? 11.619 60.271  33.193  1.00 26.53  ? 247 SER A O     1 
ATOM   1010 C  CB    . SER A 1 119 ? 14.076 58.498  33.588  1.00 22.59  ? 247 SER A CB    1 
ATOM   1011 O  OG    . SER A 1 119 ? 14.528 58.363  32.289  1.00 22.38  ? 247 SER A OG    1 
ATOM   1012 N  N     . LEU A 1 120 ? 11.245 58.634  31.641  1.00 27.85  ? 248 LEU A N     1 
ATOM   1013 C  CA    . LEU A 1 120 ? 10.264 59.362  30.805  1.00 30.13  ? 248 LEU A CA    1 
ATOM   1014 C  C     . LEU A 1 120 ? 8.908  58.678  30.673  1.00 28.89  ? 248 LEU A C     1 
ATOM   1015 O  O     . LEU A 1 120 ? 8.846  57.495  30.239  1.00 28.34  ? 248 LEU A O     1 
ATOM   1016 C  CB    . LEU A 1 120 ? 10.807 59.494  29.369  1.00 29.50  ? 248 LEU A CB    1 
ATOM   1017 C  CG    . LEU A 1 120 ? 11.908 60.472  29.074  1.00 33.26  ? 248 LEU A CG    1 
ATOM   1018 C  CD1   . LEU A 1 120 ? 12.183 60.483  27.571  1.00 33.58  ? 248 LEU A CD1   1 
ATOM   1019 C  CD2   . LEU A 1 120 ? 11.567 61.896  29.542  1.00 31.56  ? 248 LEU A CD2   1 
ATOM   1020 N  N     . PRO A 1 121 ? 7.813  59.395  30.962  1.00 30.15  ? 249 PRO A N     1 
ATOM   1021 C  CA    . PRO A 1 121 ? 6.494  58.773  30.814  1.00 31.92  ? 249 PRO A CA    1 
ATOM   1022 C  C     . PRO A 1 121 ? 6.264  58.317  29.372  1.00 31.91  ? 249 PRO A C     1 
ATOM   1023 O  O     . PRO A 1 121 ? 6.478  59.103  28.450  1.00 32.83  ? 249 PRO A O     1 
ATOM   1024 C  CB    . PRO A 1 121 ? 5.523  59.910  31.187  1.00 34.40  ? 249 PRO A CB    1 
ATOM   1025 C  CG    . PRO A 1 121 ? 6.306  60.793  32.072  1.00 36.07  ? 249 PRO A CG    1 
ATOM   1026 C  CD    . PRO A 1 121 ? 7.694  60.774  31.490  1.00 34.56  ? 249 PRO A CD    1 
ATOM   1027 N  N     . GLY A 1 122 ? 5.850  57.069  29.194  1.00 31.85  ? 250 GLY A N     1 
ATOM   1028 C  CA    . GLY A 1 122 ? 5.625  56.504  27.849  1.00 32.44  ? 250 GLY A CA    1 
ATOM   1029 C  C     . GLY A 1 122 ? 6.865  55.874  27.293  1.00 32.47  ? 250 GLY A C     1 
ATOM   1030 O  O     . GLY A 1 122 ? 6.803  55.136  26.295  1.00 33.38  ? 250 GLY A O     1 
ATOM   1031 N  N     . GLY A 1 123 ? 8.014  56.118  27.907  1.00 27.14  ? 251 GLY A N     1 
ATOM   1032 C  CA    . GLY A 1 123 ? 9.232  55.457  27.479  1.00 26.03  ? 251 GLY A CA    1 
ATOM   1033 C  C     . GLY A 1 123 ? 9.680  55.903  26.107  1.00 26.38  ? 251 GLY A C     1 
ATOM   1034 O  O     . GLY A 1 123 ? 9.488  57.065  25.688  1.00 24.83  ? 251 GLY A O     1 
ATOM   1035 N  N     . LEU A 1 124 ? 10.330 54.987  25.421  1.00 22.69  ? 252 LEU A N     1 
ATOM   1036 C  CA    . LEU A 1 124 ? 10.919 55.269  24.121  1.00 21.49  ? 252 LEU A CA    1 
ATOM   1037 C  C     . LEU A 1 124 ? 10.295 54.447  23.017  1.00 23.26  ? 252 LEU A C     1 
ATOM   1038 O  O     . LEU A 1 124 ? 9.777  53.398  23.270  1.00 24.66  ? 252 LEU A O     1 
ATOM   1039 C  CB    . LEU A 1 124 ? 12.463 55.013  24.161  1.00 19.53  ? 252 LEU A CB    1 
ATOM   1040 C  CG    . LEU A 1 124 ? 13.307 55.770  25.180  1.00 20.77  ? 252 LEU A CG    1 
ATOM   1041 C  CD1   . LEU A 1 124 ? 14.808 55.350  25.173  1.00 19.34  ? 252 LEU A CD1   1 
ATOM   1042 C  CD2   . LEU A 1 124 ? 13.221 57.288  25.004  1.00 21.88  ? 252 LEU A CD2   1 
ATOM   1043 N  N     . LYS A 1 125 ? 10.475 54.927  21.797  1.00 24.16  ? 253 LYS A N     1 
ATOM   1044 C  CA    . LYS A 1 125 ? 10.004 54.276  20.592  1.00 26.49  ? 253 LYS A CA    1 
ATOM   1045 C  C     . LYS A 1 125 ? 11.101 54.321  19.520  1.00 23.18  ? 253 LYS A C     1 
ATOM   1046 O  O     . LYS A 1 125 ? 12.081 55.046  19.648  1.00 21.27  ? 253 LYS A O     1 
ATOM   1047 C  CB    . LYS A 1 125 ? 8.792  55.052  20.067  1.00 32.31  ? 253 LYS A CB    1 
ATOM   1048 C  CG    . LYS A 1 125 ? 7.572  55.115  20.963  1.00 39.11  ? 253 LYS A CG    1 
ATOM   1049 C  CD    . LYS A 1 125 ? 6.929  53.754  21.153  1.00 47.60  ? 253 LYS A CD    1 
ATOM   1050 C  CE    . LYS A 1 125 ? 5.563  53.810  21.851  1.00 51.57  ? 253 LYS A CE    1 
ATOM   1051 N  NZ    . LYS A 1 125 ? 5.687  53.696  23.325  1.00 56.27  ? 253 LYS A NZ    1 
ATOM   1052 N  N     . GLU A 1 126 ? 10.936 53.512  18.468  1.00 22.27  ? 254 GLU A N     1 
ATOM   1053 C  CA    . GLU A 1 126 ? 11.922 53.481  17.400  1.00 22.10  ? 254 GLU A CA    1 
ATOM   1054 C  C     . GLU A 1 126 ? 12.248 54.876  16.858  1.00 22.59  ? 254 GLU A C     1 
ATOM   1055 O  O     . GLU A 1 126 ? 13.395 55.179  16.519  1.00 21.33  ? 254 GLU A O     1 
ATOM   1056 C  CB    . GLU A 1 126 ? 11.463 52.508  16.290  1.00 22.91  ? 254 GLU A CB    1 
ATOM   1057 C  CG    . GLU A 1 126 ? 12.325 52.533  15.043  1.00 23.78  ? 254 GLU A CG    1 
ATOM   1058 C  CD    . GLU A 1 126 ? 12.009 51.406  14.075  1.00 23.91  ? 254 GLU A CD    1 
ATOM   1059 O  OE1   . GLU A 1 126 ? 11.237 50.510  14.442  1.00 25.89  ? 254 GLU A OE1   1 
ATOM   1060 O  OE2   . GLU A 1 126 ? 12.518 51.424  12.931  1.00 26.28  ? 254 GLU A OE2   1 
ATOM   1061 N  N     . HIS A 1 127 ? 11.237 55.698  16.730  1.00 21.47  ? 255 HIS A N     1 
ATOM   1062 C  CA    . HIS A 1 127 ? 11.428 57.089  16.270  1.00 24.87  ? 255 HIS A CA    1 
ATOM   1063 C  C     . HIS A 1 127 ? 12.526 57.833  17.047  1.00 23.14  ? 255 HIS A C     1 
ATOM   1064 O  O     . HIS A 1 127 ? 13.223 58.666  16.478  1.00 26.31  ? 255 HIS A O     1 
ATOM   1065 C  CB    . HIS A 1 127 ? 10.056 57.793  16.384  1.00 29.53  ? 255 HIS A CB    1 
ATOM   1066 C  CG    . HIS A 1 127 ? 10.084 59.269  16.234  1.00 37.99  ? 255 HIS A CG    1 
ATOM   1067 N  ND1   . HIS A 1 127 ? 10.130 59.893  15.003  1.00 45.13  ? 255 HIS A ND1   1 
ATOM   1068 C  CD2   . HIS A 1 127 ? 9.992  60.265  17.165  1.00 42.88  ? 255 HIS A CD2   1 
ATOM   1069 C  CE1   . HIS A 1 127 ? 10.091 61.208  15.180  1.00 43.34  ? 255 HIS A CE1   1 
ATOM   1070 N  NE2   . HIS A 1 127 ? 10.007 61.459  16.480  1.00 39.17  ? 255 HIS A NE2   1 
ATOM   1071 N  N     . ASP A 1 128 ? 12.619 57.561  18.385  1.00 22.42  ? 256 ASP A N     1 
ATOM   1072 C  CA    . ASP A 1 128 ? 13.550 58.302  19.241  1.00 21.70  ? 256 ASP A CA    1 
ATOM   1073 C  C     . ASP A 1 128 ? 15.001 57.927  18.981  1.00 21.14  ? 256 ASP A C     1 
ATOM   1074 O  O     . ASP A 1 128 ? 15.922 58.658  19.332  1.00 21.72  ? 256 ASP A O     1 
ATOM   1075 C  CB    . ASP A 1 128 ? 13.179 58.026  20.718  1.00 23.29  ? 256 ASP A CB    1 
ATOM   1076 C  CG    . ASP A 1 128 ? 11.785 58.443  21.018  1.00 24.29  ? 256 ASP A CG    1 
ATOM   1077 O  OD1   . ASP A 1 128 ? 11.450 59.609  20.700  1.00 24.59  ? 256 ASP A OD1   1 
ATOM   1078 O  OD2   . ASP A 1 128 ? 11.054 57.674  21.612  1.00 25.25  ? 256 ASP A OD2   1 
ATOM   1079 N  N     . PHE A 1 129 ? 15.204 56.796  18.312  1.00 18.99  ? 257 PHE A N     1 
ATOM   1080 C  CA    . PHE A 1 129 ? 16.578 56.331  17.949  1.00 20.34  ? 257 PHE A CA    1 
ATOM   1081 C  C     . PHE A 1 129 ? 16.940 56.669  16.463  1.00 22.66  ? 257 PHE A C     1 
ATOM   1082 O  O     . PHE A 1 129 ? 17.980 56.255  15.948  1.00 28.68  ? 257 PHE A O     1 
ATOM   1083 C  CB    . PHE A 1 129 ? 16.695 54.858  18.185  1.00 19.89  ? 257 PHE A CB    1 
ATOM   1084 C  CG    . PHE A 1 129 ? 16.596 54.466  19.648  1.00 18.33  ? 257 PHE A CG    1 
ATOM   1085 C  CD1   . PHE A 1 129 ? 15.366 54.236  20.223  1.00 17.43  ? 257 PHE A CD1   1 
ATOM   1086 C  CD2   . PHE A 1 129 ? 17.703 54.332  20.418  1.00 17.41  ? 257 PHE A CD2   1 
ATOM   1087 C  CE1   . PHE A 1 129 ? 15.230 53.869  21.533  1.00 17.09  ? 257 PHE A CE1   1 
ATOM   1088 C  CE2   . PHE A 1 129 ? 17.569 53.934  21.738  1.00 17.40  ? 257 PHE A CE2   1 
ATOM   1089 C  CZ    . PHE A 1 129 ? 16.340 53.694  22.302  1.00 18.80  ? 257 PHE A CZ    1 
ATOM   1090 N  N     . ASN A 1 130 ? 16.078 57.417  15.818  1.00 23.31  ? 258 ASN A N     1 
ATOM   1091 C  CA    . ASN A 1 130 ? 16.368 58.043  14.530  1.00 24.07  ? 258 ASN A CA    1 
ATOM   1092 C  C     . ASN A 1 130 ? 16.845 59.474  14.772  1.00 26.82  ? 258 ASN A C     1 
ATOM   1093 O  O     . ASN A 1 130 ? 16.516 60.071  15.824  1.00 28.59  ? 258 ASN A O     1 
ATOM   1094 C  CB    . ASN A 1 130 ? 15.124 58.023  13.608  1.00 24.44  ? 258 ASN A CB    1 
ATOM   1095 C  CG    . ASN A 1 130 ? 14.916 56.683  12.894  1.00 23.18  ? 258 ASN A CG    1 
ATOM   1096 O  OD1   . ASN A 1 130 ? 15.086 56.604  11.664  1.00 26.30  ? 258 ASN A OD1   1 
ATOM   1097 N  ND2   . ASN A 1 130 ? 14.607 55.668  13.632  1.00 22.31  ? 258 ASN A ND2   1 
ATOM   1098 N  N     . PRO A 1 131 ? 17.603 60.043  13.828  1.00 29.67  ? 259 PRO A N     1 
ATOM   1099 C  CA    . PRO A 1 131 ? 18.015 61.452  13.944  1.00 31.63  ? 259 PRO A CA    1 
ATOM   1100 C  C     . PRO A 1 131 ? 16.809 62.348  14.134  1.00 34.38  ? 259 PRO A C     1 
ATOM   1101 O  O     . PRO A 1 131 ? 15.753 62.136  13.518  1.00 32.28  ? 259 PRO A O     1 
ATOM   1102 C  CB    . PRO A 1 131 ? 18.644 61.743  12.588  1.00 34.23  ? 259 PRO A CB    1 
ATOM   1103 C  CG    . PRO A 1 131 ? 19.158 60.440  12.131  1.00 34.78  ? 259 PRO A CG    1 
ATOM   1104 C  CD    . PRO A 1 131 ? 18.165 59.430  12.597  1.00 31.80  ? 259 PRO A CD    1 
ATOM   1105 N  N     . GLU A 1 132 ? 16.960 63.379  14.956  1.00 35.43  ? 260 GLU A N     1 
ATOM   1106 C  CA    . GLU A 1 132 ? 15.919 64.337  15.099  1.00 36.34  ? 260 GLU A CA    1 
ATOM   1107 C  C     . GLU A 1 132 ? 15.740 64.995  13.742  1.00 42.13  ? 260 GLU A C     1 
ATOM   1108 O  O     . GLU A 1 132 ? 16.744 65.295  13.061  1.00 42.14  ? 260 GLU A O     1 
ATOM   1109 C  CB    . GLU A 1 132 ? 16.372 65.404  16.117  1.00 41.21  ? 260 GLU A CB    1 
ATOM   1110 C  CG    . GLU A 1 132 ? 15.304 66.359  16.570  1.00 47.64  ? 260 GLU A CG    1 
ATOM   1111 C  CD    . GLU A 1 132 ? 14.142 65.656  17.208  1.00 49.26  ? 260 GLU A CD    1 
ATOM   1112 O  OE1   . GLU A 1 132 ? 14.377 64.675  17.963  1.00 50.23  ? 260 GLU A OE1   1 
ATOM   1113 O  OE2   . GLU A 1 132 ? 13.001 66.093  16.948  1.00 54.93  ? 260 GLU A OE2   1 
ATOM   1114 N  N     . SER A 1 133 ? 14.496 65.235  13.338  1.00 41.84  ? 261 SER A N     1 
ATOM   1115 C  CA    . SER A 1 133 ? 14.258 65.793  11.980  1.00 49.88  ? 261 SER A CA    1 
ATOM   1116 C  C     . SER A 1 133 ? 14.316 67.314  12.039  1.00 50.88  ? 261 SER A C     1 
ATOM   1117 O  O     . SER A 1 133 ? 14.226 67.874  13.138  1.00 46.07  ? 261 SER A O     1 
ATOM   1118 C  CB    . SER A 1 133 ? 12.903 65.345  11.459  1.00 52.02  ? 261 SER A CB    1 
ATOM   1119 O  OG    . SER A 1 133 ? 11.957 65.460  12.511  1.00 60.31  ? 261 SER A OG    1 
ATOM   1120 N  N     . GLY B 1 1   ? 29.448 67.995  -13.881 1.00 29.70  ? 129 GLY B N     1 
ATOM   1121 C  CA    . GLY B 1 1   ? 30.452 67.001  -13.483 1.00 29.20  ? 129 GLY B CA    1 
ATOM   1122 C  C     . GLY B 1 1   ? 30.186 66.437  -12.115 1.00 28.38  ? 129 GLY B C     1 
ATOM   1123 O  O     . GLY B 1 1   ? 29.357 66.993  -11.357 1.00 26.81  ? 129 GLY B O     1 
ATOM   1124 N  N     A SER B 1 2   ? 30.866 65.346  -11.760 0.50 26.39  ? 130 SER B N     1 
ATOM   1125 N  N     B SER B 1 2   ? 30.866 65.345  -11.774 0.50 26.13  ? 130 SER B N     1 
ATOM   1126 C  CA    A SER B 1 2   ? 30.545 64.626  -10.555 0.50 24.53  ? 130 SER B CA    1 
ATOM   1127 C  CA    B SER B 1 2   ? 30.586 64.617  -10.566 0.50 24.11  ? 130 SER B CA    1 
ATOM   1128 C  C     A SER B 1 2   ? 30.587 65.455  -9.270  0.50 23.83  ? 130 SER B C     1 
ATOM   1129 C  C     B SER B 1 2   ? 30.599 65.450  -9.266  0.50 23.60  ? 130 SER B C     1 
ATOM   1130 O  O     A SER B 1 2   ? 29.749 65.271  -8.406  0.50 23.21  ? 130 SER B O     1 
ATOM   1131 O  O     B SER B 1 2   ? 29.766 65.265  -8.387  0.50 22.94  ? 130 SER B O     1 
ATOM   1132 C  CB    A SER B 1 2   ? 31.475 63.408  -10.344 0.50 24.49  ? 130 SER B CB    1 
ATOM   1133 C  CB    B SER B 1 2   ? 31.620 63.491  -10.403 0.50 23.91  ? 130 SER B CB    1 
ATOM   1134 O  OG    A SER B 1 2   ? 32.851 63.744  -10.357 0.50 25.52  ? 130 SER B OG    1 
ATOM   1135 O  OG    B SER B 1 2   ? 31.750 62.746  -11.605 0.50 23.81  ? 130 SER B OG    1 
ATOM   1136 N  N     . LYS B 1 3   ? 31.575 66.328  -9.154  1.00 23.98  ? 131 LYS B N     1 
ATOM   1137 C  CA    . LYS B 1 3   ? 31.735 67.140  -7.924  1.00 24.44  ? 131 LYS B CA    1 
ATOM   1138 C  C     . LYS B 1 3   ? 30.517 68.011  -7.679  1.00 26.00  ? 131 LYS B C     1 
ATOM   1139 O  O     . LYS B 1 3   ? 30.146 68.227  -6.549  1.00 24.58  ? 131 LYS B O     1 
ATOM   1140 C  CB    . LYS B 1 3   ? 33.006 67.967  -7.945  1.00 24.35  ? 131 LYS B CB    1 
ATOM   1141 C  CG    . LYS B 1 3   ? 34.259 67.098  -7.796  1.00 23.74  ? 131 LYS B CG    1 
ATOM   1142 C  CD    . LYS B 1 3   ? 35.525 67.919  -7.722  1.00 25.14  ? 131 LYS B CD    1 
ATOM   1143 C  CE    . LYS B 1 3   ? 36.786 67.086  -7.613  1.00 25.22  ? 131 LYS B CE    1 
ATOM   1144 N  NZ    . LYS B 1 3   ? 37.996 67.922  -7.500  1.00 27.42  ? 131 LYS B NZ    1 
ATOM   1145 N  N     . VAL B 1 4   ? 29.921 68.511  -8.752  1.00 24.92  ? 132 VAL B N     1 
ATOM   1146 C  CA    . VAL B 1 4   ? 28.731 69.371  -8.668  1.00 25.79  ? 132 VAL B CA    1 
ATOM   1147 C  C     . VAL B 1 4   ? 27.459 68.565  -8.546  1.00 25.95  ? 132 VAL B C     1 
ATOM   1148 O  O     . VAL B 1 4   ? 26.531 68.931  -7.809  1.00 26.92  ? 132 VAL B O     1 
ATOM   1149 C  CB    . VAL B 1 4   ? 28.662 70.248  -9.949  1.00 26.53  ? 132 VAL B CB    1 
ATOM   1150 C  CG1   . VAL B 1 4   ? 27.304 70.933  -10.177 1.00 26.34  ? 132 VAL B CG1   1 
ATOM   1151 C  CG2   . VAL B 1 4   ? 29.758 71.285  -9.919  1.00 27.43  ? 132 VAL B CG2   1 
ATOM   1152 N  N     . GLU B 1 5   ? 27.387 67.457  -9.285  1.00 26.65  ? 133 GLU B N     1 
ATOM   1153 C  CA    . GLU B 1 5   ? 26.132 66.686  -9.414  1.00 26.22  ? 133 GLU B CA    1 
ATOM   1154 C  C     . GLU B 1 5   ? 25.919 65.525  -8.511  1.00 24.83  ? 133 GLU B C     1 
ATOM   1155 O  O     . GLU B 1 5   ? 24.782 65.177  -8.271  1.00 25.13  ? 133 GLU B O     1 
ATOM   1156 C  CB    . GLU B 1 5   ? 26.031 66.144  -10.854 1.00 29.29  ? 133 GLU B CB    1 
ATOM   1157 C  CG    . GLU B 1 5   ? 26.097 67.226  -11.919 1.00 32.21  ? 133 GLU B CG    1 
ATOM   1158 C  CD    . GLU B 1 5   ? 26.139 66.628  -13.328 1.00 39.16  ? 133 GLU B CD    1 
ATOM   1159 O  OE1   . GLU B 1 5   ? 25.108 66.044  -13.716 1.00 43.69  ? 133 GLU B OE1   1 
ATOM   1160 O  OE2   . GLU B 1 5   ? 27.205 66.708  -14.004 1.00 40.29  ? 133 GLU B OE2   1 
ATOM   1161 N  N     . ASP B 1 6   ? 26.987 64.896  -8.037  1.00 21.99  ? 134 ASP B N     1 
ATOM   1162 C  CA    . ASP B 1 6   ? 26.811 63.634  -7.322  1.00 23.91  ? 134 ASP B CA    1 
ATOM   1163 C  C     . ASP B 1 6   ? 26.676 63.803  -5.802  1.00 24.16  ? 134 ASP B C     1 
ATOM   1164 O  O     . ASP B 1 6   ? 27.389 64.602  -5.199  1.00 24.43  ? 134 ASP B O     1 
ATOM   1165 C  CB    . ASP B 1 6   ? 28.032 62.784  -7.571  1.00 24.52  ? 134 ASP B CB    1 
ATOM   1166 C  CG    . ASP B 1 6   ? 28.114 62.243  -9.009  1.00 28.66  ? 134 ASP B CG    1 
ATOM   1167 O  OD1   . ASP B 1 6   ? 27.127 62.302  -9.778  1.00 28.23  ? 134 ASP B OD1   1 
ATOM   1168 O  OD2   . ASP B 1 6   ? 29.201 61.705  -9.304  1.00 28.59  ? 134 ASP B OD2   1 
ATOM   1169 N  N     . PRO B 1 7   ? 25.801 63.002  -5.161  1.00 24.17  ? 135 PRO B N     1 
ATOM   1170 C  CA    . PRO B 1 7   ? 25.924 62.841  -3.727  1.00 25.59  ? 135 PRO B CA    1 
ATOM   1171 C  C     . PRO B 1 7   ? 27.298 62.336  -3.298  1.00 26.01  ? 135 PRO B C     1 
ATOM   1172 O  O     . PRO B 1 7   ? 27.920 61.513  -4.053  1.00 25.22  ? 135 PRO B O     1 
ATOM   1173 C  CB    . PRO B 1 7   ? 24.859 61.766  -3.397  1.00 24.21  ? 135 PRO B CB    1 
ATOM   1174 C  CG    . PRO B 1 7   ? 23.867 61.899  -4.439  1.00 24.98  ? 135 PRO B CG    1 
ATOM   1175 C  CD    . PRO B 1 7   ? 24.646 62.246  -5.684  1.00 24.27  ? 135 PRO B CD    1 
ATOM   1176 N  N     . LYS B 1 8   ? 27.730 62.758  -2.108  1.00 21.81  ? 136 LYS B N     1 
ATOM   1177 C  CA    . LYS B 1 8   ? 29.050 62.407  -1.613  1.00 21.62  ? 136 LYS B CA    1 
ATOM   1178 C  C     . LYS B 1 8   ? 28.934 61.396  -0.410  1.00 22.97  ? 136 LYS B C     1 
ATOM   1179 O  O     . LYS B 1 8   ? 29.945 60.980  0.156   1.00 23.40  ? 136 LYS B O     1 
ATOM   1180 C  CB    . LYS B 1 8   ? 29.861 63.624  -1.174  1.00 23.79  ? 136 LYS B CB    1 
ATOM   1181 C  CG    . LYS B 1 8   ? 30.014 64.720  -2.221  1.00 22.54  ? 136 LYS B CG    1 
ATOM   1182 C  CD    . LYS B 1 8   ? 30.556 64.215  -3.567  1.00 22.94  ? 136 LYS B CD    1 
ATOM   1183 C  CE    . LYS B 1 8   ? 30.842 65.318  -4.560  1.00 25.23  ? 136 LYS B CE    1 
ATOM   1184 N  NZ    . LYS B 1 8   ? 29.676 66.204  -4.741  1.00 25.83  ? 136 LYS B NZ    1 
ATOM   1185 N  N     . ASP B 1 9   ? 27.701 61.101  -0.010  1.00 21.11  ? 137 ASP B N     1 
ATOM   1186 C  CA    . ASP B 1 9   ? 27.412 60.308  1.128   1.00 22.81  ? 137 ASP B CA    1 
ATOM   1187 C  C     . ASP B 1 9   ? 25.931 59.877  1.020   1.00 23.07  ? 137 ASP B C     1 
ATOM   1188 O  O     . ASP B 1 9   ? 25.151 60.397  0.212   1.00 20.87  ? 137 ASP B O     1 
ATOM   1189 C  CB    . ASP B 1 9   ? 27.660 61.067  2.440   1.00 22.13  ? 137 ASP B CB    1 
ATOM   1190 C  CG    . ASP B 1 9   ? 28.006 60.151  3.618   1.00 23.38  ? 137 ASP B CG    1 
ATOM   1191 O  OD1   . ASP B 1 9   ? 27.697 58.938  3.585   1.00 25.55  ? 137 ASP B OD1   1 
ATOM   1192 O  OD2   . ASP B 1 9   ? 28.579 60.683  4.564   1.00 24.19  ? 137 ASP B OD2   1 
ATOM   1193 N  N     . PHE B 1 10  ? 25.556 58.940  1.908   1.00 21.17  ? 138 PHE B N     1 
ATOM   1194 C  CA    . PHE B 1 10  ? 24.150 58.655  2.109   1.00 19.71  ? 138 PHE B CA    1 
ATOM   1195 C  C     . PHE B 1 10  ? 23.358 59.861  2.610   1.00 22.57  ? 138 PHE B C     1 
ATOM   1196 O  O     . PHE B 1 10  ? 23.909 60.844  3.121   1.00 23.99  ? 138 PHE B O     1 
ATOM   1197 C  CB    . PHE B 1 10  ? 23.980 57.491  3.109   1.00 20.90  ? 138 PHE B CB    1 
ATOM   1198 C  CG    . PHE B 1 10  ? 24.292 56.164  2.529   1.00 17.35  ? 138 PHE B CG    1 
ATOM   1199 C  CD1   . PHE B 1 10  ? 25.606 55.741  2.351   1.00 16.41  ? 138 PHE B CD1   1 
ATOM   1200 C  CD2   . PHE B 1 10  ? 23.281 55.317  2.265   1.00 17.28  ? 138 PHE B CD2   1 
ATOM   1201 C  CE1   . PHE B 1 10  ? 25.879 54.455  1.836   1.00 17.84  ? 138 PHE B CE1   1 
ATOM   1202 C  CE2   . PHE B 1 10  ? 23.538 54.038  1.805   1.00 16.69  ? 138 PHE B CE2   1 
ATOM   1203 C  CZ    . PHE B 1 10  ? 24.843 53.634  1.573   1.00 16.80  ? 138 PHE B CZ    1 
ATOM   1204 N  N     . PRO B 1 11  ? 22.032 59.805  2.444   1.00 21.71  ? 139 PRO B N     1 
ATOM   1205 C  CA    . PRO B 1 11  ? 21.201 60.809  2.962   1.00 21.12  ? 139 PRO B CA    1 
ATOM   1206 C  C     . PRO B 1 11  ? 21.338 60.919  4.452   1.00 23.60  ? 139 PRO B C     1 
ATOM   1207 O  O     . PRO B 1 11  ? 21.440 59.900  5.141   1.00 20.08  ? 139 PRO B O     1 
ATOM   1208 C  CB    . PRO B 1 11  ? 19.780 60.320  2.615   1.00 22.66  ? 139 PRO B CB    1 
ATOM   1209 C  CG    . PRO B 1 11  ? 19.965 59.424  1.417   1.00 23.63  ? 139 PRO B CG    1 
ATOM   1210 C  CD    . PRO B 1 11  ? 21.309 58.821  1.623   1.00 22.44  ? 139 PRO B CD    1 
ATOM   1211 N  N     . SER B 1 12  ? 21.256 62.155  4.924   1.00 23.04  ? 140 SER B N     1 
ATOM   1212 C  CA    A SER B 1 12  ? 21.589 62.460  6.316   0.50 26.35  ? 140 SER B CA    1 
ATOM   1213 C  CA    B SER B 1 12  ? 21.572 62.466  6.323   0.50 25.95  ? 140 SER B CA    1 
ATOM   1214 C  C     . SER B 1 12  ? 20.729 61.696  7.296   1.00 25.41  ? 140 SER B C     1 
ATOM   1215 O  O     . SER B 1 12  ? 21.171 61.331  8.363   1.00 26.13  ? 140 SER B O     1 
ATOM   1216 C  CB    A SER B 1 12  ? 21.460 63.969  6.565   0.50 27.50  ? 140 SER B CB    1 
ATOM   1217 C  CB    B SER B 1 12  ? 21.454 63.976  6.588   0.50 26.78  ? 140 SER B CB    1 
ATOM   1218 O  OG    A SER B 1 12  ? 20.135 64.399  6.319   0.50 28.38  ? 140 SER B OG    1 
ATOM   1219 O  OG    B SER B 1 12  ? 22.196 64.723  5.635   0.50 26.48  ? 140 SER B OG    1 
ATOM   1220 N  N     . GLU B 1 13  ? 19.490 61.431  6.947   1.00 27.84  ? 141 GLU B N     1 
ATOM   1221 C  CA    . GLU B 1 13  ? 18.598 60.656  7.795   1.00 29.51  ? 141 GLU B CA    1 
ATOM   1222 C  C     . GLU B 1 13  ? 19.137 59.232  8.214   1.00 24.88  ? 141 GLU B C     1 
ATOM   1223 O  O     . GLU B 1 13  ? 18.664 58.647  9.211   1.00 26.56  ? 141 GLU B O     1 
ATOM   1224 C  CB    . GLU B 1 13  ? 17.335 60.297  6.993   1.00 33.65  ? 141 GLU B CB    1 
ATOM   1225 C  CG    . GLU B 1 13  ? 16.387 61.397  6.658   1.00 35.32  ? 141 GLU B CG    1 
ATOM   1226 C  CD    . GLU B 1 13  ? 16.669 62.078  5.317   1.00 40.54  ? 141 GLU B CD    1 
ATOM   1227 O  OE1   . GLU B 1 13  ? 17.859 62.116  4.847   1.00 32.84  ? 141 GLU B OE1   1 
ATOM   1228 O  OE2   . GLU B 1 13  ? 15.673 62.630  4.804   1.00 42.84  ? 141 GLU B OE2   1 
ATOM   1229 N  N     . LEU B 1 14  ? 20.078 58.705  7.447   1.00 22.48  ? 142 LEU B N     1 
ATOM   1230 C  CA    . LEU B 1 14  ? 20.588 57.364  7.595   1.00 20.52  ? 142 LEU B CA    1 
ATOM   1231 C  C     . LEU B 1 14  ? 22.007 57.287  8.166   1.00 19.96  ? 142 LEU B C     1 
ATOM   1232 O  O     . LEU B 1 14  ? 22.460 56.175  8.495   1.00 19.13  ? 142 LEU B O     1 
ATOM   1233 C  CB    . LEU B 1 14  ? 20.572 56.613  6.260   1.00 20.16  ? 142 LEU B CB    1 
ATOM   1234 C  CG    . LEU B 1 14  ? 19.204 56.602  5.577   1.00 21.14  ? 142 LEU B CG    1 
ATOM   1235 C  CD1   . LEU B 1 14  ? 19.327 55.971  4.183   1.00 20.55  ? 142 LEU B CD1   1 
ATOM   1236 C  CD2   . LEU B 1 14  ? 18.115 55.915  6.321   1.00 19.90  ? 142 LEU B CD2   1 
ATOM   1237 N  N     . LEU B 1 15  ? 22.686 58.408  8.269   1.00 20.45  ? 143 LEU B N     1 
ATOM   1238 C  CA    . LEU B 1 15  ? 24.130 58.395  8.587   1.00 20.58  ? 143 LEU B CA    1 
ATOM   1239 C  C     . LEU B 1 15  ? 24.455 57.761  9.967   1.00 22.93  ? 143 LEU B C     1 
ATOM   1240 O  O     . LEU B 1 15  ? 25.542 57.172  10.142  1.00 23.43  ? 143 LEU B O     1 
ATOM   1241 C  CB    . LEU B 1 15  ? 24.710 59.811  8.489   1.00 23.62  ? 143 LEU B CB    1 
ATOM   1242 C  CG    . LEU B 1 15  ? 24.773 60.395  7.069   1.00 24.87  ? 143 LEU B CG    1 
ATOM   1243 C  CD1   . LEU B 1 15  ? 25.192 61.849  7.070   1.00 26.97  ? 143 LEU B CD1   1 
ATOM   1244 C  CD2   . LEU B 1 15  ? 25.645 59.596  6.107   1.00 24.95  ? 143 LEU B CD2   1 
ATOM   1245 N  N     . SER B 1 16  ? 23.560 57.891  10.928  1.00 22.29  ? 144 SER B N     1 
ATOM   1246 C  CA    . SER B 1 16  ? 23.856 57.384  12.311  1.00 21.42  ? 144 SER B CA    1 
ATOM   1247 C  C     . SER B 1 16  ? 23.801 55.873  12.352  1.00 21.73  ? 144 SER B C     1 
ATOM   1248 O  O     . SER B 1 16  ? 24.190 55.259  13.364  1.00 21.71  ? 144 SER B O     1 
ATOM   1249 C  CB    . SER B 1 16  ? 22.930 57.977  13.362  1.00 22.28  ? 144 SER B CB    1 
ATOM   1250 O  OG    . SER B 1 16  ? 21.591 57.506  13.317  1.00 22.54  ? 144 SER B OG    1 
ATOM   1251 N  N     . PHE B 1 17  ? 23.301 55.275  11.276  1.00 20.77  ? 145 PHE B N     1 
ATOM   1252 C  CA    . PHE B 1 17  ? 23.191 53.821  11.221  1.00 19.33  ? 145 PHE B CA    1 
ATOM   1253 C  C     . PHE B 1 17  ? 24.372 53.112  10.588  1.00 20.46  ? 145 PHE B C     1 
ATOM   1254 O  O     . PHE B 1 17  ? 24.478 51.862  10.641  1.00 20.94  ? 145 PHE B O     1 
ATOM   1255 C  CB    . PHE B 1 17  ? 21.911 53.350  10.533  1.00 20.11  ? 145 PHE B CB    1 
ATOM   1256 C  CG    . PHE B 1 17  ? 20.655 54.012  11.006  1.00 21.70  ? 145 PHE B CG    1 
ATOM   1257 C  CD1   . PHE B 1 17  ? 20.408 54.243  12.367  1.00 23.70  ? 145 PHE B CD1   1 
ATOM   1258 C  CD2   . PHE B 1 17  ? 19.648 54.321  10.111  1.00 20.04  ? 145 PHE B CD2   1 
ATOM   1259 C  CE1   . PHE B 1 17  ? 19.222 54.853  12.776  1.00 22.61  ? 145 PHE B CE1   1 
ATOM   1260 C  CE2   . PHE B 1 17  ? 18.456 54.907  10.522  1.00 23.27  ? 145 PHE B CE2   1 
ATOM   1261 C  CZ    . PHE B 1 17  ? 18.256 55.175  11.871  1.00 24.44  ? 145 PHE B CZ    1 
ATOM   1262 N  N     . LEU B 1 18  ? 25.281 53.888  10.032  1.00 20.04  ? 146 LEU B N     1 
ATOM   1263 C  CA    . LEU B 1 18  ? 26.313 53.408  9.201   1.00 19.23  ? 146 LEU B CA    1 
ATOM   1264 C  C     . LEU B 1 18  ? 27.678 53.579  9.844   1.00 19.52  ? 146 LEU B C     1 
ATOM   1265 O  O     . LEU B 1 18  ? 27.912 54.454  10.718  1.00 23.86  ? 146 LEU B O     1 
ATOM   1266 C  CB    . LEU B 1 18  ? 26.328 54.232  7.881   1.00 17.57  ? 146 LEU B CB    1 
ATOM   1267 C  CG    . LEU B 1 18  ? 25.017 54.197  7.068   1.00 18.41  ? 146 LEU B CG    1 
ATOM   1268 C  CD1   . LEU B 1 18  ? 25.135 55.122  5.844   1.00 20.96  ? 146 LEU B CD1   1 
ATOM   1269 C  CD2   . LEU B 1 18  ? 24.717 52.794  6.616   1.00 22.06  ? 146 LEU B CD2   1 
ATOM   1270 N  N     . SER B 1 19  ? 28.595 52.734  9.406   1.00 19.76  ? 147 SER B N     1 
ATOM   1271 C  CA    . SER B 1 19  ? 30.012 52.928  9.635   1.00 21.24  ? 147 SER B CA    1 
ATOM   1272 C  C     . SER B 1 19  ? 30.601 53.801  8.566   1.00 24.35  ? 147 SER B C     1 
ATOM   1273 O  O     . SER B 1 19  ? 30.402 53.485  7.386   1.00 20.94  ? 147 SER B O     1 
ATOM   1274 C  CB    . SER B 1 19  ? 30.761 51.621  9.642   1.00 23.37  ? 147 SER B CB    1 
ATOM   1275 O  OG    . SER B 1 19  ? 32.166 51.907  9.820   1.00 24.95  ? 147 SER B OG    1 
ATOM   1276 N  N     . HIS B 1 20  ? 31.277 54.888  8.978   1.00 22.17  ? 148 HIS B N     1 
ATOM   1277 C  CA    . HIS B 1 20  ? 31.990 55.765  8.104   1.00 26.47  ? 148 HIS B CA    1 
ATOM   1278 C  C     . HIS B 1 20  ? 33.454 55.376  7.860   1.00 26.81  ? 148 HIS B C     1 
ATOM   1279 O  O     . HIS B 1 20  ? 34.093 55.960  6.977   1.00 27.80  ? 148 HIS B O     1 
ATOM   1280 C  CB    . HIS B 1 20  ? 31.806 57.227  8.577   1.00 26.29  ? 148 HIS B CB    1 
ATOM   1281 C  CG    . HIS B 1 20  ? 30.363 57.518  8.831   1.00 28.65  ? 148 HIS B CG    1 
ATOM   1282 N  ND1   . HIS B 1 20  ? 29.445 57.508  7.817   1.00 25.55  ? 148 HIS B ND1   1 
ATOM   1283 C  CD2   . HIS B 1 20  ? 29.653 57.683  9.979   1.00 29.52  ? 148 HIS B CD2   1 
ATOM   1284 C  CE1   . HIS B 1 20  ? 28.232 57.665  8.305   1.00 27.28  ? 148 HIS B CE1   1 
ATOM   1285 N  NE2   . HIS B 1 20  ? 28.326 57.740  9.623   1.00 27.86  ? 148 HIS B NE2   1 
ATOM   1286 N  N     . ALA B 1 21  ? 33.930 54.319  8.479   1.00 24.71  ? 149 ALA B N     1 
ATOM   1287 C  CA    . ALA B 1 21  ? 35.359 53.927  8.350   1.00 26.52  ? 149 ALA B CA    1 
ATOM   1288 C  C     . ALA B 1 21  ? 35.464 52.942  7.179   1.00 26.68  ? 149 ALA B C     1 
ATOM   1289 O  O     . ALA B 1 21  ? 35.651 51.751  7.347   1.00 24.93  ? 149 ALA B O     1 
ATOM   1290 C  CB    . ALA B 1 21  ? 35.816 53.267  9.634   1.00 27.60  ? 149 ALA B CB    1 
ATOM   1291 N  N     . VAL B 1 22  ? 35.293 53.484  5.976   1.00 26.14  ? 150 VAL B N     1 
ATOM   1292 C  CA    . VAL B 1 22  ? 35.193 52.666  4.746   1.00 26.53  ? 150 VAL B CA    1 
ATOM   1293 C  C     . VAL B 1 22  ? 36.445 51.857  4.390   1.00 26.76  ? 150 VAL B C     1 
ATOM   1294 O  O     . VAL B 1 22  ? 36.315 50.857  3.676   1.00 24.94  ? 150 VAL B O     1 
ATOM   1295 C  CB    . VAL B 1 22  ? 34.753 53.507  3.540   1.00 25.92  ? 150 VAL B CB    1 
ATOM   1296 C  CG1   . VAL B 1 22  ? 33.369 54.104  3.760   1.00 25.27  ? 150 VAL B CG1   1 
ATOM   1297 C  CG2   . VAL B 1 22  ? 35.806 54.510  3.154   1.00 28.59  ? 150 VAL B CG2   1 
ATOM   1298 N  N     . PHE B 1 23  ? 37.629 52.266  4.884   1.00 27.69  ? 151 PHE B N     1 
ATOM   1299 C  CA    . PHE B 1 23  ? 38.888 51.504  4.674   1.00 31.82  ? 151 PHE B CA    1 
ATOM   1300 C  C     . PHE B 1 23  ? 39.258 50.518  5.800   1.00 31.77  ? 151 PHE B C     1 
ATOM   1301 O  O     . PHE B 1 23  ? 40.342 49.929  5.796   1.00 31.91  ? 151 PHE B O     1 
ATOM   1302 C  CB    . PHE B 1 23  ? 40.031 52.473  4.443   1.00 34.12  ? 151 PHE B CB    1 
ATOM   1303 C  CG    . PHE B 1 23  ? 39.762 53.467  3.368   1.00 36.24  ? 151 PHE B CG    1 
ATOM   1304 C  CD1   . PHE B 1 23  ? 39.449 53.037  2.075   1.00 37.78  ? 151 PHE B CD1   1 
ATOM   1305 C  CD2   . PHE B 1 23  ? 39.770 54.826  3.637   1.00 38.73  ? 151 PHE B CD2   1 
ATOM   1306 C  CE1   . PHE B 1 23  ? 39.194 53.953  1.072   1.00 43.32  ? 151 PHE B CE1   1 
ATOM   1307 C  CE2   . PHE B 1 23  ? 39.492 55.747  2.636   1.00 42.80  ? 151 PHE B CE2   1 
ATOM   1308 C  CZ    . PHE B 1 23  ? 39.221 55.314  1.354   1.00 41.10  ? 151 PHE B CZ    1 
ATOM   1309 N  N     . SER B 1 24  ? 38.363 50.316  6.754   1.00 29.28  ? 152 SER B N     1 
ATOM   1310 C  CA    . SER B 1 24  ? 38.654 49.567  7.965   1.00 31.47  ? 152 SER B CA    1 
ATOM   1311 C  C     . SER B 1 24  ? 38.858 48.086  7.643   1.00 31.51  ? 152 SER B C     1 
ATOM   1312 O  O     . SER B 1 24  ? 38.268 47.547  6.701   1.00 30.81  ? 152 SER B O     1 
ATOM   1313 C  CB    . SER B 1 24  ? 37.469 49.707  8.959   1.00 31.48  ? 152 SER B CB    1 
ATOM   1314 O  OG    . SER B 1 24  ? 37.462 48.762  10.013  1.00 35.68  ? 152 SER B OG    1 
ATOM   1315 N  N     . ASN B 1 25  ? 39.747 47.457  8.398   1.00 29.72  ? 153 ASN B N     1 
ATOM   1316 C  CA    . ASN B 1 25  ? 39.892 45.985  8.363   1.00 31.24  ? 153 ASN B CA    1 
ATOM   1317 C  C     . ASN B 1 25  ? 38.753 45.258  9.101   1.00 31.29  ? 153 ASN B C     1 
ATOM   1318 O  O     . ASN B 1 25  ? 38.771 44.048  9.167   1.00 29.83  ? 153 ASN B O     1 
ATOM   1319 C  CB    . ASN B 1 25  ? 41.307 45.564  8.828   1.00 31.86  ? 153 ASN B CB    1 
ATOM   1320 C  CG    . ASN B 1 25  ? 41.520 45.740  10.317  1.00 32.50  ? 153 ASN B CG    1 
ATOM   1321 O  OD1   . ASN B 1 25  ? 40.568 45.961  11.085  1.00 30.88  ? 153 ASN B OD1   1 
ATOM   1322 N  ND2   . ASN B 1 25  ? 42.783 45.705  10.717  1.00 33.06  ? 153 ASN B ND2   1 
ATOM   1323 N  N     . ARG B 1 26  ? 37.737 45.957  9.640   1.00 29.78  ? 154 ARG B N     1 
ATOM   1324 C  CA    . ARG B 1 26  ? 36.676 45.256  10.385  1.00 34.64  ? 154 ARG B CA    1 
ATOM   1325 C  C     . ARG B 1 26  ? 35.650 44.595  9.484   1.00 31.20  ? 154 ARG B C     1 
ATOM   1326 O  O     . ARG B 1 26  ? 35.093 45.244  8.641   1.00 36.56  ? 154 ARG B O     1 
ATOM   1327 C  CB    . ARG B 1 26  ? 35.962 46.166  11.399  1.00 39.84  ? 154 ARG B CB    1 
ATOM   1328 C  CG    . ARG B 1 26  ? 34.818 45.477  12.174  1.00 47.37  ? 154 ARG B CG    1 
ATOM   1329 C  CD    . ARG B 1 26  ? 34.291 46.318  13.355  1.00 52.47  ? 154 ARG B CD    1 
ATOM   1330 N  NE    . ARG B 1 26  ? 33.519 47.506  12.950  1.00 54.20  ? 154 ARG B NE    1 
ATOM   1331 C  CZ    . ARG B 1 26  ? 32.172 47.627  12.948  1.00 46.27  ? 154 ARG B CZ    1 
ATOM   1332 N  NH1   . ARG B 1 26  ? 31.378 46.638  13.348  1.00 39.66  ? 154 ARG B NH1   1 
ATOM   1333 N  NH2   . ARG B 1 26  ? 31.617 48.786  12.556  1.00 36.64  ? 154 ARG B NH2   1 
ATOM   1334 N  N     . THR B 1 27  ? 35.411 43.290  9.633   1.00 26.96  ? 155 THR B N     1 
ATOM   1335 C  CA    . THR B 1 27  ? 34.453 42.706  8.717   1.00 26.05  ? 155 THR B CA    1 
ATOM   1336 C  C     . THR B 1 27  ? 33.049 42.788  9.274   1.00 25.01  ? 155 THR B C     1 
ATOM   1337 O  O     . THR B 1 27  ? 32.817 42.850  10.515  1.00 25.07  ? 155 THR B O     1 
ATOM   1338 C  CB    . THR B 1 27  ? 34.800 41.275  8.361   1.00 26.45  ? 155 THR B CB    1 
ATOM   1339 O  OG1   . THR B 1 27  ? 34.672 40.443  9.531   1.00 28.92  ? 155 THR B OG1   1 
ATOM   1340 C  CG2   . THR B 1 27  ? 36.260 41.190  7.815   1.00 27.49  ? 155 THR B CG2   1 
ATOM   1341 N  N     . LEU B 1 28  ? 32.091 42.726  8.368   1.00 23.69  ? 156 LEU B N     1 
ATOM   1342 C  CA    . LEU B 1 28  ? 30.675 42.929  8.672   1.00 24.07  ? 156 LEU B CA    1 
ATOM   1343 C  C     . LEU B 1 28  ? 29.854 42.032  7.803   1.00 20.75  ? 156 LEU B C     1 
ATOM   1344 O  O     . LEU B 1 28  ? 30.344 41.430  6.874   1.00 21.85  ? 156 LEU B O     1 
ATOM   1345 C  CB    . LEU B 1 28  ? 30.241 44.400  8.377   1.00 25.44  ? 156 LEU B CB    1 
ATOM   1346 C  CG    . LEU B 1 28  ? 30.940 45.498  9.122   1.00 34.05  ? 156 LEU B CG    1 
ATOM   1347 C  CD1   . LEU B 1 28  ? 30.527 46.832  8.602   1.00 40.95  ? 156 LEU B CD1   1 
ATOM   1348 C  CD2   . LEU B 1 28  ? 30.565 45.392  10.569  1.00 35.43  ? 156 LEU B CD2   1 
ATOM   1349 N  N     . ALA B 1 29  ? 28.567 41.966  8.061   1.00 21.59  ? 157 ALA B N     1 
ATOM   1350 C  CA    . ALA B 1 29  ? 27.676 41.142  7.225   1.00 19.66  ? 157 ALA B CA    1 
ATOM   1351 C  C     . ALA B 1 29  ? 26.428 41.887  6.893   1.00 20.87  ? 157 ALA B C     1 
ATOM   1352 O  O     . ALA B 1 29  ? 25.442 41.287  6.542   1.00 19.84  ? 157 ALA B O     1 
ATOM   1353 C  CB    . ALA B 1 29  ? 27.325 39.870  8.024   1.00 21.30  ? 157 ALA B CB    1 
ATOM   1354 N  N     . CYS B 1 30  ? 26.480 43.231  6.938   1.00 19.52  ? 158 CYS B N     1 
ATOM   1355 C  CA    . CYS B 1 30  ? 25.330 44.034  6.575   1.00 20.54  ? 158 CYS B CA    1 
ATOM   1356 C  C     . CYS B 1 30  ? 25.881 45.284  5.926   1.00 18.88  ? 158 CYS B C     1 
ATOM   1357 O  O     . CYS B 1 30  ? 26.770 45.950  6.498   1.00 18.73  ? 158 CYS B O     1 
ATOM   1358 C  CB    . CYS B 1 30  ? 24.494 44.463  7.772   1.00 22.43  ? 158 CYS B CB    1 
ATOM   1359 S  SG    . CYS B 1 30  ? 22.989 45.319  7.224   1.00 22.01  ? 158 CYS B SG    1 
ATOM   1360 N  N     . PHE B 1 31  ? 25.434 45.582  4.726   1.00 20.22  ? 159 PHE B N     1 
ATOM   1361 C  CA    . PHE B 1 31  ? 25.972 46.671  3.909   1.00 19.46  ? 159 PHE B CA    1 
ATOM   1362 C  C     . PHE B 1 31  ? 24.843 47.428  3.204   1.00 18.48  ? 159 PHE B C     1 
ATOM   1363 O  O     . PHE B 1 31  ? 23.764 46.909  3.013   1.00 17.54  ? 159 PHE B O     1 
ATOM   1364 C  CB    . PHE B 1 31  ? 26.950 46.122  2.861   1.00 20.69  ? 159 PHE B CB    1 
ATOM   1365 C  CG    . PHE B 1 31  ? 28.026 45.183  3.431   1.00 19.91  ? 159 PHE B CG    1 
ATOM   1366 C  CD1   . PHE B 1 31  ? 27.824 43.793  3.554   1.00 20.34  ? 159 PHE B CD1   1 
ATOM   1367 C  CD2   . PHE B 1 31  ? 29.216 45.702  3.820   1.00 18.54  ? 159 PHE B CD2   1 
ATOM   1368 C  CE1   . PHE B 1 31  ? 28.826 43.020  4.028   1.00 20.35  ? 159 PHE B CE1   1 
ATOM   1369 C  CE2   . PHE B 1 31  ? 30.235 44.937  4.295   1.00 19.84  ? 159 PHE B CE2   1 
ATOM   1370 C  CZ    . PHE B 1 31  ? 30.039 43.589  4.415   1.00 19.49  ? 159 PHE B CZ    1 
ATOM   1371 N  N     . ALA B 1 32  ? 25.131 48.682  2.844   1.00 18.36  ? 160 ALA B N     1 
ATOM   1372 C  CA    . ALA B 1 32  ? 24.232 49.482  2.064   1.00 19.09  ? 160 ALA B CA    1 
ATOM   1373 C  C     . ALA B 1 32  ? 25.034 50.154  0.910   1.00 17.92  ? 160 ALA B C     1 
ATOM   1374 O  O     . ALA B 1 32  ? 26.254 50.393  1.006   1.00 18.85  ? 160 ALA B O     1 
ATOM   1375 C  CB    . ALA B 1 32  ? 23.566 50.526  2.899   1.00 20.74  ? 160 ALA B CB    1 
ATOM   1376 N  N     . ILE B 1 33  ? 24.327 50.282  -0.193  1.00 17.29  ? 161 ILE B N     1 
ATOM   1377 C  CA    A ILE B 1 33  ? 24.832 50.932  -1.431  0.50 18.73  ? 161 ILE B CA    1 
ATOM   1378 C  CA    B ILE B 1 33  ? 24.827 50.943  -1.416  0.50 16.85  ? 161 ILE B CA    1 
ATOM   1379 C  C     . ILE B 1 33  ? 23.884 52.041  -1.853  1.00 18.46  ? 161 ILE B C     1 
ATOM   1380 O  O     . ILE B 1 33  ? 22.656 51.800  -1.993  1.00 20.02  ? 161 ILE B O     1 
ATOM   1381 C  CB    A ILE B 1 33  ? 25.045 49.930  -2.580  0.50 19.76  ? 161 ILE B CB    1 
ATOM   1382 C  CB    B ILE B 1 33  ? 25.130 49.937  -2.523  0.50 15.47  ? 161 ILE B CB    1 
ATOM   1383 C  CG1   A ILE B 1 33  ? 26.016 48.816  -2.203  0.50 21.83  ? 161 ILE B CG1   1 
ATOM   1384 C  CG1   B ILE B 1 33  ? 26.369 49.129  -2.172  0.50 14.83  ? 161 ILE B CG1   1 
ATOM   1385 C  CG2   A ILE B 1 33  ? 25.390 50.636  -3.917  0.50 20.97  ? 161 ILE B CG2   1 
ATOM   1386 C  CG2   B ILE B 1 33  ? 25.357 50.635  -3.877  0.50 16.42  ? 161 ILE B CG2   1 
ATOM   1387 C  CD1   A ILE B 1 33  ? 27.417 49.285  -2.153  0.50 23.20  ? 161 ILE B CD1   1 
ATOM   1388 C  CD1   B ILE B 1 33  ? 26.679 47.973  -3.125  0.50 14.22  ? 161 ILE B CD1   1 
ATOM   1389 N  N     . TYR B 1 34  ? 24.444 53.274  -2.028  1.00 17.69  ? 162 TYR B N     1 
ATOM   1390 C  CA    . TYR B 1 34  ? 23.697 54.369  -2.534  1.00 19.76  ? 162 TYR B CA    1 
ATOM   1391 C  C     . TYR B 1 34  ? 24.207 54.689  -3.925  1.00 19.00  ? 162 TYR B C     1 
ATOM   1392 O  O     . TYR B 1 34  ? 25.399 54.880  -4.154  1.00 18.39  ? 162 TYR B O     1 
ATOM   1393 C  CB    . TYR B 1 34  ? 23.872 55.568  -1.656  1.00 19.86  ? 162 TYR B CB    1 
ATOM   1394 C  CG    . TYR B 1 34  ? 23.078 56.790  -1.941  1.00 19.63  ? 162 TYR B CG    1 
ATOM   1395 C  CD1   . TYR B 1 34  ? 21.733 56.756  -2.407  1.00 21.25  ? 162 TYR B CD1   1 
ATOM   1396 C  CD2   . TYR B 1 34  ? 23.616 58.013  -1.642  1.00 24.18  ? 162 TYR B CD2   1 
ATOM   1397 C  CE1   . TYR B 1 34  ? 21.008 57.927  -2.627  1.00 25.25  ? 162 TYR B CE1   1 
ATOM   1398 C  CE2   . TYR B 1 34  ? 22.893 59.143  -1.832  1.00 24.04  ? 162 TYR B CE2   1 
ATOM   1399 C  CZ    . TYR B 1 34  ? 21.569 59.116  -2.259  1.00 25.19  ? 162 TYR B CZ    1 
ATOM   1400 O  OH    . TYR B 1 34  ? 20.944 60.344  -2.432  1.00 32.92  ? 162 TYR B OH    1 
ATOM   1401 N  N     . THR B 1 35  ? 23.295 54.614  -4.826  1.00 18.49  ? 163 THR B N     1 
ATOM   1402 C  CA    . THR B 1 35  ? 23.635 54.838  -6.309  1.00 18.18  ? 163 THR B CA    1 
ATOM   1403 C  C     . THR B 1 35  ? 22.428 55.216  -7.135  1.00 20.47  ? 163 THR B C     1 
ATOM   1404 O  O     . THR B 1 35  ? 21.355 55.433  -6.620  1.00 21.07  ? 163 THR B O     1 
ATOM   1405 C  CB    . THR B 1 35  ? 24.409 53.579  -6.851  1.00 20.75  ? 163 THR B CB    1 
ATOM   1406 O  OG1   . THR B 1 35  ? 25.027 53.874  -8.115  1.00 21.75  ? 163 THR B OG1   1 
ATOM   1407 C  CG2   . THR B 1 35  ? 23.543 52.304  -6.981  1.00 22.44  ? 163 THR B CG2   1 
ATOM   1408 N  N     . THR B 1 36  ? 22.614 55.313  -8.470  1.00 20.39  ? 164 THR B N     1 
ATOM   1409 C  CA    . THR B 1 36  ? 21.511 55.632  -9.344  1.00 22.95  ? 164 THR B CA    1 
ATOM   1410 C  C     . THR B 1 36  ? 20.526 54.526  -9.458  1.00 21.53  ? 164 THR B C     1 
ATOM   1411 O  O     . THR B 1 36  ? 20.817 53.345  -9.203  1.00 19.96  ? 164 THR B O     1 
ATOM   1412 C  CB    . THR B 1 36  ? 21.982 56.014  -10.783 1.00 24.66  ? 164 THR B CB    1 
ATOM   1413 O  OG1   . THR B 1 36  ? 22.631 54.872  -11.372 1.00 23.94  ? 164 THR B OG1   1 
ATOM   1414 C  CG2   . THR B 1 36  ? 22.905 57.166  -10.716 1.00 25.53  ? 164 THR B CG2   1 
ATOM   1415 N  N     . LYS B 1 37  ? 19.328 54.867  -9.855  1.00 24.29  ? 165 LYS B N     1 
ATOM   1416 C  CA    . LYS B 1 37  ? 18.314 53.860  -10.031 1.00 24.23  ? 165 LYS B CA    1 
ATOM   1417 C  C     . LYS B 1 37  ? 18.690 52.774  -11.059 1.00 24.04  ? 165 LYS B C     1 
ATOM   1418 O  O     . LYS B 1 37  ? 18.495 51.622  -10.821 1.00 22.23  ? 165 LYS B O     1 
ATOM   1419 C  CB    . LYS B 1 37  ? 16.976 54.507  -10.354 1.00 20.00  ? 165 LYS B CB    1 
ATOM   1420 C  CG    . LYS B 1 37  ? 15.916 53.569  -10.851 1.00 20.00  ? 165 LYS B CG    1 
ATOM   1421 C  CD    . LYS B 1 37  ? 14.565 53.850  -10.232 1.00 20.00  ? 165 LYS B CD    1 
ATOM   1422 C  CE    . LYS B 1 37  ? 13.385 53.104  -10.846 1.00 20.00  ? 165 LYS B CE    1 
ATOM   1423 N  NZ    . LYS B 1 37  ? 12.676 52.234  -9.860  1.00 20.00  ? 165 LYS B NZ    1 
ATOM   1424 N  N     . GLU B 1 38  ? 19.235 53.172  -12.204 1.00 23.13  ? 166 GLU B N     1 
ATOM   1425 C  CA    . GLU B 1 38  ? 19.593 52.169  -13.219 1.00 26.18  ? 166 GLU B CA    1 
ATOM   1426 C  C     . GLU B 1 38  ? 20.731 51.249  -12.761 1.00 25.24  ? 166 GLU B C     1 
ATOM   1427 O  O     . GLU B 1 38  ? 20.698 50.060  -13.053 1.00 27.21  ? 166 GLU B O     1 
ATOM   1428 C  CB    . GLU B 1 38  ? 19.889 52.831  -14.548 1.00 28.50  ? 166 GLU B CB    1 
ATOM   1429 C  CG    . GLU B 1 38  ? 21.201 53.584  -14.591 1.00 32.28  ? 166 GLU B CG    1 
ATOM   1430 C  CD    . GLU B 1 38  ? 21.466 54.249  -15.929 1.00 41.16  ? 166 GLU B CD    1 
ATOM   1431 O  OE1   . GLU B 1 38  ? 20.583 54.195  -16.805 1.00 43.49  ? 166 GLU B OE1   1 
ATOM   1432 O  OE2   . GLU B 1 38  ? 22.571 54.811  -16.084 1.00 39.76  ? 166 GLU B OE2   1 
ATOM   1433 N  N     . LYS B 1 39  ? 21.692 51.783  -12.004 1.00 25.77  ? 167 LYS B N     1 
ATOM   1434 C  CA    . LYS B 1 39  ? 22.744 50.944  -11.449 1.00 26.21  ? 167 LYS B CA    1 
ATOM   1435 C  C     . LYS B 1 39  ? 22.224 50.033  -10.325 1.00 25.73  ? 167 LYS B C     1 
ATOM   1436 O  O     . LYS B 1 39  ? 22.567 48.844  -10.289 1.00 24.80  ? 167 LYS B O     1 
ATOM   1437 C  CB    . LYS B 1 39  ? 23.927 51.784  -10.949 1.00 26.06  ? 167 LYS B CB    1 
ATOM   1438 C  CG    . LYS B 1 39  ? 24.647 52.531  -12.022 1.00 26.07  ? 167 LYS B CG    1 
ATOM   1439 C  CD    . LYS B 1 39  ? 25.690 53.500  -11.452 1.00 27.96  ? 167 LYS B CD    1 
ATOM   1440 C  CE    . LYS B 1 39  ? 26.840 52.798  -10.713 1.00 30.51  ? 167 LYS B CE    1 
ATOM   1441 N  NZ    . LYS B 1 39  ? 27.958 53.803  -10.458 1.00 27.45  ? 167 LYS B NZ    1 
ATOM   1442 N  N     . ALA B 1 40  ? 21.422 50.576  -9.398  1.00 22.63  ? 168 ALA B N     1 
ATOM   1443 C  CA    . ALA B 1 40  ? 20.855 49.772  -8.356  1.00 22.16  ? 168 ALA B CA    1 
ATOM   1444 C  C     . ALA B 1 40  ? 20.022 48.579  -8.896  1.00 24.49  ? 168 ALA B C     1 
ATOM   1445 O  O     . ALA B 1 40  ? 20.118 47.489  -8.331  1.00 23.45  ? 168 ALA B O     1 
ATOM   1446 C  CB    . ALA B 1 40  ? 20.043 50.616  -7.389  1.00 25.07  ? 168 ALA B CB    1 
ATOM   1447 N  N     . ALA B 1 41  ? 19.290 48.767  -9.978  1.00 23.98  ? 169 ALA B N     1 
ATOM   1448 C  CA    . ALA B 1 41  ? 18.403 47.712  -10.511 1.00 28.90  ? 169 ALA B CA    1 
ATOM   1449 C  C     . ALA B 1 41  ? 19.270 46.557  -10.991 1.00 28.73  ? 169 ALA B C     1 
ATOM   1450 O  O     . ALA B 1 41  ? 18.947 45.377  -10.779 1.00 29.36  ? 169 ALA B O     1 
ATOM   1451 C  CB    . ALA B 1 41  ? 17.542 48.240  -11.670 1.00 28.49  ? 169 ALA B CB    1 
ATOM   1452 N  N     . LEU B 1 42  ? 20.377 46.890  -11.638 1.00 28.88  ? 170 LEU B N     1 
ATOM   1453 C  CA    . LEU B 1 42  ? 21.321 45.821  -12.109 1.00 34.18  ? 170 LEU B CA    1 
ATOM   1454 C  C     . LEU B 1 42  ? 22.113 45.172  -10.941 1.00 30.79  ? 170 LEU B C     1 
ATOM   1455 O  O     . LEU B 1 42  ? 22.304 43.958  -10.859 1.00 27.15  ? 170 LEU B O     1 
ATOM   1456 C  CB    . LEU B 1 42  ? 22.269 46.388  -13.172 1.00 38.39  ? 170 LEU B CB    1 
ATOM   1457 C  CG    . LEU B 1 42  ? 21.724 46.657  -14.585 1.00 50.57  ? 170 LEU B CG    1 
ATOM   1458 C  CD1   . LEU B 1 42  ? 22.653 46.223  -15.698 1.00 46.83  ? 170 LEU B CD1   1 
ATOM   1459 C  CD2   . LEU B 1 42  ? 20.361 46.019  -14.833 1.00 55.87  ? 170 LEU B CD2   1 
ATOM   1460 N  N     . LEU B 1 43  ? 22.550 45.997  -10.003 1.00 24.57  ? 171 LEU B N     1 
ATOM   1461 C  CA    . LEU B 1 43  ? 23.354 45.533  -8.882  1.00 26.20  ? 171 LEU B CA    1 
ATOM   1462 C  C     . LEU B 1 43  ? 22.610 44.626  -7.963  1.00 24.42  ? 171 LEU B C     1 
ATOM   1463 O  O     . LEU B 1 43  ? 23.210 43.781  -7.334  1.00 26.49  ? 171 LEU B O     1 
ATOM   1464 C  CB    . LEU B 1 43  ? 23.820 46.728  -8.035  1.00 27.82  ? 171 LEU B CB    1 
ATOM   1465 C  CG    . LEU B 1 43  ? 25.253 47.173  -8.136  1.00 34.09  ? 171 LEU B CG    1 
ATOM   1466 C  CD1   . LEU B 1 43  ? 25.511 48.228  -7.058  1.00 32.34  ? 171 LEU B CD1   1 
ATOM   1467 C  CD2   . LEU B 1 43  ? 26.230 45.999  -7.994  1.00 34.46  ? 171 LEU B CD2   1 
ATOM   1468 N  N     . TYR B 1 44  ? 21.278 44.794  -7.888  1.00 23.28  ? 172 TYR B N     1 
ATOM   1469 C  CA    . TYR B 1 44  ? 20.434 43.980  -7.043  1.00 21.77  ? 172 TYR B CA    1 
ATOM   1470 C  C     . TYR B 1 44  ? 20.665 42.494  -7.331  1.00 23.73  ? 172 TYR B C     1 
ATOM   1471 O  O     . TYR B 1 44  ? 20.952 41.722  -6.417  1.00 23.18  ? 172 TYR B O     1 
ATOM   1472 C  CB    . TYR B 1 44  ? 18.963 44.322  -7.310  1.00 23.55  ? 172 TYR B CB    1 
ATOM   1473 C  CG    . TYR B 1 44  ? 17.936 43.569  -6.531  1.00 21.56  ? 172 TYR B CG    1 
ATOM   1474 C  CD1   . TYR B 1 44  ? 17.635 43.909  -5.208  1.00 22.17  ? 172 TYR B CD1   1 
ATOM   1475 C  CD2   . TYR B 1 44  ? 17.244 42.517  -7.081  1.00 25.92  ? 172 TYR B CD2   1 
ATOM   1476 C  CE1   . TYR B 1 44  ? 16.680 43.219  -4.498  1.00 21.70  ? 172 TYR B CE1   1 
ATOM   1477 C  CE2   . TYR B 1 44  ? 16.265 41.819  -6.389  1.00 25.12  ? 172 TYR B CE2   1 
ATOM   1478 C  CZ    . TYR B 1 44  ? 15.999 42.171  -5.093  1.00 24.63  ? 172 TYR B CZ    1 
ATOM   1479 O  OH    . TYR B 1 44  ? 15.065 41.461  -4.395  1.00 25.91  ? 172 TYR B OH    1 
ATOM   1480 N  N     . LYS B 1 45  ? 20.598 42.125  -8.587  1.00 21.95  ? 173 LYS B N     1 
ATOM   1481 C  CA    . LYS B 1 45  ? 20.827 40.755  -8.963  1.00 28.34  ? 173 LYS B CA    1 
ATOM   1482 C  C     . LYS B 1 45  ? 22.293 40.299  -8.818  1.00 24.74  ? 173 LYS B C     1 
ATOM   1483 O  O     . LYS B 1 45  ? 22.560 39.152  -8.425  1.00 27.39  ? 173 LYS B O     1 
ATOM   1484 C  CB    . LYS B 1 45  ? 20.290 40.543  -10.401 1.00 34.21  ? 173 LYS B CB    1 
ATOM   1485 C  CG    . LYS B 1 45  ? 18.737 40.830  -10.501 1.00 44.22  ? 173 LYS B CG    1 
ATOM   1486 C  CD    . LYS B 1 45  ? 17.938 39.597  -10.022 1.00 52.59  ? 173 LYS B CD    1 
ATOM   1487 C  CE    . LYS B 1 45  ? 16.479 39.639  -10.447 1.00 59.05  ? 173 LYS B CE    1 
ATOM   1488 N  NZ    . LYS B 1 45  ? 15.677 40.766  -9.886  1.00 57.71  ? 173 LYS B NZ    1 
ATOM   1489 N  N     . LYS B 1 46  ? 23.218 41.171  -9.212  1.00 22.27  ? 174 LYS B N     1 
ATOM   1490 C  CA    . LYS B 1 46  ? 24.652 40.881  -9.184  1.00 24.56  ? 174 LYS B CA    1 
ATOM   1491 C  C     . LYS B 1 46  ? 25.158 40.644  -7.776  1.00 25.56  ? 174 LYS B C     1 
ATOM   1492 O  O     . LYS B 1 46  ? 25.933 39.709  -7.534  1.00 24.73  ? 174 LYS B O     1 
ATOM   1493 C  CB    . LYS B 1 46  ? 25.437 41.972  -9.826  1.00 27.93  ? 174 LYS B CB    1 
ATOM   1494 C  CG    . LYS B 1 46  ? 25.230 42.053  -11.357 1.00 31.84  ? 174 LYS B CG    1 
ATOM   1495 C  CD    . LYS B 1 46  ? 25.836 40.850  -12.055 1.00 41.79  ? 174 LYS B CD    1 
ATOM   1496 C  CE    . LYS B 1 46  ? 25.877 41.022  -13.555 1.00 48.32  ? 174 LYS B CE    1 
ATOM   1497 N  NZ    . LYS B 1 46  ? 24.495 41.168  -14.073 1.00 52.85  ? 174 LYS B NZ    1 
ATOM   1498 N  N     . ILE B 1 47  ? 24.780 41.545  -6.880  1.00 21.37  ? 175 ILE B N     1 
ATOM   1499 C  CA    . ILE B 1 47  ? 25.100 41.358  -5.438  1.00 23.82  ? 175 ILE B CA    1 
ATOM   1500 C  C     . ILE B 1 47  ? 24.536 40.048  -4.952  1.00 27.30  ? 175 ILE B C     1 
ATOM   1501 O  O     . ILE B 1 47  ? 25.226 39.298  -4.281  1.00 26.07  ? 175 ILE B O     1 
ATOM   1502 C  CB    . ILE B 1 47  ? 24.591 42.534  -4.548  1.00 22.93  ? 175 ILE B CB    1 
ATOM   1503 C  CG1   . ILE B 1 47  ? 25.306 43.852  -4.853  1.00 27.17  ? 175 ILE B CG1   1 
ATOM   1504 C  CG2   . ILE B 1 47  ? 24.761 42.217  -3.043  1.00 23.67  ? 175 ILE B CG2   1 
ATOM   1505 C  CD1   . ILE B 1 47  ? 26.819 43.881  -4.569  1.00 28.64  ? 175 ILE B CD1   1 
ATOM   1506 N  N     . MET B 1 48  ? 23.250 39.826  -5.200  1.00 26.34  ? 176 MET B N     1 
ATOM   1507 C  CA    . MET B 1 48  ? 22.606 38.638  -4.724  1.00 29.00  ? 176 MET B CA    1 
ATOM   1508 C  C     . MET B 1 48  ? 23.404 37.405  -5.118  1.00 32.14  ? 176 MET B C     1 
ATOM   1509 O  O     . MET B 1 48  ? 23.627 36.540  -4.247  1.00 32.16  ? 176 MET B O     1 
ATOM   1510 C  CB    . MET B 1 48  ? 21.137 38.659  -5.224  1.00 32.52  ? 176 MET B CB    1 
ATOM   1511 C  CG    . MET B 1 48  ? 20.321 37.462  -4.888  1.00 36.14  ? 176 MET B CG    1 
ATOM   1512 S  SD    . MET B 1 48  ? 18.733 37.358  -5.731  1.00 38.26  ? 176 MET B SD    1 
ATOM   1513 C  CE    . MET B 1 48  ? 17.932 38.881  -5.258  1.00 33.41  ? 176 MET B CE    1 
ATOM   1514 N  N     . GLU B 1 49  ? 23.873 37.317  -6.382  1.00 28.24  ? 177 GLU B N     1 
ATOM   1515 C  CA    . GLU B 1 49  ? 24.661 36.196  -6.875  1.00 34.93  ? 177 GLU B CA    1 
ATOM   1516 C  C     . GLU B 1 49  ? 26.096 36.181  -6.340  1.00 34.98  ? 177 GLU B C     1 
ATOM   1517 O  O     . GLU B 1 49  ? 26.610 35.127  -5.942  1.00 34.83  ? 177 GLU B O     1 
ATOM   1518 C  CB    . GLU B 1 49  ? 24.815 36.230  -8.380  1.00 37.30  ? 177 GLU B CB    1 
ATOM   1519 C  CG    . GLU B 1 49  ? 23.538 36.050  -9.200  1.00 48.43  ? 177 GLU B CG    1 
ATOM   1520 C  CD    . GLU B 1 49  ? 23.636 36.509  -10.674 1.00 54.93  ? 177 GLU B CD    1 
ATOM   1521 O  OE1   . GLU B 1 49  ? 24.549 37.287  -11.099 1.00 52.42  ? 177 GLU B OE1   1 
ATOM   1522 O  OE2   . GLU B 1 49  ? 22.745 36.085  -11.441 1.00 63.35  ? 177 GLU B OE2   1 
ATOM   1523 N  N     . LYS B 1 50  ? 26.753 37.331  -6.330  1.00 24.79  ? 178 LYS B N     1 
ATOM   1524 C  CA    . LYS B 1 50  ? 28.186 37.372  -5.957  1.00 26.74  ? 178 LYS B CA    1 
ATOM   1525 C  C     . LYS B 1 50  ? 28.344 36.970  -4.465  1.00 25.25  ? 178 LYS B C     1 
ATOM   1526 O  O     . LYS B 1 50  ? 29.268 36.235  -4.114  1.00 29.55  ? 178 LYS B O     1 
ATOM   1527 C  CB    . LYS B 1 50  ? 28.738 38.767  -6.104  1.00 26.13  ? 178 LYS B CB    1 
ATOM   1528 C  CG    . LYS B 1 50  ? 30.134 39.022  -5.576  1.00 25.60  ? 178 LYS B CG    1 
ATOM   1529 C  CD    . LYS B 1 50  ? 31.202 38.216  -6.224  1.00 30.07  ? 178 LYS B CD    1 
ATOM   1530 C  CE    . LYS B 1 50  ? 32.563 38.696  -5.733  1.00 32.28  ? 178 LYS B CE    1 
ATOM   1531 N  NZ    . LYS B 1 50  ? 33.574 37.745  -6.230  1.00 35.13  ? 178 LYS B NZ    1 
ATOM   1532 N  N     . TYR B 1 51  ? 27.442 37.478  -3.648  1.00 24.05  ? 179 TYR B N     1 
ATOM   1533 C  CA    . TYR B 1 51  ? 27.555 37.332  -2.177  1.00 23.47  ? 179 TYR B CA    1 
ATOM   1534 C  C     . TYR B 1 51  ? 26.582 36.320  -1.571  1.00 24.43  ? 179 TYR B C     1 
ATOM   1535 O  O     . TYR B 1 51  ? 26.536 36.169  -0.333  1.00 24.45  ? 179 TYR B O     1 
ATOM   1536 C  CB    . TYR B 1 51  ? 27.529 38.715  -1.527  1.00 22.40  ? 179 TYR B CB    1 
ATOM   1537 C  CG    . TYR B 1 51  ? 28.760 39.496  -1.873  1.00 21.44  ? 179 TYR B CG    1 
ATOM   1538 C  CD1   . TYR B 1 51  ? 30.015 39.068  -1.451  1.00 23.16  ? 179 TYR B CD1   1 
ATOM   1539 C  CD2   . TYR B 1 51  ? 28.700 40.667  -2.712  1.00 22.42  ? 179 TYR B CD2   1 
ATOM   1540 C  CE1   . TYR B 1 51  ? 31.165 39.746  -1.797  1.00 24.22  ? 179 TYR B CE1   1 
ATOM   1541 C  CE2   . TYR B 1 51  ? 29.847 41.352  -3.007  1.00 21.16  ? 179 TYR B CE2   1 
ATOM   1542 C  CZ    . TYR B 1 51  ? 31.050 40.876  -2.637  1.00 22.24  ? 179 TYR B CZ    1 
ATOM   1543 O  OH    . TYR B 1 51  ? 32.171 41.497  -2.975  1.00 23.57  ? 179 TYR B OH    1 
ATOM   1544 N  N     A SER B 1 52  ? 25.842 35.597  -2.412  0.50 22.58  ? 180 SER B N     1 
ATOM   1545 N  N     B SER B 1 52  ? 25.780 35.662  -2.402  0.50 25.35  ? 180 SER B N     1 
ATOM   1546 C  CA    A SER B 1 52  ? 24.844 34.626  -1.916  0.50 22.55  ? 180 SER B CA    1 
ATOM   1547 C  CA    B SER B 1 52  ? 24.861 34.648  -1.892  0.50 27.62  ? 180 SER B CA    1 
ATOM   1548 C  C     A SER B 1 52  ? 24.088 35.175  -0.670  0.50 22.58  ? 180 SER B C     1 
ATOM   1549 C  C     B SER B 1 52  ? 24.082 35.177  -0.674  0.50 25.40  ? 180 SER B C     1 
ATOM   1550 O  O     A SER B 1 52  ? 24.001 34.566  0.395   0.50 21.25  ? 180 SER B O     1 
ATOM   1551 O  O     B SER B 1 52  ? 23.974 34.548  0.368   0.50 23.71  ? 180 SER B O     1 
ATOM   1552 C  CB    A SER B 1 52  ? 25.529 33.250  -1.697  0.50 22.24  ? 180 SER B CB    1 
ATOM   1553 C  CB    B SER B 1 52  ? 25.681 33.400  -1.556  0.50 30.10  ? 180 SER B CB    1 
ATOM   1554 O  OG    A SER B 1 52  ? 26.093 32.746  -2.926  0.50 21.38  ? 180 SER B OG    1 
ATOM   1555 O  OG    B SER B 1 52  ? 24.860 32.291  -1.365  0.50 36.33  ? 180 SER B OG    1 
ATOM   1556 N  N     . VAL B 1 53  ? 23.540 36.368  -0.826  1.00 21.21  ? 181 VAL B N     1 
ATOM   1557 C  CA    . VAL B 1 53  ? 22.918 37.080  0.293   1.00 21.23  ? 181 VAL B CA    1 
ATOM   1558 C  C     . VAL B 1 53  ? 21.794 36.315  1.015   1.00 20.01  ? 181 VAL B C     1 
ATOM   1559 O  O     . VAL B 1 53  ? 21.053 35.494  0.403   1.00 21.54  ? 181 VAL B O     1 
ATOM   1560 C  CB    . VAL B 1 53  ? 22.402 38.488  -0.122  1.00 21.43  ? 181 VAL B CB    1 
ATOM   1561 C  CG1   . VAL B 1 53  ? 23.499 39.270  -0.757  1.00 24.42  ? 181 VAL B CG1   1 
ATOM   1562 C  CG2   . VAL B 1 53  ? 21.159 38.454  -1.008  1.00 20.96  ? 181 VAL B CG2   1 
ATOM   1563 N  N     . THR B 1 54  ? 21.741 36.516  2.354   1.00 19.56  ? 182 THR B N     1 
ATOM   1564 C  CA    . THR B 1 54  ? 20.623 35.995  3.069   1.00 20.71  ? 182 THR B CA    1 
ATOM   1565 C  C     . THR B 1 54  ? 19.364 36.831  2.776   1.00 18.74  ? 182 THR B C     1 
ATOM   1566 O  O     . THR B 1 54  ? 18.240 36.273  2.820   1.00 20.49  ? 182 THR B O     1 
ATOM   1567 C  CB    . THR B 1 54  ? 20.873 35.989  4.571   1.00 20.91  ? 182 THR B CB    1 
ATOM   1568 O  OG1   . THR B 1 54  ? 21.002 37.363  4.980   1.00 21.23  ? 182 THR B OG1   1 
ATOM   1569 C  CG2   . THR B 1 54  ? 22.164 35.247  4.903   1.00 22.66  ? 182 THR B CG2   1 
ATOM   1570 N  N     . PHE B 1 55  ? 19.551 38.116  2.478   1.00 21.30  ? 183 PHE B N     1 
ATOM   1571 C  CA    . PHE B 1 55  ? 18.471 39.008  2.186   1.00 19.94  ? 183 PHE B CA    1 
ATOM   1572 C  C     . PHE B 1 55  ? 18.999 40.237  1.415   1.00 17.93  ? 183 PHE B C     1 
ATOM   1573 O  O     . PHE B 1 55  ? 20.119 40.735  1.695   1.00 18.10  ? 183 PHE B O     1 
ATOM   1574 C  CB    . PHE B 1 55  ? 17.867 39.509  3.509   1.00 19.28  ? 183 PHE B CB    1 
ATOM   1575 C  CG    . PHE B 1 55  ? 16.741 40.477  3.315   1.00 18.93  ? 183 PHE B CG    1 
ATOM   1576 C  CD1   . PHE B 1 55  ? 15.465 40.030  3.053   1.00 20.80  ? 183 PHE B CD1   1 
ATOM   1577 C  CD2   . PHE B 1 55  ? 16.991 41.857  3.291   1.00 16.34  ? 183 PHE B CD2   1 
ATOM   1578 C  CE1   . PHE B 1 55  ? 14.438 40.915  2.858   1.00 22.02  ? 183 PHE B CE1   1 
ATOM   1579 C  CE2   . PHE B 1 55  ? 15.982 42.717  3.070   1.00 16.95  ? 183 PHE B CE2   1 
ATOM   1580 C  CZ    . PHE B 1 55  ? 14.679 42.278  2.886   1.00 17.66  ? 183 PHE B CZ    1 
ATOM   1581 N  N     . ILE B 1 56  ? 18.197 40.757  0.522   1.00 20.67  ? 184 ILE B N     1 
ATOM   1582 C  CA    . ILE B 1 56  ? 18.506 42.061  -0.198  1.00 18.41  ? 184 ILE B CA    1 
ATOM   1583 C  C     . ILE B 1 56  ? 17.221 42.785  -0.517  1.00 18.59  ? 184 ILE B C     1 
ATOM   1584 O  O     . ILE B 1 56  ? 16.239 42.158  -0.889  1.00 19.36  ? 184 ILE B O     1 
ATOM   1585 C  CB    . ILE B 1 56  ? 19.398 41.863  -1.467  1.00 18.32  ? 184 ILE B CB    1 
ATOM   1586 C  CG1   . ILE B 1 56  ? 19.759 43.195  -2.166  1.00 19.37  ? 184 ILE B CG1   1 
ATOM   1587 C  CG2   . ILE B 1 56  ? 18.810 40.820  -2.433  1.00 19.81  ? 184 ILE B CG2   1 
ATOM   1588 C  CD1   . ILE B 1 56  ? 20.987 43.099  -3.026  1.00 20.45  ? 184 ILE B CD1   1 
ATOM   1589 N  N     . SER B 1 57  ? 17.272 44.129  -0.442  1.00 18.52  ? 185 SER B N     1 
ATOM   1590 C  CA    . SER B 1 57  ? 16.119 44.947  -0.699  1.00 17.10  ? 185 SER B CA    1 
ATOM   1591 C  C     . SER B 1 57  ? 16.643 46.227  -1.431  1.00 17.96  ? 185 SER B C     1 
ATOM   1592 O  O     . SER B 1 57  ? 17.831 46.619  -1.206  1.00 18.67  ? 185 SER B O     1 
ATOM   1593 C  CB    . SER B 1 57  ? 15.355 45.351  0.571   1.00 17.11  ? 185 SER B CB    1 
ATOM   1594 O  OG    . SER B 1 57  ? 16.188 45.937  1.527   1.00 18.78  ? 185 SER B OG    1 
ATOM   1595 N  N     . ARG B 1 58  ? 15.828 46.698  -2.334  1.00 19.19  ? 186 ARG B N     1 
ATOM   1596 C  CA    . ARG B 1 58  ? 16.106 47.909  -3.117  1.00 16.69  ? 186 ARG B CA    1 
ATOM   1597 C  C     . ARG B 1 58  ? 15.066 48.883  -2.783  1.00 19.25  ? 186 ARG B C     1 
ATOM   1598 O  O     . ARG B 1 58  ? 13.858 48.542  -2.829  1.00 18.55  ? 186 ARG B O     1 
ATOM   1599 C  CB    . ARG B 1 58  ? 16.191 47.570  -4.626  1.00 17.78  ? 186 ARG B CB    1 
ATOM   1600 C  CG    . ARG B 1 58  ? 16.508 48.803  -5.465  1.00 17.91  ? 186 ARG B CG    1 
ATOM   1601 C  CD    . ARG B 1 58  ? 16.924 48.441  -6.887  1.00 19.64  ? 186 ARG B CD    1 
ATOM   1602 N  NE    . ARG B 1 58  ? 15.872 47.853  -7.721  1.00 23.22  ? 186 ARG B NE    1 
ATOM   1603 C  CZ    . ARG B 1 58  ? 15.157 48.465  -8.671  1.00 25.85  ? 186 ARG B CZ    1 
ATOM   1604 N  NH1   . ARG B 1 58  ? 15.225 49.770  -8.896  1.00 25.67  ? 186 ARG B NH1   1 
ATOM   1605 N  NH2   . ARG B 1 58  ? 14.290 47.770  -9.337  1.00 27.86  ? 186 ARG B NH2   1 
ATOM   1606 N  N     . HIS B 1 59  ? 15.505 50.152  -2.535  1.00 20.14  ? 187 HIS B N     1 
ATOM   1607 C  CA    . HIS B 1 59  ? 14.676 51.182  -1.995  1.00 19.93  ? 187 HIS B CA    1 
ATOM   1608 C  C     . HIS B 1 59  ? 14.781 52.477  -2.802  1.00 20.06  ? 187 HIS B C     1 
ATOM   1609 O  O     . HIS B 1 59  ? 15.872 52.855  -3.218  1.00 19.20  ? 187 HIS B O     1 
ATOM   1610 C  CB    . HIS B 1 59  ? 15.061 51.500  -0.575  1.00 19.62  ? 187 HIS B CB    1 
ATOM   1611 C  CG    . HIS B 1 59  ? 15.057 50.304  0.309   1.00 18.82  ? 187 HIS B CG    1 
ATOM   1612 N  ND1   . HIS B 1 59  ? 14.015 50.022  1.153   1.00 21.00  ? 187 HIS B ND1   1 
ATOM   1613 C  CD2   . HIS B 1 59  ? 15.969 49.321  0.481   1.00 20.02  ? 187 HIS B CD2   1 
ATOM   1614 C  CE1   . HIS B 1 59  ? 14.283 48.899  1.828   1.00 20.89  ? 187 HIS B CE1   1 
ATOM   1615 N  NE2   . HIS B 1 59  ? 15.485 48.486  1.476   1.00 19.39  ? 187 HIS B NE2   1 
ATOM   1616 N  N     A ASN B 1 60  ? 13.647 53.121  -3.015  0.50 19.12  ? 188 ASN B N     1 
ATOM   1617 N  N     B ASN B 1 60  ? 13.640 53.149  -2.935  0.50 19.56  ? 188 ASN B N     1 
ATOM   1618 C  CA    A ASN B 1 60  ? 13.674 54.490  -3.564  0.50 21.67  ? 188 ASN B CA    1 
ATOM   1619 C  CA    B ASN B 1 60  ? 13.592 54.550  -3.415  0.50 22.60  ? 188 ASN B CA    1 
ATOM   1620 C  C     A ASN B 1 60  ? 14.196 55.497  -2.530  0.50 22.01  ? 188 ASN B C     1 
ATOM   1621 C  C     B ASN B 1 60  ? 14.205 55.533  -2.464  0.50 22.50  ? 188 ASN B C     1 
ATOM   1622 O  O     A ASN B 1 60  ? 13.841 55.437  -1.345  0.50 25.09  ? 188 ASN B O     1 
ATOM   1623 O  O     B ASN B 1 60  ? 13.840 55.569  -1.279  0.50 24.61  ? 188 ASN B O     1 
ATOM   1624 C  CB    A ASN B 1 60  ? 12.309 54.902  -4.056  0.50 23.28  ? 188 ASN B CB    1 
ATOM   1625 C  CB    B ASN B 1 60  ? 12.159 55.019  -3.478  0.50 24.80  ? 188 ASN B CB    1 
ATOM   1626 C  CG    A ASN B 1 60  ? 12.364 56.179  -4.883  0.50 25.02  ? 188 ASN B CG    1 
ATOM   1627 C  CG    B ASN B 1 60  ? 11.422 54.471  -4.632  0.50 27.58  ? 188 ASN B CG    1 
ATOM   1628 O  OD1   A ASN B 1 60  ? 11.455 56.970  -4.833  0.50 33.21  ? 188 ASN B OD1   1 
ATOM   1629 O  OD1   B ASN B 1 60  ? 11.727 54.778  -5.806  0.50 30.13  ? 188 ASN B OD1   1 
ATOM   1630 N  ND2   A ASN B 1 60  ? 13.440 56.385  -5.602  0.50 25.22  ? 188 ASN B ND2   1 
ATOM   1631 N  ND2   B ASN B 1 60  ? 10.402 53.696  -4.325  0.50 28.73  ? 188 ASN B ND2   1 
ATOM   1632 N  N     . SER B 1 61  ? 15.041 56.421  -2.983  1.00 25.45  ? 189 SER B N     1 
ATOM   1633 C  CA    . SER B 1 61  ? 15.617 57.498  -2.147  1.00 26.06  ? 189 SER B CA    1 
ATOM   1634 C  C     . SER B 1 61  ? 15.650 58.737  -3.029  1.00 29.09  ? 189 SER B C     1 
ATOM   1635 O  O     . SER B 1 61  ? 16.657 59.010  -3.720  1.00 32.59  ? 189 SER B O     1 
ATOM   1636 C  CB    . SER B 1 61  ? 17.013 57.145  -1.691  1.00 27.58  ? 189 SER B CB    1 
ATOM   1637 O  OG    . SER B 1 61  ? 17.562 58.250  -0.915  1.00 27.70  ? 189 SER B OG    1 
ATOM   1638 N  N     . TYR B 1 62  ? 14.519 59.444  -3.034  1.00 35.39  ? 190 TYR B N     1 
ATOM   1639 C  CA    . TYR B 1 62  ? 14.284 60.641  -3.880  1.00 40.49  ? 190 TYR B CA    1 
ATOM   1640 C  C     . TYR B 1 62  ? 14.556 60.192  -5.340  1.00 40.95  ? 190 TYR B C     1 
ATOM   1641 O  O     . TYR B 1 62  ? 13.994 59.148  -5.818  1.00 48.27  ? 190 TYR B O     1 
ATOM   1642 C  CB    . TYR B 1 62  ? 15.112 61.841  -3.372  1.00 46.33  ? 190 TYR B CB    1 
ATOM   1643 C  CG    . TYR B 1 62  ? 14.979 62.190  -1.838  1.00 45.83  ? 190 TYR B CG    1 
ATOM   1644 C  CD1   . TYR B 1 62  ? 13.964 63.023  -1.366  1.00 49.01  ? 190 TYR B CD1   1 
ATOM   1645 C  CD2   . TYR B 1 62  ? 15.873 61.665  -0.883  1.00 53.37  ? 190 TYR B CD2   1 
ATOM   1646 C  CE1   . TYR B 1 62  ? 13.830 63.341  -0.004  1.00 47.26  ? 190 TYR B CE1   1 
ATOM   1647 C  CE2   . TYR B 1 62  ? 15.733 61.954  0.487   1.00 50.69  ? 190 TYR B CE2   1 
ATOM   1648 C  CZ    . TYR B 1 62  ? 14.720 62.819  0.928   1.00 48.97  ? 190 TYR B CZ    1 
ATOM   1649 O  OH    . TYR B 1 62  ? 14.567 63.158  2.292   1.00 44.33  ? 190 TYR B OH    1 
ATOM   1650 N  N     . ASN B 1 63  ? 15.449 60.861  -6.050  1.00 38.74  ? 191 ASN B N     1 
ATOM   1651 C  CA    . ASN B 1 63  ? 15.773 60.423  -7.449  1.00 45.19  ? 191 ASN B CA    1 
ATOM   1652 C  C     . ASN B 1 63  ? 16.591 59.103  -7.571  1.00 36.54  ? 191 ASN B C     1 
ATOM   1653 O  O     . ASN B 1 63  ? 16.622 58.459  -8.634  1.00 43.92  ? 191 ASN B O     1 
ATOM   1654 C  CB    . ASN B 1 63  ? 16.492 61.537  -8.226  1.00 44.66  ? 191 ASN B CB    1 
ATOM   1655 C  CG    . ASN B 1 63  ? 15.762 62.879  -8.150  1.00 66.76  ? 191 ASN B CG    1 
ATOM   1656 O  OD1   . ASN B 1 63  ? 14.560 62.937  -7.829  1.00 73.75  ? 191 ASN B OD1   1 
ATOM   1657 N  ND2   . ASN B 1 63  ? 16.485 63.975  -8.450  1.00 75.19  ? 191 ASN B ND2   1 
ATOM   1658 N  N     . HIS B 1 64  ? 17.189 58.646  -6.477  1.00 26.66  ? 192 HIS B N     1 
ATOM   1659 C  CA    . HIS B 1 64  ? 18.178 57.631  -6.564  1.00 23.74  ? 192 HIS B CA    1 
ATOM   1660 C  C     . HIS B 1 64  ? 17.660 56.402  -5.813  1.00 22.03  ? 192 HIS B C     1 
ATOM   1661 O  O     . HIS B 1 64  ? 16.460 56.304  -5.547  1.00 24.09  ? 192 HIS B O     1 
ATOM   1662 C  CB    . HIS B 1 64  ? 19.516 58.120  -6.027  1.00 21.28  ? 192 HIS B CB    1 
ATOM   1663 C  CG    . HIS B 1 64  ? 20.099 59.269  -6.772  1.00 24.35  ? 192 HIS B CG    1 
ATOM   1664 N  ND1   . HIS B 1 64  ? 20.327 59.270  -8.132  1.00 25.32  ? 192 HIS B ND1   1 
ATOM   1665 C  CD2   . HIS B 1 64  ? 20.519 60.462  -6.315  1.00 25.00  ? 192 HIS B CD2   1 
ATOM   1666 C  CE1   . HIS B 1 64  ? 20.821 60.445  -8.479  1.00 30.36  ? 192 HIS B CE1   1 
ATOM   1667 N  NE2   . HIS B 1 64  ? 20.985 61.170  -7.379  1.00 24.06  ? 192 HIS B NE2   1 
ATOM   1668 N  N     . ASN B 1 65  ? 18.509 55.410  -5.682  1.00 21.08  ? 193 ASN B N     1 
ATOM   1669 C  CA    . ASN B 1 65  ? 18.150 54.159  -4.969  1.00 21.52  ? 193 ASN B CA    1 
ATOM   1670 C  C     . ASN B 1 65  ? 19.155 53.766  -3.903  1.00 20.92  ? 193 ASN B C     1 
ATOM   1671 O  O     . ASN B 1 65  ? 20.326 54.095  -4.040  1.00 21.77  ? 193 ASN B O     1 
ATOM   1672 C  CB    . ASN B 1 65  ? 18.148 53.010  -6.011  1.00 21.05  ? 193 ASN B CB    1 
ATOM   1673 C  CG    . ASN B 1 65  ? 16.824 52.804  -6.790  1.00 24.75  ? 193 ASN B CG    1 
ATOM   1674 O  OD1   . ASN B 1 65  ? 16.718 51.766  -7.425  1.00 25.99  ? 193 ASN B OD1   1 
ATOM   1675 N  ND2   . ASN B 1 65  ? 15.900 53.735  -6.823  1.00 24.28  ? 193 ASN B ND2   1 
ATOM   1676 N  N     . ILE B 1 66  ? 18.710 52.967  -2.913  1.00 18.82  ? 194 ILE B N     1 
ATOM   1677 C  CA    . ILE B 1 66  ? 19.562 52.353  -1.956  1.00 17.54  ? 194 ILE B CA    1 
ATOM   1678 C  C     . ILE B 1 66  ? 19.324 50.819  -1.903  1.00 15.94  ? 194 ILE B C     1 
ATOM   1679 O  O     . ILE B 1 66  ? 18.166 50.389  -1.997  1.00 15.64  ? 194 ILE B O     1 
ATOM   1680 C  CB    . ILE B 1 66  ? 19.391 52.974  -0.539  1.00 18.88  ? 194 ILE B CB    1 
ATOM   1681 C  CG1   . ILE B 1 66  ? 19.834 54.430  -0.564  1.00 20.20  ? 194 ILE B CG1   1 
ATOM   1682 C  CG2   . ILE B 1 66  ? 20.131 52.145  0.480   1.00 18.61  ? 194 ILE B CG2   1 
ATOM   1683 C  CD1   . ILE B 1 66  ? 19.365 55.207  0.680   1.00 20.86  ? 194 ILE B CD1   1 
ATOM   1684 N  N     . LEU B 1 67  ? 20.415 50.090  -1.944  1.00 16.44  ? 195 LEU B N     1 
ATOM   1685 C  CA    . LEU B 1 67  ? 20.403 48.646  -1.706  1.00 17.84  ? 195 LEU B CA    1 
ATOM   1686 C  C     . LEU B 1 67  ? 20.786 48.413  -0.284  1.00 18.60  ? 195 LEU B C     1 
ATOM   1687 O  O     . LEU B 1 67  ? 21.779 48.983  0.211   1.00 19.25  ? 195 LEU B O     1 
ATOM   1688 C  CB    . LEU B 1 67  ? 21.349 47.904  -2.614  1.00 19.85  ? 195 LEU B CB    1 
ATOM   1689 C  CG    . LEU B 1 67  ? 21.118 47.975  -4.112  1.00 21.52  ? 195 LEU B CG    1 
ATOM   1690 C  CD1   . LEU B 1 67  ? 22.276 47.274  -4.804  1.00 23.04  ? 195 LEU B CD1   1 
ATOM   1691 C  CD2   . LEU B 1 67  ? 19.781 47.368  -4.477  1.00 21.88  ? 195 LEU B CD2   1 
ATOM   1692 N  N     . PHE B 1 68  ? 20.116 47.467  0.379   1.00 18.47  ? 196 PHE B N     1 
ATOM   1693 C  CA    . PHE B 1 68  ? 20.387 47.067  1.741   1.00 18.26  ? 196 PHE B CA    1 
ATOM   1694 C  C     . PHE B 1 68  ? 20.540 45.528  1.635   1.00 17.77  ? 196 PHE B C     1 
ATOM   1695 O  O     . PHE B 1 68  ? 19.660 44.939  1.102   1.00 18.22  ? 196 PHE B O     1 
ATOM   1696 C  CB    . PHE B 1 68  ? 19.205 47.389  2.608   1.00 18.59  ? 196 PHE B CB    1 
ATOM   1697 C  CG    . PHE B 1 68  ? 19.247 46.745  3.994   1.00 17.27  ? 196 PHE B CG    1 
ATOM   1698 C  CD1   . PHE B 1 68  ? 18.772 45.460  4.216   1.00 17.44  ? 196 PHE B CD1   1 
ATOM   1699 C  CD2   . PHE B 1 68  ? 19.897 47.399  5.081   1.00 18.18  ? 196 PHE B CD2   1 
ATOM   1700 C  CE1   . PHE B 1 68  ? 18.896 44.867  5.485   1.00 19.85  ? 196 PHE B CE1   1 
ATOM   1701 C  CE2   . PHE B 1 68  ? 19.976 46.836  6.369   1.00 19.56  ? 196 PHE B CE2   1 
ATOM   1702 C  CZ    . PHE B 1 68  ? 19.504 45.556  6.569   1.00 18.86  ? 196 PHE B CZ    1 
ATOM   1703 N  N     . PHE B 1 69  ? 21.661 44.965  2.091   1.00 16.30  ? 197 PHE B N     1 
ATOM   1704 C  CA    . PHE B 1 69  ? 21.812 43.494  2.111   1.00 16.54  ? 197 PHE B CA    1 
ATOM   1705 C  C     . PHE B 1 69  ? 22.572 42.933  3.278   1.00 18.57  ? 197 PHE B C     1 
ATOM   1706 O  O     . PHE B 1 69  ? 23.399 43.588  3.919   1.00 18.33  ? 197 PHE B O     1 
ATOM   1707 C  CB    . PHE B 1 69  ? 22.305 43.051  0.711   1.00 17.72  ? 197 PHE B CB    1 
ATOM   1708 C  CG    . PHE B 1 69  ? 23.569 43.743  0.268   1.00 19.67  ? 197 PHE B CG    1 
ATOM   1709 C  CD1   . PHE B 1 69  ? 23.516 44.977  -0.417  1.00 21.33  ? 197 PHE B CD1   1 
ATOM   1710 C  CD2   . PHE B 1 69  ? 24.797 43.143  0.502   1.00 22.81  ? 197 PHE B CD2   1 
ATOM   1711 C  CE1   . PHE B 1 69  ? 24.670 45.625  -0.765  1.00 21.73  ? 197 PHE B CE1   1 
ATOM   1712 C  CE2   . PHE B 1 69  ? 25.973 43.760  0.044   1.00 21.18  ? 197 PHE B CE2   1 
ATOM   1713 C  CZ    . PHE B 1 69  ? 25.902 45.003  -0.580  1.00 20.57  ? 197 PHE B CZ    1 
ATOM   1714 N  N     . LEU B 1 70  ? 22.257 41.690  3.555   1.00 17.90  ? 198 LEU B N     1 
ATOM   1715 C  CA    . LEU B 1 70  ? 22.814 40.866  4.581   1.00 21.61  ? 198 LEU B CA    1 
ATOM   1716 C  C     . LEU B 1 70  ? 23.484 39.632  3.971   1.00 22.02  ? 198 LEU B C     1 
ATOM   1717 O  O     . LEU B 1 70  ? 22.933 39.027  3.095   1.00 19.63  ? 198 LEU B O     1 
ATOM   1718 C  CB    . LEU B 1 70  ? 21.698 40.438  5.522   1.00 21.79  ? 198 LEU B CB    1 
ATOM   1719 C  CG    . LEU B 1 70  ? 21.117 41.525  6.401   1.00 20.82  ? 198 LEU B CG    1 
ATOM   1720 C  CD1   . LEU B 1 70  ? 19.634 41.325  6.695   1.00 22.19  ? 198 LEU B CD1   1 
ATOM   1721 C  CD2   . LEU B 1 70  ? 21.939 41.694  7.643   1.00 22.19  ? 198 LEU B CD2   1 
ATOM   1722 N  N     . THR B 1 71  ? 24.728 39.315  4.403   1.00 21.43  ? 199 THR B N     1 
ATOM   1723 C  CA    . THR B 1 71  ? 25.478 38.267  3.807   1.00 22.18  ? 199 THR B CA    1 
ATOM   1724 C  C     . THR B 1 71  ? 25.645 37.090  4.808   1.00 21.50  ? 199 THR B C     1 
ATOM   1725 O  O     . THR B 1 71  ? 25.611 37.283  6.029   1.00 22.81  ? 199 THR B O     1 
ATOM   1726 C  CB    . THR B 1 71  ? 26.862 38.740  3.419   1.00 22.46  ? 199 THR B CB    1 
ATOM   1727 O  OG1   . THR B 1 71  ? 27.456 39.407  4.521   1.00 20.03  ? 199 THR B OG1   1 
ATOM   1728 C  CG2   . THR B 1 71  ? 26.760 39.783  2.271   1.00 24.00  ? 199 THR B CG2   1 
ATOM   1729 N  N     . PRO B 1 72  ? 25.812 35.888  4.276   1.00 23.41  ? 200 PRO B N     1 
ATOM   1730 C  CA    . PRO B 1 72  ? 25.892 34.694  5.142   1.00 24.12  ? 200 PRO B CA    1 
ATOM   1731 C  C     . PRO B 1 72  ? 27.273 34.552  5.851   1.00 25.74  ? 200 PRO B C     1 
ATOM   1732 O  O     . PRO B 1 72  ? 27.358 33.860  6.845   1.00 27.78  ? 200 PRO B O     1 
ATOM   1733 C  CB    . PRO B 1 72  ? 25.670 33.569  4.161   1.00 23.89  ? 200 PRO B CB    1 
ATOM   1734 C  CG    . PRO B 1 72  ? 26.048 34.052  2.830   1.00 24.80  ? 200 PRO B CG    1 
ATOM   1735 C  CD    . PRO B 1 72  ? 25.669 35.532  2.863   1.00 23.32  ? 200 PRO B CD    1 
ATOM   1736 N  N     A HIS B 1 73  ? 28.329 35.108  5.267   0.50 26.27  ? 201 HIS B N     1 
ATOM   1737 N  N     B HIS B 1 73  ? 28.305 35.188  5.297   0.50 24.92  ? 201 HIS B N     1 
ATOM   1738 C  CA    A HIS B 1 73  ? 29.642 35.246  5.901   0.50 29.00  ? 201 HIS B CA    1 
ATOM   1739 C  CA    B HIS B 1 73  ? 29.670 35.247  5.843   0.50 26.81  ? 201 HIS B CA    1 
ATOM   1740 C  C     A HIS B 1 73  ? 30.061 36.726  5.853   0.50 28.03  ? 201 HIS B C     1 
ATOM   1741 C  C     B HIS B 1 73  ? 30.043 36.730  5.861   0.50 26.73  ? 201 HIS B C     1 
ATOM   1742 O  O     A HIS B 1 73  ? 29.374 37.545  5.219   0.50 26.71  ? 201 HIS B O     1 
ATOM   1743 O  O     B HIS B 1 73  ? 29.303 37.549  5.268   0.50 25.21  ? 201 HIS B O     1 
ATOM   1744 C  CB    A HIS B 1 73  ? 30.693 34.242  5.372   0.50 33.58  ? 201 HIS B CB    1 
ATOM   1745 C  CB    B HIS B 1 73  ? 30.591 34.379  4.990   0.50 29.56  ? 201 HIS B CB    1 
ATOM   1746 C  CG    A HIS B 1 73  ? 31.061 34.343  3.920   0.50 37.64  ? 201 HIS B CG    1 
ATOM   1747 C  CG    B HIS B 1 73  ? 29.925 33.104  4.558   0.50 31.73  ? 201 HIS B CG    1 
ATOM   1748 N  ND1   A HIS B 1 73  ? 32.154 35.068  3.485   0.50 41.22  ? 201 HIS B ND1   1 
ATOM   1749 N  ND1   B HIS B 1 73  ? 29.764 32.015  5.397   0.50 35.79  ? 201 HIS B ND1   1 
ATOM   1750 C  CD2   A HIS B 1 73  ? 30.583 33.693  2.824   0.50 39.54  ? 201 HIS B CD2   1 
ATOM   1751 C  CD2   B HIS B 1 73  ? 29.289 32.780  3.410   0.50 32.65  ? 201 HIS B CD2   1 
ATOM   1752 C  CE1   A HIS B 1 73  ? 32.294 34.900  2.183   0.50 42.72  ? 201 HIS B CE1   1 
ATOM   1753 C  CE1   B HIS B 1 73  ? 29.077 31.071  4.775   0.50 32.69  ? 201 HIS B CE1   1 
ATOM   1754 N  NE2   A HIS B 1 73  ? 31.348 34.085  1.756   0.50 40.46  ? 201 HIS B NE2   1 
ATOM   1755 N  NE2   B HIS B 1 73  ? 28.769 31.520  3.571   0.50 29.27  ? 201 HIS B NE2   1 
ATOM   1756 N  N     . ARG B 1 74  ? 31.110 37.089  6.587   1.00 25.08  ? 202 ARG B N     1 
ATOM   1757 C  CA    . ARG B 1 74  ? 31.517 38.511  6.747   1.00 25.70  ? 202 ARG B CA    1 
ATOM   1758 C  C     . ARG B 1 74  ? 32.523 38.916  5.665   1.00 25.09  ? 202 ARG B C     1 
ATOM   1759 O  O     . ARG B 1 74  ? 33.251 38.077  5.136   1.00 25.28  ? 202 ARG B O     1 
ATOM   1760 C  CB    . ARG B 1 74  ? 32.089 38.766  8.127   1.00 27.99  ? 202 ARG B CB    1 
ATOM   1761 C  CG    . ARG B 1 74  ? 31.075 38.459  9.220   1.00 30.38  ? 202 ARG B CG    1 
ATOM   1762 C  CD    . ARG B 1 74  ? 31.675 38.350  10.605  1.00 33.18  ? 202 ARG B CD    1 
ATOM   1763 N  NE    . ARG B 1 74  ? 32.327 39.558  11.061  1.00 31.77  ? 202 ARG B NE    1 
ATOM   1764 C  CZ    . ARG B 1 74  ? 32.667 39.828  12.318  1.00 34.08  ? 202 ARG B CZ    1 
ATOM   1765 N  NH1   . ARG B 1 74  ? 32.402 38.969  13.316  1.00 34.56  ? 202 ARG B NH1   1 
ATOM   1766 N  NH2   . ARG B 1 74  ? 33.251 40.996  12.590  1.00 34.71  ? 202 ARG B NH2   1 
ATOM   1767 N  N     . HIS B 1 75  ? 32.515 40.216  5.354   1.00 23.27  ? 203 HIS B N     1 
ATOM   1768 C  CA    . HIS B 1 75  ? 33.408 40.841  4.390   1.00 23.94  ? 203 HIS B CA    1 
ATOM   1769 C  C     . HIS B 1 75  ? 33.861 42.221  4.906   1.00 24.22  ? 203 HIS B C     1 
ATOM   1770 O  O     . HIS B 1 75  ? 33.135 42.872  5.642   1.00 22.85  ? 203 HIS B O     1 
ATOM   1771 C  CB    . HIS B 1 75  ? 32.655 41.051  3.069   1.00 24.01  ? 203 HIS B CB    1 
ATOM   1772 C  CG    . HIS B 1 75  ? 31.989 39.825  2.561   1.00 25.18  ? 203 HIS B CG    1 
ATOM   1773 N  ND1   . HIS B 1 75  ? 32.647 38.900  1.794   1.00 29.19  ? 203 HIS B ND1   1 
ATOM   1774 C  CD2   . HIS B 1 75  ? 30.743 39.337  2.752   1.00 24.90  ? 203 HIS B CD2   1 
ATOM   1775 C  CE1   . HIS B 1 75  ? 31.824 37.922  1.479   1.00 28.31  ? 203 HIS B CE1   1 
ATOM   1776 N  NE2   . HIS B 1 75  ? 30.678 38.138  2.100   1.00 25.62  ? 203 HIS B NE2   1 
ATOM   1777 N  N     . ARG B 1 76  ? 35.036 42.643  4.485   1.00 22.44  ? 204 ARG B N     1 
ATOM   1778 C  CA    . ARG B 1 76  ? 35.387 44.048  4.524   1.00 24.23  ? 204 ARG B CA    1 
ATOM   1779 C  C     . ARG B 1 76  ? 34.532 44.883  3.613   1.00 22.87  ? 204 ARG B C     1 
ATOM   1780 O  O     . ARG B 1 76  ? 34.227 44.539  2.466   1.00 23.23  ? 204 ARG B O     1 
ATOM   1781 C  CB    . ARG B 1 76  ? 36.845 44.283  4.077   1.00 25.10  ? 204 ARG B CB    1 
ATOM   1782 C  CG    . ARG B 1 76  ? 37.915 43.799  5.008   1.00 27.96  ? 204 ARG B CG    1 
ATOM   1783 C  CD    . ARG B 1 76  ? 39.242 44.388  4.641   1.00 30.12  ? 204 ARG B CD    1 
ATOM   1784 N  NE    . ARG B 1 76  ? 40.339 43.743  5.354   1.00 32.33  ? 204 ARG B NE    1 
ATOM   1785 C  CZ    . ARG B 1 76  ? 41.582 44.229  5.393   1.00 35.91  ? 204 ARG B CZ    1 
ATOM   1786 N  NH1   . ARG B 1 76  ? 41.882 45.375  4.786   1.00 34.32  ? 204 ARG B NH1   1 
ATOM   1787 N  NH2   . ARG B 1 76  ? 42.532 43.571  6.052   1.00 38.15  ? 204 ARG B NH2   1 
ATOM   1788 N  N     . VAL B 1 77  ? 34.243 46.085  4.089   1.00 20.97  ? 205 VAL B N     1 
ATOM   1789 C  CA    . VAL B 1 77  ? 33.533 47.026  3.285   1.00 23.08  ? 205 VAL B CA    1 
ATOM   1790 C  C     . VAL B 1 77  ? 34.269 47.282  1.983   1.00 21.45  ? 205 VAL B C     1 
ATOM   1791 O  O     . VAL B 1 77  ? 33.627 47.395  0.948   1.00 21.91  ? 205 VAL B O     1 
ATOM   1792 C  CB    . VAL B 1 77  ? 33.277 48.322  4.071   1.00 24.60  ? 205 VAL B CB    1 
ATOM   1793 C  CG1   . VAL B 1 77  ? 32.718 49.374  3.174   1.00 24.04  ? 205 VAL B CG1   1 
ATOM   1794 C  CG2   . VAL B 1 77  ? 32.354 48.006  5.227   1.00 26.69  ? 205 VAL B CG2   1 
ATOM   1795 N  N     . SER B 1 78  ? 35.610 47.351  1.994   1.00 20.94  ? 206 SER B N     1 
ATOM   1796 C  CA    . SER B 1 78  ? 36.327 47.682  0.807   1.00 21.23  ? 206 SER B CA    1 
ATOM   1797 C  C     . SER B 1 78  ? 36.155 46.577  -0.264  1.00 23.01  ? 206 SER B C     1 
ATOM   1798 O  O     . SER B 1 78  ? 36.230 46.861  -1.475  1.00 25.13  ? 206 SER B O     1 
ATOM   1799 C  CB    . SER B 1 78  ? 37.825 47.838  1.129   1.00 21.59  ? 206 SER B CB    1 
ATOM   1800 O  OG    . SER B 1 78  ? 38.276 46.733  1.832   1.00 23.23  ? 206 SER B OG    1 
ATOM   1801 N  N     . ALA B 1 79  ? 35.998 45.340  0.166   1.00 23.42  ? 207 ALA B N     1 
ATOM   1802 C  CA    . ALA B 1 79  ? 35.797 44.253  -0.733  1.00 23.91  ? 207 ALA B CA    1 
ATOM   1803 C  C     . ALA B 1 79  ? 34.446 44.399  -1.467  1.00 22.82  ? 207 ALA B C     1 
ATOM   1804 O  O     . ALA B 1 79  ? 34.378 44.189  -2.710  1.00 24.77  ? 207 ALA B O     1 
ATOM   1805 C  CB    . ALA B 1 79  ? 35.834 42.899  0.015   1.00 27.36  ? 207 ALA B CB    1 
ATOM   1806 N  N     . ILE B 1 80  ? 33.415 44.743  -0.731  1.00 19.52  ? 208 ILE B N     1 
ATOM   1807 C  CA    . ILE B 1 80  ? 32.083 44.915  -1.321  1.00 19.44  ? 208 ILE B CA    1 
ATOM   1808 C  C     . ILE B 1 80  ? 32.137 46.133  -2.309  1.00 20.46  ? 208 ILE B C     1 
ATOM   1809 O  O     . ILE B 1 80  ? 31.706 46.065  -3.505  1.00 20.32  ? 208 ILE B O     1 
ATOM   1810 C  CB    . ILE B 1 80  ? 31.025 45.161  -0.261  1.00 20.87  ? 208 ILE B CB    1 
ATOM   1811 C  CG1   . ILE B 1 80  ? 31.029 44.052  0.825   1.00 24.39  ? 208 ILE B CG1   1 
ATOM   1812 C  CG2   . ILE B 1 80  ? 29.630 45.272  -0.877  1.00 19.60  ? 208 ILE B CG2   1 
ATOM   1813 C  CD1   . ILE B 1 80  ? 30.917 42.673  0.298   1.00 24.82  ? 208 ILE B CD1   1 
ATOM   1814 N  N     . ASN B 1 81  ? 32.764 47.211  -1.847  1.00 18.11  ? 209 ASN B N     1 
ATOM   1815 C  CA    . ASN B 1 81  ? 32.909 48.390  -2.688  1.00 20.46  ? 209 ASN B CA    1 
ATOM   1816 C  C     . ASN B 1 81  ? 33.697 48.136  -3.966  1.00 22.72  ? 209 ASN B C     1 
ATOM   1817 O  O     . ASN B 1 81  ? 33.269 48.479  -5.077  1.00 24.62  ? 209 ASN B O     1 
ATOM   1818 C  CB    . ASN B 1 81  ? 33.628 49.477  -1.930  1.00 21.60  ? 209 ASN B CB    1 
ATOM   1819 C  CG    . ASN B 1 81  ? 33.622 50.790  -2.694  1.00 21.45  ? 209 ASN B CG    1 
ATOM   1820 O  OD1   . ASN B 1 81  ? 32.552 51.318  -3.053  1.00 22.05  ? 209 ASN B OD1   1 
ATOM   1821 N  ND2   . ASN B 1 81  ? 34.790 51.304  -2.957  1.00 21.21  ? 209 ASN B ND2   1 
ATOM   1822 N  N     . ASN B 1 82  ? 34.863 47.511  -3.828  1.00 25.50  ? 210 ASN B N     1 
ATOM   1823 C  CA    . ASN B 1 82  ? 35.693 47.197  -4.966  1.00 28.49  ? 210 ASN B CA    1 
ATOM   1824 C  C     . ASN B 1 82  ? 34.924 46.395  -6.023  1.00 25.89  ? 210 ASN B C     1 
ATOM   1825 O  O     . ASN B 1 82  ? 35.005 46.713  -7.217  1.00 28.11  ? 210 ASN B O     1 
ATOM   1826 C  CB    . ASN B 1 82  ? 36.950 46.354  -4.549  1.00 33.11  ? 210 ASN B CB    1 
ATOM   1827 C  CG    . ASN B 1 82  ? 38.050 47.184  -3.828  1.00 39.71  ? 210 ASN B CG    1 
ATOM   1828 O  OD1   . ASN B 1 82  ? 38.037 48.401  -3.849  1.00 36.18  ? 210 ASN B OD1   1 
ATOM   1829 N  ND2   . ASN B 1 82  ? 39.014 46.482  -3.160  1.00 40.81  ? 210 ASN B ND2   1 
ATOM   1830 N  N     . TYR B 1 83  ? 34.171 45.374  -5.590  1.00 25.42  ? 211 TYR B N     1 
ATOM   1831 C  CA    . TYR B 1 83  ? 33.341 44.599  -6.520  1.00 25.65  ? 211 TYR B CA    1 
ATOM   1832 C  C     . TYR B 1 83  ? 32.309 45.490  -7.217  1.00 25.22  ? 211 TYR B C     1 
ATOM   1833 O  O     . TYR B 1 83  ? 32.192 45.498  -8.451  1.00 23.11  ? 211 TYR B O     1 
ATOM   1834 C  CB    . TYR B 1 83  ? 32.621 43.441  -5.798  1.00 26.37  ? 211 TYR B CB    1 
ATOM   1835 C  CG    . TYR B 1 83  ? 31.607 42.743  -6.697  1.00 24.92  ? 211 TYR B CG    1 
ATOM   1836 C  CD1   . TYR B 1 83  ? 32.005 41.897  -7.690  1.00 29.02  ? 211 TYR B CD1   1 
ATOM   1837 C  CD2   . TYR B 1 83  ? 30.240 42.969  -6.508  1.00 23.87  ? 211 TYR B CD2   1 
ATOM   1838 C  CE1   . TYR B 1 83  ? 31.070 41.275  -8.543  1.00 29.06  ? 211 TYR B CE1   1 
ATOM   1839 C  CE2   . TYR B 1 83  ? 29.303 42.337  -7.287  1.00 26.26  ? 211 TYR B CE2   1 
ATOM   1840 C  CZ    . TYR B 1 83  ? 29.703 41.533  -8.301  1.00 26.91  ? 211 TYR B CZ    1 
ATOM   1841 O  OH    . TYR B 1 83  ? 28.743 40.930  -9.068  1.00 31.72  ? 211 TYR B OH    1 
ATOM   1842 N  N     . ALA B 1 84  ? 31.600 46.288  -6.427  1.00 24.73  ? 212 ALA B N     1 
ATOM   1843 C  CA    . ALA B 1 84  ? 30.522 47.138  -6.972  1.00 25.80  ? 212 ALA B CA    1 
ATOM   1844 C  C     . ALA B 1 84  ? 31.019 48.217  -7.925  1.00 26.24  ? 212 ALA B C     1 
ATOM   1845 O  O     . ALA B 1 84  ? 30.421 48.434  -8.984  1.00 29.03  ? 212 ALA B O     1 
ATOM   1846 C  CB    . ALA B 1 84  ? 29.722 47.763  -5.854  1.00 25.76  ? 212 ALA B CB    1 
ATOM   1847 N  N     . GLN B 1 85  ? 32.150 48.840  -7.603  1.00 25.63  ? 213 GLN B N     1 
ATOM   1848 C  CA    . GLN B 1 85  ? 32.640 49.946  -8.389  1.00 24.67  ? 213 GLN B CA    1 
ATOM   1849 C  C     . GLN B 1 85  ? 33.125 49.452  -9.715  1.00 26.62  ? 213 GLN B C     1 
ATOM   1850 O  O     . GLN B 1 85  ? 32.984 50.176  -10.736 1.00 26.37  ? 213 GLN B O     1 
ATOM   1851 C  CB    . GLN B 1 85  ? 33.788 50.669  -7.706  1.00 26.20  ? 213 GLN B CB    1 
ATOM   1852 C  CG    . GLN B 1 85  ? 33.419 51.306  -6.399  1.00 24.48  ? 213 GLN B CG    1 
ATOM   1853 C  CD    . GLN B 1 85  ? 32.633 52.614  -6.517  1.00 28.55  ? 213 GLN B CD    1 
ATOM   1854 O  OE1   . GLN B 1 85  ? 32.478 53.193  -7.603  1.00 25.96  ? 213 GLN B OE1   1 
ATOM   1855 N  NE2   . GLN B 1 85  ? 32.100 53.052  -5.407  1.00 26.69  ? 213 GLN B NE2   1 
ATOM   1856 N  N     . LYS B 1 86  ? 33.746 48.271  -9.754  1.00 26.95  ? 214 LYS B N     1 
ATOM   1857 C  CA    . LYS B 1 86  ? 34.355 47.844  -11.017 1.00 29.98  ? 214 LYS B CA    1 
ATOM   1858 C  C     . LYS B 1 86  ? 33.326 47.368  -11.995 1.00 28.08  ? 214 LYS B C     1 
ATOM   1859 O  O     . LYS B 1 86  ? 33.641 47.274  -13.185 1.00 29.38  ? 214 LYS B O     1 
ATOM   1860 C  CB    . LYS B 1 86  ? 35.478 46.827  -10.860 1.00 36.37  ? 214 LYS B CB    1 
ATOM   1861 C  CG    . LYS B 1 86  ? 35.067 45.415  -10.488 1.00 47.24  ? 214 LYS B CG    1 
ATOM   1862 C  CD    . LYS B 1 86  ? 36.307 44.513  -10.510 1.00 53.25  ? 214 LYS B CD    1 
ATOM   1863 C  CE    . LYS B 1 86  ? 36.087 43.181  -9.850  1.00 56.63  ? 214 LYS B CE    1 
ATOM   1864 N  NZ    . LYS B 1 86  ? 34.693 42.685  -9.985  1.00 60.32  ? 214 LYS B NZ    1 
ATOM   1865 N  N     . LEU B 1 87  ? 32.119 47.054  -11.557 1.00 26.72  ? 215 LEU B N     1 
ATOM   1866 C  CA    . LEU B 1 87  ? 31.113 46.466  -12.483 1.00 28.12  ? 215 LEU B CA    1 
ATOM   1867 C  C     . LEU B 1 87  ? 30.658 47.453  -13.559 1.00 28.37  ? 215 LEU B C     1 
ATOM   1868 O  O     . LEU B 1 87  ? 30.516 47.086  -14.726 1.00 30.36  ? 215 LEU B O     1 
ATOM   1869 C  CB    . LEU B 1 87  ? 29.873 45.970  -11.740 1.00 26.69  ? 215 LEU B CB    1 
ATOM   1870 C  CG    . LEU B 1 87  ? 29.918 44.637  -11.058 1.00 28.42  ? 215 LEU B CG    1 
ATOM   1871 C  CD1   . LEU B 1 87  ? 28.628 44.459  -10.263 1.00 27.76  ? 215 LEU B CD1   1 
ATOM   1872 C  CD2   . LEU B 1 87  ? 30.156 43.436  -11.984 1.00 29.86  ? 215 LEU B CD2   1 
HETATM 1873 N  N     . CME B 1 88  ? 30.395 48.676  -13.143 1.00 31.10  ? 216 CME B N     1 
HETATM 1874 C  CA    . CME B 1 88  ? 29.870 49.740  -14.022 1.00 32.67  ? 216 CME B CA    1 
HETATM 1875 C  CB    . CME B 1 88  ? 28.386 50.083  -13.713 1.00 36.55  ? 216 CME B CB    1 
HETATM 1876 S  SG    . CME B 1 88  ? 27.362 48.789  -14.335 1.00 44.21  ? 216 CME B SG    1 
HETATM 1877 S  SD    . CME B 1 88  ? 25.602 48.899  -13.346 1.00 49.88  ? 216 CME B SD    1 
HETATM 1878 C  CE    . CME B 1 88  ? 25.734 47.778  -11.992 1.00 44.47  ? 216 CME B CE    1 
HETATM 1879 C  CZ    . CME B 1 88  ? 26.952 48.106  -11.133 1.00 47.30  ? 216 CME B CZ    1 
HETATM 1880 O  OH    . CME B 1 88  ? 26.865 49.389  -10.489 1.00 48.83  ? 216 CME B OH    1 
HETATM 1881 C  C     . CME B 1 88  ? 30.673 50.945  -13.731 1.00 30.72  ? 216 CME B C     1 
HETATM 1882 O  O     . CME B 1 88  ? 30.630 51.440  -12.611 1.00 31.05  ? 216 CME B O     1 
ATOM   1883 N  N     . THR B 1 89  ? 31.386 51.452  -14.723 1.00 30.72  ? 217 THR B N     1 
ATOM   1884 C  CA    . THR B 1 89  ? 32.295 52.544  -14.527 1.00 30.91  ? 217 THR B CA    1 
ATOM   1885 C  C     . THR B 1 89  ? 31.741 53.908  -14.833 1.00 31.07  ? 217 THR B C     1 
ATOM   1886 O  O     . THR B 1 89  ? 32.431 54.726  -15.397 1.00 41.96  ? 217 THR B O     1 
ATOM   1887 C  CB    . THR B 1 89  ? 33.552 52.316  -15.340 1.00 32.46  ? 217 THR B CB    1 
ATOM   1888 O  OG1   . THR B 1 89  ? 33.226 52.225  -16.721 1.00 32.37  ? 217 THR B OG1   1 
ATOM   1889 C  CG2   . THR B 1 89  ? 34.234 50.997  -14.862 1.00 32.05  ? 217 THR B CG2   1 
ATOM   1890 N  N     . PHE B 1 90  ? 30.485 54.148  -14.518 1.00 29.96  ? 218 PHE B N     1 
ATOM   1891 C  CA    . PHE B 1 90  ? 29.869 55.483  -14.692 1.00 30.83  ? 218 PHE B CA    1 
ATOM   1892 C  C     . PHE B 1 90  ? 29.044 55.809  -13.472 1.00 28.50  ? 218 PHE B C     1 
ATOM   1893 O  O     . PHE B 1 90  ? 28.603 54.899  -12.777 1.00 25.80  ? 218 PHE B O     1 
ATOM   1894 C  CB    . PHE B 1 90  ? 28.974 55.471  -15.953 1.00 31.64  ? 218 PHE B CB    1 
ATOM   1895 C  CG    . PHE B 1 90  ? 28.030 54.314  -16.005 1.00 32.95  ? 218 PHE B CG    1 
ATOM   1896 C  CD1   . PHE B 1 90  ? 28.407 53.101  -16.579 1.00 33.36  ? 218 PHE B CD1   1 
ATOM   1897 C  CD2   . PHE B 1 90  ? 26.778 54.416  -15.469 1.00 32.37  ? 218 PHE B CD2   1 
ATOM   1898 C  CE1   . PHE B 1 90  ? 27.528 52.041  -16.613 1.00 33.23  ? 218 PHE B CE1   1 
ATOM   1899 C  CE2   . PHE B 1 90  ? 25.916 53.341  -15.452 1.00 33.69  ? 218 PHE B CE2   1 
ATOM   1900 C  CZ    . PHE B 1 90  ? 26.282 52.150  -16.046 1.00 31.83  ? 218 PHE B CZ    1 
ATOM   1901 N  N     . SER B 1 91  ? 28.900 57.096  -13.168 1.00 28.30  ? 219 SER B N     1 
ATOM   1902 C  CA    . SER B 1 91  ? 28.072 57.597  -12.085 1.00 27.05  ? 219 SER B CA    1 
ATOM   1903 C  C     . SER B 1 91  ? 28.527 57.224  -10.693 1.00 26.53  ? 219 SER B C     1 
ATOM   1904 O  O     . SER B 1 91  ? 29.415 56.409  -10.514 1.00 26.59  ? 219 SER B O     1 
ATOM   1905 C  CB    . SER B 1 91  ? 26.603 57.166  -12.243 1.00 29.32  ? 219 SER B CB    1 
ATOM   1906 O  OG    . SER B 1 91  ? 26.157 57.360  -13.558 1.00 32.91  ? 219 SER B OG    1 
ATOM   1907 N  N     . PHE B 1 92  ? 27.875 57.812  -9.701  1.00 22.47  ? 220 PHE B N     1 
ATOM   1908 C  CA    . PHE B 1 92  ? 28.283 57.688  -8.360  1.00 22.88  ? 220 PHE B CA    1 
ATOM   1909 C  C     . PHE B 1 92  ? 27.889 56.355  -7.787  1.00 20.67  ? 220 PHE B C     1 
ATOM   1910 O  O     . PHE B 1 92  ? 26.943 55.685  -8.270  1.00 20.50  ? 220 PHE B O     1 
ATOM   1911 C  CB    . PHE B 1 92  ? 27.723 58.836  -7.477  1.00 22.03  ? 220 PHE B CB    1 
ATOM   1912 C  CG    . PHE B 1 92  ? 26.349 58.612  -6.950  1.00 18.95  ? 220 PHE B CG    1 
ATOM   1913 C  CD1   . PHE B 1 92  ? 25.238 58.833  -7.707  1.00 20.83  ? 220 PHE B CD1   1 
ATOM   1914 C  CD2   . PHE B 1 92  ? 26.190 58.269  -5.649  1.00 20.39  ? 220 PHE B CD2   1 
ATOM   1915 C  CE1   . PHE B 1 92  ? 23.972 58.625  -7.187  1.00 19.33  ? 220 PHE B CE1   1 
ATOM   1916 C  CE2   . PHE B 1 92  ? 24.927 58.108  -5.083  1.00 20.42  ? 220 PHE B CE2   1 
ATOM   1917 C  CZ    . PHE B 1 92  ? 23.835 58.250  -5.862  1.00 20.25  ? 220 PHE B CZ    1 
ATOM   1918 N  N     . LEU B 1 93  ? 28.580 56.016  -6.732  1.00 21.43  ? 221 LEU B N     1 
ATOM   1919 C  CA    . LEU B 1 93  ? 28.259 54.846  -5.914  1.00 20.65  ? 221 LEU B CA    1 
ATOM   1920 C  C     . LEU B 1 93  ? 28.891 54.959  -4.551  1.00 20.98  ? 221 LEU B C     1 
ATOM   1921 O  O     . LEU B 1 93  ? 30.135 55.053  -4.402  1.00 20.76  ? 221 LEU B O     1 
ATOM   1922 C  CB    . LEU B 1 93  ? 28.655 53.550  -6.617  1.00 21.55  ? 221 LEU B CB    1 
ATOM   1923 C  CG    . LEU B 1 93  ? 28.104 52.309  -5.916  1.00 21.63  ? 221 LEU B CG    1 
ATOM   1924 C  CD1   . LEU B 1 93  ? 27.899 51.214  -6.983  1.00 21.37  ? 221 LEU B CD1   1 
ATOM   1925 C  CD2   . LEU B 1 93  ? 28.978 51.770  -4.805  1.00 24.24  ? 221 LEU B CD2   1 
ATOM   1926 N  N     . ILE B 1 94  ? 28.061 54.949  -3.547  1.00 19.69  ? 222 ILE B N     1 
ATOM   1927 C  CA    . ILE B 1 94  ? 28.517 55.024  -2.143  1.00 20.91  ? 222 ILE B CA    1 
ATOM   1928 C  C     . ILE B 1 94  ? 28.221 53.674  -1.455  1.00 20.20  ? 222 ILE B C     1 
ATOM   1929 O  O     . ILE B 1 94  ? 27.095 53.185  -1.548  1.00 20.03  ? 222 ILE B O     1 
ATOM   1930 C  CB    . ILE B 1 94  ? 27.837 56.107  -1.303  1.00 22.11  ? 222 ILE B CB    1 
ATOM   1931 C  CG1   . ILE B 1 94  ? 27.727 57.473  -2.005  1.00 24.99  ? 222 ILE B CG1   1 
ATOM   1932 C  CG2   . ILE B 1 94  ? 28.534 56.301  0.055   1.00 22.37  ? 222 ILE B CG2   1 
ATOM   1933 C  CD1   . ILE B 1 94  ? 29.025 58.126  -2.315  1.00 24.15  ? 222 ILE B CD1   1 
ATOM   1934 N  N     . CYS B 1 95  ? 29.254 53.075  -0.894  1.00 17.72  ? 223 CYS B N     1 
ATOM   1935 C  CA    . CYS B 1 95  ? 29.142 51.794  -0.144  1.00 19.14  ? 223 CYS B CA    1 
ATOM   1936 C  C     . CYS B 1 95  ? 29.640 51.869  1.257   1.00 20.71  ? 223 CYS B C     1 
ATOM   1937 O  O     . CYS B 1 95  ? 30.837 52.177  1.464   1.00 22.28  ? 223 CYS B O     1 
ATOM   1938 C  CB    . CYS B 1 95  ? 29.933 50.748  -0.892  1.00 21.20  ? 223 CYS B CB    1 
ATOM   1939 S  SG    . CYS B 1 95  ? 29.850 49.060  -0.221  1.00 23.63  ? 223 CYS B SG    1 
ATOM   1940 N  N     . LYS B 1 96  ? 28.799 51.494  2.213   1.00 20.67  ? 224 LYS B N     1 
ATOM   1941 C  CA    . LYS B 1 96  ? 29.110 51.582  3.635   1.00 17.89  ? 224 LYS B CA    1 
ATOM   1942 C  C     . LYS B 1 96  ? 28.562 50.395  4.402   1.00 18.37  ? 224 LYS B C     1 
ATOM   1943 O  O     . LYS B 1 96  ? 27.521 49.815  4.059   1.00 19.97  ? 224 LYS B O     1 
ATOM   1944 C  CB    . LYS B 1 96  ? 28.637 52.861  4.283   1.00 19.18  ? 224 LYS B CB    1 
ATOM   1945 C  CG    . LYS B 1 96  ? 29.490 54.059  3.867   1.00 20.68  ? 224 LYS B CG    1 
ATOM   1946 C  CD    . LYS B 1 96  ? 29.107 55.362  4.560   1.00 20.86  ? 224 LYS B CD    1 
ATOM   1947 C  CE    . LYS B 1 96  ? 30.122 56.422  4.245   1.00 20.89  ? 224 LYS B CE    1 
ATOM   1948 N  NZ    . LYS B 1 96  ? 29.839 57.727  4.874   1.00 22.00  ? 224 LYS B NZ    1 
ATOM   1949 N  N     . GLY B 1 97  ? 29.323 49.986  5.363   1.00 17.81  ? 225 GLY B N     1 
ATOM   1950 C  CA    . GLY B 1 97  ? 28.865 48.959  6.315   1.00 17.79  ? 225 GLY B CA    1 
ATOM   1951 C  C     . GLY B 1 97  ? 27.793 49.502  7.231   1.00 19.16  ? 225 GLY B C     1 
ATOM   1952 O  O     . GLY B 1 97  ? 27.721 50.762  7.458   1.00 18.36  ? 225 GLY B O     1 
ATOM   1953 N  N     . VAL B 1 98  ? 26.876 48.636  7.628   1.00 18.10  ? 226 VAL B N     1 
ATOM   1954 C  CA    . VAL B 1 98  ? 25.736 49.056  8.418   1.00 18.17  ? 226 VAL B CA    1 
ATOM   1955 C  C     . VAL B 1 98  ? 25.926 48.543  9.838   1.00 19.04  ? 226 VAL B C     1 
ATOM   1956 O  O     . VAL B 1 98  ? 25.985 47.303  10.072  1.00 19.24  ? 226 VAL B O     1 
ATOM   1957 C  CB    . VAL B 1 98  ? 24.404 48.562  7.793   1.00 16.61  ? 226 VAL B CB    1 
ATOM   1958 C  CG1   . VAL B 1 98  ? 23.193 48.907  8.652   1.00 17.59  ? 226 VAL B CG1   1 
ATOM   1959 C  CG2   . VAL B 1 98  ? 24.188 49.067  6.367   1.00 18.41  ? 226 VAL B CG2   1 
ATOM   1960 N  N     . ASN B 1 99  ? 25.973 49.491  10.764  1.00 17.51  ? 227 ASN B N     1 
ATOM   1961 C  CA    . ASN B 1 99  ? 26.079 49.137  12.229  1.00 19.09  ? 227 ASN B CA    1 
ATOM   1962 C  C     . ASN B 1 99  ? 24.709 48.820  12.822  1.00 21.63  ? 227 ASN B C     1 
ATOM   1963 O  O     . ASN B 1 99  ? 24.626 47.886  13.701  1.00 24.59  ? 227 ASN B O     1 
ATOM   1964 C  CB    . ASN B 1 99  ? 26.689 50.232  12.997  1.00 20.01  ? 227 ASN B CB    1 
ATOM   1965 C  CG    . ASN B 1 99  ? 28.185 50.400  12.745  1.00 21.22  ? 227 ASN B CG    1 
ATOM   1966 O  OD1   . ASN B 1 99  ? 28.904 49.398  12.604  1.00 22.49  ? 227 ASN B OD1   1 
ATOM   1967 N  ND2   . ASN B 1 99  ? 28.662 51.634  12.780  1.00 22.80  ? 227 ASN B ND2   1 
ATOM   1968 N  N     . LYS B 1 100 ? 23.657 49.509  12.417  1.00 19.48  ? 228 LYS B N     1 
ATOM   1969 C  CA    . LYS B 1 100 ? 22.334 49.388  13.042  1.00 20.78  ? 228 LYS B CA    1 
ATOM   1970 C  C     . LYS B 1 100 ? 21.471 48.765  11.984  1.00 17.19  ? 228 LYS B C     1 
ATOM   1971 O  O     . LYS B 1 100 ? 20.822 49.428  11.226  1.00 19.65  ? 228 LYS B O     1 
ATOM   1972 C  CB    . LYS B 1 100 ? 21.789 50.723  13.568  1.00 19.67  ? 228 LYS B CB    1 
ATOM   1973 C  CG    . LYS B 1 100 ? 22.798 51.538  14.380  1.00 22.44  ? 228 LYS B CG    1 
ATOM   1974 C  CD    . LYS B 1 100 ? 23.152 51.032  15.726  1.00 26.58  ? 228 LYS B CD    1 
ATOM   1975 C  CE    . LYS B 1 100 ? 23.981 52.155  16.371  1.00 31.33  ? 228 LYS B CE    1 
ATOM   1976 N  NZ    . LYS B 1 100 ? 24.503 51.694  17.622  1.00 32.47  ? 228 LYS B NZ    1 
ATOM   1977 N  N     . GLU B 1 101 ? 21.510 47.408  11.873  1.00 18.66  ? 229 GLU B N     1 
ATOM   1978 C  CA    . GLU B 1 101 ? 20.946 46.728  10.707  1.00 19.53  ? 229 GLU B CA    1 
ATOM   1979 C  C     . GLU B 1 101 ? 19.414 46.913  10.656  1.00 17.89  ? 229 GLU B C     1 
ATOM   1980 O  O     . GLU B 1 101 ? 18.850 47.265  9.621   1.00 17.55  ? 229 GLU B O     1 
ATOM   1981 C  CB    . GLU B 1 101 ? 21.322 45.220  10.743  1.00 19.14  ? 229 GLU B CB    1 
ATOM   1982 C  CG    . GLU B 1 101 ? 22.832 45.015  10.810  1.00 20.45  ? 229 GLU B CG    1 
ATOM   1983 C  CD    . GLU B 1 101 ? 23.341 44.683  12.179  1.00 27.18  ? 229 GLU B CD    1 
ATOM   1984 O  OE1   . GLU B 1 101 ? 22.840 45.243  13.194  1.00 27.50  ? 229 GLU B OE1   1 
ATOM   1985 O  OE2   . GLU B 1 101 ? 24.277 43.863  12.263  1.00 31.19  ? 229 GLU B OE2   1 
ATOM   1986 N  N     . TYR B 1 102 ? 18.755 46.707  11.794  1.00 16.69  ? 230 TYR B N     1 
ATOM   1987 C  CA    . TYR B 1 102 ? 17.260 46.785  11.827  1.00 15.98  ? 230 TYR B CA    1 
ATOM   1988 C  C     . TYR B 1 102 ? 16.860 48.265  11.590  1.00 17.39  ? 230 TYR B C     1 
ATOM   1989 O  O     . TYR B 1 102 ? 15.968 48.531  10.775  1.00 19.74  ? 230 TYR B O     1 
ATOM   1990 C  CB    . TYR B 1 102 ? 16.635 46.252  13.109  1.00 16.97  ? 230 TYR B CB    1 
ATOM   1991 C  CG    . TYR B 1 102 ? 15.171 46.695  13.232  1.00 16.73  ? 230 TYR B CG    1 
ATOM   1992 C  CD1   . TYR B 1 102 ? 14.168 46.137  12.472  1.00 18.43  ? 230 TYR B CD1   1 
ATOM   1993 C  CD2   . TYR B 1 102 ? 14.853 47.774  14.061  1.00 16.19  ? 230 TYR B CD2   1 
ATOM   1994 C  CE1   . TYR B 1 102 ? 12.838 46.573  12.543  1.00 18.92  ? 230 TYR B CE1   1 
ATOM   1995 C  CE2   . TYR B 1 102 ? 13.539 48.213  14.116  1.00 18.78  ? 230 TYR B CE2   1 
ATOM   1996 C  CZ    . TYR B 1 102 ? 12.542 47.641  13.376  1.00 19.60  ? 230 TYR B CZ    1 
ATOM   1997 O  OH    . TYR B 1 102 ? 11.246 48.150  13.416  1.00 21.00  ? 230 TYR B OH    1 
ATOM   1998 N  N     . LEU B 1 103 ? 17.458 49.175  12.309  1.00 16.69  ? 231 LEU B N     1 
ATOM   1999 C  CA    . LEU B 1 103 ? 17.034 50.547  12.190  1.00 18.24  ? 231 LEU B CA    1 
ATOM   2000 C  C     . LEU B 1 103 ? 17.199 51.023  10.740  1.00 17.41  ? 231 LEU B C     1 
ATOM   2001 O  O     . LEU B 1 103 ? 16.398 51.806  10.232  1.00 18.60  ? 231 LEU B O     1 
ATOM   2002 C  CB    . LEU B 1 103 ? 17.800 51.463  13.124  1.00 18.63  ? 231 LEU B CB    1 
ATOM   2003 C  CG    . LEU B 1 103 ? 17.451 51.332  14.598  1.00 18.58  ? 231 LEU B CG    1 
ATOM   2004 C  CD1   . LEU B 1 103 ? 18.341 52.205  15.452  1.00 19.28  ? 231 LEU B CD1   1 
ATOM   2005 C  CD2   . LEU B 1 103 ? 15.950 51.606  14.841  1.00 19.46  ? 231 LEU B CD2   1 
ATOM   2006 N  N     . MET B 1 104 ? 18.327 50.689  10.148  1.00 18.70  ? 232 MET B N     1 
ATOM   2007 C  CA    . MET B 1 104 ? 18.537 50.955  8.701   1.00 18.38  ? 232 MET B CA    1 
ATOM   2008 C  C     . MET B 1 104 ? 17.468 50.462  7.756   1.00 17.96  ? 232 MET B C     1 
ATOM   2009 O  O     . MET B 1 104 ? 16.863 51.223  6.999   1.00 19.21  ? 232 MET B O     1 
ATOM   2010 C  CB    . MET B 1 104 ? 19.914 50.470  8.239   1.00 18.38  ? 232 MET B CB    1 
ATOM   2011 C  CG    . MET B 1 104 ? 20.325 50.862  6.816   1.00 17.55  ? 232 MET B CG    1 
ATOM   2012 S  SD    . MET B 1 104 ? 20.716 52.601  6.663   1.00 21.34  ? 232 MET B SD    1 
ATOM   2013 C  CE    . MET B 1 104 ? 21.262 52.634  4.946   1.00 18.69  ? 232 MET B CE    1 
ATOM   2014 N  N     . TYR B 1 105 ? 17.227 49.154  7.759   1.00 17.41  ? 233 TYR B N     1 
ATOM   2015 C  CA    . TYR B 1 105 ? 16.186 48.579  6.936   1.00 18.05  ? 233 TYR B CA    1 
ATOM   2016 C  C     . TYR B 1 105 ? 14.812 49.172  7.225   1.00 17.87  ? 233 TYR B C     1 
ATOM   2017 O  O     . TYR B 1 105 ? 14.088 49.562  6.318   1.00 18.88  ? 233 TYR B O     1 
ATOM   2018 C  CB    . TYR B 1 105 ? 16.151 47.014  7.097   1.00 17.14  ? 233 TYR B CB    1 
ATOM   2019 C  CG    . TYR B 1 105 ? 14.985 46.400  6.412   1.00 17.69  ? 233 TYR B CG    1 
ATOM   2020 C  CD1   . TYR B 1 105 ? 15.019 46.148  4.993   1.00 18.38  ? 233 TYR B CD1   1 
ATOM   2021 C  CD2   . TYR B 1 105 ? 13.799 46.161  7.095   1.00 17.96  ? 233 TYR B CD2   1 
ATOM   2022 C  CE1   . TYR B 1 105 ? 13.906 45.645  4.337   1.00 20.75  ? 233 TYR B CE1   1 
ATOM   2023 C  CE2   . TYR B 1 105 ? 12.690 45.652  6.418   1.00 20.97  ? 233 TYR B CE2   1 
ATOM   2024 C  CZ    . TYR B 1 105 ? 12.757 45.367  5.046   1.00 20.74  ? 233 TYR B CZ    1 
ATOM   2025 O  OH    . TYR B 1 105 ? 11.666 44.820  4.404   1.00 24.65  ? 233 TYR B OH    1 
ATOM   2026 N  N     . SER B 1 106 ? 14.519 49.392  8.509   1.00 16.94  ? 234 SER B N     1 
ATOM   2027 C  CA    . SER B 1 106 ? 13.190 49.847  8.908   1.00 16.21  ? 234 SER B CA    1 
ATOM   2028 C  C     . SER B 1 106 ? 12.995 51.293  8.383   1.00 18.29  ? 234 SER B C     1 
ATOM   2029 O  O     . SER B 1 106 ? 11.918 51.618  7.886   1.00 19.54  ? 234 SER B O     1 
ATOM   2030 C  CB    . SER B 1 106 ? 13.051 49.768  10.437  1.00 19.40  ? 234 SER B CB    1 
ATOM   2031 O  OG    . SER B 1 106 ? 11.791 50.309  10.837  1.00 20.78  ? 234 SER B OG    1 
ATOM   2032 N  N     . ALA B 1 107 ? 14.020 52.119  8.463   1.00 17.70  ? 235 ALA B N     1 
ATOM   2033 C  CA    . ALA B 1 107 ? 13.909 53.490  7.995   1.00 19.04  ? 235 ALA B CA    1 
ATOM   2034 C  C     . ALA B 1 107 ? 13.773 53.543  6.485   1.00 19.90  ? 235 ALA B C     1 
ATOM   2035 O  O     . ALA B 1 107 ? 13.094 54.433  5.964   1.00 21.27  ? 235 ALA B O     1 
ATOM   2036 C  CB    . ALA B 1 107 ? 15.123 54.288  8.415   1.00 20.27  ? 235 ALA B CB    1 
ATOM   2037 N  N     . LEU B 1 108 ? 14.369 52.574  5.809   1.00 19.42  ? 236 LEU B N     1 
ATOM   2038 C  CA    . LEU B 1 108 ? 14.303 52.436  4.311   1.00 20.25  ? 236 LEU B CA    1 
ATOM   2039 C  C     . LEU B 1 108 ? 12.927 51.993  3.793   1.00 20.19  ? 236 LEU B C     1 
ATOM   2040 O  O     . LEU B 1 108 ? 12.651 52.063  2.588   1.00 23.45  ? 236 LEU B O     1 
ATOM   2041 C  CB    . LEU B 1 108 ? 15.370 51.518  3.789   1.00 18.85  ? 236 LEU B CB    1 
ATOM   2042 C  CG    . LEU B 1 108 ? 16.775 52.081  3.855   1.00 19.34  ? 236 LEU B CG    1 
ATOM   2043 C  CD1   . LEU B 1 108 ? 17.762 50.994  3.569   1.00 17.87  ? 236 LEU B CD1   1 
ATOM   2044 C  CD2   . LEU B 1 108 ? 16.933 53.249  2.881   1.00 21.20  ? 236 LEU B CD2   1 
ATOM   2045 N  N     . THR B 1 109 ? 12.069 51.591  4.685   1.00 19.33  ? 237 THR B N     1 
ATOM   2046 C  CA    . THR B 1 109 ? 10.676 51.293  4.431   1.00 21.48  ? 237 THR B CA    1 
ATOM   2047 C  C     . THR B 1 109 ? 9.687  52.351  4.648   1.00 26.69  ? 237 THR B C     1 
ATOM   2048 O  O     . THR B 1 109 ? 8.519  52.112  4.304   1.00 26.18  ? 237 THR B O     1 
ATOM   2049 C  CB    . THR B 1 109 ? 10.185 50.051  5.224   1.00 23.31  ? 237 THR B CB    1 
ATOM   2050 O  OG1   . THR B 1 109 ? 9.975  50.359  6.640   1.00 23.32  ? 237 THR B OG1   1 
ATOM   2051 C  CG2   . THR B 1 109 ? 11.111 48.883  5.032   1.00 25.47  ? 237 THR B CG2   1 
ATOM   2052 N  N     . ARG B 1 110 ? 10.101 53.507  5.198   1.00 25.78  ? 238 ARG B N     1 
ATOM   2053 C  CA    . ARG B 1 110 ? 9.183  54.573  5.533   1.00 30.26  ? 238 ARG B CA    1 
ATOM   2054 C  C     . ARG B 1 110 ? 9.620  55.857  4.899   1.00 25.87  ? 238 ARG B C     1 
ATOM   2055 O  O     . ARG B 1 110 ? 10.795 56.089  4.626   1.00 24.57  ? 238 ARG B O     1 
ATOM   2056 C  CB    . ARG B 1 110 ? 9.100  54.776  7.036   1.00 37.44  ? 238 ARG B CB    1 
ATOM   2057 C  CG    . ARG B 1 110 ? 8.488  53.620  7.789   1.00 46.25  ? 238 ARG B CG    1 
ATOM   2058 C  CD    . ARG B 1 110 ? 8.249  54.028  9.251   1.00 49.20  ? 238 ARG B CD    1 
ATOM   2059 N  NE    . ARG B 1 110 ? 9.508  54.463  9.847   1.00 50.15  ? 238 ARG B NE    1 
ATOM   2060 C  CZ    . ARG B 1 110 ? 10.451 53.631  10.313  1.00 41.44  ? 238 ARG B CZ    1 
ATOM   2061 N  NH1   . ARG B 1 110 ? 10.254 52.321  10.268  1.00 41.43  ? 238 ARG B NH1   1 
ATOM   2062 N  NH2   . ARG B 1 110 ? 11.613 54.129  10.774  1.00 38.39  ? 238 ARG B NH2   1 
ATOM   2063 N  N     . ASP B 1 111 ? 8.647  56.704  4.638   1.00 28.71  ? 239 ASP B N     1 
ATOM   2064 C  CA    . ASP B 1 111 ? 8.886  58.072  4.119   1.00 32.86  ? 239 ASP B CA    1 
ATOM   2065 C  C     . ASP B 1 111 ? 10.135 58.699  4.712   1.00 29.39  ? 239 ASP B C     1 
ATOM   2066 O  O     . ASP B 1 111 ? 10.336 58.658  5.925   1.00 33.83  ? 239 ASP B O     1 
ATOM   2067 C  CB    . ASP B 1 111 ? 7.664  58.937  4.386   1.00 36.84  ? 239 ASP B CB    1 
ATOM   2068 C  CG    . ASP B 1 111 ? 6.470  58.541  3.517   1.00 44.92  ? 239 ASP B CG    1 
ATOM   2069 O  OD1   . ASP B 1 111 ? 6.656  57.830  2.489   1.00 51.40  ? 239 ASP B OD1   1 
ATOM   2070 O  OD2   . ASP B 1 111 ? 5.341  58.943  3.846   1.00 49.59  ? 239 ASP B OD2   1 
ATOM   2071 N  N     . PRO B 1 112 ? 11.007 59.272  3.916   1.00 30.75  ? 240 PRO B N     1 
ATOM   2072 C  CA    . PRO B 1 112 ? 10.892 59.514  2.486   1.00 29.70  ? 240 PRO B CA    1 
ATOM   2073 C  C     . PRO B 1 112 ? 11.236 58.290  1.582   1.00 28.36  ? 240 PRO B C     1 
ATOM   2074 O  O     . PRO B 1 112 ? 11.252 58.396  0.364   1.00 28.01  ? 240 PRO B O     1 
ATOM   2075 C  CB    . PRO B 1 112 ? 11.892 60.631  2.297   1.00 31.92  ? 240 PRO B CB    1 
ATOM   2076 C  CG    . PRO B 1 112 ? 12.983 60.287  3.232   1.00 30.81  ? 240 PRO B CG    1 
ATOM   2077 C  CD    . PRO B 1 112 ? 12.267 59.799  4.467   1.00 31.84  ? 240 PRO B CD    1 
ATOM   2078 N  N     . PHE B 1 113 ? 11.543 57.154  2.188   1.00 24.24  ? 241 PHE B N     1 
ATOM   2079 C  CA    . PHE B 1 113 ? 12.008 55.961  1.486   1.00 25.48  ? 241 PHE B CA    1 
ATOM   2080 C  C     . PHE B 1 113 ? 10.862 55.006  1.286   1.00 25.85  ? 241 PHE B C     1 
ATOM   2081 O  O     . PHE B 1 113 ? 9.802  55.143  1.892   1.00 26.66  ? 241 PHE B O     1 
ATOM   2082 C  CB    . PHE B 1 113 ? 13.167 55.264  2.217   1.00 23.97  ? 241 PHE B CB    1 
ATOM   2083 C  CG    . PHE B 1 113 ? 14.278 56.218  2.622   1.00 25.73  ? 241 PHE B CG    1 
ATOM   2084 C  CD1   . PHE B 1 113 ? 15.157 56.731  1.693   1.00 25.72  ? 241 PHE B CD1   1 
ATOM   2085 C  CD2   . PHE B 1 113 ? 14.378 56.685  3.945   1.00 24.88  ? 241 PHE B CD2   1 
ATOM   2086 C  CE1   . PHE B 1 113 ? 16.164 57.597  2.063   1.00 24.86  ? 241 PHE B CE1   1 
ATOM   2087 C  CE2   . PHE B 1 113 ? 15.378 57.574  4.305   1.00 26.11  ? 241 PHE B CE2   1 
ATOM   2088 C  CZ    . PHE B 1 113 ? 16.266 58.033  3.387   1.00 25.21  ? 241 PHE B CZ    1 
ATOM   2089 N  N     . SER B 1 114 ? 11.076 54.045  0.378   1.00 25.83  ? 242 SER B N     1 
ATOM   2090 C  CA    . SER B 1 114 ? 10.151 52.975  0.187   1.00 25.21  ? 242 SER B CA    1 
ATOM   2091 C  C     . SER B 1 114 ? 10.827 51.779  -0.438  1.00 25.10  ? 242 SER B C     1 
ATOM   2092 O  O     . SER B 1 114 ? 11.876 51.892  -1.073  1.00 25.98  ? 242 SER B O     1 
ATOM   2093 C  CB    . SER B 1 114 ? 8.977  53.436  -0.633  1.00 28.47  ? 242 SER B CB    1 
ATOM   2094 O  OG    . SER B 1 114 ? 9.373  53.940  -1.924  1.00 27.82  ? 242 SER B OG    1 
ATOM   2095 N  N     . VAL B 1 115 ? 10.228 50.611  -0.226  1.00 24.02  ? 243 VAL B N     1 
ATOM   2096 C  CA    . VAL B 1 115 ? 10.704 49.384  -0.841  1.00 24.43  ? 243 VAL B CA    1 
ATOM   2097 C  C     . VAL B 1 115 ? 10.282 49.297  -2.291  1.00 24.77  ? 243 VAL B C     1 
ATOM   2098 O  O     . VAL B 1 115 ? 9.108  49.414  -2.624  1.00 24.41  ? 243 VAL B O     1 
ATOM   2099 C  CB    . VAL B 1 115 ? 10.168 48.143  -0.090  1.00 24.37  ? 243 VAL B CB    1 
ATOM   2100 C  CG1   . VAL B 1 115 ? 10.557 46.869  -0.851  1.00 26.02  ? 243 VAL B CG1   1 
ATOM   2101 C  CG2   . VAL B 1 115 ? 10.678 48.121  1.318   1.00 26.41  ? 243 VAL B CG2   1 
ATOM   2102 N  N     . ILE B 1 116 ? 11.225 49.053  -3.172  1.00 23.52  ? 244 ILE B N     1 
ATOM   2103 C  CA    . ILE B 1 116 ? 10.910 48.794  -4.587  1.00 23.84  ? 244 ILE B CA    1 
ATOM   2104 C  C     . ILE B 1 116 ? 10.753 47.289  -4.782  1.00 23.46  ? 244 ILE B C     1 
ATOM   2105 O  O     . ILE B 1 116 ? 9.783  46.842  -5.378  1.00 25.12  ? 244 ILE B O     1 
ATOM   2106 C  CB    . ILE B 1 116 ? 11.991 49.332  -5.502  1.00 23.36  ? 244 ILE B CB    1 
ATOM   2107 C  CG1   . ILE B 1 116 ? 12.019 50.879  -5.407  1.00 25.50  ? 244 ILE B CG1   1 
ATOM   2108 C  CG2   . ILE B 1 116 ? 11.748 48.943  -6.947  1.00 24.09  ? 244 ILE B CG2   1 
ATOM   2109 C  CD1   . ILE B 1 116 ? 13.277 51.493  -5.999  1.00 26.94  ? 244 ILE B CD1   1 
ATOM   2110 N  N     . GLU B 1 117 ? 11.749 46.553  -4.352  1.00 22.45  ? 245 GLU B N     1 
ATOM   2111 C  CA    . GLU B 1 117 ? 11.705 45.075  -4.439  1.00 24.54  ? 245 GLU B CA    1 
ATOM   2112 C  C     . GLU B 1 117 ? 12.553 44.520  -3.316  1.00 24.16  ? 245 GLU B C     1 
ATOM   2113 O  O     . GLU B 1 117 ? 13.507 45.174  -2.895  1.00 21.36  ? 245 GLU B O     1 
ATOM   2114 C  CB    . GLU B 1 117 ? 12.145 44.598  -5.851  1.00 24.13  ? 245 GLU B CB    1 
ATOM   2115 C  CG    . GLU B 1 117 ? 13.582 44.972  -6.216  1.00 24.76  ? 245 GLU B CG    1 
ATOM   2116 C  CD    . GLU B 1 117 ? 14.033 44.570  -7.603  1.00 28.05  ? 245 GLU B CD    1 
ATOM   2117 O  OE1   . GLU B 1 117 ? 13.530 43.558  -8.132  1.00 28.57  ? 245 GLU B OE1   1 
ATOM   2118 O  OE2   . GLU B 1 117 ? 14.970 45.226  -8.125  1.00 26.90  ? 245 GLU B OE2   1 
ATOM   2119 N  N     . GLU B 1 118 ? 12.246 43.305  -2.841  1.00 21.99  ? 246 GLU B N     1 
ATOM   2120 C  CA    . GLU B 1 118 ? 13.080 42.630  -1.886  1.00 23.66  ? 246 GLU B CA    1 
ATOM   2121 C  C     . GLU B 1 118 ? 13.023 41.135  -2.064  1.00 23.66  ? 246 GLU B C     1 
ATOM   2122 O  O     . GLU B 1 118 ? 12.111 40.589  -2.711  1.00 23.06  ? 246 GLU B O     1 
ATOM   2123 C  CB    . GLU B 1 118 ? 12.745 43.031  -0.445  1.00 22.72  ? 246 GLU B CB    1 
ATOM   2124 C  CG    . GLU B 1 118 ? 11.273 42.958  -0.080  1.00 23.97  ? 246 GLU B CG    1 
ATOM   2125 C  CD    . GLU B 1 118 ? 10.934 43.726  1.206   1.00 25.60  ? 246 GLU B CD    1 
ATOM   2126 O  OE1   . GLU B 1 118 ? 11.870 44.169  1.921   1.00 22.80  ? 246 GLU B OE1   1 
ATOM   2127 O  OE2   . GLU B 1 118 ? 9.711  43.805  1.527   1.00 27.54  ? 246 GLU B OE2   1 
ATOM   2128 N  N     . SER B 1 119 ? 14.044 40.473  -1.538  1.00 24.19  ? 247 SER B N     1 
ATOM   2129 C  CA    . SER B 1 119 ? 14.253 39.030  -1.884  1.00 22.96  ? 247 SER B CA    1 
ATOM   2130 C  C     . SER B 1 119 ? 13.364 38.048  -1.114  1.00 25.50  ? 247 SER B C     1 
ATOM   2131 O  O     . SER B 1 119 ? 13.273 36.860  -1.509  1.00 25.46  ? 247 SER B O     1 
ATOM   2132 C  CB    . SER B 1 119 ? 15.741 38.673  -1.689  1.00 21.82  ? 247 SER B CB    1 
ATOM   2133 O  OG    . SER B 1 119 ? 16.075 38.832  -0.345  1.00 23.31  ? 247 SER B OG    1 
ATOM   2134 N  N     . LEU B 1 120 ? 12.745 38.505  -0.027  1.00 25.04  ? 248 LEU B N     1 
ATOM   2135 C  CA    . LEU B 1 120 ? 11.720 37.764  0.724   1.00 26.71  ? 248 LEU B CA    1 
ATOM   2136 C  C     . LEU B 1 120 ? 10.339 38.450  0.738   1.00 26.66  ? 248 LEU B C     1 
ATOM   2137 O  O     . LEU B 1 120 ? 10.225 39.628  1.173   1.00 26.02  ? 248 LEU B O     1 
ATOM   2138 C  CB    . LEU B 1 120 ? 12.131 37.628  2.212   1.00 27.93  ? 248 LEU B CB    1 
ATOM   2139 C  CG    . LEU B 1 120 ? 13.209 36.653  2.617   1.00 33.61  ? 248 LEU B CG    1 
ATOM   2140 C  CD1   . LEU B 1 120 ? 13.355 36.664  4.139   1.00 36.91  ? 248 LEU B CD1   1 
ATOM   2141 C  CD2   . LEU B 1 120 ? 12.903 35.220  2.127   1.00 35.12  ? 248 LEU B CD2   1 
ATOM   2142 N  N     . PRO B 1 121 ? 9.281  37.709  0.392   1.00 28.58  ? 249 PRO B N     1 
ATOM   2143 C  CA    . PRO B 1 121 ? 7.935  38.330  0.410   1.00 30.69  ? 249 PRO B CA    1 
ATOM   2144 C  C     . PRO B 1 121 ? 7.568  38.798  1.808   1.00 30.03  ? 249 PRO B C     1 
ATOM   2145 O  O     . PRO B 1 121 ? 7.724  38.024  2.749   1.00 32.64  ? 249 PRO B O     1 
ATOM   2146 C  CB    . PRO B 1 121 ? 7.015  37.189  -0.033  1.00 34.29  ? 249 PRO B CB    1 
ATOM   2147 C  CG    . PRO B 1 121 ? 7.903  36.302  -0.846  1.00 34.63  ? 249 PRO B CG    1 
ATOM   2148 C  CD    . PRO B 1 121 ? 9.225  36.332  -0.144  1.00 31.76  ? 249 PRO B CD    1 
ATOM   2149 N  N     . GLY B 1 122 ? 7.113  40.034  1.930   1.00 30.19  ? 250 GLY B N     1 
ATOM   2150 C  CA    . GLY B 1 122 ? 6.798  40.614  3.257   1.00 30.25  ? 250 GLY B CA    1 
ATOM   2151 C  C     . GLY B 1 122 ? 8.006  41.237  3.942   1.00 27.47  ? 250 GLY B C     1 
ATOM   2152 O  O     . GLY B 1 122 ? 7.849  41.945  4.928   1.00 28.13  ? 250 GLY B O     1 
ATOM   2153 N  N     . GLY B 1 123 ? 9.203  41.034  3.402   1.00 25.23  ? 251 GLY B N     1 
ATOM   2154 C  CA    . GLY B 1 123 ? 10.388 41.661  3.961   1.00 21.79  ? 251 GLY B CA    1 
ATOM   2155 C  C     . GLY B 1 123 ? 10.701 41.205  5.376   1.00 23.57  ? 251 GLY B C     1 
ATOM   2156 O  O     . GLY B 1 123 ? 10.472 40.026  5.743   1.00 22.58  ? 251 GLY B O     1 
ATOM   2157 N  N     . LEU B 1 124 ? 11.295 42.129  6.141   1.00 21.40  ? 252 LEU B N     1 
ATOM   2158 C  CA    . LEU B 1 124 ? 11.796 41.828  7.452   1.00 21.18  ? 252 LEU B CA    1 
ATOM   2159 C  C     . LEU B 1 124 ? 11.083 42.654  8.462   1.00 22.29  ? 252 LEU B C     1 
ATOM   2160 O  O     . LEU B 1 124 ? 10.540 43.690  8.157   1.00 22.04  ? 252 LEU B O     1 
ATOM   2161 C  CB    . LEU B 1 124 ? 13.315 42.088  7.553   1.00 21.28  ? 252 LEU B CB    1 
ATOM   2162 C  CG    . LEU B 1 124 ? 14.253 41.392  6.594   1.00 20.83  ? 252 LEU B CG    1 
ATOM   2163 C  CD1   . LEU B 1 124 ? 15.719 41.802  6.724   1.00 19.79  ? 252 LEU B CD1   1 
ATOM   2164 C  CD2   . LEU B 1 124 ? 14.164 39.866  6.773   1.00 24.91  ? 252 LEU B CD2   1 
ATOM   2165 N  N     . LYS B 1 125 ? 11.087 42.141  9.686   1.00 22.56  ? 253 LYS B N     1 
ATOM   2166 C  CA    . LYS B 1 125 ? 10.486 42.787  10.820  1.00 23.82  ? 253 LYS B CA    1 
ATOM   2167 C  C     . LYS B 1 125 ? 11.481 42.746  11.994  1.00 23.18  ? 253 LYS B C     1 
ATOM   2168 O  O     . LYS B 1 125 ? 12.472 42.048  11.992  1.00 20.71  ? 253 LYS B O     1 
ATOM   2169 C  CB    . LYS B 1 125 ? 9.232  42.053  11.240  1.00 28.74  ? 253 LYS B CB    1 
ATOM   2170 C  CG    . LYS B 1 125 ? 8.096  42.007  10.228  1.00 36.71  ? 253 LYS B CG    1 
ATOM   2171 C  CD    . LYS B 1 125 ? 7.490  43.385  10.000  1.00 44.11  ? 253 LYS B CD    1 
ATOM   2172 C  CE    . LYS B 1 125 ? 6.190  43.364  9.184   1.00 48.45  ? 253 LYS B CE    1 
ATOM   2173 N  NZ    . LYS B 1 125 ? 6.454  43.468  7.738   1.00 48.14  ? 253 LYS B NZ    1 
ATOM   2174 N  N     . GLU B 1 126 ? 11.208 43.545  13.022  1.00 21.72  ? 254 GLU B N     1 
ATOM   2175 C  CA    . GLU B 1 126 ? 12.079 43.564  14.200  1.00 21.64  ? 254 GLU B CA    1 
ATOM   2176 C  C     . GLU B 1 126 ? 12.337 42.197  14.825  1.00 20.51  ? 254 GLU B C     1 
ATOM   2177 O  O     . GLU B 1 126 ? 13.460 41.913  15.225  1.00 21.65  ? 254 GLU B O     1 
ATOM   2178 C  CB    . GLU B 1 126 ? 11.500 44.541  15.230  1.00 21.03  ? 254 GLU B CB    1 
ATOM   2179 C  CG    . GLU B 1 126 ? 12.212 44.513  16.566  1.00 24.34  ? 254 GLU B CG    1 
ATOM   2180 C  CD    . GLU B 1 126 ? 11.787 45.651  17.520  1.00 25.88  ? 254 GLU B CD    1 
ATOM   2181 O  OE1   . GLU B 1 126 ? 11.041 46.552  17.089  1.00 26.22  ? 254 GLU B OE1   1 
ATOM   2182 O  OE2   . GLU B 1 126 ? 12.193 45.634  18.707  1.00 23.88  ? 254 GLU B OE2   1 
ATOM   2183 N  N     . HIS B 1 127 ? 11.316 41.377  14.896  1.00 20.70  ? 255 HIS B N     1 
ATOM   2184 C  CA    . HIS B 1 127 ? 11.451 39.996  15.341  1.00 25.07  ? 255 HIS B CA    1 
ATOM   2185 C  C     . HIS B 1 127 ? 12.611 39.258  14.651  1.00 24.75  ? 255 HIS B C     1 
ATOM   2186 O  O     . HIS B 1 127 ? 13.312 38.434  15.286  1.00 25.79  ? 255 HIS B O     1 
ATOM   2187 C  CB    . HIS B 1 127 ? 10.118 39.261  15.078  1.00 29.71  ? 255 HIS B CB    1 
ATOM   2188 C  CG    . HIS B 1 127 ? 10.160 37.791  15.315  1.00 36.26  ? 255 HIS B CG    1 
ATOM   2189 N  ND1   . HIS B 1 127 ? 10.239 36.862  14.287  1.00 40.26  ? 255 HIS B ND1   1 
ATOM   2190 C  CD2   . HIS B 1 127 ? 10.108 37.082  16.463  1.00 39.79  ? 255 HIS B CD2   1 
ATOM   2191 C  CE1   . HIS B 1 127 ? 10.257 35.646  14.806  1.00 37.46  ? 255 HIS B CE1   1 
ATOM   2192 N  NE2   . HIS B 1 127 ? 10.177 35.752  16.118  1.00 40.98  ? 255 HIS B NE2   1 
ATOM   2193 N  N     . ASP B 1 128 ? 12.808 39.514  13.344  1.00 22.86  ? 256 ASP B N     1 
ATOM   2194 C  CA    . ASP B 1 128 ? 13.855 38.830  12.589  1.00 22.71  ? 256 ASP B CA    1 
ATOM   2195 C  C     . ASP B 1 128 ? 15.304 39.207  12.974  1.00 22.48  ? 256 ASP B C     1 
ATOM   2196 O  O     . ASP B 1 128 ? 16.251 38.487  12.680  1.00 23.40  ? 256 ASP B O     1 
ATOM   2197 C  CB    . ASP B 1 128 ? 13.671 39.106  11.044  1.00 22.08  ? 256 ASP B CB    1 
ATOM   2198 C  CG    . ASP B 1 128 ? 12.333 38.653  10.562  1.00 21.98  ? 256 ASP B CG    1 
ATOM   2199 O  OD1   . ASP B 1 128 ? 11.984 37.487  10.843  1.00 21.98  ? 256 ASP B OD1   1 
ATOM   2200 O  OD2   . ASP B 1 128 ? 11.637 39.426  9.921   1.00 23.35  ? 256 ASP B OD2   1 
ATOM   2201 N  N     . PHE B 1 129 ? 15.472 40.354  13.636  1.00 21.47  ? 257 PHE B N     1 
ATOM   2202 C  CA    . PHE B 1 129 ? 16.813 40.802  14.100  1.00 22.08  ? 257 PHE B CA    1 
ATOM   2203 C  C     . PHE B 1 129 ? 17.021 40.486  15.606  1.00 26.98  ? 257 PHE B C     1 
ATOM   2204 O  O     . PHE B 1 129 ? 18.009 40.963  16.223  1.00 31.63  ? 257 PHE B O     1 
ATOM   2205 C  CB    . PHE B 1 129 ? 16.951 42.313  13.818  1.00 20.50  ? 257 PHE B CB    1 
ATOM   2206 C  CG    . PHE B 1 129 ? 16.971 42.690  12.391  1.00 20.96  ? 257 PHE B CG    1 
ATOM   2207 C  CD1   . PHE B 1 129 ? 15.784 42.921  11.704  1.00 18.14  ? 257 PHE B CD1   1 
ATOM   2208 C  CD2   . PHE B 1 129 ? 18.177 42.865  11.709  1.00 19.50  ? 257 PHE B CD2   1 
ATOM   2209 C  CE1   . PHE B 1 129 ? 15.780 43.281  10.376  1.00 18.94  ? 257 PHE B CE1   1 
ATOM   2210 C  CE2   . PHE B 1 129 ? 18.170 43.192  10.370  1.00 18.20  ? 257 PHE B CE2   1 
ATOM   2211 C  CZ    . PHE B 1 129 ? 16.968 43.446  9.704   1.00 19.62  ? 257 PHE B CZ    1 
ATOM   2212 N  N     . ASN B 1 130 ? 16.117 39.700  16.183  1.00 25.30  ? 258 ASN B N     1 
ATOM   2213 C  CA    . ASN B 1 130 ? 16.300 39.091  17.473  1.00 27.42  ? 258 ASN B CA    1 
ATOM   2214 C  C     . ASN B 1 130 ? 16.828 37.652  17.253  1.00 33.32  ? 258 ASN B C     1 
ATOM   2215 O  O     . ASN B 1 130 ? 16.573 37.065  16.184  1.00 31.03  ? 258 ASN B O     1 
ATOM   2216 C  CB    . ASN B 1 130 ? 14.976 39.089  18.289  1.00 25.36  ? 258 ASN B CB    1 
ATOM   2217 C  CG    . ASN B 1 130 ? 14.696 40.433  18.963  1.00 26.30  ? 258 ASN B CG    1 
ATOM   2218 O  OD1   . ASN B 1 130 ? 14.745 40.537  20.193  1.00 27.72  ? 258 ASN B OD1   1 
ATOM   2219 N  ND2   . ASN B 1 130 ? 14.454 41.451  18.195  1.00 23.36  ? 258 ASN B ND2   1 
ATOM   2220 N  N     . PRO B 1 131 ? 17.549 37.078  18.247  1.00 36.87  ? 259 PRO B N     1 
ATOM   2221 C  CA    . PRO B 1 131 ? 17.935 35.651  18.198  1.00 36.29  ? 259 PRO B CA    1 
ATOM   2222 C  C     . PRO B 1 131 ? 16.761 34.759  17.924  1.00 37.36  ? 259 PRO B C     1 
ATOM   2223 O  O     . PRO B 1 131 ? 15.639 35.016  18.394  1.00 32.83  ? 259 PRO B O     1 
ATOM   2224 C  CB    . PRO B 1 131 ? 18.442 35.392  19.623  1.00 40.90  ? 259 PRO B CB    1 
ATOM   2225 C  CG    . PRO B 1 131 ? 18.926 36.675  20.093  1.00 38.89  ? 259 PRO B CG    1 
ATOM   2226 C  CD    . PRO B 1 131 ? 17.991 37.704  19.519  1.00 38.57  ? 259 PRO B CD    1 
ATOM   2227 N  N     . GLU B 1 132 ? 16.999 33.679  17.174  1.00 41.01  ? 260 GLU B N     1 
ATOM   2228 C  CA    . GLU B 1 132 ? 15.914 32.814  16.784  1.00 40.84  ? 260 GLU B CA    1 
ATOM   2229 C  C     . GLU B 1 132 ? 15.143 32.226  17.962  1.00 37.61  ? 260 GLU B C     1 
ATOM   2230 O  O     . GLU B 1 132 ? 15.773 31.784  18.893  1.00 39.00  ? 260 GLU B O     1 
ATOM   2231 C  CB    . GLU B 1 132 ? 16.452 31.676  15.864  1.00 46.42  ? 260 GLU B CB    1 
ATOM   2232 C  CG    . GLU B 1 132 ? 15.355 30.887  15.166  1.00 47.68  ? 260 GLU B CG    1 
ATOM   2233 C  CD    . GLU B 1 132 ? 14.260 31.775  14.567  1.00 57.10  ? 260 GLU B CD    1 
ATOM   2234 O  OE1   . GLU B 1 132 ? 14.589 32.834  13.962  1.00 53.04  ? 260 GLU B OE1   1 
ATOM   2235 O  OE2   . GLU B 1 132 ? 13.066 31.418  14.737  1.00 64.74  ? 260 GLU B OE2   1 
ATOM   2236 C  "C5'" . DG  C 2 1   ? 50.658 52.344  20.489  1.00 48.34  ? 1   DG  X "C5'" 1 
ATOM   2237 C  "C4'" . DG  C 2 1   ? 49.836 52.938  19.368  1.00 46.62  ? 1   DG  X "C4'" 1 
ATOM   2238 O  "O4'" . DG  C 2 1   ? 48.436 52.573  19.509  1.00 45.24  ? 1   DG  X "O4'" 1 
ATOM   2239 C  "C3'" . DG  C 2 1   ? 49.853 54.461  19.270  1.00 46.58  ? 1   DG  X "C3'" 1 
ATOM   2240 O  "O3'" . DG  C 2 1   ? 49.579 54.840  17.925  1.00 46.43  ? 1   DG  X "O3'" 1 
ATOM   2241 C  "C2'" . DG  C 2 1   ? 48.615 54.845  20.052  1.00 46.02  ? 1   DG  X "C2'" 1 
ATOM   2242 C  "C1'" . DG  C 2 1   ? 47.664 53.751  19.587  1.00 44.96  ? 1   DG  X "C1'" 1 
ATOM   2243 N  N9    . DG  C 2 1   ? 46.498 53.493  20.425  1.00 44.24  ? 1   DG  X N9    1 
ATOM   2244 C  C8    . DG  C 2 1   ? 46.347 53.703  21.777  1.00 45.19  ? 1   DG  X C8    1 
ATOM   2245 N  N7    . DG  C 2 1   ? 45.145 53.428  22.205  1.00 44.94  ? 1   DG  X N7    1 
ATOM   2246 C  C5    . DG  C 2 1   ? 44.454 53.044  21.063  1.00 43.53  ? 1   DG  X C5    1 
ATOM   2247 C  C6    . DG  C 2 1   ? 43.088 52.687  20.888  1.00 43.13  ? 1   DG  X C6    1 
ATOM   2248 O  O6    . DG  C 2 1   ? 42.195 52.619  21.739  1.00 44.06  ? 1   DG  X O6    1 
ATOM   2249 N  N1    . DG  C 2 1   ? 42.807 52.376  19.560  1.00 42.03  ? 1   DG  X N1    1 
ATOM   2250 C  C2    . DG  C 2 1   ? 43.708 52.450  18.522  1.00 41.23  ? 1   DG  X C2    1 
ATOM   2251 N  N2    . DG  C 2 1   ? 43.243 52.139  17.303  1.00 40.58  ? 1   DG  X N2    1 
ATOM   2252 N  N3    . DG  C 2 1   ? 44.971 52.818  18.667  1.00 41.40  ? 1   DG  X N3    1 
ATOM   2253 C  C4    . DG  C 2 1   ? 45.274 53.089  19.956  1.00 42.94  ? 1   DG  X C4    1 
ATOM   2254 P  P     . DA  C 2 2   ? 50.453 55.938  17.152  1.00 48.10  ? 2   DA  X P     1 
ATOM   2255 O  OP1   . DA  C 2 2   ? 51.863 55.469  17.156  1.00 50.46  ? 2   DA  X OP1   1 
ATOM   2256 O  OP2   . DA  C 2 2   ? 50.099 57.287  17.626  1.00 46.83  ? 2   DA  X OP2   1 
ATOM   2257 O  "O5'" . DA  C 2 2   ? 49.918 55.765  15.661  1.00 47.35  ? 2   DA  X "O5'" 1 
ATOM   2258 C  "C5'" . DA  C 2 2   ? 50.126 54.531  14.930  1.00 46.15  ? 2   DA  X "C5'" 1 
ATOM   2259 C  "C4'" . DA  C 2 2   ? 49.169 54.481  13.761  1.00 45.47  ? 2   DA  X "C4'" 1 
ATOM   2260 O  "O4'" . DA  C 2 2   ? 47.819 54.248  14.246  1.00 43.88  ? 2   DA  X "O4'" 1 
ATOM   2261 C  "C3'" . DA  C 2 2   ? 49.099 55.773  12.942  1.00 45.27  ? 2   DA  X "C3'" 1 
ATOM   2262 O  "O3'" . DA  C 2 2   ? 48.811 55.457  11.587  1.00 47.08  ? 2   DA  X "O3'" 1 
ATOM   2263 C  "C2'" . DA  C 2 2   ? 47.879 56.477  13.503  1.00 43.84  ? 2   DA  X "C2'" 1 
ATOM   2264 C  "C1'" . DA  C 2 2   ? 46.966 55.316  13.861  1.00 42.94  ? 2   DA  X "C1'" 1 
ATOM   2265 N  N9    . DA  C 2 2   ? 46.048 55.579  14.968  1.00 41.26  ? 2   DA  X N9    1 
ATOM   2266 C  C8    . DA  C 2 2   ? 46.362 55.798  16.287  1.00 41.04  ? 2   DA  X C8    1 
ATOM   2267 N  N7    . DA  C 2 2   ? 45.317 55.979  17.056  1.00 40.69  ? 2   DA  X N7    1 
ATOM   2268 C  C5    . DA  C 2 2   ? 44.241 55.865  16.190  1.00 40.22  ? 2   DA  X C5    1 
ATOM   2269 C  C6    . DA  C 2 2   ? 42.853 55.991  16.382  1.00 40.25  ? 2   DA  X C6    1 
ATOM   2270 N  N6    . DA  C 2 2   ? 42.289 56.233  17.569  1.00 40.31  ? 2   DA  X N6    1 
ATOM   2271 N  N1    . DA  C 2 2   ? 42.054 55.848  15.299  1.00 40.18  ? 2   DA  X N1    1 
ATOM   2272 C  C2    . DA  C 2 2   ? 42.621 55.615  14.108  1.00 40.14  ? 2   DA  X C2    1 
ATOM   2273 N  N3    . DA  C 2 2   ? 43.909 55.472  13.803  1.00 40.26  ? 2   DA  X N3    1 
ATOM   2274 C  C4    . DA  C 2 2   ? 44.677 55.636  14.896  1.00 40.43  ? 2   DA  X C4    1 
ATOM   2275 P  P     . DG  C 2 3   ? 49.119 56.492  10.364  1.00 49.64  ? 3   DG  X P     1 
ATOM   2276 O  OP1   . DG  C 2 3   ? 49.272 55.626  9.137   1.00 50.80  ? 3   DG  X OP1   1 
ATOM   2277 O  OP2   . DG  C 2 3   ? 50.197 57.438  10.766  1.00 48.57  ? 3   DG  X OP2   1 
ATOM   2278 O  "O5'" . DG  C 2 3   ? 47.824 57.404  10.232  1.00 49.06  ? 3   DG  X "O5'" 1 
ATOM   2279 C  "C5'" . DG  C 2 3   ? 46.569 56.849  9.840   1.00 50.67  ? 3   DG  X "C5'" 1 
ATOM   2280 C  "C4'" . DG  C 2 3   ? 45.468 57.843  10.122  1.00 52.10  ? 3   DG  X "C4'" 1 
ATOM   2281 O  "O4'" . DG  C 2 3   ? 45.307 58.022  11.549  1.00 50.07  ? 3   DG  X "O4'" 1 
ATOM   2282 C  "C3'" . DG  C 2 3   ? 45.724 59.246  9.559   1.00 54.42  ? 3   DG  X "C3'" 1 
ATOM   2283 O  "O3'" . DG  C 2 3   ? 44.477 59.743  9.097   1.00 60.45  ? 3   DG  X "O3'" 1 
ATOM   2284 C  "C2'" . DG  C 2 3   ? 46.209 60.034  10.762  1.00 52.03  ? 3   DG  X "C2'" 1 
ATOM   2285 C  "C1'" . DG  C 2 3   ? 45.360 59.415  11.856  1.00 50.08  ? 3   DG  X "C1'" 1 
ATOM   2286 N  N9    . DG  C 2 3   ? 45.835 59.542  13.229  1.00 47.75  ? 3   DG  X N9    1 
ATOM   2287 C  C8    . DG  C 2 3   ? 47.131 59.622  13.678  1.00 47.96  ? 3   DG  X C8    1 
ATOM   2288 N  N7    . DG  C 2 3   ? 47.221 59.639  14.980  1.00 47.17  ? 3   DG  X N7    1 
ATOM   2289 C  C5    . DG  C 2 3   ? 45.906 59.551  15.416  1.00 46.10  ? 3   DG  X C5    1 
ATOM   2290 C  C6    . DG  C 2 3   ? 45.369 59.546  16.731  1.00 45.59  ? 3   DG  X C6    1 
ATOM   2291 O  O6    . DG  C 2 3   ? 45.972 59.578  17.809  1.00 45.37  ? 3   DG  X O6    1 
ATOM   2292 N  N1    . DG  C 2 3   ? 43.979 59.473  16.717  1.00 44.36  ? 3   DG  X N1    1 
ATOM   2293 C  C2    . DG  C 2 3   ? 43.205 59.383  15.586  1.00 44.47  ? 3   DG  X C2    1 
ATOM   2294 N  N2    . DG  C 2 3   ? 41.879 59.310  15.777  1.00 43.82  ? 3   DG  X N2    1 
ATOM   2295 N  N3    . DG  C 2 3   ? 43.693 59.394  14.355  1.00 44.74  ? 3   DG  X N3    1 
ATOM   2296 C  C4    . DG  C 2 3   ? 45.039 59.496  14.346  1.00 46.05  ? 3   DG  X C4    1 
ATOM   2297 P  P     . DG  C 2 4   ? 44.443 60.842  7.959   1.00 70.32  ? 4   DG  X P     1 
ATOM   2298 O  OP1   . DG  C 2 4   ? 44.521 60.138  6.651   1.00 70.98  ? 4   DG  X OP1   1 
ATOM   2299 O  OP2   . DG  C 2 4   ? 45.425 61.886  8.310   1.00 66.02  ? 4   DG  X OP2   1 
ATOM   2300 O  "O5'" . DG  C 2 4   ? 42.976 61.435  8.080   1.00 69.50  ? 4   DG  X "O5'" 1 
ATOM   2301 C  "C5'" . DG  C 2 4   ? 41.833 60.571  8.189   1.00 71.97  ? 4   DG  X "C5'" 1 
ATOM   2302 C  "C4'" . DG  C 2 4   ? 40.854 61.193  9.153   1.00 74.22  ? 4   DG  X "C4'" 1 
ATOM   2303 O  "O4'" . DG  C 2 4   ? 41.400 61.164  10.497  1.00 71.96  ? 4   DG  X "O4'" 1 
ATOM   2304 C  "C3'" . DG  C 2 4   ? 40.565 62.664  8.855   1.00 76.58  ? 4   DG  X "C3'" 1 
ATOM   2305 O  "O3'" . DG  C 2 4   ? 39.187 62.890  9.132   1.00 86.57  ? 4   DG  X "O3'" 1 
ATOM   2306 C  "C2'" . DG  C 2 4   ? 41.467 63.395  9.829   1.00 72.38  ? 4   DG  X "C2'" 1 
ATOM   2307 C  "C1'" . DG  C 2 4   ? 41.383 62.477  11.030  1.00 66.70  ? 4   DG  X "C1'" 1 
ATOM   2308 N  N9    . DG  C 2 4   ? 42.482 62.596  11.979  1.00 61.63  ? 4   DG  X N9    1 
ATOM   2309 C  C8    . DG  C 2 4   ? 43.818 62.755  11.695  1.00 61.73  ? 4   DG  X C8    1 
ATOM   2310 N  N7    . DG  C 2 4   ? 44.558 62.870  12.764  1.00 59.76  ? 4   DG  X N7    1 
ATOM   2311 C  C5    . DG  C 2 4   ? 43.656 62.793  13.817  1.00 54.95  ? 4   DG  X C5    1 
ATOM   2312 C  C6    . DG  C 2 4   ? 43.873 62.837  15.217  1.00 51.19  ? 4   DG  X C6    1 
ATOM   2313 O  O6    . DG  C 2 4   ? 44.940 62.948  15.825  1.00 49.79  ? 4   DG  X O6    1 
ATOM   2314 N  N1    . DG  C 2 4   ? 42.682 62.713  15.925  1.00 50.46  ? 4   DG  X N1    1 
ATOM   2315 C  C2    . DG  C 2 4   ? 41.440 62.574  15.360  1.00 52.38  ? 4   DG  X C2    1 
ATOM   2316 N  N2    . DG  C 2 4   ? 40.406 62.470  16.212  1.00 52.86  ? 4   DG  X N2    1 
ATOM   2317 N  N3    . DG  C 2 4   ? 41.226 62.513  14.054  1.00 55.13  ? 4   DG  X N3    1 
ATOM   2318 C  C4    . DG  C 2 4   ? 42.370 62.631  13.348  1.00 56.44  ? 4   DG  X C4    1 
ATOM   2319 P  P     . DA  C 2 5   ? 38.455 64.202  8.611   1.00 92.79  ? 5   DA  X P     1 
ATOM   2320 O  OP1   . DA  C 2 5   ? 37.928 63.911  7.250   1.00 86.57  ? 5   DA  X OP1   1 
ATOM   2321 O  OP2   . DA  C 2 5   ? 39.360 65.370  8.817   1.00 84.24  ? 5   DA  X OP2   1 
ATOM   2322 O  "O5'" . DA  C 2 5   ? 37.230 64.331  9.621   1.00 81.22  ? 5   DA  X "O5'" 1 
ATOM   2323 C  "C5'" . DA  C 2 5   ? 37.117 63.491  10.787  1.00 77.82  ? 5   DA  X "C5'" 1 
ATOM   2324 C  "C4'" . DA  C 2 5   ? 36.808 64.322  12.009  1.00 70.51  ? 5   DA  X "C4'" 1 
ATOM   2325 O  "O4'" . DA  C 2 5   ? 37.984 64.440  12.840  1.00 64.14  ? 5   DA  X "O4'" 1 
ATOM   2326 C  "C3'" . DA  C 2 5   ? 36.319 65.743  11.728  1.00 69.45  ? 5   DA  X "C3'" 1 
ATOM   2327 O  "O3'" . DA  C 2 5   ? 35.070 65.875  12.407  1.00 72.06  ? 5   DA  X "O3'" 1 
ATOM   2328 C  "C2'" . DA  C 2 5   ? 37.464 66.639  12.183  1.00 63.27  ? 5   DA  X "C2'" 1 
ATOM   2329 C  "C1'" . DA  C 2 5   ? 38.224 65.797  13.191  1.00 60.54  ? 5   DA  X "C1'" 1 
ATOM   2330 N  N9    . DA  C 2 5   ? 39.675 65.979  13.209  1.00 54.59  ? 5   DA  X N9    1 
ATOM   2331 C  C8    . DA  C 2 5   ? 40.539 66.021  12.140  1.00 53.12  ? 5   DA  X C8    1 
ATOM   2332 N  N7    . DA  C 2 5   ? 41.801 66.091  12.485  1.00 51.04  ? 5   DA  X N7    1 
ATOM   2333 C  C5    . DA  C 2 5   ? 41.770 66.048  13.873  1.00 49.68  ? 5   DA  X C5    1 
ATOM   2334 C  C6    . DA  C 2 5   ? 42.784 66.110  14.845  1.00 47.81  ? 5   DA  X C6    1 
ATOM   2335 N  N6    . DA  C 2 5   ? 44.083 66.196  14.552  1.00 48.22  ? 5   DA  X N6    1 
ATOM   2336 N  N1    . DA  C 2 5   ? 42.415 66.065  16.144  1.00 47.58  ? 5   DA  X N1    1 
ATOM   2337 C  C2    . DA  C 2 5   ? 41.111 65.967  16.437  1.00 48.73  ? 5   DA  X C2    1 
ATOM   2338 N  N3    . DA  C 2 5   ? 40.064 65.920  15.613  1.00 49.21  ? 5   DA  X N3    1 
ATOM   2339 C  C4    . DA  C 2 5   ? 40.467 65.965  14.331  1.00 50.62  ? 5   DA  X C4    1 
ATOM   2340 P  P     . DG  C 2 6   ? 34.248 67.232  12.353  1.00 79.45  ? 6   DG  X P     1 
ATOM   2341 O  OP1   . DG  C 2 6   ? 32.813 66.878  12.410  1.00 85.18  ? 6   DG  X OP1   1 
ATOM   2342 O  OP2   . DG  C 2 6   ? 34.775 68.092  11.246  1.00 77.18  ? 6   DG  X OP2   1 
ATOM   2343 O  "O5'" . DG  C 2 6   ? 34.667 67.952  13.708  1.00 74.72  ? 6   DG  X "O5'" 1 
ATOM   2344 C  "C5'" . DG  C 2 6   ? 34.949 67.217  14.911  1.00 73.09  ? 6   DG  X "C5'" 1 
ATOM   2345 C  "C4'" . DG  C 2 6   ? 35.681 68.115  15.878  1.00 73.07  ? 6   DG  X "C4'" 1 
ATOM   2346 O  "O4'" . DG  C 2 6   ? 37.098 68.146  15.571  1.00 68.95  ? 6   DG  X "O4'" 1 
ATOM   2347 C  "C3'" . DG  C 2 6   ? 35.227 69.575  15.846  1.00 74.84  ? 6   DG  X "C3'" 1 
ATOM   2348 O  "O3'" . DG  C 2 6   ? 35.318 70.034  17.185  1.00 81.52  ? 6   DG  X "O3'" 1 
ATOM   2349 C  "C2'" . DG  C 2 6   ? 36.283 70.252  14.992  1.00 70.03  ? 6   DG  X "C2'" 1 
ATOM   2350 C  "C1'" . DG  C 2 6   ? 37.507 69.509  15.488  1.00 66.75  ? 6   DG  X "C1'" 1 
ATOM   2351 N  N9    . DG  C 2 6   ? 38.709 69.567  14.667  1.00 60.67  ? 6   DG  X N9    1 
ATOM   2352 C  C8    . DG  C 2 6   ? 38.795 69.651  13.297  1.00 60.18  ? 6   DG  X C8    1 
ATOM   2353 N  N7    . DG  C 2 6   ? 40.025 69.654  12.861  1.00 60.74  ? 6   DG  X N7    1 
ATOM   2354 C  C5    . DG  C 2 6   ? 40.799 69.551  14.010  1.00 58.30  ? 6   DG  X C5    1 
ATOM   2355 C  C6    . DG  C 2 6   ? 42.210 69.506  14.171  1.00 56.76  ? 6   DG  X C6    1 
ATOM   2356 O  O6    . DG  C 2 6   ? 43.087 69.529  13.297  1.00 57.21  ? 6   DG  X O6    1 
ATOM   2357 N  N1    . DG  C 2 6   ? 42.570 69.393  15.512  1.00 53.78  ? 6   DG  X N1    1 
ATOM   2358 C  C2    . DG  C 2 6   ? 41.689 69.347  16.566  1.00 53.39  ? 6   DG  X C2    1 
ATOM   2359 N  N2    . DG  C 2 6   ? 42.231 69.261  17.790  1.00 52.76  ? 6   DG  X N2    1 
ATOM   2360 N  N3    . DG  C 2 6   ? 40.373 69.375  16.429  1.00 55.42  ? 6   DG  X N3    1 
ATOM   2361 C  C4    . DG  C 2 6   ? 40.001 69.486  15.133  1.00 58.89  ? 6   DG  X C4    1 
ATOM   2362 P  P     . DG  C 2 7   ? 34.381 71.191  17.681  1.00 83.68  ? 7   DG  X P     1 
ATOM   2363 O  OP1   . DG  C 2 7   ? 33.080 70.579  18.028  1.00 87.34  ? 7   DG  X OP1   1 
ATOM   2364 O  OP2   . DG  C 2 7   ? 34.433 72.273  16.668  1.00 76.06  ? 7   DG  X OP2   1 
ATOM   2365 O  "O5'" . DG  C 2 7   ? 35.078 71.647  19.038  1.00 82.55  ? 7   DG  X "O5'" 1 
ATOM   2366 C  "C5'" . DG  C 2 7   ? 35.825 70.725  19.869  1.00 80.94  ? 7   DG  X "C5'" 1 
ATOM   2367 C  "C4'" . DG  C 2 7   ? 37.158 71.333  20.242  1.00 80.31  ? 7   DG  X "C4'" 1 
ATOM   2368 O  "O4'" . DG  C 2 7   ? 38.072 71.275  19.119  1.00 74.74  ? 7   DG  X "O4'" 1 
ATOM   2369 C  "C3'" . DG  C 2 7   ? 37.102 72.809  20.642  1.00 81.58  ? 7   DG  X "C3'" 1 
ATOM   2370 O  "O3'" . DG  C 2 7   ? 38.044 73.057  21.688  1.00 88.09  ? 7   DG  X "O3'" 1 
ATOM   2371 C  "C2'" . DG  C 2 7   ? 37.585 73.527  19.399  1.00 74.57  ? 7   DG  X "C2'" 1 
ATOM   2372 C  "C1'" . DG  C 2 7   ? 38.658 72.556  18.966  1.00 69.06  ? 7   DG  X "C1'" 1 
ATOM   2373 N  N9    . DG  C 2 7   ? 39.125 72.681  17.595  1.00 59.89  ? 7   DG  X N9    1 
ATOM   2374 C  C8    . DG  C 2 7   ? 38.373 72.821  16.454  1.00 58.48  ? 7   DG  X C8    1 
ATOM   2375 N  N7    . DG  C 2 7   ? 39.098 72.912  15.371  1.00 56.02  ? 7   DG  X N7    1 
ATOM   2376 C  C5    . DG  C 2 7   ? 40.406 72.817  15.825  1.00 53.93  ? 7   DG  X C5    1 
ATOM   2377 C  C6    . DG  C 2 7   ? 41.637 72.845  15.110  1.00 53.51  ? 7   DG  X C6    1 
ATOM   2378 O  O6    . DG  C 2 7   ? 41.821 72.976  13.892  1.00 53.33  ? 7   DG  X O6    1 
ATOM   2379 N  N1    . DG  C 2 7   ? 42.727 72.718  15.965  1.00 53.51  ? 7   DG  X N1    1 
ATOM   2380 C  C2    . DG  C 2 7   ? 42.648 72.589  17.332  1.00 55.31  ? 7   DG  X C2    1 
ATOM   2381 N  N2    . DG  C 2 7   ? 43.813 72.494  17.989  1.00 56.97  ? 7   DG  X N2    1 
ATOM   2382 N  N3    . DG  C 2 7   ? 41.511 72.567  18.009  1.00 53.87  ? 7   DG  X N3    1 
ATOM   2383 C  C4    . DG  C 2 7   ? 40.439 72.684  17.197  1.00 55.24  ? 7   DG  X C4    1 
ATOM   2384 P  P     . DC  C 2 8   ? 37.531 73.532  23.118  1.00 101.29 ? 8   DC  X P     1 
ATOM   2385 O  OP1   . DC  C 2 8   ? 37.263 72.317  23.925  1.00 85.89  ? 8   DC  X OP1   1 
ATOM   2386 O  OP2   . DC  C 2 8   ? 36.452 74.535  22.905  1.00 97.45  ? 8   DC  X OP2   1 
ATOM   2387 O  "O5'" . DC  C 2 8   ? 38.777 74.331  23.709  1.00 94.40  ? 8   DC  X "O5'" 1 
ATOM   2388 C  "C5'" . DC  C 2 8   ? 39.917 73.649  24.265  1.00 88.59  ? 8   DC  X "C5'" 1 
ATOM   2389 C  "C4'" . DC  C 2 8   ? 41.184 74.353  23.842  1.00 82.39  ? 8   DC  X "C4'" 1 
ATOM   2390 O  "O4'" . DC  C 2 8   ? 41.316 74.280  22.402  1.00 76.23  ? 8   DC  X "O4'" 1 
ATOM   2391 C  "C3'" . DC  C 2 8   ? 41.246 75.843  24.211  1.00 78.97  ? 8   DC  X "C3'" 1 
ATOM   2392 O  "O3'" . DC  C 2 8   ? 42.163 76.000  25.315  1.00 82.04  ? 8   DC  X "O3'" 1 
ATOM   2393 C  "C2'" . DC  C 2 8   ? 41.479 76.546  22.879  1.00 76.60  ? 8   DC  X "C2'" 1 
ATOM   2394 C  "C1'" . DC  C 2 8   ? 42.000 75.434  21.979  1.00 74.32  ? 8   DC  X "C1'" 1 
ATOM   2395 N  N1    . DC  C 2 8   ? 41.746 75.613  20.541  1.00 66.09  ? 8   DC  X N1    1 
ATOM   2396 C  C2    . DC  C 2 8   ? 42.826 75.606  19.648  1.00 65.83  ? 8   DC  X C2    1 
ATOM   2397 O  O2    . DC  C 2 8   ? 43.971 75.436  20.089  1.00 71.80  ? 8   DC  X O2    1 
ATOM   2398 N  N3    . DC  C 2 8   ? 42.594 75.779  18.328  1.00 61.55  ? 8   DC  X N3    1 
ATOM   2399 C  C4    . DC  C 2 8   ? 41.345 75.942  17.887  1.00 60.68  ? 8   DC  X C4    1 
ATOM   2400 N  N4    . DC  C 2 8   ? 41.163 76.104  16.578  1.00 59.35  ? 8   DC  X N4    1 
ATOM   2401 C  C5    . DC  C 2 8   ? 40.228 75.956  18.773  1.00 63.25  ? 8   DC  X C5    1 
ATOM   2402 C  C6    . DC  C 2 8   ? 40.471 75.782  20.079  1.00 63.64  ? 8   DC  X C6    1 
ATOM   2403 P  P     . DT  C 2 9   ? 43.522 76.890  25.233  1.00 82.79  ? 9   DT  X P     1 
ATOM   2404 O  OP1   . DT  C 2 9   ? 44.405 76.461  26.348  1.00 82.31  ? 9   DT  X OP1   1 
ATOM   2405 O  OP2   . DT  C 2 9   ? 43.132 78.319  25.118  1.00 84.88  ? 9   DT  X OP2   1 
ATOM   2406 O  "O5'" . DT  C 2 9   ? 44.229 76.430  23.877  1.00 82.63  ? 9   DT  X "O5'" 1 
ATOM   2407 C  "C5'" . DT  C 2 9   ? 45.648 76.159  23.786  1.00 78.30  ? 9   DT  X "C5'" 1 
ATOM   2408 C  "C4'" . DT  C 2 9   ? 46.298 76.996  22.708  1.00 73.99  ? 9   DT  X "C4'" 1 
ATOM   2409 O  "O4'" . DT  C 2 9   ? 45.466 77.091  21.518  1.00 70.91  ? 9   DT  X "O4'" 1 
ATOM   2410 C  "C3'" . DT  C 2 9   ? 46.622 78.442  23.106  1.00 74.10  ? 9   DT  X "C3'" 1 
ATOM   2411 O  "O3'" . DT  C 2 9   ? 47.959 78.699  22.664  1.00 77.26  ? 9   DT  X "O3'" 1 
ATOM   2412 C  "C2'" . DT  C 2 9   ? 45.600 79.251  22.326  1.00 69.48  ? 9   DT  X "C2'" 1 
ATOM   2413 C  "C1'" . DT  C 2 9   ? 45.552 78.431  21.051  1.00 69.24  ? 9   DT  X "C1'" 1 
ATOM   2414 N  N1    . DT  C 2 9   ? 44.417 78.693  20.132  1.00 61.25  ? 9   DT  X N1    1 
ATOM   2415 C  C2    . DT  C 2 9   ? 44.649 78.765  18.770  1.00 57.75  ? 9   DT  X C2    1 
ATOM   2416 O  O2    . DT  C 2 9   ? 45.750 78.612  18.267  1.00 59.79  ? 9   DT  X O2    1 
ATOM   2417 N  N3    . DT  C 2 9   ? 43.539 79.048  18.017  1.00 53.19  ? 9   DT  X N3    1 
ATOM   2418 C  C4    . DT  C 2 9   ? 42.252 79.252  18.475  1.00 53.34  ? 9   DT  X C4    1 
ATOM   2419 O  O4    . DT  C 2 9   ? 41.354 79.481  17.679  1.00 56.15  ? 9   DT  X O4    1 
ATOM   2420 C  C5    . DT  C 2 9   ? 42.082 79.174  19.908  1.00 56.45  ? 9   DT  X C5    1 
ATOM   2421 C  C7    . DT  C 2 9   ? 40.722 79.385  20.492  1.00 56.90  ? 9   DT  X C7    1 
ATOM   2422 C  C6    . DT  C 2 9   ? 43.159 78.905  20.654  1.00 59.44  ? 9   DT  X C6    1 
ATOM   2423 P  P     . DT  C 2 10  ? 48.680 80.121  22.913  1.00 80.14  ? 10  DT  X P     1 
ATOM   2424 O  OP1   . DT  C 2 10  ? 49.146 80.155  24.324  1.00 80.19  ? 10  DT  X OP1   1 
ATOM   2425 O  OP2   . DT  C 2 10  ? 47.811 81.215  22.415  1.00 75.73  ? 10  DT  X OP2   1 
ATOM   2426 O  "O5'" . DT  C 2 10  ? 49.925 80.048  21.914  1.00 78.84  ? 10  DT  X "O5'" 1 
ATOM   2427 C  "C5'" . DT  C 2 10  ? 49.851 79.373  20.631  1.00 72.58  ? 10  DT  X "C5'" 1 
ATOM   2428 C  "C4'" . DT  C 2 10  ? 49.797 80.342  19.468  1.00 67.94  ? 10  DT  X "C4'" 1 
ATOM   2429 O  "O4'" . DT  C 2 10  ? 48.445 80.439  18.959  1.00 63.03  ? 10  DT  X "O4'" 1 
ATOM   2430 C  "C3'" . DT  C 2 10  ? 50.273 81.783  19.719  1.00 68.75  ? 10  DT  X "C3'" 1 
ATOM   2431 O  "O3'" . DT  C 2 10  ? 51.441 82.017  18.916  1.00 71.55  ? 10  DT  X "O3'" 1 
ATOM   2432 C  "C2'" . DT  C 2 10  ? 49.063 82.644  19.368  1.00 64.33  ? 10  DT  X "C2'" 1 
ATOM   2433 C  "C1'" . DT  C 2 10  ? 48.246 81.749  18.453  1.00 60.79  ? 10  DT  X "C1'" 1 
ATOM   2434 N  N1    . DT  C 2 10  ? 46.781 82.014  18.427  1.00 54.54  ? 10  DT  X N1    1 
ATOM   2435 C  C2    . DT  C 2 10  ? 46.139 82.077  17.209  1.00 51.16  ? 10  DT  X C2    1 
ATOM   2436 O  O2    . DT  C 2 10  ? 46.717 81.964  16.142  1.00 51.97  ? 10  DT  X O2    1 
ATOM   2437 N  N3    . DT  C 2 10  ? 44.787 82.302  17.287  1.00 48.50  ? 10  DT  X N3    1 
ATOM   2438 C  C4    . DT  C 2 10  ? 44.030 82.462  18.431  1.00 48.94  ? 10  DT  X C4    1 
ATOM   2439 O  O4    . DT  C 2 10  ? 42.816 82.620  18.342  1.00 49.42  ? 10  DT  X O4    1 
ATOM   2440 C  C5    . DT  C 2 10  ? 44.767 82.384  19.674  1.00 50.85  ? 10  DT  X C5    1 
ATOM   2441 C  C7    . DT  C 2 10  ? 44.033 82.541  20.969  1.00 51.27  ? 10  DT  X C7    1 
ATOM   2442 C  C6    . DT  C 2 10  ? 46.084 82.154  19.610  1.00 52.98  ? 10  DT  X C6    1 
ATOM   2443 P  P     . DT  C 2 11  ? 51.936 83.500  18.576  1.00 77.28  ? 11  DT  X P     1 
ATOM   2444 O  OP1   . DT  C 2 11  ? 53.387 83.467  18.286  1.00 79.94  ? 11  DT  X OP1   1 
ATOM   2445 O  OP2   . DT  C 2 11  ? 51.388 84.431  19.604  1.00 74.32  ? 11  DT  X OP2   1 
ATOM   2446 O  "O5'" . DT  C 2 11  ? 51.305 83.777  17.141  1.00 72.43  ? 11  DT  X "O5'" 1 
ATOM   2447 C  "C5'" . DT  C 2 11  ? 51.513 82.842  16.067  1.00 68.09  ? 11  DT  X "C5'" 1 
ATOM   2448 C  "C4'" . DT  C 2 11  ? 50.890 83.388  14.806  1.00 62.49  ? 11  DT  X "C4'" 1 
ATOM   2449 O  "O4'" . DT  C 2 11  ? 49.460 83.529  14.991  1.00 55.90  ? 11  DT  X "O4'" 1 
ATOM   2450 C  "C3'" . DT  C 2 11  ? 51.411 84.770  14.405  1.00 60.42  ? 11  DT  X "C3'" 1 
ATOM   2451 O  "O3'" . DT  C 2 11  ? 51.690 84.678  13.004  1.00 62.48  ? 11  DT  X "O3'" 1 
ATOM   2452 C  "C2'" . DT  C 2 11  ? 50.305 85.711  14.860  1.00 57.56  ? 11  DT  X "C2'" 1 
ATOM   2453 C  "C1'" . DT  C 2 11  ? 49.051 84.860  14.693  1.00 53.71  ? 11  DT  X "C1'" 1 
ATOM   2454 N  N1    . DT  C 2 11  ? 47.880 85.167  15.562  1.00 48.83  ? 11  DT  X N1    1 
ATOM   2455 C  C2    . DT  C 2 11  ? 46.636 85.284  14.976  1.00 44.81  ? 11  DT  X C2    1 
ATOM   2456 O  O2    . DT  C 2 11  ? 46.461 85.244  13.774  1.00 43.76  ? 11  DT  X O2    1 
ATOM   2457 N  N3    . DT  C 2 11  ? 45.604 85.485  15.857  1.00 43.23  ? 11  DT  X N3    1 
ATOM   2458 C  C4    . DT  C 2 11  ? 45.693 85.605  17.233  1.00 44.29  ? 11  DT  X C4    1 
ATOM   2459 O  O4    . DT  C 2 11  ? 44.676 85.769  17.897  1.00 42.63  ? 11  DT  X O4    1 
ATOM   2460 C  C5    . DT  C 2 11  ? 47.025 85.480  17.780  1.00 46.75  ? 11  DT  X C5    1 
ATOM   2461 C  C7    . DT  C 2 11  ? 47.216 85.602  19.259  1.00 48.00  ? 11  DT  X C7    1 
ATOM   2462 C  C6    . DT  C 2 11  ? 48.038 85.263  16.930  1.00 48.51  ? 11  DT  X C6    1 
ATOM   2463 P  P     . DT  C 2 12  ? 52.054 85.964  12.160  1.00 70.16  ? 12  DT  X P     1 
ATOM   2464 O  OP1   . DT  C 2 12  ? 52.843 85.542  10.966  1.00 66.56  ? 12  DT  X OP1   1 
ATOM   2465 O  OP2   . DT  C 2 12  ? 52.584 86.994  13.104  1.00 70.13  ? 12  DT  X OP2   1 
ATOM   2466 O  "O5'" . DT  C 2 12  ? 50.631 86.423  11.602  1.00 59.98  ? 12  DT  X "O5'" 1 
ATOM   2467 C  "C5'" . DT  C 2 12  ? 49.952 85.657  10.592  1.00 55.09  ? 12  DT  X "C5'" 1 
ATOM   2468 C  "C4'" . DT  C 2 12  ? 48.726 86.414  10.143  1.00 51.23  ? 12  DT  X "C4'" 1 
ATOM   2469 O  "O4'" . DT  C 2 12  ? 47.876 86.666  11.285  1.00 47.40  ? 12  DT  X "O4'" 1 
ATOM   2470 C  "C3'" . DT  C 2 12  ? 49.038 87.781  9.531   1.00 50.76  ? 12  DT  X "C3'" 1 
ATOM   2471 O  "O3'" . DT  C 2 12  ? 48.520 87.800  8.198   1.00 52.02  ? 12  DT  X "O3'" 1 
ATOM   2472 C  "C2'" . DT  C 2 12  ? 48.518 88.783  10.560  1.00 47.91  ? 12  DT  X "C2'" 1 
ATOM   2473 C  "C1'" . DT  C 2 12  ? 47.423 88.022  11.262  1.00 45.52  ? 12  DT  X "C1'" 1 
ATOM   2474 N  N1    . DT  C 2 12  ? 47.090 88.383  12.659  1.00 42.56  ? 12  DT  X N1    1 
ATOM   2475 C  C2    . DT  C 2 12  ? 45.762 88.442  13.039  1.00 41.26  ? 12  DT  X C2    1 
ATOM   2476 O  O2    . DT  C 2 12  ? 44.828 88.382  12.252  1.00 40.65  ? 12  DT  X O2    1 
ATOM   2477 N  N3    . DT  C 2 12  ? 45.565 88.656  14.379  1.00 41.37  ? 12  DT  X N3    1 
ATOM   2478 C  C4    . DT  C 2 12  ? 46.526 88.756  15.362  1.00 41.99  ? 12  DT  X C4    1 
ATOM   2479 O  O4    . DT  C 2 12  ? 46.185 88.886  16.533  1.00 42.14  ? 12  DT  X O4    1 
ATOM   2480 C  C5    . DT  C 2 12  ? 47.892 88.635  14.902  1.00 42.92  ? 12  DT  X C5    1 
ATOM   2481 C  C7    . DT  C 2 12  ? 49.006 88.747  15.897  1.00 44.77  ? 12  DT  X C7    1 
ATOM   2482 C  C6    . DT  C 2 12  ? 48.101 88.441  13.593  1.00 43.00  ? 12  DT  X C6    1 
ATOM   2483 P  P     . DT  C 2 13  ? 48.500 89.157  7.343   1.00 59.61  ? 13  DT  X P     1 
ATOM   2484 O  OP1   . DT  C 2 13  ? 48.570 88.775  5.903   1.00 61.48  ? 13  DT  X OP1   1 
ATOM   2485 O  OP2   . DT  C 2 13  ? 49.503 90.108  7.900   1.00 56.47  ? 13  DT  X OP2   1 
ATOM   2486 O  "O5'" . DT  C 2 13  ? 47.065 89.764  7.687   1.00 53.35  ? 13  DT  X "O5'" 1 
ATOM   2487 C  "C5'" . DT  C 2 13  ? 45.896 88.936  7.583   1.00 50.70  ? 13  DT  X "C5'" 1 
ATOM   2488 C  "C4'" . DT  C 2 13  ? 44.665 89.706  7.995   1.00 47.78  ? 13  DT  X "C4'" 1 
ATOM   2489 O  "O4'" . DT  C 2 13  ? 44.646 89.905  9.427   1.00 44.81  ? 13  DT  X "O4'" 1 
ATOM   2490 C  "C3'" . DT  C 2 13  ? 44.496 91.094  7.368   1.00 46.37  ? 13  DT  X "C3'" 1 
ATOM   2491 O  "O3'" . DT  C 2 13  ? 43.133 91.091  6.923   1.00 47.11  ? 13  DT  X "O3'" 1 
ATOM   2492 C  "C2'" . DT  C 2 13  ? 44.753 92.052  8.525   1.00 45.12  ? 13  DT  X "C2'" 1 
ATOM   2493 C  "C1'" . DT  C 2 13  ? 44.249 91.254  9.709   1.00 43.00  ? 13  DT  X "C1'" 1 
ATOM   2494 N  N1    . DT  C 2 13  ? 44.785 91.580  11.049  1.00 42.21  ? 13  DT  X N1    1 
ATOM   2495 C  C2    . DT  C 2 13  ? 43.913 91.644  12.117  1.00 41.14  ? 13  DT  X C2    1 
ATOM   2496 O  O2    . DT  C 2 13  ? 42.697 91.605  11.997  1.00 40.61  ? 13  DT  X O2    1 
ATOM   2497 N  N3    . DT  C 2 13  ? 44.517 91.840  13.333  1.00 41.74  ? 13  DT  X N3    1 
ATOM   2498 C  C4    . DT  C 2 13  ? 45.870 91.926  13.592  1.00 41.58  ? 13  DT  X C4    1 
ATOM   2499 O  O4    . DT  C 2 13  ? 46.258 92.081  14.744  1.00 41.85  ? 13  DT  X O4    1 
ATOM   2500 C  C5    . DT  C 2 13  ? 46.730 91.820  12.429  1.00 42.77  ? 13  DT  X C5    1 
ATOM   2501 C  C7    . DT  C 2 13  ? 48.216 91.900  12.609  1.00 44.48  ? 13  DT  X C7    1 
ATOM   2502 C  C6    . DT  C 2 13  ? 46.152 91.642  11.235  1.00 42.44  ? 13  DT  X C6    1 
ATOM   2503 P  P     . DT  C 2 14  ? 42.542 92.267  6.020   1.00 49.39  ? 14  DT  X P     1 
ATOM   2504 O  OP1   . DT  C 2 14  ? 41.315 91.754  5.359   1.00 49.04  ? 14  DT  X OP1   1 
ATOM   2505 O  OP2   . DT  C 2 14  ? 43.632 92.853  5.206   1.00 50.41  ? 14  DT  X OP2   1 
ATOM   2506 O  "O5'" . DT  C 2 14  ? 42.051 93.306  7.126   1.00 44.50  ? 14  DT  X "O5'" 1 
ATOM   2507 C  "C5'" . DT  C 2 14  ? 40.964 92.914  7.983   1.00 43.61  ? 14  DT  X "C5'" 1 
ATOM   2508 C  "C4'" . DT  C 2 14  ? 40.779 93.910  9.105   1.00 42.57  ? 14  DT  X "C4'" 1 
ATOM   2509 O  "O4'" . DT  C 2 14  ? 41.855 93.815  10.047  1.00 41.08  ? 14  DT  X "O4'" 1 
ATOM   2510 C  "C3'" . DT  C 2 14  ? 40.749 95.376  8.682   1.00 42.32  ? 14  DT  X "C3'" 1 
ATOM   2511 O  "O3'" . DT  C 2 14  ? 39.375 95.716  8.619   1.00 43.85  ? 14  DT  X "O3'" 1 
ATOM   2512 C  "C2'" . DT  C 2 14  ? 41.446 96.106  9.821   1.00 41.15  ? 14  DT  X "C2'" 1 
ATOM   2513 C  "C1'" . DT  C 2 14  ? 41.821 95.011  10.812  1.00 39.46  ? 14  DT  X "C1'" 1 
ATOM   2514 N  N1    . DT  C 2 14  ? 43.137 95.152  11.445  1.00 38.13  ? 14  DT  X N1    1 
ATOM   2515 C  C2    . DT  C 2 14  ? 43.237 95.189  12.824  1.00 37.42  ? 14  DT  X C2    1 
ATOM   2516 O  O2    . DT  C 2 14  ? 42.266 95.199  13.570  1.00 37.14  ? 14  DT  X O2    1 
ATOM   2517 N  N3    . DT  C 2 14  ? 44.528 95.229  13.300  1.00 36.98  ? 14  DT  X N3    1 
ATOM   2518 C  C4    . DT  C 2 14  ? 45.694 95.237  12.554  1.00 37.60  ? 14  DT  X C4    1 
ATOM   2519 O  O4    . DT  C 2 14  ? 46.779 95.278  13.123  1.00 38.41  ? 14  DT  X O4    1 
ATOM   2520 C  C5    . DT  C 2 14  ? 45.510 95.169  11.117  1.00 37.75  ? 14  DT  X C5    1 
ATOM   2521 C  C7    . DT  C 2 14  ? 46.712 95.158  10.227  1.00 38.44  ? 14  DT  X C7    1 
ATOM   2522 C  C6    . DT  C 2 14  ? 44.259 95.121  10.645  1.00 37.96  ? 14  DT  X C6    1 
ATOM   2523 P  P     . DG  C 2 15  ? 38.880 97.057  7.924   1.00 46.87  ? 15  DG  X P     1 
ATOM   2524 O  OP1   . DG  C 2 15  ? 37.501 96.796  7.440   1.00 47.91  ? 15  DG  X OP1   1 
ATOM   2525 O  OP2   . DG  C 2 15  ? 39.949 97.616  7.025   1.00 45.44  ? 15  DG  X OP2   1 
ATOM   2526 O  "O5'" . DG  C 2 15  ? 38.761 98.080  9.150   1.00 43.67  ? 15  DG  X "O5'" 1 
ATOM   2527 C  "C5'" . DG  C 2 15  ? 37.826 97.825  10.223  1.00 41.32  ? 15  DG  X "C5'" 1 
ATOM   2528 C  "C4'" . DG  C 2 15  ? 38.094 98.778  11.365  1.00 39.86  ? 15  DG  X "C4'" 1 
ATOM   2529 O  "O4'" . DG  C 2 15  ? 39.341 98.414  11.989  1.00 38.17  ? 15  DG  X "O4'" 1 
ATOM   2530 C  "C3'" . DG  C 2 15  ? 38.258 100.243 10.956  1.00 39.54  ? 15  DG  X "C3'" 1 
ATOM   2531 O  "O3'" . DG  C 2 15  ? 37.772 101.091 12.010  1.00 39.51  ? 15  DG  X "O3'" 1 
ATOM   2532 C  "C2'" . DG  C 2 15  ? 39.763 100.407 10.878  1.00 38.27  ? 15  DG  X "C2'" 1 
ATOM   2533 C  "C1'" . DG  C 2 15  ? 40.146 99.554  12.071  1.00 38.02  ? 15  DG  X "C1'" 1 
ATOM   2534 N  N9    . DG  C 2 15  ? 41.538 99.141  12.162  1.00 36.71  ? 15  DG  X N9    1 
ATOM   2535 C  C8    . DG  C 2 15  ? 42.449 99.010  11.140  1.00 37.08  ? 15  DG  X C8    1 
ATOM   2536 N  N7    . DG  C 2 15  ? 43.658 98.760  11.562  1.00 36.49  ? 15  DG  X N7    1 
ATOM   2537 C  C5    . DG  C 2 15  ? 43.539 98.728  12.944  1.00 36.30  ? 15  DG  X C5    1 
ATOM   2538 C  C6    . DG  C 2 15  ? 44.502 98.454  13.941  1.00 36.63  ? 15  DG  X C6    1 
ATOM   2539 O  O6    . DG  C 2 15  ? 45.705 98.200  13.801  1.00 38.12  ? 15  DG  X O6    1 
ATOM   2540 N  N1    . DG  C 2 15  ? 43.960 98.557  15.218  1.00 36.17  ? 15  DG  X N1    1 
ATOM   2541 C  C2    . DG  C 2 15  ? 42.642 98.827  15.496  1.00 36.00  ? 15  DG  X C2    1 
ATOM   2542 N  N2    . DG  C 2 15  ? 42.309 98.887  16.792  1.00 37.03  ? 15  DG  X N2    1 
ATOM   2543 N  N3    . DG  C 2 15  ? 41.730 99.056  14.576  1.00 35.26  ? 15  DG  X N3    1 
ATOM   2544 C  C4    . DG  C 2 15  ? 42.242 98.989  13.330  1.00 36.09  ? 15  DG  X C4    1 
ATOM   2545 P  P     . DG  C 2 16  ? 36.451 101.924 11.827  1.00 39.53  ? 16  DG  X P     1 
ATOM   2546 O  OP1   . DG  C 2 16  ? 35.350 101.043 11.454  1.00 40.16  ? 16  DG  X OP1   1 
ATOM   2547 O  OP2   . DG  C 2 16  ? 36.772 103.144 11.002  1.00 40.71  ? 16  DG  X OP2   1 
ATOM   2548 O  "O5'" . DG  C 2 16  ? 36.202 102.520 13.289  1.00 40.60  ? 16  DG  X "O5'" 1 
ATOM   2549 C  "C5'" . DG  C 2 16  ? 35.907 101.649 14.413  1.00 40.75  ? 16  DG  X "C5'" 1 
ATOM   2550 C  "C4'" . DG  C 2 16  ? 36.548 102.214 15.660  1.00 39.45  ? 16  DG  X "C4'" 1 
ATOM   2551 O  "O4'" . DG  C 2 16  ? 37.955 101.888 15.646  1.00 38.30  ? 16  DG  X "O4'" 1 
ATOM   2552 C  "C3'" . DG  C 2 16  ? 36.474 103.734 15.804  1.00 39.00  ? 16  DG  X "C3'" 1 
ATOM   2553 O  "O3'" . DG  C 2 16  ? 36.312 104.015 17.198  1.00 39.80  ? 16  DG  X "O3'" 1 
ATOM   2554 C  "C2'" . DG  C 2 16  ? 37.840 104.211 15.344  1.00 37.76  ? 16  DG  X "C2'" 1 
ATOM   2555 C  "C1'" . DG  C 2 16  ? 38.742 103.063 15.778  1.00 37.83  ? 16  DG  X "C1'" 1 
ATOM   2556 N  N9    . DG  C 2 16  ? 39.965 102.870 14.997  1.00 36.97  ? 16  DG  X N9    1 
ATOM   2557 C  C8    . DG  C 2 16  ? 40.071 102.869 13.624  1.00 37.14  ? 16  DG  X C8    1 
ATOM   2558 N  N7    . DG  C 2 16  ? 41.287 102.637 13.203  1.00 36.66  ? 16  DG  X N7    1 
ATOM   2559 C  C5    . DG  C 2 16  ? 42.027 102.464 14.365  1.00 36.32  ? 16  DG  X C5    1 
ATOM   2560 C  C6    . DG  C 2 16  ? 43.397 102.143 14.541  1.00 36.23  ? 16  DG  X C6    1 
ATOM   2561 O  O6    . DG  C 2 16  ? 44.269 101.992 13.680  1.00 35.84  ? 16  DG  X O6    1 
ATOM   2562 N  N1    . DG  C 2 16  ? 43.739 102.073 15.888  1.00 36.87  ? 16  DG  X N1    1 
ATOM   2563 C  C2    . DG  C 2 16  ? 42.860 102.218 16.935  1.00 37.15  ? 16  DG  X C2    1 
ATOM   2564 N  N2    . DG  C 2 16  ? 43.378 102.063 18.168  1.00 37.74  ? 16  DG  X N2    1 
ATOM   2565 N  N3    . DG  C 2 16  ? 41.566 102.474 16.786  1.00 36.62  ? 16  DG  X N3    1 
ATOM   2566 C  C4    . DG  C 2 16  ? 41.223 102.592 15.483  1.00 36.79  ? 16  DG  X C4    1 
ATOM   2567 P  P     . DA  C 2 17  ? 35.975 105.485 17.703  1.00 39.92  ? 17  DA  X P     1 
ATOM   2568 O  OP1   . DA  C 2 17  ? 35.005 105.350 18.812  1.00 43.14  ? 17  DA  X OP1   1 
ATOM   2569 O  OP2   . DA  C 2 17  ? 35.647 106.379 16.539  1.00 39.39  ? 17  DA  X OP2   1 
ATOM   2570 O  "O5'" . DA  C 2 17  ? 37.362 105.991 18.284  1.00 38.50  ? 17  DA  X "O5'" 1 
ATOM   2571 C  "C5'" . DA  C 2 17  ? 37.943 105.337 19.417  1.00 38.64  ? 17  DA  X "C5'" 1 
ATOM   2572 C  "C4'" . DA  C 2 17  ? 39.328 105.885 19.646  1.00 37.90  ? 17  DA  X "C4'" 1 
ATOM   2573 O  "O4'" . DA  C 2 17  ? 40.186 105.429 18.575  1.00 36.75  ? 17  DA  X "O4'" 1 
ATOM   2574 C  "C3'" . DA  C 2 17  ? 39.431 107.417 19.653  1.00 37.12  ? 17  DA  X "C3'" 1 
ATOM   2575 O  "O3'" . DA  C 2 17  ? 40.486 107.717 20.541  1.00 37.18  ? 17  DA  X "O3'" 1 
ATOM   2576 C  "C2'" . DA  C 2 17  ? 39.951 107.738 18.271  1.00 36.18  ? 17  DA  X "C2'" 1 
ATOM   2577 C  "C1'" . DA  C 2 17  ? 40.880 106.545 18.077  1.00 36.12  ? 17  DA  X "C1'" 1 
ATOM   2578 N  N9    . DA  C 2 17  ? 41.263 106.278 16.699  1.00 35.76  ? 17  DA  X N9    1 
ATOM   2579 C  C8    . DA  C 2 17  ? 40.520 106.414 15.550  1.00 35.93  ? 17  DA  X C8    1 
ATOM   2580 N  N7    . DA  C 2 17  ? 41.188 106.135 14.454  1.00 35.85  ? 17  DA  X N7    1 
ATOM   2581 C  C5    . DA  C 2 17  ? 42.463 105.829 14.910  1.00 35.08  ? 17  DA  X C5    1 
ATOM   2582 C  C6    . DA  C 2 17  ? 43.652 105.485 14.240  1.00 35.47  ? 17  DA  X C6    1 
ATOM   2583 N  N6    . DA  C 2 17  ? 43.745 105.367 12.913  1.00 35.61  ? 17  DA  X N6    1 
ATOM   2584 N  N1    . DA  C 2 17  ? 44.749 105.243 14.990  1.00 35.69  ? 17  DA  X N1    1 
ATOM   2585 C  C2    . DA  C 2 17  ? 44.651 105.352 16.327  1.00 36.23  ? 17  DA  X C2    1 
ATOM   2586 N  N3    . DA  C 2 17  ? 43.593 105.670 17.069  1.00 35.78  ? 17  DA  X N3    1 
ATOM   2587 C  C4    . DA  C 2 17  ? 42.522 105.909 16.292  1.00 35.57  ? 17  DA  X C4    1 
ATOM   2588 P  P     . DG  C 2 18  ? 40.669 109.144 21.177  1.00 37.35  ? 18  DG  X P     1 
ATOM   2589 O  OP1   . DG  C 2 18  ? 39.757 109.295 22.340  1.00 39.02  ? 18  DG  X OP1   1 
ATOM   2590 O  OP2   . DG  C 2 18  ? 40.663 110.192 20.073  1.00 35.77  ? 18  DG  X OP2   1 
ATOM   2591 O  "O5'" . DG  C 2 18  ? 42.174 109.081 21.722  1.00 38.61  ? 18  DG  X "O5'" 1 
ATOM   2592 C  "C5'" . DG  C 2 18  ? 42.724 107.896 22.384  1.00 40.72  ? 18  DG  X "C5'" 1 
ATOM   2593 C  "C4'" . DG  C 2 18  ? 44.240 107.926 22.413  1.00 41.97  ? 18  DG  X "C4'" 1 
ATOM   2594 O  "O4'" . DG  C 2 18  ? 44.758 107.613 21.091  1.00 40.63  ? 18  DG  X "O4'" 1 
ATOM   2595 C  "C3'" . DG  C 2 18  ? 44.875 109.258 22.786  1.00 43.83  ? 18  DG  X "C3'" 1 
ATOM   2596 O  "O3'" . DG  C 2 18  ? 46.139 109.068 23.447  1.00 47.78  ? 18  DG  X "O3'" 1 
ATOM   2597 C  "C2'" . DG  C 2 18  ? 45.081 109.925 21.437  1.00 41.49  ? 18  DG  X "C2'" 1 
ATOM   2598 C  "C1'" . DG  C 2 18  ? 45.427 108.750 20.541  1.00 40.07  ? 18  DG  X "C1'" 1 
ATOM   2599 N  N9    . DG  C 2 18  ? 45.035 108.853 19.140  1.00 37.69  ? 18  DG  X N9    1 
ATOM   2600 C  C8    . DG  C 2 18  ? 43.762 109.004 18.640  1.00 36.42  ? 18  DG  X C8    1 
ATOM   2601 N  N7    . DG  C 2 18  ? 43.720 108.988 17.335  1.00 35.39  ? 18  DG  X N7    1 
ATOM   2602 C  C5    . DG  C 2 18  ? 45.036 108.768 16.951  1.00 35.87  ? 18  DG  X C5    1 
ATOM   2603 C  C6    . DG  C 2 18  ? 45.616 108.651 15.653  1.00 35.53  ? 18  DG  X C6    1 
ATOM   2604 O  O6    . DG  C 2 18  ? 45.057 108.692 14.544  1.00 34.14  ? 18  DG  X O6    1 
ATOM   2605 N  N1    . DG  C 2 18  ? 46.995 108.483 15.726  1.00 36.39  ? 18  DG  X N1    1 
ATOM   2606 C  C2    . DG  C 2 18  ? 47.723 108.417 16.888  1.00 37.81  ? 18  DG  X C2    1 
ATOM   2607 N  N2    . DG  C 2 18  ? 49.048 108.266 16.750  1.00 39.39  ? 18  DG  X N2    1 
ATOM   2608 N  N3    . DG  C 2 18  ? 47.203 108.555 18.094  1.00 38.17  ? 18  DG  X N3    1 
ATOM   2609 C  C4    . DG  C 2 18  ? 45.862 108.701 18.054  1.00 37.18  ? 18  DG  X C4    1 
ATOM   2610 P  P     . DG  C 2 19  ? 46.467 109.847 24.794  1.00 53.20  ? 19  DG  X P     1 
ATOM   2611 O  OP1   . DG  C 2 19  ? 47.125 108.907 25.723  1.00 57.28  ? 19  DG  X OP1   1 
ATOM   2612 O  OP2   . DG  C 2 19  ? 45.259 110.621 25.210  1.00 51.43  ? 19  DG  X OP2   1 
ATOM   2613 O  "O5'" . DG  C 2 19  ? 47.438 111.022 24.318  1.00 52.26  ? 19  DG  X "O5'" 1 
ATOM   2614 C  "C5'" . DG  C 2 19  ? 48.706 110.802 23.674  1.00 51.13  ? 19  DG  X "C5'" 1 
ATOM   2615 C  "C4'" . DG  C 2 19  ? 49.143 112.086 23.007  1.00 50.94  ? 19  DG  X "C4'" 1 
ATOM   2616 O  "O4'" . DG  C 2 19  ? 48.303 112.360 21.853  1.00 45.94  ? 19  DG  X "O4'" 1 
ATOM   2617 C  "C3'" . DG  C 2 19  ? 49.042 113.325 23.891  1.00 52.04  ? 19  DG  X "C3'" 1 
ATOM   2618 O  "O3'" . DG  C 2 19  ? 50.129 114.206 23.558  1.00 57.87  ? 19  DG  X "O3'" 1 
ATOM   2619 C  "C2'" . DG  C 2 19  ? 47.673 113.888 23.532  1.00 48.77  ? 19  DG  X "C2'" 1 
ATOM   2620 C  "C1'" . DG  C 2 19  ? 47.529 113.519 22.064  1.00 45.12  ? 19  DG  X "C1'" 1 
ATOM   2621 N  N9    . DG  C 2 19  ? 46.181 113.259 21.551  1.00 41.97  ? 19  DG  X N9    1 
ATOM   2622 C  C8    . DG  C 2 19  ? 44.972 113.379 22.200  1.00 41.47  ? 19  DG  X C8    1 
ATOM   2623 N  N7    . DG  C 2 19  ? 43.948 113.122 21.430  1.00 39.05  ? 19  DG  X N7    1 
ATOM   2624 C  C5    . DG  C 2 19  ? 44.511 112.855 20.192  1.00 37.71  ? 19  DG  X C5    1 
ATOM   2625 C  C6    . DG  C 2 19  ? 43.896 112.502 18.964  1.00 35.62  ? 19  DG  X C6    1 
ATOM   2626 O  O6    . DG  C 2 19  ? 42.692 112.348 18.728  1.00 33.94  ? 19  DG  X O6    1 
ATOM   2627 N  N1    . DG  C 2 19  ? 44.844 112.254 17.971  1.00 35.38  ? 19  DG  X N1    1 
ATOM   2628 C  C2    . DG  C 2 19  ? 46.212 112.379 18.132  1.00 36.99  ? 19  DG  X C2    1 
ATOM   2629 N  N2    . DG  C 2 19  ? 46.970 112.137 17.054  1.00 36.73  ? 19  DG  X N2    1 
ATOM   2630 N  N3    . DG  C 2 19  ? 46.793 112.711 19.274  1.00 38.66  ? 19  DG  X N3    1 
ATOM   2631 C  C4    . DG  C 2 19  ? 45.891 112.915 20.257  1.00 39.32  ? 19  DG  X C4    1 
ATOM   2632 P  P     . DC  C 2 20  ? 50.935 115.036 24.683  1.00 63.77  ? 20  DC  X P     1 
ATOM   2633 O  OP1   . DC  C 2 20  ? 49.972 115.889 25.435  1.00 62.57  ? 20  DC  X OP1   1 
ATOM   2634 O  OP2   . DC  C 2 20  ? 52.069 115.705 24.013  1.00 65.56  ? 20  DC  X OP2   1 
ATOM   2635 O  "O5'" . DC  C 2 20  ? 51.580 113.883 25.563  1.00 67.52  ? 20  DC  X "O5'" 1 
ATOM   2636 C  "C5'" . DC  C 2 20  ? 50.917 113.374 26.716  1.00 72.54  ? 20  DC  X "C5'" 1 
ATOM   2637 C  "C4'" . DC  C 2 20  ? 51.912 112.938 27.767  1.00 78.96  ? 20  DC  X "C4'" 1 
ATOM   2638 O  "O4'" . DC  C 2 20  ? 53.004 113.888 27.892  1.00 79.37  ? 20  DC  X "O4'" 1 
ATOM   2639 C  "C3'" . DC  C 2 20  ? 51.278 112.881 29.149  1.00 84.79  ? 20  DC  X "C3'" 1 
ATOM   2640 O  "O3'" . DC  C 2 20  ? 51.947 111.906 29.947  1.00 96.52  ? 20  DC  X "O3'" 1 
ATOM   2641 C  "C2'" . DC  C 2 20  ? 51.522 114.279 29.676  1.00 84.23  ? 20  DC  X "C2'" 1 
ATOM   2642 C  "C1'" . DC  C 2 20  ? 52.915 114.560 29.143  1.00 81.82  ? 20  DC  X "C1'" 1 
ATOM   2643 N  N1    . DC  C 2 20  ? 53.216 115.985 28.935  1.00 78.81  ? 20  DC  X N1    1 
ATOM   2644 C  C2    . DC  C 2 20  ? 53.421 116.789 30.061  1.00 80.14  ? 20  DC  X C2    1 
ATOM   2645 O  O2    . DC  C 2 20  ? 53.343 116.276 31.188  1.00 80.97  ? 20  DC  X O2    1 
ATOM   2646 N  N3    . DC  C 2 20  ? 53.702 118.101 29.893  1.00 79.63  ? 20  DC  X N3    1 
ATOM   2647 C  C4    . DC  C 2 20  ? 53.798 118.610 28.663  1.00 77.45  ? 20  DC  X C4    1 
ATOM   2648 N  N4    . DC  C 2 20  ? 54.076 119.910 28.545  1.00 77.84  ? 20  DC  X N4    1 
ATOM   2649 C  C5    . DC  C 2 20  ? 53.587 117.814 27.499  1.00 75.44  ? 20  DC  X C5    1 
ATOM   2650 C  C6    . DC  C 2 20  ? 53.299 116.521 27.679  1.00 75.42  ? 20  DC  X C6    1 
ATOM   2651 P  P     . DC  C 2 21  ? 51.350 110.440 30.107  1.00 107.50 ? 21  DC  X P     1 
ATOM   2652 O  OP1   . DC  C 2 21  ? 52.137 109.777 31.185  1.00 110.95 ? 21  DC  X OP1   1 
ATOM   2653 O  OP2   . DC  C 2 21  ? 51.262 109.813 28.748  1.00 98.19  ? 21  DC  X OP2   1 
ATOM   2654 O  "O5'" . DC  C 2 21  ? 49.835 110.676 30.566  1.00 112.55 ? 21  DC  X "O5'" 1 
ATOM   2655 C  "C5'" . DC  C 2 21  ? 49.447 111.632 31.586  1.00 121.73 ? 21  DC  X "C5'" 1 
ATOM   2656 C  "C4'" . DC  C 2 21  ? 48.835 110.947 32.789  1.00 125.13 ? 21  DC  X "C4'" 1 
ATOM   2657 O  "O4'" . DC  C 2 21  ? 48.014 109.813 32.402  1.00 128.45 ? 21  DC  X "O4'" 1 
ATOM   2658 C  "C3'" . DC  C 2 21  ? 49.853 110.397 33.784  1.00 125.52 ? 21  DC  X "C3'" 1 
ATOM   2659 O  "O3'" . DC  C 2 21  ? 50.255 111.417 34.705  1.00 120.84 ? 21  DC  X "O3'" 1 
ATOM   2660 C  "C2'" . DC  C 2 21  ? 49.111 109.238 34.427  1.00 127.41 ? 21  DC  X "C2'" 1 
ATOM   2661 C  "C1'" . DC  C 2 21  ? 48.191 108.724 33.313  1.00 125.63 ? 21  DC  X "C1'" 1 
ATOM   2662 N  N1    . DC  C 2 21  ? 48.666 107.548 32.541  1.00 122.66 ? 21  DC  X N1    1 
ATOM   2663 C  C2    . DC  C 2 21  ? 49.040 106.383 33.229  1.00 120.72 ? 21  DC  X C2    1 
ATOM   2664 O  O2    . DC  C 2 21  ? 48.980 106.369 34.467  1.00 120.96 ? 21  DC  X O2    1 
ATOM   2665 N  N3    . DC  C 2 21  ? 49.465 105.308 32.525  1.00 117.50 ? 21  DC  X N3    1 
ATOM   2666 C  C4    . DC  C 2 21  ? 49.506 105.357 31.190  1.00 116.13 ? 21  DC  X C4    1 
ATOM   2667 N  N4    . DC  C 2 21  ? 49.928 104.273 30.537  1.00 112.20 ? 21  DC  X N4    1 
ATOM   2668 C  C5    . DC  C 2 21  ? 49.117 106.521 30.466  1.00 112.54 ? 21  DC  X C5    1 
ATOM   2669 C  C6    . DC  C 2 21  ? 48.699 107.580 31.173  1.00 119.48 ? 21  DC  X C6    1 
ATOM   2670 O  "O5'" . DA  D 3 1   ? 43.263 115.227 -10.436 1.00 66.04  ? 1   DA  Y "O5'" 1 
ATOM   2671 C  "C5'" . DA  D 3 1   ? 44.328 115.972 -9.808  1.00 64.18  ? 1   DA  Y "C5'" 1 
ATOM   2672 C  "C4'" . DA  D 3 1   ? 45.327 115.052 -9.138  1.00 62.82  ? 1   DA  Y "C4'" 1 
ATOM   2673 O  "O4'" . DA  D 3 1   ? 45.813 114.067 -10.077 1.00 63.73  ? 1   DA  Y "O4'" 1 
ATOM   2674 C  "C3'" . DA  D 3 1   ? 46.589 115.774 -8.687  1.00 62.34  ? 1   DA  Y "C3'" 1 
ATOM   2675 O  "O3'" . DA  D 3 1   ? 47.348 114.937 -7.814  1.00 63.29  ? 1   DA  Y "O3'" 1 
ATOM   2676 C  "C2'" . DA  D 3 1   ? 47.364 115.876 -9.986  1.00 64.38  ? 1   DA  Y "C2'" 1 
ATOM   2677 C  "C1'" . DA  D 3 1   ? 47.024 114.555 -10.669 1.00 65.08  ? 1   DA  Y "C1'" 1 
ATOM   2678 N  N9    . DA  D 3 1   ? 46.815 114.665 -12.111 1.00 66.84  ? 1   DA  Y N9    1 
ATOM   2679 C  C8    . DA  D 3 1   ? 45.646 114.477 -12.801 1.00 67.35  ? 1   DA  Y C8    1 
ATOM   2680 N  N7    . DA  D 3 1   ? 45.773 114.602 -14.096 1.00 70.20  ? 1   DA  Y N7    1 
ATOM   2681 C  C5    . DA  D 3 1   ? 47.111 114.920 -14.272 1.00 71.23  ? 1   DA  Y C5    1 
ATOM   2682 C  C6    . DA  D 3 1   ? 47.876 115.203 -15.420 1.00 74.17  ? 1   DA  Y C6    1 
ATOM   2683 N  N6    . DA  D 3 1   ? 47.383 115.191 -16.660 1.00 76.85  ? 1   DA  Y N6    1 
ATOM   2684 N  N1    . DA  D 3 1   ? 49.192 115.448 -15.251 1.00 74.63  ? 1   DA  Y N1    1 
ATOM   2685 C  C2    . DA  D 3 1   ? 49.691 115.435 -14.008 1.00 72.16  ? 1   DA  Y C2    1 
ATOM   2686 N  N3    . DA  D 3 1   ? 49.074 115.190 -12.855 1.00 69.12  ? 1   DA  Y N3    1 
ATOM   2687 C  C4    . DA  D 3 1   ? 47.769 114.943 -13.058 1.00 68.89  ? 1   DA  Y C4    1 
ATOM   2688 P  P     . DC  D 3 2   ? 47.114 114.950 -6.222  1.00 61.91  ? 2   DC  Y P     1 
ATOM   2689 O  OP1   . DC  D 3 2   ? 46.335 116.158 -5.876  1.00 59.59  ? 2   DC  Y OP1   1 
ATOM   2690 O  OP2   . DC  D 3 2   ? 48.427 114.687 -5.586  1.00 62.89  ? 2   DC  Y OP2   1 
ATOM   2691 O  "O5'" . DC  D 3 2   ? 46.320 113.590 -5.978  1.00 59.25  ? 2   DC  Y "O5'" 1 
ATOM   2692 C  "C5'" . DC  D 3 2   ? 46.996 112.332 -5.900  1.00 60.13  ? 2   DC  Y "C5'" 1 
ATOM   2693 C  "C4'" . DC  D 3 2   ? 46.021 111.221 -6.199  1.00 60.03  ? 2   DC  Y "C4'" 1 
ATOM   2694 O  "O4'" . DC  D 3 2   ? 45.243 111.589 -7.354  1.00 60.72  ? 2   DC  Y "O4'" 1 
ATOM   2695 C  "C3'" . DC  D 3 2   ? 46.652 109.879 -6.552  1.00 61.83  ? 2   DC  Y "C3'" 1 
ATOM   2696 O  "O3'" . DC  D 3 2   ? 46.888 109.078 -5.380  1.00 62.41  ? 2   DC  Y "O3'" 1 
ATOM   2697 C  "C2'" . DC  D 3 2   ? 45.610 109.240 -7.459  1.00 62.35  ? 2   DC  Y "C2'" 1 
ATOM   2698 C  "C1'" . DC  D 3 2   ? 44.782 110.414 -7.998  1.00 62.02  ? 2   DC  Y "C1'" 1 
ATOM   2699 N  N1    . DC  D 3 2   ? 44.837 110.631 -9.460  1.00 64.23  ? 2   DC  Y N1    1 
ATOM   2700 C  C2    . DC  D 3 2   ? 46.076 110.768 -10.098 1.00 65.82  ? 2   DC  Y C2    1 
ATOM   2701 O  O2    . DC  D 3 2   ? 47.109 110.719 -9.419  1.00 64.76  ? 2   DC  Y O2    1 
ATOM   2702 N  N3    . DC  D 3 2   ? 46.115 110.931 -11.441 1.00 68.22  ? 2   DC  Y N3    1 
ATOM   2703 C  C4    . DC  D 3 2   ? 44.980 110.982 -12.140 1.00 69.07  ? 2   DC  Y C4    1 
ATOM   2704 N  N4    . DC  D 3 2   ? 45.065 111.159 -13.457 1.00 71.89  ? 2   DC  Y N4    1 
ATOM   2705 C  C5    . DC  D 3 2   ? 43.705 110.872 -11.514 1.00 67.46  ? 2   DC  Y C5    1 
ATOM   2706 C  C6    . DC  D 3 2   ? 43.680 110.695 -10.185 1.00 65.02  ? 2   DC  Y C6    1 
ATOM   2707 P  P     . DT  D 3 3   ? 48.328 108.407 -5.100  1.00 63.77  ? 3   DT  Y P     1 
ATOM   2708 O  OP1   . DT  D 3 3   ? 49.296 109.486 -4.850  1.00 64.66  ? 3   DT  Y OP1   1 
ATOM   2709 O  OP2   . DT  D 3 3   ? 48.597 107.405 -6.150  1.00 67.05  ? 3   DT  Y OP2   1 
ATOM   2710 O  "O5'" . DT  D 3 3   ? 48.064 107.566 -3.780  1.00 68.35  ? 3   DT  Y "O5'" 1 
ATOM   2711 C  "C5'" . DT  D 3 3   ? 47.962 108.158 -2.467  1.00 75.40  ? 3   DT  Y "C5'" 1 
ATOM   2712 C  "C4'" . DT  D 3 3   ? 48.446 107.162 -1.435  1.00 83.83  ? 3   DT  Y "C4'" 1 
ATOM   2713 O  "O4'" . DT  D 3 3   ? 47.674 105.939 -1.567  1.00 87.10  ? 3   DT  Y "O4'" 1 
ATOM   2714 C  "C3'" . DT  D 3 3   ? 49.923 106.759 -1.586  1.00 92.30  ? 3   DT  Y "C3'" 1 
ATOM   2715 O  "O3'" . DT  D 3 3   ? 50.652 106.655 -0.352  1.00 96.04  ? 3   DT  Y "O3'" 1 
ATOM   2716 C  "C2'" . DT  D 3 3   ? 49.861 105.379 -2.209  1.00 92.65  ? 3   DT  Y "C2'" 1 
ATOM   2717 C  "C1'" . DT  D 3 3   ? 48.555 104.830 -1.672  1.00 93.70  ? 3   DT  Y "C1'" 1 
ATOM   2718 N  N1    . DT  D 3 3   ? 47.944 103.827 -2.569  1.00 98.55  ? 3   DT  Y N1    1 
ATOM   2719 C  C2    . DT  D 3 3   ? 47.992 102.502 -2.192  1.00 100.96 ? 3   DT  Y C2    1 
ATOM   2720 O  O2    . DT  D 3 3   ? 48.468 102.125 -1.133  1.00 95.07  ? 3   DT  Y O2    1 
ATOM   2721 N  N3    . DT  D 3 3   ? 47.441 101.629 -3.100  1.00 105.23 ? 3   DT  Y N3    1 
ATOM   2722 C  C4    . DT  D 3 3   ? 46.879 101.943 -4.325  1.00 107.61 ? 3   DT  Y C4    1 
ATOM   2723 O  O4    . DT  D 3 3   ? 46.425 101.049 -5.035  1.00 112.31 ? 3   DT  Y O4    1 
ATOM   2724 C  C5    . DT  D 3 3   ? 46.884 103.351 -4.665  1.00 103.22 ? 3   DT  Y C5    1 
ATOM   2725 C  C7    . DT  D 3 3   ? 46.299 103.791 -5.971  1.00 103.77 ? 3   DT  Y C7    1 
ATOM   2726 C  C6    . DT  D 3 3   ? 47.419 104.207 -3.786  1.00 101.91 ? 3   DT  Y C6    1 
ATOM   2727 P  P     . DC  D 3 4   ? 51.291 107.958 0.344   1.00 91.43  ? 4   DC  Y P     1 
ATOM   2728 O  OP1   . DC  D 3 4   ? 51.284 109.077 -0.636  1.00 93.66  ? 4   DC  Y OP1   1 
ATOM   2729 O  OP2   . DC  D 3 4   ? 52.571 107.555 0.978   1.00 95.99  ? 4   DC  Y OP2   1 
ATOM   2730 O  "O5'" . DC  D 3 4   ? 50.218 108.311 1.471   1.00 91.28  ? 4   DC  Y "O5'" 1 
ATOM   2731 C  "C5'" . DC  D 3 4   ? 50.547 109.159 2.589   1.00 85.81  ? 4   DC  Y "C5'" 1 
ATOM   2732 C  "C4'" . DC  D 3 4   ? 50.509 108.376 3.884   1.00 86.62  ? 4   DC  Y "C4'" 1 
ATOM   2733 O  "O4'" . DC  D 3 4   ? 49.990 107.040 3.672   1.00 85.42  ? 4   DC  Y "O4'" 1 
ATOM   2734 C  "C3'" . DC  D 3 4   ? 51.857 108.209 4.599   1.00 85.07  ? 4   DC  Y "C3'" 1 
ATOM   2735 O  "O3'" . DC  D 3 4   ? 51.753 108.708 5.933   1.00 81.05  ? 4   DC  Y "O3'" 1 
ATOM   2736 C  "C2'" . DC  D 3 4   ? 52.099 106.710 4.614   1.00 84.27  ? 4   DC  Y "C2'" 1 
ATOM   2737 C  "C1'" . DC  D 3 4   ? 50.711 106.124 4.471   1.00 84.56  ? 4   DC  Y "C1'" 1 
ATOM   2738 N  N1    . DC  D 3 4   ? 50.714 104.825 3.785   1.00 91.23  ? 4   DC  Y N1    1 
ATOM   2739 C  C2    . DC  D 3 4   ? 51.291 103.727 4.439   1.00 95.91  ? 4   DC  Y C2    1 
ATOM   2740 O  O2    . DC  D 3 4   ? 51.749 103.880 5.584   1.00 94.60  ? 4   DC  Y O2    1 
ATOM   2741 N  N3    . DC  D 3 4   ? 51.322 102.526 3.813   1.00 93.54  ? 4   DC  Y N3    1 
ATOM   2742 C  C4    . DC  D 3 4   ? 50.817 102.402 2.583   1.00 93.72  ? 4   DC  Y C4    1 
ATOM   2743 N  N4    . DC  D 3 4   ? 50.870 101.202 2.004   1.00 97.19  ? 4   DC  Y N4    1 
ATOM   2744 C  C5    . DC  D 3 4   ? 50.231 103.503 1.893   1.00 95.27  ? 4   DC  Y C5    1 
ATOM   2745 C  C6    . DC  D 3 4   ? 50.206 104.687 2.522   1.00 92.76  ? 4   DC  Y C6    1 
ATOM   2746 P  P     . DC  D 3 5   ? 52.970 109.497 6.621   1.00 79.36  ? 5   DC  Y P     1 
ATOM   2747 O  OP1   . DC  D 3 5   ? 52.704 110.969 6.532   1.00 72.67  ? 5   DC  Y OP1   1 
ATOM   2748 O  OP2   . DC  D 3 5   ? 54.254 108.939 6.094   1.00 91.63  ? 5   DC  Y OP2   1 
ATOM   2749 O  "O5'" . DC  D 3 5   ? 52.854 109.029 8.141   1.00 73.29  ? 5   DC  Y "O5'" 1 
ATOM   2750 C  "C5'" . DC  D 3 5   ? 52.931 107.634 8.530   1.00 66.36  ? 5   DC  Y "C5'" 1 
ATOM   2751 C  "C4'" . DC  D 3 5   ? 53.189 107.576 10.018  1.00 64.01  ? 5   DC  Y "C4'" 1 
ATOM   2752 O  "O4'" . DC  D 3 5   ? 52.066 108.156 10.736  1.00 60.01  ? 5   DC  Y "O4'" 1 
ATOM   2753 C  "C3'" . DC  D 3 5   ? 53.371 106.172 10.582  1.00 63.73  ? 5   DC  Y "C3'" 1 
ATOM   2754 O  "O3'" . DC  D 3 5   ? 54.396 106.187 11.581  1.00 65.00  ? 5   DC  Y "O3'" 1 
ATOM   2755 C  "C2'" . DC  D 3 5   ? 52.011 105.865 11.174  1.00 60.04  ? 5   DC  Y "C2'" 1 
ATOM   2756 C  "C1'" . DC  D 3 5   ? 51.557 107.220 11.671  1.00 58.16  ? 5   DC  Y "C1'" 1 
ATOM   2757 N  N1    . DC  D 3 5   ? 50.084 107.376 11.727  1.00 55.28  ? 5   DC  Y N1    1 
ATOM   2758 C  C2    . DC  D 3 5   ? 49.478 107.736 12.943  1.00 52.32  ? 5   DC  Y C2    1 
ATOM   2759 O  O2    . DC  D 3 5   ? 50.191 107.925 13.938  1.00 51.89  ? 5   DC  Y O2    1 
ATOM   2760 N  N3    . DC  D 3 5   ? 48.131 107.860 12.999  1.00 50.59  ? 5   DC  Y N3    1 
ATOM   2761 C  C4    . DC  D 3 5   ? 47.392 107.609 11.915  1.00 49.59  ? 5   DC  Y C4    1 
ATOM   2762 N  N4    . DC  D 3 5   ? 46.068 107.737 12.018  1.00 47.08  ? 5   DC  Y N4    1 
ATOM   2763 C  C5    . DC  D 3 5   ? 47.981 107.241 10.668  1.00 51.82  ? 5   DC  Y C5    1 
ATOM   2764 C  C6    . DC  D 3 5   ? 49.317 107.127 10.623  1.00 53.32  ? 5   DC  Y C6    1 
ATOM   2765 P  P     . DT  D 3 6   ? 54.965 104.811 12.202  1.00 67.51  ? 6   DT  Y P     1 
ATOM   2766 O  OP1   . DT  D 3 6   ? 56.420 105.004 12.458  1.00 68.92  ? 6   DT  Y OP1   1 
ATOM   2767 O  OP2   . DT  D 3 6   ? 54.495 103.660 11.377  1.00 64.72  ? 6   DT  Y OP2   1 
ATOM   2768 O  "O5'" . DT  D 3 6   ? 54.155 104.648 13.565  1.00 64.30  ? 6   DT  Y "O5'" 1 
ATOM   2769 C  "C5'" . DT  D 3 6   ? 54.175 105.657 14.591  1.00 62.62  ? 6   DT  Y "C5'" 1 
ATOM   2770 C  "C4'" . DT  D 3 6   ? 53.121 105.336 15.624  1.00 61.22  ? 6   DT  Y "C4'" 1 
ATOM   2771 O  "O4'" . DT  D 3 6   ? 51.807 105.571 15.070  1.00 59.13  ? 6   DT  Y "O4'" 1 
ATOM   2772 C  "C3'" . DT  D 3 6   ? 53.129 103.883 16.103  1.00 61.79  ? 6   DT  Y "C3'" 1 
ATOM   2773 O  "O3'" . DT  D 3 6   ? 53.502 103.888 17.476  1.00 64.76  ? 6   DT  Y "O3'" 1 
ATOM   2774 C  "C2'" . DT  D 3 6   ? 51.705 103.386 15.893  1.00 58.93  ? 6   DT  Y "C2'" 1 
ATOM   2775 C  "C1'" . DT  D 3 6   ? 50.900 104.655 15.649  1.00 56.75  ? 6   DT  Y "C1'" 1 
ATOM   2776 N  N1    . DT  D 3 6   ? 49.745 104.517 14.732  1.00 53.83  ? 6   DT  Y N1    1 
ATOM   2777 C  C2    . DT  D 3 6   ? 48.486 104.858 15.188  1.00 51.17  ? 6   DT  Y C2    1 
ATOM   2778 O  O2    . DT  D 3 6   ? 48.270 105.259 16.321  1.00 50.51  ? 6   DT  Y O2    1 
ATOM   2779 N  N3    . DT  D 3 6   ? 47.482 104.721 14.257  1.00 49.16  ? 6   DT  Y N3    1 
ATOM   2780 C  C4    . DT  D 3 6   ? 47.605 104.262 12.958  1.00 49.42  ? 6   DT  Y C4    1 
ATOM   2781 O  O4    . DT  D 3 6   ? 46.616 104.191 12.240  1.00 47.94  ? 6   DT  Y O4    1 
ATOM   2782 C  C5    . DT  D 3 6   ? 48.949 103.920 12.547  1.00 52.25  ? 6   DT  Y C5    1 
ATOM   2783 C  C7    . DT  D 3 6   ? 49.177 103.435 11.149  1.00 52.83  ? 6   DT  Y C7    1 
ATOM   2784 C  C6    . DT  D 3 6   ? 49.939 104.067 13.441  1.00 53.39  ? 6   DT  Y C6    1 
ATOM   2785 P  P     . DC  D 3 7   ? 53.793 102.518 18.236  1.00 67.71  ? 7   DC  Y P     1 
ATOM   2786 O  OP1   . DC  D 3 7   ? 54.982 102.729 19.105  1.00 69.29  ? 7   DC  Y OP1   1 
ATOM   2787 O  OP2   . DC  D 3 7   ? 53.738 101.383 17.261  1.00 62.82  ? 7   DC  Y OP2   1 
ATOM   2788 O  "O5'" . DC  D 3 7   ? 52.498 102.320 19.135  1.00 65.22  ? 7   DC  Y "O5'" 1 
ATOM   2789 C  "C5'" . DC  D 3 7   ? 51.848 103.413 19.804  1.00 64.44  ? 7   DC  Y "C5'" 1 
ATOM   2790 C  "C4'" . DC  D 3 7   ? 50.564 102.888 20.395  1.00 63.14  ? 7   DC  Y "C4'" 1 
ATOM   2791 O  "O4'" . DC  D 3 7   ? 49.505 102.894 19.401  1.00 59.96  ? 7   DC  Y "O4'" 1 
ATOM   2792 C  "C3'" . DC  D 3 7   ? 50.658 101.451 20.922  1.00 64.27  ? 7   DC  Y "C3'" 1 
ATOM   2793 O  "O3'" . DC  D 3 7   ? 50.128 101.504 22.241  1.00 67.12  ? 7   DC  Y "O3'" 1 
ATOM   2794 C  "C2'" . DC  D 3 7   ? 49.830 100.625 19.945  1.00 60.49  ? 7   DC  Y "C2'" 1 
ATOM   2795 C  "C1'" . DC  D 3 7   ? 48.839 101.632 19.370  1.00 57.58  ? 7   DC  Y "C1'" 1 
ATOM   2796 N  N1    . DC  D 3 7   ? 48.371 101.414 17.979  1.00 54.81  ? 7   DC  Y N1    1 
ATOM   2797 C  C2    . DC  D 3 7   ? 47.014 101.635 17.671  1.00 52.44  ? 7   DC  Y C2    1 
ATOM   2798 O  O2    . DC  D 3 7   ? 46.229 101.940 18.580  1.00 50.96  ? 7   DC  Y O2    1 
ATOM   2799 N  N3    . DC  D 3 7   ? 46.598 101.510 16.388  1.00 50.60  ? 7   DC  Y N3    1 
ATOM   2800 C  C4    . DC  D 3 7   ? 47.473 101.189 15.431  1.00 51.44  ? 7   DC  Y C4    1 
ATOM   2801 N  N4    . DC  D 3 7   ? 47.019 101.091 14.180  1.00 50.25  ? 7   DC  Y N4    1 
ATOM   2802 C  C5    . DC  D 3 7   ? 48.859 100.988 15.710  1.00 52.71  ? 7   DC  Y C5    1 
ATOM   2803 C  C6    . DC  D 3 7   ? 49.261 101.112 16.985  1.00 53.80  ? 7   DC  Y C6    1 
ATOM   2804 P  P     . DC  D 3 8   ? 50.248 100.276 23.237  1.00 68.73  ? 8   DC  Y P     1 
ATOM   2805 O  OP1   . DC  D 3 8   ? 50.463 100.845 24.593  1.00 70.32  ? 8   DC  Y OP1   1 
ATOM   2806 O  OP2   . DC  D 3 8   ? 51.186 99.255  22.668  1.00 68.00  ? 8   DC  Y OP2   1 
ATOM   2807 O  "O5'" . DC  D 3 8   ? 48.812 99.600  23.149  1.00 63.03  ? 8   DC  Y "O5'" 1 
ATOM   2808 C  "C5'" . DC  D 3 8   ? 47.621 100.359 23.389  1.00 60.85  ? 8   DC  Y "C5'" 1 
ATOM   2809 C  "C4'" . DC  D 3 8   ? 46.444 99.561  22.884  1.00 58.42  ? 8   DC  Y "C4'" 1 
ATOM   2810 O  "O4'" . DC  D 3 8   ? 46.427 99.610  21.437  1.00 55.03  ? 8   DC  Y "O4'" 1 
ATOM   2811 C  "C3'" . DC  D 3 8   ? 46.472 98.071  23.258  1.00 59.33  ? 8   DC  Y "C3'" 1 
ATOM   2812 O  "O3'" . DC  D 3 8   ? 45.183 97.647  23.672  1.00 60.76  ? 8   DC  Y "O3'" 1 
ATOM   2813 C  "C2'" . DC  D 3 8   ? 46.744 97.366  21.943  1.00 56.56  ? 8   DC  Y "C2'" 1 
ATOM   2814 C  "C1'" . DC  D 3 8   ? 46.074 98.329  20.970  1.00 54.41  ? 8   DC  Y "C1'" 1 
ATOM   2815 N  N1    . DC  D 3 8   ? 46.488 98.217  19.562  1.00 51.55  ? 8   DC  Y N1    1 
ATOM   2816 C  C2    . DC  D 3 8   ? 45.518 98.342  18.558  1.00 48.97  ? 8   DC  Y C2    1 
ATOM   2817 O  O2    . DC  D 3 8   ? 44.345 98.590  18.880  1.00 47.25  ? 8   DC  Y O2    1 
ATOM   2818 N  N3    . DC  D 3 8   ? 45.890 98.218  17.264  1.00 48.04  ? 8   DC  Y N3    1 
ATOM   2819 C  C4    . DC  D 3 8   ? 47.164 97.960  16.958  1.00 49.50  ? 8   DC  Y C4    1 
ATOM   2820 N  N4    . DC  D 3 8   ? 47.490 97.844  15.669  1.00 49.38  ? 8   DC  Y N4    1 
ATOM   2821 C  C5    . DC  D 3 8   ? 48.168 97.824  17.960  1.00 51.16  ? 8   DC  Y C5    1 
ATOM   2822 C  C6    . DC  D 3 8   ? 47.789 97.956  19.235  1.00 51.86  ? 8   DC  Y C6    1 
ATOM   2823 P  P     . DG  D 3 9   ? 45.030 96.407  24.632  1.00 66.24  ? 9   DG  Y P     1 
ATOM   2824 O  OP1   . DG  D 3 9   ? 45.379 96.858  26.004  1.00 66.16  ? 9   DG  Y OP1   1 
ATOM   2825 O  OP2   . DG  D 3 9   ? 45.700 95.220  24.013  1.00 62.60  ? 9   DG  Y OP2   1 
ATOM   2826 O  "O5'" . DG  D 3 9   ? 43.475 96.090  24.541  1.00 61.10  ? 9   DG  Y "O5'" 1 
ATOM   2827 C  "C5'" . DG  D 3 9   ? 42.500 97.109  24.269  1.00 59.05  ? 9   DG  Y "C5'" 1 
ATOM   2828 C  "C4'" . DG  D 3 9   ? 41.528 96.555  23.256  1.00 56.98  ? 9   DG  Y "C4'" 1 
ATOM   2829 O  "O4'" . DG  D 3 9   ? 42.109 96.630  21.931  1.00 53.13  ? 9   DG  Y "O4'" 1 
ATOM   2830 C  "C3'" . DG  D 3 9   ? 41.170 95.077  23.480  1.00 57.20  ? 9   DG  Y "C3'" 1 
ATOM   2831 O  "O3'" . DG  D 3 9   ? 39.750 95.016  23.382  1.00 60.50  ? 9   DG  Y "O3'" 1 
ATOM   2832 C  "C2'" . DG  D 3 9   ? 41.957 94.346  22.400  1.00 53.75  ? 9   DG  Y "C2'" 1 
ATOM   2833 C  "C1'" . DG  D 3 9   ? 41.899 95.375  21.291  1.00 51.75  ? 9   DG  Y "C1'" 1 
ATOM   2834 N  N9    . DG  D 3 9   ? 42.868 95.260  20.211  1.00 48.84  ? 9   DG  Y N9    1 
ATOM   2835 C  C8    . DG  D 3 9   ? 44.228 95.078  20.297  1.00 48.69  ? 9   DG  Y C8    1 
ATOM   2836 N  N7    . DG  D 3 9   ? 44.818 95.077  19.132  1.00 47.31  ? 9   DG  Y N7    1 
ATOM   2837 C  C5    . DG  D 3 9   ? 43.789 95.305  18.227  1.00 45.86  ? 9   DG  Y C5    1 
ATOM   2838 C  C6    . DG  D 3 9   ? 43.812 95.406  16.811  1.00 44.28  ? 9   DG  Y C6    1 
ATOM   2839 O  O6    . DG  D 3 9   ? 44.783 95.323  16.049  1.00 43.77  ? 9   DG  Y O6    1 
ATOM   2840 N  N1    . DG  D 3 9   ? 42.542 95.651  16.295  1.00 43.35  ? 9   DG  Y N1    1 
ATOM   2841 C  C2    . DG  D 3 9   ? 41.392 95.753  17.043  1.00 43.90  ? 9   DG  Y C2    1 
ATOM   2842 N  N2    . DG  D 3 9   ? 40.255 95.974  16.369  1.00 43.57  ? 9   DG  Y N2    1 
ATOM   2843 N  N3    . DG  D 3 9   ? 41.360 95.657  18.360  1.00 45.00  ? 9   DG  Y N3    1 
ATOM   2844 C  C4    . DG  D 3 9   ? 42.583 95.436  18.882  1.00 46.18  ? 9   DG  Y C4    1 
ATOM   2845 P  P     . DA  D 3 10  ? 38.992 93.626  23.424  1.00 64.09  ? 10  DA  Y P     1 
ATOM   2846 O  OP1   . DA  D 3 10  ? 37.836 93.773  24.352  1.00 63.98  ? 10  DA  Y OP1   1 
ATOM   2847 O  OP2   . DA  D 3 10  ? 39.990 92.539  23.664  1.00 66.44  ? 10  DA  Y OP2   1 
ATOM   2848 O  "O5'" . DA  D 3 10  ? 38.505 93.483  21.913  1.00 59.40  ? 10  DA  Y "O5'" 1 
ATOM   2849 C  "C5'" . DA  D 3 10  ? 37.927 94.586  21.199  1.00 57.61  ? 10  DA  Y "C5'" 1 
ATOM   2850 C  "C4'" . DA  D 3 10  ? 37.430 94.124  19.851  1.00 55.91  ? 10  DA  Y "C4'" 1 
ATOM   2851 O  "O4'" . DA  D 3 10  ? 38.516 94.014  18.900  1.00 53.44  ? 10  DA  Y "O4'" 1 
ATOM   2852 C  "C3'" . DA  D 3 10  ? 36.762 92.754  19.864  1.00 56.55  ? 10  DA  Y "C3'" 1 
ATOM   2853 O  "O3'" . DA  D 3 10  ? 35.698 92.841  18.921  1.00 61.93  ? 10  DA  Y "O3'" 1 
ATOM   2854 C  "C2'" . DA  D 3 10  ? 37.888 91.804  19.480  1.00 53.24  ? 10  DA  Y "C2'" 1 
ATOM   2855 C  "C1'" . DA  D 3 10  ? 38.696 92.641  18.509  1.00 50.72  ? 10  DA  Y "C1'" 1 
ATOM   2856 N  N9    . DA  D 3 10  ? 40.132 92.382  18.464  1.00 47.05  ? 10  DA  Y N9    1 
ATOM   2857 C  C8    . DA  D 3 10  ? 41.015 92.226  19.503  1.00 46.55  ? 10  DA  Y C8    1 
ATOM   2858 N  N7    . DA  D 3 10  ? 42.262 92.100  19.121  1.00 45.70  ? 10  DA  Y N7    1 
ATOM   2859 C  C5    . DA  D 3 10  ? 42.197 92.195  17.738  1.00 44.97  ? 10  DA  Y C5    1 
ATOM   2860 C  C6    . DA  D 3 10  ? 43.185 92.149  16.740  1.00 44.70  ? 10  DA  Y C6    1 
ATOM   2861 N  N6    . DA  D 3 10  ? 44.482 91.970  16.995  1.00 45.28  ? 10  DA  Y N6    1 
ATOM   2862 N  N1    . DA  D 3 10  ? 42.790 92.293  15.454  1.00 43.90  ? 10  DA  Y N1    1 
ATOM   2863 C  C2    . DA  D 3 10  ? 41.486 92.470  15.201  1.00 43.83  ? 10  DA  Y C2    1 
ATOM   2864 N  N3    . DA  D 3 10  ? 40.464 92.539  16.055  1.00 43.78  ? 10  DA  Y N3    1 
ATOM   2865 C  C4    . DA  D 3 10  ? 40.894 92.389  17.322  1.00 45.25  ? 10  DA  Y C4    1 
ATOM   2866 P  P     . DA  D 3 11  ? 34.701 91.632  18.691  1.00 70.39  ? 11  DA  Y P     1 
ATOM   2867 O  OP1   . DA  D 3 11  ? 33.349 92.224  18.512  1.00 66.00  ? 11  DA  Y OP1   1 
ATOM   2868 O  OP2   . DA  D 3 11  ? 34.941 90.602  19.757  1.00 66.07  ? 11  DA  Y OP2   1 
ATOM   2869 O  "O5'" . DA  D 3 11  ? 35.215 91.007  17.312  1.00 67.04  ? 11  DA  Y "O5'" 1 
ATOM   2870 C  "C5'" . DA  D 3 11  ? 35.647 91.861  16.225  1.00 63.30  ? 11  DA  Y "C5'" 1 
ATOM   2871 C  "C4'" . DA  D 3 11  ? 36.127 91.035  15.054  1.00 60.47  ? 11  DA  Y "C4'" 1 
ATOM   2872 O  "O4'" . DA  D 3 11  ? 37.561 90.823  15.099  1.00 58.54  ? 11  DA  Y "O4'" 1 
ATOM   2873 C  "C3'" . DA  D 3 11  ? 35.515 89.643  14.948  1.00 59.26  ? 11  DA  Y "C3'" 1 
ATOM   2874 O  "O3'" . DA  D 3 11  ? 35.402 89.457  13.542  1.00 62.31  ? 11  DA  Y "O3'" 1 
ATOM   2875 C  "C2'" . DA  D 3 11  ? 36.572 88.761  15.589  1.00 57.20  ? 11  DA  Y "C2'" 1 
ATOM   2876 C  "C1'" . DA  D 3 11  ? 37.838 89.427  15.088  1.00 53.39  ? 11  DA  Y "C1'" 1 
ATOM   2877 N  N9    . DA  D 3 11  ? 39.032 89.197  15.899  1.00 50.53  ? 11  DA  Y N9    1 
ATOM   2878 C  C8    . DA  D 3 11  ? 39.133 89.009  17.258  1.00 49.52  ? 11  DA  Y C8    1 
ATOM   2879 N  N7    . DA  D 3 11  ? 40.365 88.846  17.677  1.00 48.47  ? 11  DA  Y N7    1 
ATOM   2880 C  C5    . DA  D 3 11  ? 41.127 88.958  16.523  1.00 46.66  ? 11  DA  Y C5    1 
ATOM   2881 C  C6    . DA  D 3 11  ? 42.514 88.885  16.294  1.00 46.46  ? 11  DA  Y C6    1 
ATOM   2882 N  N6    . DA  D 3 11  ? 43.413 88.697  17.259  1.00 47.19  ? 11  DA  Y N6    1 
ATOM   2883 N  N1    . DA  D 3 11  ? 42.950 89.022  15.022  1.00 45.70  ? 11  DA  Y N1    1 
ATOM   2884 C  C2    . DA  D 3 11  ? 42.045 89.223  14.051  1.00 46.64  ? 11  DA  Y C2    1 
ATOM   2885 N  N3    . DA  D 3 11  ? 40.717 89.323  14.144  1.00 46.77  ? 11  DA  Y N3    1 
ATOM   2886 C  C4    . DA  D 3 11  ? 40.319 89.171  15.420  1.00 47.52  ? 11  DA  Y C4    1 
ATOM   2887 P  P     . DA  D 3 12  ? 34.747 88.140  12.911  1.00 61.37  ? 12  DA  Y P     1 
ATOM   2888 O  OP1   . DA  D 3 12  ? 33.471 88.549  12.311  1.00 60.96  ? 12  DA  Y OP1   1 
ATOM   2889 O  OP2   . DA  D 3 12  ? 34.798 87.031  13.885  1.00 60.36  ? 12  DA  Y OP2   1 
ATOM   2890 O  "O5'" . DA  D 3 12  ? 35.802 87.718  11.796  1.00 55.26  ? 12  DA  Y "O5'" 1 
ATOM   2891 C  "C5'" . DA  D 3 12  ? 36.585 88.697  11.086  1.00 49.96  ? 12  DA  Y "C5'" 1 
ATOM   2892 C  "C4'" . DA  D 3 12  ? 37.752 88.002  10.435  1.00 48.20  ? 12  DA  Y "C4'" 1 
ATOM   2893 O  "O4'" . DA  D 3 12  ? 38.826 87.849  11.403  1.00 46.52  ? 12  DA  Y "O4'" 1 
ATOM   2894 C  "C3'" . DA  D 3 12  ? 37.417 86.594  9.923   1.00 47.69  ? 12  DA  Y "C3'" 1 
ATOM   2895 O  "O3'" . DA  D 3 12  ? 37.981 86.502  8.626   1.00 47.61  ? 12  DA  Y "O3'" 1 
ATOM   2896 C  "C2'" . DA  D 3 12  ? 38.030 85.665  10.959  1.00 46.37  ? 12  DA  Y "C2'" 1 
ATOM   2897 C  "C1'" . DA  D 3 12  ? 39.212 86.481  11.480  1.00 45.60  ? 12  DA  Y "C1'" 1 
ATOM   2898 N  N9    . DA  D 3 12  ? 39.582 86.202  12.866  1.00 43.36  ? 12  DA  Y N9    1 
ATOM   2899 C  C8    . DA  D 3 12  ? 38.760 86.083  13.959  1.00 42.41  ? 12  DA  Y C8    1 
ATOM   2900 N  N7    . DA  D 3 12  ? 39.400 85.833  15.076  1.00 42.40  ? 12  DA  Y N7    1 
ATOM   2901 C  C5    . DA  D 3 12  ? 40.736 85.827  14.699  1.00 42.10  ? 12  DA  Y C5    1 
ATOM   2902 C  C6    . DA  D 3 12  ? 41.921 85.654  15.432  1.00 42.22  ? 12  DA  Y C6    1 
ATOM   2903 N  N6    . DA  D 3 12  ? 41.942 85.408  16.740  1.00 42.61  ? 12  DA  Y N6    1 
ATOM   2904 N  N1    . DA  D 3 12  ? 43.091 85.684  14.755  1.00 42.17  ? 12  DA  Y N1    1 
ATOM   2905 C  C2    . DA  D 3 12  ? 43.061 85.918  13.433  1.00 42.59  ? 12  DA  Y C2    1 
ATOM   2906 N  N3    . DA  D 3 12  ? 42.008 86.117  12.636  1.00 42.08  ? 12  DA  Y N3    1 
ATOM   2907 C  C4    . DA  D 3 12  ? 40.864 86.069  13.343  1.00 42.42  ? 12  DA  Y C4    1 
ATOM   2908 P  P     . DA  D 3 13  ? 37.988 85.143  7.836   1.00 49.54  ? 13  DA  Y P     1 
ATOM   2909 O  OP1   . DA  D 3 13  ? 37.971 85.490  6.395   1.00 51.05  ? 13  DA  Y OP1   1 
ATOM   2910 O  OP2   . DA  D 3 13  ? 36.951 84.249  8.418   1.00 50.39  ? 13  DA  Y OP2   1 
ATOM   2911 O  "O5'" . DA  D 3 13  ? 39.444 84.576  8.146   1.00 48.62  ? 13  DA  Y "O5'" 1 
ATOM   2912 C  "C5'" . DA  D 3 13  ? 40.593 85.331  7.679   1.00 48.48  ? 13  DA  Y "C5'" 1 
ATOM   2913 C  "C4'" . DA  D 3 13  ? 41.870 84.636  8.082   1.00 48.83  ? 13  DA  Y "C4'" 1 
ATOM   2914 O  "O4'" . DA  D 3 13  ? 41.906 84.513  9.518   1.00 46.45  ? 13  DA  Y "O4'" 1 
ATOM   2915 C  "C3'" . DA  D 3 13  ? 42.028 83.219  7.518   1.00 49.31  ? 13  DA  Y "C3'" 1 
ATOM   2916 O  "O3'" . DA  D 3 13  ? 43.235 83.217  6.750   1.00 54.05  ? 13  DA  Y "O3'" 1 
ATOM   2917 C  "C2'" . DA  D 3 13  ? 42.044 82.318  8.747   1.00 48.16  ? 13  DA  Y "C2'" 1 
ATOM   2918 C  "C1'" . DA  D 3 13  ? 42.449 83.259  9.868   1.00 46.59  ? 13  DA  Y "C1'" 1 
ATOM   2919 N  N9    . DA  D 3 13  ? 41.940 82.937  11.200  1.00 45.03  ? 13  DA  Y N9    1 
ATOM   2920 C  C8    . DA  D 3 13  ? 40.627 82.870  11.601  1.00 44.20  ? 13  DA  Y C8    1 
ATOM   2921 N  N7    . DA  D 3 13  ? 40.478 82.655  12.885  1.00 43.45  ? 13  DA  Y N7    1 
ATOM   2922 C  C5    . DA  D 3 13  ? 41.777 82.608  13.368  1.00 43.40  ? 13  DA  Y C5    1 
ATOM   2923 C  C6    . DA  D 3 13  ? 42.297 82.424  14.657  1.00 43.82  ? 13  DA  Y C6    1 
ATOM   2924 N  N6    . DA  D 3 13  ? 41.536 82.211  15.731  1.00 43.64  ? 13  DA  Y N6    1 
ATOM   2925 N  N1    . DA  D 3 13  ? 43.643 82.420  14.799  1.00 44.25  ? 13  DA  Y N1    1 
ATOM   2926 C  C2    . DA  D 3 13  ? 44.403 82.638  13.716  1.00 44.20  ? 13  DA  Y C2    1 
ATOM   2927 N  N3    . DA  D 3 13  ? 44.031 82.835  12.455  1.00 43.98  ? 13  DA  Y N3    1 
ATOM   2928 C  C4    . DA  D 3 13  ? 42.689 82.798  12.345  1.00 44.32  ? 13  DA  Y C4    1 
ATOM   2929 P  P     . DA  D 3 14  ? 43.801 81.862  6.072   1.00 61.13  ? 14  DA  Y P     1 
ATOM   2930 O  OP1   . DA  D 3 14  ? 44.623 82.268  4.907   1.00 63.58  ? 14  DA  Y OP1   1 
ATOM   2931 O  OP2   . DA  D 3 14  ? 42.688 80.889  5.928   1.00 58.84  ? 14  DA  Y OP2   1 
ATOM   2932 O  "O5'" . DA  D 3 14  ? 44.785 81.274  7.171   1.00 58.71  ? 14  DA  Y "O5'" 1 
ATOM   2933 C  "C5'" . DA  D 3 14  ? 45.871 82.065  7.642   1.00 58.72  ? 14  DA  Y "C5'" 1 
ATOM   2934 C  "C4'" . DA  D 3 14  ? 46.615 81.285  8.691   1.00 58.67  ? 14  DA  Y "C4'" 1 
ATOM   2935 O  "O4'" . DA  D 3 14  ? 45.833 81.220  9.909   1.00 55.91  ? 14  DA  Y "O4'" 1 
ATOM   2936 C  "C3'" . DA  D 3 14  ? 46.897 79.835  8.286   1.00 60.17  ? 14  DA  Y "C3'" 1 
ATOM   2937 O  "O3'" . DA  D 3 14  ? 48.297 79.664  8.526   1.00 66.40  ? 14  DA  Y "O3'" 1 
ATOM   2938 C  "C2'" . DA  D 3 14  ? 45.920 79.044  9.138   1.00 57.40  ? 14  DA  Y "C2'" 1 
ATOM   2939 C  "C1'" . DA  D 3 14  ? 45.861 79.890  10.390  1.00 54.15  ? 14  DA  Y "C1'" 1 
ATOM   2940 N  N9    . DA  D 3 14  ? 44.672 79.689  11.209  1.00 50.78  ? 14  DA  Y N9    1 
ATOM   2941 C  C8    . DA  D 3 14  ? 43.372 79.583  10.776  1.00 49.30  ? 14  DA  Y C8    1 
ATOM   2942 N  N7    . DA  D 3 14  ? 42.508 79.392  11.742  1.00 47.75  ? 14  DA  Y N7    1 
ATOM   2943 C  C5    . DA  D 3 14  ? 43.287 79.389  12.892  1.00 47.99  ? 14  DA  Y C5    1 
ATOM   2944 C  C6    . DA  D 3 14  ? 42.965 79.239  14.251  1.00 47.15  ? 14  DA  Y C6    1 
ATOM   2945 N  N6    . DA  D 3 14  ? 41.720 79.081  14.700  1.00 46.04  ? 14  DA  Y N6    1 
ATOM   2946 N  N1    . DA  D 3 14  ? 43.978 79.279  15.148  1.00 47.56  ? 14  DA  Y N1    1 
ATOM   2947 C  C2    . DA  D 3 14  ? 45.225 79.450  14.695  1.00 48.22  ? 14  DA  Y C2    1 
ATOM   2948 N  N3    . DA  D 3 14  ? 45.656 79.586  13.440  1.00 49.30  ? 14  DA  Y N3    1 
ATOM   2949 C  C4    . DA  D 3 14  ? 44.623 79.565  12.578  1.00 49.04  ? 14  DA  Y C4    1 
ATOM   2950 P  P     . DA  D 3 15  ? 49.008 78.239  8.423   1.00 69.97  ? 15  DA  Y P     1 
ATOM   2951 O  OP1   . DA  D 3 15  ? 49.472 78.089  7.024   1.00 71.28  ? 15  DA  Y OP1   1 
ATOM   2952 O  OP2   . DA  D 3 15  ? 48.132 77.200  9.019   1.00 68.09  ? 15  DA  Y OP2   1 
ATOM   2953 O  "O5'" . DA  D 3 15  ? 50.180 78.381  9.494   1.00 69.23  ? 15  DA  Y "O5'" 1 
ATOM   2954 C  "C5'" . DA  D 3 15  ? 49.978 79.106  10.735  1.00 67.11  ? 15  DA  Y "C5'" 1 
ATOM   2955 C  "C4'" . DA  D 3 15  ? 49.960 78.203  11.951  1.00 65.31  ? 15  DA  Y "C4'" 1 
ATOM   2956 O  "O4'" . DA  D 3 15  ? 48.618 78.007  12.450  1.00 61.37  ? 15  DA  Y "O4'" 1 
ATOM   2957 C  "C3'" . DA  D 3 15  ? 50.565 76.804  11.813  1.00 67.78  ? 15  DA  Y "C3'" 1 
ATOM   2958 O  "O3'" . DA  D 3 15  ? 51.400 76.653  12.967  1.00 70.83  ? 15  DA  Y "O3'" 1 
ATOM   2959 C  "C2'" . DA  D 3 15  ? 49.354 75.881  11.832  1.00 64.90  ? 15  DA  Y "C2'" 1 
ATOM   2960 C  "C1'" . DA  D 3 15  ? 48.423 76.634  12.762  1.00 63.10  ? 15  DA  Y "C1'" 1 
ATOM   2961 N  N9    . DA  D 3 15  ? 46.994 76.363  12.630  1.00 60.07  ? 15  DA  Y N9    1 
ATOM   2962 C  C8    . DA  D 3 15  ? 46.264 76.276  11.469  1.00 59.92  ? 15  DA  Y C8    1 
ATOM   2963 N  N7    . DA  D 3 15  ? 44.978 76.114  11.664  1.00 57.41  ? 15  DA  Y N7    1 
ATOM   2964 C  C5    . DA  D 3 15  ? 44.848 76.113  13.045  1.00 56.96  ? 15  DA  Y C5    1 
ATOM   2965 C  C6    . DA  D 3 15  ? 43.731 75.984  13.887  1.00 55.25  ? 15  DA  Y C6    1 
ATOM   2966 N  N6    . DA  D 3 15  ? 42.487 75.816  13.433  1.00 53.90  ? 15  DA  Y N6    1 
ATOM   2967 N  N1    . DA  D 3 15  ? 43.940 76.025  15.223  1.00 54.05  ? 15  DA  Y N1    1 
ATOM   2968 C  C2    . DA  D 3 15  ? 45.193 76.190  15.671  1.00 56.36  ? 15  DA  Y C2    1 
ATOM   2969 N  N3    . DA  D 3 15  ? 46.325 76.332  14.977  1.00 57.23  ? 15  DA  Y N3    1 
ATOM   2970 C  C4    . DA  D 3 15  ? 46.080 76.281  13.654  1.00 58.84  ? 15  DA  Y C4    1 
ATOM   2971 P  P     . DC  D 3 16  ? 52.350 75.381  13.131  1.00 74.42  ? 16  DC  Y P     1 
ATOM   2972 O  OP1   . DC  D 3 16  ? 53.704 75.857  13.555  1.00 72.46  ? 16  DC  Y OP1   1 
ATOM   2973 O  OP2   . DC  D 3 16  ? 52.188 74.542  11.914  1.00 72.62  ? 16  DC  Y OP2   1 
ATOM   2974 O  "O5'" . DC  D 3 16  ? 51.702 74.613  14.371  1.00 75.69  ? 16  DC  Y "O5'" 1 
ATOM   2975 C  "C5'" . DC  D 3 16  ? 51.508 75.266  15.648  1.00 77.11  ? 16  DC  Y "C5'" 1 
ATOM   2976 C  "C4'" . DC  D 3 16  ? 50.657 74.395  16.541  1.00 77.34  ? 16  DC  Y "C4'" 1 
ATOM   2977 O  "O4'" . DC  D 3 16  ? 49.294 74.383  16.042  1.00 74.80  ? 16  DC  Y "O4'" 1 
ATOM   2978 C  "C3'" . DC  D 3 16  ? 51.104 72.929  16.569  1.00 80.22  ? 16  DC  Y "C3'" 1 
ATOM   2979 O  "O3'" . DC  D 3 16  ? 50.817 72.286  17.814  1.00 89.76  ? 16  DC  Y "O3'" 1 
ATOM   2980 C  "C2'" . DC  D 3 16  ? 50.187 72.284  15.551  1.00 77.57  ? 16  DC  Y "C2'" 1 
ATOM   2981 C  "C1'" . DC  D 3 16  ? 48.899 73.024  15.882  1.00 74.39  ? 16  DC  Y "C1'" 1 
ATOM   2982 N  N1    . DC  D 3 16  ? 47.781 72.954  14.905  1.00 71.04  ? 16  DC  Y N1    1 
ATOM   2983 C  C2    . DC  D 3 16  ? 46.460 72.933  15.389  1.00 67.43  ? 16  DC  Y C2    1 
ATOM   2984 O  O2    . DC  D 3 16  ? 46.263 73.012  16.612  1.00 65.94  ? 16  DC  Y O2    1 
ATOM   2985 N  N3    . DC  D 3 16  ? 45.435 72.844  14.510  1.00 64.32  ? 16  DC  Y N3    1 
ATOM   2986 C  C4    . DC  D 3 16  ? 45.684 72.751  13.201  1.00 66.90  ? 16  DC  Y C4    1 
ATOM   2987 N  N4    . DC  D 3 16  ? 44.642 72.664  12.372  1.00 67.27  ? 16  DC  Y N4    1 
ATOM   2988 C  C5    . DC  D 3 16  ? 47.014 72.755  12.683  1.00 69.36  ? 16  DC  Y C5    1 
ATOM   2989 C  C6    . DC  D 3 16  ? 48.023 72.853  13.561  1.00 69.96  ? 16  DC  Y C6    1 
ATOM   2990 P  P     . DC  D 3 17  ? 51.832 72.364  19.052  1.00 98.34  ? 17  DC  Y P     1 
ATOM   2991 O  OP1   . DC  D 3 17  ? 52.262 73.777  19.225  1.00 93.27  ? 17  DC  Y OP1   1 
ATOM   2992 O  OP2   . DC  D 3 17  ? 52.845 71.295  18.871  1.00 96.58  ? 17  DC  Y OP2   1 
ATOM   2993 O  "O5'" . DC  D 3 17  ? 50.895 71.995  20.290  1.00 93.40  ? 17  DC  Y "O5'" 1 
ATOM   2994 C  "C5'" . DC  D 3 17  ? 49.527 72.470  20.393  1.00 87.62  ? 17  DC  Y "C5'" 1 
ATOM   2995 C  "C4'" . DC  D 3 17  ? 48.555 71.318  20.529  1.00 83.59  ? 17  DC  Y "C4'" 1 
ATOM   2996 O  "O4'" . DC  D 3 17  ? 47.743 71.187  19.332  1.00 78.19  ? 17  DC  Y "O4'" 1 
ATOM   2997 C  "C3'" . DC  D 3 17  ? 49.179 69.936  20.752  1.00 81.61  ? 17  DC  Y "C3'" 1 
ATOM   2998 O  "O3'" . DC  D 3 17  ? 48.321 69.175  21.587  1.00 86.26  ? 17  DC  Y "O3'" 1 
ATOM   2999 C  "C2'" . DC  D 3 17  ? 49.058 69.281  19.394  1.00 78.13  ? 17  DC  Y "C2'" 1 
ATOM   3000 C  "C1'" . DC  D 3 17  ? 47.691 69.808  19.009  1.00 73.29  ? 17  DC  Y "C1'" 1 
ATOM   3001 N  N1    . DC  D 3 17  ? 47.264 69.666  17.604  1.00 69.44  ? 17  DC  Y N1    1 
ATOM   3002 C  C2    . DC  D 3 17  ? 45.896 69.537  17.332  1.00 65.33  ? 17  DC  Y C2    1 
ATOM   3003 O  O2    . DC  D 3 17  ? 45.089 69.590  18.272  1.00 68.21  ? 17  DC  Y O2    1 
ATOM   3004 N  N3    . DC  D 3 17  ? 45.488 69.370  16.055  1.00 62.34  ? 17  DC  Y N3    1 
ATOM   3005 C  C4    . DC  D 3 17  ? 46.386 69.313  15.070  1.00 64.32  ? 17  DC  Y C4    1 
ATOM   3006 N  N4    . DC  D 3 17  ? 45.936 69.156  13.824  1.00 65.40  ? 17  DC  Y N4    1 
ATOM   3007 C  C5    . DC  D 3 17  ? 47.787 69.422  15.318  1.00 66.97  ? 17  DC  Y C5    1 
ATOM   3008 C  C6    . DC  D 3 17  ? 48.178 69.588  16.589  1.00 68.49  ? 17  DC  Y C6    1 
ATOM   3009 P  P     . DT  D 3 18  ? 48.790 68.742  23.025  1.00 96.63  ? 18  DT  Y P     1 
ATOM   3010 O  OP1   . DT  D 3 18  ? 49.254 69.963  23.741  1.00 87.78  ? 18  DT  Y OP1   1 
ATOM   3011 O  OP2   . DT  D 3 18  ? 49.669 67.549  22.880  1.00 92.22  ? 18  DT  Y OP2   1 
ATOM   3012 O  "O5'" . DT  D 3 18  ? 47.418 68.319  23.708  1.00 85.94  ? 18  DT  Y "O5'" 1 
ATOM   3013 C  "C5'" . DT  D 3 18  ? 46.349 69.279  23.793  1.00 75.87  ? 18  DT  Y "C5'" 1 
ATOM   3014 C  "C4'" . DT  D 3 18  ? 45.032 68.593  23.532  1.00 67.28  ? 18  DT  Y "C4'" 1 
ATOM   3015 O  "O4'" . DT  D 3 18  ? 44.845 68.371  22.113  1.00 62.50  ? 18  DT  Y "O4'" 1 
ATOM   3016 C  "C3'" . DT  D 3 18  ? 44.893 67.221  24.200  1.00 65.32  ? 18  DT  Y "C3'" 1 
ATOM   3017 O  "O3'" . DT  D 3 18  ? 43.594 67.265  24.777  1.00 65.16  ? 18  DT  Y "O3'" 1 
ATOM   3018 C  "C2'" . DT  D 3 18  ? 45.041 66.241  23.049  1.00 61.06  ? 18  DT  Y "C2'" 1 
ATOM   3019 C  "C1'" . DT  D 3 18  ? 44.417 67.026  21.913  1.00 58.31  ? 18  DT  Y "C1'" 1 
ATOM   3020 N  N1    . DT  D 3 18  ? 44.774 66.639  20.528  1.00 54.12  ? 18  DT  Y N1    1 
ATOM   3021 C  C2    . DT  D 3 18  ? 43.758 66.542  19.600  1.00 52.66  ? 18  DT  Y C2    1 
ATOM   3022 O  O2    . DT  D 3 18  ? 42.580 66.704  19.876  1.00 52.03  ? 18  DT  Y O2    1 
ATOM   3023 N  N3    . DT  D 3 18  ? 44.172 66.226  18.331  1.00 52.30  ? 18  DT  Y N3    1 
ATOM   3024 C  C4    . DT  D 3 18  ? 45.470 66.033  17.900  1.00 53.77  ? 18  DT  Y C4    1 
ATOM   3025 O  O4    . DT  D 3 18  ? 45.689 65.774  16.721  1.00 56.51  ? 18  DT  Y O4    1 
ATOM   3026 C  C5    . DT  D 3 18  ? 46.485 66.165  18.918  1.00 54.78  ? 18  DT  Y C5    1 
ATOM   3027 C  C7    . DT  D 3 18  ? 47.916 65.943  18.543  1.00 55.75  ? 18  DT  Y C7    1 
ATOM   3028 C  C6    . DT  D 3 18  ? 46.093 66.465  20.165  1.00 54.73  ? 18  DT  Y C6    1 
ATOM   3029 P  P     . DC  D 3 19  ? 43.087 66.161  25.808  1.00 68.64  ? 19  DC  Y P     1 
ATOM   3030 O  OP1   . DC  D 3 19  ? 42.423 66.881  26.926  1.00 70.25  ? 19  DC  Y OP1   1 
ATOM   3031 O  OP2   . DC  D 3 19  ? 44.187 65.199  26.091  1.00 68.65  ? 19  DC  Y OP2   1 
ATOM   3032 O  "O5'" . DC  D 3 19  ? 41.970 65.431  24.945  1.00 61.18  ? 19  DC  Y "O5'" 1 
ATOM   3033 C  "C5'" . DC  D 3 19  ? 41.023 66.202  24.181  1.00 55.58  ? 19  DC  Y "C5'" 1 
ATOM   3034 C  "C4'" . DC  D 3 19  ? 40.265 65.271  23.269  1.00 52.53  ? 19  DC  Y "C4'" 1 
ATOM   3035 O  "O4'" . DC  D 3 19  ? 41.009 65.070  22.048  1.00 49.76  ? 19  DC  Y "O4'" 1 
ATOM   3036 C  "C3'" . DC  D 3 19  ? 39.991 63.879  23.853  1.00 51.25  ? 19  DC  Y "C3'" 1 
ATOM   3037 O  "O3'" . DC  D 3 19  ? 38.594 63.654  23.703  1.00 50.03  ? 19  DC  Y "O3'" 1 
ATOM   3038 C  "C2'" . DC  D 3 19  ? 40.819 62.939  22.997  1.00 49.99  ? 19  DC  Y "C2'" 1 
ATOM   3039 C  "C1'" . DC  D 3 19  ? 40.937 63.701  21.682  1.00 48.52  ? 19  DC  Y "C1'" 1 
ATOM   3040 N  N1    . DC  D 3 19  ? 42.126 63.398  20.871  1.00 46.59  ? 19  DC  Y N1    1 
ATOM   3041 C  C2    . DC  D 3 19  ? 41.983 63.256  19.484  1.00 45.53  ? 19  DC  Y C2    1 
ATOM   3042 O  O2    . DC  D 3 19  ? 40.849 63.344  18.981  1.00 44.36  ? 19  DC  Y O2    1 
ATOM   3043 N  N3    . DC  D 3 19  ? 43.083 63.015  18.730  1.00 45.46  ? 19  DC  Y N3    1 
ATOM   3044 C  C4    . DC  D 3 19  ? 44.282 62.922  19.310  1.00 46.61  ? 19  DC  Y C4    1 
ATOM   3045 N  N4    . DC  D 3 19  ? 45.334 62.680  18.531  1.00 47.63  ? 19  DC  Y N4    1 
ATOM   3046 C  C5    . DC  D 3 19  ? 44.457 63.086  20.714  1.00 47.47  ? 19  DC  Y C5    1 
ATOM   3047 C  C6    . DC  D 3 19  ? 43.363 63.325  21.449  1.00 47.28  ? 19  DC  Y C6    1 
ATOM   3048 P  P     . DC  D 3 20  ? 37.864 62.465  24.462  1.00 52.21  ? 20  DC  Y P     1 
ATOM   3049 O  OP1   . DC  D 3 20  ? 36.456 62.888  24.667  1.00 52.64  ? 20  DC  Y OP1   1 
ATOM   3050 O  OP2   . DC  D 3 20  ? 38.718 62.008  25.608  1.00 51.61  ? 20  DC  Y OP2   1 
ATOM   3051 O  "O5'" . DC  D 3 20  ? 37.771 61.325  23.339  1.00 46.75  ? 20  DC  Y "O5'" 1 
ATOM   3052 C  "C5'" . DC  D 3 20  ? 37.023 61.598  22.141  1.00 43.55  ? 20  DC  Y "C5'" 1 
ATOM   3053 C  "C4'" . DC  D 3 20  ? 37.221 60.498  21.127  1.00 41.71  ? 20  DC  Y "C4'" 1 
ATOM   3054 O  "O4'" . DC  D 3 20  ? 38.573 60.580  20.618  1.00 41.06  ? 20  DC  Y "O4'" 1 
ATOM   3055 C  "C3'" . DC  D 3 20  ? 37.047 59.072  21.667  1.00 41.10  ? 20  DC  Y "C3'" 1 
ATOM   3056 O  "O3'" . DC  D 3 20  ? 36.213 58.392  20.741  1.00 40.00  ? 20  DC  Y "O3'" 1 
ATOM   3057 C  "C2'" . DC  D 3 20  ? 38.473 58.555  21.751  1.00 41.21  ? 20  DC  Y "C2'" 1 
ATOM   3058 C  "C1'" . DC  D 3 20  ? 39.128 59.286  20.587  1.00 40.80  ? 20  DC  Y "C1'" 1 
ATOM   3059 N  N1    . DC  D 3 20  ? 40.599 59.423  20.564  1.00 40.94  ? 20  DC  Y N1    1 
ATOM   3060 C  C2    . DC  D 3 20  ? 41.259 59.380  19.329  1.00 40.64  ? 20  DC  Y C2    1 
ATOM   3061 O  O2    . DC  D 3 20  ? 40.597 59.199  18.301  1.00 40.03  ? 20  DC  Y O2    1 
ATOM   3062 N  N3    . DC  D 3 20  ? 42.602 59.513  19.291  1.00 41.16  ? 20  DC  Y N3    1 
ATOM   3063 C  C4    . DC  D 3 20  ? 43.284 59.699  20.422  1.00 42.09  ? 20  DC  Y C4    1 
ATOM   3064 N  N4    . DC  D 3 20  ? 44.606 59.834  20.338  1.00 43.07  ? 20  DC  Y N4    1 
ATOM   3065 C  C5    . DC  D 3 20  ? 42.640 59.744  21.693  1.00 42.30  ? 20  DC  Y C5    1 
ATOM   3066 C  C6    . DC  D 3 20  ? 41.308 59.621  21.715  1.00 41.76  ? 20  DC  Y C6    1 
ATOM   3067 P  P     . DG  D 3 21  ? 35.811 56.844  20.927  1.00 39.69  ? 21  DG  Y P     1 
ATOM   3068 O  OP1   . DG  D 3 21  ? 34.562 56.616  20.159  1.00 39.81  ? 21  DG  Y OP1   1 
ATOM   3069 O  OP2   . DG  D 3 21  ? 35.764 56.520  22.384  1.00 40.51  ? 21  DG  Y OP2   1 
ATOM   3070 O  "O5'" . DG  D 3 21  ? 37.055 56.072  20.294  1.00 39.08  ? 21  DG  Y "O5'" 1 
ATOM   3071 C  "C5'" . DG  D 3 21  ? 37.402 56.213  18.890  1.00 38.49  ? 21  DG  Y "C5'" 1 
ATOM   3072 C  "C4'" . DG  D 3 21  ? 38.724 55.540  18.595  1.00 38.41  ? 21  DG  Y "C4'" 1 
ATOM   3073 O  "O4'" . DG  D 3 21  ? 39.786 56.120  19.400  1.00 38.75  ? 21  DG  Y "O4'" 1 
ATOM   3074 C  "C3'" . DG  D 3 21  ? 38.761 54.032  18.896  1.00 38.40  ? 21  DG  Y "C3'" 1 
ATOM   3075 O  "O3'" . DG  D 3 21  ? 39.671 53.437  17.985  1.00 38.53  ? 21  DG  Y "O3'" 1 
ATOM   3076 C  "C2'" . DG  D 3 21  ? 39.377 53.972  20.277  1.00 38.90  ? 21  DG  Y "C2'" 1 
ATOM   3077 C  "C1'" . DG  D 3 21  ? 40.428 55.045  20.105  1.00 39.21  ? 21  DG  Y "C1'" 1 
ATOM   3078 N  N9    . DG  D 3 21  ? 41.018 55.579  21.328  1.00 39.96  ? 21  DG  Y N9    1 
ATOM   3079 C  C8    . DG  D 3 21  ? 40.459 55.688  22.581  1.00 40.35  ? 21  DG  Y C8    1 
ATOM   3080 N  N7    . DG  D 3 21  ? 41.274 56.206  23.459  1.00 41.29  ? 21  DG  Y N7    1 
ATOM   3081 C  C5    . DG  D 3 21  ? 42.458 56.398  22.758  1.00 41.45  ? 21  DG  Y C5    1 
ATOM   3082 C  C6    . DG  D 3 21  ? 43.721 56.875  23.197  1.00 42.58  ? 21  DG  Y C6    1 
ATOM   3083 O  O6    . DG  D 3 21  ? 44.035 57.300  24.320  1.00 43.60  ? 21  DG  Y O6    1 
ATOM   3084 N  N1    . DG  D 3 21  ? 44.645 56.917  22.149  1.00 42.60  ? 21  DG  Y N1    1 
ATOM   3085 C  C2    . DG  D 3 21  ? 44.399 56.495  20.860  1.00 41.79  ? 21  DG  Y C2    1 
ATOM   3086 N  N2    . DG  D 3 21  ? 45.419 56.586  19.989  1.00 42.22  ? 21  DG  Y N2    1 
ATOM   3087 N  N3    . DG  D 3 21  ? 43.229 56.033  20.450  1.00 40.79  ? 21  DG  Y N3    1 
ATOM   3088 C  C4    . DG  D 3 21  ? 42.313 56.018  21.440  1.00 40.65  ? 21  DG  Y C4    1 
ATOM   3089 P  P     . DG  D 3 22  ? 39.533 51.887  17.564  1.00 38.55  ? 22  DG  Y P     1 
ATOM   3090 O  OP1   . DG  D 3 22  ? 38.111 51.601  17.399  1.00 38.24  ? 22  DG  Y OP1   1 
ATOM   3091 O  OP2   . DG  D 3 22  ? 40.296 51.069  18.552  1.00 38.93  ? 22  DG  Y OP2   1 
ATOM   3092 O  "O5'" . DG  D 3 22  ? 40.340 51.847  16.194  1.00 38.87  ? 22  DG  Y "O5'" 1 
ATOM   3093 C  "C5'" . DG  D 3 22  ? 40.028 52.745  15.101  1.00 38.85  ? 22  DG  Y "C5'" 1 
ATOM   3094 C  "C4'" . DG  D 3 22  ? 39.773 51.937  13.848  1.00 39.24  ? 22  DG  Y "C4'" 1 
ATOM   3095 O  "O4'" . DG  D 3 22  ? 41.000 51.320  13.406  1.00 39.94  ? 22  DG  Y "O4'" 1 
ATOM   3096 C  "C3'" . DG  D 3 22  ? 38.772 50.798  14.040  1.00 39.20  ? 22  DG  Y "C3'" 1 
ATOM   3097 O  "O3'" . DG  D 3 22  ? 37.951 50.630  12.889  1.00 39.76  ? 22  DG  Y "O3'" 1 
ATOM   3098 C  "C2'" . DG  D 3 22  ? 39.637 49.556  14.223  1.00 39.50  ? 22  DG  Y "C2'" 1 
ATOM   3099 C  "C1'" . DG  D 3 22  ? 40.890 49.887  13.430  1.00 40.20  ? 22  DG  Y "C1'" 1 
ATOM   3100 N  N9    . DG  D 3 22  ? 42.137 49.356  13.977  1.00 40.79  ? 22  DG  Y N9    1 
ATOM   3101 C  C8    . DG  D 3 22  ? 42.467 49.194  15.302  1.00 40.72  ? 22  DG  Y C8    1 
ATOM   3102 N  N7    . DG  D 3 22  ? 43.691 48.779  15.478  1.00 41.47  ? 22  DG  Y N7    1 
ATOM   3103 C  C5    . DG  D 3 22  ? 44.190 48.625  14.194  1.00 42.24  ? 22  DG  Y C5    1 
ATOM   3104 C  C6    . DG  D 3 22  ? 45.466 48.194  13.752  1.00 43.47  ? 22  DG  Y C6    1 
ATOM   3105 O  O6    . DG  D 3 22  ? 46.431 47.826  14.431  1.00 44.09  ? 22  DG  Y O6    1 
ATOM   3106 N  N1    . DG  D 3 22  ? 45.556 48.201  12.363  1.00 44.22  ? 22  DG  Y N1    1 
ATOM   3107 C  C2    . DG  D 3 22  ? 44.550 48.588  11.506  1.00 43.77  ? 22  DG  Y C2    1 
ATOM   3108 N  N2    . DG  D 3 22  ? 44.825 48.515  10.196  1.00 44.83  ? 22  DG  Y N2    1 
ATOM   3109 N  N3    . DG  D 3 22  ? 43.356 48.993  11.906  1.00 42.59  ? 22  DG  Y N3    1 
ATOM   3110 C  C4    . DG  D 3 22  ? 43.249 48.995  13.255  1.00 41.90  ? 22  DG  Y C4    1 
ATOM   3111 P  P     . DA  D 3 23  ? 36.491 50.001  13.053  1.00 40.07  ? 23  DA  Y P     1 
ATOM   3112 O  OP1   . DA  D 3 23  ? 36.576 48.783  13.929  1.00 39.78  ? 23  DA  Y OP1   1 
ATOM   3113 O  OP2   . DA  D 3 23  ? 35.978 49.793  11.668  1.00 40.93  ? 23  DA  Y OP2   1 
ATOM   3114 O  "O5'" . DA  D 3 23  ? 35.669 51.179  13.733  1.00 40.27  ? 23  DA  Y "O5'" 1 
ATOM   3115 C  "C5'" . DA  D 3 23  ? 35.695 52.501  13.179  1.00 41.35  ? 23  DA  Y "C5'" 1 
ATOM   3116 C  "C4'" . DA  D 3 23  ? 35.021 53.515  14.081  1.00 41.79  ? 23  DA  Y "C4'" 1 
ATOM   3117 O  "O4'" . DA  D 3 23  ? 33.703 53.019  14.443  1.00 42.54  ? 23  DA  Y "O4'" 1 
ATOM   3118 C  "C3'" . DA  D 3 23  ? 35.746 53.842  15.396  1.00 41.65  ? 23  DA  Y "C3'" 1 
ATOM   3119 O  "O3'" . DA  D 3 23  ? 35.700 55.230  15.680  1.00 42.03  ? 23  DA  Y "O3'" 1 
ATOM   3120 C  "C2'" . DA  D 3 23  ? 34.985 53.072  16.462  1.00 41.97  ? 23  DA  Y "C2'" 1 
ATOM   3121 C  "C1'" . DA  D 3 23  ? 33.596 52.807  15.855  1.00 42.37  ? 23  DA  Y "C1'" 1 
ATOM   3122 N  N9    . DA  D 3 23  ? 33.035 51.475  16.052  1.00 42.08  ? 23  DA  Y N9    1 
ATOM   3123 C  C8    . DA  D 3 23  ? 33.720 50.288  16.150  1.00 41.98  ? 23  DA  Y C8    1 
ATOM   3124 N  N7    . DA  D 3 23  ? 32.947 49.242  16.288  1.00 42.02  ? 23  DA  Y N7    1 
ATOM   3125 C  C5    . DA  D 3 23  ? 31.665 49.771  16.281  1.00 42.31  ? 23  DA  Y C5    1 
ATOM   3126 C  C6    . DA  D 3 23  ? 30.396 49.167  16.381  1.00 42.89  ? 23  DA  Y C6    1 
ATOM   3127 N  N6    . DA  D 3 23  ? 30.218 47.851  16.507  1.00 42.91  ? 23  DA  Y N6    1 
ATOM   3128 N  N1    . DA  D 3 23  ? 29.310 49.968  16.319  1.00 43.46  ? 23  DA  Y N1    1 
ATOM   3129 C  C2    . DA  D 3 23  ? 29.497 51.287  16.166  1.00 43.82  ? 23  DA  Y C2    1 
ATOM   3130 N  N3    . DA  D 3 23  ? 30.643 51.974  16.065  1.00 43.19  ? 23  DA  Y N3    1 
ATOM   3131 C  C4    . DA  D 3 23  ? 31.701 51.141  16.110  1.00 42.51  ? 23  DA  Y C4    1 
HETATM 3132 C  C1    . EDO E 4 .   ? 32.558 43.759  33.252  1.00 28.51  ? 301 EDO A C1    1 
HETATM 3133 O  O1    . EDO E 4 .   ? 32.000 45.045  32.871  1.00 25.89  ? 301 EDO A O1    1 
HETATM 3134 C  C2    . EDO E 4 .   ? 31.904 43.132  34.480  1.00 33.06  ? 301 EDO A C2    1 
HETATM 3135 O  O2    . EDO E 4 .   ? 30.486 43.047  34.295  1.00 33.54  ? 301 EDO A O2    1 
HETATM 3136 CA CA    . CA  F 5 .   ? 29.381 50.347  -10.324 0.50 45.67  ? 301 CA  B CA    1 
HETATM 3137 C  C1    . EDO G 4 .   ? 33.021 54.234  -1.231  1.00 26.98  ? 302 EDO B C1    1 
HETATM 3138 O  O1    . EDO G 4 .   ? 31.759 54.679  -0.724  1.00 27.70  ? 302 EDO B O1    1 
HETATM 3139 C  C2    . EDO G 4 .   ? 33.799 53.508  -0.135  1.00 26.33  ? 302 EDO B C2    1 
HETATM 3140 O  O2    . EDO G 4 .   ? 33.173 52.269  0.273   1.00 25.64  ? 302 EDO B O2    1 
HETATM 3141 CA CA    . CA  H 5 .   ? 40.510 48.860  19.337  1.00 26.69  ? 101 CA  Y CA    1 
HETATM 3142 C  C     . ACT I 6 .   ? 41.358 46.109  14.473  1.00 30.28  ? 102 ACT Y C     1 
HETATM 3143 O  O     . ACT I 6 .   ? 40.363 46.263  13.705  1.00 28.62  ? 102 ACT Y O     1 
HETATM 3144 O  OXT   . ACT I 6 .   ? 41.331 46.228  15.735  1.00 29.29  ? 102 ACT Y OXT   1 
HETATM 3145 C  CH3   . ACT I 6 .   ? 42.640 45.745  13.824  1.00 18.34  ? 102 ACT Y CH3   1 
HETATM 3146 O  O     . HOH J 7 .   ? 17.310 36.530  34.413  1.00 29.97  ? 401 HOH A O     1 
HETATM 3147 O  O     . HOH J 7 .   ? 26.847 47.046  43.338  1.00 40.51  ? 402 HOH A O     1 
HETATM 3148 O  O     . HOH J 7 .   ? 32.681 56.724  36.058  1.00 31.42  ? 403 HOH A O     1 
HETATM 3149 O  O     . HOH J 7 .   ? 6.178  41.427  29.368  1.00 37.87  ? 404 HOH A O     1 
HETATM 3150 O  O     . HOH J 7 .   ? 20.259 51.920  18.087  1.00 23.49  ? 405 HOH A O     1 
HETATM 3151 O  O     . HOH J 7 .   ? 7.502  52.854  24.979  1.00 40.62  ? 406 HOH A O     1 
HETATM 3152 O  O     . HOH J 7 .   ? 28.605 36.784  37.815  1.00 22.77  ? 407 HOH A O     1 
HETATM 3153 O  O     . HOH J 7 .   ? 11.917 57.586  37.331  1.00 31.01  ? 408 HOH A O     1 
HETATM 3154 O  O     . HOH J 7 .   ? 20.218 39.550  21.437  1.00 30.97  ? 409 HOH A O     1 
HETATM 3155 O  O     . HOH J 7 .   ? 26.875 65.071  35.506  1.00 40.72  ? 410 HOH A O     1 
HETATM 3156 O  O     . HOH J 7 .   ? 24.477 55.135  22.295  1.00 35.01  ? 411 HOH A O     1 
HETATM 3157 O  O     . HOH J 7 .   ? 8.049  59.273  26.035  1.00 29.16  ? 412 HOH A O     1 
HETATM 3158 O  O     . HOH J 7 .   ? 34.237 46.432  32.344  1.00 28.39  ? 413 HOH A O     1 
HETATM 3159 O  O     . HOH J 7 .   ? 21.992 34.353  22.209  1.00 34.90  ? 414 HOH A O     1 
HETATM 3160 O  O     . HOH J 7 .   ? 19.422 63.841  15.938  1.00 40.59  ? 415 HOH A O     1 
HETATM 3161 O  O     . HOH J 7 .   ? 6.472  54.838  30.983  1.00 35.70  ? 416 HOH A O     1 
HETATM 3162 O  O     . HOH J 7 .   ? 14.048 52.514  42.288  1.00 30.98  ? 417 HOH A O     1 
HETATM 3163 O  O     . HOH J 7 .   ? 30.659 40.722  36.852  1.00 35.02  ? 418 HOH A O     1 
HETATM 3164 O  O     . HOH J 7 .   ? 34.025 54.874  37.757  1.00 27.02  ? 419 HOH A O     1 
HETATM 3165 O  O     . HOH J 7 .   ? 24.075 37.109  43.464  1.00 29.38  ? 420 HOH A O     1 
HETATM 3166 O  O     . HOH J 7 .   ? 14.419 53.148  12.063  1.00 20.73  ? 421 HOH A O     1 
HETATM 3167 O  O     . HOH J 7 .   ? 13.091 61.742  20.370  1.00 21.75  ? 422 HOH A O     1 
HETATM 3168 O  O     . HOH J 7 .   ? 23.319 33.769  29.232  1.00 34.43  ? 423 HOH A O     1 
HETATM 3169 O  O     . HOH J 7 .   ? 29.590 38.379  31.199  1.00 27.07  ? 424 HOH A O     1 
HETATM 3170 O  O     . HOH J 7 .   ? 15.558 38.803  22.151  1.00 25.05  ? 425 HOH A O     1 
HETATM 3171 O  O     . HOH J 7 .   ? 34.245 51.094  26.738  1.00 27.59  ? 426 HOH A O     1 
HETATM 3172 O  O     . HOH J 7 .   ? 27.224 61.142  31.487  1.00 27.44  ? 427 HOH A O     1 
HETATM 3173 O  O     . HOH J 7 .   ? 19.425 64.424  31.632  1.00 24.57  ? 428 HOH A O     1 
HETATM 3174 O  O     . HOH J 7 .   ? 18.483 62.082  34.476  1.00 33.33  ? 429 HOH A O     1 
HETATM 3175 O  O     . HOH J 7 .   ? 33.247 49.074  47.825  1.00 27.65  ? 430 HOH A O     1 
HETATM 3176 O  O     . HOH J 7 .   ? 26.272 52.204  21.304  1.00 23.40  ? 431 HOH A O     1 
HETATM 3177 O  O     . HOH J 7 .   ? 13.549 61.207  15.494  1.00 35.30  ? 432 HOH A O     1 
HETATM 3178 O  O     . HOH J 7 .   ? 27.200 40.999  20.249  1.00 39.70  ? 433 HOH A O     1 
HETATM 3179 O  O     . HOH J 7 .   ? 11.664 40.325  24.540  1.00 24.61  ? 434 HOH A O     1 
HETATM 3180 O  O     . HOH J 7 .   ? 8.681  58.082  22.947  1.00 36.80  ? 435 HOH A O     1 
HETATM 3181 O  O     . HOH J 7 .   ? 32.602 47.537  25.246  1.00 26.58  ? 436 HOH A O     1 
HETATM 3182 O  O     . HOH J 7 .   ? 8.564  58.488  33.934  1.00 29.06  ? 437 HOH A O     1 
HETATM 3183 O  O     . HOH J 7 .   ? 31.126 53.431  43.508  1.00 30.07  ? 438 HOH A O     1 
HETATM 3184 O  O     . HOH J 7 .   ? 29.030 36.475  25.779  1.00 40.28  ? 439 HOH A O     1 
HETATM 3185 O  O     . HOH J 7 .   ? 20.279 33.419  39.670  1.00 23.56  ? 440 HOH A O     1 
HETATM 3186 O  O     . HOH J 7 .   ? 5.159  40.934  26.023  1.00 38.30  ? 441 HOH A O     1 
HETATM 3187 O  O     . HOH J 7 .   ? 30.856 46.044  27.067  1.00 18.31  ? 442 HOH A O     1 
HETATM 3188 O  O     . HOH J 7 .   ? 28.040 44.955  42.845  1.00 36.71  ? 443 HOH A O     1 
HETATM 3189 O  O     . HOH J 7 .   ? 6.999  46.511  29.500  1.00 26.97  ? 444 HOH A O     1 
HETATM 3190 O  O     . HOH J 7 .   ? 15.317 61.084  10.919  1.00 37.82  ? 445 HOH A O     1 
HETATM 3191 O  O     . HOH J 7 .   ? 35.968 49.449  29.159  1.00 27.37  ? 446 HOH A O     1 
HETATM 3192 O  O     . HOH J 7 .   ? 21.870 27.641  40.246  1.00 26.70  ? 447 HOH A O     1 
HETATM 3193 O  O     . HOH J 7 .   ? 28.002 50.877  19.409  1.00 32.97  ? 448 HOH A O     1 
HETATM 3194 O  O     . HOH J 7 .   ? 27.629 38.076  47.703  1.00 32.41  ? 449 HOH A O     1 
HETATM 3195 O  O     . HOH J 7 .   ? 40.365 48.490  23.642  1.00 27.78  ? 450 HOH A O     1 
HETATM 3196 O  O     . HOH J 7 .   ? 33.264 57.739  33.396  1.00 27.46  ? 451 HOH A O     1 
HETATM 3197 O  O     . HOH J 7 .   ? 35.567 47.826  35.833  1.00 28.24  ? 452 HOH A O     1 
HETATM 3198 O  O     A HOH J 7 .   ? 20.821 34.715  33.098  0.50 14.97  ? 453 HOH A O     1 
HETATM 3199 O  O     B HOH J 7 .   ? 22.792 34.537  32.258  0.50 17.14  ? 453 HOH A O     1 
HETATM 3200 O  O     . HOH J 7 .   ? 22.328 42.144  16.823  1.00 39.35  ? 454 HOH A O     1 
HETATM 3201 O  O     . HOH J 7 .   ? 8.122  38.637  23.082  1.00 41.08  ? 455 HOH A O     1 
HETATM 3202 O  O     . HOH J 7 .   ? 16.699 41.189  45.406  1.00 30.28  ? 456 HOH A O     1 
HETATM 3203 O  O     . HOH J 7 .   ? 35.104 56.747  30.950  1.00 24.55  ? 457 HOH A O     1 
HETATM 3204 O  O     . HOH J 7 .   ? 16.184 47.872  47.094  1.00 35.18  ? 458 HOH A O     1 
HETATM 3205 O  O     . HOH J 7 .   ? 33.107 49.575  23.473  1.00 31.22  ? 459 HOH A O     1 
HETATM 3206 O  O     . HOH J 7 .   ? 31.165 62.232  24.697  1.00 35.43  ? 460 HOH A O     1 
HETATM 3207 O  O     . HOH J 7 .   ? 29.458 42.019  44.878  1.00 45.45  ? 461 HOH A O     1 
HETATM 3208 O  O     . HOH J 7 .   ? 4.676  44.936  26.709  1.00 52.61  ? 462 HOH A O     1 
HETATM 3209 O  O     . HOH J 7 .   ? 37.573 43.677  26.347  1.00 37.02  ? 463 HOH A O     1 
HETATM 3210 O  O     . HOH J 7 .   ? 17.062 39.259  42.369  1.00 25.17  ? 464 HOH A O     1 
HETATM 3211 O  O     . HOH J 7 .   ? 30.924 37.673  29.032  1.00 41.04  ? 465 HOH A O     1 
HETATM 3212 O  O     . HOH J 7 .   ? 26.946 54.639  22.258  1.00 21.72  ? 466 HOH A O     1 
HETATM 3213 O  O     . HOH J 7 .   ? 8.466  54.780  16.445  1.00 25.43  ? 467 HOH A O     1 
HETATM 3214 O  O     . HOH J 7 .   ? 26.292 43.811  19.136  1.00 30.92  ? 468 HOH A O     1 
HETATM 3215 O  O     . HOH J 7 .   ? 33.451 32.283  44.074  1.00 35.11  ? 469 HOH A O     1 
HETATM 3216 O  O     . HOH J 7 .   ? 36.303 47.253  38.657  1.00 35.96  ? 470 HOH A O     1 
HETATM 3217 O  O     . HOH J 7 .   ? 28.864 39.257  38.840  1.00 22.28  ? 471 HOH A O     1 
HETATM 3218 O  O     . HOH J 7 .   ? 28.809 62.930  38.987  1.00 41.33  ? 472 HOH A O     1 
HETATM 3219 O  O     . HOH J 7 .   ? 7.900  54.685  35.531  1.00 28.52  ? 473 HOH A O     1 
HETATM 3220 O  O     . HOH J 7 .   ? 20.194 54.551  17.101  1.00 26.45  ? 474 HOH A O     1 
HETATM 3221 O  O     . HOH J 7 .   ? 31.421 42.300  21.149  1.00 29.08  ? 475 HOH A O     1 
HETATM 3222 O  O     . HOH J 7 .   ? 24.829 26.880  46.368  1.00 35.16  ? 476 HOH A O     1 
HETATM 3223 O  O     . HOH J 7 .   ? 31.531 62.409  34.127  1.00 43.51  ? 477 HOH A O     1 
HETATM 3224 O  O     . HOH J 7 .   ? 26.117 60.991  23.987  1.00 37.45  ? 478 HOH A O     1 
HETATM 3225 O  O     . HOH J 7 .   ? 19.249 49.085  17.568  1.00 8.83   ? 479 HOH A O     1 
HETATM 3226 O  O     . HOH J 7 .   ? 30.912 33.404  40.178  1.00 29.76  ? 480 HOH A O     1 
HETATM 3227 O  O     . HOH J 7 .   ? 30.696 36.598  35.426  1.00 39.15  ? 481 HOH A O     1 
HETATM 3228 O  O     . HOH J 7 .   ? 9.320  56.590  37.444  1.00 32.57  ? 482 HOH A O     1 
HETATM 3229 O  O     . HOH J 7 .   ? 7.155  56.260  33.530  1.00 34.60  ? 483 HOH A O     1 
HETATM 3230 O  O     . HOH J 7 .   ? 15.545 70.695  14.726  1.00 52.62  ? 484 HOH A O     1 
HETATM 3231 O  O     . HOH J 7 .   ? 9.208  50.224  21.770  1.00 46.53  ? 485 HOH A O     1 
HETATM 3232 O  O     . HOH J 7 .   ? 22.906 36.003  20.322  1.00 45.21  ? 486 HOH A O     1 
HETATM 3233 O  O     . HOH J 7 .   ? 30.633 60.730  35.645  1.00 50.73  ? 487 HOH A O     1 
HETATM 3234 O  O     . HOH J 7 .   ? 26.740 65.988  32.708  1.00 26.79  ? 488 HOH A O     1 
HETATM 3235 O  O     . HOH J 7 .   ? 32.928 41.495  38.143  1.00 34.50  ? 489 HOH A O     1 
HETATM 3236 O  O     . HOH J 7 .   ? 35.810 43.450  35.216  1.00 36.93  ? 490 HOH A O     1 
HETATM 3237 O  O     . HOH J 7 .   ? 12.333 51.748  44.312  1.00 42.84  ? 491 HOH A O     1 
HETATM 3238 O  O     . HOH J 7 .   ? 33.429 54.974  42.514  1.00 47.18  ? 492 HOH A O     1 
HETATM 3239 O  O     . HOH J 7 .   ? 32.756 32.693  38.083  1.00 38.23  ? 493 HOH A O     1 
HETATM 3240 O  O     . HOH K 7 .   ? 12.113 58.743  -1.903  1.00 35.66  ? 401 HOH B O     1 
HETATM 3241 O  O     . HOH K 7 .   ? 33.533 49.946  10.369  1.00 27.36  ? 402 HOH B O     1 
HETATM 3242 O  O     . HOH K 7 .   ? 33.897 53.864  -18.444 1.00 33.43  ? 403 HOH B O     1 
HETATM 3243 O  O     . HOH K 7 .   ? 20.635 57.707  10.948  1.00 31.83  ? 404 HOH B O     1 
HETATM 3244 O  O     . HOH K 7 .   ? 16.237 36.593  0.900   1.00 29.66  ? 405 HOH B O     1 
HETATM 3245 O  O     . HOH K 7 .   ? 8.131  52.477  -4.213  1.00 45.69  ? 406 HOH B O     1 
HETATM 3246 O  O     . HOH K 7 .   ? 13.834 39.516  -5.606  1.00 27.51  ? 407 HOH B O     1 
HETATM 3247 O  O     . HOH K 7 .   ? 28.626 63.270  4.856   1.00 40.15  ? 408 HOH B O     1 
HETATM 3248 O  O     . HOH K 7 .   ? 7.401  50.609  7.000   1.00 36.57  ? 409 HOH B O     1 
HETATM 3249 O  O     . HOH K 7 .   ? 13.280 54.223  -8.270  1.00 35.74  ? 410 HOH B O     1 
HETATM 3250 O  O     . HOH K 7 .   ? 40.181 42.222  7.914   1.00 36.72  ? 411 HOH B O     1 
HETATM 3251 O  O     . HOH K 7 .   ? 7.208  54.737  1.956   1.00 40.84  ? 412 HOH B O     1 
HETATM 3252 O  O     . HOH K 7 .   ? 9.226  37.814  5.055   1.00 31.52  ? 413 HOH B O     1 
HETATM 3253 O  O     . HOH K 7 .   ? 30.259 60.564  -4.805  1.00 20.92  ? 414 HOH B O     1 
HETATM 3254 O  O     . HOH K 7 .   ? 24.147 63.454  3.391   1.00 38.14  ? 415 HOH B O     1 
HETATM 3255 O  O     . HOH K 7 .   ? 26.732 45.174  11.474  1.00 27.26  ? 416 HOH B O     1 
HETATM 3256 O  O     . HOH K 7 .   ? 18.328 63.930  2.959   1.00 40.54  ? 417 HOH B O     1 
HETATM 3257 O  O     . HOH K 7 .   ? 28.818 36.300  1.599   1.00 32.14  ? 418 HOH B O     1 
HETATM 3258 O  O     . HOH K 7 .   ? 16.096 58.365  9.856   1.00 27.08  ? 419 HOH B O     1 
HETATM 3259 O  O     . HOH K 7 .   ? 26.294 59.996  -10.824 1.00 31.51  ? 420 HOH B O     1 
HETATM 3260 O  O     . HOH K 7 .   ? 25.234 30.888  0.875   1.00 35.26  ? 421 HOH B O     1 
HETATM 3261 O  O     . HOH K 7 .   ? 34.571 40.396  -2.557  1.00 34.91  ? 422 HOH B O     1 
HETATM 3262 O  O     . HOH K 7 .   ? 25.062 42.074  10.429  1.00 30.07  ? 423 HOH B O     1 
HETATM 3263 O  O     . HOH K 7 .   ? 23.734 55.760  -13.863 1.00 27.87  ? 424 HOH B O     1 
HETATM 3264 O  O     . HOH K 7 .   ? 30.698 58.937  1.756   1.00 25.92  ? 425 HOH B O     1 
HETATM 3265 O  O     . HOH K 7 .   ? 21.038 32.798  0.586   1.00 26.20  ? 426 HOH B O     1 
HETATM 3266 O  O     . HOH K 7 .   ? 10.397 38.503  -2.572  1.00 31.62  ? 427 HOH B O     1 
HETATM 3267 O  O     . HOH K 7 .   ? 35.906 48.175  -14.359 1.00 29.50  ? 428 HOH B O     1 
HETATM 3268 O  O     . HOH K 7 .   ? 13.574 35.333  11.255  1.00 23.57  ? 429 HOH B O     1 
HETATM 3269 O  O     . HOH K 7 .   ? 13.744 35.868  16.040  1.00 42.11  ? 430 HOH B O     1 
HETATM 3270 O  O     . HOH K 7 .   ? 44.897 45.200  9.096   1.00 36.91  ? 431 HOH B O     1 
HETATM 3271 O  O     . HOH K 7 .   ? 35.982 42.471  -4.066  1.00 31.48  ? 432 HOH B O     1 
HETATM 3272 O  O     . HOH K 7 .   ? 30.225 52.397  -9.949  1.00 34.11  ? 433 HOH B O     1 
HETATM 3273 O  O     . HOH K 7 .   ? 20.305 45.313  14.171  1.00 22.02  ? 434 HOH B O     1 
HETATM 3274 O  O     . HOH K 7 .   ? 37.070 48.343  4.383   1.00 22.45  ? 435 HOH B O     1 
HETATM 3275 O  O     . HOH K 7 .   ? 35.410 50.861  0.911   1.00 27.08  ? 436 HOH B O     1 
HETATM 3276 O  O     . HOH K 7 .   ? 16.410 44.435  -10.301 1.00 26.87  ? 437 HOH B O     1 
HETATM 3277 O  O     . HOH K 7 .   ? 32.279 56.956  0.698   1.00 27.98  ? 438 HOH B O     1 
HETATM 3278 O  O     . HOH K 7 .   ? 39.055 44.597  0.292   1.00 42.06  ? 439 HOH B O     1 
HETATM 3279 O  O     . HOH K 7 .   ? 9.329  38.873  8.534   1.00 34.32  ? 440 HOH B O     1 
HETATM 3280 O  O     . HOH K 7 .   ? 14.033 43.957  19.884  1.00 19.26  ? 441 HOH B O     1 
HETATM 3281 O  O     . HOH K 7 .   ? 35.206 47.107  6.598   1.00 29.09  ? 442 HOH B O     1 
HETATM 3282 O  O     . HOH K 7 .   ? 31.811 51.427  6.187   1.00 20.25  ? 443 HOH B O     1 
HETATM 3283 O  O     . HOH K 7 .   ? 33.253 39.899  15.784  1.00 45.68  ? 444 HOH B O     1 
HETATM 3284 O  O     . HOH K 7 .   ? 8.641  45.354  3.576   1.00 34.79  ? 445 HOH B O     1 
HETATM 3285 O  O     . HOH K 7 .   ? 21.944 63.782  -7.479  1.00 33.95  ? 446 HOH B O     1 
HETATM 3286 O  O     . HOH K 7 .   ? 33.026 52.957  -10.907 1.00 38.97  ? 447 HOH B O     1 
HETATM 3287 O  O     . HOH K 7 .   ? 33.815 49.685  7.716   1.00 23.82  ? 448 HOH B O     1 
HETATM 3288 O  O     . HOH K 7 .   ? 32.267 35.162  8.244   1.00 26.86  ? 449 HOH B O     1 
HETATM 3289 O  O     . HOH K 7 .   ? 19.036 48.805  -14.923 1.00 35.34  ? 450 HOH B O     1 
HETATM 3290 O  O     . HOH K 7 .   ? 31.391 52.263  12.790  1.00 35.76  ? 451 HOH B O     1 
HETATM 3291 O  O     . HOH K 7 .   ? 33.219 58.068  5.343   1.00 43.29  ? 452 HOH B O     1 
HETATM 3292 O  O     . HOH K 7 .   ? 29.792 59.112  -14.909 1.00 40.79  ? 453 HOH B O     1 
HETATM 3293 O  O     . HOH K 7 .   ? 12.297 56.867  7.120   1.00 21.40  ? 454 HOH B O     1 
HETATM 3294 O  O     . HOH K 7 .   ? 8.950  47.129  15.300  1.00 30.62  ? 455 HOH B O     1 
HETATM 3295 O  O     . HOH K 7 .   ? 32.023 43.906  13.134  1.00 39.54  ? 456 HOH B O     1 
HETATM 3296 O  O     . HOH K 7 .   ? 27.547 42.715  10.597  1.00 23.01  ? 457 HOH B O     1 
HETATM 3297 O  O     . HOH K 7 .   ? 36.553 40.786  2.927   1.00 29.07  ? 458 HOH B O     1 
HETATM 3298 O  O     . HOH K 7 .   ? 22.355 55.125  15.571  1.00 45.48  ? 459 HOH B O     1 
HETATM 3299 O  O     . HOH K 7 .   ? 26.472 53.562  13.781  1.00 29.22  ? 460 HOH B O     1 
HETATM 3300 O  O     . HOH K 7 .   ? 27.394 70.000  -14.052 1.00 34.94  ? 461 HOH B O     1 
HETATM 3301 O  O     . HOH K 7 .   ? 38.303 54.074  7.038   1.00 33.02  ? 462 HOH B O     1 
HETATM 3302 O  O     . HOH K 7 .   ? 20.145 42.725  15.377  1.00 27.78  ? 463 HOH B O     1 
HETATM 3303 O  O     . HOH K 7 .   ? 7.908  42.053  0.012   1.00 38.24  ? 464 HOH B O     1 
HETATM 3304 O  O     . HOH K 7 .   ? 9.111  45.528  12.778  1.00 26.26  ? 465 HOH B O     1 
HETATM 3305 O  O     . HOH K 7 .   ? 18.998 57.759  -10.228 1.00 23.31  ? 466 HOH B O     1 
HETATM 3306 O  O     . HOH K 7 .   ? 23.655 37.889  8.106   1.00 32.48  ? 467 HOH B O     1 
HETATM 3307 O  O     . HOH K 7 .   ? 37.130 48.599  -8.003  1.00 41.27  ? 468 HOH B O     1 
HETATM 3308 O  O     . HOH K 7 .   ? 35.173 39.491  0.381   1.00 43.83  ? 469 HOH B O     1 
HETATM 3309 O  O     . HOH K 7 .   ? 24.177 62.231  -10.016 1.00 46.48  ? 470 HOH B O     1 
HETATM 3310 O  O     . HOH K 7 .   ? 30.613 57.965  -5.810  1.00 21.02  ? 471 HOH B O     1 
HETATM 3311 O  O     . HOH K 7 .   ? 32.083 55.271  11.810  1.00 22.60  ? 472 HOH B O     1 
HETATM 3312 O  O     . HOH K 7 .   ? 20.285 35.302  -2.469  1.00 40.14  ? 473 HOH B O     1 
HETATM 3313 O  O     . HOH K 7 .   ? 19.255 55.928  -13.337 1.00 26.78  ? 474 HOH B O     1 
HETATM 3314 O  O     . HOH K 7 .   ? 9.781  42.326  -4.203  1.00 24.93  ? 475 HOH B O     1 
HETATM 3315 O  O     . HOH K 7 .   ? 8.424  42.137  14.853  1.00 25.12  ? 476 HOH B O     1 
HETATM 3316 O  O     . HOH K 7 .   ? 35.618 53.866  -4.317  1.00 32.11  ? 477 HOH B O     1 
HETATM 3317 O  O     . HOH K 7 .   ? 38.802 43.378  -3.026  1.00 43.97  ? 478 HOH B O     1 
HETATM 3318 O  O     . HOH K 7 .   ? 11.705 28.851  15.883  1.00 46.01  ? 479 HOH B O     1 
HETATM 3319 O  O     . HOH K 7 .   ? 19.415 48.130  14.597  1.00 11.69  ? 480 HOH B O     1 
HETATM 3320 O  O     . HOH K 7 .   ? 22.404 66.680  -9.829  1.00 40.70  ? 481 HOH B O     1 
HETATM 3321 O  O     . HOH K 7 .   ? 31.492 61.678  -7.019  1.00 33.38  ? 482 HOH B O     1 
HETATM 3322 O  O     . HOH K 7 .   ? 31.855 60.687  -2.476  1.00 35.26  ? 483 HOH B O     1 
HETATM 3323 O  O     . HOH K 7 .   ? 11.285 40.370  -5.876  1.00 37.27  ? 484 HOH B O     1 
HETATM 3324 O  O     . HOH K 7 .   ? 41.708 41.462  3.354   1.00 51.99  ? 485 HOH B O     1 
HETATM 3325 O  O     . HOH K 7 .   ? 32.702 63.827  -6.962  1.00 29.59  ? 486 HOH B O     1 
HETATM 3326 O  O     . HOH K 7 .   ? 28.147 31.172  0.139   1.00 33.05  ? 487 HOH B O     1 
HETATM 3327 O  O     . HOH K 7 .   ? 8.516  40.895  -2.397  1.00 35.68  ? 488 HOH B O     1 
HETATM 3328 O  O     . HOH K 7 .   ? 37.511 51.495  -0.573  1.00 37.87  ? 489 HOH B O     1 
HETATM 3329 O  O     . HOH K 7 .   ? 34.440 55.946  -4.924  1.00 37.06  ? 490 HOH B O     1 
HETATM 3330 O  O     . HOH K 7 .   ? 32.853 58.266  -1.828  1.00 31.35  ? 491 HOH B O     1 
HETATM 3331 O  O     . HOH K 7 .   ? 32.160 62.384  3.659   1.00 48.06  ? 492 HOH B O     1 
HETATM 3332 O  O     . HOH K 7 .   ? 14.882 45.358  -12.610 1.00 37.38  ? 493 HOH B O     1 
HETATM 3333 O  O     . HOH K 7 .   ? 28.198 64.595  2.214   1.00 42.45  ? 494 HOH B O     1 
HETATM 3334 O  O     . HOH K 7 .   ? 33.253 64.085  -0.267  1.00 32.43  ? 495 HOH B O     1 
HETATM 3335 O  O     . HOH K 7 .   ? 23.198 70.829  -10.430 1.00 39.21  ? 496 HOH B O     1 
HETATM 3336 O  O     . HOH L 7 .   ? 44.199 86.234  20.385  1.00 41.93  ? 101 HOH X O     1 
HETATM 3337 O  O     . HOH L 7 .   ? 53.920 121.830 30.303  1.00 50.10  ? 102 HOH X O     1 
HETATM 3338 O  O     . HOH L 7 .   ? 40.334 90.605  11.359  1.00 37.72  ? 103 HOH X O     1 
HETATM 3339 O  O     . HOH L 7 .   ? 35.048 99.819  9.097   1.00 44.39  ? 104 HOH X O     1 
HETATM 3340 O  O     . HOH L 7 .   ? 34.544 98.698  12.470  1.00 42.23  ? 105 HOH X O     1 
HETATM 3341 O  O     . HOH L 7 .   ? 39.395 56.144  15.051  1.00 35.94  ? 106 HOH X O     1 
HETATM 3342 O  O     . HOH L 7 .   ? 39.213 99.324  15.488  1.00 31.37  ? 107 HOH X O     1 
HETATM 3343 O  O     . HOH L 7 .   ? 36.560 105.651 12.051  1.00 33.18  ? 108 HOH X O     1 
HETATM 3344 O  O     . HOH L 7 .   ? 43.991 105.232 19.891  1.00 34.19  ? 109 HOH X O     1 
HETATM 3345 O  O     . HOH L 7 .   ? 39.822 102.162 18.933  1.00 44.06  ? 110 HOH X O     1 
HETATM 3346 O  O     . HOH L 7 .   ? 37.288 110.374 21.640  1.00 31.90  ? 111 HOH X O     1 
HETATM 3347 O  O     . HOH L 7 .   ? 41.160 113.145 21.390  1.00 27.30  ? 112 HOH X O     1 
HETATM 3348 O  O     . HOH L 7 .   ? 47.788 58.066  19.291  1.00 44.49  ? 113 HOH X O     1 
HETATM 3349 O  O     . HOH L 7 .   ? 44.678 53.804  24.939  1.00 47.26  ? 114 HOH X O     1 
HETATM 3350 O  O     . HOH L 7 .   ? 41.847 58.628  12.284  1.00 42.23  ? 115 HOH X O     1 
HETATM 3351 O  O     . HOH L 7 .   ? 39.493 106.357 12.108  1.00 37.46  ? 116 HOH X O     1 
HETATM 3352 O  O     . HOH L 7 .   ? 44.216 54.983  10.903  1.00 38.71  ? 117 HOH X O     1 
HETATM 3353 O  O     . HOH L 7 .   ? 42.026 105.147 10.511  1.00 34.08  ? 118 HOH X O     1 
HETATM 3354 O  O     . HOH L 7 .   ? 49.463 84.582  21.931  1.00 53.67  ? 119 HOH X O     1 
HETATM 3355 O  O     . HOH L 7 .   ? 38.386 112.323 19.833  1.00 24.89  ? 120 HOH X O     1 
HETATM 3356 O  O     . HOH L 7 .   ? 55.241 109.359 30.820  1.00 34.32  ? 121 HOH X O     1 
HETATM 3357 O  O     . HOH L 7 .   ? 41.372 88.916  9.147   1.00 44.61  ? 122 HOH X O     1 
HETATM 3358 O  O     . HOH L 7 .   ? 56.033 85.806  13.596  1.00 46.04  ? 123 HOH X O     1 
HETATM 3359 O  O     . HOH L 7 .   ? 48.047 113.288 27.663  1.00 51.86  ? 124 HOH X O     1 
HETATM 3360 O  O     . HOH L 7 .   ? 35.491 108.975 20.310  1.00 40.22  ? 125 HOH X O     1 
HETATM 3361 O  O     . HOH M 7 .   ? 39.955 47.907  17.160  1.00 25.76  ? 201 HOH Y O     1 
HETATM 3362 O  O     . HOH M 7 .   ? 36.484 49.552  18.011  1.00 36.31  ? 202 HOH Y O     1 
HETATM 3363 O  O     . HOH M 7 .   ? 41.539 49.265  9.865   1.00 33.33  ? 203 HOH Y O     1 
HETATM 3364 O  O     . HOH M 7 .   ? 39.602 96.173  13.676  1.00 35.23  ? 204 HOH Y O     1 
HETATM 3365 O  O     . HOH M 7 .   ? 39.795 66.780  20.065  1.00 43.63  ? 205 HOH Y O     1 
HETATM 3366 O  O     . HOH M 7 .   ? 47.333 57.609  22.669  1.00 45.18  ? 206 HOH Y O     1 
HETATM 3367 O  O     . HOH M 7 .   ? 37.922 59.572  17.429  1.00 45.72  ? 207 HOH Y O     1 
HETATM 3368 O  O     . HOH M 7 .   ? 37.997 62.989  18.866  1.00 49.96  ? 208 HOH Y O     1 
HETATM 3369 O  O     . HOH M 7 .   ? 40.922 60.200  25.023  1.00 50.01  ? 209 HOH Y O     1 
HETATM 3370 O  O     . HOH M 7 .   ? 26.461 49.438  16.646  1.00 41.16  ? 210 HOH Y O     1 
HETATM 3371 O  O     . HOH M 7 .   ? 42.577 110.812 -15.036 1.00 51.18  ? 211 HOH Y O     1 
HETATM 3372 O  O     . HOH M 7 .   ? 33.204 88.376  9.099   1.00 40.24  ? 212 HOH Y O     1 
HETATM 3373 O  O     . HOH M 7 .   ? 48.856 82.333  11.378  1.00 45.59  ? 213 HOH Y O     1 
HETATM 3374 O  O     . HOH M 7 .   ? 55.674 74.124  17.846  1.00 47.52  ? 214 HOH Y O     1 
HETATM 3375 O  O     . HOH M 7 .   ? 41.398 69.851  22.383  1.00 43.29  ? 215 HOH Y O     1 
HETATM 3376 O  O     . HOH M 7 .   ? 54.741 76.472  17.932  1.00 46.48  ? 216 HOH Y O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . GLY A 1   ? 0.7150 0.2393 0.2252 0.0209  -0.0575 0.0840  129 GLY A N     
2    C CA    . GLY A 1   ? 0.7034 0.2552 0.2388 0.0322  -0.0636 0.0773  129 GLY A CA    
3    C C     . GLY A 1   ? 0.6777 0.2518 0.2431 0.0314  -0.0575 0.0695  129 GLY A C     
4    O O     . GLY A 1   ? 0.6357 0.2012 0.2012 0.0245  -0.0506 0.0690  129 GLY A O     
5    N N     A SER A 2   ? 0.6474 0.2496 0.2371 0.0372  -0.0604 0.0637  130 SER A N     
6    N N     B SER A 2   ? 0.6391 0.2411 0.2286 0.0372  -0.0604 0.0638  130 SER A N     
7    C CA    A SER A 2   ? 0.6244 0.2485 0.2403 0.0352  -0.0541 0.0569  130 SER A CA    
8    C CA    B SER A 2   ? 0.6074 0.2316 0.2230 0.0351  -0.0541 0.0569  130 SER A CA    
9    C C     A SER A 2   ? 0.6003 0.2159 0.2227 0.0406  -0.0519 0.0557  130 SER A C     
10   C C     B SER A 2   ? 0.5929 0.2090 0.2157 0.0407  -0.0520 0.0556  130 SER A C     
11   O O     A SER A 2   ? 0.5815 0.2026 0.2131 0.0337  -0.0442 0.0518  130 SER A O     
12   O O     B SER A 2   ? 0.5742 0.1954 0.2058 0.0338  -0.0443 0.0518  130 SER A O     
13   C CB    A SER A 2   ? 0.6158 0.2685 0.2562 0.0413  -0.0590 0.0523  130 SER A CB    
14   C CB    B SER A 2   ? 0.5935 0.2456 0.2314 0.0405  -0.0594 0.0525  130 SER A CB    
15   O OG    A SER A 2   ? 0.6657 0.3195 0.3108 0.0549  -0.0696 0.0549  130 SER A OG    
16   O OG    B SER A 2   ? 0.6058 0.2585 0.2307 0.0366  -0.0635 0.0536  130 SER A OG    
17   N N     . LYS A 3   ? 0.6149 0.2170 0.2317 0.0539  -0.0591 0.0588  131 LYS A N     
18   C CA    . LYS A 3   ? 0.6032 0.1946 0.2231 0.0621  -0.0571 0.0569  131 LYS A CA    
19   C C     . LYS A 3   ? 0.6089 0.1733 0.2097 0.0508  -0.0515 0.0578  131 LYS A C     
20   O O     . LYS A 3   ? 0.5969 0.1586 0.2030 0.0508  -0.0473 0.0537  131 LYS A O     
21   C CB    . LYS A 3   ? 0.6077 0.1876 0.2229 0.0805  -0.0657 0.0603  131 LYS A CB    
22   C CG    . LYS A 3   ? 0.6036 0.2168 0.2464 0.0922  -0.0707 0.0587  131 LYS A CG    
23   C CD    . LYS A 3   ? 0.6250 0.2314 0.2671 0.1121  -0.0787 0.0623  131 LYS A CD    
24   C CE    . LYS A 3   ? 0.6188 0.2620 0.2912 0.1220  -0.0843 0.0621  131 LYS A CE    
25   N NZ    . LYS A 3   ? 0.6445 0.2851 0.3196 0.1432  -0.0918 0.0660  131 LYS A NZ    
26   N N     . VAL A 4   ? 0.6319 0.1772 0.2103 0.0406  -0.0518 0.0636  132 VAL A N     
27   C CA    . VAL A 4   ? 0.6569 0.1758 0.2166 0.0273  -0.0475 0.0663  132 VAL A CA    
28   C C     . VAL A 4   ? 0.6395 0.1789 0.2115 0.0106  -0.0384 0.0635  132 VAL A C     
29   O O     . VAL A 4   ? 0.6575 0.1897 0.2298 0.0009  -0.0343 0.0619  132 VAL A O     
30   C CB    . VAL A 4   ? 0.6770 0.1663 0.2063 0.0233  -0.0514 0.0756  132 VAL A CB    
31   C CG1   . VAL A 4   ? 0.6941 0.1626 0.2061 0.0041  -0.0457 0.0804  132 VAL A CG1   
32   C CG2   . VAL A 4   ? 0.7150 0.1779 0.2293 0.0401  -0.0608 0.0787  132 VAL A CG2   
33   N N     . GLU A 5   ? 0.6260 0.1889 0.2065 0.0074  -0.0361 0.0630  133 GLU A N     
34   C CA    . GLU A 5   ? 0.6161 0.1975 0.2055 -0.0072 -0.0270 0.0614  133 GLU A CA    
35   C C     . GLU A 5   ? 0.5829 0.1940 0.1997 -0.0065 -0.0231 0.0535  133 GLU A C     
36   O O     . GLU A 5   ? 0.5652 0.1873 0.1902 -0.0175 -0.0162 0.0518  133 GLU A O     
37   C CB    . GLU A 5   ? 0.6552 0.2428 0.2341 -0.0111 -0.0253 0.0651  133 GLU A CB    
38   C CG    . GLU A 5   ? 0.7280 0.2861 0.2765 -0.0136 -0.0281 0.0743  133 GLU A CG    
39   C CD    . GLU A 5   ? 0.8187 0.3827 0.3544 -0.0148 -0.0270 0.0772  133 GLU A CD    
40   O OE1   . GLU A 5   ? 0.8465 0.4258 0.3856 -0.0251 -0.0172 0.0767  133 GLU A OE1   
41   O OE2   . GLU A 5   ? 0.8430 0.3975 0.3658 -0.0046 -0.0360 0.0796  133 GLU A OE2   
42   N N     . ASP A 6   ? 0.5504 0.1758 0.1822 0.0057  -0.0274 0.0492  134 ASP A N     
43   C CA    . ASP A 6   ? 0.5351 0.1882 0.1911 0.0055  -0.0236 0.0426  134 ASP A CA    
44   C C     . ASP A 6   ? 0.5198 0.1750 0.1883 0.0078  -0.0217 0.0382  134 ASP A C     
45   O O     . ASP A 6   ? 0.5250 0.1667 0.1892 0.0170  -0.0253 0.0385  134 ASP A O     
46   C CB    . ASP A 6   ? 0.5453 0.2147 0.2128 0.0154  -0.0292 0.0406  134 ASP A CB    
47   C CG    . ASP A 6   ? 0.5942 0.2657 0.2510 0.0129  -0.0315 0.0427  134 ASP A CG    
48   O OD1   . ASP A 6   ? 0.6196 0.2853 0.2629 0.0034  -0.0261 0.0450  134 ASP A OD1   
49   O OD2   . ASP A 6   ? 0.5799 0.2607 0.2433 0.0205  -0.0388 0.0418  134 ASP A OD2   
50   N N     . PRO A 7   ? 0.5082 0.1811 0.1916 0.0013  -0.0162 0.0339  135 PRO A N     
51   C CA    . PRO A 7   ? 0.5028 0.1810 0.1983 0.0054  -0.0151 0.0293  135 PRO A CA    
52   C C     . PRO A 7   ? 0.5144 0.2052 0.2230 0.0186  -0.0180 0.0275  135 PRO A C     
53   O O     . PRO A 7   ? 0.5193 0.2238 0.2348 0.0207  -0.0205 0.0281  135 PRO A O     
54   C CB    . PRO A 7   ? 0.4956 0.1930 0.2047 -0.0034 -0.0098 0.0259  135 PRO A CB    
55   C CG    . PRO A 7   ? 0.5252 0.2203 0.2254 -0.0144 -0.0069 0.0294  135 PRO A CG    
56   C CD    . PRO A 7   ? 0.5202 0.2059 0.2071 -0.0101 -0.0104 0.0336  135 PRO A CD    
57   N N     . LYS A 8   ? 0.4813 0.1673 0.1923 0.0267  -0.0177 0.0255  136 LYS A N     
58   C CA    . LYS A 8   ? 0.4827 0.1824 0.2076 0.0394  -0.0190 0.0248  136 LYS A CA    
59   C C     . LYS A 8   ? 0.4621 0.1810 0.2043 0.0387  -0.0138 0.0207  136 LYS A C     
60   O O     . LYS A 8   ? 0.4453 0.1793 0.2019 0.0477  -0.0131 0.0205  136 LYS A O     
61   C CB    . LYS A 8   ? 0.5204 0.2027 0.2355 0.0524  -0.0211 0.0261  136 LYS A CB    
62   C CG    . LYS A 8   ? 0.5281 0.1859 0.2223 0.0540  -0.0269 0.0309  136 LYS A CG    
63   C CD    . LYS A 8   ? 0.5295 0.1981 0.2270 0.0532  -0.0321 0.0346  136 LYS A CD    
64   C CE    . LYS A 8   ? 0.5583 0.2010 0.2330 0.0566  -0.0383 0.0401  136 LYS A CE    
65   N NZ    . LYS A 8   ? 0.5913 0.2066 0.2439 0.0462  -0.0362 0.0416  136 LYS A NZ    
66   N N     . ASP A 9   ? 0.4444 0.1625 0.1851 0.0285  -0.0104 0.0181  137 ASP A N     
67   C CA    . ASP A 9   ? 0.4512 0.1828 0.2038 0.0276  -0.0063 0.0146  137 ASP A CA    
68   C C     . ASP A 9   ? 0.4502 0.1832 0.2017 0.0152  -0.0047 0.0130  137 ASP A C     
69   O O     . ASP A 9   ? 0.4417 0.1654 0.1835 0.0074  -0.0057 0.0148  137 ASP A O     
70   C CB    . ASP A 9   ? 0.4689 0.1888 0.2146 0.0355  -0.0041 0.0126  137 ASP A CB    
71   C CG    . ASP A 9   ? 0.5216 0.2585 0.2808 0.0395  0.0004  0.0106  137 ASP A CG    
72   O OD1   . ASP A 9   ? 0.4670 0.2218 0.2397 0.0333  0.0016  0.0102  137 ASP A OD1   
73   O OD2   . ASP A 9   ? 0.5120 0.2430 0.2666 0.0495  0.0031  0.0097  137 ASP A OD2   
74   N N     . PHE A 10  ? 0.4238 0.1700 0.1862 0.0135  -0.0019 0.0103  138 PHE A N     
75   C CA    . PHE A 10  ? 0.4122 0.1610 0.1751 0.0034  -0.0008 0.0086  138 PHE A CA    
76   C C     . PHE A 10  ? 0.4241 0.1534 0.1725 -0.0013 -0.0024 0.0082  138 PHE A C     
77   O O     . PHE A 10  ? 0.4642 0.1758 0.2006 0.0048  -0.0038 0.0079  138 PHE A O     
78   C CB    . PHE A 10  ? 0.4167 0.1799 0.1915 0.0043  0.0014  0.0060  138 PHE A CB    
79   C CG    . PHE A 10  ? 0.3637 0.1437 0.1513 0.0043  0.0021  0.0060  138 PHE A CG    
80   C CD1   . PHE A 10  ? 0.3658 0.1525 0.1605 0.0105  0.0016  0.0073  138 PHE A CD1   
81   C CD2   . PHE A 10  ? 0.3799 0.1690 0.1730 -0.0013 0.0030  0.0047  138 PHE A CD2   
82   C CE1   . PHE A 10  ? 0.3635 0.1627 0.1684 0.0091  0.0008  0.0070  138 PHE A CE1   
83   C CE2   . PHE A 10  ? 0.3561 0.1566 0.1578 -0.0007 0.0032  0.0040  138 PHE A CE2   
84   C CZ    . PHE A 10  ? 0.3522 0.1558 0.1586 0.0039  0.0016  0.0050  138 PHE A CZ    
85   N N     . PRO A 11  ? 0.4579 0.1900 0.2072 -0.0122 -0.0026 0.0083  139 PRO A N     
86   C CA    . PRO A 11  ? 0.4660 0.1818 0.2041 -0.0192 -0.0056 0.0080  139 PRO A CA    
87   C C     . PRO A 11  ? 0.4738 0.1815 0.2067 -0.0137 -0.0070 0.0041  139 PRO A C     
88   O O     . PRO A 11  ? 0.4594 0.1818 0.2026 -0.0101 -0.0052 0.0020  139 PRO A O     
89   C CB    . PRO A 11  ? 0.4575 0.1884 0.2056 -0.0311 -0.0049 0.0089  139 PRO A CB    
90   C CG    . PRO A 11  ? 0.4475 0.1951 0.2051 -0.0300 -0.0008 0.0107  139 PRO A CG    
91   C CD    . PRO A 11  ? 0.4397 0.1905 0.2005 -0.0183 -0.0002 0.0090  139 PRO A CD    
92   N N     . SER A 12  ? 0.4731 0.1554 0.1879 -0.0145 -0.0107 0.0033  140 SER A N     
93   C CA    A SER A 12  ? 0.5213 0.1895 0.2244 -0.0068 -0.0118 -0.0008 140 SER A CA    
94   C CA    B SER A 12  ? 0.5167 0.1850 0.2198 -0.0070 -0.0118 -0.0009 140 SER A CA    
95   C C     . SER A 12  ? 0.5064 0.1861 0.2160 -0.0116 -0.0131 -0.0036 140 SER A C     
96   O O     . SER A 12  ? 0.5444 0.2234 0.2503 -0.0033 -0.0115 -0.0065 140 SER A O     
97   C CB    A SER A 12  ? 0.5654 0.1989 0.2436 -0.0075 -0.0167 -0.0019 140 SER A CB    
98   C CB    B SER A 12  ? 0.5568 0.1907 0.2353 -0.0088 -0.0170 -0.0018 140 SER A CB    
99   O OG    A SER A 12  ? 0.5938 0.2141 0.2642 -0.0036 -0.0166 0.0015  140 SER A OG    
100  O OG    B SER A 12  ? 0.5652 0.1932 0.2411 -0.0254 -0.0224 -0.0005 140 SER A OG    
101  N N     . GLU A 13  ? 0.5108 0.2008 0.2291 -0.0246 -0.0161 -0.0024 141 GLU A N     
102  C CA    . GLU A 13  ? 0.5532 0.2561 0.2795 -0.0288 -0.0187 -0.0045 141 GLU A CA    
103  C C     . GLU A 13  ? 0.5107 0.2335 0.2498 -0.0195 -0.0138 -0.0053 141 GLU A C     
104  O O     . GLU A 13  ? 0.5216 0.2493 0.2617 -0.0194 -0.0161 -0.0072 141 GLU A O     
105  C CB    . GLU A 13  ? 0.5826 0.3048 0.3252 -0.0416 -0.0201 -0.0015 141 GLU A CB    
106  C CG    . GLU A 13  ? 0.6304 0.3403 0.3662 -0.0555 -0.0256 0.0005  141 GLU A CG    
107  C CD    . GLU A 13  ? 0.7491 0.4526 0.4817 -0.0592 -0.0223 0.0050  141 GLU A CD    
108  O OE1   . GLU A 13  ? 0.6287 0.3266 0.3563 -0.0488 -0.0178 0.0054  141 GLU A OE1   
109  O OE2   . GLU A 13  ? 0.8202 0.5242 0.5549 -0.0733 -0.0247 0.0086  141 GLU A OE2   
110  N N     . LEU A 14  ? 0.4788 0.2125 0.2273 -0.0131 -0.0081 -0.0033 142 LEU A N     
111  C CA    . LEU A 14  ? 0.4285 0.1808 0.1906 -0.0071 -0.0040 -0.0030 142 LEU A CA    
112  C C     . LEU A 14  ? 0.4240 0.1728 0.1825 0.0041  0.0002  -0.0030 142 LEU A C     
113  O O     . LEU A 14  ? 0.4194 0.1813 0.1877 0.0080  0.0033  -0.0023 142 LEU A O     
114  C CB    . LEU A 14  ? 0.3875 0.1568 0.1645 -0.0094 -0.0016 -0.0008 142 LEU A CB    
115  C CG    . LEU A 14  ? 0.3998 0.1769 0.1824 -0.0193 -0.0035 0.0000  142 LEU A CG    
116  C CD1   . LEU A 14  ? 0.4030 0.1928 0.1949 -0.0197 0.0001  0.0017  142 LEU A CD1   
117  C CD2   . LEU A 14  ? 0.3816 0.1696 0.1719 -0.0223 -0.0061 -0.0014 142 LEU A CD2   
118  N N     . LEU A 15  ? 0.4640 0.1954 0.2088 0.0094  0.0004  -0.0035 143 LEU A N     
119  C CA    . LEU A 15  ? 0.4584 0.1916 0.2041 0.0214  0.0056  -0.0024 143 LEU A CA    
120  C C     . LEU A 15  ? 0.4609 0.1985 0.2054 0.0276  0.0098  -0.0032 143 LEU A C     
121  O O     . LEU A 15  ? 0.4501 0.2006 0.2046 0.0347  0.0153  -0.0007 143 LEU A O     
122  C CB    . LEU A 15  ? 0.4900 0.2027 0.2202 0.0282  0.0052  -0.0029 143 LEU A CB    
123  C CG    . LEU A 15  ? 0.5004 0.2089 0.2314 0.0246  0.0022  -0.0004 143 LEU A CG    
124  C CD1   . LEU A 15  ? 0.5463 0.2284 0.2576 0.0311  0.0003  -0.0010 143 LEU A CD1   
125  C CD2   . LEU A 15  ? 0.4652 0.1941 0.2140 0.0273  0.0041  0.0029  143 LEU A CD2   
126  N N     . SER A 16  ? 0.4573 0.1841 0.1891 0.0249  0.0070  -0.0061 144 SER A N     
127  C CA    . SER A 16  ? 0.4882 0.2157 0.2136 0.0313  0.0112  -0.0066 144 SER A CA    
128  C C     . SER A 16  ? 0.4352 0.1834 0.1777 0.0282  0.0130  -0.0037 144 SER A C     
129  O O     . SER A 16  ? 0.4727 0.2241 0.2126 0.0328  0.0175  -0.0024 144 SER A O     
130  C CB    . SER A 16  ? 0.5130 0.2201 0.2160 0.0296  0.0062  -0.0108 144 SER A CB    
131  O OG    . SER A 16  ? 0.5046 0.2167 0.2129 0.0184  -0.0013 -0.0115 144 SER A OG    
132  N N     . PHE A 17  ? 0.3939 0.1539 0.1514 0.0208  0.0098  -0.0026 145 PHE A N     
133  C CA    . PHE A 17  ? 0.3885 0.1641 0.1600 0.0183  0.0105  -0.0005 145 PHE A CA    
134  C C     . PHE A 17  ? 0.3966 0.1856 0.1829 0.0209  0.0149  0.0030  145 PHE A C     
135  O O     . PHE A 17  ? 0.3835 0.1827 0.1799 0.0192  0.0158  0.0052  145 PHE A O     
136  C CB    . PHE A 17  ? 0.3827 0.1647 0.1620 0.0103  0.0051  -0.0016 145 PHE A CB    
137  C CG    . PHE A 17  ? 0.4172 0.1903 0.1865 0.0055  -0.0009 -0.0042 145 PHE A CG    
138  C CD1   . PHE A 17  ? 0.4510 0.2121 0.2045 0.0080  -0.0029 -0.0058 145 PHE A CD1   
139  C CD2   . PHE A 17  ? 0.4113 0.1883 0.1865 -0.0022 -0.0050 -0.0048 145 PHE A CD2   
140  C CE1   . PHE A 17  ? 0.4525 0.2055 0.1973 0.0021  -0.0106 -0.0083 145 PHE A CE1   
141  C CE2   . PHE A 17  ? 0.4382 0.2099 0.2075 -0.0086 -0.0116 -0.0065 145 PHE A CE2   
142  C CZ    . PHE A 17  ? 0.4354 0.1945 0.1895 -0.0067 -0.0152 -0.0085 145 PHE A CZ    
143  N N     . LEU A 18  ? 0.4102 0.1981 0.1974 0.0249  0.0169  0.0037  146 LEU A N     
144  C CA    . LEU A 18  ? 0.3953 0.1967 0.1981 0.0256  0.0181  0.0068  146 LEU A CA    
145  C C     . LEU A 18  ? 0.4016 0.2094 0.2081 0.0335  0.0244  0.0100  146 LEU A C     
146  O O     . LEU A 18  ? 0.4226 0.2213 0.2166 0.0408  0.0283  0.0092  146 LEU A O     
147  C CB    . LEU A 18  ? 0.3899 0.1876 0.1925 0.0243  0.0145  0.0061  146 LEU A CB    
148  C CG    . LEU A 18  ? 0.3869 0.1808 0.1866 0.0163  0.0100  0.0038  146 LEU A CG    
149  C CD1   . LEU A 18  ? 0.4127 0.2004 0.2085 0.0153  0.0076  0.0041  146 LEU A CD1   
150  C CD2   . LEU A 18  ? 0.4168 0.2226 0.2280 0.0120  0.0091  0.0040  146 LEU A CD2   
151  N N     . SER A 19  ? 0.3594 0.1829 0.1828 0.0321  0.0252  0.0139  147 SER A N     
152  C CA    . SER A 19  ? 0.3791 0.2154 0.2132 0.0386  0.0303  0.0182  147 SER A CA    
153  C C     . SER A 19  ? 0.4075 0.2443 0.2450 0.0425  0.0268  0.0181  147 SER A C     
154  O O     . SER A 19  ? 0.3821 0.2195 0.2239 0.0368  0.0202  0.0173  147 SER A O     
155  C CB    . SER A 19  ? 0.3987 0.2522 0.2508 0.0334  0.0313  0.0231  147 SER A CB    
156  O OG    . SER A 19  ? 0.4348 0.3042 0.3003 0.0395  0.0360  0.0279  147 SER A OG    
157  N N     . HIS A 20  ? 0.4376 0.2723 0.2705 0.0532  0.0310  0.0186  148 HIS A N     
158  C CA    . HIS A 20  ? 0.4505 0.2854 0.2863 0.0593  0.0277  0.0194  148 HIS A CA    
159  C C     . HIS A 20  ? 0.4558 0.3151 0.3143 0.0635  0.0292  0.0250  148 HIS A C     
160  O O     . HIS A 20  ? 0.4833 0.3462 0.3473 0.0686  0.0248  0.0265  148 HIS A O     
161  C CB    . HIS A 20  ? 0.4624 0.2766 0.2775 0.0699  0.0301  0.0162  148 HIS A CB    
162  C CG    . HIS A 20  ? 0.4847 0.2767 0.2796 0.0632  0.0271  0.0113  148 HIS A CG    
163  N ND1   . HIS A 20  ? 0.4867 0.2705 0.2780 0.0537  0.0200  0.0096  148 HIS A ND1   
164  C CD2   . HIS A 20  ? 0.5608 0.3391 0.3393 0.0638  0.0299  0.0080  148 HIS A CD2   
165  C CE1   . HIS A 20  ? 0.5331 0.3024 0.3103 0.0480  0.0186  0.0061  148 HIS A CE1   
166  N NE2   . HIS A 20  ? 0.5289 0.2938 0.2977 0.0537  0.0235  0.0048  148 HIS A NE2   
167  N N     . ALA A 21  ? 0.4342 0.3111 0.3072 0.0597  0.0338  0.0289  149 ALA A N     
168  C CA    . ALA A 21  ? 0.4378 0.3421 0.3364 0.0615  0.0351  0.0355  149 ALA A CA    
169  C C     . ALA A 21  ? 0.4206 0.3317 0.3317 0.0495  0.0250  0.0364  149 ALA A C     
170  O O     . ALA A 21  ? 0.4288 0.3499 0.3514 0.0395  0.0245  0.0393  149 ALA A O     
171  C CB    . ALA A 21  ? 0.4279 0.3469 0.3350 0.0615  0.0458  0.0402  149 ALA A CB    
172  N N     . VAL A 22  ? 0.4067 0.3096 0.3129 0.0501  0.0164  0.0340  150 VAL A N     
173  C CA    . VAL A 22  ? 0.4053 0.3090 0.3165 0.0395  0.0061  0.0335  150 VAL A CA    
174  C C     . VAL A 22  ? 0.4308 0.3587 0.3673 0.0343  0.0013  0.0391  150 VAL A C     
175  O O     . VAL A 22  ? 0.4237 0.3503 0.3628 0.0237  -0.0068 0.0383  150 VAL A O     
176  C CB    . VAL A 22  ? 0.4380 0.3262 0.3350 0.0418  -0.0014 0.0302  150 VAL A CB    
177  C CG1   . VAL A 22  ? 0.4203 0.2848 0.2939 0.0418  0.0016  0.0251  150 VAL A CG1   
178  C CG2   . VAL A 22  ? 0.4360 0.3329 0.3406 0.0525  -0.0038 0.0336  150 VAL A CG2   
179  N N     . PHE A 23  ? 0.4231 0.3729 0.3780 0.0417  0.0059  0.0448  151 PHE A N     
180  C CA    . PHE A 23  ? 0.4325 0.4103 0.4161 0.0358  0.0021  0.0516  151 PHE A CA    
181  C C     . PHE A 23  ? 0.4247 0.4171 0.4218 0.0290  0.0108  0.0568  151 PHE A C     
182  O O     . PHE A 23  ? 0.4077 0.4255 0.4304 0.0234  0.0093  0.0638  151 PHE A O     
183  C CB    . PHE A 23  ? 0.4553 0.4539 0.4555 0.0484  0.0019  0.0562  151 PHE A CB    
184  C CG    . PHE A 23  ? 0.4878 0.4705 0.4733 0.0561  -0.0065 0.0524  151 PHE A CG    
185  C CD1   . PHE A 23  ? 0.5024 0.4749 0.4815 0.0472  -0.0198 0.0499  151 PHE A CD1   
186  C CD2   . PHE A 23  ? 0.5124 0.4872 0.4872 0.0724  -0.0010 0.0513  151 PHE A CD2   
187  C CE1   . PHE A 23  ? 0.4829 0.4400 0.4466 0.0538  -0.0273 0.0474  151 PHE A CE1   
188  C CE2   . PHE A 23  ? 0.5417 0.4987 0.5007 0.0786  -0.0090 0.0486  151 PHE A CE2   
189  C CZ    . PHE A 23  ? 0.5200 0.4689 0.4737 0.0688  -0.0219 0.0471  151 PHE A CZ    
190  N N     . SER A 24  ? 0.3978 0.3738 0.3775 0.0282  0.0188  0.0539  152 SER A N     
191  C CA    . SER A 24  ? 0.4004 0.3872 0.3880 0.0238  0.0288  0.0594  152 SER A CA    
192  C C     . SER A 24  ? 0.3768 0.3697 0.3779 0.0070  0.0218  0.0632  152 SER A C     
193  O O     . SER A 24  ? 0.3719 0.3486 0.3642 -0.0012 0.0110  0.0585  152 SER A O     
194  C CB    . SER A 24  ? 0.4131 0.3762 0.3744 0.0268  0.0363  0.0545  152 SER A CB    
195  O OG    . SER A 24  ? 0.3903 0.3567 0.3526 0.0212  0.0443  0.0592  152 SER A OG    
196  N N     . ASN A 25  ? 0.3600 0.3747 0.3806 0.0021  0.0286  0.0719  153 ASN A N     
197  C CA    . ASN A 25  ? 0.3914 0.4071 0.4211 -0.0153 0.0240  0.0766  153 ASN A CA    
198  C C     . ASN A 25  ? 0.4008 0.3924 0.4087 -0.0198 0.0283  0.0744  153 ASN A C     
199  O O     . ASN A 25  ? 0.3849 0.3719 0.3963 -0.0334 0.0243  0.0779  153 ASN A O     
200  C CB    . ASN A 25  ? 0.3751 0.4242 0.4346 -0.0207 0.0310  0.0884  153 ASN A CB    
201  C CG    . ASN A 25  ? 0.4084 0.4880 0.4944 -0.0148 0.0279  0.0923  153 ASN A CG    
202  O OD1   . ASN A 25  ? 0.4434 0.5171 0.5263 -0.0107 0.0166  0.0867  153 ASN A OD1   
203  N ND2   . ASN A 25  ? 0.4429 0.5563 0.5551 -0.0134 0.0382  0.1025  153 ASN A ND2   
204  N N     . ARG A 26  ? 0.3998 0.3747 0.3850 -0.0091 0.0357  0.0691  154 ARG A N     
205  C CA    . ARG A 26  ? 0.4330 0.3881 0.3994 -0.0129 0.0396  0.0684  154 ARG A CA    
206  C C     . ARG A 26  ? 0.3816 0.3132 0.3336 -0.0171 0.0276  0.0600  154 ARG A C     
207  O O     . ARG A 26  ? 0.4190 0.3425 0.3613 -0.0099 0.0242  0.0531  154 ARG A O     
208  C CB    . ARG A 26  ? 0.4663 0.4134 0.4138 -0.0009 0.0513  0.0665  154 ARG A CB    
209  C CG    . ARG A 26  ? 0.4783 0.4004 0.4030 -0.0042 0.0506  0.0636  154 ARG A CG    
210  C CD    . ARG A 26  ? 0.5235 0.4360 0.4273 0.0067  0.0602  0.0616  154 ARG A CD    
211  N NE    . ARG A 26  ? 0.5253 0.4279 0.4165 0.0168  0.0577  0.0530  154 ARG A NE    
212  C CZ    . ARG A 26  ? 0.5635 0.4451 0.4355 0.0183  0.0522  0.0456  154 ARG A CZ    
213  N NH1   . ARG A 26  ? 0.5462 0.4147 0.4088 0.0124  0.0484  0.0449  154 ARG A NH1   
214  N NH2   . ARG A 26  ? 0.5740 0.4480 0.4368 0.0257  0.0500  0.0391  154 ARG A NH2   
215  N N     . THR A 27  ? 0.3367 0.2576 0.2876 -0.0286 0.0213  0.0612  155 THR A N     
216  C CA    . THR A 27  ? 0.3310 0.2302 0.2685 -0.0317 0.0104  0.0534  155 THR A CA    
217  C C     . THR A 27  ? 0.3387 0.2188 0.2540 -0.0250 0.0140  0.0481  155 THR A C     
218  O O     . THR A 27  ? 0.3774 0.2568 0.2865 -0.0220 0.0227  0.0516  155 THR A O     
219  C CB    . THR A 27  ? 0.3532 0.2452 0.2956 -0.0454 0.0020  0.0564  155 THR A CB    
220  O OG1   . THR A 27  ? 0.3830 0.2690 0.3213 -0.0501 0.0082  0.0625  155 THR A OG1   
221  C CG2   . THR A 27  ? 0.3819 0.2953 0.3486 -0.0537 -0.0034 0.0621  155 THR A CG2   
222  N N     . LEU A 28  ? 0.3223 0.1868 0.2255 -0.0236 0.0070  0.0404  156 LEU A N     
223  C CA    . LEU A 28  ? 0.3305 0.1804 0.2161 -0.0174 0.0086  0.0350  156 LEU A CA    
224  C C     . LEU A 28  ? 0.3409 0.1748 0.2178 -0.0199 0.0008  0.0297  156 LEU A C     
225  O O     . LEU A 28  ? 0.3318 0.1633 0.2131 -0.0257 -0.0061 0.0291  156 LEU A O     
226  C CB    . LEU A 28  ? 0.3532 0.2063 0.2340 -0.0088 0.0108  0.0302  156 LEU A CB    
227  C CG    . LEU A 28  ? 0.3982 0.2634 0.2834 -0.0028 0.0186  0.0336  156 LEU A CG    
228  C CD1   . LEU A 28  ? 0.3956 0.2582 0.2738 0.0042  0.0182  0.0285  156 LEU A CD1   
229  C CD2   . LEU A 28  ? 0.4543 0.3157 0.3304 -0.0001 0.0263  0.0364  156 LEU A CD2   
230  N N     . ALA A 29  ? 0.3499 0.1726 0.2138 -0.0149 0.0014  0.0257  157 ALA A N     
231  C CA    . ALA A 29  ? 0.3302 0.1390 0.1855 -0.0145 -0.0046 0.0203  157 ALA A CA    
232  C C     . ALA A 29  ? 0.3596 0.1679 0.2075 -0.0073 -0.0035 0.0145  157 ALA A C     
233  O O     . ALA A 29  ? 0.3667 0.1660 0.2074 -0.0043 -0.0062 0.0105  157 ALA A O     
234  C CB    . ALA A 29  ? 0.3758 0.1713 0.2245 -0.0162 -0.0054 0.0233  157 ALA A CB    
235  N N     . CYS A 30  ? 0.3532 0.1712 0.2032 -0.0044 0.0001  0.0139  158 CYS A N     
236  C CA    . CYS A 30  ? 0.3595 0.1773 0.2034 0.0001  0.0007  0.0092  158 CYS A CA    
237  C C     . CYS A 30  ? 0.3584 0.1831 0.2052 0.0005  0.0015  0.0087  158 CYS A C     
238  O O     . CYS A 30  ? 0.3597 0.1903 0.2106 0.0012  0.0046  0.0120  158 CYS A O     
239  C CB    . CYS A 30  ? 0.3644 0.1820 0.2029 0.0035  0.0039  0.0097  158 CYS A CB    
240  S SG    . CYS A 30  ? 0.3872 0.2060 0.2212 0.0063  0.0028  0.0045  158 CYS A SG    
241  N N     . PHE A 31  ? 0.3687 0.1920 0.2121 0.0008  -0.0008 0.0048  159 PHE A N     
242  C CA    . PHE A 31  ? 0.3751 0.2017 0.2187 0.0011  -0.0012 0.0046  159 PHE A CA    
243  C C     . PHE A 31  ? 0.3498 0.1744 0.1860 0.0023  -0.0003 0.0013  159 PHE A C     
244  O O     . PHE A 31  ? 0.3531 0.1764 0.1864 0.0029  0.0001  -0.0013 159 PHE A O     
245  C CB    . PHE A 31  ? 0.3717 0.1983 0.2183 -0.0017 -0.0064 0.0047  159 PHE A CB    
246  C CG    . PHE A 31  ? 0.3672 0.1968 0.2233 -0.0055 -0.0084 0.0086  159 PHE A CG    
247  C CD1   . PHE A 31  ? 0.3652 0.1868 0.2197 -0.0087 -0.0112 0.0079  159 PHE A CD1   
248  C CD2   . PHE A 31  ? 0.3392 0.1795 0.2060 -0.0060 -0.0076 0.0133  159 PHE A CD2   
249  C CE1   . PHE A 31  ? 0.3552 0.1790 0.2184 -0.0142 -0.0132 0.0126  159 PHE A CE1   
250  C CE2   . PHE A 31  ? 0.3551 0.2017 0.2332 -0.0107 -0.0085 0.0181  159 PHE A CE2   
251  C CZ    . PHE A 31  ? 0.3495 0.1872 0.2258 -0.0162 -0.0120 0.0179  159 PHE A CZ    
252  N N     . ALA A 32  ? 0.3549 0.1796 0.1884 0.0029  0.0003  0.0021  160 ALA A N     
253  C CA    . ALA A 32  ? 0.3774 0.1997 0.2037 0.0022  0.0012  0.0004  160 ALA A CA    
254  C C     . ALA A 32  ? 0.3632 0.1829 0.1853 0.0021  -0.0012 0.0013  160 ALA A C     
255  O O     . ALA A 32  ? 0.3318 0.1528 0.1578 0.0038  -0.0034 0.0037  160 ALA A O     
256  C CB    . ALA A 32  ? 0.3864 0.2066 0.2094 0.0020  0.0036  0.0009  160 ALA A CB    
257  N N     . ILE A 33  ? 0.3810 0.1982 0.1954 0.0006  -0.0007 -0.0002 161 ILE A N     
258  C CA    . ILE A 33  ? 0.3788 0.1911 0.1847 0.0005  -0.0030 0.0010  161 ILE A CA    
259  C C     . ILE A 33  ? 0.3782 0.1866 0.1754 -0.0020 0.0006  0.0021  161 ILE A C     
260  O O     . ILE A 33  ? 0.3959 0.2083 0.1927 -0.0043 0.0046  0.0008  161 ILE A O     
261  C CB    . ILE A 33  ? 0.3789 0.1892 0.1796 0.0005  -0.0063 -0.0014 161 ILE A CB    
262  C CG1   . ILE A 33  ? 0.3715 0.1840 0.1808 0.0007  -0.0120 -0.0011 161 ILE A CG1   
263  C CG2   . ILE A 33  ? 0.3912 0.1948 0.1787 0.0003  -0.0083 -0.0002 161 ILE A CG2   
264  C CD1   . ILE A 33  ? 0.4026 0.2098 0.2059 -0.0002 -0.0169 -0.0044 161 ILE A CD1   
265  N N     . TYR A 34  ? 0.3574 0.1584 0.1484 -0.0015 -0.0010 0.0050  162 TYR A N     
266  C CA    . TYR A 34  ? 0.3766 0.1702 0.1571 -0.0053 0.0014  0.0072  162 TYR A CA    
267  C C     . TYR A 34  ? 0.3742 0.1606 0.1423 -0.0049 -0.0009 0.0093  162 TYR A C     
268  O O     . TYR A 34  ? 0.3680 0.1503 0.1346 -0.0006 -0.0063 0.0107  162 TYR A O     
269  C CB    . TYR A 34  ? 0.3702 0.1550 0.1485 -0.0046 0.0006  0.0091  162 TYR A CB    
270  C CG    . TYR A 34  ? 0.3950 0.1683 0.1619 -0.0101 0.0019  0.0118  162 TYR A CG    
271  C CD1   . TYR A 34  ? 0.4178 0.1960 0.1841 -0.0179 0.0059  0.0124  162 TYR A CD1   
272  C CD2   . TYR A 34  ? 0.4393 0.1975 0.1976 -0.0077 -0.0006 0.0139  162 TYR A CD2   
273  C CE1   . TYR A 34  ? 0.4554 0.2232 0.2126 -0.0252 0.0067  0.0159  162 TYR A CE1   
274  C CE2   . TYR A 34  ? 0.4867 0.2306 0.2327 -0.0139 -0.0004 0.0167  162 TYR A CE2   
275  C CZ    . TYR A 34  ? 0.4849 0.2341 0.2312 -0.0238 0.0031  0.0178  162 TYR A CZ    
276  O OH    . TYR A 34  ? 0.5540 0.2875 0.2886 -0.0318 0.0026  0.0215  162 TYR A OH    
277  N N     . THR A 35  ? 0.4020 0.1885 0.1620 -0.0087 0.0031  0.0097  163 THR A N     
278  C CA    . THR A 35  ? 0.4080 0.1864 0.1520 -0.0084 0.0016  0.0116  163 THR A CA    
279  C C     . THR A 35  ? 0.4272 0.2051 0.1611 -0.0141 0.0088  0.0140  163 THR A C     
280  O O     . THR A 35  ? 0.4159 0.2013 0.1576 -0.0188 0.0141  0.0145  163 THR A O     
281  C CB    . THR A 35  ? 0.4132 0.1947 0.1573 -0.0042 -0.0029 0.0078  163 THR A CB    
282  O OG1   . THR A 35  ? 0.4310 0.2023 0.1578 -0.0029 -0.0072 0.0097  163 THR A OG1   
283  C CG2   . THR A 35  ? 0.4375 0.2273 0.1846 -0.0040 0.0018  0.0032  163 THR A CG2   
284  N N     . THR A 36  ? 0.4364 0.2070 0.1530 -0.0137 0.0090  0.0158  164 THR A N     
285  C CA    . THR A 36  ? 0.4548 0.2267 0.1613 -0.0189 0.0175  0.0189  164 THR A CA    
286  C C     . THR A 36  ? 0.4517 0.2398 0.1659 -0.0179 0.0250  0.0148  164 THR A C     
287  O O     . THR A 36  ? 0.4450 0.2381 0.1657 -0.0120 0.0226  0.0089  164 THR A O     
288  C CB    . THR A 36  ? 0.4951 0.2535 0.1774 -0.0181 0.0164  0.0222  164 THR A CB    
289  O OG1   . THR A 36  ? 0.4675 0.2260 0.1441 -0.0115 0.0125  0.0169  164 THR A OG1   
290  C CG2   . THR A 36  ? 0.5078 0.2493 0.1814 -0.0179 0.0088  0.0271  164 THR A CG2   
291  N N     . LYS A 37  ? 0.4712 0.2675 0.1847 -0.0234 0.0344  0.0183  165 LYS A N     
292  C CA    . LYS A 37  ? 0.4876 0.3015 0.2087 -0.0206 0.0428  0.0150  165 LYS A CA    
293  C C     . LYS A 37  ? 0.5032 0.3124 0.2079 -0.0118 0.0439  0.0100  165 LYS A C     
294  O O     . LYS A 37  ? 0.4772 0.2934 0.1891 -0.0051 0.0443  0.0038  165 LYS A O     
300  N N     . GLU A 38  ? 0.5172 0.3116 0.1988 -0.0119 0.0428  0.0126  166 GLU A N     
301  C CA    . GLU A 38  ? 0.5702 0.3546 0.2307 -0.0045 0.0415  0.0081  166 GLU A CA    
302  C C     . GLU A 38  ? 0.5387 0.3174 0.2049 0.0012  0.0303  0.0010  166 GLU A C     
303  O O     . GLU A 38  ? 0.5256 0.3032 0.1867 0.0075  0.0305  -0.0053 166 GLU A O     
304  C CB    . GLU A 38  ? 0.5970 0.3624 0.2313 -0.0064 0.0374  0.0130  166 GLU A CB    
305  C CG    . GLU A 38  ? 0.6804 0.4364 0.3194 -0.0116 0.0286  0.0186  166 GLU A CG    
306  C CD    . GLU A 38  ? 0.7935 0.5290 0.4099 -0.0102 0.0190  0.0221  166 GLU A CD    
307  O OE1   . GLU A 38  ? 0.7244 0.4501 0.3148 -0.0086 0.0216  0.0233  166 GLU A OE1   
308  O OE2   . GLU A 38  ? 0.6198 0.3488 0.2434 -0.0100 0.0090  0.0239  166 GLU A OE2   
309  N N     . LYS A 39  ? 0.5416 0.3159 0.2177 -0.0013 0.0205  0.0026  167 LYS A N     
310  C CA    . LYS A 39  ? 0.5317 0.3020 0.2149 0.0021  0.0097  -0.0022 167 LYS A CA    
311  C C     . LYS A 39  ? 0.4901 0.2723 0.1936 0.0038  0.0121  -0.0065 167 LYS A C     
312  O O     . LYS A 39  ? 0.4768 0.2555 0.1806 0.0077  0.0074  -0.0120 167 LYS A O     
313  C CB    . LYS A 39  ? 0.5133 0.2785 0.2028 0.0000  -0.0002 0.0017  167 LYS A CB    
314  C CG    . LYS A 39  ? 0.5519 0.3031 0.2203 0.0001  -0.0056 0.0056  167 LYS A CG    
315  C CD    . LYS A 39  ? 0.5516 0.2997 0.2282 -0.0001 -0.0140 0.0100  167 LYS A CD    
316  C CE    . LYS A 39  ? 0.5539 0.3080 0.2479 0.0024  -0.0237 0.0071  167 LYS A CE    
317  N NZ    . LYS A 39  ? 0.5146 0.2662 0.2132 0.0045  -0.0318 0.0118  167 LYS A NZ    
318  N N     . ALA A 40  ? 0.4585 0.2527 0.1784 0.0004  0.0177  -0.0036 168 ALA A N     
319  C CA    . ALA A 40  ? 0.4285 0.2336 0.1670 0.0022  0.0192  -0.0068 168 ALA A CA    
320  C C     . ALA A 40  ? 0.4522 0.2616 0.1866 0.0086  0.0251  -0.0119 168 ALA A C     
321  O O     . ALA A 40  ? 0.4200 0.2282 0.1604 0.0128  0.0217  -0.0164 168 ALA A O     
322  C CB    . ALA A 40  ? 0.4355 0.2517 0.1892 -0.0029 0.0233  -0.0028 168 ALA A CB    
323  N N     . ALA A 41  ? 0.4985 0.3105 0.2201 0.0100  0.0337  -0.0111 169 ALA A N     
324  C CA    . ALA A 41  ? 0.5233 0.3403 0.2398 0.0181  0.0413  -0.0158 169 ALA A CA    
325  C C     . ALA A 41  ? 0.5512 0.3495 0.2510 0.0247  0.0338  -0.0229 169 ALA A C     
326  O O     . ALA A 41  ? 0.5304 0.3274 0.2321 0.0319  0.0339  -0.0285 169 ALA A O     
327  C CB    . ALA A 41  ? 0.5745 0.3981 0.2785 0.0183  0.0531  -0.0127 169 ALA A CB    
328  N N     . LEU A 42  ? 0.5464 0.3292 0.2302 0.0219  0.0260  -0.0223 170 LEU A N     
329  C CA    . LEU A 42  ? 0.5967 0.3600 0.2642 0.0258  0.0160  -0.0288 170 LEU A CA    
330  C C     . LEU A 42  ? 0.5552 0.3164 0.2399 0.0233  0.0057  -0.0304 170 LEU A C     
331  O O     . LEU A 42  ? 0.5741 0.3244 0.2543 0.0272  0.0008  -0.0363 170 LEU A O     
332  C CB    . LEU A 42  ? 0.6710 0.4195 0.3163 0.0232  0.0092  -0.0274 170 LEU A CB    
333  C CG    . LEU A 42  ? 0.8386 0.5790 0.4544 0.0287  0.0173  -0.0292 170 LEU A CG    
334  C CD1   . LEU A 42  ? 0.8579 0.6158 0.4785 0.0283  0.0334  -0.0238 170 LEU A CD1   
335  C CD2   . LEU A 42  ? 0.8791 0.6013 0.4680 0.0271  0.0090  -0.0283 170 LEU A CD2   
336  N N     . LEU A 43  ? 0.4837 0.2538 0.1870 0.0169  0.0025  -0.0250 171 LEU A N     
337  C CA    . LEU A 43  ? 0.4877 0.2579 0.2076 0.0139  -0.0059 -0.0248 171 LEU A CA    
338  C C     . LEU A 43  ? 0.4883 0.2635 0.2204 0.0171  -0.0025 -0.0274 171 LEU A C     
339  O O     . LEU A 43  ? 0.5184 0.2873 0.2562 0.0161  -0.0095 -0.0290 171 LEU A O     
340  C CB    . LEU A 43  ? 0.5226 0.3026 0.2586 0.0085  -0.0071 -0.0184 171 LEU A CB    
341  C CG    . LEU A 43  ? 0.6173 0.3929 0.3542 0.0051  -0.0171 -0.0156 171 LEU A CG    
342  C CD1   . LEU A 43  ? 0.6014 0.3873 0.3554 0.0026  -0.0158 -0.0101 171 LEU A CD1   
343  C CD2   . LEU A 43  ? 0.5977 0.3666 0.3372 0.0037  -0.0273 -0.0186 171 LEU A CD2   
344  N N     . TYR A 44  ? 0.4621 0.2489 0.1985 0.0209  0.0078  -0.0271 172 TYR A N     
345  C CA    . TYR A 44  ? 0.4437 0.2366 0.1914 0.0254  0.0109  -0.0292 172 TYR A CA    
346  C C     . TYR A 44  ? 0.4532 0.2292 0.1889 0.0314  0.0061  -0.0355 172 TYR A C     
347  O O     . TYR A 44  ? 0.4646 0.2355 0.2082 0.0311  0.0009  -0.0362 172 TYR A O     
348  C CB    . TYR A 44  ? 0.4582 0.2670 0.2091 0.0298  0.0225  -0.0285 172 TYR A CB    
349  C CG    . TYR A 44  ? 0.4624 0.2810 0.2263 0.0361  0.0258  -0.0301 172 TYR A CG    
350  C CD1   . TYR A 44  ? 0.4253 0.2551 0.2085 0.0323  0.0242  -0.0264 172 TYR A CD1   
351  C CD2   . TYR A 44  ? 0.4881 0.3041 0.2435 0.0471  0.0303  -0.0353 172 TYR A CD2   
352  C CE1   . TYR A 44  ? 0.4277 0.2665 0.2221 0.0385  0.0259  -0.0274 172 TYR A CE1   
353  C CE2   . TYR A 44  ? 0.4863 0.3117 0.2541 0.0547  0.0326  -0.0365 172 TYR A CE2   
354  C CZ    . TYR A 44  ? 0.4746 0.3119 0.2624 0.0497  0.0299  -0.0321 172 TYR A CZ    
355  O OH    . TYR A 44  ? 0.4645 0.3111 0.2636 0.0572  0.0311  -0.0328 172 TYR A OH    
356  N N     . LYS A 45  ? 0.4920 0.2571 0.2065 0.0367  0.0079  -0.0402 173 LYS A N     
357  C CA    . LYS A 45  ? 0.5516 0.2953 0.2500 0.0427  0.0023  -0.0472 173 LYS A CA    
358  C C     . LYS A 45  ? 0.5167 0.2431 0.2114 0.0349  -0.0118 -0.0478 173 LYS A C     
359  O O     . LYS A 45  ? 0.5533 0.2645 0.2455 0.0358  -0.0184 -0.0511 173 LYS A O     
360  C CB    . LYS A 45  ? 0.6685 0.4029 0.3415 0.0514  0.0081  -0.0527 173 LYS A CB    
361  C CG    . LYS A 45  ? 0.8117 0.5659 0.4906 0.0596  0.0229  -0.0518 173 LYS A CG    
362  C CD    . LYS A 45  ? 0.9831 0.7399 0.6433 0.0627  0.0322  -0.0518 173 LYS A CD    
363  C CE    . LYS A 45  ? 0.9953 0.7754 0.6638 0.0712  0.0483  -0.0506 173 LYS A CE    
364  N NZ    . LYS A 45  ? 1.0349 0.8407 0.7357 0.0683  0.0518  -0.0452 173 LYS A NZ    
365  N N     . LYS A 46  ? 0.4836 0.2114 0.1770 0.0275  -0.0169 -0.0444 174 LYS A N     
366  C CA    . LYS A 46  ? 0.5033 0.2199 0.1965 0.0194  -0.0306 -0.0438 174 LYS A CA    
367  C C     . LYS A 46  ? 0.4930 0.2170 0.2098 0.0131  -0.0345 -0.0394 174 LYS A C     
368  O O     . LYS A 46  ? 0.4868 0.1981 0.2031 0.0084  -0.0443 -0.0406 174 LYS A O     
369  C CB    . LYS A 46  ? 0.5459 0.2665 0.2355 0.0145  -0.0346 -0.0401 174 LYS A CB    
370  C CG    . LYS A 46  ? 0.6265 0.3336 0.2863 0.0194  -0.0338 -0.0445 174 LYS A CG    
371  C CD    . LYS A 46  ? 0.7542 0.4361 0.3927 0.0196  -0.0453 -0.0516 174 LYS A CD    
372  C CE    . LYS A 46  ? 0.8706 0.5372 0.4769 0.0236  -0.0468 -0.0556 174 LYS A CE    
373  N NZ    . LYS A 46  ? 0.9075 0.5779 0.5013 0.0341  -0.0304 -0.0578 174 LYS A NZ    
374  N N     . ILE A 47  ? 0.4387 0.1823 0.1744 0.0119  -0.0276 -0.0338 175 ILE A N     
375  C CA    . ILE A 47  ? 0.4426 0.1943 0.1991 0.0076  -0.0287 -0.0293 175 ILE A CA    
376  C C     . ILE A 47  ? 0.4846 0.2258 0.2392 0.0114  -0.0286 -0.0326 175 ILE A C     
377  O O     . ILE A 47  ? 0.4801 0.2136 0.2396 0.0063  -0.0352 -0.0312 175 ILE A O     
378  C CB    . ILE A 47  ? 0.4385 0.2094 0.2107 0.0075  -0.0208 -0.0242 175 ILE A CB    
379  C CG1   . ILE A 47  ? 0.4854 0.2642 0.2603 0.0039  -0.0218 -0.0201 175 ILE A CG1   
380  C CG2   . ILE A 47  ? 0.4467 0.2232 0.2355 0.0048  -0.0208 -0.0204 175 ILE A CG2   
381  C CD1   . ILE A 47  ? 0.4975 0.2773 0.2817 -0.0022 -0.0306 -0.0166 175 ILE A CD1   
382  N N     . MET A 48  ? 0.4695 0.2113 0.2175 0.0205  -0.0209 -0.0362 176 MET A N     
383  C CA    . MET A 48  ? 0.5316 0.2630 0.2764 0.0267  -0.0206 -0.0393 176 MET A CA    
384  C C     . MET A 48  ? 0.5584 0.2634 0.2882 0.0244  -0.0311 -0.0434 176 MET A C     
385  O O     . MET A 48  ? 0.5941 0.2892 0.3283 0.0218  -0.0357 -0.0418 176 MET A O     
386  C CB    . MET A 48  ? 0.5740 0.3118 0.3129 0.0386  -0.0108 -0.0432 176 MET A CB    
387  C CG    . MET A 48  ? 0.6022 0.3302 0.3369 0.0487  -0.0098 -0.0469 176 MET A CG    
388  S SD    . MET A 48  ? 0.6599 0.3979 0.3878 0.0644  0.0021  -0.0517 176 MET A SD    
389  C CE    . MET A 48  ? 0.6374 0.4103 0.3887 0.0603  0.0111  -0.0448 176 MET A CE    
390  N N     . GLU A 49  ? 0.5440 0.2350 0.2545 0.0246  -0.0357 -0.0483 177 GLU A N     
391  C CA    . GLU A 49  ? 0.6491 0.3127 0.3428 0.0208  -0.0477 -0.0527 177 GLU A CA    
392  C C     . GLU A 49  ? 0.6505 0.3150 0.3579 0.0060  -0.0586 -0.0470 177 GLU A C     
393  O O     . GLU A 49  ? 0.6525 0.2993 0.3577 0.0003  -0.0672 -0.0471 177 GLU A O     
394  C CB    . GLU A 49  ? 0.6738 0.3228 0.3418 0.0241  -0.0508 -0.0593 177 GLU A CB    
395  C CG    . GLU A 49  ? 0.8403 0.4846 0.4894 0.0393  -0.0404 -0.0659 177 GLU A CG    
396  C CD    . GLU A 49  ? 0.9641 0.6020 0.5892 0.0424  -0.0396 -0.0701 177 GLU A CD    
397  O OE1   . GLU A 49  ? 0.9779 0.6195 0.6027 0.0336  -0.0460 -0.0671 177 GLU A OE1   
398  O OE2   . GLU A 49  ? 1.0867 0.7166 0.6924 0.0553  -0.0315 -0.0763 177 GLU A OE2   
399  N N     . LYS A 50  ? 0.5207 0.2050 0.2419 -0.0001 -0.0586 -0.0417 178 LYS A N     
400  C CA    . LYS A 50  ? 0.5058 0.1938 0.2403 -0.0130 -0.0692 -0.0364 178 LYS A CA    
401  C C     . LYS A 50  ? 0.4977 0.1924 0.2521 -0.0181 -0.0673 -0.0302 178 LYS A C     
402  O O     . LYS A 50  ? 0.5214 0.2089 0.2816 -0.0285 -0.0764 -0.0271 178 LYS A O     
403  C CB    . LYS A 50  ? 0.5005 0.2109 0.2476 -0.0153 -0.0675 -0.0314 178 LYS A CB    
404  C CG    . LYS A 50  ? 0.5071 0.2305 0.2748 -0.0262 -0.0754 -0.0244 178 LYS A CG    
405  C CD    . LYS A 50  ? 0.5552 0.2643 0.3161 -0.0353 -0.0909 -0.0260 178 LYS A CD    
406  C CE    . LYS A 50  ? 0.5617 0.2920 0.3480 -0.0450 -0.0975 -0.0178 178 LYS A CE    
407  N NZ    . LYS A 50  ? 0.6222 0.3392 0.4048 -0.0562 -0.1139 -0.0188 178 LYS A NZ    
408  N N     . TYR A 51  ? 0.4714 0.1805 0.2354 -0.0117 -0.0560 -0.0277 179 TYR A N     
409  C CA    . TYR A 51  ? 0.4454 0.1646 0.2277 -0.0156 -0.0525 -0.0208 179 TYR A CA    
410  C C     . TYR A 51  ? 0.4677 0.1726 0.2426 -0.0096 -0.0497 -0.0228 179 TYR A C     
411  O O     . TYR A 51  ? 0.4714 0.1815 0.2572 -0.0118 -0.0467 -0.0172 179 TYR A O     
412  C CB    . TYR A 51  ? 0.4057 0.1507 0.2046 -0.0145 -0.0442 -0.0156 179 TYR A CB    
413  C CG    . TYR A 51  ? 0.3996 0.1566 0.2082 -0.0210 -0.0489 -0.0120 179 TYR A CG    
414  C CD1   . TYR A 51  ? 0.4136 0.1736 0.2346 -0.0310 -0.0559 -0.0068 179 TYR A CD1   
415  C CD2   . TYR A 51  ? 0.4198 0.1845 0.2243 -0.0172 -0.0474 -0.0135 179 TYR A CD2   
416  C CE1   . TYR A 51  ? 0.4318 0.2046 0.2633 -0.0360 -0.0614 -0.0035 179 TYR A CE1   
417  C CE2   . TYR A 51  ? 0.4204 0.1948 0.2330 -0.0218 -0.0531 -0.0101 179 TYR A CE2   
418  C CZ    . TYR A 51  ? 0.4402 0.2198 0.2671 -0.0305 -0.0602 -0.0053 179 TYR A CZ    
419  O OH    . TYR A 51  ? 0.4395 0.2318 0.2769 -0.0340 -0.0663 -0.0016 179 TYR A OH    
420  N N     . SER A 52  ? 0.4848 0.1703 0.2399 -0.0018 -0.0512 -0.0304 180 SER A N     
421  C CA    . SER A 52  ? 0.5046 0.1752 0.2514 0.0067  -0.0490 -0.0327 180 SER A CA    
422  C C     . SER A 52  ? 0.4985 0.1887 0.2607 0.0109  -0.0402 -0.0277 180 SER A C     
423  O O     . SER A 52  ? 0.4912 0.1760 0.2573 0.0096  -0.0409 -0.0234 180 SER A O     
424  C CB    . SER A 52  ? 0.5192 0.1624 0.2573 -0.0008 -0.0594 -0.0322 180 SER A CB    
425  O OG    . SER A 52  ? 0.5674 0.1909 0.2887 -0.0043 -0.0687 -0.0379 180 SER A OG    
426  N N     . VAL A 53  ? 0.4439 0.1566 0.2145 0.0146  -0.0326 -0.0274 181 VAL A N     
427  C CA    . VAL A 53  ? 0.4337 0.1655 0.2186 0.0163  -0.0259 -0.0226 181 VAL A CA    
428  C C     . VAL A 53  ? 0.4306 0.1568 0.2131 0.0252  -0.0242 -0.0232 181 VAL A C     
429  O O     . VAL A 53  ? 0.4520 0.1655 0.2227 0.0347  -0.0247 -0.0287 181 VAL A O     
430  C CB    . VAL A 53  ? 0.4143 0.1674 0.2056 0.0185  -0.0191 -0.0229 181 VAL A CB    
431  C CG1   . VAL A 53  ? 0.4096 0.1670 0.2024 0.0111  -0.0214 -0.0216 181 VAL A CG1   
432  C CG2   . VAL A 53  ? 0.4371 0.1926 0.2208 0.0289  -0.0140 -0.0284 181 VAL A CG2   
433  N N     . THR A 54  ? 0.4167 0.1496 0.2088 0.0224  -0.0230 -0.0171 182 THR A N     
434  C CA    . THR A 54  ? 0.4030 0.1355 0.1946 0.0315  -0.0215 -0.0171 182 THR A CA    
435  C C     . THR A 54  ? 0.3769 0.1294 0.1747 0.0396  -0.0156 -0.0198 182 THR A C     
436  O O     . THR A 54  ? 0.4040 0.1569 0.2007 0.0504  -0.0149 -0.0219 182 THR A O     
437  C CB    . THR A 54  ? 0.3880 0.1219 0.1852 0.0271  -0.0219 -0.0098 182 THR A CB    
438  O OG1   . THR A 54  ? 0.3765 0.1313 0.1847 0.0227  -0.0173 -0.0070 182 THR A OG1   
439  C CG2   . THR A 54  ? 0.4140 0.1315 0.2076 0.0173  -0.0265 -0.0054 182 THR A CG2   
440  N N     . PHE A 55  ? 0.3925 0.1625 0.1983 0.0345  -0.0117 -0.0188 183 PHE A N     
441  C CA    . PHE A 55  ? 0.3837 0.1729 0.1966 0.0389  -0.0065 -0.0200 183 PHE A CA    
442  C C     . PHE A 55  ? 0.3682 0.1672 0.1832 0.0320  -0.0034 -0.0197 183 PHE A C     
443  O O     . PHE A 55  ? 0.3694 0.1660 0.1856 0.0242  -0.0053 -0.0169 183 PHE A O     
444  C CB    . PHE A 55  ? 0.3919 0.1930 0.2146 0.0380  -0.0063 -0.0156 183 PHE A CB    
445  C CG    . PHE A 55  ? 0.3833 0.2055 0.2154 0.0397  -0.0022 -0.0161 183 PHE A CG    
446  C CD1   . PHE A 55  ? 0.3919 0.2234 0.2282 0.0490  -0.0008 -0.0183 183 PHE A CD1   
447  C CD2   . PHE A 55  ? 0.3542 0.1866 0.1908 0.0317  0.0001  -0.0141 183 PHE A CD2   
448  C CE1   . PHE A 55  ? 0.4006 0.2543 0.2484 0.0487  0.0029  -0.0177 183 PHE A CE1   
449  C CE2   . PHE A 55  ? 0.3760 0.2257 0.2207 0.0312  0.0030  -0.0139 183 PHE A CE2   
450  C CZ    . PHE A 55  ? 0.3489 0.2110 0.2005 0.0389  0.0045  -0.0153 183 PHE A CZ    
451  N N     . ILE A 56  ? 0.3918 0.2013 0.2069 0.0356  0.0014  -0.0223 184 ILE A N     
452  C CA    . ILE A 56  ? 0.3717 0.1901 0.1875 0.0294  0.0047  -0.0212 184 ILE A CA    
453  C C     . ILE A 56  ? 0.3600 0.1969 0.1830 0.0314  0.0108  -0.0208 184 ILE A C     
454  O O     . ILE A 56  ? 0.3593 0.2020 0.1831 0.0396  0.0141  -0.0233 184 ILE A O     
455  C CB    . ILE A 56  ? 0.3805 0.1869 0.1833 0.0283  0.0033  -0.0241 184 ILE A CB    
456  C CG1   . ILE A 56  ? 0.3716 0.1848 0.1732 0.0225  0.0057  -0.0221 184 ILE A CG1   
457  C CG2   . ILE A 56  ? 0.3951 0.1937 0.1866 0.0375  0.0051  -0.0298 184 ILE A CG2   
458  C CD1   . ILE A 56  ? 0.3886 0.1893 0.1793 0.0193  0.0009  -0.0232 184 ILE A CD1   
459  N N     . SER A 57  ? 0.3540 0.1997 0.1814 0.0239  0.0125  -0.0174 185 SER A N     
460  C CA    . SER A 57  ? 0.3549 0.2178 0.1898 0.0227  0.0177  -0.0159 185 SER A CA    
461  C C     . SER A 57  ? 0.3531 0.2145 0.1821 0.0152  0.0198  -0.0137 185 SER A C     
462  O O     . SER A 57  ? 0.3562 0.2064 0.1800 0.0111  0.0159  -0.0125 185 SER A O     
463  C CB    . SER A 57  ? 0.3405 0.2143 0.1878 0.0203  0.0154  -0.0132 185 SER A CB    
464  O OG    . SER A 57  ? 0.3354 0.2004 0.1808 0.0145  0.0111  -0.0110 185 SER A OG    
465  N N     . ARG A 58  ? 0.3567 0.2291 0.1859 0.0146  0.0262  -0.0129 186 ARG A N     
466  C CA    . ARG A 58  ? 0.3464 0.2171 0.1684 0.0075  0.0289  -0.0098 186 ARG A CA    
467  C C     . ARG A 58  ? 0.3373 0.2229 0.1703 0.0003  0.0317  -0.0055 186 ARG A C     
468  O O     . ARG A 58  ? 0.3419 0.2458 0.1866 0.0028  0.0358  -0.0053 186 ARG A O     
469  C CB    . ARG A 58  ? 0.3459 0.2132 0.1542 0.0115  0.0343  -0.0117 186 ARG A CB    
470  C CG    . ARG A 58  ? 0.3550 0.2180 0.1533 0.0042  0.0366  -0.0076 186 ARG A CG    
471  C CD    . ARG A 58  ? 0.3987 0.2523 0.1777 0.0085  0.0397  -0.0098 186 ARG A CD    
472  N NE    . ARG A 58  ? 0.4437 0.3085 0.2203 0.0150  0.0491  -0.0116 186 ARG A NE    
473  C CZ    . ARG A 58  ? 0.4497 0.3236 0.2207 0.0128  0.0587  -0.0080 186 ARG A CZ    
474  N NH1   . ARG A 58  ? 0.4443 0.3172 0.2124 0.0026  0.0597  -0.0016 186 ARG A NH1   
475  N NH2   . ARG A 58  ? 0.4402 0.3251 0.2092 0.0210  0.0679  -0.0102 186 ARG A NH2   
476  N N     . HIS A 59  ? 0.3358 0.2139 0.1652 -0.0083 0.0292  -0.0020 187 HIS A N     
477  C CA    . HIS A 59  ? 0.3324 0.2191 0.1706 -0.0170 0.0288  0.0018  187 HIS A CA    
478  C C     . HIS A 59  ? 0.3509 0.2310 0.1794 -0.0256 0.0315  0.0064  187 HIS A C     
479  O O     . HIS A 59  ? 0.3319 0.1951 0.1465 -0.0250 0.0297  0.0065  187 HIS A O     
480  C CB    . HIS A 59  ? 0.3427 0.2204 0.1827 -0.0191 0.0212  0.0015  187 HIS A CB    
481  C CG    . HIS A 59  ? 0.3516 0.2317 0.1979 -0.0117 0.0178  -0.0018 187 HIS A CG    
482  N ND1   . HIS A 59  ? 0.3571 0.2503 0.2156 -0.0114 0.0156  -0.0017 187 HIS A ND1   
483  C CD2   . HIS A 59  ? 0.3809 0.2517 0.2227 -0.0045 0.0160  -0.0047 187 HIS A CD2   
484  C CE1   . HIS A 59  ? 0.3676 0.2581 0.2272 -0.0033 0.0130  -0.0044 187 HIS A CE1   
485  N NE2   . HIS A 59  ? 0.3535 0.2297 0.2030 0.0000  0.0132  -0.0060 187 HIS A NE2   
486  N N     A ASN A 60  ? 0.3526 0.2464 0.1890 -0.0338 0.0353  0.0106  188 ASN A N     
487  N N     B ASN A 60  ? 0.3635 0.2572 0.1998 -0.0338 0.0353  0.0106  188 ASN A N     
488  C CA    A ASN A 60  ? 0.3749 0.2601 0.2026 -0.0448 0.0363  0.0161  188 ASN A CA    
489  C CA    B ASN A 60  ? 0.3963 0.2810 0.2234 -0.0445 0.0365  0.0161  188 ASN A CA    
490  C C     A ASN A 60  ? 0.3946 0.2605 0.2160 -0.0502 0.0279  0.0167  188 ASN A C     
491  C C     B ASN A 60  ? 0.4084 0.2745 0.2299 -0.0505 0.0281  0.0168  188 ASN A C     
492  O O     A ASN A 60  ? 0.3910 0.2592 0.2209 -0.0510 0.0224  0.0148  188 ASN A O     
493  O O     B ASN A 60  ? 0.4052 0.2737 0.2353 -0.0511 0.0225  0.0148  188 ASN A O     
494  C CB    A ASN A 60  ? 0.3873 0.2944 0.2299 -0.0545 0.0409  0.0211  188 ASN A CB    
495  C CB    B ASN A 60  ? 0.4337 0.3396 0.2719 -0.0534 0.0435  0.0214  188 ASN A CB    
496  C CG    A ASN A 60  ? 0.3985 0.3273 0.2471 -0.0502 0.0518  0.0222  188 ASN A CG    
497  C CG    B ASN A 60  ? 0.4806 0.3784 0.3040 -0.0603 0.0497  0.0272  188 ASN A CG    
498  O OD1   A ASN A 60  ? 0.4052 0.3275 0.2391 -0.0486 0.0583  0.0237  188 ASN A OD1   
499  O OD1   B ASN A 60  ? 0.5056 0.3792 0.3108 -0.0609 0.0461  0.0279  188 ASN A OD1   
500  N ND2   A ASN A 60  ? 0.4081 0.3632 0.2776 -0.0480 0.0541  0.0219  188 ASN A ND2   
501  N ND2   B ASN A 60  ? 0.5168 0.4353 0.3474 -0.0638 0.0595  0.0315  188 ASN A ND2   
502  N N     . SER A 61  ? 0.4392 0.2850 0.2441 -0.0534 0.0269  0.0194  189 SER A N     
503  C CA    . SER A 61  ? 0.4343 0.2585 0.2298 -0.0569 0.0197  0.0199  189 SER A CA    
504  C C     . SER A 61  ? 0.4746 0.2847 0.2558 -0.0657 0.0215  0.0260  189 SER A C     
505  O O     . SER A 61  ? 0.4887 0.2829 0.2548 -0.0611 0.0211  0.0269  189 SER A O     
506  C CB    . SER A 61  ? 0.4442 0.2545 0.2325 -0.0460 0.0154  0.0158  189 SER A CB    
507  O OG    . SER A 61  ? 0.5340 0.3228 0.3116 -0.0474 0.0097  0.0162  189 SER A OG    
508  N N     . TYR A 62  ? 0.5069 0.3243 0.2939 -0.0786 0.0230  0.0307  190 TYR A N     
509  C CA    . TYR A 62  ? 0.5813 0.3867 0.3561 -0.0902 0.0253  0.0381  190 TYR A CA    
510  C C     . TYR A 62  ? 0.6275 0.4378 0.3940 -0.0851 0.0338  0.0404  190 TYR A C     
511  O O     . TYR A 62  ? 0.6121 0.4465 0.3901 -0.0803 0.0409  0.0388  190 TYR A O     
512  C CB    . TYR A 62  ? 0.6287 0.4000 0.3845 -0.0923 0.0168  0.0387  190 TYR A CB    
513  C CG    . TYR A 62  ? 0.6887 0.4499 0.4469 -0.0938 0.0077  0.0344  190 TYR A CG    
514  C CD1   . TYR A 62  ? 0.7673 0.5246 0.5277 -0.1087 0.0032  0.0373  190 TYR A CD1   
515  C CD2   . TYR A 62  ? 0.7805 0.5346 0.5370 -0.0804 0.0034  0.0276  190 TYR A CD2   
516  C CE1   . TYR A 62  ? 0.7691 0.5136 0.5269 -0.1096 -0.0059 0.0328  190 TYR A CE1   
517  C CE2   . TYR A 62  ? 0.8386 0.5820 0.5933 -0.0805 -0.0038 0.0235  190 TYR A CE2   
518  C CZ    . TYR A 62  ? 0.7957 0.5327 0.5494 -0.0948 -0.0090 0.0257  190 TYR A CZ    
519  O OH    . TYR A 62  ? 0.8113 0.5335 0.5587 -0.0953 -0.0174 0.0212  190 TYR A OH    
520  N N     . ASN A 63  ? 0.6308 0.4176 0.3760 -0.0840 0.0326  0.0435  191 ASN A N     
521  C CA    . ASN A 63  ? 0.6696 0.4571 0.4022 -0.0783 0.0390  0.0452  191 ASN A CA    
522  C C     . ASN A 63  ? 0.6132 0.4060 0.3474 -0.0631 0.0376  0.0378  191 ASN A C     
523  O O     . ASN A 63  ? 0.6493 0.4479 0.3766 -0.0582 0.0430  0.0374  191 ASN A O     
524  C CB    . ASN A 63  ? 0.7144 0.4736 0.4213 -0.0820 0.0370  0.0519  191 ASN A CB    
525  C CG    . ASN A 63  ? 0.7922 0.5238 0.4886 -0.0775 0.0261  0.0501  191 ASN A CG    
526  O OD1   . ASN A 63  ? 0.7593 0.4921 0.4666 -0.0722 0.0206  0.0442  191 ASN A OD1   
527  N ND2   . ASN A 63  ? 0.7956 0.5009 0.4694 -0.0795 0.0235  0.0561  191 ASN A ND2   
528  N N     . HIS A 64  ? 0.4730 0.2646 0.2162 -0.0562 0.0308  0.0318  192 HIS A N     
529  C CA    . HIS A 64  ? 0.4536 0.2461 0.1971 -0.0443 0.0279  0.0261  192 HIS A CA    
530  C C     . HIS A 64  ? 0.4249 0.2377 0.1873 -0.0400 0.0295  0.0206  192 HIS A C     
531  O O     . HIS A 64  ? 0.4476 0.2763 0.2225 -0.0452 0.0337  0.0215  192 HIS A O     
532  C CB    . HIS A 64  ? 0.4483 0.2228 0.1858 -0.0386 0.0194  0.0248  192 HIS A CB    
533  C CG    . HIS A 64  ? 0.4845 0.2377 0.2027 -0.0401 0.0166  0.0300  192 HIS A CG    
534  N ND1   . HIS A 64  ? 0.5231 0.2715 0.2261 -0.0400 0.0191  0.0334  192 HIS A ND1   
535  C CD2   . HIS A 64  ? 0.5133 0.2467 0.2230 -0.0409 0.0113  0.0325  192 HIS A CD2   
536  C CE1   . HIS A 64  ? 0.5718 0.2985 0.2581 -0.0412 0.0151  0.0384  192 HIS A CE1   
537  N NE2   . HIS A 64  ? 0.5126 0.2296 0.2031 -0.0412 0.0102  0.0377  192 HIS A NE2   
538  N N     . ASN A 65  ? 0.4246 0.2371 0.1886 -0.0307 0.0261  0.0155  193 ASN A N     
539  C CA    . ASN A 65  ? 0.3889 0.2159 0.1680 -0.0256 0.0265  0.0105  193 ASN A CA    
540  C C     . ASN A 65  ? 0.3846 0.2055 0.1683 -0.0204 0.0197  0.0073  193 ASN A C     
541  O O     . ASN A 65  ? 0.4137 0.2224 0.1897 -0.0177 0.0152  0.0078  193 ASN A O     
542  C CB    . ASN A 65  ? 0.3862 0.2186 0.1605 -0.0191 0.0304  0.0073  193 ASN A CB    
543  C CG    . ASN A 65  ? 0.4098 0.2581 0.1866 -0.0205 0.0401  0.0086  193 ASN A CG    
544  O OD1   . ASN A 65  ? 0.4284 0.2804 0.2009 -0.0131 0.0436  0.0048  193 ASN A OD1   
545  N ND2   . ASN A 65  ? 0.4082 0.2643 0.1893 -0.0292 0.0446  0.0139  193 ASN A ND2   
546  N N     . ILE A 66  ? 0.3534 0.1844 0.1503 -0.0179 0.0192  0.0042  194 ILE A N     
547  C CA    . ILE A 66  ? 0.3541 0.1812 0.1553 -0.0130 0.0143  0.0017  194 ILE A CA    
548  C C     . ILE A 66  ? 0.3552 0.1904 0.1628 -0.0075 0.0151  -0.0022 194 ILE A C     
549  O O     . ILE A 66  ? 0.3312 0.1781 0.1451 -0.0070 0.0189  -0.0032 194 ILE A O     
550  C CB    . ILE A 66  ? 0.3682 0.1934 0.1747 -0.0153 0.0117  0.0023  194 ILE A CB    
551  C CG1   . ILE A 66  ? 0.3867 0.1981 0.1832 -0.0189 0.0100  0.0053  194 ILE A CG1   
552  C CG2   . ILE A 66  ? 0.3564 0.1809 0.1681 -0.0098 0.0088  0.0002  194 ILE A CG2   
553  C CD1   . ILE A 66  ? 0.3915 0.1979 0.1884 -0.0224 0.0076  0.0055  194 ILE A CD1   
554  N N     . LEU A 67  ? 0.3271 0.1562 0.1331 -0.0035 0.0114  -0.0040 195 LEU A N     
555  C CA    . LEU A 67  ? 0.3670 0.1980 0.1773 0.0012  0.0103  -0.0074 195 LEU A CA    
556  C C     . LEU A 67  ? 0.3578 0.1883 0.1761 0.0015  0.0073  -0.0067 195 LEU A C     
557  O O     . LEU A 67  ? 0.3543 0.1803 0.1726 0.0004  0.0050  -0.0046 195 LEU A O     
558  C CB    . LEU A 67  ? 0.3827 0.2052 0.1847 0.0037  0.0070  -0.0097 195 LEU A CB    
559  C CG    . LEU A 67  ? 0.4121 0.2316 0.2008 0.0045  0.0097  -0.0109 195 LEU A CG    
560  C CD1   . LEU A 67  ? 0.4343 0.2424 0.2139 0.0060  0.0032  -0.0132 195 LEU A CD1   
561  C CD2   . LEU A 67  ? 0.4295 0.2566 0.2181 0.0085  0.0160  -0.0134 195 LEU A CD2   
562  N N     . PHE A 68  ? 0.3435 0.1778 0.1672 0.0044  0.0074  -0.0083 196 PHE A N     
563  C CA    . PHE A 68  ? 0.3431 0.1758 0.1719 0.0052  0.0050  -0.0073 196 PHE A CA    
564  C C     . PHE A 68  ? 0.3411 0.1689 0.1692 0.0091  0.0031  -0.0095 196 PHE A C     
565  O O     . PHE A 68  ? 0.3578 0.1881 0.1849 0.0129  0.0046  -0.0121 196 PHE A O     
566  C CB    . PHE A 68  ? 0.3627 0.2027 0.1963 0.0048  0.0058  -0.0068 196 PHE A CB    
567  C CG    . PHE A 68  ? 0.3467 0.1840 0.1824 0.0068  0.0034  -0.0058 196 PHE A CG    
568  C CD1   . PHE A 68  ? 0.3426 0.1798 0.1803 0.0115  0.0020  -0.0071 196 PHE A CD1   
569  C CD2   . PHE A 68  ? 0.3376 0.1702 0.1709 0.0050  0.0027  -0.0036 196 PHE A CD2   
570  C CE1   . PHE A 68  ? 0.3548 0.1872 0.1919 0.0131  -0.0005 -0.0053 196 PHE A CE1   
571  C CE2   . PHE A 68  ? 0.3369 0.1661 0.1694 0.0069  0.0013  -0.0022 196 PHE A CE2   
572  C CZ    . PHE A 68  ? 0.3327 0.1611 0.1668 0.0104  -0.0004 -0.0026 196 PHE A CZ    
573  N N     . PHE A 69  ? 0.3334 0.1544 0.1620 0.0080  0.0000  -0.0081 197 PHE A N     
574  C CA    . PHE A 69  ? 0.3508 0.1630 0.1770 0.0102  -0.0030 -0.0097 197 PHE A CA    
575  C C     . PHE A 69  ? 0.3839 0.1916 0.2136 0.0079  -0.0051 -0.0060 197 PHE A C     
576  O O     . PHE A 69  ? 0.3432 0.1548 0.1773 0.0046  -0.0042 -0.0023 197 PHE A O     
577  C CB    . PHE A 69  ? 0.3418 0.1465 0.1603 0.0101  -0.0055 -0.0128 197 PHE A CB    
578  C CG    . PHE A 69  ? 0.3514 0.1561 0.1706 0.0052  -0.0082 -0.0108 197 PHE A CG    
579  C CD1   . PHE A 69  ? 0.3476 0.1583 0.1651 0.0045  -0.0058 -0.0101 197 PHE A CD1   
580  C CD2   . PHE A 69  ? 0.3592 0.1590 0.1815 0.0009  -0.0134 -0.0087 197 PHE A CD2   
581  C CE1   . PHE A 69  ? 0.3884 0.1989 0.2060 0.0016  -0.0091 -0.0080 197 PHE A CE1   
582  C CE2   . PHE A 69  ? 0.3602 0.1634 0.1856 -0.0028 -0.0166 -0.0065 197 PHE A CE2   
583  C CZ    . PHE A 69  ? 0.3640 0.1724 0.1870 -0.0015 -0.0145 -0.0062 197 PHE A CZ    
584  N N     . LEU A 70  ? 0.3902 0.1889 0.2168 0.0104  -0.0074 -0.0068 198 LEU A N     
585  C CA    . LEU A 70  ? 0.4099 0.2013 0.2372 0.0081  -0.0093 -0.0030 198 LEU A CA    
586  C C     . LEU A 70  ? 0.3991 0.1759 0.2215 0.0055  -0.0144 -0.0039 198 LEU A C     
587  O O     . LEU A 70  ? 0.3765 0.1448 0.1911 0.0099  -0.0165 -0.0090 198 LEU A O     
588  C CB    . LEU A 70  ? 0.4267 0.2168 0.2522 0.0133  -0.0088 -0.0023 198 LEU A CB    
589  C CG    . LEU A 70  ? 0.3890 0.1905 0.2179 0.0141  -0.0058 -0.0007 198 LEU A CG    
590  C CD1   . LEU A 70  ? 0.3728 0.1781 0.2015 0.0205  -0.0068 -0.0026 198 LEU A CD1   
591  C CD2   . LEU A 70  ? 0.3887 0.1885 0.2173 0.0104  -0.0043 0.0048  198 LEU A CD2   
592  N N     . THR A 71  ? 0.4025 0.1769 0.2292 -0.0021 -0.0166 0.0008  199 THR A N     
593  C CA    . THR A 71  ? 0.4224 0.1822 0.2449 -0.0072 -0.0232 0.0003  199 THR A CA    
594  C C     . THR A 71  ? 0.4150 0.1616 0.2351 -0.0105 -0.0251 0.0049  199 THR A C     
595  O O     . THR A 71  ? 0.4290 0.1811 0.2529 -0.0109 -0.0209 0.0104  199 THR A O     
596  C CB    . THR A 71  ? 0.4240 0.1923 0.2556 -0.0155 -0.0258 0.0031  199 THR A CB    
597  O OG1   . THR A 71  ? 0.4019 0.1848 0.2453 -0.0184 -0.0207 0.0098  199 THR A OG1   
598  C CG2   . THR A 71  ? 0.4117 0.1882 0.2420 -0.0123 -0.0254 -0.0012 199 THR A CG2   
599  N N     . PRO A 72  ? 0.4483 0.1735 0.2582 -0.0123 -0.0320 0.0026  200 PRO A N     
600  C CA    . PRO A 72  ? 0.4538 0.1622 0.2587 -0.0159 -0.0347 0.0073  200 PRO A CA    
601  C C     . PRO A 72  ? 0.4676 0.1804 0.2831 -0.0291 -0.0351 0.0163  200 PRO A C     
602  O O     . PRO A 72  ? 0.4715 0.1747 0.2842 -0.0326 -0.0346 0.0225  200 PRO A O     
603  C CB    . PRO A 72  ? 0.4768 0.1587 0.2660 -0.0140 -0.0427 0.0010  200 PRO A CB    
604  C CG    . PRO A 72  ? 0.4781 0.1651 0.2671 -0.0149 -0.0452 -0.0047 200 PRO A CG    
605  C CD    . PRO A 72  ? 0.4598 0.1734 0.2595 -0.0100 -0.0373 -0.0050 200 PRO A CD    
606  N N     A HIS A 73  ? 0.4529 0.1790 0.2798 -0.0368 -0.0369 0.0173  201 HIS A N     
607  N N     B HIS A 73  ? 0.4670 0.1936 0.2943 -0.0368 -0.0365 0.0178  201 HIS A N     
608  C CA    A HIS A 73  ? 0.4553 0.1954 0.2982 -0.0484 -0.0359 0.0261  201 HIS A CA    
609  C CA    B HIS A 73  ? 0.4919 0.2321 0.3343 -0.0475 -0.0337 0.0276  201 HIS A CA    
610  C C     A HIS A 73  ? 0.4575 0.2261 0.3152 -0.0457 -0.0297 0.0271  201 HIS A C     
611  C C     B HIS A 73  ? 0.4725 0.2397 0.3293 -0.0455 -0.0292 0.0276  201 HIS A C     
612  O O     A HIS A 73  ? 0.4715 0.2443 0.3248 -0.0370 -0.0284 0.0205  201 HIS A O     
613  O O     B HIS A 73  ? 0.4526 0.2228 0.3045 -0.0371 -0.0286 0.0206  201 HIS A O     
614  C CB    A HIS A 73  ? 0.4923 0.2201 0.3368 -0.0617 -0.0461 0.0282  201 HIS A CB    
615  C CB    B HIS A 73  ? 0.5639 0.2896 0.4073 -0.0613 -0.0421 0.0321  201 HIS A CB    
616  C CG    A HIS A 73  ? 0.5303 0.2551 0.3726 -0.0635 -0.0552 0.0214  201 HIS A CG    
617  C CG    B HIS A 73  ? 0.6119 0.3053 0.4350 -0.0594 -0.0512 0.0252  201 HIS A CG    
618  N ND1   A HIS A 73  ? 0.5443 0.2902 0.4036 -0.0704 -0.0577 0.0243  201 HIS A ND1   
619  N ND1   B HIS A 73  ? 0.6468 0.3147 0.4607 -0.0677 -0.0575 0.0288  201 HIS A ND1   
620  C CD2   A HIS A 73  ? 0.5382 0.2385 0.3620 -0.0610 -0.0638 0.0128  201 HIS A CD2   
621  C CD2   B HIS A 73  ? 0.6376 0.3190 0.4461 -0.0484 -0.0540 0.0148  201 HIS A CD2   
622  C CE1   A HIS A 73  ? 0.5614 0.2964 0.4120 -0.0717 -0.0678 0.0176  201 HIS A CE1   
623  C CE1   B HIS A 73  ? 0.6444 0.2843 0.4381 -0.0613 -0.0647 0.0203  201 HIS A CE1   
624  N NE2   A HIS A 73  ? 0.5810 0.2880 0.4090 -0.0658 -0.0709 0.0102  201 HIS A NE2   
625  N NE2   B HIS A 73  ? 0.5819 0.2310 0.3725 -0.0492 -0.0620 0.0117  201 HIS A NE2   
626  N N     . ARG A 74  ? 0.4390 0.2252 0.3125 -0.0522 -0.0253 0.0355  202 ARG A N     
627  C CA    . ARG A 74  ? 0.4113 0.2221 0.2969 -0.0473 -0.0188 0.0366  202 ARG A CA    
628  C C     . ARG A 74  ? 0.3911 0.2134 0.2884 -0.0518 -0.0255 0.0357  202 ARG A C     
629  O O     . ARG A 74  ? 0.3787 0.1958 0.2806 -0.0623 -0.0345 0.0374  202 ARG A O     
630  C CB    . ARG A 74  ? 0.4485 0.2744 0.3443 -0.0490 -0.0091 0.0457  202 ARG A CB    
631  C CG    . ARG A 74  ? 0.4991 0.3120 0.3800 -0.0438 -0.0035 0.0464  202 ARG A CG    
632  C CD    . ARG A 74  ? 0.5989 0.4208 0.4844 -0.0466 0.0056  0.0560  202 ARG A CD    
633  N NE    . ARG A 74  ? 0.6253 0.4668 0.5170 -0.0392 0.0146  0.0568  202 ARG A NE    
634  C CZ    . ARG A 74  ? 0.8239 0.6734 0.7145 -0.0366 0.0252  0.0632  202 ARG A CZ    
635  N NH1   . ARG A 74  ? 0.9158 0.7562 0.7994 -0.0417 0.0285  0.0702  202 ARG A NH1   
636  N NH2   . ARG A 74  ? 0.7157 0.5806 0.6097 -0.0282 0.0328  0.0626  202 ARG A NH2   
637  N N     . HIS A 75  ? 0.3537 0.1894 0.2543 -0.0439 -0.0224 0.0330  203 HIS A N     
638  C CA    . HIS A 75  ? 0.3953 0.2438 0.3062 -0.0452 -0.0282 0.0326  203 HIS A CA    
639  C C     . HIS A 75  ? 0.3698 0.2398 0.2920 -0.0380 -0.0204 0.0359  203 HIS A C     
640  O O     . HIS A 75  ? 0.3766 0.2468 0.2925 -0.0301 -0.0114 0.0353  203 HIS A O     
641  C CB    . HIS A 75  ? 0.3730 0.2075 0.2677 -0.0404 -0.0342 0.0236  203 HIS A CB    
642  C CG    . HIS A 75  ? 0.3994 0.2101 0.2785 -0.0434 -0.0404 0.0186  203 HIS A CG    
643  N ND1   . HIS A 75  ? 0.4408 0.2411 0.3182 -0.0522 -0.0517 0.0175  203 HIS A ND1   
644  C CD2   . HIS A 75  ? 0.4130 0.2073 0.2771 -0.0383 -0.0374 0.0144  203 HIS A CD2   
645  C CE1   . HIS A 75  ? 0.4645 0.2404 0.3242 -0.0516 -0.0550 0.0124  203 HIS A CE1   
646  N NE2   . HIS A 75  ? 0.4517 0.2249 0.3040 -0.0425 -0.0460 0.0105  203 HIS A NE2   
647  N N     . ARG A 76  ? 0.3722 0.2599 0.3110 -0.0404 -0.0247 0.0394  204 ARG A N     
648  C CA    . ARG A 76  ? 0.3582 0.2623 0.3044 -0.0310 -0.0197 0.0407  204 ARG A CA    
649  C C     . ARG A 76  ? 0.3502 0.2421 0.2795 -0.0229 -0.0215 0.0333  204 ARG A C     
650  O O     . ARG A 76  ? 0.3390 0.2182 0.2578 -0.0255 -0.0301 0.0283  204 ARG A O     
651  C CB    . ARG A 76  ? 0.4057 0.3328 0.3748 -0.0344 -0.0257 0.0463  204 ARG A CB    
652  C CG    . ARG A 76  ? 0.4548 0.4037 0.4479 -0.0421 -0.0226 0.0559  204 ARG A CG    
653  C CD    . ARG A 76  ? 0.5392 0.5120 0.5559 -0.0452 -0.0318 0.0605  204 ARG A CD    
654  N NE    . ARG A 76  ? 0.6533 0.6374 0.6722 -0.0307 -0.0284 0.0595  204 ARG A NE    
655  C CZ    . ARG A 76  ? 0.7418 0.7507 0.7781 -0.0217 -0.0190 0.0655  204 ARG A CZ    
656  N NH1   . ARG A 76  ? 0.8055 0.8358 0.8618 -0.0260 -0.0104 0.0740  204 ARG A NH1   
657  N NH2   . ARG A 76  ? 0.6549 0.6664 0.6873 -0.0075 -0.0177 0.0631  204 ARG A NH2   
658  N N     . VAL A 77  ? 0.3262 0.2220 0.2523 -0.0130 -0.0135 0.0331  205 VAL A N     
659  C CA    . VAL A 77  ? 0.3562 0.2410 0.2673 -0.0066 -0.0149 0.0275  205 VAL A CA    
660  C C     . VAL A 77  ? 0.3392 0.2274 0.2532 -0.0070 -0.0248 0.0272  205 VAL A C     
661  O O     . VAL A 77  ? 0.3456 0.2201 0.2445 -0.0069 -0.0295 0.0222  205 VAL A O     
662  C CB    . VAL A 77  ? 0.3483 0.2346 0.2549 0.0033  -0.0060 0.0278  205 VAL A CB    
663  C CG1   . VAL A 77  ? 0.3603 0.2355 0.2527 0.0086  -0.0084 0.0235  205 VAL A CG1   
664  C CG2   . VAL A 77  ? 0.3581 0.2366 0.2563 0.0036  0.0017  0.0268  205 VAL A CG2   
665  N N     . SER A 78  ? 0.3206 0.2282 0.2545 -0.0080 -0.0284 0.0328  206 SER A N     
666  C CA    . SER A 78  ? 0.3410 0.2531 0.2783 -0.0077 -0.0391 0.0332  206 SER A CA    
667  C C     . SER A 78  ? 0.3633 0.2622 0.2917 -0.0175 -0.0507 0.0293  206 SER A C     
668  O O     . SER A 78  ? 0.3627 0.2532 0.2796 -0.0162 -0.0589 0.0263  206 SER A O     
669  C CB    . SER A 78  ? 0.3375 0.2772 0.3022 -0.0073 -0.0408 0.0409  206 SER A CB    
670  O OG    . SER A 78  ? 0.3764 0.3262 0.3566 -0.0178 -0.0406 0.0451  206 SER A OG    
671  N N     . ALA A 79  ? 0.3566 0.2503 0.2863 -0.0263 -0.0510 0.0291  207 ALA A N     
672  C CA    . ALA A 79  ? 0.3666 0.2429 0.2839 -0.0342 -0.0609 0.0244  207 ALA A CA    
673  C C     . ALA A 79  ? 0.3605 0.2148 0.2514 -0.0289 -0.0588 0.0166  207 ALA A C     
674  O O     . ALA A 79  ? 0.4133 0.2542 0.2887 -0.0303 -0.0677 0.0119  207 ALA A O     
675  C CB    . ALA A 79  ? 0.3884 0.2608 0.3115 -0.0442 -0.0609 0.0264  207 ALA A CB    
676  N N     . ILE A 80  ? 0.3427 0.1933 0.2275 -0.0234 -0.0476 0.0152  208 ILE A N     
677  C CA    . ILE A 80  ? 0.3621 0.1963 0.2258 -0.0188 -0.0442 0.0089  208 ILE A CA    
678  C C     . ILE A 80  ? 0.3573 0.1912 0.2125 -0.0136 -0.0461 0.0080  208 ILE A C     
679  O O     . ILE A 80  ? 0.3760 0.1969 0.2131 -0.0128 -0.0498 0.0035  208 ILE A O     
680  C CB    . ILE A 80  ? 0.3557 0.1892 0.2176 -0.0146 -0.0332 0.0085  208 ILE A CB    
681  C CG1   . ILE A 80  ? 0.3826 0.2155 0.2516 -0.0191 -0.0311 0.0106  208 ILE A CG1   
682  C CG2   . ILE A 80  ? 0.3735 0.1942 0.2174 -0.0107 -0.0299 0.0027  208 ILE A CG2   
683  C CD1   . ILE A 80  ? 0.3970 0.2153 0.2582 -0.0245 -0.0381 0.0073  208 ILE A CD1   
684  N N     . ASN A 81  ? 0.3368 0.1839 0.2033 -0.0093 -0.0433 0.0127  209 ASN A N     
685  C CA    . ASN A 81  ? 0.3766 0.2213 0.2342 -0.0037 -0.0452 0.0129  209 ASN A CA    
686  C C     . ASN A 81  ? 0.3839 0.2255 0.2364 -0.0064 -0.0576 0.0124  209 ASN A C     
687  O O     . ASN A 81  ? 0.4090 0.2376 0.2419 -0.0046 -0.0604 0.0095  209 ASN A O     
688  C CB    . ASN A 81  ? 0.3528 0.2106 0.2234 0.0025  -0.0416 0.0179  209 ASN A CB    
689  C CG    . ASN A 81  ? 0.3710 0.2222 0.2299 0.0091  -0.0434 0.0186  209 ASN A CG    
690  O OD1   . ASN A 81  ? 0.3690 0.2060 0.2102 0.0105  -0.0391 0.0159  209 ASN A OD1   
691  N ND2   . ASN A 81  ? 0.3806 0.2424 0.2498 0.0130  -0.0501 0.0227  209 ASN A ND2   
692  N N     . ASN A 82  ? 0.4052 0.2587 0.2746 -0.0115 -0.0658 0.0155  210 ASN A N     
693  C CA    . ASN A 82  ? 0.4539 0.3045 0.3187 -0.0149 -0.0798 0.0150  210 ASN A CA    
694  C C     . ASN A 82  ? 0.4692 0.2973 0.3088 -0.0182 -0.0839 0.0080  210 ASN A C     
695  O O     . ASN A 82  ? 0.4600 0.2783 0.2825 -0.0165 -0.0913 0.0062  210 ASN A O     
696  C CB    . ASN A 82  ? 0.4685 0.3359 0.3570 -0.0224 -0.0886 0.0195  210 ASN A CB    
697  C CG    . ASN A 82  ? 0.5298 0.3964 0.4155 -0.0263 -0.1053 0.0195  210 ASN A CG    
698  O OD1   . ASN A 82  ? 0.5709 0.4286 0.4523 -0.0357 -0.1154 0.0168  210 ASN A OD1   
699  N ND2   . ASN A 82  ? 0.5657 0.4403 0.4534 -0.0190 -0.1094 0.0228  210 ASN A ND2   
700  N N     . TYR A 83  ? 0.4456 0.2646 0.2810 -0.0219 -0.0794 0.0043  211 TYR A N     
701  C CA    . TYR A 83  ? 0.4664 0.2631 0.2767 -0.0227 -0.0815 -0.0030 211 TYR A CA    
702  C C     . TYR A 83  ? 0.4787 0.2671 0.2690 -0.0152 -0.0739 -0.0056 211 TYR A C     
703  O O     . TYR A 83  ? 0.4668 0.2416 0.2353 -0.0139 -0.0790 -0.0091 211 TYR A O     
704  C CB    . TYR A 83  ? 0.4526 0.2416 0.2632 -0.0254 -0.0764 -0.0060 211 TYR A CB    
705  C CG    . TYR A 83  ? 0.4635 0.2306 0.2478 -0.0225 -0.0757 -0.0138 211 TYR A CG    
706  C CD1   . TYR A 83  ? 0.5157 0.2648 0.2831 -0.0262 -0.0875 -0.0187 211 TYR A CD1   
707  C CD2   . TYR A 83  ? 0.4570 0.2213 0.2331 -0.0156 -0.0632 -0.0165 211 TYR A CD2   
708  C CE1   . TYR A 83  ? 0.5329 0.2600 0.2729 -0.0214 -0.0859 -0.0267 211 TYR A CE1   
709  C CE2   . TYR A 83  ? 0.5247 0.2718 0.2781 -0.0112 -0.0612 -0.0234 211 TYR A CE2   
710  C CZ    . TYR A 83  ? 0.5224 0.2508 0.2574 -0.0131 -0.0715 -0.0285 211 TYR A CZ    
711  O OH    . TYR A 83  ? 0.5916 0.3028 0.3026 -0.0066 -0.0679 -0.0357 211 TYR A OH    
712  N N     . ALA A 84  ? 0.4511 0.2473 0.2481 -0.0109 -0.0621 -0.0034 212 ALA A N     
713  C CA    . ALA A 84  ? 0.4694 0.2589 0.2499 -0.0057 -0.0538 -0.0048 212 ALA A CA    
714  C C     . ALA A 84  ? 0.5008 0.2878 0.2710 -0.0031 -0.0584 -0.0021 212 ALA A C     
715  O O     . ALA A 84  ? 0.5913 0.3660 0.3390 -0.0014 -0.0573 -0.0044 212 ALA A O     
716  C CB    . ALA A 84  ? 0.4465 0.2442 0.2372 -0.0034 -0.0424 -0.0028 212 ALA A CB    
717  N N     . GLN A 85  ? 0.4662 0.2640 0.2511 -0.0024 -0.0643 0.0031  213 GLN A N     
718  C CA    . GLN A 85  ? 0.4914 0.2861 0.2669 0.0015  -0.0694 0.0065  213 GLN A CA    
719  C C     . GLN A 85  ? 0.4958 0.2794 0.2536 -0.0005 -0.0815 0.0041  213 GLN A C     
720  O O     . GLN A 85  ? 0.5342 0.3064 0.2710 0.0025  -0.0833 0.0049  213 GLN A O     
721  C CB    . GLN A 85  ? 0.4849 0.2953 0.2819 0.0048  -0.0734 0.0124  213 GLN A CB    
722  C CG    . GLN A 85  ? 0.4529 0.2720 0.2639 0.0084  -0.0624 0.0147  213 GLN A CG    
723  C CD    . GLN A 85  ? 0.4717 0.2797 0.2678 0.0132  -0.0552 0.0160  213 GLN A CD    
724  O OE1   . GLN A 85  ? 0.4746 0.2697 0.2510 0.0144  -0.0585 0.0167  213 GLN A OE1   
725  N NE2   . GLN A 85  ? 0.4375 0.2481 0.2404 0.0150  -0.0458 0.0164  213 GLN A NE2   
726  N N     . LYS A 86  ? 0.5014 0.2866 0.2660 -0.0060 -0.0907 0.0016  214 LYS A N     
727  C CA    . LYS A 86  ? 0.5455 0.3188 0.2924 -0.0084 -0.1050 -0.0009 214 LYS A CA    
728  C C     . LYS A 86  ? 0.5871 0.3384 0.3019 -0.0075 -0.1014 -0.0076 214 LYS A C     
729  O O     . LYS A 86  ? 0.5972 0.3345 0.2890 -0.0072 -0.1109 -0.0095 214 LYS A O     
730  C CB    . LYS A 86  ? 0.5942 0.3749 0.3580 -0.0162 -0.1183 -0.0010 214 LYS A CB    
731  C CG    . LYS A 86  ? 0.6542 0.4599 0.4495 -0.0166 -0.1242 0.0067  214 LYS A CG    
732  C CD    . LYS A 86  ? 0.7693 0.5838 0.5828 -0.0270 -0.1373 0.0072  214 LYS A CD    
733  C CE    . LYS A 86  ? 0.8791 0.7219 0.7245 -0.0275 -0.1461 0.0155  214 LYS A CE    
734  N NZ    . LYS A 86  ? 0.9194 0.7785 0.7922 -0.0389 -0.1534 0.0185  214 LYS A NZ    
735  N N     . LEU A 87  ? 0.5388 0.2872 0.2509 -0.0060 -0.0876 -0.0109 215 LEU A N     
736  C CA    . LEU A 87  ? 0.5749 0.3051 0.2581 -0.0035 -0.0828 -0.0173 215 LEU A CA    
737  C C     . LEU A 87  ? 0.5676 0.2889 0.2260 0.0010  -0.0788 -0.0156 215 LEU A C     
738  O O     . LEU A 87  ? 0.6047 0.3092 0.2347 0.0027  -0.0821 -0.0197 215 LEU A O     
739  C CB    . LEU A 87  ? 0.5398 0.2723 0.2282 -0.0016 -0.0690 -0.0204 215 LEU A CB    
740  C CG    . LEU A 87  ? 0.5454 0.2761 0.2442 -0.0047 -0.0716 -0.0243 215 LEU A CG    
741  C CD1   . LEU A 87  ? 0.5445 0.2809 0.2506 -0.0010 -0.0571 -0.0256 215 LEU A CD1   
742  C CD2   . LEU A 87  ? 0.5702 0.2791 0.2458 -0.0057 -0.0816 -0.0316 215 LEU A CD2   
743  N N     . CME A 88  ? 0.5787 0.3096 0.2462 0.0027  -0.0709 -0.0095 216 CME A N     
744  C CA    . CME A 88  ? 0.6299 0.3523 0.2752 0.0057  -0.0653 -0.0061 216 CME A CA    
745  C CB    . CME A 88  ? 0.6734 0.3999 0.3187 0.0064  -0.0476 -0.0057 216 CME A CB    
746  S SG    . CME A 88  ? 0.8103 0.5290 0.4377 0.0088  -0.0401 -0.0138 216 CME A SG    
747  S SD    . CME A 88  ? 0.8916 0.6273 0.5376 0.0092  -0.0201 -0.0133 216 CME A SD    
748  C CE    . CME A 88  ? 0.7526 0.4969 0.4241 0.0088  -0.0231 -0.0176 216 CME A CE    
749  C CZ    . CME A 88  ? 0.6966 0.4469 0.3881 0.0051  -0.0329 -0.0140 216 CME A CZ    
750  O OH    . CME A 88  ? 0.6529 0.4122 0.3562 0.0038  -0.0284 -0.0077 216 CME A OH    
751  C C     . CME A 88  ? 0.6200 0.3485 0.2763 0.0066  -0.0705 0.0012  216 CME A C     
752  O O     . CME A 88  ? 0.6263 0.3671 0.3051 0.0065  -0.0654 0.0042  216 CME A O     
753  N N     . THR A 89  ? 0.6123 0.3308 0.2511 0.0083  -0.0808 0.0040  217 THR A N     
754  C CA    . THR A 89  ? 0.6194 0.3426 0.2679 0.0112  -0.0880 0.0109  217 THR A CA    
755  C C     . THR A 89  ? 0.6394 0.3527 0.2723 0.0138  -0.0805 0.0169  217 THR A C     
756  O O     . THR A 89  ? 0.7749 0.4809 0.3978 0.0174  -0.0890 0.0219  217 THR A O     
757  C CB    . THR A 89  ? 0.6288 0.3482 0.2704 0.0120  -0.1066 0.0113  217 THR A CB    
758  O OG1   . THR A 89  ? 0.6486 0.3472 0.2529 0.0125  -0.1091 0.0096  217 THR A OG1   
759  C CG2   . THR A 89  ? 0.6350 0.3654 0.2967 0.0073  -0.1151 0.0067  217 THR A CG2   
760  N N     . PHE A 90  ? 0.6225 0.3346 0.2518 0.0115  -0.0653 0.0166  218 PHE A N     
761  C CA    . PHE A 90  ? 0.6139 0.3167 0.2313 0.0116  -0.0574 0.0231  218 PHE A CA    
762  C C     . PHE A 90  ? 0.5850 0.2982 0.2232 0.0090  -0.0459 0.0233  218 PHE A C     
763  O O     . PHE A 90  ? 0.5507 0.2759 0.2046 0.0070  -0.0409 0.0182  218 PHE A O     
764  C CB    . PHE A 90  ? 0.6448 0.3342 0.2314 0.0094  -0.0500 0.0235  218 PHE A CB    
765  C CG    . PHE A 90  ? 0.6391 0.3350 0.2259 0.0073  -0.0408 0.0167  218 PHE A CG    
766  C CD1   . PHE A 90  ? 0.6573 0.3497 0.2346 0.0092  -0.0478 0.0099  218 PHE A CD1   
767  C CD2   . PHE A 90  ? 0.6381 0.3425 0.2335 0.0039  -0.0259 0.0169  218 PHE A CD2   
768  C CE1   . PHE A 90  ? 0.6760 0.3719 0.2518 0.0092  -0.0390 0.0033  218 PHE A CE1   
769  C CE2   . PHE A 90  ? 0.6677 0.3797 0.2653 0.0039  -0.0175 0.0109  218 PHE A CE2   
770  C CZ    . PHE A 90  ? 0.6514 0.3582 0.2381 0.0074  -0.0235 0.0039  218 PHE A CZ    
771  N N     . SER A 91  ? 0.5995 0.3058 0.2360 0.0092  -0.0431 0.0291  219 SER A N     
772  C CA    . SER A 91  ? 0.5699 0.2812 0.2205 0.0060  -0.0336 0.0297  219 SER A CA    
773  C C     . SER A 91  ? 0.5498 0.2758 0.2281 0.0087  -0.0352 0.0266  219 SER A C     
774  O O     . SER A 91  ? 0.5227 0.2589 0.2136 0.0117  -0.0423 0.0236  219 SER A O     
775  C CB    . SER A 91  ? 0.5582 0.2739 0.2053 -0.0008 -0.0208 0.0279  219 SER A CB    
776  O OG    . SER A 91  ? 0.6253 0.3297 0.2464 -0.0031 -0.0174 0.0310  219 SER A OG    
777  N N     . PHE A 92  ? 0.4832 0.2099 0.1701 0.0066  -0.0283 0.0275  220 PHE A N     
778  C CA    . PHE A 92  ? 0.4514 0.1889 0.1602 0.0098  -0.0287 0.0253  220 PHE A CA    
779  C C     . PHE A 92  ? 0.4362 0.1898 0.1608 0.0071  -0.0252 0.0198  220 PHE A C     
780  O O     . PHE A 92  ? 0.4514 0.2069 0.1706 0.0026  -0.0198 0.0173  220 PHE A O     
781  C CB    . PHE A 92  ? 0.4531 0.1819 0.1618 0.0091  -0.0240 0.0276  220 PHE A CB    
782  C CG    . PHE A 92  ? 0.4278 0.1611 0.1407 0.0014  -0.0152 0.0254  220 PHE A CG    
783  C CD1   . PHE A 92  ? 0.4560 0.1850 0.1568 -0.0064 -0.0094 0.0272  220 PHE A CD1   
784  C CD2   . PHE A 92  ? 0.4218 0.1651 0.1514 0.0020  -0.0126 0.0220  220 PHE A CD2   
785  C CE1   . PHE A 92  ? 0.4430 0.1798 0.1512 -0.0134 -0.0020 0.0258  220 PHE A CE1   
786  C CE2   . PHE A 92  ? 0.4299 0.1776 0.1636 -0.0048 -0.0062 0.0204  220 PHE A CE2   
787  C CZ    . PHE A 92  ? 0.4317 0.1779 0.1565 -0.0124 -0.0013 0.0221  220 PHE A CZ    
788  N N     . LEU A 93  ? 0.4303 0.1945 0.1738 0.0106  -0.0270 0.0184  221 LEU A N     
789  C CA    . LEU A 93  ? 0.4029 0.1800 0.1616 0.0083  -0.0238 0.0142  221 LEU A CA    
790  C C     . LEU A 93  ? 0.4096 0.1949 0.1853 0.0123  -0.0235 0.0149  221 LEU A C     
791  O O     . LEU A 93  ? 0.4200 0.2111 0.2046 0.0174  -0.0293 0.0170  221 LEU A O     
792  C CB    . LEU A 93  ? 0.4277 0.2095 0.1870 0.0070  -0.0286 0.0111  221 LEU A CB    
793  C CG    . LEU A 93  ? 0.4259 0.2162 0.1962 0.0044  -0.0248 0.0068  221 LEU A CG    
794  C CD1   . LEU A 93  ? 0.4353 0.2213 0.1947 0.0026  -0.0272 0.0028  221 LEU A CD1   
795  C CD2   . LEU A 93  ? 0.4198 0.2212 0.2101 0.0055  -0.0274 0.0073  221 LEU A CD2   
796  N N     . ILE A 94  ? 0.3755 0.1631 0.1565 0.0103  -0.0169 0.0132  222 ILE A N     
797  C CA    . ILE A 94  ? 0.3855 0.1798 0.1797 0.0143  -0.0150 0.0135  222 ILE A CA    
798  C C     . ILE A 94  ? 0.3864 0.1920 0.1926 0.0110  -0.0126 0.0105  222 ILE A C     
799  O O     . ILE A 94  ? 0.3683 0.1726 0.1708 0.0066  -0.0091 0.0080  222 ILE A O     
800  C CB    . ILE A 94  ? 0.3938 0.1785 0.1817 0.0150  -0.0102 0.0136  222 ILE A CB    
801  C CG1   . ILE A 94  ? 0.4483 0.2155 0.2192 0.0159  -0.0120 0.0164  222 ILE A CG1   
802  C CG2   . ILE A 94  ? 0.3853 0.1748 0.1827 0.0215  -0.0081 0.0139  222 ILE A CG2   
803  C CD1   . ILE A 94  ? 0.4672 0.2317 0.2377 0.0245  -0.0171 0.0195  222 ILE A CD1   
804  N N     . CYS A 95  ? 0.3582 0.1746 0.1783 0.0131  -0.0146 0.0116  223 CYS A N     
805  C CA    . CYS A 95  ? 0.3750 0.1993 0.2053 0.0099  -0.0128 0.0101  223 CYS A CA    
806  C C     . CYS A 95  ? 0.3740 0.2062 0.2154 0.0134  -0.0086 0.0124  223 CYS A C     
807  O O     . CYS A 95  ? 0.3631 0.2039 0.2142 0.0177  -0.0098 0.0158  223 CYS A O     
808  C CB    . CYS A 95  ? 0.3578 0.1871 0.1939 0.0069  -0.0194 0.0101  223 CYS A CB    
809  S SG    . CYS A 95  ? 0.4132 0.2475 0.2592 0.0018  -0.0191 0.0088  223 CYS A SG    
810  N N     . LYS A 96  ? 0.3798 0.2107 0.2204 0.0117  -0.0038 0.0108  224 LYS A N     
811  C CA    . LYS A 96  ? 0.3692 0.2050 0.2156 0.0153  0.0014  0.0127  224 LYS A CA    
812  C C     . LYS A 96  ? 0.3681 0.2059 0.2177 0.0112  0.0032  0.0120  224 LYS A C     
813  O O     . LYS A 96  ? 0.3674 0.1997 0.2113 0.0078  0.0023  0.0090  224 LYS A O     
814  C CB    . LYS A 96  ? 0.3656 0.1917 0.2010 0.0200  0.0051  0.0118  224 LYS A CB    
815  C CG    . LYS A 96  ? 0.3805 0.2037 0.2134 0.0266  0.0039  0.0136  224 LYS A CG    
816  C CD    . LYS A 96  ? 0.4041 0.2129 0.2230 0.0320  0.0069  0.0124  224 LYS A CD    
817  C CE    . LYS A 96  ? 0.4484 0.2548 0.2662 0.0412  0.0059  0.0147  224 LYS A CE    
818  N NZ    . LYS A 96  ? 0.4684 0.2563 0.2695 0.0477  0.0081  0.0131  224 LYS A NZ    
819  N N     . GLY A 97  ? 0.3710 0.2167 0.2292 0.0125  0.0066  0.0154  225 GLY A N     
820  C CA    . GLY A 97  ? 0.3670 0.2119 0.2251 0.0099  0.0094  0.0159  225 GLY A CA    
821  C C     . GLY A 97  ? 0.3715 0.2073 0.2170 0.0127  0.0128  0.0135  225 GLY A C     
822  O O     . GLY A 97  ? 0.3814 0.2123 0.2195 0.0173  0.0146  0.0125  225 GLY A O     
823  N N     . VAL A 98  ? 0.3297 0.1614 0.1716 0.0100  0.0122  0.0122  226 VAL A N     
824  C CA    . VAL A 98  ? 0.3302 0.1542 0.1611 0.0114  0.0132  0.0099  226 VAL A CA    
825  C C     . VAL A 98  ? 0.3383 0.1617 0.1663 0.0131  0.0170  0.0129  226 VAL A C     
826  O O     . VAL A 98  ? 0.3391 0.1641 0.1715 0.0104  0.0167  0.0155  226 VAL A O     
827  C CB    . VAL A 98  ? 0.3419 0.1634 0.1709 0.0084  0.0091  0.0065  226 VAL A CB    
828  C CG1   . VAL A 98  ? 0.3638 0.1804 0.1844 0.0089  0.0083  0.0048  226 VAL A CG1   
829  C CG2   . VAL A 98  ? 0.3311 0.1536 0.1614 0.0066  0.0068  0.0043  226 VAL A CG2   
830  N N     . ASN A 99  ? 0.3291 0.1477 0.1474 0.0176  0.0206  0.0128  227 ASN A N     
831  C CA    . ASN A 99  ? 0.3533 0.1691 0.1637 0.0202  0.0251  0.0156  227 ASN A CA    
832  C C     . ASN A 99  ? 0.4075 0.2139 0.2064 0.0190  0.0208  0.0131  227 ASN A C     
833  O O     . ASN A 99  ? 0.4756 0.2802 0.2709 0.0188  0.0220  0.0163  227 ASN A O     
834  C CB    . ASN A 99  ? 0.3752 0.1881 0.1767 0.0271  0.0311  0.0161  227 ASN A CB    
835  C CG    . ASN A 99  ? 0.4086 0.2348 0.2232 0.0303  0.0372  0.0206  227 ASN A CG    
836  O OD1   . ASN A 99  ? 0.4358 0.2736 0.2644 0.0262  0.0385  0.0253  227 ASN A OD1   
837  N ND2   . ASN A 99  ? 0.4371 0.2611 0.2467 0.0378  0.0404  0.0193  227 ASN A ND2   
838  N N     . LYS A 100 ? 0.3652 0.1665 0.1592 0.0177  0.0156  0.0085  228 LYS A N     
839  C CA    . LYS A 100 ? 0.3798 0.1745 0.1643 0.0165  0.0102  0.0063  228 LYS A CA    
840  C C     . LYS A 100 ? 0.3494 0.1512 0.1452 0.0126  0.0054  0.0048  228 LYS A C     
841  O O     . LYS A 100 ? 0.3682 0.1720 0.1669 0.0099  0.0027  0.0021  228 LYS A O     
842  C CB    . LYS A 100 ? 0.3907 0.1744 0.1605 0.0173  0.0079  0.0029  228 LYS A CB    
843  C CG    . LYS A 100 ? 0.4532 0.2286 0.2107 0.0235  0.0142  0.0034  228 LYS A CG    
844  C CD    . LYS A 100 ? 0.4687 0.2398 0.2143 0.0282  0.0189  0.0062  228 LYS A CD    
845  C CE    . LYS A 100 ? 0.5575 0.3196 0.2891 0.0358  0.0254  0.0053  228 LYS A CE    
846  N NZ    . LYS A 100 ? 0.5909 0.3504 0.3106 0.0414  0.0327  0.0087  228 LYS A NZ    
847  N N     . GLU A 101 ? 0.3578 0.1633 0.1602 0.0126  0.0050  0.0069  229 GLU A N     
848  C CA    . GLU A 101 ? 0.3526 0.1644 0.1656 0.0110  0.0023  0.0053  229 GLU A CA    
849  C C     . GLU A 101 ? 0.3526 0.1678 0.1662 0.0106  -0.0029 0.0025  229 GLU A C     
850  O O     . GLU A 101 ? 0.3245 0.1469 0.1451 0.0086  -0.0037 0.0002  229 GLU A O     
851  C CB    . GLU A 101 ? 0.3537 0.1635 0.1699 0.0117  0.0023  0.0081  229 GLU A CB    
852  C CG    . GLU A 101 ? 0.3708 0.1807 0.1900 0.0100  0.0068  0.0118  229 GLU A CG    
853  C CD    . GLU A 101 ? 0.4831 0.2885 0.2954 0.0108  0.0103  0.0167  229 GLU A CD    
854  O OE1   . GLU A 101 ? 0.5351 0.3364 0.3366 0.0135  0.0109  0.0165  229 GLU A OE1   
855  O OE2   . GLU A 101 ? 0.5365 0.3417 0.3533 0.0081  0.0123  0.0212  229 GLU A OE2   
856  N N     . TYR A 102 ? 0.3403 0.1517 0.1468 0.0124  -0.0063 0.0033  230 TYR A N     
857  C CA    . TYR A 102 ? 0.3377 0.1554 0.1472 0.0120  -0.0127 0.0013  230 TYR A CA    
858  C C     . TYR A 102 ? 0.3414 0.1609 0.1501 0.0067  -0.0143 -0.0010 230 TYR A C     
859  O O     . TYR A 102 ? 0.3675 0.1979 0.1864 0.0035  -0.0162 -0.0023 230 TYR A O     
860  C CB    . TYR A 102 ? 0.3360 0.1488 0.1373 0.0151  -0.0180 0.0029  230 TYR A CB    
861  C CG    . TYR A 102 ? 0.3315 0.1531 0.1373 0.0132  -0.0259 0.0010  230 TYR A CG    
862  C CD1   . TYR A 102 ? 0.3375 0.1737 0.1582 0.0148  -0.0286 0.0003  230 TYR A CD1   
863  C CD2   . TYR A 102 ? 0.3463 0.1619 0.1415 0.0092  -0.0306 -0.0003 230 TYR A CD2   
864  C CE1   . TYR A 102 ? 0.3370 0.1863 0.1663 0.0120  -0.0356 -0.0006 230 TYR A CE1   
865  C CE2   . TYR A 102 ? 0.3689 0.1939 0.1702 0.0053  -0.0392 -0.0016 230 TYR A CE2   
866  C CZ    . TYR A 102 ? 0.3636 0.2072 0.1836 0.0063  -0.0415 -0.0013 230 TYR A CZ    
867  O OH    . TYR A 102 ? 0.3851 0.2424 0.2150 0.0015  -0.0497 -0.0017 230 TYR A OH    
868  N N     . LEU A 103 ? 0.3476 0.1557 0.1434 0.0059  -0.0133 -0.0012 231 LEU A N     
869  C CA    . LEU A 103 ? 0.3783 0.1826 0.1696 0.0006  -0.0160 -0.0034 231 LEU A CA    
870  C C     . LEU A 103 ? 0.3540 0.1649 0.1552 -0.0029 -0.0127 -0.0037 231 LEU A C     
871  O O     . LEU A 103 ? 0.3666 0.1808 0.1710 -0.0092 -0.0156 -0.0045 231 LEU A O     
872  C CB    . LEU A 103 ? 0.3829 0.1703 0.1559 0.0026  -0.0145 -0.0042 231 LEU A CB    
873  C CG    . LEU A 103 ? 0.4064 0.1839 0.1638 0.0051  -0.0188 -0.0044 231 LEU A CG    
874  C CD1   . LEU A 103 ? 0.4118 0.1718 0.1489 0.0092  -0.0149 -0.0055 231 LEU A CD1   
875  C CD2   . LEU A 103 ? 0.4267 0.2062 0.1838 -0.0007 -0.0298 -0.0063 231 LEU A CD2   
876  N N     . MET A 104 ? 0.3568 0.1679 0.1610 0.0003  -0.0068 -0.0026 232 MET A N     
877  C CA    . MET A 104 ? 0.3424 0.1592 0.1543 -0.0022 -0.0040 -0.0027 232 MET A CA    
878  C C     . MET A 104 ? 0.3414 0.1714 0.1646 -0.0046 -0.0050 -0.0032 232 MET A C     
879  O O     . MET A 104 ? 0.3411 0.1754 0.1671 -0.0098 -0.0050 -0.0031 232 MET A O     
880  C CB    . MET A 104 ? 0.3538 0.1695 0.1675 0.0016  0.0006  -0.0014 232 MET A CB    
881  C CG    . MET A 104 ? 0.3211 0.1393 0.1385 0.0000  0.0024  -0.0014 232 MET A CG    
882  S SD    . MET A 104 ? 0.3981 0.2050 0.2055 -0.0019 0.0026  -0.0011 232 MET A SD    
883  C CE    . MET A 104 ? 0.3886 0.1989 0.1996 -0.0028 0.0041  -0.0002 232 MET A CE    
884  N N     . TYR A 105 ? 0.3390 0.1758 0.1687 -0.0002 -0.0050 -0.0032 233 TYR A N     
885  C CA    . TYR A 105 ? 0.3409 0.1914 0.1814 0.0004  -0.0049 -0.0040 233 TYR A CA    
886  C C     . TYR A 105 ? 0.3337 0.1947 0.1804 -0.0041 -0.0089 -0.0037 233 TYR A C     
887  O O     . TYR A 105 ? 0.3308 0.2037 0.1857 -0.0079 -0.0070 -0.0033 233 TYR A O     
888  C CB    . TYR A 105 ? 0.3316 0.1832 0.1751 0.0077  -0.0054 -0.0043 233 TYR A CB    
889  C CG    . TYR A 105 ? 0.3285 0.1945 0.1826 0.0112  -0.0052 -0.0055 233 TYR A CG    
890  C CD1   . TYR A 105 ? 0.3631 0.2338 0.2198 0.0128  -0.0003 -0.0070 233 TYR A CD1   
891  C CD2   . TYR A 105 ? 0.3387 0.2151 0.1999 0.0131  -0.0099 -0.0050 233 TYR A CD2   
892  C CE1   . TYR A 105 ? 0.3555 0.2407 0.2214 0.0176  0.0016  -0.0081 233 TYR A CE1   
893  C CE2   . TYR A 105 ? 0.3468 0.2403 0.2204 0.0178  -0.0090 -0.0057 233 TYR A CE2   
894  C CZ    . TYR A 105 ? 0.3478 0.2462 0.2238 0.0203  -0.0023 -0.0073 233 TYR A CZ    
895  O OH    . TYR A 105 ? 0.3532 0.2689 0.2405 0.0267  0.0003  -0.0080 233 TYR A OH    
896  N N     . SER A 106 ? 0.3372 0.1930 0.1785 -0.0049 -0.0146 -0.0035 234 SER A N     
897  C CA    . SER A 106 ? 0.3412 0.2072 0.1889 -0.0099 -0.0207 -0.0032 234 SER A CA    
898  C C     . SER A 106 ? 0.3437 0.2083 0.1903 -0.0201 -0.0207 -0.0027 234 SER A C     
899  O O     . SER A 106 ? 0.3613 0.2417 0.2203 -0.0261 -0.0221 -0.0013 234 SER A O     
900  C CB    . SER A 106 ? 0.3565 0.2127 0.1938 -0.0085 -0.0282 -0.0034 234 SER A CB    
901  O OG    . SER A 106 ? 0.3661 0.2320 0.2097 -0.0147 -0.0364 -0.0031 234 SER A OG    
902  N N     . ALA A 107 ? 0.3439 0.1898 0.1758 -0.0217 -0.0192 -0.0032 235 ALA A N     
903  C CA    . ALA A 107 ? 0.3583 0.1974 0.1856 -0.0308 -0.0196 -0.0025 235 ALA A CA    
904  C C     . ALA A 107 ? 0.3497 0.2011 0.1871 -0.0334 -0.0133 -0.0005 235 ALA A C     
905  O O     . ALA A 107 ? 0.3822 0.2368 0.2223 -0.0427 -0.0139 0.0015  235 ALA A O     
906  C CB    . ALA A 107 ? 0.3842 0.1999 0.1930 -0.0286 -0.0185 -0.0036 235 ALA A CB    
907  N N     . LEU A 108 ? 0.3459 0.2019 0.1867 -0.0256 -0.0075 -0.0010 236 LEU A N     
908  C CA    . LEU A 108 ? 0.3416 0.2074 0.1883 -0.0262 -0.0009 0.0002  236 LEU A CA    
909  C C     . LEU A 108 ? 0.3426 0.2317 0.2053 -0.0279 0.0008  0.0015  236 LEU A C     
910  O O     . LEU A 108 ? 0.3548 0.2534 0.2214 -0.0297 0.0070  0.0031  236 LEU A O     
911  C CB    . LEU A 108 ? 0.3358 0.1967 0.1787 -0.0179 0.0030  -0.0013 236 LEU A CB    
912  C CG    . LEU A 108 ? 0.3604 0.2038 0.1911 -0.0167 0.0032  -0.0013 236 LEU A CG    
913  C CD1   . LEU A 108 ? 0.3594 0.2012 0.1899 -0.0096 0.0051  -0.0025 236 LEU A CD1   
914  C CD2   . LEU A 108 ? 0.3906 0.2284 0.2150 -0.0224 0.0052  0.0008  236 LEU A CD2   
915  N N     . THR A 109 ? 0.3575 0.2571 0.2294 -0.0268 -0.0043 0.0011  237 THR A N     
916  C CA    . THR A 109 ? 0.3479 0.2734 0.2386 -0.0287 -0.0043 0.0029  237 THR A CA    
917  C C     . THR A 109 ? 0.3808 0.3155 0.2793 -0.0414 -0.0086 0.0061  237 THR A C     
918  O O     . THR A 109 ? 0.3870 0.3480 0.3048 -0.0433 -0.0076 0.0085  237 THR A O     
919  C CB    . THR A 109 ? 0.3732 0.3084 0.2725 -0.0190 -0.0086 0.0013  237 THR A CB    
920  O OG1   . THR A 109 ? 0.3883 0.3156 0.2831 -0.0223 -0.0186 0.0011  237 THR A OG1   
921  C CG2   . THR A 109 ? 0.3557 0.2798 0.2467 -0.0076 -0.0050 -0.0014 237 THR A CG2   
922  N N     . ARG A 110 ? 0.4006 0.3151 0.2854 -0.0504 -0.0136 0.0064  238 ARG A N     
923  C CA    . ARG A 110 ? 0.4111 0.3294 0.3007 -0.0645 -0.0205 0.0092  238 ARG A CA    
924  C C     . ARG A 110 ? 0.4317 0.3319 0.3081 -0.0748 -0.0186 0.0114  238 ARG A C     
925  O O     . ARG A 110 ? 0.3939 0.2720 0.2529 -0.0699 -0.0151 0.0097  238 ARG A O     
926  C CB    . ARG A 110 ? 0.4519 0.3569 0.3327 -0.0657 -0.0326 0.0065  238 ARG A CB    
927  C CG    . ARG A 110 ? 0.5188 0.4404 0.4115 -0.0572 -0.0373 0.0053  238 ARG A CG    
928  C CD    . ARG A 110 ? 0.5699 0.4777 0.4516 -0.0607 -0.0503 0.0034  238 ARG A CD    
929  N NE    . ARG A 110 ? 0.6356 0.5109 0.4906 -0.0572 -0.0499 0.0002  238 ARG A NE    
930  C CZ    . ARG A 110 ? 0.6095 0.4741 0.4540 -0.0448 -0.0462 -0.0020 238 ARG A CZ    
931  N NH1   . ARG A 110 ? 0.5834 0.4634 0.4396 -0.0355 -0.0439 -0.0016 238 ARG A NH1   
932  N NH2   . ARG A 110 ? 0.6552 0.4934 0.4776 -0.0418 -0.0443 -0.0043 238 ARG A NH2   
933  N N     A ASP A 111 ? 0.4505 0.3593 0.3353 -0.0896 -0.0218 0.0156  239 ASP A N     
934  N N     B ASP A 111 ? 0.4485 0.3575 0.3333 -0.0894 -0.0217 0.0156  239 ASP A N     
935  C CA    A ASP A 111 ? 0.4999 0.3878 0.3704 -0.1018 -0.0220 0.0186  239 ASP A CA    
936  C CA    B ASP A 111 ? 0.5001 0.3884 0.3708 -0.1014 -0.0220 0.0185  239 ASP A CA    
937  C C     A ASP A 111 ? 0.4920 0.3427 0.3351 -0.0964 -0.0252 0.0144  239 ASP A C     
938  C C     B ASP A 111 ? 0.4913 0.3421 0.3344 -0.0963 -0.0252 0.0144  239 ASP A C     
939  O O     A ASP A 111 ? 0.4968 0.3344 0.3307 -0.0925 -0.0329 0.0102  239 ASP A O     
940  O O     B ASP A 111 ? 0.4957 0.3331 0.3294 -0.0924 -0.0329 0.0101  239 ASP A O     
941  C CB    A ASP A 111 ? 0.5272 0.4201 0.4055 -0.1203 -0.0310 0.0225  239 ASP A CB    
942  C CB    B ASP A 111 ? 0.5253 0.4191 0.4042 -0.1190 -0.0313 0.0220  239 ASP A CB    
943  C CG    A ASP A 111 ? 0.5288 0.4587 0.4343 -0.1291 -0.0251 0.0292  239 ASP A CG    
944  C CG    B ASP A 111 ? 0.5519 0.4326 0.4225 -0.1337 -0.0294 0.0274  239 ASP A CG    
945  O OD1   A ASP A 111 ? 0.5179 0.4693 0.4351 -0.1183 -0.0145 0.0295  239 ASP A OD1   
946  O OD1   B ASP A 111 ? 0.5663 0.4652 0.4477 -0.1366 -0.0190 0.0327  239 ASP A OD1   
947  O OD2   A ASP A 111 ? 0.5465 0.4835 0.4611 -0.1469 -0.0308 0.0342  239 ASP A OD2   
948  O OD2   B ASP A 111 ? 0.5667 0.4162 0.4173 -0.1412 -0.0378 0.0262  239 ASP A OD2   
949  N N     . PRO A 112 ? 0.5215 0.3552 0.3507 -0.0955 -0.0194 0.0159  240 PRO A N     
950  C CA    . PRO A 112 ? 0.4869 0.3288 0.3198 -0.1007 -0.0108 0.0213  240 PRO A CA    
951  C C     . PRO A 112 ? 0.4531 0.3138 0.2948 -0.0884 -0.0007 0.0205  240 PRO A C     
952  O O     . PRO A 112 ? 0.4437 0.3105 0.2854 -0.0904 0.0073  0.0244  240 PRO A O     
953  C CB    . PRO A 112 ? 0.5400 0.3478 0.3484 -0.1022 -0.0121 0.0219  240 PRO A CB    
954  C CG    . PRO A 112 ? 0.5346 0.3258 0.3310 -0.0883 -0.0152 0.0156  240 PRO A CG    
955  C CD    . PRO A 112 ? 0.5359 0.3367 0.3411 -0.0887 -0.0220 0.0123  240 PRO A CD    
956  N N     . PHE A 113 ? 0.4127 0.2809 0.2599 -0.0762 -0.0013 0.0158  241 PHE A N     
957  C CA    . PHE A 113 ? 0.4056 0.2850 0.2571 -0.0641 0.0063  0.0140  241 PHE A CA    
958  C C     . PHE A 113 ? 0.4131 0.3230 0.2857 -0.0620 0.0095  0.0145  241 PHE A C     
959  O O     . PHE A 113 ? 0.4222 0.3472 0.3087 -0.0690 0.0048  0.0162  241 PHE A O     
960  C CB    . PHE A 113 ? 0.3929 0.2589 0.2358 -0.0518 0.0041  0.0090  241 PHE A CB    
961  C CG    . PHE A 113 ? 0.4372 0.2760 0.2617 -0.0517 0.0008  0.0083  241 PHE A CG    
962  C CD1   . PHE A 113 ? 0.4628 0.2889 0.2758 -0.0506 0.0043  0.0099  241 PHE A CD1   
963  C CD2   . PHE A 113 ? 0.4484 0.2731 0.2654 -0.0523 -0.0063 0.0061  241 PHE A CD2   
964  C CE1   . PHE A 113 ? 0.4669 0.2688 0.2638 -0.0486 0.0011  0.0094  241 PHE A CE1   
965  C CE2   . PHE A 113 ? 0.4716 0.2710 0.2707 -0.0505 -0.0084 0.0052  241 PHE A CE2   
966  C CZ    . PHE A 113 ? 0.4625 0.2514 0.2529 -0.0482 -0.0048 0.0069  241 PHE A CZ    
967  N N     . SER A 114 ? 0.3935 0.3130 0.2684 -0.0524 0.0175  0.0133  242 SER A N     
968  C CA    . SER A 114 ? 0.3884 0.3351 0.2815 -0.0459 0.0212  0.0128  242 SER A CA    
969  C C     . SER A 114 ? 0.3854 0.3295 0.2725 -0.0319 0.0268  0.0088  242 SER A C     
970  O O     . SER A 114 ? 0.3969 0.3232 0.2677 -0.0299 0.0292  0.0077  242 SER A O     
971  C CB    . SER A 114 ? 0.3926 0.3636 0.2999 -0.0546 0.0277  0.0184  242 SER A CB    
972  O OG    . SER A 114 ? 0.4070 0.3724 0.3028 -0.0572 0.0366  0.0213  242 SER A OG    
973  N N     . VAL A 115 ? 0.3589 0.3192 0.2582 -0.0221 0.0276  0.0064  243 VAL A N     
974  C CA    . VAL A 115 ? 0.3640 0.3200 0.2564 -0.0086 0.0322  0.0021  243 VAL A CA    
975  C C     . VAL A 115 ? 0.3594 0.3272 0.2508 -0.0064 0.0433  0.0033  243 VAL A C     
976  O O     . VAL A 115 ? 0.3593 0.3530 0.2666 -0.0082 0.0490  0.0067  243 VAL A O     
977  C CB    . VAL A 115 ? 0.3857 0.3509 0.2886 0.0026  0.0289  -0.0009 243 VAL A CB    
978  C CG1   . VAL A 115 ? 0.4072 0.3657 0.3014 0.0164  0.0336  -0.0055 243 VAL A CG1   
979  C CG2   . VAL A 115 ? 0.4226 0.3729 0.3219 0.0014  0.0187  -0.0020 243 VAL A CG2   
980  N N     . ILE A 116 ? 0.3417 0.2922 0.2148 -0.0021 0.0466  0.0008  244 ILE A N     
981  C CA    . ILE A 116 ? 0.3657 0.3240 0.2326 0.0029  0.0575  0.0009  244 ILE A CA    
982  C C     . ILE A 116 ? 0.3759 0.3358 0.2417 0.0191  0.0598  -0.0051 244 ILE A C     
983  O O     . ILE A 116 ? 0.3735 0.3535 0.2473 0.0263  0.0684  -0.0051 244 ILE A O     
984  C CB    . ILE A 116 ? 0.3707 0.3073 0.2151 -0.0006 0.0587  0.0012  244 ILE A CB    
985  C CG1   . ILE A 116 ? 0.4023 0.3362 0.2466 -0.0155 0.0571  0.0076  244 ILE A CG1   
986  C CG2   . ILE A 116 ? 0.3830 0.3239 0.2160 0.0060  0.0695  0.0004  244 ILE A CG2   
987  C CD1   . ILE A 116 ? 0.4178 0.3268 0.2401 -0.0184 0.0548  0.0082  244 ILE A CD1   
988  N N     . GLU A 117 ? 0.3541 0.2920 0.2092 0.0244  0.0523  -0.0099 245 GLU A N     
989  C CA    . GLU A 117 ? 0.3707 0.3035 0.2215 0.0391  0.0525  -0.0158 245 GLU A CA    
990  C C     . GLU A 117 ? 0.3728 0.2869 0.2208 0.0396  0.0419  -0.0180 245 GLU A C     
991  O O     . GLU A 117 ? 0.3809 0.2825 0.2245 0.0306  0.0362  -0.0162 245 GLU A O     
992  C CB    . GLU A 117 ? 0.3989 0.3187 0.2281 0.0461  0.0586  -0.0198 245 GLU A CB    
993  C CG    . GLU A 117 ? 0.3922 0.2867 0.2022 0.0394  0.0530  -0.0206 245 GLU A CG    
994  C CD    . GLU A 117 ? 0.4315 0.3115 0.2177 0.0451  0.0571  -0.0245 245 GLU A CD    
995  O OE1   . GLU A 117 ? 0.4417 0.3224 0.2212 0.0574  0.0625  -0.0292 245 GLU A OE1   
996  O OE2   . GLU A 117 ? 0.4271 0.2941 0.2000 0.0380  0.0544  -0.0229 245 GLU A OE2   
997  N N     . GLU A 118 ? 0.3716 0.2833 0.2220 0.0504  0.0393  -0.0214 246 GLU A N     
998  C CA    . GLU A 118 ? 0.3701 0.2621 0.2158 0.0508  0.0299  -0.0228 246 GLU A CA    
999  C C     . GLU A 118 ? 0.3883 0.2676 0.2254 0.0644  0.0288  -0.0280 246 GLU A C     
1000 O O     . GLU A 118 ? 0.3904 0.2796 0.2286 0.0754  0.0351  -0.0305 246 GLU A O     
1001 C CB    . GLU A 118 ? 0.3618 0.2618 0.2214 0.0459  0.0239  -0.0191 246 GLU A CB    
1002 C CG    . GLU A 118 ? 0.3748 0.2994 0.2524 0.0514  0.0253  -0.0176 246 GLU A CG    
1003 C CD    . GLU A 118 ? 0.3617 0.2947 0.2511 0.0432  0.0185  -0.0135 246 GLU A CD    
1004 O OE1   . GLU A 118 ? 0.3563 0.2743 0.2383 0.0351  0.0137  -0.0123 246 GLU A OE1   
1005 O OE2   . GLU A 118 ? 0.3604 0.3167 0.2668 0.0447  0.0184  -0.0113 246 GLU A OE2   
1006 N N     . SER A 119 ? 0.4159 0.2719 0.2430 0.0632  0.0213  -0.0293 247 SER A N     
1007 C CA    . SER A 119 ? 0.4381 0.2727 0.2507 0.0741  0.0188  -0.0347 247 SER A CA    
1008 C C     . SER A 119 ? 0.4563 0.2923 0.2751 0.0855  0.0164  -0.0351 247 SER A C     
1009 O O     . SER A 119 ? 0.4609 0.2801 0.2670 0.0973  0.0157  -0.0400 247 SER A O     
1010 C CB    . SER A 119 ? 0.4167 0.2252 0.2163 0.0666  0.0111  -0.0352 247 SER A CB    
1011 O OG    . SER A 119 ? 0.4111 0.2195 0.2197 0.0600  0.0058  -0.0305 247 SER A OG    
1012 N N     . LEU A 120 ? 0.4565 0.3095 0.2922 0.0829  0.0142  -0.0305 248 LEU A N     
1013 C CA    . LEU A 120 ? 0.4798 0.3403 0.3246 0.0941  0.0116  -0.0298 248 LEU A CA    
1014 C C     . LEU A 120 ? 0.4453 0.3407 0.3116 0.0969  0.0162  -0.0273 248 LEU A C     
1015 O O     . LEU A 120 ? 0.4291 0.3406 0.3072 0.0847  0.0157  -0.0230 248 LEU A O     
1016 C CB    . LEU A 120 ? 0.4751 0.3251 0.3207 0.0882  0.0027  -0.0257 248 LEU A CB    
1017 C CG    . LEU A 120 ? 0.5390 0.3571 0.3677 0.0871  -0.0033 -0.0262 248 LEU A CG    
1018 C CD1   . LEU A 120 ? 0.5435 0.3575 0.3749 0.0823  -0.0099 -0.0208 248 LEU A CD1   
1019 C CD2   . LEU A 120 ? 0.5279 0.3271 0.3441 0.1018  -0.0044 -0.0309 248 LEU A CD2   
1020 N N     . PRO A 121 ? 0.4553 0.3628 0.3277 0.1126  0.0198  -0.0294 249 PRO A N     
1021 C CA    . PRO A 121 ? 0.4568 0.4022 0.3539 0.1146  0.0238  -0.0260 249 PRO A CA    
1022 C C     . PRO A 121 ? 0.4485 0.4041 0.3598 0.1072  0.0143  -0.0208 249 PRO A C     
1023 O O     . PRO A 121 ? 0.4676 0.4068 0.3728 0.1125  0.0059  -0.0206 249 PRO A O     
1024 C CB    . PRO A 121 ? 0.4853 0.4372 0.3847 0.1362  0.0277  -0.0295 249 PRO A CB    
1025 C CG    . PRO A 121 ? 0.5265 0.4451 0.3989 0.1432  0.0299  -0.0359 249 PRO A CG    
1026 C CD    . PRO A 121 ? 0.5224 0.4107 0.3799 0.1296  0.0208  -0.0351 249 PRO A CD    
1027 N N     . GLY A 122 ? 0.4344 0.4140 0.3617 0.0948  0.0152  -0.0166 250 GLY A N     
1028 C CA    . GLY A 122 ? 0.4356 0.4233 0.3737 0.0863  0.0052  -0.0122 250 GLY A CA    
1029 C C     . GLY A 122 ? 0.4489 0.4129 0.3720 0.0724  0.0005  -0.0113 250 GLY A C     
1030 O O     . GLY A 122 ? 0.4574 0.4255 0.3854 0.0631  -0.0065 -0.0082 250 GLY A O     
1031 N N     . GLY A 123 ? 0.3956 0.3350 0.3004 0.0709  0.0038  -0.0141 251 GLY A N     
1032 C CA    . GLY A 123 ? 0.3917 0.3126 0.2848 0.0585  0.0008  -0.0128 251 GLY A CA    
1033 C C     . GLY A 123 ? 0.4035 0.3090 0.2899 0.0588  -0.0079 -0.0110 251 GLY A C     
1034 O O     . GLY A 123 ? 0.3879 0.2848 0.2707 0.0692  -0.0116 -0.0115 251 GLY A O     
1035 N N     . LEU A 124 ? 0.3602 0.2597 0.2423 0.0478  -0.0107 -0.0088 252 LEU A N     
1036 C CA    . LEU A 124 ? 0.3535 0.2370 0.2258 0.0468  -0.0172 -0.0066 252 LEU A CA    
1037 C C     . LEU A 124 ? 0.3710 0.2645 0.2484 0.0417  -0.0236 -0.0042 252 LEU A C     
1038 O O     . LEU A 124 ? 0.3807 0.2891 0.2672 0.0347  -0.0229 -0.0040 252 LEU A O     
1039 C CB    . LEU A 124 ? 0.3399 0.2035 0.1986 0.0396  -0.0146 -0.0062 252 LEU A CB    
1040 C CG    . LEU A 124 ? 0.3623 0.2129 0.2140 0.0418  -0.0105 -0.0083 252 LEU A CG    
1041 C CD1   . LEU A 124 ? 0.3514 0.1887 0.1946 0.0336  -0.0089 -0.0070 252 LEU A CD1   
1042 C CD2   . LEU A 124 ? 0.3827 0.2200 0.2285 0.0513  -0.0135 -0.0089 252 LEU A CD2   
1043 N N     . LYS A 125 ? 0.3894 0.2709 0.2577 0.0443  -0.0301 -0.0021 253 LYS A N     
1044 C CA    . LYS A 125 ? 0.4180 0.3031 0.2854 0.0402  -0.0380 -0.0001 253 LYS A CA    
1045 C C     . LYS A 125 ? 0.3906 0.2522 0.2379 0.0377  -0.0396 0.0018  253 LYS A C     
1046 O O     . LYS A 125 ? 0.3749 0.2207 0.2127 0.0399  -0.0353 0.0026  253 LYS A O     
1047 C CB    . LYS A 125 ? 0.4846 0.3818 0.3612 0.0496  -0.0457 0.0011  253 LYS A CB    
1048 C CG    . LYS A 125 ? 0.5540 0.4790 0.4530 0.0543  -0.0439 0.0000  253 LYS A CG    
1049 C CD    . LYS A 125 ? 0.6500 0.5960 0.5628 0.0429  -0.0447 0.0005  253 LYS A CD    
1050 C CE    . LYS A 125 ? 0.6806 0.6598 0.6191 0.0470  -0.0434 0.0011  253 LYS A CE    
1051 N NZ    . LYS A 125 ? 0.7358 0.7225 0.6797 0.0469  -0.0309 -0.0007 253 LYS A NZ    
1052 N N     . GLU A 126 ? 0.3822 0.2417 0.2224 0.0327  -0.0457 0.0028  254 GLU A N     
1053 C CA    . GLU A 126 ? 0.3939 0.2324 0.2135 0.0314  -0.0459 0.0047  254 GLU A CA    
1054 C C     . GLU A 126 ? 0.4078 0.2326 0.2178 0.0393  -0.0468 0.0080  254 GLU A C     
1055 O O     . GLU A 126 ? 0.4019 0.2102 0.1985 0.0382  -0.0418 0.0104  254 GLU A O     
1056 C CB    . GLU A 126 ? 0.4077 0.2445 0.2183 0.0266  -0.0541 0.0046  254 GLU A CB    
1057 C CG    . GLU A 126 ? 0.4343 0.2492 0.2203 0.0274  -0.0543 0.0067  254 GLU A CG    
1058 C CD    . GLU A 126 ? 0.4423 0.2513 0.2149 0.0223  -0.0617 0.0051  254 GLU A CD    
1059 O OE1   . GLU A 126 ? 0.4598 0.2806 0.2432 0.0161  -0.0665 0.0024  254 GLU A OE1   
1060 O OE2   . GLU A 126 ? 0.4858 0.2770 0.2356 0.0242  -0.0630 0.0066  254 GLU A OE2   
1061 N N     . HIS A 127 ? 0.3892 0.2207 0.2059 0.0471  -0.0533 0.0087  255 HIS A N     
1062 C CA    . HIS A 127 ? 0.4409 0.2568 0.2475 0.0554  -0.0552 0.0122  255 HIS A CA    
1063 C C     . HIS A 127 ? 0.4245 0.2270 0.2277 0.0550  -0.0466 0.0125  255 HIS A C     
1064 O O     . HIS A 127 ? 0.4759 0.2590 0.2648 0.0562  -0.0462 0.0166  255 HIS A O     
1065 C CB    . HIS A 127 ? 0.4910 0.3205 0.3105 0.0658  -0.0629 0.0118  255 HIS A CB    
1066 C CG    . HIS A 127 ? 0.6062 0.4196 0.4176 0.0763  -0.0649 0.0144  255 HIS A CG    
1067 N ND1   . HIS A 127 ? 0.7084 0.5042 0.5022 0.0803  -0.0718 0.0194  255 HIS A ND1   
1068 C CD2   . HIS A 127 ? 0.6675 0.4777 0.4841 0.0844  -0.0617 0.0128  255 HIS A CD2   
1069 C CE1   . HIS A 127 ? 0.6921 0.4737 0.4811 0.0898  -0.0729 0.0211  255 HIS A CE1   
1070 N NE2   . HIS A 127 ? 0.6322 0.4215 0.4345 0.0927  -0.0671 0.0167  255 HIS A NE2   
1071 N N     . ASP A 128 ? 0.4076 0.2205 0.2237 0.0530  -0.0406 0.0086  256 ASP A N     
1072 C CA    . ASP A 128 ? 0.4035 0.2043 0.2169 0.0526  -0.0346 0.0082  256 ASP A CA    
1073 C C     . ASP A 128 ? 0.4031 0.1927 0.2073 0.0437  -0.0291 0.0108  256 ASP A C     
1074 O O     . ASP A 128 ? 0.4161 0.1931 0.2160 0.0417  -0.0260 0.0124  256 ASP A O     
1075 C CB    . ASP A 128 ? 0.4142 0.2293 0.2414 0.0533  -0.0303 0.0031  256 ASP A CB    
1076 C CG    . ASP A 128 ? 0.4185 0.2476 0.2566 0.0633  -0.0337 0.0010  256 ASP A CG    
1077 O OD1   . ASP A 128 ? 0.4276 0.2461 0.2605 0.0728  -0.0379 0.0021  256 ASP A OD1   
1078 O OD2   . ASP A 128 ? 0.4192 0.2692 0.2709 0.0621  -0.0319 -0.0014 256 ASP A OD2   
1079 N N     . PHE A 129 ? 0.3755 0.1696 0.1764 0.0384  -0.0283 0.0114  257 PHE A N     
1080 C CA    . PHE A 129 ? 0.3980 0.1842 0.1906 0.0319  -0.0221 0.0141  257 PHE A CA    
1081 C C     . PHE A 129 ? 0.4377 0.2101 0.2130 0.0327  -0.0232 0.0196  257 PHE A C     
1082 O O     . PHE A 129 ? 0.5183 0.2858 0.2856 0.0288  -0.0173 0.0225  257 PHE A O     
1083 C CB    . PHE A 129 ? 0.3878 0.1838 0.1841 0.0272  -0.0195 0.0111  257 PHE A CB    
1084 C CG    . PHE A 129 ? 0.3598 0.1668 0.1697 0.0251  -0.0168 0.0071  257 PHE A CG    
1085 C CD1   . PHE A 129 ? 0.3408 0.1607 0.1609 0.0270  -0.0201 0.0039  257 PHE A CD1   
1086 C CD2   . PHE A 129 ? 0.3480 0.1534 0.1602 0.0215  -0.0112 0.0072  257 PHE A CD2   
1087 C CE1   . PHE A 129 ? 0.3300 0.1594 0.1599 0.0252  -0.0167 0.0009  257 PHE A CE1   
1088 C CE2   . PHE A 129 ? 0.3420 0.1558 0.1634 0.0199  -0.0094 0.0038  257 PHE A CE2   
1089 C CZ    . PHE A 129 ? 0.3535 0.1783 0.1825 0.0218  -0.0116 0.0006  257 PHE A CZ    
1090 N N     . ASN A 130 ? 0.4497 0.2166 0.2192 0.0386  -0.0303 0.0213  258 ASN A N     
1091 C CA    . ASN A 130 ? 0.4710 0.2216 0.2219 0.0403  -0.0318 0.0275  258 ASN A CA    
1092 C C     . ASN A 130 ? 0.5115 0.2476 0.2597 0.0413  -0.0307 0.0318  258 ASN A C     
1093 O O     . ASN A 130 ? 0.5297 0.2677 0.2889 0.0439  -0.0323 0.0287  258 ASN A O     
1094 C CB    . ASN A 130 ? 0.4780 0.2289 0.2218 0.0464  -0.0422 0.0274  258 ASN A CB    
1095 C CG    . ASN A 130 ? 0.4628 0.2186 0.1994 0.0434  -0.0442 0.0251  258 ASN A CG    
1096 O OD1   . ASN A 130 ? 0.5133 0.2567 0.2294 0.0442  -0.0461 0.0284  258 ASN A OD1   
1097 N ND2   . ASN A 130 ? 0.4422 0.2129 0.1925 0.0398  -0.0437 0.0197  258 ASN A ND2   
1098 N N     . PRO A 131 ? 0.5584 0.2785 0.2905 0.0391  -0.0280 0.0391  259 PRO A N     
1099 C CA    . PRO A 131 ? 0.5909 0.2932 0.3179 0.0386  -0.0284 0.0443  259 PRO A CA    
1100 C C     . PRO A 131 ? 0.6279 0.3235 0.3547 0.0485  -0.0381 0.0424  259 PRO A C     
1101 O O     . PRO A 131 ? 0.6012 0.3009 0.3244 0.0559  -0.0453 0.0413  259 PRO A O     
1102 C CB    . PRO A 131 ? 0.6355 0.3231 0.3420 0.0360  -0.0253 0.0532  259 PRO A CB    
1103 C CG    . PRO A 131 ? 0.6389 0.3386 0.3438 0.0326  -0.0185 0.0521  259 PRO A CG    
1104 C CD    . PRO A 131 ? 0.5922 0.3080 0.3080 0.0366  -0.0238 0.0434  259 PRO A CD    
1105 N N     . GLU A 132 ? 0.6441 0.3283 0.3738 0.0493  -0.0391 0.0420  260 GLU A N     
1106 C CA    . GLU A 132 ? 0.6599 0.3342 0.3868 0.0606  -0.0475 0.0406  260 GLU A CA    
1107 C C     . GLU A 132 ? 0.7464 0.4016 0.4529 0.0643  -0.0527 0.0486  260 GLU A C     
1108 O O     . GLU A 132 ? 0.7561 0.3962 0.4488 0.0560  -0.0481 0.0563  260 GLU A O     
1109 C CB    . GLU A 132 ? 0.7270 0.3845 0.4541 0.0596  -0.0471 0.0395  260 GLU A CB    
1110 C CG    . GLU A 132 ? 0.8124 0.4598 0.5379 0.0735  -0.0546 0.0359  260 GLU A CG    
1111 C CD    . GLU A 132 ? 0.8183 0.4924 0.5611 0.0828  -0.0557 0.0279  260 GLU A CD    
1112 O OE1   . GLU A 132 ? 0.8192 0.5135 0.5759 0.0767  -0.0498 0.0232  260 GLU A OE1   
1113 O OE2   . GLU A 132 ? 0.8897 0.5648 0.6324 0.0963  -0.0626 0.0271  260 GLU A OE2   
1114 N N     . SER A 133 ? 0.7429 0.3994 0.4473 0.0765  -0.0620 0.0475  261 SER A N     
1115 C CA    . SER A 133 ? 0.8583 0.4962 0.5409 0.0809  -0.0684 0.0554  261 SER A CA    
1116 C C     . SER A 133 ? 0.8855 0.4931 0.5546 0.0860  -0.0726 0.0601  261 SER A C     
1117 O O     . SER A 133 ? 0.8228 0.4267 0.5010 0.0894  -0.0726 0.0553  261 SER A O     
1118 C CB    . SER A 133 ? 0.8789 0.5322 0.5654 0.0916  -0.0785 0.0527  261 SER A CB    
1119 O OG    . SER A 133 ? 0.9716 0.6411 0.6788 0.1009  -0.0818 0.0455  261 SER A OG    
1120 N N     . GLY B 1   ? 0.6423 0.2514 0.2347 -0.0465 0.0556  0.0735  129 GLY B N     
1121 C CA    . GLY B 1   ? 0.6198 0.2541 0.2357 -0.0546 0.0608  0.0628  129 GLY B CA    
1122 C C     . GLY B 1   ? 0.5944 0.2467 0.2372 -0.0491 0.0539  0.0559  129 GLY B C     
1123 O O     . GLY B 1   ? 0.5776 0.2202 0.2208 -0.0411 0.0474  0.0586  129 GLY B O     
1124 N N     A SER B 2   ? 0.5536 0.2307 0.2185 -0.0529 0.0556  0.0474  130 SER B N     
1125 N N     B SER B 2   ? 0.5503 0.2274 0.2151 -0.0529 0.0556  0.0474  130 SER B N     
1126 C CA    A SER B 2   ? 0.5163 0.2111 0.2045 -0.0471 0.0482  0.0415  130 SER B CA    
1127 C CA    B SER B 2   ? 0.5109 0.2059 0.1993 -0.0475 0.0485  0.0414  130 SER B CA    
1128 C C     A SER B 2   ? 0.5081 0.1942 0.2032 -0.0484 0.0464  0.0408  130 SER B C     
1129 C C     B SER B 2   ? 0.5051 0.1914 0.2003 -0.0485 0.0464  0.0407  130 SER B C     
1130 O O     A SER B 2   ? 0.4967 0.1860 0.1991 -0.0400 0.0388  0.0397  130 SER B O     
1131 O O     B SER B 2   ? 0.4931 0.1826 0.1959 -0.0401 0.0388  0.0395  130 SER B O     
1132 C CB    A SER B 2   ? 0.4996 0.2202 0.2107 -0.0517 0.0515  0.0333  130 SER B CB    
1133 C CB    B SER B 2   ? 0.4927 0.2125 0.2032 -0.0531 0.0528  0.0334  130 SER B CB    
1134 O OG    A SER B 2   ? 0.5091 0.2327 0.2276 -0.0638 0.0613  0.0311  130 SER B OG    
1135 O OG    B SER B 2   ? 0.4922 0.2174 0.1949 -0.0536 0.0574  0.0326  130 SER B OG    
1136 N N     . LYS B 3   ? 0.5146 0.1900 0.2066 -0.0600 0.0540  0.0408  131 LYS B N     
1137 C CA    . LYS B 3   ? 0.5225 0.1876 0.2183 -0.0640 0.0529  0.0389  131 LYS B CA    
1138 C C     . LYS B 3   ? 0.5560 0.1967 0.2354 -0.0537 0.0488  0.0443  131 LYS B C     
1139 O O     . LYS B 3   ? 0.5372 0.1746 0.2222 -0.0508 0.0451  0.0414  131 LYS B O     
1140 C CB    . LYS B 3   ? 0.5250 0.1816 0.2186 -0.0802 0.0619  0.0381  131 LYS B CB    
1141 C CG    . LYS B 3   ? 0.4992 0.1854 0.2175 -0.0897 0.0650  0.0318  131 LYS B CG    
1142 C CD    . LYS B 3   ? 0.5177 0.1996 0.2378 -0.1071 0.0732  0.0308  131 LYS B CD    
1143 C CE    . LYS B 3   ? 0.4985 0.2129 0.2468 -0.1156 0.0764  0.0255  131 LYS B CE    
1144 N NZ    . LYS B 3   ? 0.5255 0.2385 0.2779 -0.1337 0.0839  0.0247  131 LYS B NZ    
1145 N N     . VAL B 4   ? 0.5547 0.1783 0.2136 -0.0482 0.0499  0.0524  132 VAL B N     
1146 C CA    . VAL B 4   ? 0.5785 0.1790 0.2226 -0.0363 0.0463  0.0593  132 VAL B CA    
1147 C C     . VAL B 4   ? 0.5721 0.1885 0.2254 -0.0212 0.0365  0.0601  132 VAL B C     
1148 O O     . VAL B 4   ? 0.5860 0.1953 0.2414 -0.0110 0.0327  0.0613  132 VAL B O     
1149 C CB    . VAL B 4   ? 0.6049 0.1806 0.2224 -0.0367 0.0507  0.0694  132 VAL B CB    
1150 C CG1   . VAL B 4   ? 0.6138 0.1701 0.2171 -0.0208 0.0452  0.0790  132 VAL B CG1   
1151 C CG2   . VAL B 4   ? 0.6275 0.1812 0.2337 -0.0516 0.0611  0.0694  132 VAL B CG2   
1152 N N     . GLU B 5   ? 0.5720 0.2098 0.2306 -0.0200 0.0330  0.0591  133 GLU B N     
1153 C CA    . GLU B 5   ? 0.5597 0.2124 0.2243 -0.0073 0.0234  0.0608  133 GLU B CA    
1154 C C     . GLU B 5   ? 0.5261 0.2037 0.2137 -0.0050 0.0186  0.0529  133 GLU B C     
1155 O O     . GLU B 5   ? 0.5250 0.2109 0.2189 0.0054  0.0114  0.0543  133 GLU B O     
1156 C CB    . GLU B 5   ? 0.6007 0.2591 0.2529 -0.0078 0.0216  0.0647  133 GLU B CB    
1157 C CG    . GLU B 5   ? 0.6551 0.2881 0.2804 -0.0092 0.0252  0.0745  133 GLU B CG    
1158 C CD    . GLU B 5   ? 0.7465 0.3848 0.3566 -0.0123 0.0243  0.0772  133 GLU B CD    
1159 O OE1   . GLU B 5   ? 0.8003 0.4499 0.4099 -0.0039 0.0145  0.0798  133 GLU B OE1   
1160 O OE2   . GLU B 5   ? 0.7666 0.3987 0.3657 -0.0238 0.0338  0.0760  133 GLU B OE2   
1161 N N     . ASP B 6   ? 0.4814 0.1720 0.1823 -0.0144 0.0223  0.0451  134 ASP B N     
1162 C CA    . ASP B 6   ? 0.4911 0.2052 0.2121 -0.0120 0.0175  0.0385  134 ASP B CA    
1163 C C     . ASP B 6   ? 0.4902 0.2047 0.2229 -0.0108 0.0157  0.0346  134 ASP B C     
1164 O O     . ASP B 6   ? 0.4983 0.2010 0.2287 -0.0177 0.0200  0.0331  134 ASP B O     
1165 C CB    . ASP B 6   ? 0.4906 0.2195 0.2215 -0.0213 0.0221  0.0329  134 ASP B CB    
1166 C CG    . ASP B 6   ? 0.5454 0.2777 0.2659 -0.0224 0.0244  0.0344  134 ASP B CG    
1167 O OD1   . ASP B 6   ? 0.5462 0.2733 0.2531 -0.0161 0.0197  0.0394  134 ASP B OD1   
1168 O OD2   . ASP B 6   ? 0.5392 0.2807 0.2666 -0.0299 0.0309  0.0300  134 ASP B OD2   
1169 N N     . PRO B 7   ? 0.4819 0.2101 0.2264 -0.0033 0.0096  0.0323  135 PRO B N     
1170 C CA    . PRO B 7   ? 0.4947 0.2270 0.2505 -0.0047 0.0086  0.0271  135 PRO B CA    
1171 C C     . PRO B 7   ? 0.4930 0.2358 0.2595 -0.0154 0.0107  0.0217  135 PRO B C     
1172 O O     . PRO B 7   ? 0.4766 0.2326 0.2492 -0.0186 0.0119  0.0204  135 PRO B O     
1173 C CB    . PRO B 7   ? 0.4680 0.2169 0.2350 0.0035  0.0025  0.0257  135 PRO B CB    
1174 C CG    . PRO B 7   ? 0.4808 0.2282 0.2402 0.0112  -0.0003 0.0315  135 PRO B CG    
1175 C CD    . PRO B 7   ? 0.4786 0.2183 0.2253 0.0055  0.0033  0.0344  135 PRO B CD    
1176 N N     . LYS B 8   ? 0.4404 0.1786 0.2097 -0.0205 0.0109  0.0185  136 LYS B N     
1177 C CA    . LYS B 8   ? 0.4305 0.1799 0.2111 -0.0310 0.0114  0.0144  136 LYS B CA    
1178 C C     . LYS B 8   ? 0.4379 0.2027 0.2324 -0.0292 0.0053  0.0105  136 LYS B C     
1179 O O     . LYS B 8   ? 0.4354 0.2122 0.2415 -0.0363 0.0035  0.0079  136 LYS B O     
1180 C CB    . LYS B 8   ? 0.4658 0.1997 0.2384 -0.0416 0.0151  0.0138  136 LYS B CB    
1181 C CG    . LYS B 8   ? 0.4618 0.1764 0.2183 -0.0446 0.0218  0.0181  136 LYS B CG    
1182 C CD    . LYS B 8   ? 0.4622 0.1875 0.2217 -0.0463 0.0255  0.0201  136 LYS B CD    
1183 C CE    . LYS B 8   ? 0.5039 0.2090 0.2456 -0.0513 0.0328  0.0248  136 LYS B CE    
1184 N NZ    . LYS B 8   ? 0.5258 0.2070 0.2487 -0.0424 0.0322  0.0301  136 LYS B NZ    
1185 N N     . ASP B 9   ? 0.4152 0.1788 0.2079 -0.0201 0.0022  0.0109  137 ASP B N     
1186 C CA    . ASP B 9   ? 0.4309 0.2038 0.2318 -0.0184 -0.0024 0.0080  137 ASP B CA    
1187 C C     . ASP B 9   ? 0.4338 0.2085 0.2342 -0.0076 -0.0040 0.0095  137 ASP B C     
1188 O O     . ASP B 9   ? 0.4108 0.1782 0.2040 -0.0016 -0.0024 0.0129  137 ASP B O     
1189 C CB    . ASP B 9   ? 0.4284 0.1898 0.2226 -0.0244 -0.0027 0.0055  137 ASP B CB    
1190 C CG    . ASP B 9   ? 0.4370 0.2111 0.2403 -0.0275 -0.0083 0.0027  137 ASP B CG    
1191 O OD1   . ASP B 9   ? 0.4561 0.2448 0.2700 -0.0224 -0.0115 0.0029  137 ASP B OD1   
1192 O OD2   . ASP B 9   ? 0.4511 0.2188 0.2492 -0.0356 -0.0097 0.0004  137 ASP B OD2   
1193 N N     . PHE B 10  ? 0.4039 0.1885 0.2121 -0.0057 -0.0076 0.0073  138 PHE B N     
1194 C CA    . PHE B 10  ? 0.3847 0.1709 0.1933 0.0026  -0.0085 0.0081  138 PHE B CA    
1195 C C     . PHE B 10  ? 0.4298 0.1996 0.2281 0.0069  -0.0048 0.0090  138 PHE B C     
1196 O O     . PHE B 10  ? 0.4561 0.2106 0.2447 0.0020  -0.0018 0.0077  138 PHE B O     
1197 C CB    . PHE B 10  ? 0.3933 0.1905 0.2102 0.0021  -0.0118 0.0056  138 PHE B CB    
1198 C CG    . PHE B 10  ? 0.3400 0.1519 0.1674 0.0018  -0.0147 0.0052  138 PHE B CG    
1199 C CD1   . PHE B 10  ? 0.3240 0.1417 0.1576 -0.0036 -0.0155 0.0043  138 PHE B CD1   
1200 C CD2   . PHE B 10  ? 0.3349 0.1547 0.1668 0.0065  -0.0162 0.0054  138 PHE B CD2   
1201 C CE1   . PHE B 10  ? 0.3353 0.1643 0.1784 -0.0027 -0.0167 0.0035  138 PHE B CE1   
1202 C CE2   . PHE B 10  ? 0.3215 0.1515 0.1611 0.0056  -0.0180 0.0043  138 PHE B CE2   
1203 C CZ    . PHE B 10  ? 0.3203 0.1534 0.1647 0.0016  -0.0178 0.0032  138 PHE B CZ    
1204 N N     . PRO B 11  ? 0.4172 0.1899 0.2178 0.0160  -0.0045 0.0111  139 PRO B N     
1205 C CA    . PRO B 11  ? 0.4164 0.1755 0.2105 0.0221  0.0000  0.0120  139 PRO B CA    
1206 C C     . PRO B 11  ? 0.4521 0.2034 0.2414 0.0180  0.0027  0.0073  139 PRO B C     
1207 O O     . PRO B 11  ? 0.4016 0.1644 0.1968 0.0144  -0.0003 0.0047  139 PRO B O     
1208 C CB    . PRO B 11  ? 0.4280 0.2006 0.2322 0.0320  -0.0016 0.0149  139 PRO B CB    
1209 C CG    . PRO B 11  ? 0.4334 0.2210 0.2436 0.0304  -0.0072 0.0168  139 PRO B CG    
1210 C CD    . PRO B 11  ? 0.4178 0.2071 0.2278 0.0206  -0.0084 0.0130  139 PRO B CD    
1211 N N     . SER B 12  ? 0.4562 0.1864 0.2330 0.0188  0.0086  0.0064  140 SER B N     
1212 C CA    A SER B 12  ? 0.5058 0.2234 0.2721 0.0122  0.0116  0.0010  140 SER B CA    
1213 C CA    B SER B 12  ? 0.5008 0.2183 0.2670 0.0123  0.0117  0.0010  140 SER B CA    
1214 C C     . SER B 12  ? 0.4894 0.2159 0.2603 0.0154  0.0126  -0.0012 140 SER B C     
1215 O O     . SER B 12  ? 0.5009 0.2260 0.2661 0.0077  0.0114  -0.0051 140 SER B O     
1216 C CB    A SER B 12  ? 0.5350 0.2247 0.2851 0.0137  0.0195  0.0000  140 SER B CB    
1217 C CB    B SER B 12  ? 0.5261 0.2155 0.2760 0.0137  0.0196  0.0000  140 SER B CB    
1218 O OG    A SER B 12  ? 0.5463 0.2325 0.2997 0.0276  0.0249  0.0032  140 SER B OG    
1219 O OG    B SER B 12  ? 0.5275 0.2068 0.2719 0.0104  0.0195  0.0027  140 SER B OG    
1220 N N     . GLU B 13  ? 0.5133 0.2498 0.2947 0.0260  0.0144  0.0015  141 GLU B N     
1221 C CA    . GLU B 13  ? 0.5288 0.2758 0.3165 0.0285  0.0163  -0.0002 141 GLU B CA    
1222 C C     . GLU B 13  ? 0.4634 0.2256 0.2563 0.0203  0.0096  -0.0017 141 GLU B C     
1223 O O     . GLU B 13  ? 0.4839 0.2491 0.2760 0.0190  0.0117  -0.0038 141 GLU B O     
1224 C CB    . GLU B 13  ? 0.5700 0.3342 0.3742 0.0393  0.0161  0.0042  141 GLU B CB    
1225 C CG    . GLU B 13  ? 0.5934 0.3496 0.3991 0.0512  0.0223  0.0073  141 GLU B CG    
1226 C CD    . GLU B 13  ? 0.6613 0.4130 0.4658 0.0551  0.0187  0.0127  141 GLU B CD    
1227 O OE1   . GLU B 13  ? 0.5686 0.3143 0.3650 0.0467  0.0146  0.0124  141 GLU B OE1   
1228 O OE2   . GLU B 13  ? 0.6874 0.4411 0.4991 0.0668  0.0208  0.0176  141 GLU B OE2   
1229 N N     . LEU B 14  ? 0.4287 0.1992 0.2264 0.0156  0.0026  -0.0002 142 LEU B N     
1230 C CA    . LEU B 14  ? 0.3969 0.1812 0.2017 0.0104  -0.0035 -0.0004 142 LEU B CA    
1231 C C     . LEU B 14  ? 0.3933 0.1733 0.1919 0.0006  -0.0078 -0.0020 142 LEU B C     
1232 O O     . LEU B 14  ? 0.3776 0.1675 0.1817 -0.0029 -0.0128 -0.0017 142 LEU B O     
1233 C CB    . LEU B 14  ? 0.3832 0.1824 0.2005 0.0130  -0.0078 0.0023  142 LEU B CB    
1234 C CG    . LEU B 14  ? 0.3902 0.1977 0.2153 0.0214  -0.0061 0.0047  142 LEU B CG    
1235 C CD1   . LEU B 14  ? 0.3763 0.1954 0.2089 0.0219  -0.0110 0.0068  142 LEU B CD1   
1236 C CD2   . LEU B 14  ? 0.3697 0.1856 0.2009 0.0234  -0.0041 0.0039  142 LEU B CD2   
1237 N N     . LEU B 15  ? 0.4075 0.1736 0.1958 -0.0036 -0.0062 -0.0033 143 LEU B N     
1238 C CA    . LEU B 15  ? 0.4100 0.1761 0.1958 -0.0137 -0.0115 -0.0042 143 LEU B CA    
1239 C C     . LEU B 15  ? 0.4412 0.2083 0.2216 -0.0200 -0.0158 -0.0057 143 LEU B C     
1240 O O     . LEU B 15  ? 0.4425 0.2192 0.2286 -0.0261 -0.0230 -0.0045 143 LEU B O     
1241 C CB    . LEU B 15  ? 0.4581 0.2072 0.2322 -0.0188 -0.0084 -0.0058 143 LEU B CB    
1242 C CG    . LEU B 15  ? 0.4730 0.2207 0.2512 -0.0150 -0.0057 -0.0031 143 LEU B CG    
1243 C CD1   . LEU B 15  ? 0.5116 0.2378 0.2753 -0.0200 -0.0011 -0.0045 143 LEU B CD1   
1244 C CD2   . LEU B 15  ? 0.4635 0.2287 0.2558 -0.0170 -0.0102 -0.0008 143 LEU B CD2   
1245 N N     . SER B 16  ? 0.4399 0.1977 0.2093 -0.0186 -0.0114 -0.0078 144 SER B N     
1246 C CA    . SER B 16  ? 0.4332 0.1886 0.1921 -0.0257 -0.0153 -0.0089 144 SER B CA    
1247 C C     . SER B 16  ? 0.4278 0.1993 0.1987 -0.0237 -0.0207 -0.0055 144 SER B C     
1248 O O     . SER B 16  ? 0.4298 0.2014 0.1939 -0.0292 -0.0259 -0.0045 144 SER B O     
1249 C CB    . SER B 16  ? 0.4557 0.1941 0.1965 -0.0256 -0.0073 -0.0128 144 SER B CB    
1250 O OG    . SER B 16  ? 0.4554 0.1986 0.2024 -0.0169 -0.0008 -0.0122 144 SER B OG    
1251 N N     . PHE B 17  ? 0.4065 0.1897 0.1931 -0.0162 -0.0195 -0.0034 145 PHE B N     
1252 C CA    . PHE B 17  ? 0.3806 0.1762 0.1778 -0.0144 -0.0233 -0.0007 145 PHE B CA    
1253 C C     . PHE B 17  ? 0.3869 0.1937 0.1968 -0.0156 -0.0303 0.0019  145 PHE B C     
1254 O O     . PHE B 17  ? 0.3880 0.2023 0.2055 -0.0143 -0.0337 0.0044  145 PHE B O     
1255 C CB    . PHE B 17  ? 0.3852 0.1875 0.1913 -0.0072 -0.0184 -0.0004 145 PHE B CB    
1256 C CG    . PHE B 17  ? 0.4100 0.2053 0.2092 -0.0039 -0.0104 -0.0024 145 PHE B CG    
1257 C CD1   . PHE B 17  ? 0.4441 0.2283 0.2281 -0.0077 -0.0069 -0.0043 145 PHE B CD1   
1258 C CD2   . PHE B 17  ? 0.3842 0.1851 0.1924 0.0034  -0.0059 -0.0021 145 PHE B CD2   
1259 C CE1   . PHE B 17  ? 0.4339 0.2120 0.2131 -0.0036 0.0027  -0.0065 145 PHE B CE1   
1260 C CE2   . PHE B 17  ? 0.4270 0.2242 0.2329 0.0081  0.0021  -0.0033 145 PHE B CE2   
1261 C CZ    . PHE B 17  ? 0.4504 0.2359 0.2422 0.0048  0.0073  -0.0059 145 PHE B CZ    
1262 N N     . LEU B 18  ? 0.3806 0.1878 0.1929 -0.0182 -0.0315 0.0014  146 LEU B N     
1263 C CA    . LEU B 18  ? 0.3618 0.1805 0.1884 -0.0182 -0.0351 0.0032  146 LEU B CA    
1264 C C     . LEU B 18  ? 0.3640 0.1862 0.1916 -0.0255 -0.0419 0.0044  146 LEU B C     
1265 O O     . LEU B 18  ? 0.4264 0.2395 0.2407 -0.0325 -0.0435 0.0029  146 LEU B O     
1266 C CB    . LEU B 18  ? 0.3399 0.1579 0.1697 -0.0160 -0.0303 0.0021  146 LEU B CB    
1267 C CG    . LEU B 18  ? 0.3509 0.1677 0.1807 -0.0088 -0.0251 0.0017  146 LEU B CG    
1268 C CD1   . LEU B 18  ? 0.3844 0.1983 0.2138 -0.0074 -0.0215 0.0018  146 LEU B CD1   
1269 C CD2   . LEU B 18  ? 0.3903 0.2174 0.2304 -0.0051 -0.0265 0.0027  146 LEU B CD2   
1270 N N     . SER B 19  ? 0.3571 0.1929 0.2009 -0.0242 -0.0459 0.0071  147 SER B N     
1271 C CA    . SER B 19  ? 0.3699 0.2152 0.2221 -0.0302 -0.0521 0.0089  147 SER B CA    
1272 C C     . SER B 19  ? 0.4062 0.2544 0.2647 -0.0326 -0.0476 0.0071  147 SER B C     
1273 O O     . SER B 19  ? 0.3592 0.2108 0.2257 -0.0268 -0.0420 0.0067  147 SER B O     
1274 C CB    . SER B 19  ? 0.3863 0.2459 0.2558 -0.0262 -0.0574 0.0132  147 SER B CB    
1275 O OG    . SER B 19  ? 0.3980 0.2707 0.2793 -0.0319 -0.0635 0.0153  147 SER B OG    
1276 N N     . HIS B 20  ? 0.3817 0.2266 0.2341 -0.0420 -0.0497 0.0059  148 HIS B N     
1277 C CA    . HIS B 20  ? 0.4338 0.2808 0.2913 -0.0467 -0.0458 0.0046  148 HIS B CA    
1278 C C     . HIS B 20  ? 0.4237 0.2919 0.3032 -0.0503 -0.0500 0.0072  148 HIS B C     
1279 O O     . HIS B 20  ? 0.4324 0.3048 0.3191 -0.0540 -0.0451 0.0064  148 HIS B O     
1280 C CB    . HIS B 20  ? 0.4442 0.2728 0.2817 -0.0554 -0.0437 0.0013  148 HIS B CB    
1281 C CG    . HIS B 20  ? 0.4863 0.2964 0.3060 -0.0496 -0.0386 -0.0008 148 HIS B CG    
1282 N ND1   . HIS B 20  ? 0.4483 0.2542 0.2684 -0.0406 -0.0315 -0.0007 148 HIS B ND1   
1283 C CD2   . HIS B 20  ? 0.5070 0.3044 0.3101 -0.0508 -0.0395 -0.0026 148 HIS B CD2   
1284 C CE1   . HIS B 20  ? 0.4784 0.2720 0.2860 -0.0359 -0.0285 -0.0020 148 HIS B CE1   
1285 N NE2   . HIS B 20  ? 0.4912 0.2792 0.2883 -0.0417 -0.0323 -0.0034 148 HIS B NE2   
1286 N N     . ALA B 21  ? 0.3884 0.2703 0.2802 -0.0478 -0.0576 0.0108  149 ALA B N     
1287 C CA    . ALA B 21  ? 0.3954 0.3004 0.3118 -0.0500 -0.0622 0.0141  149 ALA B CA    
1288 C C     . ALA B 21  ? 0.3883 0.3029 0.3227 -0.0393 -0.0552 0.0150  149 ALA B C     
1289 O O     . ALA B 21  ? 0.3588 0.2824 0.3060 -0.0315 -0.0583 0.0183  149 ALA B O     
1290 C CB    . ALA B 21  ? 0.4047 0.3190 0.3251 -0.0514 -0.0748 0.0187  149 ALA B CB    
1291 N N     . VAL B 22  ? 0.3838 0.2932 0.3161 -0.0391 -0.0451 0.0118  150 VAL B N     
1292 C CA    . VAL B 22  ? 0.3843 0.2973 0.3265 -0.0300 -0.0366 0.0111  150 VAL B CA    
1293 C C     . VAL B 22  ? 0.3708 0.3055 0.3406 -0.0265 -0.0357 0.0135  150 VAL B C     
1294 O O     . VAL B 22  ? 0.3449 0.2808 0.3220 -0.0175 -0.0300 0.0130  150 VAL B O     
1295 C CB    . VAL B 22  ? 0.3843 0.2860 0.3148 -0.0316 -0.0267 0.0078  150 VAL B CB    
1296 C CG1   . VAL B 22  ? 0.3908 0.2720 0.2972 -0.0311 -0.0266 0.0061  150 VAL B CG1   
1297 C CG2   . VAL B 22  ? 0.4136 0.3221 0.3506 -0.0411 -0.0234 0.0075  150 VAL B CG2   
1298 N N     . PHE B 23  ? 0.3717 0.3235 0.3571 -0.0337 -0.0411 0.0160  151 PHE B N     
1299 C CA    . PHE B 23  ? 0.4053 0.3819 0.4219 -0.0296 -0.0410 0.0193  151 PHE B CA    
1300 C C     . PHE B 23  ? 0.3962 0.3846 0.4261 -0.0240 -0.0529 0.0252  151 PHE B C     
1301 O O     . PHE B 23  ? 0.3813 0.3921 0.4392 -0.0199 -0.0547 0.0293  151 PHE B O     
1302 C CB    . PHE B 23  ? 0.4244 0.4172 0.4550 -0.0406 -0.0395 0.0192  151 PHE B CB    
1303 C CG    . PHE B 23  ? 0.4601 0.4401 0.4767 -0.0466 -0.0279 0.0146  151 PHE B CG    
1304 C CD1   . PHE B 23  ? 0.4823 0.4561 0.4973 -0.0392 -0.0153 0.0119  151 PHE B CD1   
1305 C CD2   . PHE B 23  ? 0.4995 0.4706 0.5013 -0.0599 -0.0296 0.0130  151 PHE B CD2   
1306 C CE1   . PHE B 23  ? 0.5617 0.5227 0.5615 -0.0447 -0.0054 0.0088  151 PHE B CE1   
1307 C CE2   . PHE B 23  ? 0.5609 0.5174 0.5480 -0.0647 -0.0189 0.0098  151 PHE B CE2   
1308 C CZ    . PHE B 23  ? 0.5409 0.4933 0.5274 -0.0571 -0.0072 0.0082  151 PHE B CZ    
1309 N N     . SER B 24  ? 0.3763 0.3498 0.3865 -0.0234 -0.0606 0.0263  152 SER B N     
1310 C CA    . SER B 24  ? 0.3994 0.3805 0.4158 -0.0205 -0.0734 0.0328  152 SER B CA    
1311 C C     . SER B 24  ? 0.3920 0.3789 0.4265 -0.0061 -0.0709 0.0364  152 SER B C     
1312 O O     . SER B 24  ? 0.3879 0.3637 0.4190 0.0013  -0.0598 0.0326  152 SER B O     
1313 C CB    . SER B 24  ? 0.4169 0.3761 0.4031 -0.0235 -0.0792 0.0321  152 SER B CB    
1314 O OG    . SER B 24  ? 0.4698 0.4298 0.4560 -0.0188 -0.0894 0.0384  152 SER B OG    
1315 N N     . ASN B 25  ? 0.3569 0.3613 0.4110 -0.0023 -0.0812 0.0440  153 ASN B N     
1316 C CA    . ASN B 25  ? 0.3707 0.3767 0.4396 0.0125  -0.0805 0.0490  153 ASN B CA    
1317 C C     . ASN B 25  ? 0.3872 0.3698 0.4318 0.0162  -0.0846 0.0507  153 ASN B C     
1318 O O     . ASN B 25  ? 0.3673 0.3465 0.4197 0.0275  -0.0844 0.0550  153 ASN B O     
1319 C CB    . ASN B 25  ? 0.3579 0.3928 0.4599 0.0169  -0.0898 0.0577  153 ASN B CB    
1320 C CG    . ASN B 25  ? 0.3662 0.4069 0.4615 0.0104  -0.1087 0.0651  153 ASN B CG    
1321 O OD1   . ASN B 25  ? 0.3629 0.3830 0.4275 0.0045  -0.1139 0.0640  153 ASN B OD1   
1322 N ND2   . ASN B 25  ? 0.3541 0.4240 0.4780 0.0105  -0.1188 0.0724  153 ASN B ND2   
1323 N N     . ARG B 26  ? 0.3836 0.3489 0.3989 0.0072  -0.0870 0.0473  154 ARG B N     
1324 C CA    . ARG B 26  ? 0.4592 0.4042 0.4530 0.0099  -0.0900 0.0492  154 ARG B CA    
1325 C C     . ARG B 26  ? 0.4241 0.3516 0.4095 0.0164  -0.0776 0.0439  154 ARG B C     
1326 O O     . ARG B 26  ? 0.4967 0.4184 0.4741 0.0130  -0.0688 0.0368  154 ARG B O     
1327 C CB    . ARG B 26  ? 0.5381 0.4713 0.5043 -0.0015 -0.0964 0.0477  154 ARG B CB    
1328 C CG    . ARG B 26  ? 0.6480 0.5606 0.5914 0.0003  -0.0977 0.0493  154 ARG B CG    
1329 C CD    . ARG B 26  ? 0.7248 0.6271 0.6417 -0.0108 -0.1042 0.0487  154 ARG B CD    
1330 N NE    . ARG B 26  ? 0.7550 0.6477 0.6568 -0.0177 -0.0960 0.0401  154 ARG B NE    
1331 C CZ    . ARG B 26  ? 0.6669 0.5419 0.5493 -0.0181 -0.0884 0.0355  154 ARG B CZ    
1332 N NH1   . ARG B 26  ? 0.5897 0.4538 0.4634 -0.0137 -0.0873 0.0379  154 ARG B NH1   
1333 N NH2   . ARG B 26  ? 0.5505 0.4189 0.4226 -0.0231 -0.0816 0.0288  154 ARG B NH2   
1334 N N     . THR B 27  ? 0.3730 0.2916 0.3599 0.0255  -0.0772 0.0477  155 THR B N     
1335 C CA    . THR B 27  ? 0.3697 0.2722 0.3481 0.0295  -0.0656 0.0418  155 THR B CA    
1336 C C     . THR B 27  ? 0.3715 0.2555 0.3233 0.0240  -0.0659 0.0396  155 THR B C     
1337 O O     . THR B 27  ? 0.3779 0.2575 0.3171 0.0200  -0.0747 0.0443  155 THR B O     
1338 C CB    . THR B 27  ? 0.3716 0.2700 0.3634 0.0413  -0.0614 0.0447  155 THR B CB    
1339 O OG1   . THR B 27  ? 0.4077 0.2976 0.3933 0.0444  -0.0703 0.0529  155 THR B OG1   
1340 C CG2   . THR B 27  ? 0.3677 0.2871 0.3899 0.0482  -0.0597 0.0471  155 THR B CG2   
1341 N N     . LEU B 28  ? 0.3612 0.2348 0.3042 0.0236  -0.0563 0.0328  156 LEU B N     
1342 C CA    . LEU B 28  ? 0.3778 0.2375 0.2991 0.0182  -0.0547 0.0297  156 LEU B CA    
1343 C C     . LEU B 28  ? 0.3406 0.1891 0.2586 0.0213  -0.0463 0.0254  156 LEU B C     
1344 O O     . LEU B 28  ? 0.3505 0.2000 0.2797 0.0268  -0.0407 0.0235  156 LEU B O     
1345 C CB    . LEU B 28  ? 0.3970 0.2597 0.3097 0.0111  -0.0526 0.0245  156 LEU B CB    
1346 C CG    . LEU B 28  ? 0.5035 0.3745 0.4156 0.0053  -0.0595 0.0265  156 LEU B CG    
1347 C CD1   . LEU B 28  ? 0.5939 0.4639 0.4981 -0.0001 -0.0551 0.0211  156 LEU B CD1   
1348 C CD2   . LEU B 28  ? 0.5284 0.3919 0.4259 0.0017  -0.0669 0.0306  156 LEU B CD2   
1349 N N     . ALA B 29  ? 0.3600 0.1979 0.2623 0.0171  -0.0446 0.0233  157 ALA B N     
1350 C CA    . ALA B 29  ? 0.3404 0.1683 0.2384 0.0177  -0.0374 0.0187  157 ALA B CA    
1351 C C     . ALA B 29  ? 0.3594 0.1870 0.2465 0.0118  -0.0345 0.0138  157 ALA B C     
1352 O O     . ALA B 29  ? 0.3507 0.1713 0.2318 0.0098  -0.0308 0.0108  157 ALA B O     
1353 C CB    . ALA B 29  ? 0.3676 0.1820 0.2598 0.0189  -0.0388 0.0231  157 ALA B CB    
1354 N N     . CYS B 30  ? 0.3403 0.1759 0.2257 0.0091  -0.0360 0.0128  158 CYS B N     
1355 C CA    . CYS B 30  ? 0.3558 0.1918 0.2328 0.0055  -0.0332 0.0089  158 CYS B CA    
1356 C C     . CYS B 30  ? 0.3314 0.1747 0.2114 0.0053  -0.0325 0.0071  158 CYS B C     
1357 O O     . CYS B 30  ? 0.3273 0.1746 0.2098 0.0044  -0.0361 0.0095  158 CYS B O     
1358 C CB    . CYS B 30  ? 0.3844 0.2170 0.2508 0.0018  -0.0351 0.0106  158 CYS B CB    
1359 S SG    . CYS B 30  ? 0.3801 0.2152 0.2410 -0.0003 -0.0305 0.0063  158 CYS B SG    
1360 N N     . PHE B 31  ? 0.3482 0.1929 0.2272 0.0054  -0.0283 0.0034  159 PHE B N     
1361 C CA    . PHE B 31  ? 0.3365 0.1858 0.2169 0.0051  -0.0265 0.0020  159 PHE B CA    
1362 C C     . PHE B 31  ? 0.3271 0.1757 0.1994 0.0041  -0.0244 -0.0001 159 PHE B C     
1363 O O     . PHE B 31  ? 0.3167 0.1641 0.1856 0.0038  -0.0240 -0.0014 159 PHE B O     
1364 C CB    . PHE B 31  ? 0.3484 0.2005 0.2374 0.0075  -0.0226 0.0004  159 PHE B CB    
1365 C CG    . PHE B 31  ? 0.3339 0.1880 0.2346 0.0108  -0.0242 0.0031  159 PHE B CG    
1366 C CD1   . PHE B 31  ? 0.3410 0.1886 0.2433 0.0137  -0.0233 0.0032  159 PHE B CD1   
1367 C CD2   . PHE B 31  ? 0.3104 0.1730 0.2210 0.0108  -0.0266 0.0059  159 PHE B CD2   
1368 C CE1   . PHE B 31  ? 0.3368 0.1859 0.2505 0.0183  -0.0247 0.0067  159 PHE B CE1   
1369 C CE2   . PHE B 31  ? 0.3207 0.1883 0.2447 0.0147  -0.0290 0.0094  159 PHE B CE2   
1370 C CZ    . PHE B 31  ? 0.3181 0.1786 0.2438 0.0194  -0.0281 0.0103  159 PHE B CZ    
1371 N N     . ALA B 32  ? 0.3263 0.1756 0.1958 0.0034  -0.0236 0.0001  160 ALA B N     
1372 C CA    . ALA B 32  ? 0.3382 0.1865 0.2007 0.0039  -0.0221 -0.0005 160 ALA B CA    
1373 C C     . ALA B 32  ? 0.3238 0.1720 0.1850 0.0033  -0.0190 -0.0009 160 ALA B C     
1374 O O     . ALA B 32  ? 0.3334 0.1831 0.1997 0.0016  -0.0179 -0.0005 160 ALA B O     
1375 C CB    . ALA B 32  ? 0.3621 0.2071 0.2190 0.0040  -0.0229 0.0010  160 ALA B CB    
1376 N N     . ILE B 33  ? 0.3181 0.1658 0.1729 0.0040  -0.0179 -0.0016 161 ILE B N     
1377 C CA    A ILE B 33  ? 0.3391 0.1846 0.1881 0.0030  -0.0146 -0.0015 161 ILE B CA    
1378 C CA    B ILE B 33  ? 0.3153 0.1607 0.1642 0.0030  -0.0146 -0.0015 161 ILE B CA    
1379 C C     . ILE B 33  ? 0.3401 0.1820 0.1794 0.0047  -0.0160 0.0013  161 ILE B C     
1380 O O     . ILE B 33  ? 0.3594 0.2044 0.1969 0.0067  -0.0192 0.0019  161 ILE B O     
1381 C CB    A ILE B 33  ? 0.3525 0.1987 0.1998 0.0021  -0.0115 -0.0048 161 ILE B CB    
1382 C CB    B ILE B 33  ? 0.2978 0.1442 0.1458 0.0021  -0.0114 -0.0047 161 ILE B CB    
1383 C CG1   A ILE B 33  ? 0.3742 0.2227 0.2324 0.0024  -0.0090 -0.0071 161 ILE B CG1   
1384 C CG1   B ILE B 33  ? 0.2850 0.1339 0.1444 0.0021  -0.0082 -0.0065 161 ILE B CG1   
1385 C CG2   A ILE B 33  ? 0.3723 0.2149 0.2093 0.0004  -0.0077 -0.0045 161 ILE B CG2   
1386 C CG2   B ILE B 33  ? 0.3147 0.1573 0.1518 0.0005  -0.0079 -0.0044 161 ILE B CG2   
1387 C CD1   A ILE B 33  ? 0.3881 0.2394 0.2539 0.0016  -0.0053 -0.0063 161 ILE B CD1   
1388 C CD1   B ILE B 33  ? 0.2780 0.1253 0.1370 0.0022  -0.0033 -0.0107 161 ILE B CD1   
1389 N N     . TYR B 34  ? 0.3342 0.1699 0.1683 0.0038  -0.0137 0.0036  162 TYR B N     
1390 C CA    . TYR B 34  ? 0.3657 0.1953 0.1899 0.0064  -0.0144 0.0072  162 TYR B CA    
1391 C C     . TYR B 34  ? 0.3607 0.1861 0.1752 0.0041  -0.0113 0.0083  162 TYR B C     
1392 O O     . TYR B 34  ? 0.3537 0.1767 0.1685 0.0000  -0.0065 0.0073  162 TYR B O     
1393 C CB    . TYR B 34  ? 0.3705 0.1914 0.1926 0.0066  -0.0132 0.0091  162 TYR B CB    
1394 C CG    . TYR B 34  ? 0.3739 0.1855 0.1866 0.0110  -0.0130 0.0134  162 TYR B CG    
1395 C CD1   . TYR B 34  ? 0.3934 0.2091 0.2050 0.0172  -0.0166 0.0163  162 TYR B CD1   
1396 C CD2   . TYR B 34  ? 0.4383 0.2365 0.2441 0.0092  -0.0096 0.0149  162 TYR B CD2   
1397 C CE1   . TYR B 34  ? 0.4491 0.2563 0.2540 0.0232  -0.0166 0.0214  162 TYR B CE1   
1398 C CE2   . TYR B 34  ? 0.4432 0.2299 0.2402 0.0144  -0.0088 0.0191  162 TYR B CE2   
1399 C CZ    . TYR B 34  ? 0.4561 0.2473 0.2535 0.0225  -0.0121 0.0227  162 TYR B CZ    
1400 O OH    . TYR B 34  ? 0.5609 0.3393 0.3505 0.0291  -0.0108 0.0280  162 TYR B OH    
1401 N N     . THR B 35  ? 0.3565 0.1828 0.1632 0.0063  -0.0142 0.0101  163 THR B N     
1402 C CA    . THR B 35  ? 0.3590 0.1801 0.1516 0.0036  -0.0118 0.0114  163 THR B CA    
1403 C C     . THR B 35  ? 0.3919 0.2124 0.1735 0.0070  -0.0176 0.0162  163 THR B C     
1404 O O     . THR B 35  ? 0.3961 0.2212 0.1831 0.0122  -0.0228 0.0189  163 THR B O     
1405 C CB    . THR B 35  ? 0.3895 0.2148 0.1840 -0.0008 -0.0076 0.0055  163 THR B CB    
1406 O OG1   . THR B 35  ? 0.4091 0.2277 0.1897 -0.0046 -0.0024 0.0059  163 THR B OG1   
1407 C CG2   . THR B 35  ? 0.4079 0.2404 0.2044 -0.0006 -0.0119 0.0021  163 THR B CG2   
1408 N N     . THR B 36  ? 0.3978 0.2133 0.1637 0.0041  -0.0166 0.0176  164 THR B N     
1409 C CA    . THR B 36  ? 0.4340 0.2500 0.1881 0.0068  -0.0238 0.0231  164 THR B CA    
1410 C C     . THR B 36  ? 0.4101 0.2391 0.1689 0.0062  -0.0307 0.0203  164 THR B C     
1411 O O     . THR B 36  ? 0.3862 0.2203 0.1518 0.0022  -0.0285 0.0132  164 THR B O     
1412 C CB    . THR B 36  ? 0.4666 0.2721 0.1983 0.0025  -0.0213 0.0257  164 THR B CB    
1413 O OG1   . THR B 36  ? 0.4583 0.2655 0.1857 -0.0044 -0.0165 0.0183  164 THR B OG1   
1414 C CG2   . THR B 36  ? 0.4839 0.2757 0.2102 0.0019  -0.0141 0.0291  164 THR B CG2   
1415 N N     . LYS B 37  ? 0.4441 0.2791 0.1998 0.0102  -0.0395 0.0261  165 LYS B N     
1416 C CA    . LYS B 37  ? 0.4370 0.2865 0.1971 0.0079  -0.0473 0.0238  165 LYS B CA    
1417 C C     . LYS B 37  ? 0.4402 0.2873 0.1860 -0.0015 -0.0461 0.0173  165 LYS B C     
1418 O O     . LYS B 37  ? 0.4132 0.2663 0.1651 -0.0061 -0.0463 0.0105  165 LYS B O     
1424 N N     . GLU B 38  ? 0.4394 0.2754 0.1642 -0.0047 -0.0439 0.0191  166 GLU B N     
1425 C CA    . GLU B 38  ? 0.4851 0.3165 0.1931 -0.0137 -0.0415 0.0123  166 GLU B CA    
1426 C C     . GLU B 38  ? 0.4723 0.2986 0.1879 -0.0169 -0.0299 0.0030  166 GLU B C     
1427 O O     . GLU B 38  ? 0.4986 0.3248 0.2106 -0.0226 -0.0286 -0.0044 166 GLU B O     
1428 C CB    . GLU B 38  ? 0.5273 0.3471 0.2085 -0.0169 -0.0410 0.0166  166 GLU B CB    
1429 C CG    . GLU B 38  ? 0.5814 0.3874 0.2578 -0.0164 -0.0291 0.0174  166 GLU B CG    
1430 C CD    . GLU B 38  ? 0.7079 0.5007 0.3552 -0.0203 -0.0278 0.0223  166 GLU B CD    
1431 O OE1   . GLU B 38  ? 0.7427 0.5371 0.3728 -0.0226 -0.0378 0.0259  166 GLU B OE1   
1432 O OE2   . GLU B 38  ? 0.6959 0.4772 0.3376 -0.0219 -0.0169 0.0225  166 GLU B OE2   
1433 N N     . LYS B 39  ? 0.4765 0.2990 0.2036 -0.0132 -0.0221 0.0036  167 LYS B N     
1434 C CA    . LYS B 39  ? 0.4787 0.2997 0.2174 -0.0145 -0.0126 -0.0037 167 LYS B CA    
1435 C C     . LYS B 39  ? 0.4634 0.2934 0.2208 -0.0127 -0.0162 -0.0069 167 LYS B C     
1436 O O     . LYS B 39  ? 0.4513 0.2797 0.2115 -0.0155 -0.0119 -0.0138 167 LYS B O     
1437 C CB    . LYS B 39  ? 0.4755 0.2925 0.2222 -0.0123 -0.0047 -0.0016 167 LYS B CB    
1438 C CG    . LYS B 39  ? 0.4849 0.2917 0.2139 -0.0157 0.0017  0.0005  167 LYS B CG    
1439 C CD    . LYS B 39  ? 0.5067 0.3108 0.2449 -0.0148 0.0083  0.0033  167 LYS B CD    
1440 C CE    . LYS B 39  ? 0.5303 0.3404 0.2884 -0.0153 0.0160  -0.0024 167 LYS B CE    
1441 N NZ    . LYS B 39  ? 0.4904 0.2984 0.2541 -0.0173 0.0228  0.0002  167 LYS B NZ    
1442 N N     . ALA B 40  ? 0.4176 0.2554 0.1870 -0.0078 -0.0228 -0.0021 168 ALA B N     
1443 C CA    . ALA B 40  ? 0.4039 0.2495 0.1886 -0.0069 -0.0257 -0.0045 168 ALA B CA    
1444 C C     . ALA B 40  ? 0.4340 0.2832 0.2133 -0.0127 -0.0300 -0.0091 168 ALA B C     
1445 O O     . ALA B 40  ? 0.4183 0.2672 0.2055 -0.0147 -0.0276 -0.0142 168 ALA B O     
1446 C CB    . ALA B 40  ? 0.4347 0.2874 0.2306 -0.0011 -0.0308 0.0012  168 ALA B CB    
1447 N N     . ALA B 41  ? 0.4316 0.2829 0.1967 -0.0159 -0.0362 -0.0073 169 ALA B N     
1448 C CA    . ALA B 41  ? 0.4945 0.3503 0.2534 -0.0234 -0.0419 -0.0117 169 ALA B CA    
1449 C C     . ALA B 41  ? 0.5001 0.3427 0.2488 -0.0294 -0.0333 -0.0207 169 ALA B C     
1450 O O     . ALA B 41  ? 0.5077 0.3492 0.2587 -0.0344 -0.0331 -0.0267 169 ALA B O     
1451 C CB    . ALA B 41  ? 0.4928 0.3537 0.2361 -0.0262 -0.0515 -0.0071 169 ALA B CB    
1452 N N     . LEU B 42  ? 0.5095 0.3410 0.2470 -0.0289 -0.0251 -0.0219 170 LEU B N     
1453 C CA    . LEU B 42  ? 0.5837 0.4019 0.3130 -0.0330 -0.0142 -0.0308 170 LEU B CA    
1454 C C     . LEU B 42  ? 0.5343 0.3511 0.2843 -0.0281 -0.0069 -0.0336 170 LEU B C     
1455 O O     . LEU B 42  ? 0.4906 0.2998 0.2411 -0.0304 -0.0021 -0.0402 170 LEU B O     
1456 C CB    . LEU B 42  ? 0.6461 0.4544 0.3582 -0.0341 -0.0062 -0.0311 170 LEU B CB    
1457 C CG    . LEU B 42  ? 0.8114 0.6148 0.4951 -0.0412 -0.0110 -0.0306 170 LEU B CG    
1458 C CD1   . LEU B 42  ? 0.7765 0.5641 0.4386 -0.0466 0.0012  -0.0376 170 LEU B CD1   
1459 C CD2   . LEU B 42  ? 0.8788 0.6883 0.5557 -0.0478 -0.0230 -0.0321 170 LEU B CD2   
1460 N N     . LEU B 43  ? 0.4481 0.2712 0.2143 -0.0212 -0.0067 -0.0279 171 LEU B N     
1461 C CA    . LEU B 43  ? 0.4624 0.2857 0.2474 -0.0165 -0.0016 -0.0289 171 LEU B CA    
1462 C C     . LEU B 43  ? 0.4359 0.2616 0.2304 -0.0169 -0.0060 -0.0301 171 LEU B C     
1463 O O     . LEU B 43  ? 0.4604 0.2816 0.2645 -0.0147 -0.0012 -0.0326 171 LEU B O     
1464 C CB    . LEU B 43  ? 0.4766 0.3064 0.2740 -0.0110 -0.0026 -0.0223 171 LEU B CB    
1465 C CG    . LEU B 43  ? 0.5551 0.3829 0.3573 -0.0090 0.0060  -0.0221 171 LEU B CG    
1466 C CD1   . LEU B 43  ? 0.5267 0.3608 0.3414 -0.0055 0.0029  -0.0163 171 LEU B CD1   
1467 C CD2   . LEU B 43  ? 0.5577 0.3821 0.3693 -0.0074 0.0142  -0.0274 171 LEU B CD2   
1468 N N     . TYR B 44  ? 0.4196 0.2530 0.2121 -0.0197 -0.0151 -0.0278 172 TYR B N     
1469 C CA    . TYR B 44  ? 0.3963 0.2332 0.1975 -0.0217 -0.0190 -0.0287 172 TYR B CA    
1470 C C     . TYR B 44  ? 0.4273 0.2517 0.2226 -0.0265 -0.0137 -0.0362 172 TYR B C     
1471 O O     . TYR B 44  ? 0.4186 0.2382 0.2238 -0.0245 -0.0107 -0.0371 172 TYR B O     
1472 C CB    . TYR B 44  ? 0.4159 0.2645 0.2143 -0.0256 -0.0287 -0.0261 172 TYR B CB    
1473 C CG    . TYR B 44  ? 0.3855 0.2406 0.1932 -0.0292 -0.0326 -0.0268 172 TYR B CG    
1474 C CD1   . TYR B 44  ? 0.3855 0.2480 0.2087 -0.0245 -0.0335 -0.0223 172 TYR B CD1   
1475 C CD2   . TYR B 44  ? 0.4439 0.2970 0.2438 -0.0386 -0.0349 -0.0321 172 TYR B CD2   
1476 C CE1   . TYR B 44  ? 0.3751 0.2434 0.2061 -0.0287 -0.0358 -0.0229 172 TYR B CE1   
1477 C CE2   . TYR B 44  ? 0.4289 0.2882 0.2373 -0.0436 -0.0380 -0.0327 172 TYR B CE2   
1478 C CZ    . TYR B 44  ? 0.4146 0.2819 0.2392 -0.0384 -0.0380 -0.0278 172 TYR B CZ    
1479 O OH    . TYR B 44  ? 0.4263 0.2992 0.2588 -0.0440 -0.0395 -0.0284 172 TYR B OH    
1480 N N     . LYS B 45  ? 0.4131 0.2300 0.1908 -0.0327 -0.0121 -0.0415 173 LYS B N     
1481 C CA    . LYS B 45  ? 0.5022 0.3035 0.2712 -0.0376 -0.0057 -0.0496 173 LYS B CA    
1482 C C     . LYS B 45  ? 0.4588 0.2481 0.2332 -0.0309 0.0064  -0.0523 173 LYS B C     
1483 O O     . LYS B 45  ? 0.4952 0.2727 0.2729 -0.0304 0.0117  -0.0562 173 LYS B O     
1484 C CB    . LYS B 45  ? 0.5862 0.3821 0.3313 -0.0475 -0.0076 -0.0551 173 LYS B CB    
1485 C CG    . LYS B 45  ? 0.7086 0.5198 0.4519 -0.0547 -0.0213 -0.0520 173 LYS B CG    
1486 C CD    . LYS B 45  ? 0.8147 0.6227 0.5608 -0.0625 -0.0231 -0.0565 173 LYS B CD    
1487 C CE    . LYS B 45  ? 0.8931 0.7156 0.6348 -0.0727 -0.0354 -0.0558 173 LYS B CE    
1488 N NZ    . LYS B 45  ? 0.8625 0.7090 0.6211 -0.0673 -0.0449 -0.0462 173 LYS B NZ    
1489 N N     . LYS B 46  ? 0.4265 0.2185 0.2014 -0.0261 0.0109  -0.0502 174 LYS B N     
1490 C CA    . LYS B 46  ? 0.4550 0.2402 0.2380 -0.0196 0.0225  -0.0521 174 LYS B CA    
1491 C C     . LYS B 46  ? 0.4586 0.2484 0.2644 -0.0119 0.0220  -0.0476 174 LYS B C     
1492 O O     . LYS B 46  ? 0.4485 0.2293 0.2618 -0.0073 0.0296  -0.0502 174 LYS B O     
1493 C CB    . LYS B 46  ? 0.4969 0.2869 0.2772 -0.0176 0.0267  -0.0499 174 LYS B CB    
1494 C CG    . LYS B 46  ? 0.5581 0.3393 0.3122 -0.0250 0.0300  -0.0549 174 LYS B CG    
1495 C CD    . LYS B 46  ? 0.6933 0.4572 0.4375 -0.0265 0.0427  -0.0644 174 LYS B CD    
1496 C CE    . LYS B 46  ? 0.7886 0.5425 0.5051 -0.0337 0.0483  -0.0696 174 LYS B CE    
1497 N NZ    . LYS B 46  ? 0.8522 0.6071 0.5488 -0.0433 0.0356  -0.0693 174 LYS B NZ    
1498 N N     . ILE B 47  ? 0.3977 0.2007 0.2136 -0.0100 0.0136  -0.0406 175 ILE B N     
1499 C CA    . ILE B 47  ? 0.4213 0.2284 0.2554 -0.0042 0.0111  -0.0358 175 ILE B CA    
1500 C C     . ILE B 47  ? 0.4690 0.2661 0.3023 -0.0061 0.0106  -0.0382 175 ILE B C     
1501 O O     . ILE B 47  ? 0.4519 0.2432 0.2954 -0.0008 0.0141  -0.0372 175 ILE B O     
1502 C CB    . ILE B 47  ? 0.4034 0.2236 0.2440 -0.0035 0.0024  -0.0289 175 ILE B CB    
1503 C CG1   . ILE B 47  ? 0.4542 0.2815 0.2965 -0.0015 0.0036  -0.0259 175 ILE B CG1   
1504 C CG2   . ILE B 47  ? 0.4076 0.2298 0.2619 0.0005  -0.0007 -0.0246 175 ILE B CG2   
1505 C CD1   . ILE B 47  ? 0.4676 0.2971 0.3235 0.0035  0.0096  -0.0248 175 ILE B CD1   
1506 N N     . MET B 48  ? 0.4606 0.2570 0.2833 -0.0137 0.0055  -0.0403 176 MET B N     
1507 C CA    . MET B 48  ? 0.4981 0.2848 0.3191 -0.0175 0.0050  -0.0425 176 MET B CA    
1508 C C     . MET B 48  ? 0.5454 0.3130 0.3628 -0.0156 0.0148  -0.0481 176 MET B C     
1509 O O     . MET B 48  ? 0.5463 0.3049 0.3709 -0.0122 0.0165  -0.0464 176 MET B O     
1510 C CB    . MET B 48  ? 0.5447 0.3361 0.3546 -0.0278 -0.0016 -0.0448 176 MET B CB    
1511 C CG    . MET B 48  ? 0.5949 0.3770 0.4013 -0.0350 -0.0022 -0.0479 176 MET B CG    
1512 S SD    . MET B 48  ? 0.6234 0.4127 0.4174 -0.0490 -0.0096 -0.0520 176 MET B SD    
1513 C CE    . MET B 48  ? 0.5490 0.3652 0.3551 -0.0458 -0.0193 -0.0436 176 MET B CE    
1514 N N     . GLU B 49  ? 0.5024 0.2624 0.3081 -0.0170 0.0219  -0.0544 177 GLU B N     
1515 C CA    . GLU B 49  ? 0.5952 0.3354 0.3964 -0.0144 0.0334  -0.0608 177 GLU B CA    
1516 C C     . GLU B 49  ? 0.5889 0.3308 0.4093 -0.0017 0.0401  -0.0569 177 GLU B C     
1517 O O     . GLU B 49  ? 0.5895 0.3178 0.4161 0.0040  0.0461  -0.0576 177 GLU B O     
1518 C CB    . GLU B 49  ? 0.6343 0.3664 0.4164 -0.0196 0.0404  -0.0688 177 GLU B CB    
1519 C CG    . GLU B 49  ? 0.7843 0.5120 0.5439 -0.0332 0.0347  -0.0744 177 GLU B CG    
1520 C CD    . GLU B 49  ? 0.8747 0.5996 0.6130 -0.0390 0.0382  -0.0799 177 GLU B CD    
1521 O OE1   . GLU B 49  ? 0.8402 0.5705 0.5810 -0.0333 0.0438  -0.0782 177 GLU B OE1   
1522 O OE2   . GLU B 49  ? 0.9909 0.7080 0.7082 -0.0507 0.0350  -0.0859 177 GLU B OE2   
1523 N N     . LYS B 50  ? 0.4510 0.2096 0.2814 0.0025  0.0389  -0.0524 178 LYS B N     
1524 C CA    . LYS B 50  ? 0.4672 0.2312 0.3176 0.0134  0.0452  -0.0490 178 LYS B CA    
1525 C C     . LYS B 50  ? 0.4417 0.2085 0.3092 0.0197  0.0390  -0.0415 178 LYS B C     
1526 O O     . LYS B 50  ? 0.4933 0.2552 0.3742 0.0287  0.0445  -0.0398 178 LYS B O     
1527 C CB    . LYS B 50  ? 0.4509 0.2334 0.3086 0.0142  0.0434  -0.0450 178 LYS B CB    
1528 C CG    . LYS B 50  ? 0.4323 0.2266 0.3137 0.0234  0.0470  -0.0402 178 LYS B CG    
1529 C CD    . LYS B 50  ? 0.4892 0.2760 0.3776 0.0301  0.0609  -0.0447 178 LYS B CD    
1530 C CE    . LYS B 50  ? 0.5019 0.3072 0.4173 0.0381  0.0629  -0.0389 178 LYS B CE    
1531 N NZ    . LYS B 50  ? 0.5365 0.3352 0.4629 0.0469  0.0771  -0.0427 178 LYS B NZ    
1532 N N     . TYR B 51  ? 0.4243 0.1989 0.2904 0.0153  0.0280  -0.0368 179 TYR B N     
1533 C CA    . TYR B 51  ? 0.4113 0.1901 0.2903 0.0198  0.0211  -0.0289 179 TYR B CA    
1534 C C     . TYR B 51  ? 0.4310 0.1956 0.3017 0.0159  0.0183  -0.0289 179 TYR B C     
1535 O O     . TYR B 51  ? 0.4286 0.1945 0.3060 0.0184  0.0125  -0.0221 179 TYR B O     
1536 C CB    . TYR B 51  ? 0.3894 0.1869 0.2747 0.0189  0.0127  -0.0230 179 TYR B CB    
1537 C CG    . TYR B 51  ? 0.3692 0.1789 0.2665 0.0234  0.0161  -0.0217 179 TYR B CG    
1538 C CD1   . TYR B 51  ? 0.3838 0.1971 0.2992 0.0319  0.0189  -0.0183 179 TYR B CD1   
1539 C CD2   . TYR B 51  ? 0.3810 0.1989 0.2719 0.0190  0.0170  -0.0238 179 TYR B CD2   
1540 C CE1   . TYR B 51  ? 0.3882 0.2149 0.3171 0.0351  0.0228  -0.0173 179 TYR B CE1   
1541 C CE2   . TYR B 51  ? 0.3579 0.1862 0.2598 0.0218  0.0211  -0.0225 179 TYR B CE2   
1542 C CZ    . TYR B 51  ? 0.3636 0.1969 0.2844 0.0292  0.0247  -0.0201 179 TYR B CZ    
1543 O OH    . TYR B 51  ? 0.3721 0.2176 0.3057 0.0311  0.0294  -0.0192 179 TYR B OH    
1544 N N     A SER B 52  ? 0.4175 0.1678 0.2727 0.0091  0.0226  -0.0363 180 SER B N     
1545 N N     B SER B 52  ? 0.4523 0.2035 0.3072 0.0086  0.0221  -0.0362 180 SER B N     
1546 C CA    A SER B 52  ? 0.4248 0.1610 0.2711 0.0029  0.0207  -0.0369 180 SER B CA    
1547 C CA    B SER B 52  ? 0.4887 0.2254 0.3355 0.0031  0.0205  -0.0367 180 SER B CA    
1548 C C     A SER B 52  ? 0.4197 0.1680 0.2703 0.0002  0.0109  -0.0297 180 SER B C     
1549 C C     B SER B 52  ? 0.4555 0.2038 0.3060 0.0002  0.0109  -0.0298 180 SER B C     
1550 O O     A SER B 52  ? 0.4044 0.1454 0.2576 0.0017  0.0089  -0.0248 180 SER B O     
1551 O O     B SER B 52  ? 0.4359 0.1765 0.2886 0.0015  0.0090  -0.0250 180 SER B O     
1552 C CB    A SER B 52  ? 0.4275 0.1417 0.2759 0.0096  0.0282  -0.0373 180 SER B CB    
1553 C CB    B SER B 52  ? 0.5248 0.2422 0.3764 0.0112  0.0274  -0.0358 180 SER B CB    
1554 O OG    A SER B 52  ? 0.4231 0.1243 0.2651 0.0113  0.0392  -0.0455 180 SER B OG    
1555 O OG    B SER B 52  ? 0.6144 0.3119 0.4541 0.0047  0.0288  -0.0382 180 SER B OG    
1556 N N     . VAL B 53  ? 0.3967 0.1625 0.2468 -0.0036 0.0054  -0.0291 181 VAL B N     
1557 C CA    . VAL B 53  ? 0.3915 0.1694 0.2459 -0.0050 -0.0020 -0.0230 181 VAL B CA    
1558 C C     . VAL B 53  ? 0.3802 0.1510 0.2291 -0.0120 -0.0038 -0.0222 181 VAL B C     
1559 O O     . VAL B 53  ? 0.4058 0.1669 0.2456 -0.0198 -0.0014 -0.0277 181 VAL B O     
1560 C CB    . VAL B 53  ? 0.3882 0.1838 0.2421 -0.0075 -0.0063 -0.0230 181 VAL B CB    
1561 C CG1   . VAL B 53  ? 0.4228 0.2242 0.2809 -0.0020 -0.0040 -0.0231 181 VAL B CG1   
1562 C CG2   . VAL B 53  ? 0.3847 0.1828 0.2288 -0.0164 -0.0078 -0.0279 181 VAL B CG2   
1563 N N     . THR B 54  ? 0.3718 0.1459 0.2254 -0.0100 -0.0076 -0.0154 182 THR B N     
1564 C CA    . THR B 54  ? 0.3895 0.1595 0.2379 -0.0174 -0.0086 -0.0142 182 THR B CA    
1565 C C     . THR B 54  ? 0.3590 0.1458 0.2071 -0.0245 -0.0115 -0.0164 182 THR B C     
1566 O O     . THR B 54  ? 0.3828 0.1685 0.2271 -0.0334 -0.0111 -0.0184 182 THR B O     
1567 C CB    . THR B 54  ? 0.3921 0.1598 0.2424 -0.0142 -0.0112 -0.0064 182 THR B CB    
1568 O OG1   . THR B 54  ? 0.3890 0.1734 0.2442 -0.0112 -0.0153 -0.0035 182 THR B OG1   
1569 C CG2   . THR B 54  ? 0.4178 0.1721 0.2712 -0.0056 -0.0101 -0.0024 182 THR B CG2   
1570 N N     . PHE B 55  ? 0.3849 0.1868 0.2375 -0.0205 -0.0143 -0.0156 183 PHE B N     
1571 C CA    . PHE B 55  ? 0.3619 0.1798 0.2159 -0.0243 -0.0173 -0.0164 183 PHE B CA    
1572 C C     . PHE B 55  ? 0.3327 0.1602 0.1884 -0.0191 -0.0190 -0.0166 183 PHE B C     
1573 O O     . PHE B 55  ? 0.3343 0.1604 0.1930 -0.0125 -0.0185 -0.0141 183 PHE B O     
1574 C CB    . PHE B 55  ? 0.3501 0.1749 0.2077 -0.0244 -0.0184 -0.0116 183 PHE B CB    
1575 C CG    . PHE B 55  ? 0.3383 0.1805 0.2003 -0.0262 -0.0204 -0.0116 183 PHE B CG    
1576 C CD1   . PHE B 55  ? 0.3587 0.2086 0.2229 -0.0341 -0.0207 -0.0137 183 PHE B CD1   
1577 C CD2   . PHE B 55  ? 0.3016 0.1528 0.1666 -0.0199 -0.0221 -0.0095 183 PHE B CD2   
1578 C CE1   . PHE B 55  ? 0.3655 0.2340 0.2370 -0.0344 -0.0229 -0.0129 183 PHE B CE1   
1579 C CE2   . PHE B 55  ? 0.3028 0.1685 0.1726 -0.0199 -0.0236 -0.0089 183 PHE B CE2   
1580 C CZ    . PHE B 55  ? 0.3069 0.1828 0.1813 -0.0263 -0.0242 -0.0102 183 PHE B CZ    
1581 N N     . ILE B 56  ? 0.3643 0.2023 0.2186 -0.0223 -0.0214 -0.0187 184 ILE B N     
1582 C CA    . ILE B 56  ? 0.3328 0.1794 0.1870 -0.0177 -0.0233 -0.0176 184 ILE B CA    
1583 C C     . ILE B 56  ? 0.3296 0.1911 0.1859 -0.0199 -0.0276 -0.0164 184 ILE B C     
1584 O O     . ILE B 56  ? 0.3379 0.2041 0.1937 -0.0268 -0.0297 -0.0187 184 ILE B O     
1585 C CB    . ILE B 56  ? 0.3366 0.1759 0.1836 -0.0173 -0.0208 -0.0215 184 ILE B CB    
1586 C CG1   . ILE B 56  ? 0.3483 0.1943 0.1933 -0.0134 -0.0220 -0.0197 184 ILE B CG1   
1587 C CG2   . ILE B 56  ? 0.3603 0.1940 0.1983 -0.0252 -0.0204 -0.0274 184 ILE B CG2   
1588 C CD1   . ILE B 56  ? 0.3664 0.2043 0.2064 -0.0115 -0.0170 -0.0224 184 ILE B CD1   
1589 N N     . SER B 57  ? 0.3254 0.1940 0.1842 -0.0141 -0.0291 -0.0126 185 SER B N     
1590 C CA    . SER B 57  ? 0.3013 0.1843 0.1643 -0.0134 -0.0330 -0.0101 185 SER B CA    
1591 C C     . SER B 57  ? 0.3136 0.1966 0.1721 -0.0076 -0.0341 -0.0076 185 SER B C     
1592 O O     . SER B 57  ? 0.3267 0.2003 0.1823 -0.0041 -0.0308 -0.0072 185 SER B O     
1593 C CB    . SER B 57  ? 0.2960 0.1860 0.1682 -0.0111 -0.0316 -0.0070 185 SER B CB    
1594 O OG    . SER B 57  ? 0.3202 0.2020 0.1913 -0.0062 -0.0284 -0.0051 185 SER B OG    
1595 N N     . ARG B 58  ? 0.3264 0.2191 0.1837 -0.0077 -0.0389 -0.0059 186 ARG B N     
1596 C CA    . ARG B 58  ? 0.2969 0.1890 0.1481 -0.0027 -0.0406 -0.0024 186 ARG B CA    
1597 C C     . ARG B 58  ? 0.3226 0.2262 0.1825 0.0030  -0.0433 0.0029  186 ARG B C     
1598 O O     . ARG B 58  ? 0.3061 0.2243 0.1744 0.0009  -0.0475 0.0036  186 ARG B O     
1599 C CB    . ARG B 58  ? 0.3154 0.2061 0.1541 -0.0076 -0.0439 -0.0045 186 ARG B CB    
1600 C CG    . ARG B 58  ? 0.3210 0.2089 0.1507 -0.0029 -0.0454 0.0000  186 ARG B CG    
1601 C CD    . ARG B 58  ? 0.3506 0.2322 0.1635 -0.0085 -0.0463 -0.0028 186 ARG B CD    
1602 N NE    . ARG B 58  ? 0.3945 0.2856 0.2024 -0.0149 -0.0540 -0.0038 186 ARG B NE    
1603 C CZ    . ARG B 58  ? 0.4276 0.3264 0.2282 -0.0148 -0.0621 0.0010  186 ARG B CZ    
1604 N NH1   . ARG B 58  ? 0.4265 0.3243 0.2244 -0.0072 -0.0635 0.0082  186 ARG B NH1   
1605 N NH2   . ARG B 58  ? 0.4513 0.3593 0.2478 -0.0225 -0.0695 -0.0009 186 ARG B NH2   
1606 N N     . HIS B 59  ? 0.3366 0.2338 0.1946 0.0102  -0.0410 0.0067  187 HIS B N     
1607 C CA    . HIS B 59  ? 0.3291 0.2326 0.1954 0.0177  -0.0409 0.0114  187 HIS B CA    
1608 C C     . HIS B 59  ? 0.3348 0.2336 0.1938 0.0241  -0.0427 0.0169  187 HIS B C     
1609 O O     . HIS B 59  ? 0.3322 0.2176 0.1796 0.0232  -0.0405 0.0165  187 HIS B O     
1610 C CB    . HIS B 59  ? 0.3270 0.2224 0.1963 0.0202  -0.0343 0.0104  187 HIS B CB    
1611 C CG    . HIS B 59  ? 0.3148 0.2115 0.1886 0.0143  -0.0321 0.0064  187 HIS B CG    
1612 N ND1   . HIS B 59  ? 0.3357 0.2422 0.2199 0.0143  -0.0304 0.0065  187 HIS B ND1   
1613 C CD2   . HIS B 59  ? 0.3342 0.2230 0.2035 0.0087  -0.0309 0.0026  187 HIS B CD2   
1614 C CE1   . HIS B 59  ? 0.3357 0.2385 0.2194 0.0080  -0.0284 0.0031  187 HIS B CE1   
1615 N NE2   . HIS B 59  ? 0.3234 0.2149 0.1984 0.0054  -0.0289 0.0010  187 HIS B NE2   
1616 N N     A ASN B 60  ? 0.3166 0.2268 0.1832 0.0305  -0.0465 0.0223  188 ASN B N     
1617 N N     B ASN B 60  ? 0.3221 0.2320 0.1892 0.0308  -0.0462 0.0223  188 ASN B N     
1618 C CA    A ASN B 60  ? 0.3535 0.2562 0.2136 0.0387  -0.0474 0.0288  188 ASN B CA    
1619 C CA    B ASN B 60  ? 0.3645 0.2677 0.2263 0.0395  -0.0469 0.0290  188 ASN B CA    
1620 C C     A ASN B 60  ? 0.3635 0.2505 0.2222 0.0443  -0.0391 0.0291  188 ASN B C     
1621 C C     B ASN B 60  ? 0.3699 0.2563 0.2287 0.0446  -0.0387 0.0290  188 ASN B C     
1622 O O     A ASN B 60  ? 0.3988 0.2878 0.2668 0.0461  -0.0342 0.0269  188 ASN B O     
1623 O O     B ASN B 60  ? 0.3931 0.2809 0.2610 0.0470  -0.0337 0.0272  188 ASN B O     
1624 C CB    A ASN B 60  ? 0.3646 0.2846 0.2352 0.0455  -0.0543 0.0356  188 ASN B CB    
1625 C CB    B ASN B 60  ? 0.3820 0.3022 0.2581 0.0477  -0.0512 0.0351  188 ASN B CB    
1626 C CG    A ASN B 60  ? 0.3931 0.3038 0.2539 0.0536  -0.0568 0.0436  188 ASN B CG    
1627 C CG    B ASN B 60  ? 0.4110 0.3485 0.2886 0.0442  -0.0617 0.0377  188 ASN B CG    
1628 O OD1   A ASN B 60  ? 0.4911 0.4089 0.3617 0.0638  -0.0587 0.0503  188 ASN B OD1   
1629 O OD1   B ASN B 60  ? 0.4498 0.3820 0.3131 0.0435  -0.0673 0.0412  188 ASN B OD1   
1630 N ND2   A ASN B 60  ? 0.4074 0.3015 0.2493 0.0495  -0.0561 0.0431  188 ASN B ND2   
1631 N ND2   B ASN B 60  ? 0.4130 0.3715 0.3071 0.0414  -0.0648 0.0364  188 ASN B ND2   
1632 N N     . SER B 61  ? 0.4172 0.2873 0.2624 0.0460  -0.0371 0.0314  189 SER B N     
1633 C CA    . SER B 61  ? 0.4327 0.2846 0.2729 0.0496  -0.0297 0.0315  189 SER B CA    
1634 C C     . SER B 61  ? 0.4787 0.3186 0.3081 0.0557  -0.0305 0.0386  189 SER B C     
1635 O O     . SER B 61  ? 0.5319 0.3592 0.3472 0.0510  -0.0298 0.0389  189 SER B O     
1636 C CB    . SER B 61  ? 0.4580 0.2989 0.2910 0.0411  -0.0255 0.0257  189 SER B CB    
1637 O OG    . SER B 61  ? 0.4677 0.2907 0.2941 0.0428  -0.0192 0.0256  189 SER B OG    
1638 N N     . TYR B 62  ? 0.5545 0.3989 0.3914 0.0665  -0.0319 0.0447  190 TYR B N     
1639 C CA    . TYR B 62  ? 0.6255 0.4592 0.4537 0.0750  -0.0338 0.0535  190 TYR B CA    
1640 C C     . TYR B 62  ? 0.6334 0.4719 0.4505 0.0693  -0.0420 0.0564  190 TYR B C     
1641 O O     . TYR B 62  ? 0.7170 0.5760 0.5410 0.0653  -0.0494 0.0553  190 TYR B O     
1642 C CB    . TYR B 62  ? 0.7132 0.5187 0.5284 0.0765  -0.0248 0.0534  190 TYR B CB    
1643 C CG    . TYR B 62  ? 0.7073 0.5050 0.5290 0.0794  -0.0158 0.0484  190 TYR B CG    
1644 C CD1   . TYR B 62  ? 0.7460 0.5408 0.5754 0.0922  -0.0117 0.0524  190 TYR B CD1   
1645 C CD2   . TYR B 62  ? 0.8051 0.5985 0.6244 0.0693  -0.0113 0.0398  190 TYR B CD2   
1646 C CE1   . TYR B 62  ? 0.7259 0.5116 0.5581 0.0943  -0.0022 0.0471  190 TYR B CE1   
1647 C CE2   . TYR B 62  ? 0.7730 0.5586 0.5945 0.0707  -0.0037 0.0352  190 TYR B CE2   
1648 C CZ    . TYR B 62  ? 0.7513 0.5316 0.5778 0.0828  0.0016  0.0383  190 TYR B CZ    
1649 O OH    . TYR B 62  ? 0.6965 0.4660 0.5220 0.0839  0.0109  0.0330  190 TYR B OH    
1650 N N     . ASN B 63  ? 0.6181 0.4374 0.4164 0.0667  -0.0401 0.0591  191 ASN B N     
1651 C CA    . ASN B 63  ? 0.7038 0.5254 0.4879 0.0602  -0.0463 0.0612  191 ASN B CA    
1652 C C     . ASN B 63  ? 0.5926 0.4209 0.3750 0.0475  -0.0452 0.0519  191 ASN B C     
1653 O O     . ASN B 63  ? 0.6872 0.5212 0.4603 0.0418  -0.0503 0.0517  191 ASN B O     
1654 C CB    . ASN B 63  ? 0.7120 0.5101 0.4749 0.0605  -0.0434 0.0672  191 ASN B CB    
1655 C CG    . ASN B 63  ? 0.9958 0.7826 0.7582 0.0738  -0.0436 0.0770  191 ASN B CG    
1656 O OD1   . ASN B 63  ? 1.0742 0.8752 0.8526 0.0841  -0.0482 0.0810  191 ASN B OD1   
1657 N ND2   . ASN B 63  ? 1.1173 0.8778 0.8618 0.0740  -0.0380 0.0813  191 ASN B ND2   
1658 N N     . HIS B 64  ? 0.4647 0.2923 0.2559 0.0435  -0.0389 0.0442  192 HIS B N     
1659 C CA    . HIS B 64  ? 0.4281 0.2568 0.2169 0.0335  -0.0361 0.0367  192 HIS B CA    
1660 C C     . HIS B 64  ? 0.3959 0.2409 0.2003 0.0314  -0.0380 0.0310  192 HIS B C     
1661 O O     . HIS B 64  ? 0.4141 0.2718 0.2293 0.0364  -0.0426 0.0333  192 HIS B O     
1662 C CB    . HIS B 64  ? 0.4035 0.2170 0.1881 0.0294  -0.0276 0.0337  192 HIS B CB    
1663 C CG    . HIS B 64  ? 0.4536 0.2498 0.2220 0.0293  -0.0245 0.0388  192 HIS B CG    
1664 N ND1   . HIS B 64  ? 0.4720 0.2647 0.2252 0.0261  -0.0260 0.0419  192 HIS B ND1   
1665 C CD2   . HIS B 64  ? 0.4691 0.2484 0.2325 0.0310  -0.0192 0.0413  192 HIS B CD2   
1666 C CE1   . HIS B 64  ? 0.5463 0.3209 0.2862 0.0264  -0.0218 0.0469  192 HIS B CE1   
1667 N NE2   . HIS B 64  ? 0.4674 0.2332 0.2136 0.0289  -0.0175 0.0463  192 HIS B NE2   
1668 N N     . ASN B 65  ? 0.3834 0.2290 0.1884 0.0239  -0.0350 0.0242  193 ASN B N     
1669 C CA    . ASN B 65  ? 0.3810 0.2382 0.1984 0.0210  -0.0360 0.0188  193 ASN B CA    
1670 C C     . ASN B 65  ? 0.3733 0.2253 0.1962 0.0179  -0.0302 0.0139  193 ASN B C     
1671 O O     . ASN B 65  ? 0.3892 0.2317 0.2064 0.0154  -0.0258 0.0129  193 ASN B O     
1672 C CB    . ASN B 65  ? 0.3753 0.2379 0.1865 0.0143  -0.0391 0.0153  193 ASN B CB    
1673 C CG    . ASN B 65  ? 0.4182 0.2935 0.2288 0.0146  -0.0479 0.0184  193 ASN B CG    
1674 O OD1   . ASN B 65  ? 0.4340 0.3134 0.2399 0.0077  -0.0505 0.0142  193 ASN B OD1   
1675 N ND2   . ASN B 65  ? 0.4090 0.2901 0.2234 0.0218  -0.0525 0.0254  193 ASN B ND2   
1676 N N     . ILE B 66  ? 0.3407 0.2000 0.1744 0.0173  -0.0305 0.0110  194 ILE B N     
1677 C CA    . ILE B 66  ? 0.3241 0.1801 0.1624 0.0141  -0.0270 0.0070  194 ILE B CA    
1678 C C     . ILE B 66  ? 0.2999 0.1626 0.1433 0.0098  -0.0284 0.0030  194 ILE B C     
1679 O O     . ILE B 66  ? 0.2917 0.1635 0.1390 0.0095  -0.0318 0.0032  194 ILE B O     
1680 C CB    . ILE B 66  ? 0.3406 0.1934 0.1835 0.0170  -0.0248 0.0079  194 ILE B CB    
1681 C CG1   . ILE B 66  ? 0.3635 0.2050 0.1992 0.0197  -0.0222 0.0108  194 ILE B CG1   
1682 C CG2   . ILE B 66  ? 0.3362 0.1876 0.1833 0.0131  -0.0233 0.0046  194 ILE B CG2   
1683 C CD1   . ILE B 66  ? 0.3731 0.2094 0.2101 0.0233  -0.0194 0.0115  194 ILE B CD1   
1684 N N     . LEU B 67  ? 0.3078 0.1659 0.1508 0.0065  -0.0256 -0.0003 195 LEU B N     
1685 C CA    . LEU B 67  ? 0.3238 0.1831 0.1708 0.0031  -0.0254 -0.0041 195 LEU B CA    
1686 C C     . LEU B 67  ? 0.3319 0.1892 0.1857 0.0038  -0.0242 -0.0038 195 LEU B C     
1687 O O     . LEU B 67  ? 0.3412 0.1945 0.1959 0.0049  -0.0226 -0.0026 195 LEU B O     
1688 C CB    . LEU B 67  ? 0.3524 0.2067 0.1952 0.0005  -0.0222 -0.0077 195 LEU B CB    
1689 C CG    . LEU B 67  ? 0.3775 0.2312 0.2090 -0.0018 -0.0227 -0.0090 195 LEU B CG    
1690 C CD1   . LEU B 67  ? 0.4004 0.2470 0.2282 -0.0038 -0.0166 -0.0133 195 LEU B CD1   
1691 C CD2   . LEU B 67  ? 0.3808 0.2407 0.2100 -0.0052 -0.0278 -0.0101 195 LEU B CD2   
1692 N N     . PHE B 68  ? 0.3282 0.1876 0.1859 0.0019  -0.0251 -0.0048 196 PHE B N     
1693 C CA    . PHE B 68  ? 0.3254 0.1815 0.1868 0.0018  -0.0245 -0.0039 196 PHE B CA    
1694 C C     . PHE B 68  ? 0.3201 0.1723 0.1826 -0.0012 -0.0238 -0.0065 196 PHE B C     
1695 O O     . PHE B 68  ? 0.3254 0.1802 0.1867 -0.0044 -0.0243 -0.0085 196 PHE B O     
1696 C CB    . PHE B 68  ? 0.3276 0.1880 0.1906 0.0020  -0.0248 -0.0024 196 PHE B CB    
1697 C CG    . PHE B 68  ? 0.3123 0.1683 0.1757 0.0002  -0.0239 -0.0016 196 PHE B CG    
1698 C CD1   . PHE B 68  ? 0.3143 0.1694 0.1790 -0.0036 -0.0235 -0.0026 196 PHE B CD1   
1699 C CD2   . PHE B 68  ? 0.3266 0.1772 0.1868 0.0014  -0.0236 0.0003  196 PHE B CD2   
1700 C CE1   . PHE B 68  ? 0.3476 0.1963 0.2102 -0.0054 -0.0227 -0.0009 196 PHE B CE1   
1701 C CE2   . PHE B 68  ? 0.3468 0.1922 0.2042 -0.0008 -0.0236 0.0017  196 PHE B CE2   
1702 C CZ    . PHE B 68  ? 0.3379 0.1821 0.1964 -0.0038 -0.0231 0.0015  196 PHE B CZ    
1703 N N     . PHE B 69  ? 0.3027 0.1489 0.1677 0.0000  -0.0227 -0.0061 197 PHE B N     
1704 C CA    . PHE B 69  ? 0.3078 0.1469 0.1736 -0.0015 -0.0212 -0.0078 197 PHE B CA    
1705 C C     . PHE B 69  ? 0.3343 0.1678 0.2036 0.0005  -0.0220 -0.0045 197 PHE B C     
1706 O O     . PHE B 69  ? 0.3295 0.1652 0.2018 0.0030  -0.0239 -0.0014 197 PHE B O     
1707 C CB    . PHE B 69  ? 0.3246 0.1606 0.1882 -0.0017 -0.0180 -0.0120 197 PHE B CB    
1708 C CG    . PHE B 69  ? 0.3476 0.1854 0.2145 0.0020  -0.0159 -0.0115 197 PHE B CG    
1709 C CD1   . PHE B 69  ? 0.3681 0.2113 0.2312 0.0019  -0.0162 -0.0112 197 PHE B CD1   
1710 C CD2   . PHE B 69  ? 0.3859 0.2204 0.2604 0.0057  -0.0134 -0.0109 197 PHE B CD2   
1711 C CE1   . PHE B 69  ? 0.3716 0.2163 0.2377 0.0038  -0.0136 -0.0105 197 PHE B CE1   
1712 C CE2   . PHE B 69  ? 0.3619 0.2008 0.2419 0.0082  -0.0106 -0.0106 197 PHE B CE2   
1713 C CZ    . PHE B 69  ? 0.3543 0.1979 0.2295 0.0064  -0.0105 -0.0106 197 PHE B CZ    
1714 N N     . LEU B 70  ? 0.3289 0.1544 0.1968 -0.0013 -0.0209 -0.0049 198 LEU B N     
1715 C CA    . LEU B 70  ? 0.3782 0.1955 0.2474 0.0006  -0.0219 -0.0010 198 LEU B CA    
1716 C C     . LEU B 70  ? 0.3860 0.1929 0.2577 0.0032  -0.0183 -0.0028 198 LEU B C     
1717 O O     . LEU B 70  ? 0.3590 0.1606 0.2262 -0.0001 -0.0148 -0.0077 198 LEU B O     
1718 C CB    . LEU B 70  ? 0.3838 0.1972 0.2471 -0.0043 -0.0223 0.0007  198 LEU B CB    
1719 C CG    . LEU B 70  ? 0.3699 0.1906 0.2304 -0.0058 -0.0242 0.0028  198 LEU B CG    
1720 C CD1   . LEU B 70  ? 0.3878 0.2105 0.2450 -0.0115 -0.0219 0.0017  198 LEU B CD1   
1721 C CD2   . LEU B 70  ? 0.3892 0.2062 0.2476 -0.0037 -0.0276 0.0080  198 LEU B CD2   
1722 N N     . THR B 71  ? 0.3769 0.1814 0.2560 0.0095  -0.0192 0.0011  199 THR B N     
1723 C CA    . THR B 71  ? 0.3880 0.1831 0.2717 0.0142  -0.0145 -0.0004 199 THR B CA    
1724 C C     . THR B 71  ? 0.3841 0.1656 0.2673 0.0170  -0.0158 0.0050  199 THR B C     
1725 O O     . THR B 71  ? 0.4007 0.1837 0.2823 0.0167  -0.0216 0.0113  199 THR B O     
1726 C CB    . THR B 71  ? 0.3842 0.1885 0.2806 0.0209  -0.0135 0.0006  199 THR B CB    
1727 O OG1   . THR B 71  ? 0.3482 0.1620 0.2509 0.0227  -0.0205 0.0072  199 THR B OG1   
1728 C CG2   . THR B 71  ? 0.4012 0.2149 0.2956 0.0179  -0.0107 -0.0047 199 THR B CG2   
1729 N N     . PRO B 72  ? 0.4136 0.1799 0.2960 0.0195  -0.0100 0.0026  200 PRO B N     
1730 C CA    . PRO B 72  ? 0.4292 0.1785 0.3090 0.0223  -0.0104 0.0081  200 PRO B CA    
1731 C C     . PRO B 72  ? 0.4441 0.1967 0.3374 0.0333  -0.0144 0.0165  200 PRO B C     
1732 O O     . PRO B 72  ? 0.4742 0.2163 0.3649 0.0358  -0.0180 0.0239  200 PRO B O     
1733 C CB    . PRO B 72  ? 0.4343 0.1651 0.3084 0.0214  -0.0017 0.0014  200 PRO B CB    
1734 C CG    . PRO B 72  ? 0.4420 0.1806 0.3198 0.0224  0.0035  -0.0060 200 PRO B CG    
1735 C CD    . PRO B 72  ? 0.4157 0.1759 0.2944 0.0177  -0.0023 -0.0060 200 PRO B CD    
1736 N N     A HIS B 73  ? 0.4414 0.2077 0.3491 0.0395  -0.0134 0.0156  201 HIS B N     
1737 N N     B HIS B 73  ? 0.4239 0.1913 0.3315 0.0391  -0.0138 0.0157  201 HIS B N     
1738 C CA    A HIS B 73  ? 0.4666 0.2441 0.3911 0.0486  -0.0188 0.0237  201 HIS B CA    
1739 C CA    B HIS B 73  ? 0.4387 0.2163 0.3637 0.0488  -0.0184 0.0234  201 HIS B CA    
1740 C C     A HIS B 73  ? 0.4442 0.2449 0.3759 0.0457  -0.0233 0.0231  201 HIS B C     
1741 C C     B HIS B 73  ? 0.4278 0.2284 0.3593 0.0455  -0.0233 0.0231  201 HIS B C     
1742 O O     A HIS B 73  ? 0.4286 0.2338 0.3524 0.0385  -0.0208 0.0166  201 HIS B O     
1743 O O     B HIS B 73  ? 0.4101 0.2149 0.3329 0.0380  -0.0211 0.0167  201 HIS B O     
1744 C CB    A HIS B 73  ? 0.5221 0.2927 0.4612 0.0605  -0.0121 0.0246  201 HIS B CB    
1745 C CB    B HIS B 73  ? 0.4712 0.2426 0.4093 0.0590  -0.0097 0.0215  201 HIS B CB    
1746 C CG    A HIS B 73  ? 0.5706 0.3438 0.5157 0.0623  -0.0012 0.0156  201 HIS B CG    
1747 C CG    B HIS B 73  ? 0.5117 0.2566 0.4372 0.0585  -0.0015 0.0171  201 HIS B CG    
1748 N ND1   A HIS B 73  ? 0.6032 0.3966 0.5666 0.0670  0.0001  0.0156  201 HIS B ND1   
1749 N ND1   B HIS B 73  ? 0.5714 0.2970 0.4913 0.0617  -0.0034 0.0236  201 HIS B ND1   
1750 C CD2   A HIS B 73  ? 0.6036 0.3601 0.5385 0.0602  0.0096  0.0065  201 HIS B CD2   
1751 C CD2   B HIS B 73  ? 0.5311 0.2640 0.4454 0.0532  0.0079  0.0069  201 HIS B CD2   
1752 C CE1   A HIS B 73  ? 0.6238 0.4126 0.5869 0.0679  0.0119  0.0070  201 HIS B CE1   
1753 C CE1   B HIS B 73  ? 0.5443 0.2466 0.4511 0.0581  0.0053  0.0171  201 HIS B CE1   
1754 N NE2   A HIS B 73  ? 0.6087 0.3749 0.5536 0.0637  0.0174  0.0012  201 HIS B NE2   
1755 N NE2   B HIS B 73  ? 0.5007 0.2077 0.4037 0.0525  0.0118  0.0066  201 HIS B NE2   
1756 N N     . ARG B 74  ? 0.3977 0.2123 0.3431 0.0503  -0.0307 0.0305  202 ARG B N     
1757 C CA    . ARG B 74  ? 0.3971 0.2318 0.3475 0.0456  -0.0361 0.0306  202 ARG B CA    
1758 C C     . ARG B 74  ? 0.3788 0.2276 0.3470 0.0495  -0.0298 0.0270  202 ARG B C     
1759 O O     . ARG B 74  ? 0.3772 0.2244 0.3591 0.0583  -0.0238 0.0272  202 ARG B O     
1760 C CB    . ARG B 74  ? 0.4222 0.2653 0.3759 0.0457  -0.0483 0.0399  202 ARG B CB    
1761 C CG    . ARG B 74  ? 0.4643 0.2927 0.3974 0.0407  -0.0533 0.0433  202 ARG B CG    
1762 C CD    . ARG B 74  ? 0.4987 0.3303 0.4318 0.0419  -0.0654 0.0537  202 ARG B CD    
1763 N NE    . ARG B 74  ? 0.4732 0.3230 0.4107 0.0370  -0.0734 0.0552  202 ARG B NE    
1764 C CZ    . ARG B 74  ? 0.5033 0.3569 0.4345 0.0337  -0.0852 0.0625  202 ARG B CZ    
1765 N NH1   . ARG B 74  ? 0.5179 0.3580 0.4371 0.0352  -0.0907 0.0701  202 ARG B NH1   
1766 N NH2   . ARG B 74  ? 0.5050 0.3745 0.4395 0.0275  -0.0914 0.0621  202 ARG B NH2   
1767 N N     . HIS B 75  ? 0.3524 0.2130 0.3188 0.0426  -0.0303 0.0236  203 HIS B N     
1768 C CA    . HIS B 75  ? 0.3515 0.2262 0.3320 0.0435  -0.0244 0.0203  203 HIS B CA    
1769 C C     . HIS B 75  ? 0.3487 0.2394 0.3323 0.0367  -0.0317 0.0225  203 HIS B C     
1770 O O     . HIS B 75  ? 0.3377 0.2244 0.3061 0.0299  -0.0380 0.0232  203 HIS B O     
1771 C CB    . HIS B 75  ? 0.3595 0.2255 0.3273 0.0398  -0.0144 0.0114  203 HIS B CB    
1772 C CG    . HIS B 75  ? 0.3833 0.2310 0.3422 0.0428  -0.0079 0.0076  203 HIS B CG    
1773 N ND1   . HIS B 75  ? 0.4325 0.2754 0.4011 0.0503  0.0015  0.0051  203 HIS B ND1   
1774 C CD2   . HIS B 75  ? 0.3907 0.2232 0.3322 0.0389  -0.0089 0.0057  203 HIS B CD2   
1775 C CE1   . HIS B 75  ? 0.4325 0.2557 0.3875 0.0501  0.0059  0.0011  203 HIS B CE1   
1776 N NE2   . HIS B 75  ? 0.4054 0.2231 0.3450 0.0430  -0.0010 0.0020  203 HIS B NE2   
1777 N N     . ARG B 76  ? 0.3140 0.2218 0.3168 0.0380  -0.0295 0.0231  204 ARG B N     
1778 C CA    . ARG B 76  ? 0.3325 0.2525 0.3357 0.0294  -0.0323 0.0224  204 ARG B CA    
1779 C C     . ARG B 76  ? 0.3243 0.2349 0.3096 0.0231  -0.0254 0.0155  204 ARG B C     
1780 O O     . ARG B 76  ? 0.3326 0.2360 0.3139 0.0254  -0.0155 0.0104  204 ARG B O     
1781 C CB    . ARG B 76  ? 0.3276 0.2690 0.3571 0.0313  -0.0291 0.0239  204 ARG B CB    
1782 C CG    . ARG B 76  ? 0.3506 0.3089 0.4030 0.0364  -0.0383 0.0321  204 ARG B CG    
1783 C CD    . ARG B 76  ? 0.3610 0.3443 0.4391 0.0346  -0.0363 0.0332  204 ARG B CD    
1784 N NE    . ARG B 76  ? 0.3732 0.3763 0.4789 0.0420  -0.0443 0.0417  204 ARG B NE    
1785 C CZ    . ARG B 76  ? 0.4004 0.4311 0.5330 0.0397  -0.0469 0.0450  204 ARG B CZ    
1786 N NH1   . ARG B 76  ? 0.3772 0.4165 0.5104 0.0292  -0.0414 0.0402  204 ARG B NH1   
1787 N NH2   . ARG B 76  ? 0.4133 0.4635 0.5727 0.0478  -0.0553 0.0538  204 ARG B NH2   
1788 N N     . VAL B 77  ? 0.3038 0.2149 0.2782 0.0147  -0.0305 0.0156  205 VAL B N     
1789 C CA    . VAL B 77  ? 0.3382 0.2414 0.2972 0.0094  -0.0249 0.0106  205 VAL B CA    
1790 C C     . VAL B 77  ? 0.3124 0.2223 0.2803 0.0094  -0.0150 0.0075  205 VAL B C     
1791 O O     . VAL B 77  ? 0.3254 0.2259 0.2810 0.0090  -0.0079 0.0032  205 VAL B O     
1792 C CB    . VAL B 77  ? 0.3618 0.2635 0.3094 0.0011  -0.0312 0.0115  205 VAL B CB    
1793 C CG1   . VAL B 77  ? 0.3619 0.2558 0.2960 -0.0031 -0.0251 0.0076  205 VAL B CG1   
1794 C CG2   . VAL B 77  ? 0.3957 0.2877 0.3304 0.0012  -0.0382 0.0134  205 VAL B CG2   
1795 N N     . SER B 78  ? 0.2930 0.2199 0.2825 0.0097  -0.0143 0.0098  206 SER B N     
1796 C CA    . SER B 78  ? 0.2918 0.2255 0.2894 0.0085  -0.0036 0.0068  206 SER B CA    
1797 C C     . SER B 78  ? 0.3170 0.2431 0.3143 0.0163  0.0071  0.0027  206 SER B C     
1798 O O     . SER B 78  ? 0.3469 0.2697 0.3384 0.0143  0.0177  -0.0016 206 SER B O     
1799 C CB    . SER B 78  ? 0.2794 0.2364 0.3046 0.0076  -0.0049 0.0105  206 SER B CB    
1800 O OG    . SER B 78  ? 0.2916 0.2569 0.3343 0.0162  -0.0101 0.0149  206 SER B OG    
1801 N N     . ALA B 79  ? 0.3217 0.2438 0.3242 0.0243  0.0051  0.0041  207 ALA B N     
1802 C CA    . ALA B 79  ? 0.3323 0.2438 0.3323 0.0308  0.0150  -0.0004 207 ALA B CA    
1803 C C     . ALA B 79  ? 0.3340 0.2270 0.3061 0.0263  0.0175  -0.0057 207 ALA B C     
1804 O O     . ALA B 79  ? 0.3639 0.2495 0.3277 0.0262  0.0281  -0.0113 207 ALA B O     
1805 C CB    . ALA B 79  ? 0.3742 0.2817 0.3834 0.0400  0.0113  0.0029  207 ALA B CB    
1806 N N     . ILE B 80  ? 0.2990 0.1853 0.2572 0.0226  0.0082  -0.0040 208 ILE B N     
1807 C CA    . ILE B 80  ? 0.3103 0.1829 0.2455 0.0186  0.0088  -0.0079 208 ILE B CA    
1808 C C     . ILE B 80  ? 0.3259 0.1997 0.2517 0.0128  0.0135  -0.0099 208 ILE B C     
1809 O O     . ILE B 80  ? 0.3315 0.1970 0.2434 0.0112  0.0200  -0.0143 208 ILE B O     
1810 C CB    . ILE B 80  ? 0.3330 0.2013 0.2585 0.0162  -0.0011 -0.0051 208 ILE B CB    
1811 C CG1   . ILE B 80  ? 0.3759 0.2420 0.3087 0.0208  -0.0061 -0.0018 208 ILE B CG1   
1812 C CG2   . ILE B 80  ? 0.3269 0.1847 0.2330 0.0128  -0.0008 -0.0085 208 ILE B CG2   
1813 C CD1   . ILE B 80  ? 0.3847 0.2408 0.3176 0.0256  -0.0002 -0.0049 208 ILE B CD1   
1814 N N     . ASN B 81  ? 0.2907 0.1740 0.2233 0.0092  0.0105  -0.0066 209 ASN B N     
1815 C CA    . ASN B 81  ? 0.3236 0.2063 0.2474 0.0034  0.0152  -0.0074 209 ASN B CA    
1816 C C     . ASN B 81  ? 0.3506 0.2351 0.2776 0.0038  0.0275  -0.0109 209 ASN B C     
1817 O O     . ASN B 81  ? 0.3835 0.2589 0.2931 0.0008  0.0330  -0.0136 209 ASN B O     
1818 C CB    . ASN B 81  ? 0.3320 0.2241 0.2645 -0.0016 0.0109  -0.0037 209 ASN B CB    
1819 C CG    . ASN B 81  ? 0.3361 0.2231 0.2558 -0.0083 0.0152  -0.0040 209 ASN B CG    
1820 O OD1   . ASN B 81  ? 0.3545 0.2289 0.2546 -0.0094 0.0138  -0.0042 209 ASN B OD1   
1821 N ND2   . ASN B 81  ? 0.3258 0.2227 0.2572 -0.0127 0.0205  -0.0034 209 ASN B ND2   
1822 N N     . ASN B 82  ? 0.3744 0.2709 0.3236 0.0078  0.0321  -0.0107 210 ASN B N     
1823 C CA    . ASN B 82  ? 0.4095 0.3088 0.3644 0.0090  0.0457  -0.0144 210 ASN B CA    
1824 C C     . ASN B 82  ? 0.3887 0.2711 0.3239 0.0109  0.0526  -0.0203 210 ASN B C     
1825 O O     . ASN B 82  ? 0.4233 0.2997 0.3451 0.0071  0.0622  -0.0238 210 ASN B O     
1826 C CB    . ASN B 82  ? 0.4524 0.3676 0.4379 0.0163  0.0495  -0.0130 210 ASN B CB    
1827 C CG    . ASN B 82  ? 0.5212 0.4580 0.5296 0.0126  0.0454  -0.0078 210 ASN B CG    
1828 O OD1   . ASN B 82  ? 0.4788 0.4167 0.4793 0.0036  0.0432  -0.0066 210 ASN B OD1   
1829 N ND2   . ASN B 82  ? 0.5197 0.4736 0.5571 0.0195  0.0437  -0.0044 210 ASN B ND2   
1830 N N     . TYR B 83  ? 0.3869 0.2606 0.3183 0.0155  0.0477  -0.0214 211 TYR B N     
1831 C CA    . TYR B 83  ? 0.4023 0.2591 0.3132 0.0152  0.0526  -0.0274 211 TYR B CA    
1832 C C     . TYR B 83  ? 0.4081 0.2567 0.2933 0.0077  0.0492  -0.0281 211 TYR B C     
1833 O O     . TYR B 83  ? 0.3902 0.2300 0.2580 0.0042  0.0570  -0.0324 211 TYR B O     
1834 C CB    . TYR B 83  ? 0.4142 0.2628 0.3251 0.0195  0.0466  -0.0278 211 TYR B CB    
1835 C CG    . TYR B 83  ? 0.4094 0.2405 0.2969 0.0164  0.0495  -0.0342 211 TYR B CG    
1836 C CD1   . TYR B 83  ? 0.4667 0.2874 0.3486 0.0179  0.0620  -0.0409 211 TYR B CD1   
1837 C CD2   . TYR B 83  ? 0.4032 0.2292 0.2747 0.0113  0.0396  -0.0334 211 TYR B CD2   
1838 C CE1   . TYR B 83  ? 0.4809 0.2846 0.3385 0.0129  0.0640  -0.0475 211 TYR B CE1   
1839 C CE2   . TYR B 83  ? 0.4445 0.2572 0.2961 0.0070  0.0406  -0.0390 211 TYR B CE2   
1840 C CZ    . TYR B 83  ? 0.4593 0.2605 0.3025 0.0070  0.0520  -0.0460 211 TYR B CZ    
1841 O OH    . TYR B 83  ? 0.5323 0.3197 0.3532 0.0007  0.0519  -0.0519 211 TYR B OH    
1842 N N     . ALA B 84  ? 0.4020 0.2533 0.2844 0.0054  0.0379  -0.0233 212 ALA B N     
1843 C CA    . ALA B 84  ? 0.4252 0.2695 0.2857 0.0002  0.0333  -0.0225 212 ALA B CA    
1844 C C     . ALA B 84  ? 0.4342 0.2777 0.2852 -0.0044 0.0396  -0.0217 212 ALA B C     
1845 O O     . ALA B 84  ? 0.4796 0.3139 0.3093 -0.0079 0.0412  -0.0231 212 ALA B O     
1846 C CB    . ALA B 84  ? 0.4233 0.2704 0.2852 0.0002  0.0217  -0.0176 212 ALA B CB    
1847 N N     . GLN B 85  ? 0.4183 0.2712 0.2843 -0.0052 0.0434  -0.0192 213 GLN B N     
1848 C CA    . GLN B 85  ? 0.4096 0.2610 0.2669 -0.0108 0.0495  -0.0177 213 GLN B CA    
1849 C C     . GLN B 85  ? 0.4391 0.2853 0.2872 -0.0122 0.0625  -0.0227 213 GLN B C     
1850 O O     . GLN B 85  ? 0.4457 0.2831 0.2732 -0.0175 0.0668  -0.0222 213 GLN B O     
1851 C CB    . GLN B 85  ? 0.4181 0.2820 0.2954 -0.0130 0.0509  -0.0145 213 GLN B CB    
1852 C CG    . GLN B 85  ? 0.3934 0.2604 0.2764 -0.0134 0.0391  -0.0102 213 GLN B CG    
1853 C CD    . GLN B 85  ? 0.4553 0.3109 0.3187 -0.0176 0.0346  -0.0067 213 GLN B CD    
1854 O OE1   . GLN B 85  ? 0.4314 0.2777 0.2772 -0.0210 0.0398  -0.0062 213 GLN B OE1   
1855 N NE2   . GLN B 85  ? 0.4314 0.2863 0.2963 -0.0170 0.0253  -0.0040 213 GLN B NE2   
1856 N N     . LYS B 86  ? 0.4374 0.2874 0.2992 -0.0075 0.0699  -0.0273 214 LYS B N     
1857 C CA    . LYS B 86  ? 0.4805 0.3249 0.3340 -0.0088 0.0851  -0.0329 214 LYS B CA    
1858 C C     . LYS B 86  ? 0.4721 0.2991 0.2958 -0.0114 0.0852  -0.0373 214 LYS B C     
1859 O O     . LYS B 86  ? 0.4968 0.3153 0.3042 -0.0150 0.0971  -0.0417 214 LYS B O     
1860 C CB    . LYS B 86  ? 0.5500 0.4034 0.4284 -0.0022 0.0958  -0.0364 214 LYS B CB    
1861 C CG    . LYS B 86  ? 0.6884 0.5355 0.5710 0.0050  0.0938  -0.0402 214 LYS B CG    
1862 C CD    . LYS B 86  ? 0.7538 0.6086 0.6610 0.0127  0.1070  -0.0431 214 LYS B CD    
1863 C CE    . LYS B 86  ? 0.7949 0.6446 0.7122 0.0214  0.1041  -0.0446 214 LYS B CE    
1864 N NZ    . LYS B 86  ? 0.8567 0.6875 0.7477 0.0182  0.0965  -0.0478 214 LYS B NZ    
1865 N N     . LEU B 87  ? 0.4592 0.2812 0.2747 -0.0106 0.0729  -0.0366 215 LEU B N     
1866 C CA    . LEU B 87  ? 0.4909 0.2982 0.2792 -0.0142 0.0718  -0.0414 215 LEU B CA    
1867 C C     . LEU B 87  ? 0.5059 0.3054 0.2665 -0.0212 0.0710  -0.0391 215 LEU B C     
1868 O O     . LEU B 87  ? 0.5430 0.3306 0.2799 -0.0259 0.0774  -0.0441 215 LEU B O     
1869 C CB    . LEU B 87  ? 0.4732 0.2797 0.2612 -0.0128 0.0582  -0.0405 215 LEU B CB    
1870 C CG    . LEU B 87  ? 0.4909 0.2961 0.2929 -0.0079 0.0590  -0.0444 215 LEU B CG    
1871 C CD1   . LEU B 87  ? 0.4824 0.2888 0.2836 -0.0084 0.0450  -0.0418 215 LEU B CD1   
1872 C CD2   . LEU B 87  ? 0.5178 0.3089 0.3080 -0.0088 0.0707  -0.0535 215 LEU B CD2   
1873 N N     . CME B 88  ? 0.5383 0.3429 0.3003 -0.0220 0.0628  -0.0315 216 CME B N     
1874 C CA    . CME B 88  ? 0.5693 0.3659 0.3059 -0.0273 0.0598  -0.0269 216 CME B CA    
1875 C CB    . CME B 88  ? 0.6215 0.4178 0.3495 -0.0263 0.0435  -0.0220 216 CME B CB    
1876 S SG    . CME B 88  ? 0.7258 0.5163 0.4376 -0.0290 0.0391  -0.0285 216 CME B SG    
1877 S SD    . CME B 88  ? 0.7919 0.5920 0.5113 -0.0257 0.0189  -0.0230 216 CME B SD    
1878 C CE    . CME B 88  ? 0.7121 0.5192 0.4582 -0.0212 0.0189  -0.0272 216 CME B CE    
1879 C CZ    . CME B 88  ? 0.7391 0.5514 0.5067 -0.0166 0.0256  -0.0257 216 CME B CZ    
1880 O OH    . CME B 88  ? 0.7546 0.5721 0.5286 -0.0145 0.0202  -0.0183 216 CME B OH    
1881 C C     . CME B 88  ? 0.5402 0.3411 0.2858 -0.0282 0.0632  -0.0213 216 CME B C     
1882 O O     . CME B 88  ? 0.5360 0.3448 0.2991 -0.0252 0.0561  -0.0171 216 CME B O     
1883 N N     . THR B 89  ? 0.5470 0.3414 0.2788 -0.0335 0.0743  -0.0213 217 THR B N     
1884 C CA    . THR B 89  ? 0.5454 0.3432 0.2858 -0.0364 0.0799  -0.0168 217 THR B CA    
1885 C C     . THR B 89  ? 0.5575 0.3449 0.2780 -0.0398 0.0738  -0.0087 217 THR B C     
1886 O O     . THR B 89  ? 0.7003 0.4821 0.4121 -0.0455 0.0826  -0.0060 217 THR B O     
1887 C CB    . THR B 89  ? 0.5646 0.3630 0.3058 -0.0405 0.0979  -0.0213 217 THR B CB    
1888 O OG1   . THR B 89  ? 0.5795 0.3625 0.2878 -0.0455 0.1037  -0.0233 217 THR B OG1   
1889 C CG2   . THR B 89  ? 0.5466 0.3568 0.3141 -0.0347 0.1046  -0.0284 217 THR B CG2   
1890 N N     . PHE B 90  ? 0.5472 0.3313 0.2599 -0.0362 0.0597  -0.0045 218 PHE B N     
1891 C CA    . PHE B 90  ? 0.5672 0.3408 0.2633 -0.0370 0.0530  0.0044  218 PHE B CA    
1892 C C     . PHE B 90  ? 0.5311 0.3100 0.2416 -0.0306 0.0404  0.0080  218 PHE B C     
1893 O O     . PHE B 90  ? 0.4889 0.2776 0.2139 -0.0264 0.0348  0.0041  218 PHE B O     
1894 C CB    . PHE B 90  ? 0.5921 0.3539 0.2562 -0.0389 0.0488  0.0068  218 PHE B CB    
1895 C CG    . PHE B 90  ? 0.6072 0.3744 0.2701 -0.0362 0.0407  0.0022  218 PHE B CG    
1896 C CD1   . PHE B 90  ? 0.6138 0.3811 0.2726 -0.0393 0.0486  -0.0068 218 PHE B CD1   
1897 C CD2   . PHE B 90  ? 0.5972 0.3690 0.2636 -0.0309 0.0261  0.0063  218 PHE B CD2   
1898 C CE1   . PHE B 90  ? 0.6121 0.3822 0.2684 -0.0384 0.0412  -0.0114 218 PHE B CE1   
1899 C CE2   . PHE B 90  ? 0.6115 0.3897 0.2788 -0.0299 0.0188  0.0018  218 PHE B CE2   
1900 C CZ    . PHE B 90  ? 0.5908 0.3671 0.2517 -0.0344 0.0259  -0.0071 218 PHE B CZ    
1901 N N     . SER B 91  ? 0.5326 0.3036 0.2390 -0.0303 0.0375  0.0150  219 SER B N     
1902 C CA    . SER B 91  ? 0.5131 0.2854 0.2291 -0.0242 0.0273  0.0188  219 SER B CA    
1903 C C     . SER B 91  ? 0.4937 0.2779 0.2362 -0.0227 0.0267  0.0146  219 SER B C     
1904 O O     . SER B 91  ? 0.4865 0.2807 0.2433 -0.0250 0.0325  0.0090  219 SER B O     
1905 C CB    . SER B 91  ? 0.5433 0.3181 0.2527 -0.0181 0.0158  0.0207  219 SER B CB    
1906 O OG    . SER B 91  ? 0.6001 0.3660 0.2844 -0.0199 0.0144  0.0245  219 SER B OG    
1907 N N     . PHE B 92  ? 0.4408 0.2236 0.1893 -0.0182 0.0196  0.0178  220 PHE B N     
1908 C CA    . PHE B 92  ? 0.4367 0.2274 0.2051 -0.0179 0.0185  0.0149  220 PHE B CA    
1909 C C     . PHE B 92  ? 0.3997 0.2037 0.1821 -0.0140 0.0139  0.0102  220 PHE B C     
1910 O O     . PHE B 92  ? 0.3988 0.2048 0.1751 -0.0106 0.0095  0.0097  220 PHE B O     
1911 C CB    . PHE B 92  ? 0.4298 0.2109 0.1962 -0.0152 0.0140  0.0192  220 PHE B CB    
1912 C CG    . PHE B 92  ? 0.3893 0.1730 0.1576 -0.0070 0.0056  0.0205  220 PHE B CG    
1913 C CD1   . PHE B 92  ? 0.4187 0.1981 0.1746 -0.0017 0.0010  0.0252  220 PHE B CD1   
1914 C CD2   . PHE B 92  ? 0.4006 0.1912 0.1831 -0.0050 0.0024  0.0177  220 PHE B CD2   
1915 C CE1   . PHE B 92  ? 0.3959 0.1811 0.1574 0.0056  -0.0063 0.0265  220 PHE B CE1   
1916 C CE2   . PHE B 92  ? 0.3989 0.1925 0.1844 0.0020  -0.0038 0.0187  220 PHE B CE2   
1917 C CZ    . PHE B 92  ? 0.4002 0.1924 0.1769 0.0073  -0.0078 0.0229  220 PHE B CZ    
1918 N N     . LEU B 93  ? 0.4004 0.2130 0.2007 -0.0150 0.0143  0.0074  221 LEU B N     
1919 C CA    . LEU B 93  ? 0.3825 0.2055 0.1966 -0.0112 0.0097  0.0039  221 LEU B CA    
1920 C C     . LEU B 93  ? 0.3797 0.2083 0.2091 -0.0125 0.0078  0.0034  221 LEU B C     
1921 O O     . LEU B 93  ? 0.3716 0.2058 0.2112 -0.0170 0.0121  0.0025  221 LEU B O     
1922 C CB    . LEU B 93  ? 0.3906 0.2198 0.2085 -0.0113 0.0141  -0.0007 221 LEU B CB    
1923 C CG    . LEU B 93  ? 0.3861 0.2218 0.2139 -0.0073 0.0092  -0.0036 221 LEU B CG    
1924 C CD1   . LEU B 93  ? 0.3857 0.2201 0.2062 -0.0073 0.0126  -0.0078 221 LEU B CD1   
1925 C CD2   . LEU B 93  ? 0.4096 0.2541 0.2570 -0.0065 0.0092  -0.0048 221 LEU B CD2   
1926 N N     . ILE B 94  ? 0.3629 0.1912 0.1941 -0.0091 0.0014  0.0041  222 ILE B N     
1927 C CA    . ILE B 94  ? 0.3736 0.2056 0.2155 -0.0107 -0.0017 0.0037  222 ILE B CA    
1928 C C     . ILE B 94  ? 0.3582 0.1989 0.2105 -0.0071 -0.0057 0.0017  222 ILE B C     
1929 O O     . ILE B 94  ? 0.3578 0.1974 0.2057 -0.0031 -0.0082 0.0014  222 ILE B O     
1930 C CB    . ILE B 94  ? 0.3949 0.2166 0.2285 -0.0104 -0.0047 0.0057  222 ILE B CB    
1931 C CG1   . ILE B 94  ? 0.4408 0.2486 0.2601 -0.0119 -0.0011 0.0087  222 ILE B CG1   
1932 C CG2   . ILE B 94  ? 0.3952 0.2189 0.2358 -0.0149 -0.0073 0.0048  222 ILE B CG2   
1933 C CD1   . ILE B 94  ? 0.4306 0.2364 0.2504 -0.0199 0.0039  0.0088  222 ILE B CD1   
1934 N N     . CYS B 95  ? 0.3191 0.1688 0.1853 -0.0087 -0.0059 0.0008  223 CYS B N     
1935 C CA    . CYS B 95  ? 0.3317 0.1876 0.2077 -0.0052 -0.0097 0.0000  223 CYS B CA    
1936 C C     . CYS B 95  ? 0.3480 0.2078 0.2312 -0.0073 -0.0151 0.0016  223 CYS B C     
1937 O O     . CYS B 95  ? 0.3622 0.2293 0.2552 -0.0111 -0.0151 0.0025  223 CYS B O     
1938 C CB    . CYS B 95  ? 0.3522 0.2148 0.2385 -0.0034 -0.0049 -0.0020 223 CYS B CB    
1939 S SG    . CYS B 95  ? 0.3783 0.2444 0.2751 0.0019  -0.0078 -0.0026 223 CYS B SG    
1940 N N     . LYS B 96  ? 0.3498 0.2063 0.2292 -0.0053 -0.0198 0.0022  224 LYS B N     
1941 C CA    . LYS B 96  ? 0.3136 0.1712 0.1947 -0.0079 -0.0257 0.0039  224 LYS B CA    
1942 C C     . LYS B 96  ? 0.3192 0.1769 0.2018 -0.0045 -0.0293 0.0048  224 LYS B C     
1943 O O     . LYS B 96  ? 0.3422 0.1962 0.2204 -0.0012 -0.0275 0.0036  224 LYS B O     
1944 C CB    . LYS B 96  ? 0.3377 0.1855 0.2056 -0.0118 -0.0266 0.0038  224 LYS B CB    
1945 C CG    . LYS B 96  ? 0.3576 0.2039 0.2243 -0.0176 -0.0242 0.0036  224 LYS B CG    
1946 C CD    . LYS B 96  ? 0.3693 0.2020 0.2212 -0.0219 -0.0243 0.0030  224 LYS B CD    
1947 C CE    . LYS B 96  ? 0.3706 0.2013 0.2219 -0.0296 -0.0222 0.0028  224 LYS B CE    
1948 N NZ    . LYS B 96  ? 0.3956 0.2095 0.2307 -0.0346 -0.0213 0.0015  224 LYS B NZ    
1949 N N     . GLY B 97  ? 0.3083 0.1710 0.1975 -0.0057 -0.0346 0.0073  225 GLY B N     
1950 C CA    . GLY B 97  ? 0.3094 0.1696 0.1971 -0.0035 -0.0387 0.0094  225 GLY B CA    
1951 C C     . GLY B 97  ? 0.3351 0.1857 0.2071 -0.0061 -0.0398 0.0089  225 GLY B C     
1952 O O     . GLY B 97  ? 0.3295 0.1755 0.1928 -0.0101 -0.0391 0.0075  225 GLY B O     
1953 N N     . VAL B 98  ? 0.3246 0.1708 0.1924 -0.0038 -0.0395 0.0093  226 VAL B N     
1954 C CA    . VAL B 98  ? 0.3325 0.1707 0.1870 -0.0057 -0.0383 0.0085  226 VAL B CA    
1955 C C     . VAL B 98  ? 0.3470 0.1814 0.1950 -0.0084 -0.0434 0.0117  226 VAL B C     
1956 O O     . VAL B 98  ? 0.3482 0.1828 0.2001 -0.0063 -0.0455 0.0146  226 VAL B O     
1957 C CB    . VAL B 98  ? 0.3133 0.1505 0.1672 -0.0026 -0.0335 0.0066  226 VAL B CB    
1958 C CG1   . VAL B 98  ? 0.3311 0.1627 0.1747 -0.0038 -0.0310 0.0060  226 VAL B CG1   
1959 C CG2   . VAL B 98  ? 0.3337 0.1744 0.1914 -0.0003 -0.0299 0.0042  226 VAL B CG2   
1960 N N     . ASN B 99  ? 0.3335 0.1622 0.1695 -0.0132 -0.0450 0.0113  227 ASN B N     
1961 C CA    . ASN B 99  ? 0.3594 0.1822 0.1836 -0.0173 -0.0502 0.0143  227 ASN B CA    
1962 C C     . ASN B 99  ? 0.3984 0.2126 0.2110 -0.0172 -0.0448 0.0134  227 ASN B C     
1963 O O     . ASN B 99  ? 0.4394 0.2494 0.2457 -0.0186 -0.0477 0.0171  227 ASN B O     
1964 C CB    . ASN B 99  ? 0.3761 0.1948 0.1892 -0.0242 -0.0538 0.0135  227 ASN B CB    
1965 C CG    . ASN B 99  ? 0.3837 0.2135 0.2090 -0.0266 -0.0611 0.0157  227 ASN B CG    
1966 O OD1   . ASN B 99  ? 0.3919 0.2314 0.2311 -0.0232 -0.0663 0.0201  227 ASN B OD1   
1967 N ND2   . ASN B 99  ? 0.4062 0.2339 0.2263 -0.0327 -0.0615 0.0129  227 ASN B ND2   
1968 N N     . LYS B 100 ? 0.3728 0.1845 0.1828 -0.0156 -0.0371 0.0094  228 LYS B N     
1969 C CA    . LYS B 100 ? 0.3942 0.2000 0.1951 -0.0158 -0.0306 0.0082  228 LYS B CA    
1970 C C     . LYS B 100 ? 0.3419 0.1556 0.1558 -0.0112 -0.0266 0.0074  228 LYS B C     
1971 O O     . LYS B 100 ? 0.3701 0.1875 0.1889 -0.0079 -0.0222 0.0049  228 LYS B O     
1972 C CB    . LYS B 100 ? 0.3875 0.1844 0.1754 -0.0173 -0.0246 0.0044  228 LYS B CB    
1973 C CG    . LYS B 100 ? 0.4300 0.2183 0.2041 -0.0236 -0.0292 0.0038  228 LYS B CG    
1974 C CD    . LYS B 100 ? 0.4899 0.2713 0.2486 -0.0299 -0.0341 0.0064  228 LYS B CD    
1975 C CE    . LYS B 100 ? 0.5580 0.3306 0.3019 -0.0372 -0.0378 0.0041  228 LYS B CE    
1976 N NZ    . LYS B 100 ? 0.5795 0.3467 0.3076 -0.0443 -0.0452 0.0073  228 LYS B NZ    
1977 N N     . GLU B 101 ? 0.3578 0.1738 0.1774 -0.0110 -0.0289 0.0099  229 GLU B N     
1978 C CA    . GLU B 101 ? 0.3624 0.1854 0.1940 -0.0082 -0.0266 0.0086  229 GLU B CA    
1979 C C     . GLU B 101 ? 0.3404 0.1669 0.1724 -0.0082 -0.0200 0.0064  229 GLU B C     
1980 O O     . GLU B 101 ? 0.3306 0.1651 0.1711 -0.0054 -0.0181 0.0043  229 GLU B O     
1981 C CB    . GLU B 101 ? 0.3575 0.1777 0.1922 -0.0087 -0.0295 0.0115  229 GLU B CB    
1982 C CG    . GLU B 101 ? 0.3731 0.1927 0.2112 -0.0070 -0.0360 0.0146  229 GLU B CG    
1983 C CD    . GLU B 101 ? 0.4640 0.2765 0.2921 -0.0095 -0.0410 0.0195  229 GLU B CD    
1984 O OE1   . GLU B 101 ? 0.4744 0.2815 0.2888 -0.0136 -0.0397 0.0195  229 GLU B OE1   
1985 O OE2   . GLU B 101 ? 0.5133 0.3251 0.3466 -0.0072 -0.0462 0.0238  229 GLU B OE2   
1986 N N     . TYR B 102 ? 0.3299 0.1512 0.1530 -0.0115 -0.0164 0.0072  230 TYR B N     
1987 C CA    . TYR B 102 ? 0.3176 0.1450 0.1444 -0.0117 -0.0089 0.0054  230 TYR B CA    
1988 C C     . TYR B 102 ? 0.3340 0.1645 0.1622 -0.0071 -0.0050 0.0030  230 TYR B C     
1989 O O     . TYR B 102 ? 0.3562 0.1978 0.1960 -0.0036 -0.0025 0.0019  230 TYR B O     
1990 C CB    . TYR B 102 ? 0.3358 0.1566 0.1523 -0.0168 -0.0040 0.0066  230 TYR B CB    
1991 C CG    . TYR B 102 ? 0.3282 0.1574 0.1502 -0.0161 0.0053  0.0043  230 TYR B CG    
1992 C CD1   . TYR B 102 ? 0.3401 0.1830 0.1771 -0.0167 0.0073  0.0036  230 TYR B CD1   
1993 C CD2   . TYR B 102 ? 0.3261 0.1502 0.1391 -0.0147 0.0119  0.0026  230 TYR B CD2   
1994 C CE1   . TYR B 102 ? 0.3392 0.1941 0.1857 -0.0154 0.0153  0.0022  230 TYR B CE1   
1995 C CE2   . TYR B 102 ? 0.3529 0.1864 0.1744 -0.0123 0.0213  0.0007  230 TYR B CE2   
1996 C CZ    . TYR B 102 ? 0.3516 0.2019 0.1912 -0.0122 0.0228  0.0009  230 TYR B CZ    
1997 O OH    . TYR B 102 ? 0.3608 0.2243 0.2127 -0.0089 0.0317  -0.0003 230 TYR B OH    
1998 N N     . LEU B 103 ? 0.3324 0.1529 0.1487 -0.0073 -0.0047 0.0024  231 LEU B N     
1999 C CA    . LEU B 103 ? 0.3529 0.1720 0.1683 -0.0029 0.0005  0.0001  231 LEU B CA    
2000 C C     . LEU B 103 ? 0.3357 0.1627 0.1629 0.0023  -0.0027 0.0002  231 LEU B C     
2001 O O     . LEU B 103 ? 0.3472 0.1789 0.1807 0.0079  0.0013  -0.0003 231 LEU B O     
2002 C CB    . LEU B 103 ? 0.3687 0.1726 0.1667 -0.0056 0.0008  -0.0013 231 LEU B CB    
2003 C CG    . LEU B 103 ? 0.3770 0.1705 0.1585 -0.0105 0.0060  -0.0022 231 LEU B CG    
2004 C CD1   . LEU B 103 ? 0.3977 0.1753 0.1595 -0.0151 0.0044  -0.0040 231 LEU B CD1   
2005 C CD2   . LEU B 103 ? 0.3855 0.1828 0.1711 -0.0068 0.0178  -0.0042 231 LEU B CD2   
2006 N N     . MET B 104 ? 0.3516 0.1785 0.1803 0.0008  -0.0097 0.0012  232 MET B N     
2007 C CA    . MET B 104 ? 0.3421 0.1760 0.1801 0.0045  -0.0124 0.0014  232 MET B CA    
2008 C C     . MET B 104 ? 0.3288 0.1753 0.1783 0.0070  -0.0119 0.0017  232 MET B C     
2009 O O     . MET B 104 ? 0.3414 0.1930 0.1957 0.0119  -0.0108 0.0022  232 MET B O     
2010 C CB    . MET B 104 ? 0.3421 0.1751 0.1812 0.0020  -0.0183 0.0021  232 MET B CB    
2011 C CG    . MET B 104 ? 0.3284 0.1655 0.1731 0.0046  -0.0198 0.0020  232 MET B CG    
2012 S SD    . MET B 104 ? 0.3815 0.2102 0.2191 0.0063  -0.0177 0.0019  232 MET B SD    
2013 C CE    . MET B 104 ? 0.3444 0.1783 0.1875 0.0078  -0.0196 0.0026  232 MET B CE    
2014 N N     . TYR B 105 ? 0.3189 0.1702 0.1726 0.0034  -0.0134 0.0017  233 TYR B N     
2015 C CA    . TYR B 105 ? 0.3195 0.1831 0.1832 0.0034  -0.0136 0.0014  233 TYR B CA    
2016 C C     . TYR B 105 ? 0.3120 0.1846 0.1822 0.0064  -0.0087 0.0018  233 TYR B C     
2017 O O     . TYR B 105 ? 0.3181 0.2021 0.1972 0.0101  -0.0100 0.0027  233 TYR B O     
2018 C CB    . TYR B 105 ? 0.3077 0.1711 0.1725 -0.0028 -0.0148 0.0009  233 TYR B CB    
2019 C CG    . TYR B 105 ? 0.3075 0.1833 0.1815 -0.0053 -0.0149 0.0000  233 TYR B CG    
2020 C CD1   . TYR B 105 ? 0.3130 0.1947 0.1906 -0.0058 -0.0193 -0.0013 233 TYR B CD1   
2021 C CD2   . TYR B 105 ? 0.3066 0.1899 0.1858 -0.0080 -0.0104 0.0002  233 TYR B CD2   
2022 C CE1   . TYR B 105 ? 0.3361 0.2307 0.2216 -0.0095 -0.0208 -0.0022 233 TYR B CE1   
2023 C CE2   . TYR B 105 ? 0.3361 0.2344 0.2263 -0.0114 -0.0113 -0.0005 233 TYR B CE2   
2024 C CZ    . TYR B 105 ? 0.3304 0.2342 0.2233 -0.0127 -0.0173 -0.0018 233 TYR B CZ    
2025 O OH    . TYR B 105 ? 0.3718 0.2907 0.2742 -0.0180 -0.0195 -0.0027 233 TYR B OH    
2026 N N     . SER B 106 ? 0.3039 0.1708 0.1688 0.0058  -0.0028 0.0016  234 SER B N     
2027 C CA    . SER B 106 ? 0.2890 0.1651 0.1617 0.0089  0.0041  0.0016  234 SER B CA    
2028 C C     . SER B 106 ? 0.3141 0.1909 0.1898 0.0180  0.0054  0.0026  234 SER B C     
2029 O O     . SER B 106 ? 0.3206 0.2119 0.2100 0.0231  0.0069  0.0041  234 SER B O     
2030 C CB    . SER B 106 ? 0.3361 0.2025 0.1984 0.0056  0.0114  0.0006  234 SER B CB    
2031 O OG    . SER B 106 ? 0.3479 0.2231 0.2187 0.0097  0.0203  0.0002  234 SER B OG    
2032 N N     . ALA B 107 ? 0.3157 0.1774 0.1794 0.0196  0.0045  0.0021  235 ALA B N     
2033 C CA    . ALA B 107 ? 0.3339 0.1917 0.1976 0.0276  0.0065  0.0033  235 ALA B CA    
2034 C C     . ALA B 107 ? 0.3382 0.2069 0.2111 0.0311  -0.0002 0.0062  235 ALA B C     
2035 O O     . ALA B 107 ? 0.3520 0.2250 0.2312 0.0392  0.0011  0.0090  235 ALA B O     
2036 C CB    . ALA B 107 ? 0.3616 0.1995 0.2090 0.0259  0.0067  0.0018  235 ALA B CB    
2037 N N     . LEU B 108 ? 0.3308 0.2034 0.2038 0.0253  -0.0069 0.0058  236 LEU B N     
2038 C CA    . LEU B 108 ? 0.3364 0.2183 0.2145 0.0264  -0.0135 0.0078  236 LEU B CA    
2039 C C     . LEU B 108 ? 0.3241 0.2262 0.2167 0.0276  -0.0157 0.0095  236 LEU B C     
2040 O O     . LEU B 108 ? 0.3613 0.2722 0.2574 0.0291  -0.0217 0.0119  236 LEU B O     
2041 C CB    . LEU B 108 ? 0.3219 0.1999 0.1944 0.0198  -0.0181 0.0059  236 LEU B CB    
2042 C CG    . LEU B 108 ? 0.3365 0.1997 0.1985 0.0191  -0.0178 0.0054  236 LEU B CG    
2043 C CD1   . LEU B 108 ? 0.3190 0.1806 0.1793 0.0134  -0.0207 0.0034  236 LEU B CD1   
2044 C CD2   . LEU B 108 ? 0.3626 0.2221 0.2209 0.0239  -0.0187 0.0080  236 LEU B CD2   
2045 N N     . THR B 109 ? 0.3079 0.2178 0.2086 0.0264  -0.0110 0.0087  237 THR B N     
2046 C CA    . THR B 109 ? 0.3223 0.2539 0.2401 0.0274  -0.0117 0.0104  237 THR B CA    
2047 C C     . THR B 109 ? 0.3814 0.3220 0.3108 0.0374  -0.0069 0.0136  237 THR B C     
2048 O O     . THR B 109 ? 0.3615 0.3245 0.3088 0.0386  -0.0088 0.0159  237 THR B O     
2049 C CB    . THR B 109 ? 0.3416 0.2798 0.2643 0.0186  -0.0085 0.0076  237 THR B CB    
2050 O OG1   . THR B 109 ? 0.3449 0.2761 0.2652 0.0201  0.0015  0.0065  237 THR B OG1   
2051 C CG2   . THR B 109 ? 0.3758 0.3040 0.2878 0.0094  -0.0126 0.0048  237 THR B CG2   
2052 N N     . ARG B 110 ? 0.3783 0.3023 0.2990 0.0446  -0.0008 0.0139  238 ARG B N     
2053 C CA    . ARG B 110 ? 0.4302 0.3585 0.3610 0.0558  0.0062  0.0165  238 ARG B CA    
2054 C C     . ARG B 110 ? 0.3816 0.2966 0.3048 0.0648  0.0047  0.0199  238 ARG B C     
2055 O O     . ARG B 110 ? 0.3766 0.2736 0.2831 0.0615  0.0019  0.0188  238 ARG B O     
2056 C CB    . ARG B 110 ? 0.5270 0.4437 0.4519 0.0556  0.0184  0.0126  238 ARG B CB    
2057 C CG    . ARG B 110 ? 0.6320 0.5611 0.5643 0.0475  0.0221  0.0101  238 ARG B CG    
2058 C CD    . ARG B 110 ? 0.6756 0.5929 0.6010 0.0488  0.0359  0.0068  238 ARG B CD    
2059 N NE    . ARG B 110 ? 0.7053 0.5945 0.6055 0.0458  0.0369  0.0038  238 ARG B NE    
2060 C CZ    . ARG B 110 ? 0.6037 0.4821 0.4888 0.0352  0.0332  0.0014  238 ARG B CZ    
2061 N NH1   . ARG B 110 ? 0.5977 0.4877 0.4887 0.0272  0.0294  0.0016  238 ARG B NH1   
2062 N NH2   . ARG B 110 ? 0.5794 0.4353 0.4440 0.0327  0.0325  -0.0007 238 ARG B NH2   
2063 N N     . ASP B 111 ? 0.4099 0.3343 0.3467 0.0767  0.0070  0.0247  239 ASP B N     
2064 C CA    . ASP B 111 ? 0.4698 0.3791 0.3998 0.0875  0.0074  0.0291  239 ASP B CA    
2065 C C     . ASP B 111 ? 0.4443 0.3221 0.3503 0.0841  0.0128  0.0249  239 ASP B C     
2066 O O     . ASP B 111 ? 0.5068 0.3733 0.4054 0.0805  0.0214  0.0195  239 ASP B O     
2067 C CB    . ASP B 111 ? 0.5115 0.4296 0.4588 0.1020  0.0147  0.0333  239 ASP B CB    
2068 C CG    . ASP B 111 ? 0.5939 0.5458 0.5669 0.1066  0.0064  0.0397  239 ASP B CG    
2069 O OD1   . ASP B 111 ? 0.6723 0.6359 0.6448 0.0993  -0.0063 0.0416  239 ASP B OD1   
2070 O OD2   . ASP B 111 ? 0.6411 0.6083 0.6348 0.1173  0.0124  0.0428  239 ASP B OD2   
2071 N N     . PRO B 112 ? 0.4709 0.3339 0.3636 0.0840  0.0080  0.0271  240 PRO B N     
2072 C CA    . PRO B 112 ? 0.4543 0.3246 0.3497 0.0883  -0.0014 0.0339  240 PRO B CA    
2073 C C     . PRO B 112 ? 0.4322 0.3174 0.3281 0.0779  -0.0122 0.0333  240 PRO B C     
2074 O O     . PRO B 112 ? 0.4269 0.3166 0.3208 0.0791  -0.0203 0.0382  240 PRO B O     
2075 C CB    . PRO B 112 ? 0.4984 0.3403 0.3741 0.0896  0.0013  0.0348  240 PRO B CB    
2076 C CG    . PRO B 112 ? 0.4937 0.3210 0.3560 0.0784  0.0054  0.0271  240 PRO B CG    
2077 C CD    . PRO B 112 ? 0.5010 0.3365 0.3722 0.0783  0.0122  0.0228  240 PRO B CD    
2078 N N     . PHE B 113 ? 0.3782 0.2683 0.2744 0.0676  -0.0117 0.0274  241 PHE B N     
2079 C CA    . PHE B 113 ? 0.3919 0.2903 0.2859 0.0574  -0.0195 0.0253  241 PHE B CA    
2080 C C     . PHE B 113 ? 0.3824 0.3063 0.2934 0.0553  -0.0238 0.0259  241 PHE B C     
2081 O O     . PHE B 113 ? 0.3835 0.3199 0.3095 0.0604  -0.0197 0.0271  241 PHE B O     
2082 C CB    . PHE B 113 ? 0.3806 0.2665 0.2637 0.0477  -0.0168 0.0191  241 PHE B CB    
2083 C CG    . PHE B 113 ? 0.4155 0.2784 0.2838 0.0481  -0.0123 0.0180  241 PHE B CG    
2084 C CD1   . PHE B 113 ? 0.4222 0.2749 0.2800 0.0473  -0.0153 0.0198  241 PHE B CD1   
2085 C CD2   . PHE B 113 ? 0.4103 0.2611 0.2739 0.0487  -0.0045 0.0151  241 PHE B CD2   
2086 C CE1   . PHE B 113 ? 0.4222 0.2549 0.2673 0.0459  -0.0111 0.0187  241 PHE B CE1   
2087 C CE2   . PHE B 113 ? 0.4377 0.2674 0.2868 0.0472  -0.0012 0.0137  241 PHE B CE2   
2088 C CZ    . PHE B 113 ? 0.4318 0.2532 0.2728 0.0457  -0.0045 0.0155  241 PHE B CZ    
2089 N N     . SER B 114 ? 0.3805 0.3119 0.2890 0.0471  -0.0317 0.0247  242 SER B N     
2090 C CA    . SER B 114 ? 0.3611 0.3141 0.2827 0.0414  -0.0361 0.0238  242 SER B CA    
2091 C C     . SER B 114 ? 0.3640 0.3140 0.2756 0.0299  -0.0410 0.0194  242 SER B C     
2092 O O     . SER B 114 ? 0.3849 0.3206 0.2816 0.0281  -0.0425 0.0185  242 SER B O     
2093 C CB    . SER B 114 ? 0.3909 0.3647 0.3263 0.0480  -0.0430 0.0304  242 SER B CB    
2094 O OG    . SER B 114 ? 0.3882 0.3569 0.3119 0.0500  -0.0508 0.0346  242 SER B OG    
2095 N N     . VAL B 115 ? 0.3433 0.3059 0.2633 0.0217  -0.0421 0.0162  243 VAL B N     
2096 C CA    . VAL B 115 ? 0.3527 0.3117 0.2637 0.0107  -0.0461 0.0116  243 VAL B CA    
2097 C C     . VAL B 115 ? 0.3542 0.3241 0.2628 0.0079  -0.0559 0.0135  243 VAL B C     
2098 O O     . VAL B 115 ? 0.3381 0.3293 0.2600 0.0088  -0.0616 0.0171  243 VAL B O     
2099 C CB    . VAL B 115 ? 0.3471 0.3128 0.2660 0.0018  -0.0433 0.0076  243 VAL B CB    
2100 C CG1   . VAL B 115 ? 0.3731 0.3335 0.2821 -0.0095 -0.0473 0.0027  243 VAL B CG1   
2101 C CG2   . VAL B 115 ? 0.3780 0.3306 0.2948 0.0031  -0.0344 0.0059  243 VAL B CG2   
2102 N N     . ILE B 116 ? 0.3485 0.3050 0.2401 0.0040  -0.0581 0.0111  244 ILE B N     
2103 C CA    . ILE B 116 ? 0.3528 0.3164 0.2365 -0.0013 -0.0673 0.0117  244 ILE B CA    
2104 C C     . ILE B 116 ? 0.3485 0.3135 0.2294 -0.0145 -0.0687 0.0048  244 ILE B C     
2105 O O     . ILE B 116 ? 0.3626 0.3440 0.2479 -0.0212 -0.0764 0.0050  244 ILE B O     
2106 C CB    . ILE B 116 ? 0.3588 0.3056 0.2232 0.0006  -0.0674 0.0124  244 ILE B CB    
2107 C CG1   . ILE B 116 ? 0.3862 0.3305 0.2522 0.0129  -0.0666 0.0199  244 ILE B CG1   
2108 C CG2   . ILE B 116 ? 0.3711 0.3218 0.2224 -0.0066 -0.0761 0.0119  244 ILE B CG2   
2109 C CD1   . ILE B 116 ? 0.4173 0.3414 0.2648 0.0145  -0.0634 0.0203  244 ILE B CD1   
2110 N N     . GLU B 117 ? 0.3446 0.2914 0.2171 -0.0182 -0.0616 -0.0009 245 GLU B N     
2111 C CA    . GLU B 117 ? 0.3740 0.3163 0.2421 -0.0301 -0.0609 -0.0077 245 GLU B CA    
2112 C C     . GLU B 117 ? 0.3744 0.3008 0.2427 -0.0292 -0.0518 -0.0107 245 GLU B C     
2113 O O     . GLU B 117 ? 0.3434 0.2592 0.2091 -0.0215 -0.0473 -0.0090 245 GLU B O     
2114 C CB    . GLU B 117 ? 0.3782 0.3115 0.2270 -0.0371 -0.0646 -0.0119 245 GLU B CB    
2115 C CG    . GLU B 117 ? 0.3975 0.3112 0.2321 -0.0321 -0.0589 -0.0130 245 GLU B CG    
2116 C CD    . GLU B 117 ? 0.4494 0.3529 0.2634 -0.0387 -0.0603 -0.0174 245 GLU B CD    
2117 O OE1   . GLU B 117 ? 0.4582 0.3619 0.2653 -0.0494 -0.0634 -0.0227 245 GLU B OE1   
2118 O OE2   . GLU B 117 ? 0.4418 0.3351 0.2452 -0.0339 -0.0571 -0.0162 245 GLU B OE2   
2119 N N     . GLU B 118 ? 0.3472 0.2709 0.2175 -0.0377 -0.0496 -0.0148 246 GLU B N     
2120 C CA    . GLU B 118 ? 0.3748 0.2815 0.2428 -0.0373 -0.0421 -0.0170 246 GLU B CA    
2121 C C     . GLU B 118 ? 0.3805 0.2766 0.2418 -0.0481 -0.0405 -0.0228 246 GLU B C     
2122 O O     . GLU B 118 ? 0.3704 0.2750 0.2310 -0.0578 -0.0450 -0.0256 246 GLU B O     
2123 C CB    . GLU B 118 ? 0.3572 0.2689 0.2370 -0.0326 -0.0383 -0.0131 246 GLU B CB    
2124 C CG    . GLU B 118 ? 0.3620 0.2934 0.2555 -0.0370 -0.0399 -0.0115 246 GLU B CG    
2125 C CD    . GLU B 118 ? 0.3772 0.3145 0.2811 -0.0301 -0.0349 -0.0074 246 GLU B CD    
2126 O OE1   . GLU B 118 ? 0.3482 0.2718 0.2463 -0.0237 -0.0307 -0.0063 246 GLU B OE1   
2127 O OE2   . GLU B 118 ? 0.3908 0.3467 0.3087 -0.0322 -0.0348 -0.0057 246 GLU B OE2   
2128 N N     . SER B 119 ? 0.3956 0.2722 0.2512 -0.0464 -0.0344 -0.0247 247 SER B N     
2129 C CA    . SER B 119 ? 0.3891 0.2488 0.2347 -0.0551 -0.0314 -0.0307 247 SER B CA    
2130 C C     . SER B 119 ? 0.4200 0.2791 0.2698 -0.0642 -0.0299 -0.0315 247 SER B C     
2131 O O     . SER B 119 ? 0.4271 0.2725 0.2677 -0.0737 -0.0280 -0.0369 247 SER B O     
2132 C CB    . SER B 119 ? 0.3835 0.2225 0.2231 -0.0483 -0.0252 -0.0316 247 SER B CB    
2133 O OG    . SER B 119 ? 0.4004 0.2375 0.2476 -0.0423 -0.0227 -0.0267 247 SER B OG    
2134 N N     . LEU B 120 ? 0.4061 0.2774 0.2678 -0.0621 -0.0294 -0.0266 248 LEU B N     
2135 C CA    . LEU B 120 ? 0.4239 0.2994 0.2915 -0.0714 -0.0275 -0.0265 248 LEU B CA    
2136 C C     . LEU B 120 ? 0.4086 0.3129 0.2916 -0.0743 -0.0316 -0.0241 248 LEU B C     
2137 O O     . LEU B 120 ? 0.3929 0.3104 0.2854 -0.0646 -0.0318 -0.0193 248 LEU B O     
2138 C CB    . LEU B 120 ? 0.4427 0.3073 0.3113 -0.0668 -0.0214 -0.0223 248 LEU B CB    
2139 C CG    . LEU B 120 ? 0.5274 0.3650 0.3847 -0.0655 -0.0169 -0.0229 248 LEU B CG    
2140 C CD1   . LEU B 120 ? 0.5708 0.4025 0.4291 -0.0621 -0.0130 -0.0173 248 LEU B CD1   
2141 C CD2   . LEU B 120 ? 0.5544 0.3768 0.4030 -0.0775 -0.0149 -0.0282 248 LEU B CD2   
2142 N N     . PRO B 121 ? 0.4283 0.3424 0.3151 -0.0875 -0.0339 -0.0270 249 PRO B N     
2143 C CA    . PRO B 121 ? 0.4383 0.3838 0.3439 -0.0898 -0.0379 -0.0240 249 PRO B CA    
2144 C C     . PRO B 121 ? 0.4233 0.3762 0.3414 -0.0842 -0.0310 -0.0192 249 PRO B C     
2145 O O     . PRO B 121 ? 0.4632 0.4008 0.3760 -0.0887 -0.0240 -0.0196 249 PRO B O     
2146 C CB    . PRO B 121 ? 0.4820 0.4327 0.3882 -0.1076 -0.0403 -0.0287 249 PRO B CB    
2147 C CG    . PRO B 121 ? 0.5026 0.4261 0.3869 -0.1128 -0.0406 -0.0350 249 PRO B CG    
2148 C CD    . PRO B 121 ? 0.4779 0.3762 0.3527 -0.1012 -0.0334 -0.0334 249 PRO B CD    
2149 N N     . GLY B 122 ? 0.4139 0.3874 0.3459 -0.0745 -0.0324 -0.0147 250 GLY B N     
2150 C CA    . GLY B 122 ? 0.4096 0.3883 0.3514 -0.0681 -0.0244 -0.0108 250 GLY B CA    
2151 C C     . GLY B 122 ? 0.3853 0.3434 0.3150 -0.0565 -0.0201 -0.0090 250 GLY B C     
2152 O O     . GLY B 122 ? 0.3913 0.3520 0.3256 -0.0499 -0.0142 -0.0061 250 GLY B O     
2153 N N     . GLY B 123 ? 0.3686 0.3070 0.2830 -0.0542 -0.0231 -0.0108 251 GLY B N     
2154 C CA    . GLY B 123 ? 0.3335 0.2557 0.2386 -0.0441 -0.0205 -0.0089 251 GLY B CA    
2155 C C     . GLY B 123 ? 0.3631 0.2706 0.2619 -0.0453 -0.0136 -0.0075 251 GLY B C     
2156 O O     . GLY B 123 ? 0.3546 0.2539 0.2496 -0.0545 -0.0108 -0.0087 251 GLY B O     
2157 N N     . LEU B 124 ? 0.3387 0.2405 0.2338 -0.0366 -0.0111 -0.0049 252 LEU B N     
2158 C CA    . LEU B 124 ? 0.3444 0.2305 0.2297 -0.0370 -0.0062 -0.0030 252 LEU B CA    
2159 C C     . LEU B 124 ? 0.3545 0.2485 0.2437 -0.0343 0.0000  -0.0012 252 LEU B C     
2160 O O     . LEU B 124 ? 0.3433 0.2517 0.2424 -0.0285 0.0003  -0.0009 252 LEU B O     
2161 C CB    . LEU B 124 ? 0.3550 0.2246 0.2291 -0.0306 -0.0091 -0.0019 252 LEU B CB    
2162 C CG    . LEU B 124 ? 0.3537 0.2138 0.2239 -0.0308 -0.0135 -0.0037 252 LEU B CG    
2163 C CD1   . LEU B 124 ? 0.3463 0.1954 0.2103 -0.0238 -0.0158 -0.0022 252 LEU B CD1   
2164 C CD2   . LEU B 124 ? 0.4111 0.2590 0.2764 -0.0387 -0.0118 -0.0045 252 LEU B CD2   
2165 N N     . LYS B 125 ? 0.3648 0.2474 0.2450 -0.0385 0.0055  0.0004  253 LYS B N     
2166 C CA    . LYS B 125 ? 0.3800 0.2655 0.2595 -0.0372 0.0136  0.0015  253 LYS B CA    
2167 C C     . LYS B 125 ? 0.3858 0.2494 0.2454 -0.0368 0.0147  0.0038  253 LYS B C     
2168 O O     . LYS B 125 ? 0.3627 0.2116 0.2125 -0.0379 0.0096  0.0053  253 LYS B O     
2169 C CB    . LYS B 125 ? 0.4365 0.3319 0.3237 -0.0463 0.0205  0.0014  253 LYS B CB    
2170 C CG    . LYS B 125 ? 0.5219 0.4425 0.4304 -0.0489 0.0190  -0.0004 253 LYS B CG    
2171 C CD    . LYS B 125 ? 0.6044 0.5441 0.5276 -0.0391 0.0207  0.0000  253 LYS B CD    
2172 C CE    . LYS B 125 ? 0.6414 0.6106 0.5887 -0.0416 0.0192  -0.0003 253 LYS B CE    
2173 N NZ    . LYS B 125 ? 0.6337 0.6099 0.5855 -0.0394 0.0077  -0.0007 253 LYS B NZ    
2174 N N     . GLU B 126 ? 0.3701 0.2317 0.2235 -0.0347 0.0216  0.0041  254 GLU B N     
2175 C CA    . GLU B 126 ? 0.3829 0.2243 0.2151 -0.0356 0.0220  0.0063  254 GLU B CA    
2176 C C     . GLU B 126 ? 0.3774 0.2043 0.1975 -0.0435 0.0214  0.0097  254 GLU B C     
2177 O O     . GLU B 126 ? 0.4016 0.2129 0.2081 -0.0428 0.0154  0.0128  254 GLU B O     
2178 C CB    . GLU B 126 ? 0.3775 0.2183 0.2031 -0.0341 0.0318  0.0051  254 GLU B CB    
2179 C CG    . GLU B 126 ? 0.4349 0.2548 0.2352 -0.0376 0.0328  0.0072  254 GLU B CG    
2180 C CD    . GLU B 126 ? 0.4593 0.2750 0.2491 -0.0358 0.0428  0.0046  254 GLU B CD    
2181 O OE1   . GLU B 126 ? 0.4545 0.2832 0.2587 -0.0297 0.0488  0.0014  254 GLU B OE1   
2182 O OE2   . GLU B 126 ? 0.4476 0.2460 0.2138 -0.0403 0.0448  0.0058  254 GLU B OE2   
2183 N N     . HIS B 127 ? 0.3761 0.2084 0.2019 -0.0509 0.0273  0.0096  255 HIS B N     
2184 C CA    . HIS B 127 ? 0.4403 0.2572 0.2551 -0.0591 0.0273  0.0130  255 HIS B CA    
2185 C C     . HIS B 127 ? 0.4409 0.2462 0.2533 -0.0565 0.0173  0.0147  255 HIS B C     
2186 O O     . HIS B 127 ? 0.4655 0.2513 0.2630 -0.0585 0.0148  0.0194  255 HIS B O     
2187 C CB    . HIS B 127 ? 0.4909 0.3197 0.3181 -0.0682 0.0343  0.0113  255 HIS B CB    
2188 C CG    . HIS B 127 ? 0.5827 0.3949 0.4001 -0.0775 0.0347  0.0142  255 HIS B CG    
2189 N ND1   . HIS B 127 ? 0.6316 0.4423 0.4560 -0.0811 0.0299  0.0126  255 HIS B ND1   
2190 C CD2   . HIS B 127 ? 0.6394 0.4336 0.4387 -0.0845 0.0401  0.0186  255 HIS B CD2   
2191 C CE1   . HIS B 127 ? 0.6069 0.3979 0.4183 -0.0893 0.0325  0.0159  255 HIS B CE1   
2192 N NE2   . HIS B 127 ? 0.6598 0.4410 0.4561 -0.0914 0.0384  0.0201  255 HIS B NE2   
2193 N N     . ASP B 128 ? 0.4084 0.2249 0.2351 -0.0519 0.0119  0.0112  256 ASP B N     
2194 C CA    . ASP B 128 ? 0.4101 0.2166 0.2361 -0.0492 0.0045  0.0118  256 ASP B CA    
2195 C C     . ASP B 128 ? 0.4137 0.2094 0.2308 -0.0417 -0.0019 0.0152  256 ASP B C     
2196 O O     . ASP B 128 ? 0.4297 0.2146 0.2449 -0.0391 -0.0067 0.0173  256 ASP B O     
2197 C CB    . ASP B 128 ? 0.3919 0.2135 0.2334 -0.0468 0.0012  0.0067  256 ASP B CB    
2198 C CG    . ASP B 128 ? 0.3832 0.2174 0.2347 -0.0550 0.0051  0.0036  256 ASP B CG    
2199 O OD1   . ASP B 128 ? 0.3883 0.2122 0.2347 -0.0636 0.0081  0.0043  256 ASP B OD1   
2200 O OD2   . ASP B 128 ? 0.3897 0.2435 0.2539 -0.0534 0.0048  0.0010  256 ASP B OD2   
2201 N N     . PHE B 129 ? 0.4014 0.2005 0.2137 -0.0383 -0.0016 0.0156  257 PHE B N     
2202 C CA    . PHE B 129 ? 0.4147 0.2057 0.2185 -0.0332 -0.0084 0.0188  257 PHE B CA    
2203 C C     . PHE B 129 ? 0.4883 0.2643 0.2725 -0.0372 -0.0082 0.0243  257 PHE B C     
2204 O O     . PHE B 129 ? 0.5522 0.3227 0.3270 -0.0348 -0.0142 0.0273  257 PHE B O     
2205 C CB    . PHE B 129 ? 0.3896 0.1914 0.1979 -0.0284 -0.0089 0.0154  257 PHE B CB    
2206 C CG    . PHE B 129 ? 0.3863 0.2002 0.2100 -0.0240 -0.0106 0.0116  257 PHE B CG    
2207 C CD1   . PHE B 129 ? 0.3426 0.1696 0.1771 -0.0249 -0.0061 0.0081  257 PHE B CD1   
2208 C CD2   . PHE B 129 ? 0.3665 0.1802 0.1943 -0.0192 -0.0170 0.0118  257 PHE B CD2   
2209 C CE1   . PHE B 129 ? 0.3454 0.1828 0.1914 -0.0213 -0.0086 0.0053  257 PHE B CE1   
2210 C CE2   . PHE B 129 ? 0.3431 0.1663 0.1822 -0.0160 -0.0178 0.0084  257 PHE B CE2   
2211 C CZ    . PHE B 129 ? 0.3548 0.1893 0.2016 -0.0171 -0.0141 0.0053  257 PHE B CZ    
2212 N N     . ASN B 130 ? 0.4715 0.2411 0.2488 -0.0441 -0.0016 0.0258  258 ASN B N     
2213 C CA    . ASN B 130 ? 0.5109 0.2631 0.2679 -0.0488 -0.0015 0.0321  258 ASN B CA    
2214 C C     . ASN B 130 ? 0.5906 0.3290 0.3466 -0.0488 -0.0059 0.0372  258 ASN B C     
2215 O O     . ASN B 130 ? 0.5556 0.2979 0.3254 -0.0485 -0.0047 0.0340  258 ASN B O     
2216 C CB    . ASN B 130 ? 0.4879 0.2394 0.2362 -0.0570 0.0101  0.0310  258 ASN B CB    
2217 C CG    . ASN B 130 ? 0.5005 0.2572 0.2415 -0.0563 0.0150  0.0278  258 ASN B CG    
2218 O OD1   . ASN B 130 ? 0.5301 0.2740 0.2492 -0.0606 0.0175  0.0307  258 ASN B OD1   
2219 N ND2   . ASN B 130 ? 0.4528 0.2253 0.2093 -0.0511 0.0162  0.0221  258 ASN B ND2   
2220 N N     . PRO B 131 ? 0.6470 0.3681 0.3857 -0.0491 -0.0109 0.0453  259 PRO B N     
2221 C CA    . PRO B 131 ? 0.6465 0.3504 0.3819 -0.0488 -0.0134 0.0514  259 PRO B CA    
2222 C C     . PRO B 131 ? 0.6614 0.3601 0.3979 -0.0570 -0.0039 0.0490  259 PRO B C     
2223 O O     . PRO B 131 ? 0.6042 0.3073 0.3359 -0.0652 0.0050  0.0465  259 PRO B O     
2224 C CB    . PRO B 131 ? 0.7184 0.4054 0.4301 -0.0505 -0.0181 0.0610  259 PRO B CB    
2225 C CG    . PRO B 131 ? 0.6911 0.3881 0.3984 -0.0485 -0.0229 0.0597  259 PRO B CG    
2226 C CD    . PRO B 131 ? 0.6773 0.3919 0.3961 -0.0504 -0.0144 0.0496  259 PRO B CD    
2227 N N     . GLU B 132 ? 0.7087 0.3976 0.4517 -0.0556 -0.0047 0.0495  260 GLU B N     
2228 C CA    . GLU B 132 ? 0.7078 0.3916 0.4524 -0.0650 0.0039  0.0462  260 GLU B CA    
2229 C C     . GLU B 132 ? 0.6782 0.3470 0.4038 -0.0754 0.0109  0.0514  260 GLU B C     
2230 O O     . GLU B 132 ? 0.7080 0.3579 0.4161 -0.0737 0.0072  0.0603  260 GLU B O     
2231 C CB    . GLU B 132 ? 0.7814 0.4509 0.5315 -0.0617 0.0020  0.0461  260 GLU B CB    
2232 C CG    . GLU B 132 ? 0.7968 0.4636 0.5510 -0.0726 0.0099  0.0401  260 GLU B CG    
2233 C CD    . GLU B 132 ? 0.9020 0.5967 0.6707 -0.0784 0.0138  0.0315  260 GLU B CD    
2234 O OE1   . GLU B 132 ? 0.8400 0.5541 0.6210 -0.0708 0.0094  0.0275  260 GLU B OE1   
2235 O OE2   . GLU B 132 ? 0.9981 0.6954 0.7663 -0.0905 0.0214  0.0294  260 GLU B OE2   
2236 C "C5'" . DG  C 1   ? 0.6234 0.3600 0.8532 0.0179  -0.1434 0.0120  1   DG  X "C5'" 
2237 C "C4'" . DG  C 1   ? 0.5928 0.3548 0.8236 0.0154  -0.1188 0.0092  1   DG  X "C4'" 
2238 O "O4'" . DG  C 1   ? 0.5892 0.3474 0.7822 0.0139  -0.1054 0.0067  1   DG  X "O4'" 
2239 C "C3'" . DG  C 1   ? 0.5889 0.3566 0.8241 0.0152  -0.1225 0.0083  1   DG  X "C3'" 
2240 O "O3'" . DG  C 1   ? 0.5754 0.3641 0.8248 0.0137  -0.1023 0.0066  1   DG  X "O3'" 
2241 C "C2'" . DG  C 1   ? 0.6033 0.3555 0.7896 0.0146  -0.1204 0.0062  1   DG  X "C2'" 
2242 C "C1'" . DG  C 1   ? 0.5904 0.3499 0.7678 0.0129  -0.1017 0.0048  1   DG  X "C1'" 
2243 N N9    . DG  C 1   ? 0.5998 0.3398 0.7414 0.0130  -0.0930 0.0044  1   DG  X N9    
2244 C C8    . DG  C 1   ? 0.6382 0.3405 0.7384 0.0158  -0.0984 0.0059  1   DG  X C8    
2245 N N7    . DG  C 1   ? 0.6473 0.3349 0.7254 0.0159  -0.0783 0.0060  1   DG  X N7    
2246 C C5    . DG  C 1   ? 0.6057 0.3280 0.7202 0.0122  -0.0653 0.0041  1   DG  X C5    
2247 C C6    . DG  C 1   ? 0.5953 0.3218 0.7218 0.0103  -0.0453 0.0038  1   DG  X C6    
2248 O O6    . DG  C 1   ? 0.6206 0.3222 0.7311 0.0118  -0.0269 0.0057  1   DG  X O6    
2249 N N1    . DG  C 1   ? 0.5595 0.3160 0.7213 0.0068  -0.0472 0.0012  1   DG  X N1    
2250 C C2    . DG  C 1   ? 0.5398 0.3138 0.7131 0.0061  -0.0594 -0.0004 1   DG  X C2    
2251 N N2    . DG  C 1   ? 0.5217 0.3076 0.7124 0.0037  -0.0599 -0.0029 1   DG  X N2    
2252 N N3    . DG  C 1   ? 0.5438 0.3167 0.7127 0.0081  -0.0698 0.0007  1   DG  X N3    
2253 C C4    . DG  C 1   ? 0.5790 0.3290 0.7236 0.0107  -0.0753 0.0028  1   DG  X C4    
2254 P P     . DA  C 2   ? 0.5807 0.3801 0.8669 0.0146  -0.0982 0.0079  2   DA  X P     
2255 O OP1   . DA  C 2   ? 0.5940 0.3923 0.9310 0.0168  -0.1028 0.0124  2   DA  X OP1   
2256 O OP2   . DA  C 2   ? 0.5692 0.3682 0.8419 0.0140  -0.1081 0.0065  2   DA  X OP2   
2257 O "O5'" . DA  C 2   ? 0.5733 0.3770 0.8486 0.0140  -0.0730 0.0058  2   DA  X "O5'" 
2258 C "C5'" . DA  C 2   ? 0.5597 0.3570 0.8369 0.0150  -0.0586 0.0066  2   DA  X "C5'" 
2259 C "C4'" . DA  C 2   ? 0.5663 0.3537 0.8078 0.0142  -0.0455 0.0028  2   DA  X "C4'" 
2260 O "O4'" . DA  C 2   ? 0.5534 0.3445 0.7694 0.0111  -0.0565 -0.0006 2   DA  X "O4'" 
2261 C "C3'" . DA  C 2   ? 0.5685 0.3502 0.8014 0.0150  -0.0380 0.0015  2   DA  X "C3'" 
2262 O "O3'" . DA  C 2   ? 0.6115 0.3658 0.8114 0.0166  -0.0232 -0.0004 2   DA  X "O3'" 
2263 C "C2'" . DA  C 2   ? 0.5530 0.3451 0.7675 0.0117  -0.0535 -0.0020 2   DA  X "C2'" 
2264 C "C1'" . DA  C 2   ? 0.5464 0.3379 0.7473 0.0097  -0.0592 -0.0036 2   DA  X "C1'" 
2265 N N9    . DA  C 2   ? 0.5229 0.3237 0.7211 0.0074  -0.0690 -0.0044 2   DA  X N9    
2266 C C8    . DA  C 2   ? 0.5184 0.3211 0.7198 0.0080  -0.0760 -0.0023 2   DA  X C8    
2267 N N7    . DA  C 2   ? 0.5193 0.3188 0.7080 0.0068  -0.0764 -0.0030 2   DA  X N7    
2268 C C5    . DA  C 2   ? 0.5113 0.3145 0.7026 0.0045  -0.0722 -0.0057 2   DA  X C5    
2269 C C6    . DA  C 2   ? 0.5097 0.3129 0.7066 0.0024  -0.0694 -0.0069 2   DA  X C6    
2270 N N6    . DA  C 2   ? 0.5140 0.3102 0.7073 0.0029  -0.0619 -0.0050 2   DA  X N6    
2271 N N1    . DA  C 2   ? 0.5055 0.3087 0.7124 0.0003  -0.0745 -0.0097 2   DA  X N1    
2272 C C2    . DA  C 2   ? 0.5118 0.3071 0.7064 0.0010  -0.0795 -0.0114 2   DA  X C2    
2273 N N3    . DA  C 2   ? 0.5182 0.3097 0.7019 0.0036  -0.0744 -0.0101 2   DA  X N3    
2274 C C4    . DA  C 2   ? 0.5149 0.3155 0.7057 0.0049  -0.0715 -0.0071 2   DA  X C4    
2275 P P     . DG  C 3   ? 0.6595 0.3869 0.8395 0.0198  -0.0055 -0.0005 3   DG  X P     
2276 O OP1   . DG  C 3   ? 0.7019 0.3849 0.8435 0.0236  0.0142  -0.0005 3   DG  X OP1   
2277 O OP2   . DG  C 3   ? 0.6254 0.3688 0.8514 0.0214  0.0019  0.0036  3   DG  X OP2   
2278 O "O5'" . DG  C 3   ? 0.6622 0.3900 0.8119 0.0169  -0.0238 -0.0056 3   DG  X "O5'" 
2279 C "C5'" . DG  C 3   ? 0.6986 0.4115 0.8152 0.0147  -0.0391 -0.0100 3   DG  X "C5'" 
2280 C "C4'" . DG  C 3   ? 0.7120 0.4385 0.8290 0.0114  -0.0580 -0.0132 3   DG  X "C4'" 
2281 O "O4'" . DG  C 3   ? 0.6616 0.4265 0.8145 0.0086  -0.0647 -0.0117 3   DG  X "O4'" 
2282 C "C3'" . DG  C 3   ? 0.7490 0.4648 0.8538 0.0132  -0.0530 -0.0137 3   DG  X "C3'" 
2283 O "O3'" . DG  C 3   ? 0.8368 0.5394 0.9207 0.0112  -0.0728 -0.0181 3   DG  X "O3'" 
2284 C "C2'" . DG  C 3   ? 0.6919 0.4468 0.8381 0.0119  -0.0527 -0.0110 3   DG  X "C2'" 
2285 C "C1'" . DG  C 3   ? 0.6545 0.4320 0.8163 0.0083  -0.0666 -0.0117 3   DG  X "C1'" 
2286 N N9    . DG  C 3   ? 0.6088 0.4095 0.7962 0.0078  -0.0685 -0.0088 3   DG  X N9    
2287 C C8    . DG  C 3   ? 0.6022 0.4085 0.8113 0.0099  -0.0646 -0.0052 3   DG  X C8    
2288 N N7    . DG  C 3   ? 0.5862 0.4014 0.8046 0.0093  -0.0752 -0.0037 3   DG  X N7    
2289 C C5    . DG  C 3   ? 0.5782 0.3940 0.7795 0.0071  -0.0787 -0.0059 3   DG  X C5    
2290 C C6    . DG  C 3   ? 0.5759 0.3883 0.7681 0.0067  -0.0832 -0.0051 3   DG  X C6    
2291 O O6    . DG  C 3   ? 0.5783 0.3809 0.7646 0.0084  -0.0909 -0.0029 3   DG  X O6    
2292 N N1    . DG  C 3   ? 0.5617 0.3740 0.7499 0.0046  -0.0781 -0.0069 3   DG  X N1    
2293 C C2    . DG  C 3   ? 0.5597 0.3752 0.7547 0.0027  -0.0781 -0.0096 3   DG  X C2    
2294 N N2    . DG  C 3   ? 0.5478 0.3631 0.7542 0.0006  -0.0763 -0.0104 3   DG  X N2    
2295 N N3    . DG  C 3   ? 0.5662 0.3774 0.7562 0.0033  -0.0798 -0.0111 3   DG  X N3    
2296 C C4    . DG  C 3   ? 0.5822 0.3937 0.7739 0.0057  -0.0760 -0.0090 3   DG  X C4    
2297 P P     . DG  C 4   ? 0.9878 0.6527 1.0313 0.0140  -0.0726 -0.0202 4   DG  X P     
2298 O OP1   . DG  C 4   ? 1.0368 0.6394 1.0209 0.0181  -0.0693 -0.0217 4   DG  X OP1   
2299 O OP2   . DG  C 4   ? 0.9197 0.6041 0.9846 0.0156  -0.0546 -0.0170 4   DG  X OP2   
2300 O "O5'" . DG  C 4   ? 0.9718 0.6450 1.0238 0.0098  -0.1020 -0.0242 4   DG  X "O5'" 
2301 C "C5'" . DG  C 4   ? 0.9988 0.6720 1.0639 0.0064  -0.1241 -0.0264 4   DG  X "C5'" 
2302 C "C4'" . DG  C 4   ? 0.9974 0.7099 1.1128 0.0021  -0.1349 -0.0264 4   DG  X "C4'" 
2303 O "O4'" . DG  C 4   ? 0.9445 0.6980 1.0918 0.0013  -0.1160 -0.0226 4   DG  X "O4'" 
2304 C "C3'" . DG  C 4   ? 1.0298 0.7391 1.1408 0.0021  -0.1424 -0.0280 4   DG  X "C3'" 
2305 O "O3'" . DG  C 4   ? 1.1392 0.8598 1.2901 -0.0018 -0.1629 -0.0294 4   DG  X "O3'" 
2306 C "C2'" . DG  C 4   ? 0.9589 0.7037 1.0877 0.0027  -0.1202 -0.0246 4   DG  X "C2'" 
2307 C "C1'" . DG  C 4   ? 0.8667 0.6397 1.0279 0.0008  -0.1130 -0.0220 4   DG  X "C1'" 
2308 N N9    . DG  C 4   ? 0.7931 0.5866 0.9620 0.0022  -0.0966 -0.0185 4   DG  X N9    
2309 C C8    . DG  C 4   ? 0.7996 0.5881 0.9578 0.0053  -0.0847 -0.0166 4   DG  X C8    
2310 N N7    . DG  C 4   ? 0.7619 0.5694 0.9392 0.0057  -0.0796 -0.0135 4   DG  X N7    
2311 C C5    . DG  C 4   ? 0.6937 0.5130 0.8811 0.0035  -0.0850 -0.0135 4   DG  X C5    
2312 C C6    . DG  C 4   ? 0.6419 0.4682 0.8348 0.0038  -0.0841 -0.0110 4   DG  X C6    
2313 O O6    . DG  C 4   ? 0.6234 0.4497 0.8185 0.0056  -0.0860 -0.0086 4   DG  X O6    
2314 N N1    . DG  C 4   ? 0.6320 0.4575 0.8277 0.0022  -0.0817 -0.0110 4   DG  X N1    
2315 C C2    . DG  C 4   ? 0.6516 0.4776 0.8612 -0.0001 -0.0831 -0.0130 4   DG  X C2    
2316 N N2    . DG  C 4   ? 0.6533 0.4776 0.8775 -0.0009 -0.0745 -0.0115 4   DG  X N2    
2317 N N3    . DG  C 4   ? 0.6885 0.5092 0.8971 -0.0009 -0.0925 -0.0159 4   DG  X N3    
2318 C C4    . DG  C 4   ? 0.7136 0.5279 0.9030 0.0012  -0.0918 -0.0161 4   DG  X C4    
2319 P P     . DA  C 5   ? 1.2214 0.9303 1.3741 -0.0025 -0.1822 -0.0320 5   DA  X P     
2320 O OP1   . DA  C 5   ? 1.1739 0.8267 1.2887 -0.0014 -0.2138 -0.0362 5   DA  X OP1   
2321 O OP2   . DA  C 5   ? 1.1144 0.8361 1.2503 -0.0004 -0.1631 -0.0307 5   DA  X OP2   
2322 O "O5'" . DA  C 5   ? 1.0387 0.7828 1.2646 -0.0068 -0.1861 -0.0303 5   DA  X "O5'" 
2323 C "C5'" . DA  C 5   ? 0.9736 0.7466 1.2366 -0.0082 -0.1667 -0.0268 5   DA  X "C5'" 
2324 C "C4'" . DA  C 5   ? 0.8592 0.6621 1.1578 -0.0091 -0.1469 -0.0235 5   DA  X "C4'" 
2325 O "O4'" . DA  C 5   ? 0.7838 0.5998 1.0537 -0.0067 -0.1236 -0.0211 5   DA  X "O4'" 
2326 C "C3'" . DA  C 5   ? 0.8417 0.6453 1.1517 -0.0097 -0.1567 -0.0248 5   DA  X "C3'" 
2327 O "O3'" . DA  C 5   ? 0.8486 0.6651 1.2242 -0.0120 -0.1522 -0.0224 5   DA  X "O3'" 
2328 C "C2'" . DA  C 5   ? 0.7717 0.5864 1.0456 -0.0073 -0.1384 -0.0238 5   DA  X "C2'" 
2329 C "C1'" . DA  C 5   ? 0.7368 0.5621 1.0012 -0.0060 -0.1172 -0.0207 5   DA  X "C1'" 
2330 N N9    . DA  C 5   ? 0.6739 0.4995 0.9008 -0.0033 -0.1095 -0.0202 5   DA  X N9    
2331 C C8    . DA  C 5   ? 0.6707 0.4813 0.8665 -0.0014 -0.1142 -0.0219 5   DA  X C8    
2332 N N7    . DA  C 5   ? 0.6464 0.4625 0.8303 0.0008  -0.1024 -0.0198 5   DA  X N7    
2333 C C5    . DA  C 5   ? 0.6192 0.4506 0.8179 0.0004  -0.0954 -0.0172 5   DA  X C5    
2334 C C6    . DA  C 5   ? 0.5951 0.4313 0.7900 0.0021  -0.0898 -0.0144 5   DA  X C6    
2335 N N6    . DA  C 5   ? 0.6012 0.4367 0.7940 0.0042  -0.0887 -0.0131 5   DA  X N6    
2336 N N1    . DA  C 5   ? 0.5930 0.4274 0.7872 0.0023  -0.0855 -0.0124 5   DA  X N1    
2337 C C2    . DA  C 5   ? 0.6043 0.4371 0.8103 0.0007  -0.0796 -0.0125 5   DA  X C2    
2338 N N3    . DA  C 5   ? 0.6019 0.4382 0.8298 -0.0016 -0.0838 -0.0145 5   DA  X N3    
2339 C C4    . DA  C 5   ? 0.6232 0.4575 0.8426 -0.0017 -0.0956 -0.0172 5   DA  X C4    
2340 P P     . DG  C 6   ? 0.9287 0.7500 1.3400 -0.0132 -0.1591 -0.0225 6   DG  X P     
2341 O OP1   . DG  C 6   ? 0.9742 0.7959 1.4664 -0.0160 -0.1682 -0.0207 6   DG  X OP1   
2342 O OP2   . DG  C 6   ? 0.9216 0.7258 1.2851 -0.0121 -0.1815 -0.0268 6   DG  X OP2   
2343 O "O5'" . DG  C 6   ? 0.8656 0.7050 1.2686 -0.0114 -0.1230 -0.0186 6   DG  X "O5'" 
2344 C "C5'" . DG  C 6   ? 0.8460 0.6884 1.2425 -0.0097 -0.0937 -0.0147 6   DG  X "C5'" 
2345 C "C4'" . DG  C 6   ? 0.8581 0.7016 1.2166 -0.0070 -0.0730 -0.0128 6   DG  X "C4'" 
2346 O "O4'" . DG  C 6   ? 0.8239 0.6677 1.1283 -0.0055 -0.0819 -0.0150 6   DG  X "O4'" 
2347 C "C3'" . DG  C 6   ? 0.8742 0.7219 1.2476 -0.0073 -0.0733 -0.0131 6   DG  X "C3'" 
2348 O "O3'" . DG  C 6   ? 0.9678 0.8061 1.3236 -0.0045 -0.0443 -0.0093 6   DG  X "O3'" 
2349 C "C2'" . DG  C 6   ? 0.8268 0.6776 1.1564 -0.0069 -0.0930 -0.0170 6   DG  X "C2'" 
2350 C "C1'" . DG  C 6   ? 0.8004 0.6481 1.0877 -0.0047 -0.0849 -0.0160 6   DG  X "C1'" 
2351 N N9    . DG  C 6   ? 0.7349 0.5823 0.9880 -0.0038 -0.0974 -0.0185 6   DG  X N9    
2352 C C8    . DG  C 6   ? 0.7344 0.5740 0.9782 -0.0042 -0.1146 -0.0218 6   DG  X C8    
2353 N N7    . DG  C 6   ? 0.7535 0.5881 0.9661 -0.0021 -0.1132 -0.0222 6   DG  X N7    
2354 C C5    . DG  C 6   ? 0.7206 0.5647 0.9299 -0.0008 -0.1006 -0.0192 6   DG  X C5    
2355 C C6    . DG  C 6   ? 0.7055 0.5501 0.9009 0.0014  -0.0966 -0.0176 6   DG  X C6    
2356 O O6    . DG  C 6   ? 0.7165 0.5547 0.9026 0.0030  -0.0956 -0.0179 6   DG  X O6    
2357 N N1    . DG  C 6   ? 0.6678 0.5137 0.8618 0.0023  -0.0926 -0.0149 6   DG  X N1    
2358 C C2    . DG  C 6   ? 0.6648 0.5052 0.8585 0.0020  -0.0861 -0.0136 6   DG  X C2    
2359 N N2    . DG  C 6   ? 0.6680 0.4943 0.8425 0.0041  -0.0844 -0.0112 6   DG  X N2    
2360 N N3    . DG  C 6   ? 0.6839 0.5258 0.8960 0.0002  -0.0814 -0.0143 6   DG  X N3    
2361 C C4    . DG  C 6   ? 0.7219 0.5692 0.9465 -0.0016 -0.0921 -0.0172 6   DG  X C4    
2362 P P     . DG  C 7   ? 0.9857 0.8205 1.3732 -0.0040 -0.0270 -0.0067 7   DG  X P     
2363 O OP1   . DG  C 7   ? 1.0123 0.8412 1.4652 -0.0046 -0.0068 -0.0026 7   DG  X OP1   
2364 O OP2   . DG  C 7   ? 0.8824 0.7317 1.2759 -0.0060 -0.0525 -0.0106 7   DG  X OP2   
2365 O "O5'" . DG  C 7   ? 0.9999 0.8102 1.3265 0.0005  -0.0025 -0.0039 7   DG  X "O5'" 
2366 C "C5'" . DG  C 7   ? 1.0031 0.7915 1.2808 0.0034  0.0070  -0.0023 7   DG  X "C5'" 
2367 C "C4'" . DG  C 7   ? 1.0194 0.7977 1.2342 0.0056  -0.0060 -0.0039 7   DG  X "C4'" 
2368 O "O4'" . DG  C 7   ? 0.9390 0.7455 1.1555 0.0031  -0.0354 -0.0079 7   DG  X "O4'" 
2369 C "C3'" . DG  C 7   ? 1.0444 0.8126 1.2426 0.0072  -0.0009 -0.0035 7   DG  X "C3'" 
2370 O "O3'" . DG  C 7   ? 1.1609 0.8935 1.2926 0.0113  -0.0019 -0.0025 7   DG  X "O3'" 
2371 C "C2'" . DG  C 7   ? 0.9379 0.7415 1.1540 0.0039  -0.0287 -0.0079 7   DG  X "C2'" 
2372 C "C1'" . DG  C 7   ? 0.8706 0.6824 1.0710 0.0034  -0.0463 -0.0096 7   DG  X "C1'" 
2373 N N9    . DG  C 7   ? 0.7411 0.5780 0.9566 0.0010  -0.0670 -0.0131 7   DG  X N9    
2374 C C8    . DG  C 7   ? 0.7079 0.5586 0.9555 -0.0017 -0.0763 -0.0155 7   DG  X C8    
2375 N N7    . DG  C 7   ? 0.6784 0.5349 0.9151 -0.0021 -0.0919 -0.0183 7   DG  X N7    
2376 C C5    . DG  C 7   ? 0.6615 0.5157 0.8718 0.0000  -0.0906 -0.0171 7   DG  X C5    
2377 C C6    . DG  C 7   ? 0.6595 0.5157 0.8582 0.0011  -0.0973 -0.0179 7   DG  X C6    
2378 O O6    . DG  C 7   ? 0.6589 0.5128 0.8545 0.0011  -0.1021 -0.0199 7   DG  X O6    
2379 N N1    . DG  C 7   ? 0.6637 0.5165 0.8529 0.0030  -0.0971 -0.0155 7   DG  X N1    
2380 C C2    . DG  C 7   ? 0.6956 0.5352 0.8709 0.0042  -0.0947 -0.0134 7   DG  X C2    
2381 N N2    . DG  C 7   ? 0.7233 0.5528 0.8885 0.0062  -0.1038 -0.0116 7   DG  X N2    
2382 N N3    . DG  C 7   ? 0.6820 0.5116 0.8534 0.0040  -0.0835 -0.0126 7   DG  X N3    
2383 C C4    . DG  C 7   ? 0.6867 0.5286 0.8835 0.0017  -0.0802 -0.0143 7   DG  X C4    
2384 P P     . DC  C 8   ? 1.3631 1.0378 1.4475 0.0169  0.0288  0.0017  8   DC  X P     
2385 O OP1   . DC  C 8   ? 1.1889 0.8256 1.2489 0.0201  0.0507  0.0052  8   DC  X OP1   
2386 O OP2   . DC  C 8   ? 1.2975 0.9825 1.4227 0.0159  0.0477  0.0028  8   DC  X OP2   
2387 O "O5'" . DC  C 8   ? 1.3070 0.9541 1.3259 0.0197  0.0051  0.0003  8   DC  X "O5'" 
2388 C "C5'" . DC  C 8   ? 1.2589 0.8780 1.2291 0.0221  -0.0164 0.0000  8   DC  X "C5'" 
2389 C "C4'" . DC  C 8   ? 1.1729 0.8129 1.1446 0.0205  -0.0538 -0.0030 8   DC  X "C4'" 
2390 O "O4'" . DC  C 8   ? 1.0514 0.7562 1.0887 0.0152  -0.0638 -0.0056 8   DC  X "O4'" 
2391 C "C3'" . DC  C 8   ? 1.1440 0.7656 1.0909 0.0222  -0.0579 -0.0034 8   DC  X "C3'" 
2392 O "O3'" . DC  C 8   ? 1.2256 0.7871 1.1043 0.0268  -0.0802 -0.0027 8   DC  X "O3'" 
2393 C "C2'" . DC  C 8   ? 1.0724 0.7578 1.0804 0.0171  -0.0713 -0.0064 8   DC  X "C2'" 
2394 C "C1'" . DC  C 8   ? 1.0183 0.7406 1.0647 0.0141  -0.0825 -0.0075 8   DC  X "C1'" 
2395 N N1    . DC  C 8   ? 0.8793 0.6525 0.9792 0.0099  -0.0826 -0.0099 8   DC  X N1    
2396 C C2    . DC  C 8   ? 0.8599 0.6588 0.9826 0.0084  -0.1005 -0.0114 8   DC  X C2    
2397 O O2    . DC  C 8   ? 0.9429 0.7292 1.0558 0.0100  -0.1171 -0.0104 8   DC  X O2    
2398 N N3    . DC  C 8   ? 0.7849 0.6144 0.9394 0.0058  -0.0990 -0.0135 8   DC  X N3    
2399 C C4    . DC  C 8   ? 0.7660 0.6040 0.9354 0.0040  -0.0884 -0.0146 8   DC  X C4    
2400 N N4    . DC  C 8   ? 0.7364 0.5925 0.9262 0.0021  -0.0934 -0.0170 8   DC  X N4    
2401 C C5    . DC  C 8   ? 0.8059 0.6269 0.9703 0.0048  -0.0718 -0.0128 8   DC  X C5    
2402 C C6    . DC  C 8   ? 0.8345 0.6221 0.9613 0.0080  -0.0654 -0.0103 8   DC  X C6    
2403 P P     . DT  C 9   ? 1.2332 0.7990 1.1134 0.0263  -0.1230 -0.0047 9   DT  X P     
2404 O OP1   . DT  C 9   ? 1.2701 0.7690 1.0881 0.0310  -0.1519 -0.0037 9   DT  X OP1   
2405 O OP2   . DT  C 9   ? 1.2572 0.8291 1.1387 0.0259  -0.1164 -0.0055 9   DT  X OP2   
2406 O "O5'" . DT  C 9   ? 1.1806 0.8188 1.1400 0.0210  -0.1372 -0.0065 9   DT  X "O5'" 
2407 C "C5'" . DT  C 9   ? 1.1174 0.7601 1.0976 0.0207  -0.1717 -0.0065 9   DT  X "C5'" 
2408 C "C4'" . DT  C 9   ? 1.0257 0.7186 1.0671 0.0174  -0.1810 -0.0077 9   DT  X "C4'" 
2409 O "O4'" . DT  C 9   ? 0.9588 0.6996 1.0357 0.0140  -0.1542 -0.0092 9   DT  X "O4'" 
2410 C "C3'" . DT  C 9   ? 1.0373 0.7128 1.0652 0.0186  -0.1973 -0.0082 9   DT  X "C3'" 
2411 O "O3'" . DT  C 9   ? 1.0529 0.7485 1.1343 0.0175  -0.2236 -0.0076 9   DT  X "O3'" 
2412 C "C2'" . DT  C 9   ? 0.9622 0.6722 1.0056 0.0162  -0.1697 -0.0097 9   DT  X "C2'" 
2413 C "C1'" . DT  C 9   ? 0.9260 0.6846 1.0202 0.0129  -0.1563 -0.0103 9   DT  X "C1'" 
2414 N N1    . DT  C 9   ? 0.8092 0.5978 0.9201 0.0104  -0.1323 -0.0120 9   DT  X N1    
2415 C C2    . DT  C 9   ? 0.7397 0.5642 0.8901 0.0082  -0.1290 -0.0133 9   DT  X C2    
2416 O O2    . DT  C 9   ? 0.7534 0.5884 0.9299 0.0083  -0.1375 -0.0125 9   DT  X O2    
2417 N N3    . DT  C 9   ? 0.6741 0.5146 0.8323 0.0063  -0.1148 -0.0151 9   DT  X N3    
2418 C C4    . DT  C 9   ? 0.6826 0.5145 0.8297 0.0060  -0.1019 -0.0152 9   DT  X C4    
2419 O O4    . DT  C 9   ? 0.7063 0.5539 0.8734 0.0040  -0.0953 -0.0167 9   DT  X O4    
2420 C C5    . DT  C 9   ? 0.7462 0.5422 0.8565 0.0088  -0.0974 -0.0130 9   DT  X C5    
2421 C C7    . DT  C 9   ? 0.7609 0.5394 0.8618 0.0096  -0.0743 -0.0117 9   DT  X C7    
2422 C C6    . DT  C 9   ? 0.7999 0.5724 0.8862 0.0111  -0.1139 -0.0118 9   DT  X C6    
2423 P P     . DT  C 10  ? 1.0895 0.7744 1.1811 0.0181  -0.2491 -0.0076 10  DT  X P     
2424 O OP1   . DT  C 10  ? 1.1318 0.7472 1.1680 0.0220  -0.2853 -0.0069 10  DT  X OP1   
2425 O OP2   . DT  C 10  ? 1.0277 0.7347 1.1148 0.0166  -0.2256 -0.0094 10  DT  X OP2   
2426 O "O5'" . DT  C 10  ? 1.0290 0.7568 1.2099 0.0160  -0.2581 -0.0059 10  DT  X "O5'" 
2427 C "C5'" . DT  C 10  ? 0.9193 0.6934 1.1451 0.0138  -0.2289 -0.0056 10  DT  X "C5'" 
2428 C "C4'" . DT  C 10  ? 0.8370 0.6468 1.0977 0.0121  -0.2085 -0.0062 10  DT  X "C4'" 
2429 O "O4'" . DT  C 10  ? 0.7820 0.6046 1.0083 0.0108  -0.1818 -0.0090 10  DT  X "O4'" 
2430 C "C3'" . DT  C 10  ? 0.8444 0.6488 1.1191 0.0125  -0.2252 -0.0060 10  DT  X "C3'" 
2431 O "O3'" . DT  C 10  ? 0.8472 0.6735 1.1978 0.0124  -0.2237 -0.0030 10  DT  X "O3'" 
2432 C "C2'" . DT  C 10  ? 0.7970 0.6118 1.0353 0.0114  -0.2035 -0.0090 10  DT  X "C2'" 
2433 C "C1'" . DT  C 10  ? 0.7470 0.5828 0.9802 0.0101  -0.1751 -0.0102 10  DT  X "C1'" 
2434 N N1    . DT  C 10  ? 0.6807 0.5172 0.8745 0.0091  -0.1588 -0.0128 10  DT  X N1    
2435 C C2    . DT  C 10  ? 0.6270 0.4860 0.8306 0.0076  -0.1395 -0.0145 10  DT  X C2    
2436 O O2    . DT  C 10  ? 0.6242 0.4960 0.8542 0.0076  -0.1316 -0.0141 10  DT  X O2    
2437 N N3    . DT  C 10  ? 0.6015 0.4596 0.7818 0.0065  -0.1296 -0.0164 10  DT  X N3    
2438 C C4    . DT  C 10  ? 0.6243 0.4613 0.7740 0.0073  -0.1285 -0.0161 10  DT  X C4    
2439 O O4    . DT  C 10  ? 0.6311 0.4703 0.7763 0.0064  -0.1148 -0.0170 10  DT  X O4    
2440 C C5    . DT  C 10  ? 0.6672 0.4728 0.7921 0.0098  -0.1445 -0.0143 10  DT  X C5    
2441 C C7    . DT  C 10  ? 0.7032 0.4674 0.7772 0.0123  -0.1396 -0.0135 10  DT  X C7    
2442 C C6    . DT  C 10  ? 0.6859 0.4931 0.8340 0.0103  -0.1628 -0.0131 10  DT  X C6    
2443 P P     . DT  C 11  ? 0.9043 0.7405 1.2915 0.0123  -0.2261 -0.0023 11  DT  X P     
2444 O OP1   . DT  C 11  ? 0.9064 0.7495 1.3816 0.0131  -0.2346 0.0025  11  DT  X OP1   
2445 O OP2   . DT  C 11  ? 0.8933 0.7037 1.2267 0.0125  -0.2480 -0.0048 11  DT  X OP2   
2446 O "O5'" . DT  C 11  ? 0.8346 0.6983 1.2193 0.0116  -0.1844 -0.0036 11  DT  X "O5'" 
2447 C "C5'" . DT  C 11  ? 0.7684 0.6436 1.1750 0.0122  -0.1566 -0.0020 11  DT  X "C5'" 
2448 C "C4'" . DT  C 11  ? 0.7014 0.5847 1.0880 0.0124  -0.1257 -0.0039 11  DT  X "C4'" 
2449 O "O4'" . DT  C 11  ? 0.6386 0.5213 0.9640 0.0107  -0.1272 -0.0085 11  DT  X "O4'" 
2450 C "C3'" . DT  C 11  ? 0.6639 0.5511 1.0808 0.0132  -0.1200 -0.0025 11  DT  X "C3'" 
2451 O "O3'" . DT  C 11  ? 0.6880 0.5706 1.1154 0.0157  -0.0840 -0.0007 11  DT  X "O3'" 
2452 C "C2'" . DT  C 11  ? 0.6442 0.5323 1.0106 0.0114  -0.1313 -0.0068 11  DT  X "C2'" 
2453 C "C1'" . DT  C 11  ? 0.6134 0.4998 0.9275 0.0103  -0.1237 -0.0102 11  DT  X "C1'" 
2454 N N1    . DT  C 11  ? 0.5674 0.4503 0.8377 0.0086  -0.1358 -0.0133 11  DT  X N1    
2455 C C2    . DT  C 11  ? 0.5255 0.4116 0.7656 0.0075  -0.1241 -0.0164 11  DT  X C2    
2456 O O2    . DT  C 11  ? 0.5126 0.3994 0.7504 0.0080  -0.1098 -0.0173 11  DT  X O2    
2457 N N3    . DT  C 11  ? 0.5165 0.3974 0.7287 0.0065  -0.1301 -0.0179 11  DT  X N3    
2458 C C4    . DT  C 11  ? 0.5410 0.4051 0.7365 0.0072  -0.1437 -0.0169 11  DT  X C4    
2459 O O4    . DT  C 11  ? 0.5337 0.3860 0.7001 0.0071  -0.1398 -0.0178 11  DT  X O4    
2460 C C5    . DT  C 11  ? 0.5689 0.4232 0.7841 0.0085  -0.1620 -0.0145 11  DT  X C5    
2461 C C7    . DT  C 11  ? 0.6064 0.4266 0.7908 0.0102  -0.1844 -0.0138 11  DT  X C7    
2462 C C6    . DT  C 11  ? 0.5718 0.4402 0.8311 0.0088  -0.1583 -0.0127 11  DT  X C6    
2463 P P     . DT  C 12  ? 0.7809 0.6595 1.2255 0.0176  -0.0630 0.0007  12  DT  X P     
2464 O OP1   . DT  C 12  ? 0.7328 0.5930 1.2031 0.0219  -0.0234 0.0052  12  DT  X OP1   
2465 O OP2   . DT  C 12  ? 0.7632 0.6528 1.2487 0.0163  -0.0894 0.0019  12  DT  X OP2   
2466 O "O5'" . DT  C 12  ? 0.6793 0.5518 1.0478 0.0167  -0.0584 -0.0050 12  DT  X "O5'" 
2467 C "C5'" . DT  C 12  ? 0.6404 0.4931 0.9596 0.0181  -0.0404 -0.0071 12  DT  X "C5'" 
2468 C "C4'" . DT  C 12  ? 0.6120 0.4577 0.8770 0.0171  -0.0450 -0.0120 12  DT  X "C4'" 
2469 O "O4'" . DT  C 12  ? 0.5583 0.4263 0.8164 0.0132  -0.0722 -0.0148 12  DT  X "O4'" 
2470 C "C3'" . DT  C 12  ? 0.6085 0.4445 0.8758 0.0191  -0.0317 -0.0112 12  DT  X "C3'" 
2471 O "O3'" . DT  C 12  ? 0.6558 0.4538 0.8669 0.0222  -0.0145 -0.0132 12  DT  X "O3'" 
2472 C "C2'" . DT  C 12  ? 0.5616 0.4236 0.8352 0.0156  -0.0573 -0.0135 12  DT  X "C2'" 
2473 C "C1'" . DT  C 12  ? 0.5368 0.4085 0.7844 0.0125  -0.0769 -0.0167 12  DT  X "C1'" 
2474 N N1    . DT  C 12  ? 0.4913 0.3802 0.7454 0.0098  -0.0991 -0.0175 12  DT  X N1    
2475 C C2    . DT  C 12  ? 0.4838 0.3754 0.7084 0.0077  -0.1077 -0.0206 12  DT  X C2    
2476 O O2    . DT  C 12  ? 0.4857 0.3709 0.6880 0.0073  -0.1039 -0.0232 12  DT  X O2    
2477 N N3    . DT  C 12  ? 0.4848 0.3797 0.7074 0.0065  -0.1215 -0.0203 12  DT  X N3    
2478 C C4    . DT  C 12  ? 0.4885 0.3794 0.7274 0.0072  -0.1349 -0.0180 12  DT  X C4    
2479 O O4    . DT  C 12  ? 0.5013 0.3805 0.7192 0.0071  -0.1472 -0.0182 12  DT  X O4    
2480 C C5    . DT  C 12  ? 0.4856 0.3790 0.7661 0.0087  -0.1326 -0.0150 12  DT  X C5    
2481 C C7    . DT  C 12  ? 0.5009 0.3876 0.8128 0.0093  -0.1549 -0.0122 12  DT  X C7    
2482 C C6    . DT  C 12  ? 0.4836 0.3777 0.7727 0.0099  -0.1111 -0.0145 12  DT  X C6    
2483 P P     . DT  C 13  ? 0.7680 0.5420 0.9548 0.0250  -0.0006 -0.0137 13  DT  X P     
2484 O OP1   . DT  C 13  ? 0.8305 0.5447 0.9608 0.0307  0.0267  -0.0133 13  DT  X OP1   
2485 O OP2   . DT  C 13  ? 0.6999 0.4972 0.9485 0.0249  0.0052  -0.0097 13  DT  X OP2   
2486 O "O5'" . DT  C 13  ? 0.6944 0.4829 0.8498 0.0209  -0.0314 -0.0194 13  DT  X "O5'" 
2487 C "C5'" . DT  C 13  ? 0.6748 0.4563 0.7952 0.0190  -0.0499 -0.0234 13  DT  X "C5'" 
2488 C "C4'" . DT  C 13  ? 0.6343 0.4329 0.7482 0.0154  -0.0744 -0.0272 13  DT  X "C4'" 
2489 O "O4'" . DT  C 13  ? 0.5692 0.4098 0.7237 0.0117  -0.0853 -0.0263 13  DT  X "O4'" 
2490 C "C3'" . DT  C 13  ? 0.6285 0.4110 0.7221 0.0169  -0.0727 -0.0286 13  DT  X "C3'" 
2491 O "O3'" . DT  C 13  ? 0.6536 0.4198 0.7163 0.0155  -0.0952 -0.0329 13  DT  X "O3'" 
2492 C "C2'" . DT  C 13  ? 0.5847 0.4083 0.7214 0.0142  -0.0777 -0.0272 13  DT  X "C2'" 
2493 C "C1'" . DT  C 13  ? 0.5414 0.3932 0.6994 0.0105  -0.0925 -0.0275 13  DT  X "C1'" 
2494 N N1    . DT  C 13  ? 0.5112 0.3899 0.7026 0.0089  -0.0976 -0.0253 13  DT  X N1    
2495 C C2    . DT  C 13  ? 0.4928 0.3854 0.6851 0.0063  -0.1103 -0.0264 13  DT  X C2    
2496 O O2    . DT  C 13  ? 0.4901 0.3815 0.6712 0.0048  -0.1156 -0.0286 13  DT  X O2    
2497 N N3    . DT  C 13  ? 0.4926 0.3935 0.7000 0.0060  -0.1168 -0.0243 13  DT  X N3    
2498 C C4    . DT  C 13  ? 0.4817 0.3834 0.7148 0.0073  -0.1182 -0.0215 13  DT  X C4    
2499 O O4    . DT  C 13  ? 0.4833 0.3838 0.7231 0.0070  -0.1324 -0.0203 13  DT  X O4    
2500 C C5    . DT  C 13  ? 0.4934 0.3891 0.7427 0.0095  -0.1020 -0.0198 13  DT  X C5    
2501 C C7    . DT  C 13  ? 0.4985 0.3960 0.7955 0.0111  -0.0998 -0.0156 13  DT  X C7    
2502 C C6    . DT  C 13  ? 0.5031 0.3848 0.7247 0.0105  -0.0897 -0.0217 13  DT  X C6    
2503 P P     . DT  C 14  ? 0.7055 0.4402 0.7311 0.0172  -0.1040 -0.0357 14  DT  X P     
2504 O OP1   . DT  C 14  ? 0.7219 0.4251 0.7163 0.0167  -0.1311 -0.0397 14  DT  X OP1   
2505 O OP2   . DT  C 14  ? 0.7386 0.4391 0.7375 0.0225  -0.0764 -0.0334 14  DT  X OP2   
2506 O "O5'" . DT  C 14  ? 0.6129 0.3957 0.6821 0.0130  -0.1148 -0.0359 14  DT  X "O5'" 
2507 C "C5'" . DT  C 14  ? 0.5825 0.3933 0.6812 0.0087  -0.1328 -0.0371 14  DT  X "C5'" 
2508 C "C4'" . DT  C 14  ? 0.5464 0.3930 0.6782 0.0062  -0.1327 -0.0361 14  DT  X "C4'" 
2509 O "O4'" . DT  C 14  ? 0.5141 0.3818 0.6650 0.0063  -0.1198 -0.0330 14  DT  X "O4'" 
2510 C "C3'" . DT  C 14  ? 0.5487 0.3889 0.6705 0.0072  -0.1337 -0.0372 14  DT  X "C3'" 
2511 O "O3'" . DT  C 14  ? 0.5650 0.4050 0.6961 0.0050  -0.1523 -0.0394 14  DT  X "O3'" 
2512 C "C2'" . DT  C 14  ? 0.5153 0.3852 0.6628 0.0063  -0.1241 -0.0347 14  DT  X "C2'" 
2513 C "C1'" . DT  C 14  ? 0.4832 0.3682 0.6481 0.0053  -0.1208 -0.0325 14  DT  X "C1'" 
2514 N N1    . DT  C 14  ? 0.4581 0.3523 0.6383 0.0063  -0.1136 -0.0297 14  DT  X N1    
2515 C C2    . DT  C 14  ? 0.4410 0.3474 0.6332 0.0051  -0.1194 -0.0283 14  DT  X C2    
2516 O O2    . DT  C 14  ? 0.4384 0.3471 0.6258 0.0037  -0.1229 -0.0289 14  DT  X O2    
2517 N N3    . DT  C 14  ? 0.4289 0.3370 0.6390 0.0061  -0.1206 -0.0257 14  DT  X N3    
2518 C C4    . DT  C 14  ? 0.4313 0.3360 0.6614 0.0081  -0.1112 -0.0237 14  DT  X C4    
2519 O O4    . DT  C 14  ? 0.4305 0.3381 0.6908 0.0086  -0.1163 -0.0209 14  DT  X O4    
2520 C C5    . DT  C 14  ? 0.4441 0.3338 0.6562 0.0098  -0.0961 -0.0247 14  DT  X C5    
2521 C C7    . DT  C 14  ? 0.4526 0.3274 0.6804 0.0133  -0.0753 -0.0216 14  DT  X C7    
2522 C C6    . DT  C 14  ? 0.4593 0.3415 0.6414 0.0089  -0.1010 -0.0280 14  DT  X C6    
2523 P P     . DG  C 15  ? 0.6130 0.4374 0.7305 0.0058  -0.1631 -0.0416 15  DG  X P     
2524 O OP1   . DG  C 15  ? 0.6285 0.4368 0.7549 0.0042  -0.1896 -0.0441 15  DG  X OP1   
2525 O OP2   . DG  C 15  ? 0.6180 0.4140 0.6946 0.0098  -0.1500 -0.0415 15  DG  X OP2   
2526 O "O5'" . DG  C 15  ? 0.5485 0.4101 0.7006 0.0036  -0.1556 -0.0399 15  DG  X "O5'" 
2527 C "C5'" . DG  C 15  ? 0.4986 0.3826 0.6887 0.0008  -0.1564 -0.0387 15  DG  X "C5'" 
2528 C "C4'" . DG  C 15  ? 0.4701 0.3737 0.6707 0.0005  -0.1437 -0.0367 15  DG  X "C4'" 
2529 O "O4'" . DG  C 15  ? 0.4507 0.3594 0.6400 0.0016  -0.1333 -0.0349 15  DG  X "O4'" 
2530 C "C3'" . DG  C 15  ? 0.4698 0.3716 0.6609 0.0012  -0.1459 -0.0379 15  DG  X "C3'" 
2531 O "O3'" . DG  C 15  ? 0.4590 0.3743 0.6680 0.0003  -0.1392 -0.0365 15  DG  X "O3'" 
2532 C "C2'" . DG  C 15  ? 0.4604 0.3610 0.6326 0.0032  -0.1364 -0.0369 15  DG  X "C2'" 
2533 C "C1'" . DG  C 15  ? 0.4502 0.3619 0.6325 0.0026  -0.1302 -0.0345 15  DG  X "C1'" 
2534 N N9    . DG  C 15  ? 0.4345 0.3456 0.6145 0.0040  -0.1251 -0.0328 15  DG  X N9    
2535 C C8    . DG  C 15  ? 0.4450 0.3451 0.6188 0.0060  -0.1186 -0.0325 15  DG  X C8    
2536 N N7    . DG  C 15  ? 0.4306 0.3350 0.6207 0.0070  -0.1137 -0.0299 15  DG  X N7    
2537 C C5    . DG  C 15  ? 0.4226 0.3368 0.6200 0.0055  -0.1228 -0.0290 15  DG  X C5    
2538 C C6    . DG  C 15  ? 0.4219 0.3363 0.6334 0.0058  -0.1300 -0.0267 15  DG  X C6    
2539 O O6    . DG  C 15  ? 0.4326 0.3466 0.6690 0.0069  -0.1296 -0.0243 15  DG  X O6    
2540 N N1    . DG  C 15  ? 0.4240 0.3316 0.6188 0.0052  -0.1386 -0.0267 15  DG  X N1    
2541 C C2    . DG  C 15  ? 0.4284 0.3337 0.6057 0.0045  -0.1335 -0.0281 15  DG  X C2    
2542 N N2    . DG  C 15  ? 0.4546 0.3419 0.6103 0.0052  -0.1354 -0.0271 15  DG  X N2    
2543 N N3    . DG  C 15  ? 0.4153 0.3285 0.5961 0.0036  -0.1274 -0.0299 15  DG  X N3    
2544 C C4    . DG  C 15  ? 0.4229 0.3387 0.6095 0.0041  -0.1257 -0.0307 15  DG  X C4    
2545 P P     . DG  C 16  ? 0.4504 0.3665 0.6853 -0.0008 -0.1459 -0.0372 16  DG  X P     
2546 O OP1   . DG  C 16  ? 0.4499 0.3611 0.7147 -0.0022 -0.1565 -0.0374 16  DG  X OP1   
2547 O OP2   . DG  C 16  ? 0.4733 0.3833 0.6900 0.0001  -0.1539 -0.0393 16  DG  X OP2   
2548 O "O5'" . DG  C 16  ? 0.4577 0.3816 0.7031 -0.0007 -0.1275 -0.0342 16  DG  X "O5'" 
2549 C "C5'" . DG  C 16  ? 0.4587 0.3786 0.7109 -0.0003 -0.1116 -0.0313 16  DG  X "C5'" 
2550 C "C4'" . DG  C 16  ? 0.4561 0.3653 0.6775 0.0016  -0.0984 -0.0294 16  DG  X "C4'" 
2551 O "O4'" . DG  C 16  ? 0.4512 0.3597 0.6444 0.0023  -0.1076 -0.0302 16  DG  X "O4'" 
2552 C "C3'" . DG  C 16  ? 0.4522 0.3611 0.6687 0.0021  -0.0969 -0.0297 16  DG  X "C3'" 
2553 O "O3'" . DG  C 16  ? 0.4778 0.3627 0.6718 0.0045  -0.0783 -0.0269 16  DG  X "O3'" 
2554 C "C2'" . DG  C 16  ? 0.4424 0.3568 0.6355 0.0023  -0.1109 -0.0317 16  DG  X "C2'" 
2555 C "C1'" . DG  C 16  ? 0.4508 0.3585 0.6279 0.0030  -0.1129 -0.0308 16  DG  X "C1'" 
2556 N N9    . DG  C 16  ? 0.4376 0.3534 0.6135 0.0030  -0.1235 -0.0319 16  DG  X N9    
2557 C C8    . DG  C 16  ? 0.4349 0.3578 0.6185 0.0026  -0.1275 -0.0337 16  DG  X C8    
2558 N N7    . DG  C 16  ? 0.4295 0.3518 0.6116 0.0036  -0.1284 -0.0333 16  DG  X N7    
2559 C C5    . DG  C 16  ? 0.4265 0.3458 0.6078 0.0041  -0.1314 -0.0313 16  DG  X C5    
2560 C C6    . DG  C 16  ? 0.4220 0.3396 0.6148 0.0050  -0.1364 -0.0295 16  DG  X C6    
2561 O O6    . DG  C 16  ? 0.4104 0.3310 0.6204 0.0058  -0.1318 -0.0287 16  DG  X O6    
2562 N N1    . DG  C 16  ? 0.4379 0.3421 0.6209 0.0054  -0.1475 -0.0282 16  DG  X N1    
2563 C C2    . DG  C 16  ? 0.4568 0.3440 0.6107 0.0058  -0.1465 -0.0283 16  DG  X C2    
2564 N N2    . DG  C 16  ? 0.4813 0.3405 0.6121 0.0074  -0.1594 -0.0269 16  DG  X N2    
2565 N N3    . DG  C 16  ? 0.4509 0.3413 0.5991 0.0053  -0.1336 -0.0292 16  DG  X N3    
2566 C C4    . DG  C 16  ? 0.4399 0.3501 0.6080 0.0040  -0.1297 -0.0308 16  DG  X C4    
2567 P P     . DA  C 17  ? 0.4858 0.3599 0.6710 0.0059  -0.0690 -0.0261 17  DA  X P     
2568 O OP1   . DA  C 17  ? 0.5374 0.3817 0.7199 0.0086  -0.0390 -0.0220 17  DA  X OP1   
2569 O OP2   . DA  C 17  ? 0.4602 0.3597 0.6769 0.0037  -0.0817 -0.0285 17  DA  X OP2   
2570 O "O5'" . DA  C 17  ? 0.4893 0.3478 0.6257 0.0075  -0.0816 -0.0270 17  DA  X "O5'" 
2571 C "C5'" . DA  C 17  ? 0.5172 0.3408 0.6101 0.0101  -0.0803 -0.0254 17  DA  X "C5'" 
2572 C "C4'" . DA  C 17  ? 0.5195 0.3347 0.5861 0.0106  -0.1043 -0.0268 17  DA  X "C4'" 
2573 O "O4'" . DA  C 17  ? 0.4829 0.3321 0.5813 0.0081  -0.1208 -0.0285 17  DA  X "O4'" 
2574 C "C3'" . DA  C 17  ? 0.5117 0.3262 0.5726 0.0109  -0.1087 -0.0277 17  DA  X "C3'" 
2575 O "O3'" . DA  C 17  ? 0.5370 0.3174 0.5583 0.0130  -0.1281 -0.0276 17  DA  X "O3'" 
2576 C "C2'" . DA  C 17  ? 0.4714 0.3295 0.5740 0.0078  -0.1214 -0.0300 17  DA  X "C2'" 
2577 C "C1'" . DA  C 17  ? 0.4666 0.3297 0.5760 0.0073  -0.1329 -0.0299 17  DA  X "C1'" 
2578 N N9    . DA  C 17  ? 0.4402 0.3347 0.5837 0.0054  -0.1358 -0.0311 17  DA  X N9    
2579 C C8    . DA  C 17  ? 0.4299 0.3431 0.5921 0.0041  -0.1292 -0.0327 17  DA  X C8    
2580 N N7    . DA  C 17  ? 0.4213 0.3449 0.5960 0.0039  -0.1322 -0.0334 17  DA  X N7    
2581 C C5    . DA  C 17  ? 0.4118 0.3311 0.5900 0.0047  -0.1389 -0.0318 17  DA  X C5    
2582 C C6    . DA  C 17  ? 0.4084 0.3321 0.6070 0.0053  -0.1392 -0.0308 17  DA  X C6    
2583 N N6    . DA  C 17  ? 0.4077 0.3338 0.6114 0.0060  -0.1287 -0.0313 17  DA  X N6    
2584 N N1    . DA  C 17  ? 0.4086 0.3263 0.6211 0.0059  -0.1505 -0.0287 17  DA  X N1    
2585 C C2    . DA  C 17  ? 0.4282 0.3284 0.6198 0.0061  -0.1642 -0.0284 17  DA  X C2    
2586 N N3    . DA  C 17  ? 0.4386 0.3250 0.5961 0.0064  -0.1610 -0.0293 17  DA  X N3    
2587 C C4    . DA  C 17  ? 0.4302 0.3316 0.5897 0.0054  -0.1459 -0.0308 17  DA  X C4    
2588 P P     . DG  C 18  ? 0.5591 0.3115 0.5486 0.0149  -0.1351 -0.0279 18  DG  X P     
2589 O OP1   . DG  C 18  ? 0.6170 0.3144 0.5511 0.0192  -0.1122 -0.0256 18  DG  X OP1   
2590 O OP2   . DG  C 18  ? 0.5094 0.3067 0.5429 0.0120  -0.1366 -0.0296 18  DG  X OP2   
2591 O "O5'" . DG  C 18  ? 0.5894 0.3167 0.5608 0.0158  -0.1715 -0.0283 18  DG  X "O5'" 
2592 C "C5'" . DG  C 18  ? 0.6346 0.3308 0.5816 0.0175  -0.1855 -0.0274 18  DG  X "C5'" 
2593 C "C4'" . DG  C 18  ? 0.6436 0.3382 0.6127 0.0167  -0.2251 -0.0278 18  DG  X "C4'" 
2594 O "O4'" . DG  C 18  ? 0.5809 0.3377 0.6250 0.0129  -0.2227 -0.0279 18  DG  X "O4'" 
2595 C "C3'" . DG  C 18  ? 0.6771 0.3507 0.6377 0.0174  -0.2499 -0.0285 18  DG  X "C3'" 
2596 O "O3'" . DG  C 18  ? 0.7398 0.3776 0.6981 0.0185  -0.2937 -0.0281 18  DG  X "O3'" 
2597 C "C2'" . DG  C 18  ? 0.6014 0.3408 0.6343 0.0136  -0.2406 -0.0291 18  DG  X "C2'" 
2598 C "C1'" . DG  C 18  ? 0.5534 0.3325 0.6364 0.0115  -0.2334 -0.0284 18  DG  X "C1'" 
2599 N N9    . DG  C 18  ? 0.4918 0.3225 0.6178 0.0090  -0.2083 -0.0290 18  DG  X N9    
2600 C C8    . DG  C 18  ? 0.4739 0.3205 0.5894 0.0084  -0.1825 -0.0301 18  DG  X C8    
2601 N N7    . DG  C 18  ? 0.4373 0.3189 0.5885 0.0068  -0.1705 -0.0307 18  DG  X N7    
2602 C C5    . DG  C 18  ? 0.4284 0.3184 0.6161 0.0066  -0.1814 -0.0294 18  DG  X C5    
2603 C C6    . DG  C 18  ? 0.4035 0.3163 0.6304 0.0063  -0.1697 -0.0287 18  DG  X C6    
2604 O O6    . DG  C 18  ? 0.3822 0.3074 0.6078 0.0062  -0.1519 -0.0298 18  DG  X O6    
2605 N N1    . DG  C 18  ? 0.4006 0.3124 0.6695 0.0068  -0.1810 -0.0260 18  DG  X N1    
2606 C C2    . DG  C 18  ? 0.4237 0.3151 0.6979 0.0071  -0.2091 -0.0248 18  DG  X C2    
2607 N N2    . DG  C 18  ? 0.4230 0.3173 0.7564 0.0073  -0.2199 -0.0217 18  DG  X N2    
2608 N N3    . DG  C 18  ? 0.4544 0.3168 0.6790 0.0077  -0.2256 -0.0262 18  DG  X N3    
2609 C C4    . DG  C 18  ? 0.4558 0.3192 0.6378 0.0076  -0.2064 -0.0282 18  DG  X C4    
2610 P P     . DG  C 19  ? 0.8605 0.4159 0.7451 0.0227  -0.3278 -0.0286 19  DG  X P     
2611 O OP1   . DG  C 19  ? 0.9450 0.4407 0.7908 0.0255  -0.3625 -0.0281 19  DG  X OP1   
2612 O OP2   . DG  C 19  ? 0.8693 0.3959 0.6888 0.0255  -0.2966 -0.0290 19  DG  X OP2   
2613 O "O5'" . DG  C 19  ? 0.8181 0.4013 0.7661 0.0201  -0.3549 -0.0291 19  DG  X "O5'" 
2614 C "C5'" . DG  C 19  ? 0.7599 0.3823 0.8007 0.0171  -0.3794 -0.0278 19  DG  X "C5'" 
2615 C "C4'" . DG  C 19  ? 0.7260 0.3841 0.8254 0.0148  -0.3812 -0.0277 19  DG  X "C4'" 
2616 O "O4'" . DG  C 19  ? 0.6354 0.3528 0.7573 0.0127  -0.3333 -0.0282 19  DG  X "O4'" 
2617 C "C3'" . DG  C 19  ? 0.7767 0.3819 0.8188 0.0171  -0.4042 -0.0292 19  DG  X "C3'" 
2618 O "O3'" . DG  C 19  ? 0.8190 0.4426 0.9370 0.0151  -0.4320 -0.0283 19  DG  X "O3'" 
2619 C "C2'" . DG  C 19  ? 0.7418 0.3669 0.7443 0.0173  -0.3569 -0.0305 19  DG  X "C2'" 
2620 C "C1'" . DG  C 19  ? 0.6435 0.3488 0.7220 0.0136  -0.3220 -0.0298 19  DG  X "C1'" 
2621 N N9    . DG  C 19  ? 0.6029 0.3335 0.6584 0.0132  -0.2782 -0.0306 19  DG  X N9    
2622 C C8    . DG  C 19  ? 0.6300 0.3284 0.6172 0.0156  -0.2575 -0.0312 19  DG  X C8    
2623 N N7    . DG  C 19  ? 0.5816 0.3180 0.5842 0.0142  -0.2223 -0.0313 19  DG  X N7    
2624 C C5    . DG  C 19  ? 0.5241 0.3143 0.5943 0.0111  -0.2207 -0.0313 19  DG  X C5    
2625 C C6    . DG  C 19  ? 0.4715 0.3068 0.5751 0.0090  -0.1952 -0.0318 19  DG  X C6    
2626 O O6    . DG  C 19  ? 0.4515 0.2946 0.5435 0.0089  -0.1727 -0.0322 19  DG  X O6    
2627 N N1    . DG  C 19  ? 0.4409 0.3064 0.5971 0.0075  -0.1985 -0.0312 19  DG  X N1    
2628 C C2    . DG  C 19  ? 0.4513 0.3123 0.6418 0.0076  -0.2210 -0.0296 19  DG  X C2    
2629 N N2    . DG  C 19  ? 0.4206 0.3092 0.6658 0.0068  -0.2120 -0.0281 19  DG  X N2    
2630 N N3    . DG  C 19  ? 0.4904 0.3151 0.6632 0.0088  -0.2508 -0.0292 19  DG  X N3    
2631 C C4    . DG  C 19  ? 0.5339 0.3215 0.6386 0.0107  -0.2502 -0.0305 19  DG  X C4    
2632 P P     . DC  C 20  ? 0.9257 0.4786 1.0187 0.0173  -0.4928 -0.0289 20  DC  X P     
2633 O OP1   . DC  C 20  ? 0.9635 0.4637 0.9503 0.0206  -0.4849 -0.0314 20  DC  X OP1   
2634 O OP2   . DC  C 20  ? 0.8966 0.4907 1.1039 0.0142  -0.5113 -0.0267 20  DC  X OP2   
2635 O "O5'" . DC  C 20  ? 0.9989 0.4956 1.0708 0.0194  -0.5366 -0.0282 20  DC  X "O5'" 
2636 C "C5'" . DC  C 20  ? 1.1316 0.5459 1.0785 0.0243  -0.5446 -0.0300 20  DC  X "C5'" 
2637 C "C4'" . DC  C 20  ? 1.2475 0.5812 1.1716 0.0270  -0.6142 -0.0299 20  DC  X "C4'" 
2638 O "O4'" . DC  C 20  ? 1.2359 0.5571 1.2226 0.0257  -0.6685 -0.0295 20  DC  X "O4'" 
2639 C "C3'" . DC  C 20  ? 1.4131 0.6297 1.1788 0.0340  -0.6294 -0.0320 20  DC  X "C3'" 
2640 O "O3'" . DC  C 20  ? 1.5949 0.7428 1.3294 0.0368  -0.6797 -0.0317 20  DC  X "O3'" 
2641 C "C2'" . DC  C 20  ? 1.4350 0.5995 1.1658 0.0358  -0.6641 -0.0336 20  DC  X "C2'" 
2642 C "C1'" . DC  C 20  ? 1.3417 0.5539 1.2132 0.0309  -0.7120 -0.0320 20  DC  X "C1'" 
2643 N N1    . DC  C 20  ? 1.2858 0.5117 1.1970 0.0292  -0.7259 -0.0325 20  DC  X N1    
2644 C C2    . DC  C 20  ? 1.3678 0.4881 1.1890 0.0336  -0.7809 -0.0348 20  DC  X C2    
2645 O O2    . DC  C 20  ? 1.4533 0.4657 1.1574 0.0394  -0.8153 -0.0362 20  DC  X O2    
2646 N N3    . DC  C 20  ? 1.3454 0.4768 1.2032 0.0320  -0.7955 -0.0353 20  DC  X N3    
2647 C C4    . DC  C 20  ? 1.2410 0.4821 1.2195 0.0264  -0.7560 -0.0334 20  DC  X C4    
2648 N N4    . DC  C 20  ? 1.2333 0.4802 1.2439 0.0251  -0.7709 -0.0338 20  DC  X N4    
2649 C C5    . DC  C 20  ? 1.1543 0.4957 1.2164 0.0225  -0.6988 -0.0311 20  DC  X C5    
2650 C C6    . DC  C 20  ? 1.1697 0.5004 1.1954 0.0239  -0.6868 -0.0308 20  DC  X C6    
2651 P P     . DC  C 21  ? 1.7541 0.8921 1.4384 0.0389  -0.6485 -0.0310 21  DC  X P     
2652 O OP1   . DC  C 21  ? 1.8498 0.8872 1.4785 0.0432  -0.7164 -0.0314 21  DC  X OP1   
2653 O OP2   . DC  C 21  ? 1.5555 0.8166 1.3587 0.0327  -0.6009 -0.0291 21  DC  X OP2   
2654 O "O5'" . DC  C 21  ? 1.8757 0.9691 1.4314 0.0439  -0.5899 -0.0319 21  DC  X "O5'" 
2655 C "C5'" . DC  C 21  ? 2.0680 1.0573 1.4999 0.0502  -0.6014 -0.0334 21  DC  X "C5'" 
2656 C "C4'" . DC  C 21  ? 2.2038 1.0701 1.4804 0.0589  -0.5939 -0.0332 21  DC  X "C4'" 
2657 O "O4'" . DC  C 21  ? 2.2274 1.1394 1.5136 0.0583  -0.5349 -0.0313 21  DC  X "O4'" 
2658 C "C3'" . DC  C 21  ? 2.2645 1.0237 1.4809 0.0633  -0.6721 -0.0342 21  DC  X "C3'" 
2659 O "O3'" . DC  C 21  ? 2.2722 0.9204 1.3987 0.0685  -0.7261 -0.0362 21  DC  X "O3'" 
2660 C "C2'" . DC  C 21  ? 2.3472 1.0379 1.4560 0.0695  -0.6379 -0.0329 21  DC  X "C2'" 
2661 C "C1'" . DC  C 21  ? 2.2524 1.0710 1.4500 0.0640  -0.5574 -0.0309 21  DC  X "C1'" 
2662 N N1    . DC  C 21  ? 2.1493 1.0559 1.4555 0.0581  -0.5603 -0.0299 21  DC  X N1    
2663 C C2    . DC  C 21  ? 2.1659 1.0036 1.4174 0.0619  -0.5895 -0.0295 21  DC  X C2    
2664 O O2    . DC  C 21  ? 2.2631 0.9621 1.3708 0.0705  -0.6140 -0.0301 21  DC  X O2    
2665 N N3    . DC  C 21  ? 2.0655 0.9827 1.4161 0.0567  -0.5901 -0.0285 21  DC  X N3    
2666 C C4    . DC  C 21  ? 1.9569 1.0088 1.4465 0.0487  -0.5608 -0.0278 21  DC  X C4    
2667 N N4    . DC  C 21  ? 1.8564 0.9744 1.4322 0.0445  -0.5597 -0.0265 21  DC  X N4    
2668 C C5    . DC  C 21  ? 1.8732 0.9903 1.4124 0.0451  -0.5311 -0.0282 21  DC  X C5    
2669 C C6    . DC  C 21  ? 2.0151 1.0606 1.4640 0.0497  -0.5322 -0.0293 21  DC  X C6    
2670 O "O5'" . DA  D 1   ? 1.3361 0.4141 0.7592 0.0302  0.0376  0.0067  1   DA  Y "O5'" 
2671 C "C5'" . DA  D 1   ? 1.2714 0.4042 0.7631 0.0348  0.0702  0.0115  1   DA  Y "C5'" 
2672 C "C4'" . DA  D 1   ? 1.2209 0.3951 0.7710 0.0393  0.1048  0.0164  1   DA  Y "C4'" 
2673 O "O4'" . DA  D 1   ? 1.2809 0.3774 0.7631 0.0426  0.1369  0.0186  1   DA  Y "O4'" 
2674 C "C3'" . DA  D 1   ? 1.1798 0.3935 0.7952 0.0441  0.1413  0.0234  1   DA  Y "C3'" 
2675 O "O3'" . DA  D 1   ? 1.1500 0.4170 0.8379 0.0468  0.1602  0.0281  1   DA  Y "O3'" 
2676 C "C2'" . DA  D 1   ? 1.2609 0.3825 0.8029 0.0487  0.1853  0.0274  1   DA  Y "C2'" 
2677 C "C1'" . DA  D 1   ? 1.3153 0.3724 0.7851 0.0484  0.1879  0.0251  1   DA  Y "C1'" 
2678 N N9    . DA  D 1   ? 1.4158 0.3582 0.7655 0.0480  0.1973  0.0234  1   DA  Y N9    
2679 C C8    . DA  D 1   ? 1.4716 0.3529 0.7346 0.0423  0.1569  0.0171  1   DA  Y C8    
2680 N N7    . DA  D 1   ? 1.5816 0.3508 0.7348 0.0427  0.1754  0.0175  1   DA  Y N7    
2681 C C5    . DA  D 1   ? 1.5921 0.3500 0.7641 0.0499  0.2363  0.0243  1   DA  Y C5    
2682 C C6    . DA  D 1   ? 1.6911 0.3465 0.7804 0.0540  0.2860  0.0280  1   DA  Y C6    
2683 N N6    . DA  D 1   ? 1.8102 0.3447 0.7652 0.0508  0.2794  0.0248  1   DA  Y N6    
2684 N N1    . DA  D 1   ? 1.6704 0.3460 0.8193 0.0613  0.3442  0.0357  1   DA  Y N1    
2685 C C2    . DA  D 1   ? 1.5572 0.3472 0.8374 0.0635  0.3457  0.0396  1   DA  Y C2    
2686 N N3    . DA  D 1   ? 1.4603 0.3478 0.8180 0.0597  0.3004  0.0363  1   DA  Y N3    
2687 C C4    . DA  D 1   ? 1.4846 0.3507 0.7823 0.0531  0.2488  0.0284  1   DA  Y C4    
2688 P P     . DC  D 2   ? 1.0666 0.4354 0.8504 0.0436  0.1315  0.0273  2   DC  Y P     
2689 O OP1   . DC  D 2   ? 1.0241 0.4220 0.8180 0.0395  0.0984  0.0228  2   DC  Y OP1   
2690 O OP2   . DC  D 2   ? 1.0419 0.4482 0.8995 0.0476  0.1631  0.0360  2   DC  Y OP2   
2691 O "O5'" . DC  D 2   ? 1.0365 0.4088 0.8060 0.0409  0.1104  0.0226  2   DC  Y "O5'" 
2692 C "C5'" . DC  D 2   ? 1.0448 0.4128 0.8269 0.0441  0.1357  0.0266  2   DC  Y "C5'" 
2693 C "C4'" . DC  D 2   ? 1.0697 0.4095 0.8016 0.0413  0.1142  0.0207  2   DC  Y "C4'" 
2694 O "O4'" . DC  D 2   ? 1.1319 0.3995 0.7755 0.0392  0.0998  0.0161  2   DC  Y "O4'" 
2695 C "C3'" . DC  D 2   ? 1.1091 0.4164 0.8238 0.0450  0.1445  0.0242  2   DC  Y "C3'" 
2696 O "O3'" . DC  D 2   ? 1.0695 0.4438 0.8578 0.0446  0.1405  0.0261  2   DC  Y "O3'" 
2697 C "C2'" . DC  D 2   ? 1.1676 0.4086 0.7930 0.0420  0.1236  0.0180  2   DC  Y "C2'" 
2698 C "C1'" . DC  D 2   ? 1.1873 0.4007 0.7687 0.0383  0.0953  0.0136  2   DC  Y "C1'" 
2699 N N1    . DC  D 2   ? 1.2838 0.3939 0.7627 0.0393  0.1098  0.0136  2   DC  Y N1    
2700 C C2    . DC  D 2   ? 1.3264 0.3906 0.7838 0.0454  0.1628  0.0198  2   DC  Y C2    
2701 O O2    . DC  D 2   ? 1.2701 0.3862 0.8042 0.0497  0.1938  0.0259  2   DC  Y O2    
2702 N N3    . DC  D 2   ? 1.4267 0.3859 0.7796 0.0461  0.1791  0.0196  2   DC  Y N3    
2703 C C4    . DC  D 2   ? 1.4841 0.3847 0.7555 0.0404  0.1389  0.0138  2   DC  Y C4    
2704 N N4    . DC  D 2   ? 1.5942 0.3826 0.7546 0.0405  0.1543  0.0139  2   DC  Y N4    
2705 C C5    . DC  D 2   ? 1.4370 0.3876 0.7384 0.0340  0.0811  0.0081  2   DC  Y C5    
2706 C C6    . DC  D 2   ? 1.3369 0.3915 0.7422 0.0340  0.0714  0.0081  2   DC  Y C6    
2707 P P     . DT  D 3   ? 1.0644 0.4519 0.9067 0.0500  0.1827  0.0355  3   DT  Y P     
2708 O OP1   . DT  D 3   ? 1.0497 0.4613 0.9460 0.0525  0.2018  0.0424  3   DT  Y OP1   
2709 O OP2   . DT  D 3   ? 1.1510 0.4662 0.9304 0.0536  0.2129  0.0367  3   DT  Y OP2   
2710 O "O5'" . DT  D 3   ? 1.0786 0.5353 0.9830 0.0469  0.1585  0.0344  3   DT  Y "O5'" 
2711 C "C5'" . DT  D 3   ? 1.1205 0.6501 1.0942 0.0432  0.1329  0.0343  3   DT  Y "C5'" 
2712 C "C4'" . DT  D 3   ? 1.1926 0.7664 1.2261 0.0428  0.1329  0.0383  3   DT  Y "C4'" 
2713 O "O4'" . DT  D 3   ? 1.2513 0.8101 1.2481 0.0414  0.1222  0.0328  3   DT  Y "O4'" 
2714 C "C3'" . DT  D 3   ? 1.2883 0.8543 1.3646 0.0481  0.1721  0.0492  3   DT  Y "C3'" 
2715 O "O3'" . DT  D 3   ? 1.2890 0.9110 1.4491 0.0466  0.1648  0.0559  3   DT  Y "O3'" 
2716 C "C2'" . DT  D 3   ? 1.3191 0.8455 1.3555 0.0506  0.1892  0.0483  3   DT  Y "C2'" 
2717 C "C1'" . DT  D 3   ? 1.3329 0.8806 1.3465 0.0452  0.1500  0.0390  3   DT  Y "C1'" 
2718 N N1    . DT  D 3   ? 1.4354 0.9305 1.3785 0.0460  0.1537  0.0342  3   DT  Y N1    
2719 C C2    . DT  D 3   ? 1.4580 0.9635 1.4144 0.0460  0.1551  0.0347  3   DT  Y C2    
2720 O O2    . DT  D 3   ? 1.3447 0.9006 1.3668 0.0452  0.1513  0.0387  3   DT  Y O2    
2721 N N3    . DT  D 3   ? 1.5540 1.0044 1.4399 0.0466  0.1584  0.0305  3   DT  Y N3    
2722 C C4    . DT  D 3   ? 1.6349 1.0171 1.4368 0.0467  0.1584  0.0263  3   DT  Y C4    
2723 O O4    . DT  D 3   ? 1.7320 1.0634 1.4720 0.0465  0.1583  0.0231  3   DT  Y O4    
2724 C C5    . DT  D 3   ? 1.5859 0.9587 1.3773 0.0465  0.1568  0.0262  3   DT  Y C5    
2725 C C7    . DT  D 3   ? 1.6503 0.9446 1.3480 0.0459  0.1537  0.0221  3   DT  Y C7    
2726 C C6    . DT  D 3   ? 1.5258 0.9569 1.3893 0.0465  0.1561  0.0300  3   DT  Y C6    
2727 P P     . DC  D 4   ? 1.1980 0.8572 1.4188 0.0451  0.1572  0.0617  4   DC  Y P     
2728 O OP1   . DC  D 4   ? 1.2498 0.8747 1.4343 0.0476  0.1724  0.0608  4   DC  Y OP1   
2729 O OP2   . DC  D 4   ? 1.2207 0.9042 1.5224 0.0464  0.1696  0.0735  4   DC  Y OP2   
2730 O "O5'" . DC  D 4   ? 1.1818 0.8838 1.4027 0.0379  0.1124  0.0537  4   DC  Y "O5'" 
2731 C "C5'" . DC  D 4   ? 1.0809 0.8248 1.3547 0.0340  0.0920  0.0572  4   DC  Y "C5'" 
2732 C "C4'" . DC  D 4   ? 1.0686 0.8465 1.3760 0.0293  0.0692  0.0578  4   DC  Y "C4'" 
2733 O "O4'" . DC  D 4   ? 1.0673 0.8331 1.3451 0.0300  0.0721  0.0534  4   DC  Y "O4'" 
2734 C "C3'" . DC  D 4   ? 1.0176 0.8150 1.3997 0.0290  0.0719  0.0703  4   DC  Y "C3'" 
2735 O "O3'" . DC  D 4   ? 0.9483 0.7761 1.3552 0.0223  0.0389  0.0705  4   DC  Y "O3'" 
2736 C "C2'" . DC  D 4   ? 1.0064 0.7988 1.3968 0.0306  0.0815  0.0726  4   DC  Y "C2'" 
2737 C "C1'" . DC  D 4   ? 1.0345 0.8189 1.3596 0.0289  0.0699  0.0602  4   DC  Y "C1'" 
2738 N N1    . DC  D 4   ? 1.1341 0.8947 1.4376 0.0327  0.0899  0.0597  4   DC  Y N1    
2739 C C2    . DC  D 4   ? 1.1755 0.9502 1.5184 0.0320  0.0889  0.0654  4   DC  Y C2    
2740 O O2    . DC  D 4   ? 1.1330 0.9370 1.5244 0.0277  0.0684  0.0705  4   DC  Y O2    
2741 N N3    . DC  D 4   ? 1.1594 0.9115 1.4832 0.0357  0.1086  0.0652  4   DC  Y N3    
2742 C C4    . DC  D 4   ? 1.1953 0.9072 1.4583 0.0395  0.1276  0.0598  4   DC  Y C4    
2743 N N4    . DC  D 4   ? 1.2555 0.9410 1.4963 0.0427  0.1465  0.0598  4   DC  Y N4    
2744 C C5    . DC  D 4   ? 1.2361 0.9287 1.4551 0.0398  0.1264  0.0543  4   DC  Y C5    
2745 C C6    . DC  D 4   ? 1.1869 0.9071 1.4307 0.0366  0.1081  0.0545  4   DC  Y C6    
2746 P P     . DC  D 5   ? 0.8981 0.7424 1.3746 0.0201  0.0299  0.0825  5   DC  Y P     
2747 O OP1   . DC  D 5   ? 0.8169 0.6636 1.2807 0.0190  0.0232  0.0797  5   DC  Y OP1   
2748 O OP2   . DC  D 5   ? 1.0377 0.8734 1.5702 0.0253  0.0571  0.0948  5   DC  Y OP2   
2749 O "O5'" . DC  D 5   ? 0.8101 0.6736 1.3010 0.0124  -0.0055 0.0829  5   DC  Y "O5'" 
2750 C "C5'" . DC  D 5   ? 0.7195 0.5841 1.2176 0.0115  -0.0084 0.0842  5   DC  Y "C5'" 
2751 C "C4'" . DC  D 5   ? 0.6784 0.5540 1.1997 0.0034  -0.0439 0.0883  5   DC  Y "C4'" 
2752 O "O4'" . DC  D 5   ? 0.6445 0.5214 1.1142 -0.0020 -0.0651 0.0777  5   DC  Y "O4'" 
2753 C "C3'" . DC  D 5   ? 0.6709 0.5468 1.2040 0.0015  -0.0516 0.0909  5   DC  Y "C3'" 
2754 O "O3'" . DC  D 5   ? 0.6676 0.5466 1.2556 -0.0040 -0.0775 0.1027  5   DC  Y "O3'" 
2755 C "C2'" . DC  D 5   ? 0.6460 0.5204 1.1147 -0.0027 -0.0658 0.0778  5   DC  Y "C2'" 
2756 C "C1'" . DC  D 5   ? 0.6291 0.5042 1.0765 -0.0069 -0.0822 0.0736  5   DC  Y "C1'" 
2757 N N1    . DC  D 5   ? 0.6137 0.4865 1.0003 -0.0081 -0.0827 0.0599  5   DC  Y N1    
2758 C C2    . DC  D 5   ? 0.5872 0.4545 0.9460 -0.0154 -0.1053 0.0552  5   DC  Y C2    
2759 O O2    . DC  D 5   ? 0.5782 0.4385 0.9550 -0.0212 -0.1275 0.0624  5   DC  Y O2    
2760 N N3    . DC  D 5   ? 0.5814 0.4463 0.8943 -0.0161 -0.1022 0.0435  5   DC  Y N3    
2761 C C4    . DC  D 5   ? 0.5731 0.4418 0.8693 -0.0105 -0.0835 0.0369  5   DC  Y C4    
2762 N N4    . DC  D 5   ? 0.5536 0.4203 0.8150 -0.0117 -0.0834 0.0267  5   DC  Y N4    
2763 C C5    . DC  D 5   ? 0.5952 0.4645 0.9091 -0.0038 -0.0640 0.0411  5   DC  Y C5    
2764 C C6    . DC  D 5   ? 0.5990 0.4699 0.9570 -0.0025 -0.0614 0.0523  5   DC  Y C6    
2765 P P     . DT  D 6   ? 0.6890 0.5667 1.3093 -0.0064 -0.0890 0.1099  6   DT  Y P     
2766 O OP1   . DT  D 6   ? 0.6777 0.5576 1.3835 -0.0076 -0.0998 0.1268  6   DT  Y OP1   
2767 O OP2   . DT  D 6   ? 0.6624 0.5383 1.2584 -0.0003 -0.0604 0.1039  6   DT  Y OP2   
2768 O "O5'" . DT  D 6   ? 0.6682 0.5378 1.2371 -0.0155 -0.1240 0.1026  6   DT  Y "O5'" 
2769 C "C5'" . DT  D 6   ? 0.6538 0.5140 1.2117 -0.0233 -0.1560 0.1038  6   DT  Y "C5'" 
2770 C "C4'" . DT  D 6   ? 0.6638 0.5084 1.1538 -0.0300 -0.1743 0.0935  6   DT  Y "C4'" 
2771 O "O4'" . DT  D 6   ? 0.6538 0.5039 1.0889 -0.0263 -0.1526 0.0793  6   DT  Y "O4'" 
2772 C "C3'" . DT  D 6   ? 0.6745 0.5124 1.1610 -0.0320 -0.1808 0.0943  6   DT  Y "C3'" 
2773 O "O3'" . DT  D 6   ? 0.7229 0.5357 1.2021 -0.0419 -0.2194 0.0997  6   DT  Y "O3'" 
2774 C "C2'" . DT  D 6   ? 0.6590 0.4979 1.0821 -0.0298 -0.1625 0.0792  6   DT  Y "C2'" 
2775 C "C1'" . DT  D 6   ? 0.6421 0.4828 1.0312 -0.0291 -0.1554 0.0708  6   DT  Y "C1'" 
2776 N N1    . DT  D 6   ? 0.6128 0.4638 0.9686 -0.0232 -0.1289 0.0592  6   DT  Y N1    
2777 C C2    . DT  D 6   ? 0.5986 0.4420 0.9036 -0.0261 -0.1300 0.0480  6   DT  Y C2    
2778 O O2    . DT  D 6   ? 0.6048 0.4300 0.8843 -0.0330 -0.1479 0.0467  6   DT  Y O2    
2779 N N3    . DT  D 6   ? 0.5767 0.4294 0.8616 -0.0207 -0.1092 0.0390  6   DT  Y N3    
2780 C C4    . DT  D 6   ? 0.5721 0.4345 0.8709 -0.0134 -0.0891 0.0394  6   DT  Y C4    
2781 O O4    . DT  D 6   ? 0.5614 0.4249 0.8351 -0.0102 -0.0769 0.0312  6   DT  Y O4    
2782 C C5    . DT  D 6   ? 0.5918 0.4576 0.9359 -0.0105 -0.0842 0.0506  6   DT  Y C5    
2783 C C7    . DT  D 6   ? 0.5957 0.4622 0.9492 -0.0026 -0.0580 0.0518  6   DT  Y C7    
2784 C C6    . DT  D 6   ? 0.5966 0.4595 0.9723 -0.0152 -0.1037 0.0601  6   DT  Y C6    
2785 P P     . DC  D 7   ? 0.7644 0.5623 1.2461 -0.0463 -0.2374 0.1040  7   DC  Y P     
2786 O OP1   . DC  D 7   ? 0.7767 0.5548 1.3011 -0.0541 -0.2773 0.1187  7   DC  Y OP1   
2787 O OP2   . DC  D 7   ? 0.6876 0.5077 1.1915 -0.0381 -0.2066 0.1025  7   DC  Y OP2   
2788 O "O5'" . DC  D 7   ? 0.7703 0.5435 1.1643 -0.0518 -0.2429 0.0907  7   DC  Y "O5'" 
2789 C "C5'" . DC  D 7   ? 0.7857 0.5368 1.1260 -0.0571 -0.2530 0.0842  7   DC  Y "C5'" 
2790 C "C4'" . DC  D 7   ? 0.7996 0.5314 1.0679 -0.0596 -0.2443 0.0715  7   DC  Y "C4'" 
2791 O "O4'" . DC  D 7   ? 0.7538 0.5135 1.0107 -0.0516 -0.2089 0.0603  7   DC  Y "O4'" 
2792 C "C3'" . DC  D 7   ? 0.8211 0.5393 1.0816 -0.0623 -0.2525 0.0731  7   DC  Y "C3'" 
2793 O "O3'" . DC  D 7   ? 0.8961 0.5665 1.0877 -0.0714 -0.2700 0.0687  7   DC  Y "O3'" 
2794 C "C2'" . DC  D 7   ? 0.7628 0.5117 1.0237 -0.0538 -0.2175 0.0642  7   DC  Y "C2'" 
2795 C "C1'" . DC  D 7   ? 0.7295 0.4912 0.9671 -0.0498 -0.1955 0.0541  7   DC  Y "C1'" 
2796 N N1    . DC  D 7   ? 0.6765 0.4723 0.9337 -0.0403 -0.1654 0.0490  7   DC  Y N1    
2797 C C2    . DC  D 7   ? 0.6568 0.4571 0.8786 -0.0378 -0.1463 0.0370  7   DC  Y C2    
2798 O O2    . DC  D 7   ? 0.6598 0.4376 0.8389 -0.0430 -0.1501 0.0307  7   DC  Y O2    
2799 N N3    . DC  D 7   ? 0.6212 0.4452 0.8563 -0.0301 -0.1244 0.0330  7   DC  Y N3    
2800 C C4    . DC  D 7   ? 0.6136 0.4529 0.8881 -0.0246 -0.1165 0.0398  7   DC  Y C4    
2801 N N4    . DC  D 7   ? 0.5943 0.4461 0.8690 -0.0178 -0.0956 0.0355  7   DC  Y N4    
2802 C C5    . DC  D 7   ? 0.6164 0.4541 0.9324 -0.0262 -0.1298 0.0521  7   DC  Y C5    
2803 C C6    . DC  D 7   ? 0.6390 0.4568 0.9484 -0.0342 -0.1563 0.0566  7   DC  Y C6    
2804 P P     . DC  D 8   ? 0.9380 0.5730 1.1003 -0.0781 -0.2890 0.0709  8   DC  Y P     
2805 O OP1   . DC  D 8   ? 0.9963 0.5706 1.1049 -0.0896 -0.3228 0.0741  8   DC  Y OP1   
2806 O OP2   . DC  D 8   ? 0.8973 0.5596 1.1267 -0.0742 -0.2930 0.0804  8   DC  Y OP2   
2807 O "O5'" . DC  D 8   ? 0.8806 0.5188 0.9953 -0.0746 -0.2562 0.0566  8   DC  Y "O5'" 
2808 C "C5'" . DC  D 8   ? 0.8752 0.4993 0.9375 -0.0751 -0.2372 0.0453  8   DC  Y "C5'" 
2809 C "C4'" . DC  D 8   ? 0.8407 0.4859 0.8931 -0.0691 -0.2043 0.0345  8   DC  Y "C4'" 
2810 O "O4'" . DC  D 8   ? 0.7622 0.4607 0.8678 -0.0594 -0.1849 0.0338  8   DC  Y "O4'" 
2811 C "C3'" . DC  D 8   ? 0.8586 0.4934 0.9025 -0.0706 -0.2070 0.0352  8   DC  Y "C3'" 
2812 O "O3'" . DC  D 8   ? 0.8981 0.5154 0.8949 -0.0711 -0.1848 0.0243  8   DC  Y "O3'" 
2813 C "C2'" . DC  D 8   ? 0.7861 0.4729 0.8900 -0.0615 -0.1927 0.0371  8   DC  Y "C2'" 
2814 C "C1'" . DC  D 8   ? 0.7450 0.4613 0.8610 -0.0551 -0.1704 0.0308  8   DC  Y "C1'" 
2815 N N1    . DC  D 8   ? 0.6771 0.4356 0.8459 -0.0465 -0.1579 0.0337  8   DC  Y N1    
2816 C C2    . DC  D 8   ? 0.6363 0.4184 0.8059 -0.0399 -0.1333 0.0254  8   DC  Y C2    
2817 O O2    . DC  D 8   ? 0.6288 0.4013 0.7654 -0.0412 -0.1231 0.0163  8   DC  Y O2    
2818 N N3    . DC  D 8   ? 0.6032 0.4128 0.8091 -0.0326 -0.1214 0.0279  8   DC  Y N3    
2819 C C4    . DC  D 8   ? 0.6058 0.4228 0.8520 -0.0310 -0.1280 0.0383  8   DC  Y C4    
2820 N N4    . DC  D 8   ? 0.5882 0.4246 0.8636 -0.0235 -0.1108 0.0404  8   DC  Y N4    
2821 C C5    . DC  D 8   ? 0.6285 0.4281 0.8872 -0.0373 -0.1530 0.0476  8   DC  Y C5    
2822 C C6    . DC  D 8   ? 0.6616 0.4310 0.8779 -0.0452 -0.1696 0.0449  8   DC  Y C6    
2823 P P     . DG  D 9   ? 0.9934 0.5732 0.9500 -0.0764 -0.1901 0.0235  9   DG  Y P     
2824 O OP1   . DG  D 9   ? 1.0343 0.5480 0.9315 -0.0871 -0.2145 0.0268  9   DG  Y OP1   
2825 O OP2   . DG  D 9   ? 0.9211 0.5326 0.9250 -0.0724 -0.1956 0.0291  9   DG  Y OP2   
2826 O "O5'" . DG  D 9   ? 0.9355 0.5182 0.8677 -0.0729 -0.1540 0.0110  9   DG  Y "O5'" 
2827 C "C5'" . DG  D 9   ? 0.9091 0.4990 0.8357 -0.0702 -0.1316 0.0035  9   DG  Y "C5'" 
2828 C "C4'" . DG  D 9   ? 0.8572 0.4900 0.8176 -0.0621 -0.1053 -0.0034 9   DG  Y "C4'" 
2829 O "O4'" . DG  D 9   ? 0.7734 0.4561 0.7892 -0.0552 -0.1096 0.0007  9   DG  Y "O4'" 
2830 C "C3'" . DG  D 9   ? 0.8644 0.4921 0.8170 -0.0620 -0.0977 -0.0056 9   DG  Y "C3'" 
2831 O "O3'" . DG  D 9   ? 0.9065 0.5367 0.8556 -0.0594 -0.0690 -0.0148 9   DG  Y "O3'" 
2832 C "C2'" . DG  D 9   ? 0.7892 0.4608 0.7923 -0.0564 -0.1068 -0.0002 9   DG  Y "C2'" 
2833 C "C1'" . DG  D 9   ? 0.7405 0.4472 0.7784 -0.0506 -0.1011 -0.0007 9   DG  Y "C1'" 
2834 N N9    . DG  D 9   ? 0.6774 0.4180 0.7603 -0.0454 -0.1089 0.0060  9   DG  Y N9    
2835 C C8    . DG  D 9   ? 0.6688 0.4090 0.7722 -0.0469 -0.1286 0.0161  9   DG  Y C8    
2836 N N7    . DG  D 9   ? 0.6267 0.3982 0.7728 -0.0406 -0.1246 0.0204  9   DG  Y N7    
2837 C C5    . DG  D 9   ? 0.6021 0.3922 0.7483 -0.0351 -0.1046 0.0124  9   DG  Y C5    
2838 C C6    . DG  D 9   ? 0.5647 0.3806 0.7372 -0.0278 -0.0925 0.0123  9   DG  Y C6    
2839 O O6    . DG  D 9   ? 0.5443 0.3722 0.7466 -0.0239 -0.0919 0.0192  9   DG  Y O6    
2840 N N1    . DG  D 9   ? 0.5548 0.3767 0.7155 -0.0253 -0.0796 0.0035  9   DG  Y N1    
2841 C C2    . DG  D 9   ? 0.5740 0.3831 0.7107 -0.0287 -0.0750 -0.0039 9   DG  Y C2    
2842 N N2    . DG  D 9   ? 0.5658 0.3841 0.7056 -0.0256 -0.0642 -0.0106 9   DG  Y N2    
2843 N N3    . DG  D 9   ? 0.6047 0.3888 0.7160 -0.0350 -0.0802 -0.0041 9   DG  Y N3    
2844 C C4    . DG  D 9   ? 0.6225 0.3966 0.7355 -0.0381 -0.0964 0.0039  9   DG  Y C4    
2845 P P     . DA  D 10  ? 0.9513 0.5830 0.9009 -0.0578 -0.0533 -0.0192 10  DA  Y P     
2846 O OP1   . DA  D 10  ? 0.9752 0.5673 0.8886 -0.0611 -0.0286 -0.0261 10  DA  Y OP1   
2847 O OP2   . DA  D 10  ? 0.9843 0.6107 0.9292 -0.0599 -0.0727 -0.0131 10  DA  Y OP2   
2848 O "O5'" . DA  D 10  ? 0.8550 0.5416 0.8605 -0.0492 -0.0448 -0.0216 10  DA  Y "O5'" 
2849 C "C5'" . DA  D 10  ? 0.8176 0.5246 0.8465 -0.0456 -0.0368 -0.0245 10  DA  Y "C5'" 
2850 C "C4'" . DA  D 10  ? 0.7691 0.5154 0.8399 -0.0388 -0.0326 -0.0264 10  DA  Y "C4'" 
2851 O "O4'" . DA  D 10  ? 0.7230 0.4939 0.8135 -0.0352 -0.0477 -0.0206 10  DA  Y "O4'" 
2852 C "C3'" . DA  D 10  ? 0.7752 0.5225 0.8509 -0.0378 -0.0232 -0.0296 10  DA  Y "C3'" 
2853 O "O3'" . DA  D 10  ? 0.8250 0.5942 0.9340 -0.0334 -0.0150 -0.0337 10  DA  Y "O3'" 
2854 C "C2'" . DA  D 10  ? 0.7282 0.4873 0.8075 -0.0364 -0.0379 -0.0239 10  DA  Y "C2'" 
2855 C "C1'" . DA  D 10  ? 0.6824 0.4632 0.7817 -0.0329 -0.0487 -0.0194 10  DA  Y "C1'" 
2856 N N9    . DA  D 10  ? 0.6338 0.4172 0.7369 -0.0332 -0.0633 -0.0114 10  DA  Y N9    
2857 C C8    . DA  D 10  ? 0.6407 0.4019 0.7261 -0.0386 -0.0763 -0.0061 10  DA  Y C8    
2858 N N7    . DA  D 10  ? 0.6191 0.3909 0.7264 -0.0372 -0.0890 0.0020  10  DA  Y N7    
2859 C C5    . DA  D 10  ? 0.5914 0.3911 0.7261 -0.0302 -0.0799 0.0015  10  DA  Y C5    
2860 C C6    . DA  D 10  ? 0.5723 0.3891 0.7370 -0.0254 -0.0807 0.0081  10  DA  Y C6    
2861 N N6    . DA  D 10  ? 0.5736 0.3883 0.7584 -0.0266 -0.0922 0.0175  10  DA  Y N6    
2862 N N1    . DA  D 10  ? 0.5542 0.3856 0.7282 -0.0193 -0.0689 0.0053  10  DA  Y N1    
2863 C C2    . DA  D 10  ? 0.5574 0.3897 0.7181 -0.0186 -0.0618 -0.0030 10  DA  Y C2    
2864 N N3    . DA  D 10  ? 0.5656 0.3882 0.7097 -0.0225 -0.0599 -0.0092 10  DA  Y N3    
2865 C C4    . DA  D 10  ? 0.5951 0.4004 0.7240 -0.0281 -0.0670 -0.0067 10  DA  Y C4    
2866 P P     . DA  D 11  ? 0.9243 0.6988 1.0513 -0.0316 -0.0054 -0.0375 11  DA  Y P     
2867 O OP1   . DA  D 11  ? 0.8586 0.6354 1.0137 -0.0307 0.0072  -0.0420 11  DA  Y OP1   
2868 O OP2   . DA  D 11  ? 0.8868 0.6381 0.9855 -0.0354 -0.0003 -0.0372 11  DA  Y OP2   
2869 O "O5'" . DA  D 11  ? 0.8672 0.6680 1.0120 -0.0266 -0.0198 -0.0347 11  DA  Y "O5'" 
2870 C "C5'" . DA  D 11  ? 0.8111 0.6273 0.9668 -0.0233 -0.0300 -0.0324 11  DA  Y "C5'" 
2871 C "C4'" . DA  D 11  ? 0.7697 0.5975 0.9305 -0.0190 -0.0382 -0.0298 11  DA  Y "C4'" 
2872 O "O4'" . DA  D 11  ? 0.7487 0.5771 0.8985 -0.0186 -0.0433 -0.0238 11  DA  Y "O4'" 
2873 C "C3'" . DA  D 11  ? 0.7530 0.5801 0.9186 -0.0184 -0.0356 -0.0321 11  DA  Y "C3'" 
2874 O "O3'" . DA  D 11  ? 0.7876 0.6200 0.9598 -0.0143 -0.0437 -0.0317 11  DA  Y "O3'" 
2875 C "C2'" . DA  D 11  ? 0.7341 0.5564 0.8829 -0.0198 -0.0359 -0.0283 11  DA  Y "C2'" 
2876 C "C1'" . DA  D 11  ? 0.6846 0.5124 0.8314 -0.0179 -0.0428 -0.0225 11  DA  Y "C1'" 
2877 N N9    . DA  D 11  ? 0.6533 0.4751 0.7917 -0.0205 -0.0472 -0.0168 11  DA  Y N9    
2878 C C8    . DA  D 11  ? 0.6516 0.4567 0.7731 -0.0259 -0.0486 -0.0166 11  DA  Y C8    
2879 N N7    . DA  D 11  ? 0.6406 0.4405 0.7604 -0.0277 -0.0588 -0.0097 11  DA  Y N7    
2880 C C5    . DA  D 11  ? 0.6046 0.4217 0.7467 -0.0226 -0.0601 -0.0051 11  DA  Y C5    
2881 C C6    . DA  D 11  ? 0.5945 0.4157 0.7552 -0.0213 -0.0667 0.0038  11  DA  Y C6    
2882 N N6    . DA  D 11  ? 0.6070 0.4168 0.7693 -0.0259 -0.0798 0.0101  11  DA  Y N6    
2883 N N1    . DA  D 11  ? 0.5749 0.4079 0.7535 -0.0154 -0.0595 0.0065  11  DA  Y N1    
2884 C C2    . DA  D 11  ? 0.5881 0.4249 0.7590 -0.0117 -0.0509 0.0006  11  DA  Y C2    
2885 N N3    . DA  D 11  ? 0.5947 0.4300 0.7524 -0.0129 -0.0494 -0.0074 11  DA  Y N3    
2886 C C4    . DA  D 11  ? 0.6103 0.4377 0.7577 -0.0182 -0.0522 -0.0098 11  DA  Y C4    
2887 P P     . DA  D 12  ? 0.7749 0.6048 0.9521 -0.0127 -0.0469 -0.0335 12  DA  Y P     
2888 O OP1   . DA  D 12  ? 0.7631 0.5916 0.9615 -0.0126 -0.0538 -0.0368 12  DA  Y OP1   
2889 O OP2   . DA  D 12  ? 0.7640 0.5922 0.9373 -0.0149 -0.0393 -0.0340 12  DA  Y OP2   
2890 O "O5'" . DA  D 12  ? 0.7050 0.5308 0.8638 -0.0088 -0.0516 -0.0293 12  DA  Y "O5'" 
2891 C "C5'" . DA  D 12  ? 0.6415 0.4652 0.7916 -0.0064 -0.0532 -0.0261 12  DA  Y "C5'" 
2892 C "C4'" . DA  D 12  ? 0.6264 0.4432 0.7617 -0.0030 -0.0486 -0.0212 12  DA  Y "C4'" 
2893 O "O4'" . DA  D 12  ? 0.5999 0.4258 0.7420 -0.0043 -0.0430 -0.0167 12  DA  Y "O4'" 
2894 C "C3'" . DA  D 12  ? 0.6267 0.4332 0.7522 -0.0017 -0.0494 -0.0224 12  DA  Y "C3'" 
2895 O "O3'" . DA  D 12  ? 0.6398 0.4263 0.7430 0.0024  -0.0469 -0.0197 12  DA  Y "O3'" 
2896 C "C2'" . DA  D 12  ? 0.6045 0.4206 0.7366 -0.0031 -0.0429 -0.0202 12  DA  Y "C2'" 
2897 C "C1'" . DA  D 12  ? 0.5899 0.4135 0.7293 -0.0035 -0.0393 -0.0149 12  DA  Y "C1'" 
2898 N N9    . DA  D 12  ? 0.5569 0.3870 0.7035 -0.0076 -0.0400 -0.0133 12  DA  Y N9    
2899 C C8    . DA  D 12  ? 0.5456 0.3753 0.6905 -0.0120 -0.0413 -0.0177 12  DA  Y C8    
2900 N N7    . DA  D 12  ? 0.5477 0.3738 0.6895 -0.0155 -0.0432 -0.0146 12  DA  Y N7    
2901 C C5    . DA  D 12  ? 0.5397 0.3689 0.6909 -0.0134 -0.0453 -0.0072 12  DA  Y C5    
2902 C C6    . DA  D 12  ? 0.5396 0.3659 0.6988 -0.0158 -0.0521 0.0001  12  DA  Y C6    
2903 N N6    . DA  D 12  ? 0.5524 0.3667 0.6997 -0.0215 -0.0599 0.0003  12  DA  Y N6    
2904 N N1    . DA  D 12  ? 0.5302 0.3616 0.7104 -0.0122 -0.0504 0.0076  12  DA  Y N1    
2905 C C2    . DA  D 12  ? 0.5339 0.3680 0.7164 -0.0065 -0.0399 0.0072  12  DA  Y C2    
2906 N N3    . DA  D 12  ? 0.5338 0.3655 0.6996 -0.0044 -0.0355 0.0004  12  DA  Y N3    
2907 C C4    . DA  D 12  ? 0.5417 0.3736 0.6967 -0.0081 -0.0403 -0.0064 12  DA  Y C4    
2908 P P     . DA  D 13  ? 0.6782 0.4442 0.7599 0.0047  -0.0451 -0.0194 13  DA  Y P     
2909 O OP1   . DA  D 13  ? 0.7192 0.4522 0.7682 0.0074  -0.0474 -0.0190 13  DA  Y OP1   
2910 O OP2   . DA  D 13  ? 0.6825 0.4562 0.7759 0.0018  -0.0531 -0.0237 13  DA  Y OP2   
2911 O "O5'" . DA  D 13  ? 0.6630 0.4344 0.7500 0.0070  -0.0289 -0.0131 13  DA  Y "O5'" 
2912 C "C5'" . DA  D 13  ? 0.6632 0.4287 0.7500 0.0101  -0.0172 -0.0075 13  DA  Y "C5'" 
2913 C "C4'" . DA  D 13  ? 0.6590 0.4316 0.7645 0.0118  -0.0039 -0.0007 13  DA  Y "C4'" 
2914 O "O4'" . DA  D 13  ? 0.6118 0.4099 0.7432 0.0075  -0.0123 -0.0004 13  DA  Y "O4'" 
2915 C "C3'" . DA  D 13  ? 0.6765 0.4311 0.7661 0.0145  0.0053  0.0002  13  DA  Y "C3'" 
2916 O "O3'" . DA  D 13  ? 0.7424 0.4793 0.8319 0.0194  0.0262  0.0072  13  DA  Y "O3'" 
2917 C "C2'" . DA  D 13  ? 0.6468 0.4239 0.7593 0.0113  -0.0004 0.0004  13  DA  Y "C2'" 
2918 C "C1'" . DA  D 13  ? 0.6100 0.4098 0.7503 0.0078  -0.0074 0.0029  13  DA  Y "C1'" 
2919 N N9    . DA  D 13  ? 0.5825 0.3972 0.7311 0.0026  -0.0191 0.0000  13  DA  Y N9    
2920 C C8    . DA  D 13  ? 0.5749 0.3917 0.7129 -0.0005 -0.0270 -0.0075 13  DA  Y C8    
2921 N N7    . DA  D 13  ? 0.5609 0.3850 0.7049 -0.0051 -0.0322 -0.0084 13  DA  Y N7    
2922 C C5    . DA  D 13  ? 0.5545 0.3813 0.7131 -0.0056 -0.0327 -0.0008 13  DA  Y C5    
2923 C C6    . DA  D 13  ? 0.5578 0.3845 0.7227 -0.0104 -0.0411 0.0026  13  DA  Y C6    
2924 N N6    . DA  D 13  ? 0.5625 0.3833 0.7122 -0.0153 -0.0460 -0.0022 13  DA  Y N6    
2925 N N1    . DA  D 13  ? 0.5554 0.3833 0.7428 -0.0101 -0.0443 0.0116  13  DA  Y N1    
2926 C C2    . DA  D 13  ? 0.5481 0.3785 0.7529 -0.0047 -0.0340 0.0167  13  DA  Y C2    
2927 N N3    . DA  D 13  ? 0.5505 0.3769 0.7438 0.0003  -0.0215 0.0137  13  DA  Y N3    
2928 C C4    . DA  D 13  ? 0.5640 0.3881 0.7320 -0.0007 -0.0241 0.0048  13  DA  Y C4    
2929 P P     . DA  D 14  ? 0.8449 0.5572 0.9207 0.0234  0.0447  0.0105  14  DA  Y P     
2930 O OP1   . DA  D 14  ? 0.8926 0.5715 0.9517 0.0287  0.0688  0.0154  14  DA  Y OP1   
2931 O OP2   . DA  D 14  ? 0.8288 0.5310 0.8758 0.0216  0.0327  0.0038  14  DA  Y OP2   
2932 O "O5'" . DA  D 14  ? 0.7883 0.5290 0.9133 0.0226  0.0480  0.0172  14  DA  Y "O5'" 
2933 C "C5'" . DA  D 14  ? 0.7690 0.5259 0.9363 0.0228  0.0524  0.0250  14  DA  Y "C5'" 
2934 C "C4'" . DA  D 14  ? 0.7475 0.5249 0.9567 0.0207  0.0479  0.0311  14  DA  Y "C4'" 
2935 O "O4'" . DA  D 14  ? 0.7064 0.5040 0.9140 0.0144  0.0235  0.0258  14  DA  Y "O4'" 
2936 C "C3'" . DA  D 14  ? 0.7724 0.5360 0.9779 0.0239  0.0624  0.0331  14  DA  Y "C3'" 
2937 O "O3'" . DA  D 14  ? 0.8314 0.6014 1.0899 0.0258  0.0739  0.0444  14  DA  Y "O3'" 
2938 C "C2'" . DA  D 14  ? 0.7378 0.5145 0.9289 0.0191  0.0424  0.0262  14  DA  Y "C2'" 
2939 C "C1'" . DA  D 14  ? 0.6816 0.4820 0.8938 0.0133  0.0214  0.0263  14  DA  Y "C1'" 
2940 N N9    . DA  D 14  ? 0.6432 0.4518 0.8344 0.0082  0.0039  0.0180  14  DA  Y N9    
2941 C C8    . DA  D 14  ? 0.6379 0.4395 0.7959 0.0080  0.0011  0.0090  14  DA  Y C8    
2942 N N7    . DA  D 14  ? 0.6168 0.4276 0.7699 0.0033  -0.0116 0.0037  14  DA  Y N7    
2943 C C5    . DA  D 14  ? 0.6096 0.4296 0.7844 -0.0003 -0.0187 0.0089  14  DA  Y C5    
2944 C C6    . DA  D 14  ? 0.5988 0.4218 0.7710 -0.0063 -0.0311 0.0071  14  DA  Y C6    
2945 N N6    . DA  D 14  ? 0.5919 0.4130 0.7445 -0.0091 -0.0338 -0.0009 14  DA  Y N6    
2946 N N1    . DA  D 14  ? 0.5978 0.4208 0.7884 -0.0096 -0.0407 0.0143  14  DA  Y N1    
2947 C C2    . DA  D 14  ? 0.5950 0.4208 0.8161 -0.0066 -0.0373 0.0234  14  DA  Y C2    
2948 N N3    . DA  D 14  ? 0.6052 0.4308 0.8371 -0.0003 -0.0209 0.0262  14  DA  Y N3    
2949 C C4    . DA  D 14  ? 0.6138 0.4341 0.8155 0.0025  -0.0122 0.0181  14  DA  Y C4    
2950 P P     . DA  D 15  ? 0.8719 0.6348 1.1519 0.0287  0.0893  0.0504  15  DA  Y P     
2951 O OP1   . DA  D 15  ? 0.9052 0.6336 1.1694 0.0359  0.1242  0.0533  15  DA  Y OP1   
2952 O OP2   . DA  D 15  ? 0.8536 0.6238 1.1098 0.0251  0.0728  0.0436  15  DA  Y OP2   
2953 O "O5'" . DA  D 15  ? 0.8308 0.6176 1.1819 0.0259  0.0778  0.0617  15  DA  Y "O5'" 
2954 C "C5'" . DA  D 15  ? 0.7929 0.6013 1.1556 0.0189  0.0460  0.0609  15  DA  Y "C5'" 
2955 C "C4'" . DA  D 15  ? 0.7626 0.5820 1.1368 0.0132  0.0232  0.0618  15  DA  Y "C4'" 
2956 O "O4'" . DA  D 15  ? 0.7293 0.5503 1.0523 0.0090  0.0083  0.0501  15  DA  Y "O4'" 
2957 C "C3'" . DA  D 15  ? 0.7872 0.6023 1.1858 0.0159  0.0348  0.0676  15  DA  Y "C3'" 
2958 O "O3'" . DA  D 15  ? 0.8062 0.6316 1.2536 0.0107  0.0114  0.0768  15  DA  Y "O3'" 
2959 C "C2'" . DA  D 15  ? 0.7702 0.5809 1.1148 0.0148  0.0320  0.0564  15  DA  Y "C2'" 
2960 C "C1'" . DA  D 15  ? 0.7539 0.5734 1.0701 0.0082  0.0066  0.0488  15  DA  Y "C1'" 
2961 N N9    . DA  D 15  ? 0.7341 0.5499 0.9983 0.0072  0.0050  0.0366  15  DA  Y N9    
2962 C C8    . DA  D 15  ? 0.7476 0.5511 0.9777 0.0117  0.0202  0.0301  15  DA  Y C8    
2963 N N7    . DA  D 15  ? 0.7272 0.5308 0.9232 0.0090  0.0108  0.0206  15  DA  Y N7    
2964 C C5    . DA  D 15  ? 0.7149 0.5300 0.9192 0.0028  -0.0072 0.0202  15  DA  Y C5    
2965 C C6    . DA  D 15  ? 0.7001 0.5173 0.8820 -0.0021 -0.0190 0.0124  15  DA  Y C6    
2966 N N6    . DA  D 15  ? 0.6926 0.5063 0.8492 -0.0014 -0.0165 0.0040  15  DA  Y N6    
2967 N N1    . DA  D 15  ? 0.6830 0.5010 0.8697 -0.0080 -0.0333 0.0143  15  DA  Y N1    
2968 C C2    . DA  D 15  ? 0.7025 0.5210 0.9181 -0.0093 -0.0411 0.0238  15  DA  Y C2    
2969 N N3    . DA  D 15  ? 0.7009 0.5229 0.9506 -0.0051 -0.0331 0.0325  15  DA  Y N3    
2970 C C4    . DA  D 15  ? 0.7249 0.5449 0.9659 0.0013  -0.0132 0.0298  15  DA  Y C4    
2971 P P     . DC  D 16  ? 0.8354 0.6604 1.3318 0.0120  0.0154  0.0868  16  DC  Y P     
2972 O OP1   . DC  D 16  ? 0.7831 0.6137 1.3564 0.0105  0.0049  0.1017  16  DC  Y OP1   
2973 O OP2   . DC  D 16  ? 0.8231 0.6354 1.3007 0.0196  0.0505  0.0839  16  DC  Y OP2   
2974 O "O5'" . DC  D 16  ? 0.8604 0.6875 1.3278 0.0045  -0.0145 0.0816  16  DC  Y "O5'" 
2975 C "C5'" . DC  D 16  ? 0.8822 0.7091 1.3384 -0.0041 -0.0491 0.0809  16  DC  Y "C5'" 
2976 C "C4'" . DC  D 16  ? 0.9024 0.7226 1.3137 -0.0095 -0.0652 0.0732  16  DC  Y "C4'" 
2977 O "O4'" . DC  D 16  ? 0.8893 0.7099 1.2430 -0.0073 -0.0504 0.0595  16  DC  Y "O4'" 
2978 C "C3'" . DC  D 16  ? 0.9318 0.7509 1.3654 -0.0082 -0.0617 0.0780  16  DC  Y "C3'" 
2979 O "O3'" . DC  D 16  ? 1.0639 0.8722 1.4743 -0.0158 -0.0881 0.0764  16  DC  Y "O3'" 
2980 C "C2'" . DC  D 16  ? 0.9107 0.7311 1.3055 -0.0021 -0.0334 0.0679  16  DC  Y "C2'" 
2981 C "C1'" . DC  D 16  ? 0.8898 0.7085 1.2282 -0.0056 -0.0415 0.0558  16  DC  Y "C1'" 
2982 N N1    . DC  D 16  ? 0.8614 0.6796 1.1582 -0.0010 -0.0216 0.0450  16  DC  Y N1    
2983 C C2    . DC  D 16  ? 0.8315 0.6475 1.0830 -0.0047 -0.0293 0.0341  16  DC  Y C2    
2984 O O2    . DC  D 16  ? 0.8178 0.6293 1.0585 -0.0114 -0.0483 0.0332  16  DC  Y O2    
2985 N N3    . DC  D 16  ? 0.8030 0.6173 1.0238 -0.0012 -0.0160 0.0255  16  DC  Y N3    
2986 C C4    . DC  D 16  ? 0.8369 0.6458 1.0593 0.0053  0.0034  0.0268  16  DC  Y C4    
2987 N N4    . DC  D 16  ? 0.8561 0.6565 1.0435 0.0076  0.0106  0.0186  16  DC  Y N4    
2988 C C5    . DC  D 16  ? 0.8563 0.6629 1.1163 0.0095  0.0164  0.0371  16  DC  Y C5    
2989 C C6    . DC  D 16  ? 0.8472 0.6617 1.1493 0.0064  0.0039  0.0462  16  DC  Y C6    
2990 P P     . DC  D 17  ? 1.1655 0.9604 1.6107 -0.0240 -0.1255 0.0883  17  DC  Y P     
2991 O OP1   . DC  D 17  ? 1.0961 0.8895 1.5582 -0.0265 -0.1387 0.0929  17  DC  Y OP1   
2992 O OP2   . DC  D 17  ? 1.1222 0.9212 1.6263 -0.0216 -0.1237 0.0994  17  DC  Y OP2   
2993 O "O5'" . DC  D 17  ? 1.1326 0.9052 1.5108 -0.0323 -0.1470 0.0797  17  DC  Y "O5'" 
2994 C "C5'" . DC  D 17  ? 1.0827 0.8509 1.3955 -0.0333 -0.1376 0.0657  17  DC  Y "C5'" 
2995 C "C4'" . DC  D 17  ? 1.0465 0.8108 1.3188 -0.0331 -0.1272 0.0565  17  DC  Y "C4'" 
2996 O "O4'" . DC  D 17  ? 0.9748 0.7586 1.2373 -0.0253 -0.0968 0.0480  17  DC  Y "O4'" 
2997 C "C3'" . DC  D 17  ? 1.0145 0.7758 1.3105 -0.0335 -0.1337 0.0629  17  DC  Y "C3'" 
2998 O "O3'" . DC  D 17  ? 1.0967 0.8393 1.3414 -0.0384 -0.1392 0.0554  17  DC  Y "O3'" 
2999 C "C2'" . DC  D 17  ? 0.9562 0.7407 1.2719 -0.0240 -0.1020 0.0607  17  DC  Y "C2'" 
3000 C "C1'" . DC  D 17  ? 0.9100 0.6979 1.1768 -0.0223 -0.0864 0.0475  17  DC  Y "C1'" 
3001 N N1    . DC  D 17  ? 0.8564 0.6587 1.1234 -0.0140 -0.0583 0.0427  17  DC  Y N1    
3002 C C2    . DC  D 17  ? 0.8185 0.6208 1.0429 -0.0131 -0.0481 0.0309  17  DC  Y C2    
3003 O O2    . DC  D 17  ? 0.8687 0.6616 1.0614 -0.0186 -0.0581 0.0248  17  DC  Y O2    
3004 N N3    . DC  D 17  ? 0.7807 0.5883 0.9994 -0.0065 -0.0278 0.0269  17  DC  Y N3    
3005 C C4    . DC  D 17  ? 0.7959 0.6052 1.0426 -0.0007 -0.0130 0.0337  17  DC  Y C4    
3006 N N4    . DC  D 17  ? 0.8176 0.6215 1.0458 0.0051  0.0062  0.0294  17  DC  Y N4    
3007 C C5    . DC  D 17  ? 0.8125 0.6242 1.1079 -0.0007 -0.0172 0.0458  17  DC  Y C5    
3008 C C6    . DC  D 17  ? 0.8283 0.6383 1.1357 -0.0076 -0.0423 0.0502  17  DC  Y C6    
3009 P P     . DT  D 18  ? 1.2454 0.9529 1.4733 -0.0481 -0.1728 0.0612  18  DT  Y P     
3010 O OP1   . DT  D 18  ? 1.1424 0.8282 1.3649 -0.0546 -0.1981 0.0662  18  DT  Y OP1   
3011 O OP2   . DT  D 18  ? 1.1722 0.8865 1.4451 -0.0466 -0.1782 0.0701  18  DT  Y OP2   
3012 O "O5'" . DT  D 18  ? 1.1409 0.8271 1.2972 -0.0517 -0.1648 0.0484  18  DT  Y "O5'" 
3013 C "C5'" . DT  D 18  ? 1.0291 0.7097 1.1439 -0.0523 -0.1521 0.0384  18  DT  Y "C5'" 
3014 C "C4'" . DT  D 18  ? 0.9278 0.6152 1.0132 -0.0491 -0.1268 0.0269  18  DT  Y "C4'" 
3015 O "O4'" . DT  D 18  ? 0.8433 0.5689 0.9627 -0.0400 -0.1047 0.0247  18  DT  Y "O4'" 
3016 C "C3'" . DT  D 18  ? 0.9162 0.5850 0.9806 -0.0524 -0.1309 0.0262  18  DT  Y "C3'" 
3017 O "O3'" . DT  D 18  ? 0.9381 0.5863 0.9516 -0.0551 -0.1168 0.0156  18  DT  Y "O3'" 
3018 C "C2'" . DT  D 18  ? 0.8372 0.5410 0.9416 -0.0444 -0.1153 0.0270  18  DT  Y "C2'" 
3019 C "C1'" . DT  D 18  ? 0.7899 0.5205 0.9050 -0.0377 -0.0941 0.0212  18  DT  Y "C1'" 
3020 N N1    . DT  D 18  ? 0.7146 0.4739 0.8679 -0.0293 -0.0790 0.0236  18  DT  Y N1    
3021 C C2    . DT  D 18  ? 0.6950 0.4678 0.8382 -0.0242 -0.0590 0.0152  18  DT  Y C2    
3022 O O2    . DT  D 18  ? 0.6983 0.4656 0.8129 -0.0259 -0.0533 0.0066  18  DT  Y O2    
3023 N N3    . DT  D 18  ? 0.6768 0.4651 0.8452 -0.0171 -0.0457 0.0180  18  DT  Y N3    
3024 C C4    . DT  D 18  ? 0.6807 0.4743 0.8879 -0.0140 -0.0452 0.0280  18  DT  Y C4    
3025 O O4    . DT  D 18  ? 0.7088 0.5089 0.9293 -0.0074 -0.0276 0.0292  18  DT  Y O4    
3026 C C5    . DT  D 18  ? 0.6892 0.4744 0.9179 -0.0194 -0.0665 0.0371  18  DT  Y C5    
3027 C C7    . DT  D 18  ? 0.6810 0.4723 0.9650 -0.0164 -0.0671 0.0497  18  DT  Y C7    
3028 C C6    . DT  D 18  ? 0.7046 0.4720 0.9027 -0.0270 -0.0846 0.0345  18  DT  Y C6    
3029 P P     . DC  D 19  ? 1.0086 0.6218 0.9774 -0.0605 -0.1170 0.0120  19  DC  Y P     
3030 O OP1   . DC  D 19  ? 1.0641 0.6310 0.9740 -0.0674 -0.1157 0.0070  19  DC  Y OP1   
3031 O OP2   . DC  D 19  ? 1.0054 0.6117 0.9912 -0.0628 -0.1393 0.0213  19  DC  Y OP2   
3032 O "O5'" . DC  D 19  ? 0.9003 0.5438 0.8807 -0.0535 -0.0882 0.0033  19  DC  Y "O5'" 
3033 C "C5'" . DC  D 19  ? 0.8186 0.4845 0.8085 -0.0488 -0.0682 -0.0037 19  DC  Y "C5'" 
3034 C "C4'" . DC  D 19  ? 0.7648 0.4574 0.7738 -0.0427 -0.0506 -0.0088 19  DC  Y "C4'" 
3035 O "O4'" . DC  D 19  ? 0.7058 0.4301 0.7546 -0.0363 -0.0526 -0.0039 19  DC  Y "O4'" 
3036 C "C3'" . DC  D 19  ? 0.7595 0.4370 0.7509 -0.0449 -0.0481 -0.0104 19  DC  Y "C3'" 
3037 O "O3'" . DC  D 19  ? 0.7448 0.4253 0.7310 -0.0432 -0.0272 -0.0192 19  DC  Y "O3'" 
3038 C "C2'" . DC  D 19  ? 0.7240 0.4265 0.7490 -0.0401 -0.0534 -0.0049 19  DC  Y "C2'" 
3039 C "C1'" . DC  D 19  ? 0.6847 0.4174 0.7414 -0.0336 -0.0474 -0.0043 19  DC  Y "C1'" 
3040 N N1    . DC  D 19  ? 0.6432 0.3929 0.7339 -0.0292 -0.0523 0.0039  19  DC  Y N1    
3041 C C2    . DC  D 19  ? 0.6166 0.3872 0.7262 -0.0220 -0.0389 0.0026  19  DC  Y C2    
3042 O O2    . DC  D 19  ? 0.6039 0.3791 0.7026 -0.0200 -0.0286 -0.0051 19  DC  Y O2    
3043 N N3    . DC  D 19  ? 0.6027 0.3828 0.7417 -0.0176 -0.0375 0.0102  19  DC  Y N3    
3044 C C4    . DC  D 19  ? 0.6117 0.3870 0.7723 -0.0201 -0.0506 0.0195  19  DC  Y C4    
3045 N N4    . DC  D 19  ? 0.6092 0.3937 0.8069 -0.0152 -0.0448 0.0276  19  DC  Y N4    
3046 C C5    . DC  D 19  ? 0.6345 0.3899 0.7791 -0.0280 -0.0704 0.0215  19  DC  Y C5    
3047 C C6    . DC  D 19  ? 0.6506 0.3911 0.7549 -0.0324 -0.0696 0.0132  19  DC  Y C6    
3048 P P     . DC  D 20  ? 0.7875 0.4464 0.7499 -0.0461 -0.0168 -0.0235 20  DC  Y P     
3049 O OP1   . DC  D 20  ? 0.7977 0.4482 0.7541 -0.0464 0.0051  -0.0313 20  DC  Y OP1   
3050 O OP2   . DC  D 20  ? 0.8031 0.4262 0.7316 -0.0526 -0.0325 -0.0185 20  DC  Y OP2   
3051 O "O5'" . DC  D 20  ? 0.6966 0.3883 0.6915 -0.0399 -0.0136 -0.0237 20  DC  Y "O5'" 
3052 C "C5'" . DC  D 20  ? 0.6373 0.3568 0.6606 -0.0342 -0.0045 -0.0275 20  DC  Y "C5'" 
3053 C "C4'" . DC  D 20  ? 0.6007 0.3404 0.6435 -0.0292 -0.0058 -0.0262 20  DC  Y "C4'" 
3054 O "O4'" . DC  D 20  ? 0.5853 0.3348 0.6401 -0.0268 -0.0166 -0.0187 20  DC  Y "O4'" 
3055 C "C3'" . DC  D 20  ? 0.6000 0.3296 0.6321 -0.0309 -0.0030 -0.0271 20  DC  Y "C3'" 
3056 O "O3'" . DC  D 20  ? 0.5754 0.3200 0.6245 -0.0268 0.0039  -0.0310 20  DC  Y "O3'" 
3057 C "C2'" . DC  D 20  ? 0.6010 0.3303 0.6346 -0.0310 -0.0163 -0.0193 20  DC  Y "C2'" 
3058 C "C1'" . DC  D 20  ? 0.5808 0.3308 0.6387 -0.0259 -0.0192 -0.0154 20  DC  Y "C1'" 
3059 N N1    . DC  D 20  ? 0.5768 0.3288 0.6498 -0.0255 -0.0305 -0.0063 20  DC  Y N1    
3060 C C2    . DC  D 20  ? 0.5592 0.3277 0.6573 -0.0193 -0.0261 -0.0021 20  DC  Y C2    
3061 O O2    . DC  D 20  ? 0.5490 0.3253 0.6467 -0.0148 -0.0158 -0.0065 20  DC  Y O2    
3062 N N3    . DC  D 20  ? 0.5571 0.3276 0.6792 -0.0186 -0.0332 0.0072  20  DC  Y N3    
3063 C C4    . DC  D 20  ? 0.5732 0.3306 0.6954 -0.0244 -0.0499 0.0126  20  DC  Y C4    
3064 N N4    . DC  D 20  ? 0.5733 0.3337 0.7296 -0.0237 -0.0589 0.0229  20  DC  Y N4    
3065 C C5    . DC  D 20  ? 0.5951 0.3302 0.6818 -0.0314 -0.0580 0.0082  20  DC  Y C5    
3066 C C6    . DC  D 20  ? 0.5969 0.3299 0.6598 -0.0314 -0.0450 -0.0014 20  DC  Y C6    
3067 P P     . DG  D 21  ? 0.5738 0.3145 0.6198 -0.0270 0.0084  -0.0329 21  DG  Y P     
3068 O OP1   . DG  D 21  ? 0.5658 0.3162 0.6308 -0.0244 0.0147  -0.0380 21  DG  Y OP1   
3069 O OP2   . DG  D 21  ? 0.6018 0.3161 0.6214 -0.0329 0.0124  -0.0336 21  DG  Y OP2   
3070 O "O5'" . DG  D 21  ? 0.5611 0.3113 0.6126 -0.0237 -0.0004 -0.0266 21  DG  Y "O5'" 
3071 C "C5'" . DG  D 21  ? 0.5437 0.3087 0.6102 -0.0180 -0.0018 -0.0245 21  DG  Y "C5'" 
3072 C "C4'" . DG  D 21  ? 0.5397 0.3071 0.6125 -0.0156 -0.0050 -0.0174 21  DG  Y "C4'" 
3073 O "O4'" . DG  D 21  ? 0.5445 0.3074 0.6205 -0.0186 -0.0135 -0.0112 21  DG  Y "O4'" 
3074 C "C3'" . DG  D 21  ? 0.5424 0.3057 0.6110 -0.0160 -0.0038 -0.0171 21  DG  Y "C3'" 
3075 O "O3'" . DG  D 21  ? 0.5387 0.3065 0.6189 -0.0112 -0.0013 -0.0118 21  DG  Y "O3'" 
3076 C "C2'" . DG  D 21  ? 0.5555 0.3064 0.6160 -0.0217 -0.0122 -0.0135 21  DG  Y "C2'" 
3077 C "C1'" . DG  D 21  ? 0.5533 0.3083 0.6282 -0.0210 -0.0192 -0.0071 21  DG  Y "C1'" 
3078 N N9    . DG  D 21  ? 0.5711 0.3100 0.6372 -0.0271 -0.0328 -0.0031 21  DG  Y N9    
3079 C C8    . DG  D 21  ? 0.5945 0.3095 0.6293 -0.0337 -0.0364 -0.0067 21  DG  Y C8    
3080 N N7    . DG  D 21  ? 0.6156 0.3115 0.6416 -0.0389 -0.0527 -0.0010 21  DG  Y N7    
3081 C C5    . DG  D 21  ? 0.5994 0.3128 0.6627 -0.0353 -0.0606 0.0075  21  DG  Y C5    
3082 C C6    . DG  D 21  ? 0.6106 0.3155 0.6916 -0.0384 -0.0809 0.0174  21  DG  Y C6    
3083 O O6    . DG  D 21  ? 0.6405 0.3166 0.6996 -0.0457 -0.1000 0.0203  21  DG  Y O6    
3084 N N1    . DG  D 21  ? 0.5871 0.3160 0.7154 -0.0322 -0.0773 0.0244  21  DG  Y N1    
3085 C C2    . DG  D 21  ? 0.5642 0.3150 0.7087 -0.0244 -0.0564 0.0218  21  DG  Y C2    
3086 N N2    . DG  D 21  ? 0.5514 0.3154 0.7373 -0.0192 -0.0509 0.0298  21  DG  Y N2    
3087 N N3    . DG  D 21  ? 0.5580 0.3128 0.6791 -0.0222 -0.0419 0.0125  21  DG  Y N3    
3088 C C4    . DG  D 21  ? 0.5731 0.3118 0.6596 -0.0277 -0.0454 0.0060  21  DG  Y C4    
3089 P P     . DG  D 22  ? 0.5409 0.3063 0.6176 -0.0088 0.0038  -0.0125 22  DG  Y P     
3090 O OP1   . DG  D 22  ? 0.5414 0.3049 0.6068 -0.0096 0.0055  -0.0204 22  DG  Y OP1   
3091 O OP2   . DG  D 22  ? 0.5452 0.3072 0.6266 -0.0118 -0.0015 -0.0078 22  DG  Y OP2   
3092 O "O5'" . DG  D 22  ? 0.5429 0.3069 0.6270 -0.0024 0.0124  -0.0078 22  DG  Y "O5'" 
3093 C "C5'" . DG  D 22  ? 0.5466 0.3065 0.6229 0.0009  0.0165  -0.0098 22  DG  Y "C5'" 
3094 C "C4'" . DG  D 22  ? 0.5627 0.3071 0.6210 0.0053  0.0241  -0.0114 22  DG  Y "C4'" 
3095 O "O4'" . DG  D 22  ? 0.5712 0.3085 0.6378 0.0095  0.0367  -0.0042 22  DG  Y "O4'" 
3096 C "C3'" . DG  D 22  ? 0.5668 0.3086 0.6142 0.0034  0.0194  -0.0167 22  DG  Y "C3'" 
3097 O "O3'" . DG  D 22  ? 0.5872 0.3110 0.6123 0.0054  0.0173  -0.0208 22  DG  Y "O3'" 
3098 C "C2'" . DG  D 22  ? 0.5691 0.3094 0.6222 0.0049  0.0264  -0.0120 22  DG  Y "C2'" 
3099 C "C1'" . DG  D 22  ? 0.5784 0.3104 0.6386 0.0099  0.0393  -0.0048 22  DG  Y "C1'" 
3100 N N9    . DG  D 22  ? 0.5741 0.3132 0.6626 0.0105  0.0445  0.0032  22  DG  Y N9    
3101 C C8    . DG  D 22  ? 0.5617 0.3148 0.6707 0.0058  0.0329  0.0058  22  DG  Y C8    
3102 N N7    . DG  D 22  ? 0.5609 0.3155 0.6993 0.0072  0.0368  0.0146  22  DG  Y N7    
3103 C C5    . DG  D 22  ? 0.5749 0.3165 0.7135 0.0138  0.0572  0.0177  22  DG  Y C5    
3104 C C6    . DG  D 22  ? 0.5820 0.3175 0.7521 0.0184  0.0739  0.0272  22  DG  Y C6    
3105 O O6    . DG  D 22  ? 0.5730 0.3175 0.7845 0.0173  0.0698  0.0356  22  DG  Y O6    
3106 N N1    . DG  D 22  ? 0.6062 0.3182 0.7558 0.0247  0.0974  0.0271  22  DG  Y N1    
3107 C C2    . DG  D 22  ? 0.6223 0.3167 0.7239 0.0256  0.0989  0.0189  22  DG  Y C2    
3108 N N2    . DG  D 22  ? 0.6549 0.3165 0.7318 0.0313  0.1220  0.0202  22  DG  Y N2    
3109 N N3    . DG  D 22  ? 0.6118 0.3154 0.6913 0.0211  0.0792  0.0106  22  DG  Y N3    
3110 C C4    . DG  D 22  ? 0.5874 0.3157 0.6890 0.0157  0.0616  0.0105  22  DG  Y C4    
3111 P P     . DA  D 23  ? 0.5925 0.3153 0.6147 0.0023  0.0063  -0.0274 23  DA  Y P     
3112 O OP1   . DA  D 23  ? 0.5835 0.3146 0.6133 0.0006  0.0091  -0.0272 23  DA  Y OP1   
3113 O OP2   . DA  D 23  ? 0.6212 0.3167 0.6172 0.0045  0.0007  -0.0291 23  DA  Y OP2   
3114 O "O5'" . DA  D 23  ? 0.5847 0.3214 0.6240 -0.0015 -0.0008 -0.0309 23  DA  Y "O5'" 
3115 C "C5'" . DA  D 23  ? 0.6000 0.3340 0.6373 -0.0005 -0.0036 -0.0306 23  DA  Y "C5'" 
3116 C "C4'" . DA  D 23  ? 0.5940 0.3428 0.6509 -0.0043 -0.0068 -0.0335 23  DA  Y "C4'" 
3117 O "O4'" . DA  D 23  ? 0.5986 0.3487 0.6692 -0.0072 -0.0115 -0.0383 23  DA  Y "O4'" 
3118 C "C3'" . DA  D 23  ? 0.5851 0.3467 0.6506 -0.0068 -0.0005 -0.0312 23  DA  Y "C3'" 
3119 O "O3'" . DA  D 23  ? 0.5860 0.3529 0.6580 -0.0082 -0.0017 -0.0315 23  DA  Y "O3'" 
3120 C "C2'" . DA  D 23  ? 0.5865 0.3500 0.6580 -0.0107 0.0016  -0.0346 23  DA  Y "C2'" 
3121 C "C1'" . DA  D 23  ? 0.5896 0.3494 0.6710 -0.0107 -0.0035 -0.0394 23  DA  Y "C1'" 
3122 N N9    . DA  D 23  ? 0.5860 0.3427 0.6703 -0.0116 -0.0026 -0.0413 23  DA  Y N9    
3123 C C8    . DA  D 23  ? 0.5897 0.3440 0.6615 -0.0106 0.0005  -0.0391 23  DA  Y C8    
3124 N N7    . DA  D 23  ? 0.5891 0.3406 0.6669 -0.0117 0.0003  -0.0417 23  DA  Y N7    
3125 C C5    . DA  D 23  ? 0.5850 0.3373 0.6854 -0.0136 -0.0030 -0.0454 23  DA  Y C5    
3126 C C6    . DA  D 23  ? 0.5848 0.3353 0.7093 -0.0154 -0.0045 -0.0485 23  DA  Y C6    
3127 N N6    . DA  D 23  ? 0.5865 0.3339 0.7099 -0.0156 -0.0033 -0.0490 23  DA  Y N6    
3128 N N1    . DA  D 23  ? 0.5814 0.3334 0.7364 -0.0169 -0.0076 -0.0504 23  DA  Y N1    
3129 C C2    . DA  D 23  ? 0.5849 0.3399 0.7402 -0.0166 -0.0092 -0.0499 23  DA  Y C2    
3130 N N3    . DA  D 23  ? 0.5847 0.3417 0.7145 -0.0150 -0.0080 -0.0476 23  DA  Y N3    
3131 C C4    . DA  D 23  ? 0.5850 0.3404 0.6897 -0.0135 -0.0050 -0.0451 23  DA  Y C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   129 129 GLY GLY A . n 
A 1 2   SER 2   130 130 SER SER A . n 
A 1 3   LYS 3   131 131 LYS LYS A . n 
A 1 4   VAL 4   132 132 VAL VAL A . n 
A 1 5   GLU 5   133 133 GLU GLU A . n 
A 1 6   ASP 6   134 134 ASP ASP A . n 
A 1 7   PRO 7   135 135 PRO PRO A . n 
A 1 8   LYS 8   136 136 LYS LYS A . n 
A 1 9   ASP 9   137 137 ASP ASP A . n 
A 1 10  PHE 10  138 138 PHE PHE A . n 
A 1 11  PRO 11  139 139 PRO PRO A . n 
A 1 12  SER 12  140 140 SER SER A . n 
A 1 13  GLU 13  141 141 GLU GLU A . n 
A 1 14  LEU 14  142 142 LEU LEU A . n 
A 1 15  LEU 15  143 143 LEU LEU A . n 
A 1 16  SER 16  144 144 SER SER A . n 
A 1 17  PHE 17  145 145 PHE PHE A . n 
A 1 18  LEU 18  146 146 LEU LEU A . n 
A 1 19  SER 19  147 147 SER SER A . n 
A 1 20  HIS 20  148 148 HIS HIS A . n 
A 1 21  ALA 21  149 149 ALA ALA A . n 
A 1 22  VAL 22  150 150 VAL VAL A . n 
A 1 23  PHE 23  151 151 PHE PHE A . n 
A 1 24  SER 24  152 152 SER SER A . n 
A 1 25  ASN 25  153 153 ASN ASN A . n 
A 1 26  ARG 26  154 154 ARG ARG A . n 
A 1 27  THR 27  155 155 THR THR A . n 
A 1 28  LEU 28  156 156 LEU LEU A . n 
A 1 29  ALA 29  157 157 ALA ALA A . n 
A 1 30  CYS 30  158 158 CYS CYS A . n 
A 1 31  PHE 31  159 159 PHE PHE A . n 
A 1 32  ALA 32  160 160 ALA ALA A . n 
A 1 33  ILE 33  161 161 ILE ILE A . n 
A 1 34  TYR 34  162 162 TYR TYR A . n 
A 1 35  THR 35  163 163 THR THR A . n 
A 1 36  THR 36  164 164 THR THR A . n 
A 1 37  LYS 37  165 165 LYS LYS A . n 
A 1 38  GLU 38  166 166 GLU GLU A . n 
A 1 39  LYS 39  167 167 LYS LYS A . n 
A 1 40  ALA 40  168 168 ALA ALA A . n 
A 1 41  ALA 41  169 169 ALA ALA A . n 
A 1 42  LEU 42  170 170 LEU LEU A . n 
A 1 43  LEU 43  171 171 LEU LEU A . n 
A 1 44  TYR 44  172 172 TYR TYR A . n 
A 1 45  LYS 45  173 173 LYS LYS A . n 
A 1 46  LYS 46  174 174 LYS LYS A . n 
A 1 47  ILE 47  175 175 ILE ILE A . n 
A 1 48  MET 48  176 176 MET MET A . n 
A 1 49  GLU 49  177 177 GLU GLU A . n 
A 1 50  LYS 50  178 178 LYS LYS A . n 
A 1 51  TYR 51  179 179 TYR TYR A . n 
A 1 52  SER 52  180 180 SER SER A . n 
A 1 53  VAL 53  181 181 VAL VAL A . n 
A 1 54  THR 54  182 182 THR THR A . n 
A 1 55  PHE 55  183 183 PHE PHE A . n 
A 1 56  ILE 56  184 184 ILE ILE A . n 
A 1 57  SER 57  185 185 SER SER A . n 
A 1 58  ARG 58  186 186 ARG ARG A . n 
A 1 59  HIS 59  187 187 HIS HIS A . n 
A 1 60  ASN 60  188 188 ASN ASN A . n 
A 1 61  SER 61  189 189 SER SER A . n 
A 1 62  TYR 62  190 190 TYR TYR A . n 
A 1 63  ASN 63  191 191 ASN ASN A . n 
A 1 64  HIS 64  192 192 HIS HIS A . n 
A 1 65  ASN 65  193 193 ASN ASN A . n 
A 1 66  ILE 66  194 194 ILE ILE A . n 
A 1 67  LEU 67  195 195 LEU LEU A . n 
A 1 68  PHE 68  196 196 PHE PHE A . n 
A 1 69  PHE 69  197 197 PHE PHE A . n 
A 1 70  LEU 70  198 198 LEU LEU A . n 
A 1 71  THR 71  199 199 THR THR A . n 
A 1 72  PRO 72  200 200 PRO PRO A . n 
A 1 73  HIS 73  201 201 HIS HIS A . n 
A 1 74  ARG 74  202 202 ARG ARG A . n 
A 1 75  HIS 75  203 203 HIS HIS A . n 
A 1 76  ARG 76  204 204 ARG ARG A . n 
A 1 77  VAL 77  205 205 VAL VAL A . n 
A 1 78  SER 78  206 206 SER SER A . n 
A 1 79  ALA 79  207 207 ALA ALA A . n 
A 1 80  ILE 80  208 208 ILE ILE A . n 
A 1 81  ASN 81  209 209 ASN ASN A . n 
A 1 82  ASN 82  210 210 ASN ASN A . n 
A 1 83  TYR 83  211 211 TYR TYR A . n 
A 1 84  ALA 84  212 212 ALA ALA A . n 
A 1 85  GLN 85  213 213 GLN GLN A . n 
A 1 86  LYS 86  214 214 LYS LYS A . n 
A 1 87  LEU 87  215 215 LEU LEU A . n 
A 1 88  CME 88  216 216 CME CME A . n 
A 1 89  THR 89  217 217 THR THR A . n 
A 1 90  PHE 90  218 218 PHE PHE A . n 
A 1 91  SER 91  219 219 SER SER A . n 
A 1 92  PHE 92  220 220 PHE PHE A . n 
A 1 93  LEU 93  221 221 LEU LEU A . n 
A 1 94  ILE 94  222 222 ILE ILE A . n 
A 1 95  CYS 95  223 223 CYS CYS A . n 
A 1 96  LYS 96  224 224 LYS LYS A . n 
A 1 97  GLY 97  225 225 GLY GLY A . n 
A 1 98  VAL 98  226 226 VAL VAL A . n 
A 1 99  ASN 99  227 227 ASN ASN A . n 
A 1 100 LYS 100 228 228 LYS LYS A . n 
A 1 101 GLU 101 229 229 GLU GLU A . n 
A 1 102 TYR 102 230 230 TYR TYR A . n 
A 1 103 LEU 103 231 231 LEU LEU A . n 
A 1 104 MET 104 232 232 MET MET A . n 
A 1 105 TYR 105 233 233 TYR TYR A . n 
A 1 106 SER 106 234 234 SER SER A . n 
A 1 107 ALA 107 235 235 ALA ALA A . n 
A 1 108 LEU 108 236 236 LEU LEU A . n 
A 1 109 THR 109 237 237 THR THR A . n 
A 1 110 ARG 110 238 238 ARG ARG A . n 
A 1 111 ASP 111 239 239 ASP ASP A . n 
A 1 112 PRO 112 240 240 PRO PRO A . n 
A 1 113 PHE 113 241 241 PHE PHE A . n 
A 1 114 SER 114 242 242 SER SER A . n 
A 1 115 VAL 115 243 243 VAL VAL A . n 
A 1 116 ILE 116 244 244 ILE ILE A . n 
A 1 117 GLU 117 245 245 GLU GLU A . n 
A 1 118 GLU 118 246 246 GLU GLU A . n 
A 1 119 SER 119 247 247 SER SER A . n 
A 1 120 LEU 120 248 248 LEU LEU A . n 
A 1 121 PRO 121 249 249 PRO PRO A . n 
A 1 122 GLY 122 250 250 GLY GLY A . n 
A 1 123 GLY 123 251 251 GLY GLY A . n 
A 1 124 LEU 124 252 252 LEU LEU A . n 
A 1 125 LYS 125 253 253 LYS LYS A . n 
A 1 126 GLU 126 254 254 GLU GLU A . n 
A 1 127 HIS 127 255 255 HIS HIS A . n 
A 1 128 ASP 128 256 256 ASP ASP A . n 
A 1 129 PHE 129 257 257 PHE PHE A . n 
A 1 130 ASN 130 258 258 ASN ASN A . n 
A 1 131 PRO 131 259 259 PRO PRO A . n 
A 1 132 GLU 132 260 260 GLU GLU A . n 
A 1 133 SER 133 261 261 SER SER A . n 
A 1 134 SER 134 262 ?   ?   ?   A . n 
B 1 1   GLY 1   129 129 GLY GLY B . n 
B 1 2   SER 2   130 130 SER SER B . n 
B 1 3   LYS 3   131 131 LYS LYS B . n 
B 1 4   VAL 4   132 132 VAL VAL B . n 
B 1 5   GLU 5   133 133 GLU GLU B . n 
B 1 6   ASP 6   134 134 ASP ASP B . n 
B 1 7   PRO 7   135 135 PRO PRO B . n 
B 1 8   LYS 8   136 136 LYS LYS B . n 
B 1 9   ASP 9   137 137 ASP ASP B . n 
B 1 10  PHE 10  138 138 PHE PHE B . n 
B 1 11  PRO 11  139 139 PRO PRO B . n 
B 1 12  SER 12  140 140 SER SER B . n 
B 1 13  GLU 13  141 141 GLU GLU B . n 
B 1 14  LEU 14  142 142 LEU LEU B . n 
B 1 15  LEU 15  143 143 LEU LEU B . n 
B 1 16  SER 16  144 144 SER SER B . n 
B 1 17  PHE 17  145 145 PHE PHE B . n 
B 1 18  LEU 18  146 146 LEU LEU B . n 
B 1 19  SER 19  147 147 SER SER B . n 
B 1 20  HIS 20  148 148 HIS HIS B . n 
B 1 21  ALA 21  149 149 ALA ALA B . n 
B 1 22  VAL 22  150 150 VAL VAL B . n 
B 1 23  PHE 23  151 151 PHE PHE B . n 
B 1 24  SER 24  152 152 SER SER B . n 
B 1 25  ASN 25  153 153 ASN ASN B . n 
B 1 26  ARG 26  154 154 ARG ARG B . n 
B 1 27  THR 27  155 155 THR THR B . n 
B 1 28  LEU 28  156 156 LEU LEU B . n 
B 1 29  ALA 29  157 157 ALA ALA B . n 
B 1 30  CYS 30  158 158 CYS CYS B . n 
B 1 31  PHE 31  159 159 PHE PHE B . n 
B 1 32  ALA 32  160 160 ALA ALA B . n 
B 1 33  ILE 33  161 161 ILE ILE B . n 
B 1 34  TYR 34  162 162 TYR TYR B . n 
B 1 35  THR 35  163 163 THR THR B . n 
B 1 36  THR 36  164 164 THR THR B . n 
B 1 37  LYS 37  165 165 LYS LYS B . n 
B 1 38  GLU 38  166 166 GLU GLU B . n 
B 1 39  LYS 39  167 167 LYS LYS B . n 
B 1 40  ALA 40  168 168 ALA ALA B . n 
B 1 41  ALA 41  169 169 ALA ALA B . n 
B 1 42  LEU 42  170 170 LEU LEU B . n 
B 1 43  LEU 43  171 171 LEU LEU B . n 
B 1 44  TYR 44  172 172 TYR TYR B . n 
B 1 45  LYS 45  173 173 LYS LYS B . n 
B 1 46  LYS 46  174 174 LYS LYS B . n 
B 1 47  ILE 47  175 175 ILE ILE B . n 
B 1 48  MET 48  176 176 MET MET B . n 
B 1 49  GLU 49  177 177 GLU GLU B . n 
B 1 50  LYS 50  178 178 LYS LYS B . n 
B 1 51  TYR 51  179 179 TYR TYR B . n 
B 1 52  SER 52  180 180 SER SER B . n 
B 1 53  VAL 53  181 181 VAL VAL B . n 
B 1 54  THR 54  182 182 THR THR B . n 
B 1 55  PHE 55  183 183 PHE PHE B . n 
B 1 56  ILE 56  184 184 ILE ILE B . n 
B 1 57  SER 57  185 185 SER SER B . n 
B 1 58  ARG 58  186 186 ARG ARG B . n 
B 1 59  HIS 59  187 187 HIS HIS B . n 
B 1 60  ASN 60  188 188 ASN ASN B . n 
B 1 61  SER 61  189 189 SER SER B . n 
B 1 62  TYR 62  190 190 TYR TYR B . n 
B 1 63  ASN 63  191 191 ASN ASN B . n 
B 1 64  HIS 64  192 192 HIS HIS B . n 
B 1 65  ASN 65  193 193 ASN ASN B . n 
B 1 66  ILE 66  194 194 ILE ILE B . n 
B 1 67  LEU 67  195 195 LEU LEU B . n 
B 1 68  PHE 68  196 196 PHE PHE B . n 
B 1 69  PHE 69  197 197 PHE PHE B . n 
B 1 70  LEU 70  198 198 LEU LEU B . n 
B 1 71  THR 71  199 199 THR THR B . n 
B 1 72  PRO 72  200 200 PRO PRO B . n 
B 1 73  HIS 73  201 201 HIS HIS B . n 
B 1 74  ARG 74  202 202 ARG ARG B . n 
B 1 75  HIS 75  203 203 HIS HIS B . n 
B 1 76  ARG 76  204 204 ARG ARG B . n 
B 1 77  VAL 77  205 205 VAL VAL B . n 
B 1 78  SER 78  206 206 SER SER B . n 
B 1 79  ALA 79  207 207 ALA ALA B . n 
B 1 80  ILE 80  208 208 ILE ILE B . n 
B 1 81  ASN 81  209 209 ASN ASN B . n 
B 1 82  ASN 82  210 210 ASN ASN B . n 
B 1 83  TYR 83  211 211 TYR TYR B . n 
B 1 84  ALA 84  212 212 ALA ALA B . n 
B 1 85  GLN 85  213 213 GLN GLN B . n 
B 1 86  LYS 86  214 214 LYS LYS B . n 
B 1 87  LEU 87  215 215 LEU LEU B . n 
B 1 88  CME 88  216 216 CME CME B . n 
B 1 89  THR 89  217 217 THR THR B . n 
B 1 90  PHE 90  218 218 PHE PHE B . n 
B 1 91  SER 91  219 219 SER SER B . n 
B 1 92  PHE 92  220 220 PHE PHE B . n 
B 1 93  LEU 93  221 221 LEU LEU B . n 
B 1 94  ILE 94  222 222 ILE ILE B . n 
B 1 95  CYS 95  223 223 CYS CYS B . n 
B 1 96  LYS 96  224 224 LYS LYS B . n 
B 1 97  GLY 97  225 225 GLY GLY B . n 
B 1 98  VAL 98  226 226 VAL VAL B . n 
B 1 99  ASN 99  227 227 ASN ASN B . n 
B 1 100 LYS 100 228 228 LYS LYS B . n 
B 1 101 GLU 101 229 229 GLU GLU B . n 
B 1 102 TYR 102 230 230 TYR TYR B . n 
B 1 103 LEU 103 231 231 LEU LEU B . n 
B 1 104 MET 104 232 232 MET MET B . n 
B 1 105 TYR 105 233 233 TYR TYR B . n 
B 1 106 SER 106 234 234 SER SER B . n 
B 1 107 ALA 107 235 235 ALA ALA B . n 
B 1 108 LEU 108 236 236 LEU LEU B . n 
B 1 109 THR 109 237 237 THR THR B . n 
B 1 110 ARG 110 238 238 ARG ARG B . n 
B 1 111 ASP 111 239 239 ASP ASP B . n 
B 1 112 PRO 112 240 240 PRO PRO B . n 
B 1 113 PHE 113 241 241 PHE PHE B . n 
B 1 114 SER 114 242 242 SER SER B . n 
B 1 115 VAL 115 243 243 VAL VAL B . n 
B 1 116 ILE 116 244 244 ILE ILE B . n 
B 1 117 GLU 117 245 245 GLU GLU B . n 
B 1 118 GLU 118 246 246 GLU GLU B . n 
B 1 119 SER 119 247 247 SER SER B . n 
B 1 120 LEU 120 248 248 LEU LEU B . n 
B 1 121 PRO 121 249 249 PRO PRO B . n 
B 1 122 GLY 122 250 250 GLY GLY B . n 
B 1 123 GLY 123 251 251 GLY GLY B . n 
B 1 124 LEU 124 252 252 LEU LEU B . n 
B 1 125 LYS 125 253 253 LYS LYS B . n 
B 1 126 GLU 126 254 254 GLU GLU B . n 
B 1 127 HIS 127 255 255 HIS HIS B . n 
B 1 128 ASP 128 256 256 ASP ASP B . n 
B 1 129 PHE 129 257 257 PHE PHE B . n 
B 1 130 ASN 130 258 258 ASN ASN B . n 
B 1 131 PRO 131 259 259 PRO PRO B . n 
B 1 132 GLU 132 260 260 GLU GLU B . n 
B 1 133 SER 133 261 ?   ?   ?   B . n 
B 1 134 SER 134 262 ?   ?   ?   B . n 
C 2 1   DG  1   1   1   DG  DG  X . n 
C 2 2   DA  2   2   2   DA  DA  X . n 
C 2 3   DG  3   3   3   DG  DG  X . n 
C 2 4   DG  4   4   4   DG  DG  X . n 
C 2 5   DA  5   5   5   DA  DA  X . n 
C 2 6   DG  6   6   6   DG  DG  X . n 
C 2 7   DG  7   7   7   DG  DG  X . n 
C 2 8   DC  8   8   8   DC  DC  X . n 
C 2 9   DT  9   9   9   DT  DT  X . n 
C 2 10  DT  10  10  10  DT  DT  X . n 
C 2 11  DT  11  11  11  DT  DT  X . n 
C 2 12  DT  12  12  12  DT  DT  X . n 
C 2 13  DT  13  13  13  DT  DT  X . n 
C 2 14  DT  14  14  14  DT  DT  X . n 
C 2 15  DG  15  15  15  DG  DG  X . n 
C 2 16  DG  16  16  16  DG  DG  X . n 
C 2 17  DA  17  17  17  DA  DA  X . n 
C 2 18  DG  18  18  18  DG  DG  X . n 
C 2 19  DG  19  19  19  DG  DG  X . n 
C 2 20  DC  20  20  20  DC  DC  X . n 
C 2 21  DC  21  21  21  DC  DC  X . n 
D 3 1   DA  1   1   1   DA  DA  Y . n 
D 3 2   DC  2   2   2   DC  DC  Y . n 
D 3 3   DT  3   3   3   DT  DT  Y . n 
D 3 4   DC  4   4   4   DC  DC  Y . n 
D 3 5   DC  5   5   5   DC  DC  Y . n 
D 3 6   DT  6   6   6   DT  DT  Y . n 
D 3 7   DC  7   7   7   DC  DC  Y . n 
D 3 8   DC  8   8   8   DC  DC  Y . n 
D 3 9   DG  9   9   9   DG  DG  Y . n 
D 3 10  DA  10  10  10  DA  DA  Y . n 
D 3 11  DA  11  11  11  DA  DA  Y . n 
D 3 12  DA  12  12  12  DA  DA  Y . n 
D 3 13  DA  13  13  13  DA  DA  Y . n 
D 3 14  DA  14  14  14  DA  DA  Y . n 
D 3 15  DA  15  15  15  DA  DA  Y . n 
D 3 16  DC  16  16  16  DC  DC  Y . n 
D 3 17  DC  17  17  17  DC  DC  Y . n 
D 3 18  DT  18  18  18  DT  DT  Y . n 
D 3 19  DC  19  19  19  DC  DC  Y . n 
D 3 20  DC  20  20  20  DC  DC  Y . n 
D 3 21  DG  21  21  21  DG  DG  Y . n 
D 3 22  DG  22  22  22  DG  DG  Y . n 
D 3 23  DA  23  23  23  DA  DA  Y . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 EDO 1  301 2   EDO EDO A . 
F 5 CA  1  301 2   CA  CA  B . 
G 4 EDO 1  302 1   EDO EDO B . 
H 5 CA  1  101 1   CA  CA  Y . 
I 6 ACT 1  102 1   ACT ACT Y . 
J 7 HOH 1  401 44  HOH HOH A . 
J 7 HOH 2  402 227 HOH HOH A . 
J 7 HOH 3  403 33  HOH HOH A . 
J 7 HOH 4  404 52  HOH HOH A . 
J 7 HOH 5  405 5   HOH HOH A . 
J 7 HOH 6  406 37  HOH HOH A . 
J 7 HOH 7  407 41  HOH HOH A . 
J 7 HOH 8  408 27  HOH HOH A . 
J 7 HOH 9  409 223 HOH HOH A . 
J 7 HOH 10 410 224 HOH HOH A . 
J 7 HOH 11 411 219 HOH HOH A . 
J 7 HOH 12 412 13  HOH HOH A . 
J 7 HOH 13 413 3   HOH HOH A . 
J 7 HOH 14 414 47  HOH HOH A . 
J 7 HOH 15 415 22  HOH HOH A . 
J 7 HOH 16 416 30  HOH HOH A . 
J 7 HOH 17 417 6   HOH HOH A . 
J 7 HOH 18 418 188 HOH HOH A . 
J 7 HOH 19 419 34  HOH HOH A . 
J 7 HOH 20 420 19  HOH HOH A . 
J 7 HOH 21 421 35  HOH HOH A . 
J 7 HOH 22 422 10  HOH HOH A . 
J 7 HOH 23 423 21  HOH HOH A . 
J 7 HOH 24 424 25  HOH HOH A . 
J 7 HOH 25 425 69  HOH HOH A . 
J 7 HOH 26 426 12  HOH HOH A . 
J 7 HOH 27 427 189 HOH HOH A . 
J 7 HOH 28 428 26  HOH HOH A . 
J 7 HOH 29 429 203 HOH HOH A . 
J 7 HOH 30 430 46  HOH HOH A . 
J 7 HOH 31 431 11  HOH HOH A . 
J 7 HOH 32 432 15  HOH HOH A . 
J 7 HOH 33 433 199 HOH HOH A . 
J 7 HOH 34 434 179 HOH HOH A . 
J 7 HOH 35 435 9   HOH HOH A . 
J 7 HOH 36 436 28  HOH HOH A . 
J 7 HOH 37 437 31  HOH HOH A . 
J 7 HOH 38 438 2   HOH HOH A . 
J 7 HOH 39 439 43  HOH HOH A . 
J 7 HOH 40 440 185 HOH HOH A . 
J 7 HOH 41 441 190 HOH HOH A . 
J 7 HOH 42 442 4   HOH HOH A . 
J 7 HOH 43 443 222 HOH HOH A . 
J 7 HOH 44 444 20  HOH HOH A . 
J 7 HOH 45 445 32  HOH HOH A . 
J 7 HOH 46 446 8   HOH HOH A . 
J 7 HOH 47 447 42  HOH HOH A . 
J 7 HOH 48 448 230 HOH HOH A . 
J 7 HOH 49 449 40  HOH HOH A . 
J 7 HOH 50 450 53  HOH HOH A . 
J 7 HOH 51 451 192 HOH HOH A . 
J 7 HOH 52 452 45  HOH HOH A . 
J 7 HOH 53 453 226 HOH HOH A . 
J 7 HOH 54 454 24  HOH HOH A . 
J 7 HOH 55 455 17  HOH HOH A . 
J 7 HOH 56 456 186 HOH HOH A . 
J 7 HOH 57 457 16  HOH HOH A . 
J 7 HOH 58 458 187 HOH HOH A . 
J 7 HOH 59 459 1   HOH HOH A . 
J 7 HOH 60 460 48  HOH HOH A . 
J 7 HOH 61 461 39  HOH HOH A . 
J 7 HOH 62 462 193 HOH HOH A . 
J 7 HOH 63 463 51  HOH HOH A . 
J 7 HOH 64 464 36  HOH HOH A . 
J 7 HOH 65 465 50  HOH HOH A . 
J 7 HOH 66 466 18  HOH HOH A . 
J 7 HOH 67 467 14  HOH HOH A . 
J 7 HOH 68 468 23  HOH HOH A . 
J 7 HOH 69 469 104 HOH HOH A . 
J 7 HOH 70 470 135 HOH HOH A . 
J 7 HOH 71 471 38  HOH HOH A . 
J 7 HOH 72 472 49  HOH HOH A . 
J 7 HOH 73 473 29  HOH HOH A . 
J 7 HOH 74 474 115 HOH HOH A . 
J 7 HOH 75 475 7   HOH HOH A . 
J 7 HOH 76 476 184 HOH HOH A . 
J 7 HOH 77 477 169 HOH HOH A . 
J 7 HOH 78 478 114 HOH HOH A . 
J 7 HOH 79 479 172 HOH HOH A . 
J 7 HOH 80 480 150 HOH HOH A . 
J 7 HOH 81 481 102 HOH HOH A . 
J 7 HOH 82 482 148 HOH HOH A . 
J 7 HOH 83 483 137 HOH HOH A . 
J 7 HOH 84 484 117 HOH HOH A . 
J 7 HOH 85 485 194 HOH HOH A . 
J 7 HOH 86 486 180 HOH HOH A . 
J 7 HOH 87 487 162 HOH HOH A . 
J 7 HOH 88 488 118 HOH HOH A . 
J 7 HOH 89 489 165 HOH HOH A . 
J 7 HOH 90 490 98  HOH HOH A . 
J 7 HOH 91 491 163 HOH HOH A . 
J 7 HOH 92 492 110 HOH HOH A . 
J 7 HOH 93 493 126 HOH HOH A . 
K 7 HOH 1  401 176 HOH HOH B . 
K 7 HOH 2  402 130 HOH HOH B . 
K 7 HOH 3  403 160 HOH HOH B . 
K 7 HOH 4  404 58  HOH HOH B . 
K 7 HOH 5  405 143 HOH HOH B . 
K 7 HOH 6  406 142 HOH HOH B . 
K 7 HOH 7  407 90  HOH HOH B . 
K 7 HOH 8  408 207 HOH HOH B . 
K 7 HOH 9  409 170 HOH HOH B . 
K 7 HOH 10 410 151 HOH HOH B . 
K 7 HOH 11 411 131 HOH HOH B . 
K 7 HOH 12 412 166 HOH HOH B . 
K 7 HOH 13 413 77  HOH HOH B . 
K 7 HOH 14 414 61  HOH HOH B . 
K 7 HOH 15 415 154 HOH HOH B . 
K 7 HOH 16 416 75  HOH HOH B . 
K 7 HOH 17 417 64  HOH HOH B . 
K 7 HOH 18 418 123 HOH HOH B . 
K 7 HOH 19 419 63  HOH HOH B . 
K 7 HOH 20 420 83  HOH HOH B . 
K 7 HOH 21 421 228 HOH HOH B . 
K 7 HOH 22 422 220 HOH HOH B . 
K 7 HOH 23 423 54  HOH HOH B . 
K 7 HOH 24 424 89  HOH HOH B . 
K 7 HOH 25 425 55  HOH HOH B . 
K 7 HOH 26 426 76  HOH HOH B . 
K 7 HOH 27 427 72  HOH HOH B . 
K 7 HOH 28 428 116 HOH HOH B . 
K 7 HOH 29 429 59  HOH HOH B . 
K 7 HOH 30 430 175 HOH HOH B . 
K 7 HOH 31 431 145 HOH HOH B . 
K 7 HOH 32 432 132 HOH HOH B . 
K 7 HOH 33 433 218 HOH HOH B . 
K 7 HOH 34 434 62  HOH HOH B . 
K 7 HOH 35 435 66  HOH HOH B . 
K 7 HOH 36 436 65  HOH HOH B . 
K 7 HOH 37 437 82  HOH HOH B . 
K 7 HOH 38 438 134 HOH HOH B . 
K 7 HOH 39 439 147 HOH HOH B . 
K 7 HOH 40 440 60  HOH HOH B . 
K 7 HOH 41 441 67  HOH HOH B . 
K 7 HOH 42 442 95  HOH HOH B . 
K 7 HOH 43 443 113 HOH HOH B . 
K 7 HOH 44 444 181 HOH HOH B . 
K 7 HOH 45 445 73  HOH HOH B . 
K 7 HOH 46 446 86  HOH HOH B . 
K 7 HOH 47 447 167 HOH HOH B . 
K 7 HOH 48 448 93  HOH HOH B . 
K 7 HOH 49 449 139 HOH HOH B . 
K 7 HOH 50 450 87  HOH HOH B . 
K 7 HOH 51 451 92  HOH HOH B . 
K 7 HOH 52 452 81  HOH HOH B . 
K 7 HOH 53 453 84  HOH HOH B . 
K 7 HOH 54 454 70  HOH HOH B . 
K 7 HOH 55 455 68  HOH HOH B . 
K 7 HOH 56 456 217 HOH HOH B . 
K 7 HOH 57 457 78  HOH HOH B . 
K 7 HOH 58 458 79  HOH HOH B . 
K 7 HOH 59 459 56  HOH HOH B . 
K 7 HOH 60 460 57  HOH HOH B . 
K 7 HOH 61 461 111 HOH HOH B . 
K 7 HOH 62 462 96  HOH HOH B . 
K 7 HOH 63 463 121 HOH HOH B . 
K 7 HOH 64 464 74  HOH HOH B . 
K 7 HOH 65 465 136 HOH HOH B . 
K 7 HOH 66 466 85  HOH HOH B . 
K 7 HOH 67 467 101 HOH HOH B . 
K 7 HOH 68 468 211 HOH HOH B . 
K 7 HOH 69 469 158 HOH HOH B . 
K 7 HOH 70 470 213 HOH HOH B . 
K 7 HOH 71 471 94  HOH HOH B . 
K 7 HOH 72 472 80  HOH HOH B . 
K 7 HOH 73 473 103 HOH HOH B . 
K 7 HOH 74 474 88  HOH HOH B . 
K 7 HOH 75 475 71  HOH HOH B . 
K 7 HOH 76 476 91  HOH HOH B . 
K 7 HOH 77 477 146 HOH HOH B . 
K 7 HOH 78 478 196 HOH HOH B . 
K 7 HOH 79 479 198 HOH HOH B . 
K 7 HOH 80 480 105 HOH HOH B . 
K 7 HOH 81 481 215 HOH HOH B . 
K 7 HOH 82 482 133 HOH HOH B . 
K 7 HOH 83 483 155 HOH HOH B . 
K 7 HOH 84 484 152 HOH HOH B . 
K 7 HOH 85 485 204 HOH HOH B . 
K 7 HOH 86 486 99  HOH HOH B . 
K 7 HOH 87 487 229 HOH HOH B . 
K 7 HOH 88 488 107 HOH HOH B . 
K 7 HOH 89 489 128 HOH HOH B . 
K 7 HOH 90 490 225 HOH HOH B . 
K 7 HOH 91 491 144 HOH HOH B . 
K 7 HOH 92 492 177 HOH HOH B . 
K 7 HOH 93 493 168 HOH HOH B . 
K 7 HOH 94 494 124 HOH HOH B . 
K 7 HOH 95 495 119 HOH HOH B . 
K 7 HOH 96 496 125 HOH HOH B . 
L 7 HOH 1  101 183 HOH HOH X . 
L 7 HOH 2  102 214 HOH HOH X . 
L 7 HOH 3  103 171 HOH HOH X . 
L 7 HOH 4  104 108 HOH HOH X . 
L 7 HOH 5  105 161 HOH HOH X . 
L 7 HOH 6  106 138 HOH HOH X . 
L 7 HOH 7  107 129 HOH HOH X . 
L 7 HOH 8  108 122 HOH HOH X . 
L 7 HOH 9  109 159 HOH HOH X . 
L 7 HOH 10 110 205 HOH HOH X . 
L 7 HOH 11 111 127 HOH HOH X . 
L 7 HOH 12 112 112 HOH HOH X . 
L 7 HOH 13 113 206 HOH HOH X . 
L 7 HOH 14 114 182 HOH HOH X . 
L 7 HOH 15 115 100 HOH HOH X . 
L 7 HOH 16 116 140 HOH HOH X . 
L 7 HOH 17 117 191 HOH HOH X . 
L 7 HOH 18 118 153 HOH HOH X . 
L 7 HOH 19 119 202 HOH HOH X . 
L 7 HOH 20 120 109 HOH HOH X . 
L 7 HOH 21 121 156 HOH HOH X . 
L 7 HOH 22 122 141 HOH HOH X . 
L 7 HOH 23 123 174 HOH HOH X . 
L 7 HOH 24 124 195 HOH HOH X . 
L 7 HOH 25 125 173 HOH HOH X . 
M 7 HOH 1  201 97  HOH HOH Y . 
M 7 HOH 2  202 197 HOH HOH Y . 
M 7 HOH 3  203 157 HOH HOH Y . 
M 7 HOH 4  204 149 HOH HOH Y . 
M 7 HOH 5  205 210 HOH HOH Y . 
M 7 HOH 6  206 178 HOH HOH Y . 
M 7 HOH 7  207 212 HOH HOH Y . 
M 7 HOH 8  208 209 HOH HOH Y . 
M 7 HOH 9  209 208 HOH HOH Y . 
M 7 HOH 10 210 221 HOH HOH Y . 
M 7 HOH 11 211 216 HOH HOH Y . 
M 7 HOH 12 212 106 HOH HOH Y . 
M 7 HOH 13 213 200 HOH HOH Y . 
M 7 HOH 14 214 164 HOH HOH Y . 
M 7 HOH 15 215 201 HOH HOH Y . 
M 7 HOH 16 216 120 HOH HOH Y . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CME 88 A CME 216 ? CYS 'modified residue' 
2 B CME 88 B CME 216 ? CYS 'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4500  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  21430 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? B ALA 84 ? B ALA 212 ? 1_555 CA ? F CA . ? B CA 301 ? 1_555 OH  ? B CME 88 ? B CME 216 ? 1_555 98.4  ? 
2  O   ? B ALA 84 ? B ALA 212 ? 1_555 CA ? F CA . ? B CA 301 ? 1_555 O   ? B CME 88 ? B CME 216 ? 1_555 122.3 ? 
3  OH  ? B CME 88 ? B CME 216 ? 1_555 CA ? F CA . ? B CA 301 ? 1_555 O   ? B CME 88 ? B CME 216 ? 1_555 120.0 ? 
4  O   ? B ALA 84 ? B ALA 212 ? 1_555 CA ? F CA . ? B CA 301 ? 1_555 O   ? K HOH .  ? B HOH 433 ? 1_555 116.2 ? 
5  OH  ? B CME 88 ? B CME 216 ? 1_555 CA ? F CA . ? B CA 301 ? 1_555 O   ? K HOH .  ? B HOH 433 ? 1_555 133.2 ? 
6  O   ? B CME 88 ? B CME 216 ? 1_555 CA ? F CA . ? B CA 301 ? 1_555 O   ? K HOH .  ? B HOH 433 ? 1_555 67.4  ? 
7  OP2 ? D DG  22 ? Y DG  22  ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O   ? M HOH .  ? Y HOH 201 ? 1_555 92.8  ? 
8  OP2 ? D DG  22 ? Y DG  22  ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 OP2 ? C DG  18 ? X DG  18  ? 1_555 20.9  ? 
9  O   ? M HOH .  ? Y HOH 201 ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 OP2 ? C DG  18 ? X DG  18  ? 1_555 113.7 ? 
10 OP2 ? D DG  22 ? Y DG  22  ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O6  ? C DG  19 ? X DG  19  ? 1_555 20.3  ? 
11 O   ? M HOH .  ? Y HOH 201 ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O6  ? C DG  19 ? X DG  19  ? 1_555 112.9 ? 
12 OP2 ? C DG  18 ? X DG  18  ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O6  ? C DG  19 ? X DG  19  ? 1_555 2.2   ? 
13 OP2 ? D DG  22 ? Y DG  22  ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O   ? L HOH .  ? X HOH 120 ? 1_545 87.5  ? 
14 O   ? M HOH .  ? Y HOH 201 ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O   ? L HOH .  ? X HOH 120 ? 1_545 89.7  ? 
15 OP2 ? C DG  18 ? X DG  18  ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O   ? L HOH .  ? X HOH 120 ? 1_545 88.1  ? 
16 O6  ? C DG  19 ? X DG  19  ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O   ? L HOH .  ? X HOH 120 ? 1_545 90.2  ? 
17 OP2 ? D DG  22 ? Y DG  22  ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O   ? L HOH .  ? X HOH 112 ? 1_545 87.7  ? 
18 O   ? M HOH .  ? Y HOH 201 ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O   ? L HOH .  ? X HOH 112 ? 1_545 176.9 ? 
19 OP2 ? C DG  18 ? X DG  18  ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O   ? L HOH .  ? X HOH 112 ? 1_545 66.8  ? 
20 O6  ? C DG  19 ? X DG  19  ? 1_555 CA ? H CA . ? Y CA 101 ? 1_555 O   ? L HOH .  ? X HOH 112 ? 1_545 67.4  ? 
21 O   ? L HOH .  ? X HOH 120 ? 1_545 CA ? H CA . ? Y CA 101 ? 1_555 O   ? L HOH .  ? X HOH 112 ? 1_545 93.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-09 
2 'Structure model' 1 1 2017-09-20 
3 'Structure model' 1 2 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Derived calculations'       
3 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_audit_support    
2 2 'Structure model' pdbx_struct_oper_list 
3 3 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_pdbx_audit_support.funding_organization'  
2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3 3 'Structure model' '_pdbx_audit_support.country'               
4 3 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 21.7880 48.3400 31.6780 0.1862 ? 0.0011  ? 0.0018  ? 0.0088 ? -0.0029 ? 0.0075 ? 0.9180 ? -0.2371 
? 0.4027  ? 1.8849 ? -0.3969 ? 2.2792 ? -0.0123 ? -0.0792 ? 0.0463  ? 0.1219  ? -0.0307 ? -0.0361 ? 0.0183  ? -0.0549 ? 0.0430  ? 
2 'X-RAY DIFFRACTION' ? refined 23.1660 48.9190 0.7360  0.1580 ? 0.0045  ? -0.0211 ? 0.0082 ? -0.0026 ? 0.0167 ? 1.0703 ? 0.4904  
? -0.4291 ? 1.8618 ? -0.2025 ? 1.8798 ? -0.0025 ? 0.0864  ? -0.0617 ? -0.0737 ? 0.0051  ? -0.0706 ? -0.0197 ? -0.0346 ? -0.0026 ? 
3 'X-RAY DIFFRACTION' ? refined 44.2460 84.9630 17.1140 0.3841 ? 0.0060  ? -0.1294 ? 0.2491 ? -0.0185 ? 0.5602 ? 0.0809 ? -0.6503 
? -0.0057 ? 8.9806 ? -0.4597 ? 0.0850 ? -0.0538 ? -0.0282 ? -0.0544 ? 0.4689  ? -0.0028 ? -0.3068 ? 0.0436  ? -0.0015 ? 0.0566  ? 
4 'X-RAY DIFFRACTION' ? refined 44.4980 84.4500 12.8150 0.4540 ? -0.0017 ? -0.0288 ? 0.2859 ? 0.0170  ? 0.6613 ? 0.0199 ? 0.3129  
? -0.0261 ? 6.0394 ? -0.6568 ? 0.1022 ? 0.0320  ? -0.0036 ? -0.0179 ? -0.0944 ? -0.2204 ? -0.6366 ? 0.0568  ? 0.0351  ? 0.1883  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? A 129 ? ? A 261 ? ? 
2 'X-RAY DIFFRACTION' 2 ? ? B 129 ? ? B 260 ? ? 
3 'X-RAY DIFFRACTION' 3 ? ? X 1   ? ? X 21  ? ? 
4 'X-RAY DIFFRACTION' 4 ? ? Y 1   ? ? Y 23  ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC    ? ? ? 5.8.0129 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000  ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER    ? ? ? .        4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OD1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ASN 
_pdbx_validate_symm_contact.auth_seq_id_1     191 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    CE1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HIS 
_pdbx_validate_symm_contact.auth_seq_id_2     201 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    B 
_pdbx_validate_symm_contact.site_symmetry_2   4_546 
_pdbx_validate_symm_contact.dist              1.89 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 190 ? ? 57.29  -125.06 
2  1 THR A 217 ? ? -96.26 35.20   
3  1 SER A 219 ? ? 66.36  171.11  
4  1 ASP A 239 ? A -36.07 130.71  
5  1 ASP A 239 ? B -35.22 130.61  
6  1 SER B 180 ? A 39.30  52.99   
7  1 TYR B 190 ? ? 55.16  -124.26 
8  1 THR B 217 ? ? -95.53 37.41   
9  1 SER B 219 ? ? 65.88  172.00  
10 1 ASP B 239 ? ? -36.46 131.75  
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     X 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     DG 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      1 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     "O5'" 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    C 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    DG 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     1 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    "O5'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 262 ? A SER 134 
2 1 Y 1 B SER 261 ? B SER 133 
3 1 Y 1 B SER 262 ? B SER 134 
# 
_ndb_struct_conf_na.entry_id   5D9I 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DA 2  1_555 D DG 21 1_555 -6.678 -4.297 0.647  -20.093 2.355   3.863  1  X_DA2:DG21_Y  X 2  ? Y 21 ? 11 9 
1 C DG 3  1_555 D DC 20 1_555 -0.083 -0.103 -0.040 2.504   4.560   -1.105 2  X_DG3:DC20_Y  X 3  ? Y 20 ? 19 1 
1 C DG 4  1_555 D DC 19 1_555 -0.217 -0.229 0.133  6.789   -13.515 -3.786 3  X_DG4:DC19_Y  X 4  ? Y 19 ? 19 1 
1 C DA 5  1_555 D DT 18 1_555 0.391  -0.172 0.202  5.680   -14.258 -6.041 4  X_DA5:DT18_Y  X 5  ? Y 18 ? 20 1 
1 C DG 6  1_555 D DC 17 1_555 -0.147 -0.068 0.287  8.309   -8.505  -1.858 5  X_DG6:DC17_Y  X 6  ? Y 17 ? 19 1 
1 C DG 7  1_555 D DC 16 1_555 -0.491 0.034  0.026  1.335   -10.578 3.340  6  X_DG7:DC16_Y  X 7  ? Y 16 ? 19 1 
1 C DC 8  1_555 D DA 15 1_555 -1.376 0.327  -0.006 3.113   -14.079 -2.209 7  X_DC8:DA15_Y  X 8  ? Y 15 ? ?  ? 
1 C DT 9  1_555 D DA 14 1_555 -0.033 -0.053 0.120  0.676   -17.188 -1.286 8  X_DT9:DA14_Y  X 9  ? Y 14 ? 20 1 
1 C DT 10 1_555 D DA 13 1_555 0.121  -0.235 0.191  2.626   -15.146 0.741  9  X_DT10:DA13_Y X 10 ? Y 13 ? 20 1 
1 C DT 11 1_555 D DA 12 1_555 -0.098 -0.182 0.204  0.674   -15.333 1.506  10 X_DT11:DA12_Y X 11 ? Y 12 ? 20 1 
1 C DT 12 1_555 D DA 11 1_555 0.062  -0.245 -0.029 -3.853  -15.362 1.575  11 X_DT12:DA11_Y X 12 ? Y 11 ? 20 1 
1 C DT 13 1_555 D DA 10 1_555 -0.024 -0.199 -0.151 -4.362  -13.827 0.549  12 X_DT13:DA10_Y X 13 ? Y 10 ? 20 1 
1 C DT 14 1_555 D DG 9  1_555 2.177  -0.585 -0.150 -8.727  -7.736  -2.136 13 X_DT14:DG9_Y  X 14 ? Y 9  ? 28 1 
1 C DG 15 1_555 D DC 8  1_555 -0.109 -0.251 0.051  4.619   -1.383  -5.817 14 X_DG15:DC8_Y  X 15 ? Y 8  ? 19 1 
1 C DG 16 1_555 D DC 7  1_555 -0.247 -0.089 0.175  4.732   -8.937  -1.213 15 X_DG16:DC7_Y  X 16 ? Y 7  ? 19 1 
1 C DA 17 1_555 D DT 6  1_555 0.300  -0.021 -0.010 2.157   -15.454 4.522  16 X_DA17:DT6_Y  X 17 ? Y 6  ? 20 1 
1 C DG 18 1_555 D DC 5  1_555 -0.337 -0.073 0.063  -8.391  -10.449 -3.985 17 X_DG18:DC5_Y  X 18 ? Y 5  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DA 2  1_555 D DG 21 1_555 C DG 3  1_555 D DC 20 1_555 -0.752 1.668  2.985 1.711  8.927  58.442 1.260  0.845  3.165 9.083  
-1.741 59.083 1  XX_DA2DG3:DC20DG21_YY   X 2  ? Y 21 ? X 3  ? Y 20 ? 
1 C DG 3  1_555 D DC 20 1_555 C DG 4  1_555 D DC 19 1_555 -0.933 0.608  3.324 -2.849 4.553  32.393 0.263  1.141  3.443 8.091  
5.064  32.823 2  XX_DG3DG4:DC19DC20_YY   X 3  ? Y 20 ? X 4  ? Y 19 ? 
1 C DG 4  1_555 D DC 19 1_555 C DA 5  1_555 D DT 18 1_555 -0.389 0.101  3.279 -1.014 0.542  40.915 0.085  0.445  3.289 0.775  
1.451  40.931 3  XX_DG4DA5:DT18DC19_YY   X 4  ? Y 19 ? X 5  ? Y 18 ? 
1 C DA 5  1_555 D DT 18 1_555 C DG 6  1_555 D DC 17 1_555 1.079  0.339  3.317 1.193  -4.322 32.887 1.330  -1.686 3.283 -7.591 
-2.094 33.183 4  XX_DA5DG6:DC17DT18_YY   X 5  ? Y 18 ? X 6  ? Y 17 ? 
1 C DG 6  1_555 D DC 17 1_555 C DG 7  1_555 D DC 16 1_555 0.100  0.281  3.524 1.115  -1.842 34.183 0.789  0.018  3.506 -3.130 
-1.895 34.248 5  XX_DG6DG7:DC16DC17_YY   X 6  ? Y 17 ? X 7  ? Y 16 ? 
1 C DG 7  1_555 D DC 16 1_555 C DC 8  1_555 D DA 15 1_555 -0.893 0.057  3.139 -1.862 -1.344 34.008 0.304  1.237  3.177 -2.295 
3.180  34.083 6  XX_DG7DC8:DA15DC16_YY   X 7  ? Y 16 ? X 8  ? Y 15 ? 
1 C DC 8  1_555 D DA 15 1_555 C DT 9  1_555 D DA 14 1_555 0.336  -0.245 3.302 -0.605 -3.781 40.128 0.076  -0.557 3.305 -5.495 
0.879  40.303 7  XX_DC8DT9:DA14DA15_YY   X 8  ? Y 15 ? X 9  ? Y 14 ? 
1 C DT 9  1_555 D DA 14 1_555 C DT 10 1_555 D DA 13 1_555 0.121  -0.369 3.167 0.636  -1.702 36.198 -0.361 -0.108 3.182 -2.737 
-1.023 36.242 8  XX_DT9DT10:DA13DA14_YY  X 9  ? Y 14 ? X 10 ? Y 13 ? 
1 C DT 10 1_555 D DA 13 1_555 C DT 11 1_555 D DA 12 1_555 -0.049 -0.337 3.227 -0.376 -1.948 36.608 -0.271 0.027  3.240 -3.099 
0.599  36.660 9  XX_DT10DT11:DA12DA13_YY X 10 ? Y 13 ? X 11 ? Y 12 ? 
1 C DT 11 1_555 D DA 12 1_555 C DT 12 1_555 D DA 11 1_555 -0.027 0.036  3.261 2.064  -2.342 40.996 0.305  0.262  3.249 -3.338 
-2.941 41.109 10 XX_DT11DT12:DA11DA12_YY X 11 ? Y 12 ? X 12 ? Y 11 ? 
1 C DT 12 1_555 D DA 11 1_555 C DT 13 1_555 D DA 10 1_555 -0.132 -0.104 3.223 -0.184 -1.835 35.392 0.094  0.190  3.225 -3.015 
0.303  35.439 11 XX_DT12DT13:DA10DA11_YY X 12 ? Y 11 ? X 13 ? Y 10 ? 
1 C DT 13 1_555 D DA 10 1_555 C DT 14 1_555 D DG 9  1_555 0.461  -0.032 3.384 2.400  1.948  44.982 -0.223 -0.378 3.399 2.543  
-3.133 45.083 12 XX_DT13DT14:DG9DA10_YY  X 13 ? Y 10 ? X 14 ? Y 9  ? 
1 C DT 14 1_555 D DG 9  1_555 C DG 15 1_555 D DC 8  1_555 0.367  0.153  2.907 1.431  7.597  20.656 -2.229 -0.465 2.802 20.293 
-3.822 22.040 13 XX_DT14DG15:DC8DG9_YY   X 14 ? Y 9  ? X 15 ? Y 8  ? 
1 C DG 15 1_555 D DC 8  1_555 C DG 16 1_555 D DC 7  1_555 -0.739 0.627  3.344 -2.107 2.394  35.526 0.664  0.891  3.414 3.914  
3.444  35.664 14 XX_DG15DG16:DC7DC8_YY   X 15 ? Y 8  ? X 16 ? Y 7  ? 
1 C DG 16 1_555 D DC 7  1_555 C DA 17 1_555 D DT 6  1_555 0.559  0.186  3.466 0.416  7.239  35.454 -0.789 -0.838 3.443 11.736 
-0.674 36.165 15 XX_DG16DA17:DT6DC7_YY   X 16 ? Y 7  ? X 17 ? Y 6  ? 
1 C DA 17 1_555 D DT 6  1_555 C DG 18 1_555 D DC 5  1_555 -1.396 -0.359 3.401 -6.281 1.452  37.952 -0.739 1.283  3.563 2.213  
9.573  38.475 16 XX_DA17DG18:DC5DT6_YY   X 17 ? Y 6  ? X 18 ? Y 5  ? 
# 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.grant_number           9R01GM55397 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 1,2-ETHANEDIOL EDO 
5 'CALCIUM ION'  CA  
6 'ACETATE ION'  ACT 
7 water          HOH 
#