data_5DIS
# 
_entry.id   5DIS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DIS         
WWPDB D_1000213212 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DIS 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-01 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Monecke, T.'      1 
'Port, S.A.'       2 
'Dickmanns, A.'    3 
'Kehlenbach, R.H.' 4 
'Ficner, R.'       5 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? US ? ? primary 'Cell Rep'        ? ?    2211-1247 ? ? 13 ? 690 702 
;Structural and Functional Characterization of CRM1-Nup214 Interactions Reveals Multiple FG-Binding Sites Involved in Nuclear Export.
;
2015 ? 10.1016/j.celrep.2015.09.042 26489467 ? 
? ? ? ? ? ? ? ?  ? ? 1       'To Be Published' ? 0353 ?         ? ? ?  ? ?   ?   
;Combining dehydration, construct optimization and improved data collection to solve the crystal structure of a CRM1-RanGTP-SPN1-Nup214 quaternary export complex
;
?    ? ?                            ?        ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Port, S.A.'       1  ? 
primary 'Monecke, T.'      2  ? 
primary 'Dickmanns, A.'    3  ? 
primary 'Spillner, C.'     4  ? 
primary 'Hofele, R.'       5  ? 
primary 'Urlaub, H.'       6  ? 
primary 'Ficner, R.'       7  ? 
primary 'Kehlenbach, R.H.' 8  ? 
1       'Monecke, T.'      9  ? 
1       'Dickmanns, A.'    10 ? 
1       'Weiss, M.S.'      11 ? 
1       'Port, S.A.'       12 ? 
1       'Kehlenbach, R.H.' 13 ? 
1       'Ficner, R.'       14 ? 
# 
_cell.entry_id           5DIS 
_cell.length_a           112.330 
_cell.length_b           248.970 
_cell.length_c           210.570 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5DIS 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Exportin-1                                                                120395.742 1  ? ?    
'UNP residues 5-1058' ? 
2 polymer     man 'GTP-binding nuclear protein Ran'                                         19812.088  1  ? Q69L 
'UNP residues 8-179'  ? 
3 polymer     man Snurportin-1                                                              33276.527  1  ? ?    ? ? 
4 polymer     man 'Maltose-binding periplasmic protein,Nuclear pore complex protein Nup214' 50577.461  1  ? ?    ? ? 
5 branched    man 'alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose'                       342.297    1  ? ?    ? ? 
6 non-polymer syn PROLINE                                                                   115.130    2  ? ?    ? ? 
7 non-polymer syn "GUANOSINE-5'-TRIPHOSPHATE"                                               523.180    1  ? ?    ? ? 
8 non-polymer syn 'MAGNESIUM ION'                                                           24.305     1  ? ?    ? ? 
9 water       nat water                                                                     18.015     12 ? ?    ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Exp1,Chromosome region maintenance 1 protein homolog'                                                
2 'Androgen receptor-associated protein 24,GTPase Ran,Ras-like protein TC4,Ras-related nuclear protein' 
3 'RNA U transporter 1'                                                                                 
4 'MBP,MMBP,Maltodextrin-binding protein,214 kDa nucleoporin,Nucleoporin Nup214,Protein CAN'            
5 alpha-maltose                                                                                         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILE
NVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLC
QNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFET
KLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSL
FLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPP
RRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQV
NGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKT
VVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQ
TDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCL
SENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTM
AIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKH
TMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNP
GNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQ
ADEE
;
;MTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILE
NVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLC
QNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFET
KLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSL
FLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPP
RRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQV
NGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKT
VVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQ
TDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCL
SENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTM
AIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKH
TMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNP
GNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQ
ADEE
;
A ? 
2 'polypeptide(L)' no no 
;QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAI
IMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARK
LIGDPNLEFVAM
;
;QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAI
IMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARK
LIGDPNLEFVAM
;
B ? 
3 'polypeptide(L)' no no 
;GSMEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTGMESEEE
NKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPG
GNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCT
PESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLG
;
;GSMEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTGMESEEE
NKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPG
GNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCT
PESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLG
;
C ? 
4 'polypeptide(L)' no no 
;KLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAF
QDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADG
GYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVT
VLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQ
KGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFSNTSNLFGNSGAKTFGGFASSSFGEQKPTGTFS
SGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPGFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFG
;
;KLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAF
QDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADG
GYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVT
VLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQ
KGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFSNTSNLFGNSGAKTFGGFASSSFGEQKPTGTFS
SGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPGFGGVPAFGSAPAFTSPLGSTGGKVFGEGTAAASAGGFGFG
;
D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    THR n 
1 3    MET n 
1 4    LEU n 
1 5    ALA n 
1 6    ASP n 
1 7    HIS n 
1 8    ALA n 
1 9    ALA n 
1 10   ARG n 
1 11   GLN n 
1 12   LEU n 
1 13   LEU n 
1 14   ASP n 
1 15   PHE n 
1 16   SER n 
1 17   GLN n 
1 18   LYS n 
1 19   LEU n 
1 20   ASP n 
1 21   ILE n 
1 22   ASN n 
1 23   LEU n 
1 24   LEU n 
1 25   ASP n 
1 26   ASN n 
1 27   VAL n 
1 28   VAL n 
1 29   ASN n 
1 30   CYS n 
1 31   LEU n 
1 32   TYR n 
1 33   HIS n 
1 34   GLY n 
1 35   GLU n 
1 36   GLY n 
1 37   ALA n 
1 38   GLN n 
1 39   GLN n 
1 40   ARG n 
1 41   MET n 
1 42   ALA n 
1 43   GLN n 
1 44   GLU n 
1 45   VAL n 
1 46   LEU n 
1 47   THR n 
1 48   HIS n 
1 49   LEU n 
1 50   LYS n 
1 51   GLU n 
1 52   HIS n 
1 53   PRO n 
1 54   ASP n 
1 55   ALA n 
1 56   TRP n 
1 57   THR n 
1 58   ARG n 
1 59   VAL n 
1 60   ASP n 
1 61   THR n 
1 62   ILE n 
1 63   LEU n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   GLN n 
1 68   ASN n 
1 69   MET n 
1 70   ASN n 
1 71   THR n 
1 72   LYS n 
1 73   TYR n 
1 74   TYR n 
1 75   GLY n 
1 76   LEU n 
1 77   GLN n 
1 78   ILE n 
1 79   LEU n 
1 80   GLU n 
1 81   ASN n 
1 82   VAL n 
1 83   ILE n 
1 84   LYS n 
1 85   THR n 
1 86   ARG n 
1 87   TRP n 
1 88   LYS n 
1 89   ILE n 
1 90   LEU n 
1 91   PRO n 
1 92   ARG n 
1 93   ASN n 
1 94   GLN n 
1 95   CYS n 
1 96   GLU n 
1 97   GLY n 
1 98   ILE n 
1 99   LYS n 
1 100  LYS n 
1 101  TYR n 
1 102  VAL n 
1 103  VAL n 
1 104  GLY n 
1 105  LEU n 
1 106  ILE n 
1 107  ILE n 
1 108  LYS n 
1 109  THR n 
1 110  SER n 
1 111  SER n 
1 112  ASP n 
1 113  PRO n 
1 114  THR n 
1 115  CYS n 
1 116  VAL n 
1 117  GLU n 
1 118  LYS n 
1 119  GLU n 
1 120  LYS n 
1 121  VAL n 
1 122  TYR n 
1 123  ILE n 
1 124  GLY n 
1 125  LYS n 
1 126  LEU n 
1 127  ASN n 
1 128  MET n 
1 129  ILE n 
1 130  LEU n 
1 131  VAL n 
1 132  GLN n 
1 133  ILE n 
1 134  LEU n 
1 135  LYS n 
1 136  GLN n 
1 137  GLU n 
1 138  TRP n 
1 139  PRO n 
1 140  LYS n 
1 141  HIS n 
1 142  TRP n 
1 143  PRO n 
1 144  THR n 
1 145  PHE n 
1 146  ILE n 
1 147  SER n 
1 148  ASP n 
1 149  ILE n 
1 150  VAL n 
1 151  GLY n 
1 152  ALA n 
1 153  SER n 
1 154  ARG n 
1 155  THR n 
1 156  SER n 
1 157  GLU n 
1 158  SER n 
1 159  LEU n 
1 160  CYS n 
1 161  GLN n 
1 162  ASN n 
1 163  ASN n 
1 164  MET n 
1 165  VAL n 
1 166  ILE n 
1 167  LEU n 
1 168  LYS n 
1 169  LEU n 
1 170  LEU n 
1 171  SER n 
1 172  GLU n 
1 173  GLU n 
1 174  VAL n 
1 175  PHE n 
1 176  ASP n 
1 177  PHE n 
1 178  SER n 
1 179  SER n 
1 180  GLY n 
1 181  GLN n 
1 182  ILE n 
1 183  THR n 
1 184  GLN n 
1 185  VAL n 
1 186  LYS n 
1 187  SER n 
1 188  LYS n 
1 189  HIS n 
1 190  LEU n 
1 191  LYS n 
1 192  ASP n 
1 193  SER n 
1 194  MET n 
1 195  CYS n 
1 196  ASN n 
1 197  GLU n 
1 198  PHE n 
1 199  SER n 
1 200  GLN n 
1 201  ILE n 
1 202  PHE n 
1 203  GLN n 
1 204  LEU n 
1 205  CYS n 
1 206  GLN n 
1 207  PHE n 
1 208  VAL n 
1 209  MET n 
1 210  GLU n 
1 211  ASN n 
1 212  SER n 
1 213  GLN n 
1 214  ASN n 
1 215  ALA n 
1 216  PRO n 
1 217  LEU n 
1 218  VAL n 
1 219  HIS n 
1 220  ALA n 
1 221  THR n 
1 222  LEU n 
1 223  GLU n 
1 224  THR n 
1 225  LEU n 
1 226  LEU n 
1 227  ARG n 
1 228  PHE n 
1 229  LEU n 
1 230  ASN n 
1 231  TRP n 
1 232  ILE n 
1 233  PRO n 
1 234  LEU n 
1 235  GLY n 
1 236  TYR n 
1 237  ILE n 
1 238  PHE n 
1 239  GLU n 
1 240  THR n 
1 241  LYS n 
1 242  LEU n 
1 243  ILE n 
1 244  SER n 
1 245  THR n 
1 246  LEU n 
1 247  ILE n 
1 248  TYR n 
1 249  LYS n 
1 250  PHE n 
1 251  LEU n 
1 252  ASN n 
1 253  VAL n 
1 254  PRO n 
1 255  MET n 
1 256  PHE n 
1 257  ARG n 
1 258  ASN n 
1 259  VAL n 
1 260  SER n 
1 261  LEU n 
1 262  LYS n 
1 263  CYS n 
1 264  LEU n 
1 265  THR n 
1 266  GLU n 
1 267  ILE n 
1 268  ALA n 
1 269  GLY n 
1 270  VAL n 
1 271  SER n 
1 272  VAL n 
1 273  SER n 
1 274  GLN n 
1 275  TYR n 
1 276  GLU n 
1 277  GLU n 
1 278  GLN n 
1 279  PHE n 
1 280  VAL n 
1 281  THR n 
1 282  LEU n 
1 283  PHE n 
1 284  THR n 
1 285  LEU n 
1 286  THR n 
1 287  MET n 
1 288  MET n 
1 289  GLN n 
1 290  LEU n 
1 291  LYS n 
1 292  GLN n 
1 293  MET n 
1 294  LEU n 
1 295  PRO n 
1 296  LEU n 
1 297  ASN n 
1 298  THR n 
1 299  ASN n 
1 300  ILE n 
1 301  ARG n 
1 302  LEU n 
1 303  ALA n 
1 304  TYR n 
1 305  SER n 
1 306  ASN n 
1 307  GLY n 
1 308  LYS n 
1 309  ASP n 
1 310  ASP n 
1 311  GLU n 
1 312  GLN n 
1 313  ASN n 
1 314  PHE n 
1 315  ILE n 
1 316  GLN n 
1 317  ASN n 
1 318  LEU n 
1 319  SER n 
1 320  LEU n 
1 321  PHE n 
1 322  LEU n 
1 323  CYS n 
1 324  THR n 
1 325  PHE n 
1 326  LEU n 
1 327  LYS n 
1 328  GLU n 
1 329  HIS n 
1 330  ASP n 
1 331  GLN n 
1 332  LEU n 
1 333  ILE n 
1 334  GLU n 
1 335  LYS n 
1 336  ARG n 
1 337  LEU n 
1 338  ASN n 
1 339  LEU n 
1 340  ARG n 
1 341  GLU n 
1 342  THR n 
1 343  LEU n 
1 344  MET n 
1 345  GLU n 
1 346  ALA n 
1 347  LEU n 
1 348  HIS n 
1 349  TYR n 
1 350  MET n 
1 351  LEU n 
1 352  LEU n 
1 353  VAL n 
1 354  SER n 
1 355  GLU n 
1 356  VAL n 
1 357  GLU n 
1 358  GLU n 
1 359  THR n 
1 360  GLU n 
1 361  ILE n 
1 362  PHE n 
1 363  LYS n 
1 364  ILE n 
1 365  CYS n 
1 366  LEU n 
1 367  GLU n 
1 368  TYR n 
1 369  TRP n 
1 370  ASN n 
1 371  HIS n 
1 372  LEU n 
1 373  ALA n 
1 374  ALA n 
1 375  GLU n 
1 376  LEU n 
1 377  TYR n 
1 378  ARG n 
1 379  GLU n 
1 380  SER n 
1 381  PRO n 
1 382  PHE n 
1 383  SER n 
1 384  THR n 
1 385  SER n 
1 386  ALA n 
1 387  SER n 
1 388  PRO n 
1 389  LEU n 
1 390  LEU n 
1 391  SER n 
1 392  GLY n 
1 393  SER n 
1 394  GLN n 
1 395  HIS n 
1 396  PHE n 
1 397  ASP n 
1 398  VAL n 
1 399  PRO n 
1 400  PRO n 
1 401  ARG n 
1 402  ARG n 
1 403  GLN n 
1 404  LEU n 
1 405  TYR n 
1 406  LEU n 
1 407  PRO n 
1 408  MET n 
1 409  LEU n 
1 410  PHE n 
1 411  LYS n 
1 412  VAL n 
1 413  ARG n 
1 414  LEU n 
1 415  LEU n 
1 416  MET n 
1 417  VAL n 
1 418  SER n 
1 419  ARG n 
1 420  MET n 
1 421  ALA n 
1 422  LYS n 
1 423  PRO n 
1 424  GLU n 
1 425  GLU n 
1 426  VAL n 
1 427  LEU n 
1 428  VAL n 
1 429  VAL n 
1 430  GLU n 
1 431  ASN n 
1 432  ASP n 
1 433  GLN n 
1 434  GLY n 
1 435  GLU n 
1 436  VAL n 
1 437  VAL n 
1 438  ARG n 
1 439  GLU n 
1 440  PHE n 
1 441  MET n 
1 442  LYS n 
1 443  ASP n 
1 444  THR n 
1 445  ASP n 
1 446  SER n 
1 447  ILE n 
1 448  ASN n 
1 449  LEU n 
1 450  TYR n 
1 451  LYS n 
1 452  ASN n 
1 453  MET n 
1 454  ARG n 
1 455  GLU n 
1 456  THR n 
1 457  LEU n 
1 458  VAL n 
1 459  TYR n 
1 460  LEU n 
1 461  THR n 
1 462  HIS n 
1 463  LEU n 
1 464  ASP n 
1 465  TYR n 
1 466  VAL n 
1 467  ASP n 
1 468  THR n 
1 469  GLU n 
1 470  ARG n 
1 471  ILE n 
1 472  MET n 
1 473  THR n 
1 474  GLU n 
1 475  LYS n 
1 476  LEU n 
1 477  HIS n 
1 478  ASN n 
1 479  GLN n 
1 480  VAL n 
1 481  ASN n 
1 482  GLY n 
1 483  THR n 
1 484  GLU n 
1 485  TRP n 
1 486  SER n 
1 487  TRP n 
1 488  LYS n 
1 489  ASN n 
1 490  LEU n 
1 491  ASN n 
1 492  THR n 
1 493  LEU n 
1 494  CYS n 
1 495  TRP n 
1 496  ALA n 
1 497  ILE n 
1 498  GLY n 
1 499  SER n 
1 500  ILE n 
1 501  SER n 
1 502  GLY n 
1 503  ALA n 
1 504  MET n 
1 505  HIS n 
1 506  GLU n 
1 507  GLU n 
1 508  ASP n 
1 509  GLU n 
1 510  LYS n 
1 511  ARG n 
1 512  PHE n 
1 513  LEU n 
1 514  VAL n 
1 515  THR n 
1 516  VAL n 
1 517  ILE n 
1 518  LYS n 
1 519  ASP n 
1 520  LEU n 
1 521  LEU n 
1 522  GLY n 
1 523  LEU n 
1 524  CYS n 
1 525  GLU n 
1 526  GLN n 
1 527  LYS n 
1 528  ARG n 
1 529  GLY n 
1 530  LYS n 
1 531  ASP n 
1 532  ASN n 
1 533  LYS n 
1 534  ALA n 
1 535  ILE n 
1 536  ILE n 
1 537  ALA n 
1 538  SER n 
1 539  ASN n 
1 540  ILE n 
1 541  MET n 
1 542  TYR n 
1 543  ILE n 
1 544  VAL n 
1 545  GLY n 
1 546  GLN n 
1 547  TYR n 
1 548  PRO n 
1 549  ARG n 
1 550  PHE n 
1 551  LEU n 
1 552  ARG n 
1 553  ALA n 
1 554  HIS n 
1 555  TRP n 
1 556  LYS n 
1 557  PHE n 
1 558  LEU n 
1 559  LYS n 
1 560  THR n 
1 561  VAL n 
1 562  VAL n 
1 563  ASN n 
1 564  LYS n 
1 565  LEU n 
1 566  PHE n 
1 567  GLU n 
1 568  PHE n 
1 569  MET n 
1 570  HIS n 
1 571  GLU n 
1 572  THR n 
1 573  HIS n 
1 574  ASP n 
1 575  GLY n 
1 576  VAL n 
1 577  GLN n 
1 578  ASP n 
1 579  MET n 
1 580  ALA n 
1 581  CYS n 
1 582  ASP n 
1 583  THR n 
1 584  PHE n 
1 585  ILE n 
1 586  LYS n 
1 587  ILE n 
1 588  ALA n 
1 589  GLN n 
1 590  LYS n 
1 591  CYS n 
1 592  ARG n 
1 593  ARG n 
1 594  HIS n 
1 595  PHE n 
1 596  VAL n 
1 597  GLN n 
1 598  VAL n 
1 599  GLN n 
1 600  VAL n 
1 601  GLY n 
1 602  GLU n 
1 603  VAL n 
1 604  MET n 
1 605  PRO n 
1 606  PHE n 
1 607  ILE n 
1 608  ASP n 
1 609  GLU n 
1 610  ILE n 
1 611  LEU n 
1 612  ASN n 
1 613  ASN n 
1 614  ILE n 
1 615  ASN n 
1 616  THR n 
1 617  ILE n 
1 618  ILE n 
1 619  CYS n 
1 620  ASP n 
1 621  LEU n 
1 622  GLN n 
1 623  PRO n 
1 624  GLN n 
1 625  GLN n 
1 626  VAL n 
1 627  HIS n 
1 628  THR n 
1 629  PHE n 
1 630  TYR n 
1 631  GLU n 
1 632  ALA n 
1 633  VAL n 
1 634  GLY n 
1 635  TYR n 
1 636  MET n 
1 637  ILE n 
1 638  GLY n 
1 639  ALA n 
1 640  GLN n 
1 641  THR n 
1 642  ASP n 
1 643  GLN n 
1 644  THR n 
1 645  VAL n 
1 646  GLN n 
1 647  GLU n 
1 648  HIS n 
1 649  LEU n 
1 650  ILE n 
1 651  GLU n 
1 652  LYS n 
1 653  TYR n 
1 654  MET n 
1 655  LEU n 
1 656  LEU n 
1 657  PRO n 
1 658  ASN n 
1 659  GLN n 
1 660  VAL n 
1 661  TRP n 
1 662  ASP n 
1 663  SER n 
1 664  ILE n 
1 665  ILE n 
1 666  GLN n 
1 667  GLN n 
1 668  ALA n 
1 669  THR n 
1 670  LYS n 
1 671  ASN n 
1 672  VAL n 
1 673  ASP n 
1 674  ILE n 
1 675  LEU n 
1 676  LYS n 
1 677  ASP n 
1 678  PRO n 
1 679  GLU n 
1 680  THR n 
1 681  VAL n 
1 682  LYS n 
1 683  GLN n 
1 684  LEU n 
1 685  GLY n 
1 686  SER n 
1 687  ILE n 
1 688  LEU n 
1 689  LYS n 
1 690  THR n 
1 691  ASN n 
1 692  VAL n 
1 693  ARG n 
1 694  ALA n 
1 695  CYS n 
1 696  LYS n 
1 697  ALA n 
1 698  VAL n 
1 699  GLY n 
1 700  HIS n 
1 701  PRO n 
1 702  PHE n 
1 703  VAL n 
1 704  ILE n 
1 705  GLN n 
1 706  LEU n 
1 707  GLY n 
1 708  ARG n 
1 709  ILE n 
1 710  TYR n 
1 711  LEU n 
1 712  ASP n 
1 713  MET n 
1 714  LEU n 
1 715  ASN n 
1 716  VAL n 
1 717  TYR n 
1 718  LYS n 
1 719  CYS n 
1 720  LEU n 
1 721  SER n 
1 722  GLU n 
1 723  ASN n 
1 724  ILE n 
1 725  SER n 
1 726  ALA n 
1 727  ALA n 
1 728  ILE n 
1 729  GLN n 
1 730  ALA n 
1 731  ASN n 
1 732  GLY n 
1 733  GLU n 
1 734  MET n 
1 735  VAL n 
1 736  THR n 
1 737  LYS n 
1 738  GLN n 
1 739  PRO n 
1 740  LEU n 
1 741  ILE n 
1 742  ARG n 
1 743  SER n 
1 744  MET n 
1 745  ARG n 
1 746  THR n 
1 747  VAL n 
1 748  LYS n 
1 749  ARG n 
1 750  GLU n 
1 751  THR n 
1 752  LEU n 
1 753  LYS n 
1 754  LEU n 
1 755  ILE n 
1 756  SER n 
1 757  GLY n 
1 758  TRP n 
1 759  VAL n 
1 760  SER n 
1 761  ARG n 
1 762  SER n 
1 763  ASN n 
1 764  ASP n 
1 765  PRO n 
1 766  GLN n 
1 767  MET n 
1 768  VAL n 
1 769  ALA n 
1 770  GLU n 
1 771  ASN n 
1 772  PHE n 
1 773  VAL n 
1 774  PRO n 
1 775  PRO n 
1 776  LEU n 
1 777  LEU n 
1 778  ASP n 
1 779  ALA n 
1 780  VAL n 
1 781  LEU n 
1 782  ILE n 
1 783  ASP n 
1 784  TYR n 
1 785  GLN n 
1 786  ARG n 
1 787  ASN n 
1 788  VAL n 
1 789  PRO n 
1 790  ALA n 
1 791  ALA n 
1 792  ARG n 
1 793  GLU n 
1 794  PRO n 
1 795  GLU n 
1 796  VAL n 
1 797  LEU n 
1 798  SER n 
1 799  THR n 
1 800  MET n 
1 801  ALA n 
1 802  ILE n 
1 803  ILE n 
1 804  VAL n 
1 805  ASN n 
1 806  LYS n 
1 807  LEU n 
1 808  GLY n 
1 809  GLY n 
1 810  HIS n 
1 811  ILE n 
1 812  THR n 
1 813  ALA n 
1 814  GLU n 
1 815  ILE n 
1 816  PRO n 
1 817  GLN n 
1 818  ILE n 
1 819  PHE n 
1 820  ASP n 
1 821  ALA n 
1 822  VAL n 
1 823  PHE n 
1 824  GLU n 
1 825  CYS n 
1 826  THR n 
1 827  LEU n 
1 828  ASN n 
1 829  MET n 
1 830  ILE n 
1 831  ASN n 
1 832  LYS n 
1 833  ASP n 
1 834  PHE n 
1 835  GLU n 
1 836  GLU n 
1 837  TYR n 
1 838  PRO n 
1 839  GLU n 
1 840  HIS n 
1 841  ARG n 
1 842  THR n 
1 843  ASN n 
1 844  PHE n 
1 845  PHE n 
1 846  LEU n 
1 847  LEU n 
1 848  LEU n 
1 849  GLN n 
1 850  ALA n 
1 851  VAL n 
1 852  ASN n 
1 853  SER n 
1 854  HIS n 
1 855  CYS n 
1 856  PHE n 
1 857  PRO n 
1 858  ALA n 
1 859  PHE n 
1 860  LEU n 
1 861  ALA n 
1 862  ILE n 
1 863  PRO n 
1 864  PRO n 
1 865  THR n 
1 866  GLN n 
1 867  PHE n 
1 868  LYS n 
1 869  LEU n 
1 870  VAL n 
1 871  LEU n 
1 872  ASP n 
1 873  SER n 
1 874  ILE n 
1 875  ILE n 
1 876  TRP n 
1 877  ALA n 
1 878  PHE n 
1 879  LYS n 
1 880  HIS n 
1 881  THR n 
1 882  MET n 
1 883  ARG n 
1 884  ASN n 
1 885  VAL n 
1 886  ALA n 
1 887  ASP n 
1 888  THR n 
1 889  GLY n 
1 890  LEU n 
1 891  GLN n 
1 892  ILE n 
1 893  LEU n 
1 894  PHE n 
1 895  THR n 
1 896  LEU n 
1 897  LEU n 
1 898  GLN n 
1 899  ASN n 
1 900  VAL n 
1 901  ALA n 
1 902  GLN n 
1 903  GLU n 
1 904  GLU n 
1 905  ALA n 
1 906  ALA n 
1 907  ALA n 
1 908  GLN n 
1 909  SER n 
1 910  PHE n 
1 911  TYR n 
1 912  GLN n 
1 913  THR n 
1 914  TYR n 
1 915  PHE n 
1 916  CYS n 
1 917  ASP n 
1 918  ILE n 
1 919  LEU n 
1 920  GLN n 
1 921  HIS n 
1 922  ILE n 
1 923  PHE n 
1 924  SER n 
1 925  VAL n 
1 926  VAL n 
1 927  THR n 
1 928  ASP n 
1 929  THR n 
1 930  SER n 
1 931  HIS n 
1 932  THR n 
1 933  ALA n 
1 934  GLY n 
1 935  LEU n 
1 936  THR n 
1 937  MET n 
1 938  HIS n 
1 939  ALA n 
1 940  SER n 
1 941  ILE n 
1 942  LEU n 
1 943  ALA n 
1 944  TYR n 
1 945  MET n 
1 946  PHE n 
1 947  ASN n 
1 948  LEU n 
1 949  VAL n 
1 950  GLU n 
1 951  GLU n 
1 952  GLY n 
1 953  LYS n 
1 954  ILE n 
1 955  SER n 
1 956  THR n 
1 957  SER n 
1 958  LEU n 
1 959  ASN n 
1 960  PRO n 
1 961  GLY n 
1 962  ASN n 
1 963  PRO n 
1 964  VAL n 
1 965  ASN n 
1 966  ASN n 
1 967  GLN n 
1 968  ILE n 
1 969  PHE n 
1 970  LEU n 
1 971  GLN n 
1 972  GLU n 
1 973  TYR n 
1 974  VAL n 
1 975  ALA n 
1 976  ASN n 
1 977  LEU n 
1 978  LEU n 
1 979  LYS n 
1 980  SER n 
1 981  ALA n 
1 982  PHE n 
1 983  PRO n 
1 984  HIS n 
1 985  LEU n 
1 986  GLN n 
1 987  ASP n 
1 988  ALA n 
1 989  GLN n 
1 990  VAL n 
1 991  LYS n 
1 992  LEU n 
1 993  PHE n 
1 994  VAL n 
1 995  THR n 
1 996  GLY n 
1 997  LEU n 
1 998  PHE n 
1 999  SER n 
1 1000 LEU n 
1 1001 ASN n 
1 1002 GLN n 
1 1003 ASP n 
1 1004 ILE n 
1 1005 PRO n 
1 1006 ALA n 
1 1007 PHE n 
1 1008 LYS n 
1 1009 GLU n 
1 1010 HIS n 
1 1011 LEU n 
1 1012 ARG n 
1 1013 ASP n 
1 1014 PHE n 
1 1015 LEU n 
1 1016 VAL n 
1 1017 GLN n 
1 1018 ILE n 
1 1019 LYS n 
1 1020 GLU n 
1 1021 PHE n 
1 1022 ALA n 
1 1023 GLY n 
1 1024 GLU n 
1 1025 ASP n 
1 1026 THR n 
1 1027 SER n 
1 1028 ASP n 
1 1029 LEU n 
1 1030 PHE n 
1 1031 LEU n 
1 1032 GLU n 
1 1033 GLU n 
1 1034 ARG n 
1 1035 GLU n 
1 1036 ILE n 
1 1037 ALA n 
1 1038 LEU n 
1 1039 ARG n 
1 1040 GLN n 
1 1041 ALA n 
1 1042 ASP n 
1 1043 GLU n 
1 1044 GLU n 
2 1    GLN n 
2 2    VAL n 
2 3    GLN n 
2 4    PHE n 
2 5    LYS n 
2 6    LEU n 
2 7    VAL n 
2 8    LEU n 
2 9    VAL n 
2 10   GLY n 
2 11   ASP n 
2 12   GLY n 
2 13   GLY n 
2 14   THR n 
2 15   GLY n 
2 16   LYS n 
2 17   THR n 
2 18   THR n 
2 19   PHE n 
2 20   VAL n 
2 21   LYS n 
2 22   ARG n 
2 23   HIS n 
2 24   LEU n 
2 25   THR n 
2 26   GLY n 
2 27   GLU n 
2 28   PHE n 
2 29   GLU n 
2 30   LYS n 
2 31   LYS n 
2 32   TYR n 
2 33   VAL n 
2 34   ALA n 
2 35   THR n 
2 36   LEU n 
2 37   GLY n 
2 38   VAL n 
2 39   GLU n 
2 40   VAL n 
2 41   HIS n 
2 42   PRO n 
2 43   LEU n 
2 44   VAL n 
2 45   PHE n 
2 46   HIS n 
2 47   THR n 
2 48   ASN n 
2 49   ARG n 
2 50   GLY n 
2 51   PRO n 
2 52   ILE n 
2 53   LYS n 
2 54   PHE n 
2 55   ASN n 
2 56   VAL n 
2 57   TRP n 
2 58   ASP n 
2 59   THR n 
2 60   ALA n 
2 61   GLY n 
2 62   LEU n 
2 63   GLU n 
2 64   LYS n 
2 65   PHE n 
2 66   GLY n 
2 67   GLY n 
2 68   LEU n 
2 69   ARG n 
2 70   ASP n 
2 71   GLY n 
2 72   TYR n 
2 73   TYR n 
2 74   ILE n 
2 75   GLN n 
2 76   ALA n 
2 77   GLN n 
2 78   CYS n 
2 79   ALA n 
2 80   ILE n 
2 81   ILE n 
2 82   MET n 
2 83   PHE n 
2 84   ASP n 
2 85   VAL n 
2 86   THR n 
2 87   SER n 
2 88   ARG n 
2 89   VAL n 
2 90   THR n 
2 91   TYR n 
2 92   LYS n 
2 93   ASN n 
2 94   VAL n 
2 95   PRO n 
2 96   ASN n 
2 97   TRP n 
2 98   HIS n 
2 99   ARG n 
2 100  ASP n 
2 101  LEU n 
2 102  VAL n 
2 103  ARG n 
2 104  VAL n 
2 105  CYS n 
2 106  GLU n 
2 107  ASN n 
2 108  ILE n 
2 109  PRO n 
2 110  ILE n 
2 111  VAL n 
2 112  LEU n 
2 113  CYS n 
2 114  GLY n 
2 115  ASN n 
2 116  LYS n 
2 117  VAL n 
2 118  ASP n 
2 119  ILE n 
2 120  LYS n 
2 121  ASP n 
2 122  ARG n 
2 123  LYS n 
2 124  VAL n 
2 125  LYS n 
2 126  ALA n 
2 127  LYS n 
2 128  SER n 
2 129  ILE n 
2 130  VAL n 
2 131  PHE n 
2 132  HIS n 
2 133  ARG n 
2 134  LYS n 
2 135  LYS n 
2 136  ASN n 
2 137  LEU n 
2 138  GLN n 
2 139  TYR n 
2 140  TYR n 
2 141  ASP n 
2 142  ILE n 
2 143  SER n 
2 144  ALA n 
2 145  LYS n 
2 146  SER n 
2 147  ASN n 
2 148  TYR n 
2 149  ASN n 
2 150  PHE n 
2 151  GLU n 
2 152  LYS n 
2 153  PRO n 
2 154  PHE n 
2 155  LEU n 
2 156  TRP n 
2 157  LEU n 
2 158  ALA n 
2 159  ARG n 
2 160  LYS n 
2 161  LEU n 
2 162  ILE n 
2 163  GLY n 
2 164  ASP n 
2 165  PRO n 
2 166  ASN n 
2 167  LEU n 
2 168  GLU n 
2 169  PHE n 
2 170  VAL n 
2 171  ALA n 
2 172  MET n 
3 1    GLY n 
3 2    SER n 
3 3    MET n 
3 4    GLU n 
3 5    GLU n 
3 6    LEU n 
3 7    SER n 
3 8    GLN n 
3 9    ALA n 
3 10   LEU n 
3 11   ALA n 
3 12   SER n 
3 13   SER n 
3 14   PHE n 
3 15   SER n 
3 16   VAL n 
3 17   SER n 
3 18   GLN n 
3 19   ASP n 
3 20   LEU n 
3 21   ASN n 
3 22   SER n 
3 23   THR n 
3 24   ALA n 
3 25   ALA n 
3 26   PRO n 
3 27   HIS n 
3 28   PRO n 
3 29   ARG n 
3 30   LEU n 
3 31   SER n 
3 32   GLN n 
3 33   TYR n 
3 34   LYS n 
3 35   SER n 
3 36   LYS n 
3 37   TYR n 
3 38   SER n 
3 39   SER n 
3 40   LEU n 
3 41   GLU n 
3 42   GLN n 
3 43   SER n 
3 44   GLU n 
3 45   ARG n 
3 46   ARG n 
3 47   ARG n 
3 48   ARG n 
3 49   LEU n 
3 50   LEU n 
3 51   GLU n 
3 52   LEU n 
3 53   GLN n 
3 54   LYS n 
3 55   SER n 
3 56   LYS n 
3 57   ARG n 
3 58   LEU n 
3 59   ASP n 
3 60   TYR n 
3 61   VAL n 
3 62   ASN n 
3 63   HIS n 
3 64   ALA n 
3 65   ARG n 
3 66   ARG n 
3 67   LEU n 
3 68   ALA n 
3 69   GLU n 
3 70   ASP n 
3 71   ASP n 
3 72   TRP n 
3 73   THR n 
3 74   GLY n 
3 75   MET n 
3 76   GLU n 
3 77   SER n 
3 78   GLU n 
3 79   GLU n 
3 80   GLU n 
3 81   ASN n 
3 82   LYS n 
3 83   LYS n 
3 84   ASP n 
3 85   ASP n 
3 86   GLU n 
3 87   GLU n 
3 88   MET n 
3 89   ASP n 
3 90   ILE n 
3 91   ASP n 
3 92   THR n 
3 93   VAL n 
3 94   LYS n 
3 95   LYS n 
3 96   LEU n 
3 97   PRO n 
3 98   LYS n 
3 99   HIS n 
3 100  TYR n 
3 101  ALA n 
3 102  ASN n 
3 103  GLN n 
3 104  LEU n 
3 105  MET n 
3 106  LEU n 
3 107  SER n 
3 108  GLU n 
3 109  TRP n 
3 110  LEU n 
3 111  ILE n 
3 112  ASP n 
3 113  VAL n 
3 114  PRO n 
3 115  SER n 
3 116  ASP n 
3 117  LEU n 
3 118  GLY n 
3 119  GLN n 
3 120  GLU n 
3 121  TRP n 
3 122  ILE n 
3 123  VAL n 
3 124  VAL n 
3 125  VAL n 
3 126  CYS n 
3 127  PRO n 
3 128  VAL n 
3 129  GLY n 
3 130  LYS n 
3 131  ARG n 
3 132  ALA n 
3 133  LEU n 
3 134  ILE n 
3 135  VAL n 
3 136  ALA n 
3 137  SER n 
3 138  ARG n 
3 139  GLY n 
3 140  SER n 
3 141  THR n 
3 142  SER n 
3 143  ALA n 
3 144  TYR n 
3 145  THR n 
3 146  LYS n 
3 147  SER n 
3 148  GLY n 
3 149  TYR n 
3 150  CYS n 
3 151  VAL n 
3 152  ASN n 
3 153  ARG n 
3 154  PHE n 
3 155  SER n 
3 156  SER n 
3 157  LEU n 
3 158  LEU n 
3 159  PRO n 
3 160  GLY n 
3 161  GLY n 
3 162  ASN n 
3 163  ARG n 
3 164  ARG n 
3 165  ASN n 
3 166  SER n 
3 167  THR n 
3 168  ALA n 
3 169  LYS n 
3 170  ASP n 
3 171  TYR n 
3 172  THR n 
3 173  ILE n 
3 174  LEU n 
3 175  ASP n 
3 176  CYS n 
3 177  ILE n 
3 178  TYR n 
3 179  ASN n 
3 180  GLU n 
3 181  VAL n 
3 182  ASN n 
3 183  GLN n 
3 184  THR n 
3 185  TYR n 
3 186  TYR n 
3 187  VAL n 
3 188  LEU n 
3 189  ASP n 
3 190  VAL n 
3 191  MET n 
3 192  CYS n 
3 193  TRP n 
3 194  ARG n 
3 195  GLY n 
3 196  HIS n 
3 197  PRO n 
3 198  PHE n 
3 199  TYR n 
3 200  ASP n 
3 201  CYS n 
3 202  GLN n 
3 203  THR n 
3 204  ASP n 
3 205  PHE n 
3 206  ARG n 
3 207  PHE n 
3 208  TYR n 
3 209  TRP n 
3 210  MET n 
3 211  HIS n 
3 212  SER n 
3 213  LYS n 
3 214  LEU n 
3 215  PRO n 
3 216  GLU n 
3 217  GLU n 
3 218  GLU n 
3 219  GLY n 
3 220  LEU n 
3 221  GLY n 
3 222  GLU n 
3 223  LYS n 
3 224  THR n 
3 225  LYS n 
3 226  LEU n 
3 227  ASN n 
3 228  PRO n 
3 229  PHE n 
3 230  LYS n 
3 231  PHE n 
3 232  VAL n 
3 233  GLY n 
3 234  LEU n 
3 235  LYS n 
3 236  ASN n 
3 237  PHE n 
3 238  PRO n 
3 239  CYS n 
3 240  THR n 
3 241  PRO n 
3 242  GLU n 
3 243  SER n 
3 244  LEU n 
3 245  CYS n 
3 246  ASP n 
3 247  VAL n 
3 248  LEU n 
3 249  SER n 
3 250  MET n 
3 251  ASP n 
3 252  PHE n 
3 253  PRO n 
3 254  PHE n 
3 255  GLU n 
3 256  VAL n 
3 257  ASP n 
3 258  GLY n 
3 259  LEU n 
3 260  LEU n 
3 261  PHE n 
3 262  TYR n 
3 263  HIS n 
3 264  LYS n 
3 265  GLN n 
3 266  THR n 
3 267  HIS n 
3 268  TYR n 
3 269  SER n 
3 270  PRO n 
3 271  GLY n 
3 272  SER n 
3 273  THR n 
3 274  PRO n 
3 275  LEU n 
3 276  VAL n 
3 277  GLY n 
3 278  TRP n 
3 279  LEU n 
3 280  ARG n 
3 281  PRO n 
3 282  TYR n 
3 283  MET n 
3 284  VAL n 
3 285  SER n 
3 286  ASP n 
3 287  VAL n 
3 288  LEU n 
3 289  GLY n 
4 1    LYS n 
4 2    LEU n 
4 3    VAL n 
4 4    ILE n 
4 5    TRP n 
4 6    ILE n 
4 7    ASN n 
4 8    GLY n 
4 9    ASP n 
4 10   LYS n 
4 11   GLY n 
4 12   TYR n 
4 13   ASN n 
4 14   GLY n 
4 15   LEU n 
4 16   ALA n 
4 17   GLU n 
4 18   VAL n 
4 19   GLY n 
4 20   LYS n 
4 21   LYS n 
4 22   PHE n 
4 23   GLU n 
4 24   LYS n 
4 25   ASP n 
4 26   THR n 
4 27   GLY n 
4 28   ILE n 
4 29   LYS n 
4 30   VAL n 
4 31   THR n 
4 32   VAL n 
4 33   GLU n 
4 34   HIS n 
4 35   PRO n 
4 36   ASP n 
4 37   LYS n 
4 38   LEU n 
4 39   GLU n 
4 40   GLU n 
4 41   LYS n 
4 42   PHE n 
4 43   PRO n 
4 44   GLN n 
4 45   VAL n 
4 46   ALA n 
4 47   ALA n 
4 48   THR n 
4 49   GLY n 
4 50   ASP n 
4 51   GLY n 
4 52   PRO n 
4 53   ASP n 
4 54   ILE n 
4 55   ILE n 
4 56   PHE n 
4 57   TRP n 
4 58   ALA n 
4 59   HIS n 
4 60   ASP n 
4 61   ARG n 
4 62   PHE n 
4 63   GLY n 
4 64   GLY n 
4 65   TYR n 
4 66   ALA n 
4 67   GLN n 
4 68   SER n 
4 69   GLY n 
4 70   LEU n 
4 71   LEU n 
4 72   ALA n 
4 73   GLU n 
4 74   ILE n 
4 75   THR n 
4 76   PRO n 
4 77   ASP n 
4 78   LYS n 
4 79   ALA n 
4 80   PHE n 
4 81   GLN n 
4 82   ASP n 
4 83   LYS n 
4 84   LEU n 
4 85   TYR n 
4 86   PRO n 
4 87   PHE n 
4 88   THR n 
4 89   TRP n 
4 90   ASP n 
4 91   ALA n 
4 92   VAL n 
4 93   ARG n 
4 94   TYR n 
4 95   ASN n 
4 96   GLY n 
4 97   LYS n 
4 98   LEU n 
4 99   ILE n 
4 100  ALA n 
4 101  TYR n 
4 102  PRO n 
4 103  ILE n 
4 104  ALA n 
4 105  VAL n 
4 106  GLU n 
4 107  ALA n 
4 108  LEU n 
4 109  SER n 
4 110  LEU n 
4 111  ILE n 
4 112  TYR n 
4 113  ASN n 
4 114  LYS n 
4 115  ASP n 
4 116  LEU n 
4 117  LEU n 
4 118  PRO n 
4 119  ASN n 
4 120  PRO n 
4 121  PRO n 
4 122  LYS n 
4 123  THR n 
4 124  TRP n 
4 125  GLU n 
4 126  GLU n 
4 127  ILE n 
4 128  PRO n 
4 129  ALA n 
4 130  LEU n 
4 131  ASP n 
4 132  LYS n 
4 133  GLU n 
4 134  LEU n 
4 135  LYS n 
4 136  ALA n 
4 137  LYS n 
4 138  GLY n 
4 139  LYS n 
4 140  SER n 
4 141  ALA n 
4 142  LEU n 
4 143  MET n 
4 144  PHE n 
4 145  ASN n 
4 146  LEU n 
4 147  GLN n 
4 148  GLU n 
4 149  PRO n 
4 150  TYR n 
4 151  PHE n 
4 152  THR n 
4 153  TRP n 
4 154  PRO n 
4 155  LEU n 
4 156  ILE n 
4 157  ALA n 
4 158  ALA n 
4 159  ASP n 
4 160  GLY n 
4 161  GLY n 
4 162  TYR n 
4 163  ALA n 
4 164  PHE n 
4 165  LYS n 
4 166  TYR n 
4 167  GLU n 
4 168  ASN n 
4 169  GLY n 
4 170  LYS n 
4 171  TYR n 
4 172  ASP n 
4 173  ILE n 
4 174  LYS n 
4 175  ASP n 
4 176  VAL n 
4 177  GLY n 
4 178  VAL n 
4 179  ASP n 
4 180  ASN n 
4 181  ALA n 
4 182  GLY n 
4 183  ALA n 
4 184  LYS n 
4 185  ALA n 
4 186  GLY n 
4 187  LEU n 
4 188  THR n 
4 189  PHE n 
4 190  LEU n 
4 191  VAL n 
4 192  ASP n 
4 193  LEU n 
4 194  ILE n 
4 195  LYS n 
4 196  ASN n 
4 197  LYS n 
4 198  HIS n 
4 199  MET n 
4 200  ASN n 
4 201  ALA n 
4 202  ASP n 
4 203  THR n 
4 204  ASP n 
4 205  TYR n 
4 206  SER n 
4 207  ILE n 
4 208  ALA n 
4 209  GLU n 
4 210  ALA n 
4 211  ALA n 
4 212  PHE n 
4 213  ASN n 
4 214  LYS n 
4 215  GLY n 
4 216  GLU n 
4 217  THR n 
4 218  ALA n 
4 219  MET n 
4 220  THR n 
4 221  ILE n 
4 222  ASN n 
4 223  GLY n 
4 224  PRO n 
4 225  TRP n 
4 226  ALA n 
4 227  TRP n 
4 228  SER n 
4 229  ASN n 
4 230  ILE n 
4 231  ASP n 
4 232  THR n 
4 233  SER n 
4 234  LYS n 
4 235  VAL n 
4 236  ASN n 
4 237  TYR n 
4 238  GLY n 
4 239  VAL n 
4 240  THR n 
4 241  VAL n 
4 242  LEU n 
4 243  PRO n 
4 244  THR n 
4 245  PHE n 
4 246  LYS n 
4 247  GLY n 
4 248  GLN n 
4 249  PRO n 
4 250  SER n 
4 251  LYS n 
4 252  PRO n 
4 253  PHE n 
4 254  VAL n 
4 255  GLY n 
4 256  VAL n 
4 257  LEU n 
4 258  SER n 
4 259  ALA n 
4 260  GLY n 
4 261  ILE n 
4 262  ASN n 
4 263  ALA n 
4 264  ALA n 
4 265  SER n 
4 266  PRO n 
4 267  ASN n 
4 268  LYS n 
4 269  GLU n 
4 270  LEU n 
4 271  ALA n 
4 272  LYS n 
4 273  GLU n 
4 274  PHE n 
4 275  LEU n 
4 276  GLU n 
4 277  ASN n 
4 278  TYR n 
4 279  LEU n 
4 280  LEU n 
4 281  THR n 
4 282  ASP n 
4 283  GLU n 
4 284  GLY n 
4 285  LEU n 
4 286  GLU n 
4 287  ALA n 
4 288  VAL n 
4 289  ASN n 
4 290  LYS n 
4 291  ASP n 
4 292  LYS n 
4 293  PRO n 
4 294  LEU n 
4 295  GLY n 
4 296  ALA n 
4 297  VAL n 
4 298  ALA n 
4 299  LEU n 
4 300  LYS n 
4 301  SER n 
4 302  TYR n 
4 303  GLU n 
4 304  GLU n 
4 305  GLU n 
4 306  LEU n 
4 307  ALA n 
4 308  LYS n 
4 309  ASP n 
4 310  PRO n 
4 311  ARG n 
4 312  ILE n 
4 313  ALA n 
4 314  ALA n 
4 315  THR n 
4 316  MET n 
4 317  GLU n 
4 318  ASN n 
4 319  ALA n 
4 320  GLN n 
4 321  LYS n 
4 322  GLY n 
4 323  GLU n 
4 324  ILE n 
4 325  MET n 
4 326  PRO n 
4 327  ASN n 
4 328  ILE n 
4 329  PRO n 
4 330  GLN n 
4 331  MET n 
4 332  SER n 
4 333  ALA n 
4 334  PHE n 
4 335  TRP n 
4 336  TYR n 
4 337  ALA n 
4 338  VAL n 
4 339  ARG n 
4 340  THR n 
4 341  ALA n 
4 342  VAL n 
4 343  ILE n 
4 344  ASN n 
4 345  ALA n 
4 346  ALA n 
4 347  SER n 
4 348  GLY n 
4 349  ARG n 
4 350  GLN n 
4 351  THR n 
4 352  VAL n 
4 353  ASP n 
4 354  GLU n 
4 355  ALA n 
4 356  LEU n 
4 357  ALA n 
4 358  ALA n 
4 359  ALA n 
4 360  GLN n 
4 361  THR n 
4 362  ASN n 
4 363  ALA n 
4 364  ALA n 
4 365  ALA n 
4 366  GLU n 
4 367  PHE n 
4 368  SER n 
4 369  ASN n 
4 370  THR n 
4 371  SER n 
4 372  ASN n 
4 373  LEU n 
4 374  PHE n 
4 375  GLY n 
4 376  ASN n 
4 377  SER n 
4 378  GLY n 
4 379  ALA n 
4 380  LYS n 
4 381  THR n 
4 382  PHE n 
4 383  GLY n 
4 384  GLY n 
4 385  PHE n 
4 386  ALA n 
4 387  SER n 
4 388  SER n 
4 389  SER n 
4 390  PHE n 
4 391  GLY n 
4 392  GLU n 
4 393  GLN n 
4 394  LYS n 
4 395  PRO n 
4 396  THR n 
4 397  GLY n 
4 398  THR n 
4 399  PHE n 
4 400  SER n 
4 401  SER n 
4 402  GLY n 
4 403  GLY n 
4 404  GLY n 
4 405  SER n 
4 406  VAL n 
4 407  ALA n 
4 408  SER n 
4 409  GLN n 
4 410  GLY n 
4 411  PHE n 
4 412  GLY n 
4 413  PHE n 
4 414  SER n 
4 415  SER n 
4 416  PRO n 
4 417  ASN n 
4 418  LYS n 
4 419  THR n 
4 420  GLY n 
4 421  GLY n 
4 422  PHE n 
4 423  GLY n 
4 424  ALA n 
4 425  ALA n 
4 426  PRO n 
4 427  VAL n 
4 428  PHE n 
4 429  GLY n 
4 430  SER n 
4 431  PRO n 
4 432  PRO n 
4 433  THR n 
4 434  PHE n 
4 435  GLY n 
4 436  GLY n 
4 437  SER n 
4 438  PRO n 
4 439  GLY n 
4 440  PHE n 
4 441  GLY n 
4 442  GLY n 
4 443  VAL n 
4 444  PRO n 
4 445  ALA n 
4 446  PHE n 
4 447  GLY n 
4 448  SER n 
4 449  ALA n 
4 450  PRO n 
4 451  ALA n 
4 452  PHE n 
4 453  THR n 
4 454  SER n 
4 455  PRO n 
4 456  LEU n 
4 457  GLY n 
4 458  SER n 
4 459  THR n 
4 460  GLY n 
4 461  GLY n 
4 462  LYS n 
4 463  VAL n 
4 464  PHE n 
4 465  GLY n 
4 466  GLU n 
4 467  GLY n 
4 468  THR n 
4 469  ALA n 
4 470  ALA n 
4 471  ALA n 
4 472  SER n 
4 473  ALA n 
4 474  GLY n 
4 475  GLY n 
4 476  PHE n 
4 477  GLY n 
4 478  PHE n 
4 479  GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   1044 Human ? 'XPO1, CRM1'                  ? ? ? ? ? ? 'Homo sapiens'                  9606  
? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   172  Human ? 'RAN, ARA24, OK/SW-cl.81'     ? ? ? ? ? ? 'Homo sapiens'                  9606  
? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1   289  Human ? 'SNUPN, RNUT1, SPN1'          ? ? ? ? ? ? 'Homo sapiens'                  9606  
? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1   356  ?     ? 'malE, b4034, JW3994'         ? ? ? ? ? ? 'Escherichia coli (strain K12)' 83333 
? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 2 sample 'Biological sequence' 357 479  Human ? 'NUP214, CAIN, CAN, KIAA0023' ? ? ? ? ? ? 'Homo sapiens'                  9606  
? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP XPO1_HUMAN  O14980 ? 1 
;MTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILE
NVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLC
QNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFET
KLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSL
FLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPP
RRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQV
NGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKT
VVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQ
TDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCL
SENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTM
AIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKH
TMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNP
GNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQ
ADEE
;
5    
2 UNP RAN_HUMAN   P62826 ? 2 
;QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAI
IMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARK
LIGDPNLEFVAM
;
8    
3 UNP SPN1_HUMAN  O95149 ? 3 
;MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTGMESEEENK
KDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGN
RRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPE
SLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLG
;
1    
4 UNP MALE_ECOLI  P0AEX9 ? 4 
;KLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAF
QDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADG
GYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVT
VLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQ
KGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEAL
;
32   
5 UNP NU214_HUMAN P35658 ? 4 
;SNTSNLFGNSGAKTFGGFASSSFGEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPGFGGVPAFG
SAPAFTSPLGSTGGKVFGEGTAAASAGGFGFG
;
1916 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5DIS A 1   ? 1044 ? O14980 5    ? 1048 ? 5    1048 
2 2 5DIS B 1   ? 172  ? P62826 8    ? 179  ? 8    179  
3 3 5DIS C 3   ? 289  ? O95149 1    ? 287  ? 1    287  
4 4 5DIS D 1   ? 356  ? P0AEX9 32   ? 387  ? 6    361  
5 5 5DIS D 368 ? 479  ? P35658 1916 ? 2027 ? 1916 2027 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 5DIS LEU B 62  ? UNP P62826 GLN 69 'engineered mutation' 69   1  
3 5DIS GLY C 1   ? UNP O95149 ?   ?  linker                -1   2  
3 5DIS SER C 2   ? UNP O95149 ?   ?  linker                0    3  
4 5DIS ALA D 357 ? UNP P0AEX9 ?   ?  linker                362  4  
4 5DIS ALA D 358 ? UNP P0AEX9 ?   ?  linker                363  5  
4 5DIS ALA D 359 ? UNP P0AEX9 ?   ?  linker                364  6  
4 5DIS GLN D 360 ? UNP P0AEX9 ?   ?  linker                365  7  
4 5DIS THR D 361 ? UNP P0AEX9 ?   ?  linker                366  8  
4 5DIS ASN D 362 ? UNP P0AEX9 ?   ?  linker                367  9  
4 5DIS ALA D 363 ? UNP P0AEX9 ?   ?  linker                368  10 
4 5DIS ALA D 364 ? UNP P0AEX9 ?   ?  linker                1912 11 
4 5DIS ALA D 365 ? UNP P0AEX9 ?   ?  linker                1913 12 
4 5DIS GLU D 366 ? UNP P0AEX9 ?   ?  linker                1914 13 
4 5DIS PHE D 367 ? UNP P0AEX9 ?   ?  linker                1915 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking'           y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking'           y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking'           y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose       ? 'C6 H12 O6'         180.156 
GLN 'L-peptide linking'           y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'             y GLYCINE                     ? 'C2 H5 N O2'        75.067  
GTP non-polymer                   n "GUANOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking'           y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer                   . WATER                       ? 'H2 O'              18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking'           y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking'           y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking'           y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer                   . 'MAGNESIUM ION'             ? 'Mg 2'              24.305  
PHE 'L-peptide linking'           y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking'           y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking'           y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking'           y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking'           y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking'           y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DIS 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.29 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         62.56 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '5% PEG 8000, 0.2M L-proline, 0.1M Tris pH 7.5, 4 mM D-maltose, 180 mM LiCl' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-11-28 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si111-DCM with sagital bender' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9184 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9184 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_synchrotron_site       BESSY 
# 
_reflns.B_iso_Wilson_estimate            80.010 
_reflns.entry_id                         5DIS 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.850 
_reflns.d_resolution_low                 48.49 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       67922 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             98.200 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     0.999 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.6 
_reflns.pdbx_Rmerge_I_obs                0.055 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.520 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.037 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.062 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         313050 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.850  2.950  ? 2.010  ? 25297 6721  ? 6140  91.400 ? ? 0.873 ? 0.571 ? ? ? ? ? ? ? ? 4.1 ? ? ? ? 0.644 ? 0 1  1 ? ? 
2.950  3.050  ? 2.710  ? 23638 5864  ? 5596  95.400 ? ? 0.917 ? 0.465 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.528 ? 0 2  1 ? ? 
3.050  3.250  ? 4.430  ? 47205 9684  ? 9653  99.700 ? ? 0.964 ? 0.307 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.344 ? 0 3  1 ? ? 
3.250  3.830  ? 9.840  ? 85369 18001 ? 17925 99.600 ? ? 0.993 ? 0.127 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.143 ? 0 4  1 ? ? 
3.830  4.120  ? 18.320 ? 26990 5599  ? 5571  99.500 ? ? 0.997 ? 0.063 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.071 ? 0 5  1 ? ? 
4.120  4.410  ? 22.890 ? 20152 4232  ? 4206  99.400 ? ? 0.998 ? 0.050 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.056 ? 0 6  1 ? ? 
4.410  4.700  ? 26.550 ? 14986 3258  ? 3234  99.300 ? ? 0.998 ? 0.042 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.047 ? 0 7  1 ? ? 
4.700  14.000 ? 33.050 ? 67145 15115 ? 14980 99.100 ? ? 0.999 ? 0.030 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.034 ? 0 8  1 ? ? 
14.000 17.000 ? 47.270 ? 1069  277   ? 269   97.100 ? ? 0.999 ? 0.023 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.026 ? 0 9  1 ? ? 
17.000 50.000 ? 44.390 ? 1199  368   ? 348   94.600 ? ? 0.999 ? 0.021 ? ? ? ? ? ? ? ? ?   ? ? ? ? 0.025 ? 0 10 1 ? ? 
50.000 ?      ? ?      ? ?     21    ? ?     ?      ? ? ?     ? ?     ? ? ? ? ? ? ? ? ?   ? ? ? ? ?     ? 0 11 1 ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5DIS 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     67814 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.485 
_refine.ls_d_res_high                            2.850 
_refine.ls_percent_reflns_obs                    98.16 
_refine.ls_R_factor_obs                          0.2078 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2056 
_refine.ls_R_factor_R_free                       0.2493 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  3392 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.00 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;Overall, the electron density map for MBP and especially its N-terminal lobe is of poor quality. This suggests that significant movement of MBP in the crystal lattice is possible, which is consistent with the overall elevated B-factors of the MBP residues. Hence, several parts of MBP are not defined in the electron density map. Since dissolved crystals analysed by SDS-PAGE clearly showed the presence of full-length MBP in order to retain structural integrity of the crystal lattice and the MBP, the residues were not omitted.
;
_refine.pdbx_starting_model                      '3GJX, 1ANF' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.42 
_refine.pdbx_overall_phase_error                 32.17 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14907 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             12 
_refine_hist.number_atoms_total               14991 
_refine_hist.d_res_high                       2.850 
_refine_hist.d_res_low                        48.485 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 15303 'X-RAY DIFFRACTION' ? 
f_angle_d          0.925  ? ? 20716 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.263 ? ? 5641  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.037  ? ? 2311  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 2634  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.8500 2.8907  2444 0.4069 91.00  0.4669 . . 130 . . . . 
'X-RAY DIFFRACTION' . 2.8907 2.9338  2459 0.3674 92.00  0.4294 . . 130 . . . . 
'X-RAY DIFFRACTION' . 2.9338 2.9797  2466 0.3379 91.00  0.4136 . . 130 . . . . 
'X-RAY DIFFRACTION' . 2.9797 3.0285  2630 0.3167 96.00  0.4205 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.0285 3.0807  2670 0.3096 100.00 0.3539 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.0807 3.1367  2723 0.2909 100.00 0.3243 . . 143 . . . . 
'X-RAY DIFFRACTION' . 3.1367 3.1971  2681 0.2840 100.00 0.3435 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.1971 3.2623  2704 0.2752 99.00  0.3818 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.2623 3.3332  2691 0.2605 100.00 0.3214 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.3332 3.4107  2729 0.2419 100.00 0.3200 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.4107 3.4960  2700 0.2317 100.00 0.2988 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.4960 3.5905  2679 0.2259 99.00  0.2965 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.5905 3.6961  2701 0.2192 99.00  0.2579 . . 143 . . . . 
'X-RAY DIFFRACTION' . 3.6961 3.8154  2705 0.2137 100.00 0.2726 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.8154 3.9517  2703 0.2028 100.00 0.2481 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.9517 4.1098  2738 0.1819 99.00  0.2117 . . 145 . . . . 
'X-RAY DIFFRACTION' . 4.1098 4.2968  2704 0.1752 99.00  0.2055 . . 142 . . . . 
'X-RAY DIFFRACTION' . 4.2968 4.5231  2725 0.1643 100.00 0.2196 . . 144 . . . . 
'X-RAY DIFFRACTION' . 4.5231 4.8063  2700 0.1659 99.00  0.2208 . . 142 . . . . 
'X-RAY DIFFRACTION' . 4.8063 5.1770  2721 0.1762 99.00  0.2084 . . 143 . . . . 
'X-RAY DIFFRACTION' . 5.1770 5.6973  2776 0.1919 100.00 0.2107 . . 146 . . . . 
'X-RAY DIFFRACTION' . 5.6973 6.5200  2756 0.2183 100.00 0.2515 . . 146 . . . . 
'X-RAY DIFFRACTION' . 6.5200 8.2080  2759 0.2025 99.00  0.2415 . . 145 . . . . 
'X-RAY DIFFRACTION' . 8.2080 48.4924 2858 0.1656 98.00  0.1941 . . 151 . . . . 
# 
_struct.entry_id                     5DIS 
_struct.title                        
'Crystal structure of a CRM1-RanGTP-SPN1 export complex bound to a 113 amino acid FG-repeat containing fragment of Nup214' 
_struct.pdbx_descriptor              
'Exportin-1, GTP-binding nuclear protein Ran, Snurportin-1, Maltose-binding periplasmic protein,Nuclear pore complex protein Nup214' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DIS 
_struct_keywords.text            'FG-repeats, Nucleoporin, Nup214, Exportin, transport protein' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 8 ? 
I N N 6 ? 
J N N 9 ? 
K N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 MET A 1    ? LEU A 13   ? MET A 5    LEU A 17   1 ? 13 
HELX_P HELX_P2  AA2 ASP A 20   ? GLY A 34   ? ASP A 24   GLY A 38   1 ? 15 
HELX_P HELX_P3  AA3 GLU A 35   ? HIS A 52   ? GLU A 39   HIS A 56   1 ? 18 
HELX_P HELX_P4  AA4 ALA A 55   ? SER A 66   ? ALA A 59   SER A 70   1 ? 12 
HELX_P HELX_P5  AA5 ASN A 68   ? TRP A 87   ? ASN A 72   TRP A 91   1 ? 20 
HELX_P HELX_P6  AA6 LYS A 88   ? LEU A 90   ? LYS A 92   LEU A 94   5 ? 3  
HELX_P HELX_P7  AA7 PRO A 91   ? SER A 111  ? PRO A 95   SER A 115  1 ? 21 
HELX_P HELX_P8  AA8 ASP A 112  ? VAL A 116  ? ASP A 116  VAL A 120  5 ? 5  
HELX_P HELX_P9  AA9 GLU A 119  ? TRP A 138  ? GLU A 123  TRP A 142  1 ? 20 
HELX_P HELX_P10 AB1 THR A 144  ? SER A 153  ? THR A 148  SER A 157  1 ? 10 
HELX_P HELX_P11 AB2 SER A 156  ? ASP A 176  ? SER A 160  ASP A 180  1 ? 21 
HELX_P HELX_P12 AB3 THR A 183  ? GLU A 197  ? THR A 187  GLU A 201  1 ? 15 
HELX_P HELX_P13 AB4 GLU A 197  ? SER A 212  ? GLU A 201  SER A 216  1 ? 16 
HELX_P HELX_P14 AB5 ASN A 214  ? ILE A 232  ? ASN A 218  ILE A 236  1 ? 19 
HELX_P HELX_P15 AB6 LEU A 234  ? GLU A 239  ? LEU A 238  GLU A 243  1 ? 6  
HELX_P HELX_P16 AB7 LYS A 241  ? PHE A 250  ? LYS A 245  PHE A 254  1 ? 10 
HELX_P HELX_P17 AB8 VAL A 253  ? VAL A 270  ? VAL A 257  VAL A 274  1 ? 18 
HELX_P HELX_P18 AB9 VAL A 272  ? GLN A 274  ? VAL A 276  GLN A 278  5 ? 3  
HELX_P HELX_P19 AC1 TYR A 275  ? LEU A 294  ? TYR A 279  LEU A 298  1 ? 20 
HELX_P HELX_P20 AC2 ASN A 299  ? GLY A 307  ? ASN A 303  GLY A 311  1 ? 9  
HELX_P HELX_P21 AC3 LYS A 308  ? LYS A 335  ? LYS A 312  LYS A 339  1 ? 28 
HELX_P HELX_P22 AC4 ARG A 336  ? ASN A 338  ? ARG A 340  ASN A 342  5 ? 3  
HELX_P HELX_P23 AC5 LEU A 339  ? GLU A 355  ? LEU A 343  GLU A 359  1 ? 17 
HELX_P HELX_P24 AC6 GLU A 358  ? SER A 380  ? GLU A 362  SER A 384  1 ? 23 
HELX_P HELX_P25 AC7 PRO A 399  ? MET A 420  ? PRO A 403  MET A 424  1 ? 22 
HELX_P HELX_P26 AC8 THR A 444  ? ASP A 464  ? THR A 448  ASP A 468  1 ? 21 
HELX_P HELX_P27 AC9 ASP A 464  ? ASN A 481  ? ASP A 468  ASN A 485  1 ? 18 
HELX_P HELX_P28 AD1 SER A 486  ? ILE A 500  ? SER A 490  ILE A 504  1 ? 15 
HELX_P HELX_P29 AD2 HIS A 505  ? LYS A 527  ? HIS A 509  LYS A 531  1 ? 23 
HELX_P HELX_P30 AD3 GLY A 529  ? GLN A 546  ? GLY A 533  GLN A 550  1 ? 18 
HELX_P HELX_P31 AD4 TYR A 547  ? HIS A 554  ? TYR A 551  HIS A 558  1 ? 8  
HELX_P HELX_P32 AD5 HIS A 554  ? MET A 569  ? HIS A 558  MET A 573  1 ? 16 
HELX_P HELX_P33 AD6 GLY A 575  ? CYS A 591  ? GLY A 579  CYS A 595  1 ? 17 
HELX_P HELX_P34 AD7 ARG A 592  ? GLN A 597  ? ARG A 596  GLN A 601  1 ? 6  
HELX_P HELX_P35 AD8 PRO A 605  ? ASN A 613  ? PRO A 609  ASN A 617  1 ? 9  
HELX_P HELX_P36 AD9 ASN A 613  ? CYS A 619  ? ASN A 617  CYS A 623  1 ? 7  
HELX_P HELX_P37 AE1 GLN A 622  ? ALA A 639  ? GLN A 626  ALA A 643  1 ? 18 
HELX_P HELX_P38 AE2 ASP A 642  ? MET A 654  ? ASP A 646  MET A 658  1 ? 13 
HELX_P HELX_P39 AE3 MET A 654  ? ASN A 671  ? MET A 658  ASN A 675  1 ? 18 
HELX_P HELX_P40 AE4 VAL A 672  ? LYS A 676  ? VAL A 676  LYS A 680  5 ? 5  
HELX_P HELX_P41 AE5 ASP A 677  ? GLY A 699  ? ASP A 681  GLY A 703  1 ? 23 
HELX_P HELX_P42 AE6 PHE A 702  ? GLY A 732  ? PHE A 706  GLY A 736  1 ? 31 
HELX_P HELX_P43 AE7 GLU A 733  ? LYS A 737  ? GLU A 737  LYS A 741  5 ? 5  
HELX_P HELX_P44 AE8 GLN A 738  ? ARG A 761  ? GLN A 742  ARG A 765  1 ? 24 
HELX_P HELX_P45 AE9 ASP A 764  ? PHE A 772  ? ASP A 768  PHE A 776  1 ? 9  
HELX_P HELX_P46 AF1 PHE A 772  ? VAL A 780  ? PHE A 776  VAL A 784  1 ? 9  
HELX_P HELX_P47 AF2 VAL A 780  ? ASN A 787  ? VAL A 784  ASN A 791  1 ? 8  
HELX_P HELX_P48 AF3 VAL A 788  ? GLU A 793  ? VAL A 792  GLU A 797  5 ? 6  
HELX_P HELX_P49 AF4 PRO A 794  ? GLY A 808  ? PRO A 798  GLY A 812  1 ? 15 
HELX_P HELX_P50 AF5 GLY A 809  ? ALA A 813  ? GLY A 813  ALA A 817  5 ? 5  
HELX_P HELX_P51 AF6 GLU A 814  ? ASN A 828  ? GLU A 818  ASN A 832  1 ? 15 
HELX_P HELX_P52 AF7 TYR A 837  ? CYS A 855  ? TYR A 841  CYS A 859  1 ? 19 
HELX_P HELX_P53 AF8 PHE A 856  ? ALA A 861  ? PHE A 860  ALA A 865  1 ? 6  
HELX_P HELX_P54 AF9 PRO A 863  ? LYS A 879  ? PRO A 867  LYS A 883  1 ? 17 
HELX_P HELX_P55 AG1 MET A 882  ? GLU A 903  ? MET A 886  GLU A 907  1 ? 22 
HELX_P HELX_P56 AG2 GLU A 903  ? THR A 927  ? GLU A 907  THR A 931  1 ? 25 
HELX_P HELX_P57 AG3 ASP A 928  ? ALA A 933  ? ASP A 932  ALA A 937  5 ? 6  
HELX_P HELX_P58 AG4 GLY A 934  ? GLY A 952  ? GLY A 938  GLY A 956  1 ? 19 
HELX_P HELX_P59 AG5 ASN A 965  ? PHE A 982  ? ASN A 969  PHE A 986  1 ? 18 
HELX_P HELX_P60 AG6 GLN A 986  ? LEU A 1000 ? GLN A 990  LEU A 1004 1 ? 15 
HELX_P HELX_P61 AG7 ASP A 1003 ? ILE A 1018 ? ASP A 1007 ILE A 1022 1 ? 16 
HELX_P HELX_P62 AG8 PHE A 1030 ? GLU A 1044 ? PHE A 1034 GLU A 1048 1 ? 15 
HELX_P HELX_P63 AG9 GLY B 15   ? THR B 25   ? GLY B 22   THR B 32   1 ? 11 
HELX_P HELX_P64 AH1 LEU B 62   ? GLY B 66   ? LEU B 69   GLY B 73   5 ? 5  
HELX_P HELX_P65 AH2 LEU B 68   ? ILE B 74   ? LEU B 75   ILE B 81   5 ? 7  
HELX_P HELX_P66 AH3 SER B 87   ? ASN B 93   ? SER B 94   ASN B 100  1 ? 7  
HELX_P HELX_P67 AH4 ASN B 93   ? CYS B 105  ? ASN B 100  CYS B 112  1 ? 13 
HELX_P HELX_P68 AH5 LYS B 125  ? ILE B 129  ? LYS B 132  ILE B 136  5 ? 5  
HELX_P HELX_P69 AH6 VAL B 130  ? ASN B 136  ? VAL B 137  ASN B 143  1 ? 7  
HELX_P HELX_P70 AH7 GLU B 151  ? GLY B 163  ? GLU B 158  GLY B 170  1 ? 13 
HELX_P HELX_P71 AH8 SER C 2    ? SER C 13   ? SER C 0    SER C 11   1 ? 12 
HELX_P HELX_P72 AH9 GLU C 41   ? LYS C 54   ? GLU C 39   LYS C 52   1 ? 14 
HELX_P HELX_P73 AI1 ASP C 59   ? ASP C 70   ? ASP C 57   ASP C 68   1 ? 12 
HELX_P HELX_P74 AI2 ASP C 116  ? GLU C 120  ? ASP C 114  GLU C 118  1 ? 5  
HELX_P HELX_P75 AI3 GLN C 202  ? LEU C 214  ? GLN C 200  LEU C 212  1 ? 13 
HELX_P HELX_P76 AI4 PRO C 215  ? GLU C 222  ? PRO C 213  GLU C 220  5 ? 8  
HELX_P HELX_P77 AI5 THR C 240  ? MET C 250  ? THR C 238  MET C 248  1 ? 11 
HELX_P HELX_P78 AI6 ARG C 280  ? VAL C 287  ? ARG C 278  VAL C 285  5 ? 8  
HELX_P HELX_P79 AI7 ASN D 13   ? GLY D 27   ? ASN D 18   GLY D 32   1 ? 15 
HELX_P HELX_P80 AI8 LYS D 37   ? ALA D 46   ? LYS D 42   ALA D 51   1 ? 10 
HELX_P HELX_P81 AI9 ALA D 47   ? GLY D 49   ? ALA D 52   GLY D 54   5 ? 3  
HELX_P HELX_P82 AJ1 ARG D 61   ? GLY D 69   ? ARG D 66   GLY D 74   1 ? 9  
HELX_P HELX_P83 AJ2 TYR D 85   ? VAL D 92   ? TYR D 90   VAL D 97   1 ? 8  
HELX_P HELX_P84 AJ3 ILE D 127  ? ALA D 129  ? ILE D 132  ALA D 134  5 ? 3  
HELX_P HELX_P85 AJ4 LEU D 130  ? LYS D 137  ? LEU D 135  LYS D 142  1 ? 8  
HELX_P HELX_P86 AJ5 GLU D 148  ? TRP D 153  ? GLU D 153  TRP D 158  1 ? 6  
HELX_P HELX_P87 AJ6 LEU D 155  ? GLY D 160  ? LEU D 160  GLY D 165  1 ? 6  
HELX_P HELX_P88 AJ7 ALA D 183  ? ASN D 196  ? ALA D 188  ASN D 201  1 ? 14 
HELX_P HELX_P89 AJ8 ALA D 208  ? LYS D 214  ? ALA D 213  LYS D 219  1 ? 7  
HELX_P HELX_P90 AJ9 GLY D 223  ? TRP D 227  ? GLY D 228  TRP D 232  5 ? 5  
HELX_P HELX_P91 AK1 ASN D 267  ? TYR D 278  ? ASN D 272  TYR D 283  1 ? 12 
HELX_P HELX_P92 AK2 THR D 281  ? LYS D 292  ? THR D 286  LYS D 297  1 ? 12 
HELX_P HELX_P93 AK3 LEU D 299  ? GLU D 304  ? LEU D 304  GLU D 309  1 ? 6  
HELX_P HELX_P94 AK4 ASP D 309  ? LYS D 321  ? ASP D 314  LYS D 326  1 ? 13 
HELX_P HELX_P95 AK5 GLN D 330  ? GLY D 348  ? GLN D 335  GLY D 353  1 ? 19 
HELX_P HELX_P96 AK6 VAL D 352  ? ASN D 362  ? VAL D 357  ASN D 367  1 ? 11 
HELX_P HELX_P97 AK7 ASN D 376  ? PHE D 382  ? ASN D 1924 PHE D 1930 1 ? 7  
HELX_P HELX_P98 AK8 GLY D 467  ? SER D 472  ? GLY D 2015 SER D 2020 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? E GLC .  O4  ? ? ? 1_555 E GLC . C1 ? ? E GLC 1   E GLC 2   1_555 ? ? ? ? ? ? ? 1.436 sing ? 
metalc1 metalc ?    ? B THR 17 OG1 ? ? ? 1_555 H MG  . MG ? ? B THR 24  B MG  202 1_555 ? ? ? ? ? ? ? 2.148 ?    ? 
metalc2 metalc ?    ? B THR 35 OG1 ? ? ? 1_555 H MG  . MG ? ? B THR 42  B MG  202 1_555 ? ? ? ? ? ? ? 2.014 ?    ? 
metalc3 metalc ?    ? G GTP .  O1G ? ? ? 1_555 H MG  . MG ? ? B GTP 201 B MG  202 1_555 ? ? ? ? ? ? ? 2.035 ?    ? 
metalc4 metalc ?    ? G GTP .  O1B ? ? ? 1_555 H MG  . MG ? ? B GTP 201 B MG  202 1_555 ? ? ? ? ? ? ? 1.953 ?    ? 
metalc5 metalc ?    ? H MG  .  MG  ? ? ? 1_555 K HOH . O  ? ? B MG  202 B HOH 302 1_555 ? ? ? ? ? ? ? 2.239 ?    ? 
metalc6 metalc ?    ? H MG  .  MG  ? ? ? 1_555 K HOH . O  ? ? B MG  202 B HOH 303 1_555 ? ? ? ? ? ? ? 2.003 ?    ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TRP 
_struct_mon_prot_cis.label_seq_id           138 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TRP 
_struct_mon_prot_cis.auth_seq_id            142 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    139 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     143 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.48 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 7 ? 
AA3 ? 5 ? 
AA4 ? 6 ? 
AA5 ? 6 ? 
AA6 ? 6 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? parallel      
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 425 ? GLU A 430 ? GLU A 429 GLU A 434 
AA1 2 VAL A 436 ? MET A 441 ? VAL A 440 MET A 445 
AA2 1 GLN B 138 ? ASP B 141 ? GLN B 145 ASP B 148 
AA2 2 ILE B 110 ? ASN B 115 ? ILE B 117 ASN B 122 
AA2 3 CYS B 78  ? ASP B 84  ? CYS B 85  ASP B 91  
AA2 4 GLN B 3   ? GLY B 10  ? GLN B 10  GLY B 17  
AA2 5 GLY B 50  ? THR B 59  ? GLY B 57  THR B 66  
AA2 6 VAL B 38  ? THR B 47  ? VAL B 45  THR B 54  
AA2 7 PHE B 169 ? VAL B 170 ? PHE B 176 VAL B 177 
AA3 1 MET C 105 ? TRP C 109 ? MET C 103 TRP C 107 
AA3 2 GLY C 271 ? LEU C 279 ? GLY C 269 LEU C 277 
AA3 3 VAL C 256 ? HIS C 263 ? VAL C 254 HIS C 261 
AA3 4 TRP C 121 ? PRO C 127 ? TRP C 119 PRO C 125 
AA3 5 ASN C 236 ? PRO C 238 ? ASN C 234 PRO C 236 
AA4 1 CYS C 150 ? PHE C 154 ? CYS C 148 PHE C 152 
AA4 2 SER C 140 ? TYR C 144 ? SER C 138 TYR C 142 
AA4 3 LYS C 130 ? SER C 137 ? LYS C 128 SER C 135 
AA4 4 THR C 172 ? ASN C 179 ? THR C 170 ASN C 177 
AA4 5 THR C 184 ? TRP C 193 ? THR C 182 TRP C 191 
AA4 6 HIS C 196 ? PRO C 197 ? HIS C 194 PRO C 195 
AA5 1 CYS C 150 ? PHE C 154 ? CYS C 148 PHE C 152 
AA5 2 SER C 140 ? TYR C 144 ? SER C 138 TYR C 142 
AA5 3 LYS C 130 ? SER C 137 ? LYS C 128 SER C 135 
AA5 4 THR C 172 ? ASN C 179 ? THR C 170 ASN C 177 
AA5 5 THR C 184 ? TRP C 193 ? THR C 182 TRP C 191 
AA5 6 LYS C 230 ? GLY C 233 ? LYS C 228 GLY C 231 
AA6 1 VAL D 30  ? GLU D 33  ? VAL D 35  GLU D 38  
AA6 2 LEU D 2   ? TRP D 5   ? LEU D 7   TRP D 10  
AA6 3 ILE D 54  ? TRP D 57  ? ILE D 59  TRP D 62  
AA6 4 LEU D 257 ? ILE D 261 ? LEU D 262 ILE D 266 
AA6 5 ALA D 100 ? VAL D 105 ? ALA D 105 VAL D 110 
AA6 6 ALA D 296 ? VAL D 297 ? ALA D 301 VAL D 302 
AA7 1 ARG D 93  ? TYR D 94  ? ARG D 98  TYR D 99  
AA7 2 LYS D 97  ? LEU D 98  ? LYS D 102 LEU D 103 
AA8 1 PHE D 253 ? VAL D 254 ? PHE D 258 VAL D 259 
AA8 2 GLU D 323 ? ILE D 324 ? GLU D 328 ILE D 329 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 427 ? N LEU A 431 O GLU A 439 ? O GLU A 443 
AA2 1 2 O GLN B 138 ? O GLN B 145 N LEU B 112 ? N LEU B 119 
AA2 2 3 O ASN B 115 ? O ASN B 122 N PHE B 83  ? N PHE B 90  
AA2 3 4 O ILE B 80  ? O ILE B 87  N VAL B 7   ? N VAL B 14  
AA2 4 5 N LEU B 6   ? N LEU B 13  O TRP B 57  ? O TRP B 64  
AA2 5 6 O PHE B 54  ? O PHE B 61  N LEU B 43  ? N LEU B 50  
AA2 6 7 N HIS B 46  ? N HIS B 53  O VAL B 170 ? O VAL B 177 
AA3 1 2 N LEU C 106 ? N LEU C 104 O GLY C 271 ? O GLY C 269 
AA3 2 3 O LEU C 279 ? O LEU C 277 N LEU C 259 ? N LEU C 257 
AA3 3 4 O LEU C 260 ? O LEU C 258 N VAL C 124 ? N VAL C 122 
AA3 4 5 N VAL C 123 ? N VAL C 121 O PHE C 237 ? O PHE C 235 
AA4 1 2 O PHE C 154 ? O PHE C 152 N THR C 141 ? N THR C 139 
AA4 2 3 O SER C 140 ? O SER C 138 N SER C 137 ? N SER C 135 
AA4 3 4 N ILE C 134 ? N ILE C 132 O LEU C 174 ? O LEU C 172 
AA4 4 5 N ASP C 175 ? N ASP C 173 O ASP C 189 ? O ASP C 187 
AA4 5 6 N TRP C 193 ? N TRP C 191 O HIS C 196 ? O HIS C 194 
AA5 1 2 O PHE C 154 ? O PHE C 152 N THR C 141 ? N THR C 139 
AA5 2 3 O SER C 140 ? O SER C 138 N SER C 137 ? N SER C 135 
AA5 3 4 N ILE C 134 ? N ILE C 132 O LEU C 174 ? O LEU C 172 
AA5 4 5 N ASP C 175 ? N ASP C 173 O ASP C 189 ? O ASP C 187 
AA5 5 6 N VAL C 187 ? N VAL C 185 O VAL C 232 ? O VAL C 230 
AA6 1 2 O GLU D 33  ? O GLU D 38  N ILE D 4   ? N ILE D 9   
AA6 2 3 N TRP D 5   ? N TRP D 10  O PHE D 56  ? O PHE D 61  
AA6 3 4 N TRP D 57  ? N TRP D 62  O SER D 258 ? O SER D 263 
AA6 4 5 O LEU D 257 ? O LEU D 262 N ILE D 103 ? N ILE D 108 
AA6 5 6 N VAL D 105 ? N VAL D 110 O ALA D 296 ? O ALA D 301 
AA7 1 2 N TYR D 94  ? N TYR D 99  O LYS D 97  ? O LYS D 102 
AA8 1 2 N VAL D 254 ? N VAL D 259 O GLU D 323 ? O GLU D 328 
# 
_atom_sites.entry_id                    5DIS 
_atom_sites.fract_transf_matrix[1][1]   0.008902 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004017 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004749 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . MET A 1 1    ? 21.247  -55.374  13.495  1.00 153.15 ? 5    MET A N     1 
ATOM   2     C  CA    . MET A 1 1    ? 20.275  -56.264  14.119  1.00 157.16 ? 5    MET A CA    1 
ATOM   3     C  C     . MET A 1 1    ? 20.615  -56.428  15.591  1.00 151.52 ? 5    MET A C     1 
ATOM   4     O  O     . MET A 1 1    ? 21.573  -55.829  16.076  1.00 156.41 ? 5    MET A O     1 
ATOM   5     C  CB    . MET A 1 1    ? 20.249  -57.620  13.404  1.00 177.84 ? 5    MET A CB    1 
ATOM   6     C  CG    . MET A 1 1    ? 18.956  -58.422  13.564  1.00 184.31 ? 5    MET A CG    1 
ATOM   7     S  SD    . MET A 1 1    ? 18.966  -59.486  15.023  1.00 185.97 ? 5    MET A SD    1 
ATOM   8     C  CE    . MET A 1 1    ? 18.604  -61.081  14.287  1.00 125.43 ? 5    MET A CE    1 
ATOM   9     N  N     . THR A 1 2    ? 19.838  -57.242  16.299  1.00 155.03 ? 6    THR A N     1 
ATOM   10    C  CA    . THR A 1 2    ? 20.046  -57.443  17.728  1.00 163.11 ? 6    THR A CA    1 
ATOM   11    C  C     . THR A 1 2    ? 21.344  -58.195  18.011  1.00 162.57 ? 6    THR A C     1 
ATOM   12    O  O     . THR A 1 2    ? 21.653  -58.469  19.164  1.00 164.54 ? 6    THR A O     1 
ATOM   13    C  CB    . THR A 1 2    ? 18.878  -58.216  18.374  1.00 167.98 ? 6    THR A CB    1 
ATOM   14    O  OG1   . THR A 1 2    ? 18.927  -59.589  17.965  1.00 186.36 ? 6    THR A OG1   1 
ATOM   15    C  CG2   . THR A 1 2    ? 17.546  -57.608  17.966  1.00 160.80 ? 6    THR A CG2   1 
ATOM   16    N  N     . MET A 1 3    ? 22.094  -58.536  16.967  1.00 142.73 ? 7    MET A N     1 
ATOM   17    C  CA    . MET A 1 3    ? 23.408  -59.137  17.150  1.00 123.69 ? 7    MET A CA    1 
ATOM   18    C  C     . MET A 1 3    ? 24.389  -58.072  17.638  1.00 137.64 ? 7    MET A C     1 
ATOM   19    O  O     . MET A 1 3    ? 24.930  -58.159  18.747  1.00 130.91 ? 7    MET A O     1 
ATOM   20    C  CB    . MET A 1 3    ? 23.889  -59.775  15.845  1.00 119.41 ? 7    MET A CB    1 
ATOM   21    C  CG    . MET A 1 3    ? 25.150  -60.607  15.969  1.00 91.00  ? 7    MET A CG    1 
ATOM   22    S  SD    . MET A 1 3    ? 25.205  -61.986  14.815  1.00 111.04 ? 7    MET A SD    1 
ATOM   23    C  CE    . MET A 1 3    ? 25.039  -61.148  13.245  1.00 159.94 ? 7    MET A CE    1 
ATOM   24    N  N     . LEU A 1 4    ? 24.595  -57.054  16.806  1.00 149.27 ? 8    LEU A N     1 
ATOM   25    C  CA    . LEU A 1 4    ? 25.443  -55.920  17.153  1.00 141.72 ? 8    LEU A CA    1 
ATOM   26    C  C     . LEU A 1 4    ? 24.860  -55.172  18.348  1.00 134.08 ? 8    LEU A C     1 
ATOM   27    O  O     . LEU A 1 4    ? 25.589  -54.760  19.257  1.00 134.00 ? 8    LEU A O     1 
ATOM   28    C  CB    . LEU A 1 4    ? 25.599  -54.977  15.957  1.00 142.82 ? 8    LEU A CB    1 
ATOM   29    C  CG    . LEU A 1 4    ? 26.157  -55.601  14.675  1.00 155.17 ? 8    LEU A CG    1 
ATOM   30    C  CD1   . LEU A 1 4    ? 25.047  -56.157  13.772  1.00 160.97 ? 8    LEU A CD1   1 
ATOM   31    C  CD2   . LEU A 1 4    ? 27.025  -54.614  13.914  1.00 160.12 ? 8    LEU A CD2   1 
ATOM   32    N  N     . ALA A 1 5    ? 23.539  -55.015  18.335  1.00 127.21 ? 9    ALA A N     1 
ATOM   33    C  CA    . ALA A 1 5    ? 22.818  -54.366  19.419  1.00 123.88 ? 9    ALA A CA    1 
ATOM   34    C  C     . ALA A 1 5    ? 23.087  -55.072  20.742  1.00 140.20 ? 9    ALA A C     1 
ATOM   35    O  O     . ALA A 1 5    ? 23.456  -54.419  21.732  1.00 144.17 ? 9    ALA A O     1 
ATOM   36    C  CB    . ALA A 1 5    ? 21.330  -54.332  19.129  1.00 115.41 ? 9    ALA A CB    1 
ATOM   37    N  N     . ASP A 1 6    ? 22.916  -56.395  20.759  1.00 148.63 ? 10   ASP A N     1 
ATOM   38    C  CA    . ASP A 1 6    ? 23.162  -57.161  21.978  1.00 138.54 ? 10   ASP A CA    1 
ATOM   39    C  C     . ASP A 1 6    ? 24.609  -57.019  22.403  1.00 130.08 ? 10   ASP A C     1 
ATOM   40    O  O     . ASP A 1 6    ? 24.879  -56.729  23.553  1.00 145.42 ? 10   ASP A O     1 
ATOM   41    C  CB    . ASP A 1 6    ? 22.815  -58.637  21.795  1.00 144.80 ? 10   ASP A CB    1 
ATOM   42    C  CG    . ASP A 1 6    ? 22.650  -59.368  23.107  1.00 157.78 ? 10   ASP A CG    1 
ATOM   43    O  OD1   . ASP A 1 6    ? 22.540  -60.611  23.087  1.00 161.85 ? 10   ASP A OD1   1 
ATOM   44    O  OD2   . ASP A 1 6    ? 22.631  -58.704  24.162  1.00 171.12 ? 10   ASP A OD2   1 
ATOM   45    N  N     . HIS A 1 7    ? 25.535  -57.206  21.467  1.00 107.45 ? 11   HIS A N     1 
ATOM   46    C  CA    . HIS A 1 7    ? 26.962  -57.144  21.783  1.00 101.47 ? 11   HIS A CA    1 
ATOM   47    C  C     . HIS A 1 7    ? 27.351  -55.834  22.462  1.00 106.10 ? 11   HIS A C     1 
ATOM   48    O  O     . HIS A 1 7    ? 27.934  -55.840  23.556  1.00 107.66 ? 11   HIS A O     1 
ATOM   49    C  CB    . HIS A 1 7    ? 27.798  -57.330  20.519  1.00 97.80  ? 11   HIS A CB    1 
ATOM   50    C  CG    . HIS A 1 7    ? 29.267  -57.428  20.775  1.00 97.59  ? 11   HIS A CG    1 
ATOM   51    N  ND1   . HIS A 1 7    ? 29.835  -58.487  21.450  1.00 108.79 ? 11   HIS A ND1   1 
ATOM   52    C  CD2   . HIS A 1 7    ? 30.287  -56.603  20.441  1.00 95.64  ? 11   HIS A CD2   1 
ATOM   53    C  CE1   . HIS A 1 7    ? 31.142  -58.309  21.522  1.00 109.83 ? 11   HIS A CE1   1 
ATOM   54    N  NE2   . HIS A 1 7    ? 31.442  -57.176  20.914  1.00 112.15 ? 11   HIS A NE2   1 
ATOM   55    N  N     . ALA A 1 8    ? 27.022  -54.719  21.811  1.00 96.07  ? 12   ALA A N     1 
ATOM   56    C  CA    . ALA A 1 8    ? 27.338  -53.398  22.344  1.00 91.11  ? 12   ALA A CA    1 
ATOM   57    C  C     . ALA A 1 8    ? 26.641  -53.160  23.685  1.00 103.46 ? 12   ALA A C     1 
ATOM   58    O  O     . ALA A 1 8    ? 27.258  -52.657  24.643  1.00 112.28 ? 12   ALA A O     1 
ATOM   59    C  CB    . ALA A 1 8    ? 26.953  -52.324  21.351  1.00 82.99  ? 12   ALA A CB    1 
ATOM   60    N  N     . ALA A 1 9    ? 25.360  -53.527  23.746  1.00 107.02 ? 13   ALA A N     1 
ATOM   61    C  CA    . ALA A 1 9    ? 24.575  -53.386  24.969  1.00 107.04 ? 13   ALA A CA    1 
ATOM   62    C  C     . ALA A 1 9    ? 25.232  -54.108  26.148  1.00 101.76 ? 13   ALA A C     1 
ATOM   63    O  O     . ALA A 1 9    ? 25.321  -53.555  27.248  1.00 101.70 ? 13   ALA A O     1 
ATOM   64    C  CB    . ALA A 1 9    ? 23.163  -53.900  24.754  1.00 108.67 ? 13   ALA A CB    1 
ATOM   65    N  N     . ARG A 1 10   ? 25.692  -55.334  25.914  1.00 88.19  ? 14   ARG A N     1 
ATOM   66    C  CA    . ARG A 1 10   ? 26.347  -56.122  26.947  1.00 103.40 ? 14   ARG A CA    1 
ATOM   67    C  C     . ARG A 1 10   ? 27.691  -55.521  27.331  1.00 112.11 ? 14   ARG A C     1 
ATOM   68    O  O     . ARG A 1 10   ? 28.067  -55.536  28.503  1.00 133.88 ? 14   ARG A O     1 
ATOM   69    C  CB    . ARG A 1 10   ? 26.540  -57.568  26.487  1.00 118.00 ? 14   ARG A CB    1 
ATOM   70    C  CG    . ARG A 1 10   ? 25.256  -58.284  26.113  1.00 128.68 ? 14   ARG A CG    1 
ATOM   71    C  CD    . ARG A 1 10   ? 24.955  -59.435  27.047  1.00 142.82 ? 14   ARG A CD    1 
ATOM   72    N  NE    . ARG A 1 10   ? 24.730  -60.679  26.318  1.00 139.90 ? 14   ARG A NE    1 
ATOM   73    C  CZ    . ARG A 1 10   ? 24.424  -61.835  26.896  1.00 145.44 ? 14   ARG A CZ    1 
ATOM   74    N  NH1   . ARG A 1 10   ? 24.239  -62.919  26.155  1.00 158.95 ? 14   ARG A NH1   1 
ATOM   75    N  NH2   . ARG A 1 10   ? 24.302  -61.907  28.216  1.00 138.60 ? 14   ARG A NH2   1 
ATOM   76    N  N     . GLN A 1 11   ? 28.420  -55.009  26.341  1.00 108.09 ? 15   GLN A N     1 
ATOM   77    C  CA    . GLN A 1 11   ? 29.697  -54.352  26.608  1.00 106.70 ? 15   GLN A CA    1 
ATOM   78    C  C     . GLN A 1 11   ? 29.500  -53.179  27.557  1.00 110.10 ? 15   GLN A C     1 
ATOM   79    O  O     . GLN A 1 11   ? 30.306  -52.952  28.459  1.00 121.84 ? 15   GLN A O     1 
ATOM   80    C  CB    . GLN A 1 11   ? 30.351  -53.866  25.317  1.00 113.29 ? 15   GLN A CB    1 
ATOM   81    C  CG    . GLN A 1 11   ? 31.532  -54.707  24.864  1.00 130.23 ? 15   GLN A CG    1 
ATOM   82    C  CD    . GLN A 1 11   ? 32.218  -54.136  23.639  1.00 135.47 ? 15   GLN A CD    1 
ATOM   83    O  OE1   . GLN A 1 11   ? 32.805  -53.055  23.688  1.00 138.32 ? 15   GLN A OE1   1 
ATOM   84    N  NE2   . GLN A 1 11   ? 32.141  -54.860  22.528  1.00 134.65 ? 15   GLN A NE2   1 
ATOM   85    N  N     . LEU A 1 12   ? 28.415  -52.442  27.353  1.00 98.63  ? 16   LEU A N     1 
ATOM   86    C  CA    . LEU A 1 12   ? 28.109  -51.307  28.208  1.00 97.97  ? 16   LEU A CA    1 
ATOM   87    C  C     . LEU A 1 12   ? 27.545  -51.766  29.556  1.00 117.41 ? 16   LEU A C     1 
ATOM   88    O  O     . LEU A 1 12   ? 27.784  -51.134  30.594  1.00 112.99 ? 16   LEU A O     1 
ATOM   89    C  CB    . LEU A 1 12   ? 27.129  -50.367  27.503  1.00 89.67  ? 16   LEU A CB    1 
ATOM   90    C  CG    . LEU A 1 12   ? 27.698  -49.625  26.291  1.00 92.23  ? 16   LEU A CG    1 
ATOM   91    C  CD1   . LEU A 1 12   ? 26.607  -49.220  25.309  1.00 93.77  ? 16   LEU A CD1   1 
ATOM   92    C  CD2   . LEU A 1 12   ? 28.491  -48.412  26.732  1.00 96.12  ? 16   LEU A CD2   1 
ATOM   93    N  N     . LEU A 1 13   ? 26.814  -52.879  29.545  1.00 123.08 ? 17   LEU A N     1 
ATOM   94    C  CA    . LEU A 1 13   ? 26.123  -53.346  30.747  1.00 116.19 ? 17   LEU A CA    1 
ATOM   95    C  C     . LEU A 1 13   ? 26.792  -54.524  31.445  1.00 124.55 ? 17   LEU A C     1 
ATOM   96    O  O     . LEU A 1 13   ? 26.120  -55.283  32.140  1.00 129.88 ? 17   LEU A O     1 
ATOM   97    C  CB    . LEU A 1 13   ? 24.689  -53.744  30.404  1.00 120.67 ? 17   LEU A CB    1 
ATOM   98    C  CG    . LEU A 1 13   ? 23.787  -52.654  29.843  1.00 128.68 ? 17   LEU A CG    1 
ATOM   99    C  CD1   . LEU A 1 13   ? 22.477  -53.266  29.391  1.00 127.59 ? 17   LEU A CD1   1 
ATOM   100   C  CD2   . LEU A 1 13   ? 23.565  -51.561  30.886  1.00 131.51 ? 17   LEU A CD2   1 
ATOM   101   N  N     . ASP A 1 14   ? 28.096  -54.692  31.274  1.00 135.84 ? 18   ASP A N     1 
ATOM   102   C  CA    . ASP A 1 14   ? 28.760  -55.865  31.834  1.00 143.44 ? 18   ASP A CA    1 
ATOM   103   C  C     . ASP A 1 14   ? 28.819  -55.798  33.364  1.00 136.64 ? 18   ASP A C     1 
ATOM   104   O  O     . ASP A 1 14   ? 28.520  -56.788  34.042  1.00 148.25 ? 18   ASP A O     1 
ATOM   105   C  CB    . ASP A 1 14   ? 30.166  -56.020  31.250  1.00 154.70 ? 18   ASP A CB    1 
ATOM   106   C  CG    . ASP A 1 14   ? 30.872  -57.277  31.737  1.00 167.23 ? 18   ASP A CG    1 
ATOM   107   O  OD1   . ASP A 1 14   ? 32.066  -57.442  31.417  1.00 172.13 ? 18   ASP A OD1   1 
ATOM   108   O  OD2   . ASP A 1 14   ? 30.249  -58.101  32.440  1.00 182.75 ? 18   ASP A OD2   1 
ATOM   109   N  N     . PHE A 1 15   ? 29.224  -54.639  33.884  1.00 131.90 ? 19   PHE A N     1 
ATOM   110   C  CA    . PHE A 1 15   ? 29.282  -54.333  35.332  1.00 127.41 ? 19   PHE A CA    1 
ATOM   111   C  C     . PHE A 1 15   ? 30.507  -54.942  35.989  1.00 130.28 ? 19   PHE A C     1 
ATOM   112   O  O     . PHE A 1 15   ? 30.696  -54.813  37.189  1.00 140.25 ? 19   PHE A O     1 
ATOM   113   C  CB    . PHE A 1 15   ? 28.007  -54.771  36.080  1.00 118.97 ? 19   PHE A CB    1 
ATOM   114   C  CG    . PHE A 1 15   ? 26.765  -53.994  35.702  1.00 124.20 ? 19   PHE A CG    1 
ATOM   115   C  CD1   . PHE A 1 15   ? 25.754  -53.810  36.619  1.00 128.61 ? 19   PHE A CD1   1 
ATOM   116   C  CD2   . PHE A 1 15   ? 26.596  -53.473  34.433  1.00 142.56 ? 19   PHE A CD2   1 
ATOM   117   C  CE1   . PHE A 1 15   ? 24.607  -53.103  36.281  1.00 139.73 ? 19   PHE A CE1   1 
ATOM   118   C  CE2   . PHE A 1 15   ? 25.453  -52.778  34.088  1.00 147.43 ? 19   PHE A CE2   1 
ATOM   119   C  CZ    . PHE A 1 15   ? 24.460  -52.588  35.015  1.00 140.92 ? 19   PHE A CZ    1 
ATOM   120   N  N     . SER A 1 16   ? 31.357  -55.574  35.194  1.00 139.80 ? 20   SER A N     1 
ATOM   121   C  CA    . SER A 1 16   ? 32.553  -56.213  35.725  1.00 150.41 ? 20   SER A CA    1 
ATOM   122   C  C     . SER A 1 16   ? 33.762  -55.288  35.661  1.00 161.26 ? 20   SER A C     1 
ATOM   123   O  O     . SER A 1 16   ? 34.841  -55.640  36.136  1.00 166.91 ? 20   SER A O     1 
ATOM   124   C  CB    . SER A 1 16   ? 32.842  -57.511  34.970  1.00 159.23 ? 20   SER A CB    1 
ATOM   125   O  OG    . SER A 1 16   ? 31.764  -58.421  35.106  1.00 166.05 ? 20   SER A OG    1 
ATOM   126   N  N     . GLN A 1 17   ? 33.575  -54.107  35.078  1.00 165.95 ? 21   GLN A N     1 
ATOM   127   C  CA    . GLN A 1 17   ? 34.653  -53.127  34.980  1.00 157.74 ? 21   GLN A CA    1 
ATOM   128   C  C     . GLN A 1 17   ? 34.136  -51.749  34.578  1.00 145.93 ? 21   GLN A C     1 
ATOM   129   O  O     . GLN A 1 17   ? 32.947  -51.576  34.298  1.00 133.18 ? 21   GLN A O     1 
ATOM   130   C  CB    . GLN A 1 17   ? 35.718  -53.586  33.982  1.00 159.62 ? 21   GLN A CB    1 
ATOM   131   C  CG    . GLN A 1 17   ? 35.262  -53.607  32.534  1.00 151.25 ? 21   GLN A CG    1 
ATOM   132   C  CD    . GLN A 1 17   ? 36.395  -53.954  31.587  1.00 147.67 ? 21   GLN A CD    1 
ATOM   133   O  OE1   . GLN A 1 17   ? 37.450  -54.437  32.009  1.00 140.78 ? 21   GLN A OE1   1 
ATOM   134   N  NE2   . GLN A 1 17   ? 36.187  -53.699  30.300  1.00 145.33 ? 21   GLN A NE2   1 
ATOM   135   N  N     . LYS A 1 18   ? 35.047  -50.778  34.553  1.00 147.10 ? 22   LYS A N     1 
ATOM   136   C  CA    . LYS A 1 18   ? 34.714  -49.384  34.276  1.00 138.93 ? 22   LYS A CA    1 
ATOM   137   C  C     . LYS A 1 18   ? 33.905  -49.238  32.997  1.00 129.94 ? 22   LYS A C     1 
ATOM   138   O  O     . LYS A 1 18   ? 34.137  -49.942  32.015  1.00 141.87 ? 22   LYS A O     1 
ATOM   139   C  CB    . LYS A 1 18   ? 35.988  -48.538  34.190  1.00 148.16 ? 22   LYS A CB    1 
ATOM   140   C  CG    . LYS A 1 18   ? 36.766  -48.458  35.496  1.00 160.82 ? 22   LYS A CG    1 
ATOM   141   C  CD    . LYS A 1 18   ? 38.040  -47.639  35.344  1.00 167.78 ? 22   LYS A CD    1 
ATOM   142   C  CE    . LYS A 1 18   ? 38.862  -47.657  36.627  1.00 171.42 ? 22   LYS A CE    1 
ATOM   143   N  NZ    . LYS A 1 18   ? 40.143  -46.911  36.486  1.00 173.79 ? 22   LYS A NZ    1 
ATOM   144   N  N     . LEU A 1 19   ? 32.946  -48.321  33.029  1.00 120.70 ? 23   LEU A N     1 
ATOM   145   C  CA    . LEU A 1 19   ? 32.041  -48.099  31.910  1.00 126.06 ? 23   LEU A CA    1 
ATOM   146   C  C     . LEU A 1 19   ? 32.664  -47.229  30.824  1.00 133.91 ? 23   LEU A C     1 
ATOM   147   O  O     . LEU A 1 19   ? 33.263  -46.191  31.117  1.00 128.69 ? 23   LEU A O     1 
ATOM   148   C  CB    . LEU A 1 19   ? 30.747  -47.452  32.397  1.00 117.55 ? 23   LEU A CB    1 
ATOM   149   C  CG    . LEU A 1 19   ? 29.705  -47.152  31.321  1.00 119.88 ? 23   LEU A CG    1 
ATOM   150   C  CD1   . LEU A 1 19   ? 29.356  -48.416  30.543  1.00 131.24 ? 23   LEU A CD1   1 
ATOM   151   C  CD2   . LEU A 1 19   ? 28.467  -46.539  31.944  1.00 117.62 ? 23   LEU A CD2   1 
ATOM   152   N  N     . ASP A 1 20   ? 32.505  -47.652  29.571  1.00 128.07 ? 24   ASP A N     1 
ATOM   153   C  CA    . ASP A 1 20   ? 33.078  -46.929  28.446  1.00 126.83 ? 24   ASP A CA    1 
ATOM   154   C  C     . ASP A 1 20   ? 32.213  -45.745  28.034  1.00 122.70 ? 24   ASP A C     1 
ATOM   155   O  O     . ASP A 1 20   ? 31.271  -45.901  27.241  1.00 108.85 ? 24   ASP A O     1 
ATOM   156   C  CB    . ASP A 1 20   ? 33.270  -47.866  27.259  1.00 133.86 ? 24   ASP A CB    1 
ATOM   157   C  CG    . ASP A 1 20   ? 34.338  -47.378  26.299  1.00 133.00 ? 24   ASP A CG    1 
ATOM   158   O  OD1   . ASP A 1 20   ? 34.728  -48.156  25.399  1.00 138.64 ? 24   ASP A OD1   1 
ATOM   159   O  OD2   . ASP A 1 20   ? 34.795  -46.224  26.454  1.00 128.03 ? 24   ASP A OD2   1 
ATOM   160   N  N     . ILE A 1 21   ? 32.539  -44.567  28.569  1.00 121.70 ? 25   ILE A N     1 
ATOM   161   C  CA    . ILE A 1 21   ? 31.806  -43.345  28.244  1.00 114.86 ? 25   ILE A CA    1 
ATOM   162   C  C     . ILE A 1 21   ? 32.123  -42.895  26.810  1.00 112.47 ? 25   ILE A C     1 
ATOM   163   O  O     . ILE A 1 21   ? 31.273  -42.328  26.123  1.00 100.69 ? 25   ILE A O     1 
ATOM   164   C  CB    . ILE A 1 21   ? 32.132  -42.224  29.234  1.00 113.94 ? 25   ILE A CB    1 
ATOM   165   C  CG1   . ILE A 1 21   ? 31.872  -42.700  30.660  1.00 129.94 ? 25   ILE A CG1   1 
ATOM   166   C  CG2   . ILE A 1 21   ? 31.308  -40.980  28.945  1.00 112.82 ? 25   ILE A CG2   1 
ATOM   167   C  CD1   . ILE A 1 21   ? 33.079  -42.601  31.572  1.00 146.33 ? 25   ILE A CD1   1 
ATOM   168   N  N     . ASN A 1 22   ? 33.348  -43.164  26.368  1.00 113.25 ? 26   ASN A N     1 
ATOM   169   C  CA    . ASN A 1 22   ? 33.765  -42.857  25.012  1.00 110.93 ? 26   ASN A CA    1 
ATOM   170   C  C     . ASN A 1 22   ? 32.858  -43.568  24.010  1.00 115.90 ? 26   ASN A C     1 
ATOM   171   O  O     . ASN A 1 22   ? 32.327  -42.956  23.071  1.00 123.14 ? 26   ASN A O     1 
ATOM   172   C  CB    . ASN A 1 22   ? 35.222  -43.262  24.809  1.00 125.85 ? 26   ASN A CB    1 
ATOM   173   C  CG    . ASN A 1 22   ? 35.945  -42.365  23.824  1.00 147.84 ? 26   ASN A CG    1 
ATOM   174   O  OD1   . ASN A 1 22   ? 36.274  -41.220  24.142  1.00 155.68 ? 26   ASN A OD1   1 
ATOM   175   N  ND2   . ASN A 1 22   ? 36.213  -42.885  22.627  1.00 154.31 ? 26   ASN A ND2   1 
ATOM   176   N  N     . LEU A 1 23   ? 32.671  -44.865  24.232  1.00 110.31 ? 27   LEU A N     1 
ATOM   177   C  CA    . LEU A 1 23   ? 31.812  -45.681  23.385  1.00 91.46  ? 27   LEU A CA    1 
ATOM   178   C  C     . LEU A 1 23   ? 30.363  -45.209  23.399  1.00 96.99  ? 27   LEU A C     1 
ATOM   179   O  O     . LEU A 1 23   ? 29.736  -45.104  22.350  1.00 101.20 ? 27   LEU A O     1 
ATOM   180   C  CB    . LEU A 1 23   ? 31.880  -47.144  23.819  1.00 95.23  ? 27   LEU A CB    1 
ATOM   181   C  CG    . LEU A 1 23   ? 30.810  -48.063  23.217  1.00 107.13 ? 27   LEU A CG    1 
ATOM   182   C  CD1   . LEU A 1 23   ? 30.974  -48.196  21.698  1.00 84.28  ? 27   LEU A CD1   1 
ATOM   183   C  CD2   . LEU A 1 23   ? 30.838  -49.432  23.883  1.00 107.86 ? 27   LEU A CD2   1 
ATOM   184   N  N     . LEU A 1 24   ? 29.834  -44.926  24.588  1.00 100.41 ? 28   LEU A N     1 
ATOM   185   C  CA    . LEU A 1 24   ? 28.443  -44.501  24.720  1.00 97.84  ? 28   LEU A CA    1 
ATOM   186   C  C     . LEU A 1 24   ? 28.201  -43.174  23.998  1.00 104.83 ? 28   LEU A C     1 
ATOM   187   O  O     . LEU A 1 24   ? 27.210  -43.015  23.263  1.00 92.30  ? 28   LEU A O     1 
ATOM   188   C  CB    . LEU A 1 24   ? 28.052  -44.378  26.191  1.00 92.25  ? 28   LEU A CB    1 
ATOM   189   C  CG    . LEU A 1 24   ? 26.574  -44.057  26.441  1.00 98.62  ? 28   LEU A CG    1 
ATOM   190   C  CD1   . LEU A 1 24   ? 25.685  -45.086  25.755  1.00 107.63 ? 28   LEU A CD1   1 
ATOM   191   C  CD2   . LEU A 1 24   ? 26.274  -43.999  27.926  1.00 98.88  ? 28   LEU A CD2   1 
ATOM   192   N  N     . ASP A 1 25   ? 29.116  -42.229  24.208  1.00 112.99 ? 29   ASP A N     1 
ATOM   193   C  CA    . ASP A 1 25   ? 29.079  -40.946  23.517  1.00 105.64 ? 29   ASP A CA    1 
ATOM   194   C  C     . ASP A 1 25   ? 29.105  -41.153  22.010  1.00 102.19 ? 29   ASP A C     1 
ATOM   195   O  O     . ASP A 1 25   ? 28.373  -40.491  21.274  1.00 93.25  ? 29   ASP A O     1 
ATOM   196   C  CB    . ASP A 1 25   ? 30.251  -40.063  23.950  1.00 115.35 ? 29   ASP A CB    1 
ATOM   197   C  CG    . ASP A 1 25   ? 30.126  -39.588  25.383  1.00 125.49 ? 29   ASP A CG    1 
ATOM   198   O  OD1   . ASP A 1 25   ? 29.278  -40.134  26.118  1.00 133.66 ? 29   ASP A OD1   1 
ATOM   199   O  OD2   . ASP A 1 25   ? 30.881  -38.673  25.777  1.00 129.32 ? 29   ASP A OD2   1 
ATOM   200   N  N     . ASN A 1 26   ? 29.945  -42.082  21.556  1.00 106.42 ? 30   ASN A N     1 
ATOM   201   C  CA    . ASN A 1 26   ? 30.037  -42.385  20.131  1.00 103.75 ? 30   ASN A CA    1 
ATOM   202   C  C     . ASN A 1 26   ? 28.740  -42.962  19.559  1.00 102.37 ? 30   ASN A C     1 
ATOM   203   O  O     . ASN A 1 26   ? 28.301  -42.559  18.484  1.00 105.40 ? 30   ASN A O     1 
ATOM   204   C  CB    . ASN A 1 26   ? 31.195  -43.346  19.863  1.00 108.17 ? 30   ASN A CB    1 
ATOM   205   C  CG    . ASN A 1 26   ? 32.549  -42.679  20.004  1.00 117.38 ? 30   ASN A CG    1 
ATOM   206   O  OD1   . ASN A 1 26   ? 32.643  -41.457  20.088  1.00 124.44 ? 30   ASN A OD1   1 
ATOM   207   N  ND2   . ASN A 1 26   ? 33.606  -43.480  20.020  1.00 118.95 ? 30   ASN A ND2   1 
ATOM   208   N  N     . VAL A 1 27   ? 28.129  -43.900  20.279  1.00 97.42  ? 31   VAL A N     1 
ATOM   209   C  CA    . VAL A 1 27   ? 26.872  -44.511  19.845  1.00 93.01  ? 31   VAL A CA    1 
ATOM   210   C  C     . VAL A 1 27   ? 25.766  -43.465  19.778  1.00 88.61  ? 31   VAL A C     1 
ATOM   211   O  O     . VAL A 1 27   ? 24.974  -43.442  18.841  1.00 81.14  ? 31   VAL A O     1 
ATOM   212   C  CB    . VAL A 1 27   ? 26.436  -45.664  20.791  1.00 80.53  ? 31   VAL A CB    1 
ATOM   213   C  CG1   . VAL A 1 27   ? 25.082  -46.220  20.387  1.00 74.04  ? 31   VAL A CG1   1 
ATOM   214   C  CG2   . VAL A 1 27   ? 27.480  -46.768  20.808  1.00 77.79  ? 31   VAL A CG2   1 
ATOM   215   N  N     . VAL A 1 28   ? 25.728  -42.592  20.777  1.00 104.70 ? 32   VAL A N     1 
ATOM   216   C  CA    . VAL A 1 28   ? 24.731  -41.526  20.835  1.00 105.22 ? 32   VAL A CA    1 
ATOM   217   C  C     . VAL A 1 28   ? 24.895  -40.530  19.682  1.00 102.20 ? 32   VAL A C     1 
ATOM   218   O  O     . VAL A 1 28   ? 23.934  -40.227  18.966  1.00 94.14  ? 32   VAL A O     1 
ATOM   219   C  CB    . VAL A 1 28   ? 24.798  -40.780  22.195  1.00 87.93  ? 32   VAL A CB    1 
ATOM   220   C  CG1   . VAL A 1 28   ? 24.079  -39.450  22.116  1.00 88.55  ? 32   VAL A CG1   1 
ATOM   221   C  CG2   . VAL A 1 28   ? 24.208  -41.642  23.294  1.00 86.18  ? 32   VAL A CG2   1 
ATOM   222   N  N     . ASN A 1 29   ? 26.117  -40.032  19.506  1.00 110.21 ? 33   ASN A N     1 
ATOM   223   C  CA    . ASN A 1 29   ? 26.423  -39.115  18.412  1.00 100.54 ? 33   ASN A CA    1 
ATOM   224   C  C     . ASN A 1 29   ? 26.120  -39.755  17.059  1.00 94.97  ? 33   ASN A C     1 
ATOM   225   O  O     . ASN A 1 29   ? 25.688  -39.080  16.120  1.00 85.12  ? 33   ASN A O     1 
ATOM   226   C  CB    . ASN A 1 29   ? 27.887  -38.678  18.469  1.00 110.17 ? 33   ASN A CB    1 
ATOM   227   C  CG    . ASN A 1 29   ? 28.212  -37.603  17.447  1.00 118.10 ? 33   ASN A CG    1 
ATOM   228   O  OD1   . ASN A 1 29   ? 28.445  -37.898  16.278  1.00 127.25 ? 33   ASN A OD1   1 
ATOM   229   N  ND2   . ASN A 1 29   ? 28.235  -36.349  17.889  1.00 124.93 ? 33   ASN A ND2   1 
ATOM   230   N  N     . CYS A 1 30   ? 26.341  -41.063  16.967  1.00 93.31  ? 34   CYS A N     1 
ATOM   231   C  CA    . CYS A 1 30   ? 25.955  -41.808  15.777  1.00 89.89  ? 34   CYS A CA    1 
ATOM   232   C  C     . CYS A 1 30   ? 24.451  -41.765  15.594  1.00 88.92  ? 34   CYS A C     1 
ATOM   233   O  O     . CYS A 1 30   ? 23.957  -41.620  14.492  1.00 104.09 ? 34   CYS A O     1 
ATOM   234   C  CB    . CYS A 1 30   ? 26.434  -43.261  15.847  1.00 89.63  ? 34   CYS A CB    1 
ATOM   235   S  SG    . CYS A 1 30   ? 28.133  -43.510  15.303  1.00 134.78 ? 34   CYS A SG    1 
ATOM   236   N  N     . LEU A 1 31   ? 23.708  -41.894  16.678  1.00 83.63  ? 35   LEU A N     1 
ATOM   237   C  CA    . LEU A 1 31   ? 22.260  -41.852  16.555  1.00 95.26  ? 35   LEU A CA    1 
ATOM   238   C  C     . LEU A 1 31   ? 21.780  -40.486  16.071  1.00 99.02  ? 35   LEU A C     1 
ATOM   239   O  O     . LEU A 1 31   ? 20.875  -40.396  15.242  1.00 94.05  ? 35   LEU A O     1 
ATOM   240   C  CB    . LEU A 1 31   ? 21.594  -42.194  17.886  1.00 90.61  ? 35   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1 31   ? 20.114  -41.818  17.940  1.00 85.09  ? 35   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1 31   ? 19.288  -42.555  16.891  1.00 82.40  ? 35   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1 31   ? 19.632  -42.132  19.287  1.00 98.82  ? 35   LEU A CD2   1 
ATOM   244   N  N     . TYR A 1 32   ? 22.381  -39.420  16.583  1.00 103.02 ? 36   TYR A N     1 
ATOM   245   C  CA    . TYR A 1 32   ? 21.879  -38.092  16.253  1.00 101.32 ? 36   TYR A CA    1 
ATOM   246   C  C     . TYR A 1 32   ? 22.476  -37.533  14.963  1.00 103.67 ? 36   TYR A C     1 
ATOM   247   O  O     . TYR A 1 32   ? 21.988  -36.533  14.438  1.00 110.07 ? 36   TYR A O     1 
ATOM   248   C  CB    . TYR A 1 32   ? 22.127  -37.127  17.419  1.00 97.72  ? 36   TYR A CB    1 
ATOM   249   C  CG    . TYR A 1 32   ? 21.248  -37.418  18.605  1.00 95.21  ? 36   TYR A CG    1 
ATOM   250   C  CD1   . TYR A 1 32   ? 21.712  -38.179  19.673  1.00 98.86  ? 36   TYR A CD1   1 
ATOM   251   C  CD2   . TYR A 1 32   ? 19.944  -36.955  18.650  1.00 92.33  ? 36   TYR A CD2   1 
ATOM   252   C  CE1   . TYR A 1 32   ? 20.900  -38.457  20.760  1.00 95.52  ? 36   TYR A CE1   1 
ATOM   253   C  CE2   . TYR A 1 32   ? 19.125  -37.228  19.739  1.00 93.98  ? 36   TYR A CE2   1 
ATOM   254   C  CZ    . TYR A 1 32   ? 19.608  -37.979  20.781  1.00 89.18  ? 36   TYR A CZ    1 
ATOM   255   O  OH    . TYR A 1 32   ? 18.787  -38.250  21.839  1.00 89.64  ? 36   TYR A OH    1 
ATOM   256   N  N     . HIS A 1 33   ? 23.520  -38.171  14.442  1.00 108.28 ? 37   HIS A N     1 
ATOM   257   C  CA    . HIS A 1 33   ? 24.175  -37.648  13.243  1.00 116.55 ? 37   HIS A CA    1 
ATOM   258   C  C     . HIS A 1 33   ? 24.657  -38.718  12.255  1.00 129.90 ? 37   HIS A C     1 
ATOM   259   O  O     . HIS A 1 33   ? 25.189  -38.392  11.198  1.00 109.75 ? 37   HIS A O     1 
ATOM   260   C  CB    . HIS A 1 33   ? 25.357  -36.763  13.644  1.00 105.78 ? 37   HIS A CB    1 
ATOM   261   C  CG    . HIS A 1 33   ? 24.983  -35.641  14.558  1.00 109.57 ? 37   HIS A CG    1 
ATOM   262   N  ND1   . HIS A 1 33   ? 24.949  -35.782  15.927  1.00 122.82 ? 37   HIS A ND1   1 
ATOM   263   C  CD2   . HIS A 1 33   ? 24.610  -34.366  14.301  1.00 114.44 ? 37   HIS A CD2   1 
ATOM   264   C  CE1   . HIS A 1 33   ? 24.580  -34.640  16.477  1.00 115.98 ? 37   HIS A CE1   1 
ATOM   265   N  NE2   . HIS A 1 33   ? 24.368  -33.764  15.512  1.00 119.16 ? 37   HIS A NE2   1 
ATOM   266   N  N     . GLY A 1 34   ? 24.471  -39.988  12.592  1.00 153.05 ? 38   GLY A N     1 
ATOM   267   C  CA    . GLY A 1 34   ? 24.955  -41.060  11.740  1.00 157.08 ? 38   GLY A CA    1 
ATOM   268   C  C     . GLY A 1 34   ? 24.052  -41.386  10.566  1.00 156.67 ? 38   GLY A C     1 
ATOM   269   O  O     . GLY A 1 34   ? 22.950  -40.840  10.436  1.00 152.57 ? 38   GLY A O     1 
ATOM   270   N  N     . GLU A 1 35   ? 24.539  -42.285  9.711   1.00 159.40 ? 39   GLU A N     1 
ATOM   271   C  CA    . GLU A 1 35   ? 23.803  -42.769  8.546   1.00 155.65 ? 39   GLU A CA    1 
ATOM   272   C  C     . GLU A 1 35   ? 22.903  -43.937  8.891   1.00 141.32 ? 39   GLU A C     1 
ATOM   273   O  O     . GLU A 1 35   ? 23.110  -44.600  9.891   1.00 150.89 ? 39   GLU A O     1 
ATOM   274   C  CB    . GLU A 1 35   ? 24.763  -43.210  7.448   1.00 172.24 ? 39   GLU A CB    1 
ATOM   275   C  CG    . GLU A 1 35   ? 25.644  -42.109  6.920   1.00 186.65 ? 39   GLU A CG    1 
ATOM   276   C  CD    . GLU A 1 35   ? 24.842  -40.972  6.329   1.00 198.15 ? 39   GLU A CD    1 
ATOM   277   O  OE1   . GLU A 1 35   ? 23.816  -41.244  5.670   1.00 202.49 ? 39   GLU A OE1   1 
ATOM   278   O  OE2   . GLU A 1 35   ? 25.235  -39.805  6.532   1.00 199.80 ? 39   GLU A OE2   1 
ATOM   279   N  N     . GLY A 1 36   ? 21.947  -44.210  8.013   1.00 131.62 ? 40   GLY A N     1 
ATOM   280   C  CA    . GLY A 1 36   ? 20.951  -45.250  8.201   1.00 127.20 ? 40   GLY A CA    1 
ATOM   281   C  C     . GLY A 1 36   ? 21.385  -46.593  8.756   1.00 135.21 ? 40   GLY A C     1 
ATOM   282   O  O     . GLY A 1 36   ? 20.636  -47.193  9.509   1.00 157.39 ? 40   GLY A O     1 
ATOM   283   N  N     . ALA A 1 37   ? 22.565  -47.086  8.391   1.00 132.47 ? 41   ALA A N     1 
ATOM   284   C  CA    . ALA A 1 37   ? 23.030  -48.349  8.960   1.00 122.44 ? 41   ALA A CA    1 
ATOM   285   C  C     . ALA A 1 37   ? 23.604  -48.100  10.350  1.00 122.32 ? 41   ALA A C     1 
ATOM   286   O  O     . ALA A 1 37   ? 23.145  -48.669  11.346  1.00 122.20 ? 41   ALA A O     1 
ATOM   287   C  CB    . ALA A 1 37   ? 24.063  -49.006  8.058   1.00 111.06 ? 41   ALA A CB    1 
ATOM   288   N  N     . GLN A 1 38   ? 24.609  -47.231  10.398  1.00 125.84 ? 42   GLN A N     1 
ATOM   289   C  CA    . GLN A 1 38   ? 25.214  -46.791  11.648  1.00 124.78 ? 42   GLN A CA    1 
ATOM   290   C  C     . GLN A 1 38   ? 24.149  -46.249  12.613  1.00 129.18 ? 42   GLN A C     1 
ATOM   291   O  O     . GLN A 1 38   ? 24.142  -46.582  13.794  1.00 134.91 ? 42   GLN A O     1 
ATOM   292   C  CB    . GLN A 1 38   ? 26.278  -45.728  11.363  1.00 121.29 ? 42   GLN A CB    1 
ATOM   293   C  CG    . GLN A 1 38   ? 27.327  -45.565  12.444  1.00 129.25 ? 42   GLN A CG    1 
ATOM   294   C  CD    . GLN A 1 38   ? 28.393  -44.550  12.069  1.00 137.03 ? 42   GLN A CD    1 
ATOM   295   O  OE1   . GLN A 1 38   ? 28.097  -43.510  11.481  1.00 144.51 ? 42   GLN A OE1   1 
ATOM   296   N  NE2   . GLN A 1 38   ? 29.641  -44.851  12.405  1.00 139.62 ? 42   GLN A NE2   1 
ATOM   297   N  N     . GLN A 1 39   ? 23.241  -45.427  12.095  1.00 122.45 ? 43   GLN A N     1 
ATOM   298   C  CA    . GLN A 1 39   ? 22.154  -44.864  12.894  1.00 113.55 ? 43   GLN A CA    1 
ATOM   299   C  C     . GLN A 1 39   ? 21.141  -45.927  13.306  1.00 110.55 ? 43   GLN A C     1 
ATOM   300   O  O     . GLN A 1 39   ? 20.675  -45.908  14.440  1.00 125.42 ? 43   GLN A O     1 
ATOM   301   C  CB    . GLN A 1 39   ? 21.449  -43.740  12.126  1.00 123.97 ? 43   GLN A CB    1 
ATOM   302   C  CG    . GLN A 1 39   ? 20.254  -43.114  12.811  1.00 128.45 ? 43   GLN A CG    1 
ATOM   303   C  CD    . GLN A 1 39   ? 19.612  -42.046  11.947  1.00 131.98 ? 43   GLN A CD    1 
ATOM   304   O  OE1   . GLN A 1 39   ? 20.045  -41.804  10.819  1.00 129.57 ? 43   GLN A OE1   1 
ATOM   305   N  NE2   . GLN A 1 39   ? 18.576  -41.401  12.468  1.00 135.59 ? 43   GLN A NE2   1 
ATOM   306   N  N     . ARG A 1 40   ? 20.787  -46.836  12.395  1.00 104.34 ? 44   ARG A N     1 
ATOM   307   C  CA    . ARG A 1 40   ? 19.900  -47.953  12.734  1.00 107.99 ? 44   ARG A CA    1 
ATOM   308   C  C     . ARG A 1 40   ? 20.436  -48.659  13.950  1.00 106.20 ? 44   ARG A C     1 
ATOM   309   O  O     . ARG A 1 40   ? 19.752  -48.794  14.957  1.00 114.73 ? 44   ARG A O     1 
ATOM   310   C  CB    . ARG A 1 40   ? 19.784  -48.973  11.600  1.00 125.63 ? 44   ARG A CB    1 
ATOM   311   C  CG    . ARG A 1 40   ? 18.417  -49.062  10.939  1.00 141.11 ? 44   ARG A CG    1 
ATOM   312   C  CD    . ARG A 1 40   ? 18.170  -50.470  10.406  1.00 158.15 ? 44   ARG A CD    1 
ATOM   313   N  NE    . ARG A 1 40   ? 17.894  -51.408  11.492  1.00 168.99 ? 44   ARG A NE    1 
ATOM   314   C  CZ    . ARG A 1 40   ? 17.747  -52.722  11.338  1.00 174.54 ? 44   ARG A CZ    1 
ATOM   315   N  NH1   . ARG A 1 40   ? 17.494  -53.489  12.391  1.00 177.17 ? 44   ARG A NH1   1 
ATOM   316   N  NH2   . ARG A 1 40   ? 17.858  -53.271  10.136  1.00 175.17 ? 44   ARG A NH2   1 
ATOM   317   N  N     . MET A 1 41   ? 21.683  -49.099  13.836  1.00 97.63  ? 45   MET A N     1 
ATOM   318   C  CA    . MET A 1 41   ? 22.312  -49.890  14.878  1.00 99.67  ? 45   MET A CA    1 
ATOM   319   C  C     . MET A 1 41   ? 22.429  -49.101  16.177  1.00 108.29 ? 45   MET A C     1 
ATOM   320   O  O     . MET A 1 41   ? 22.160  -49.638  17.245  1.00 104.87 ? 45   MET A O     1 
ATOM   321   C  CB    . MET A 1 41   ? 23.680  -50.383  14.412  1.00 91.02  ? 45   MET A CB    1 
ATOM   322   C  CG    . MET A 1 41   ? 23.583  -51.377  13.265  1.00 95.55  ? 45   MET A CG    1 
ATOM   323   S  SD    . MET A 1 41   ? 25.167  -52.017  12.717  1.00 177.99 ? 45   MET A SD    1 
ATOM   324   C  CE    . MET A 1 41   ? 25.870  -50.582  11.913  1.00 88.27  ? 45   MET A CE    1 
ATOM   325   N  N     . ALA A 1 42   ? 22.812  -47.829  16.083  1.00 111.15 ? 46   ALA A N     1 
ATOM   326   C  CA    . ALA A 1 42   ? 22.899  -46.975  17.264  1.00 102.09 ? 46   ALA A CA    1 
ATOM   327   C  C     . ALA A 1 42   ? 21.556  -46.919  17.990  1.00 98.43  ? 46   ALA A C     1 
ATOM   328   O  O     . ALA A 1 42   ? 21.484  -47.061  19.214  1.00 105.88 ? 46   ALA A O     1 
ATOM   329   C  CB    . ALA A 1 42   ? 23.357  -45.583  16.875  1.00 97.58  ? 46   ALA A CB    1 
ATOM   330   N  N     . GLN A 1 43   ? 20.496  -46.724  17.213  1.00 92.29  ? 47   GLN A N     1 
ATOM   331   C  CA    . GLN A 1 43   ? 19.128  -46.693  17.720  1.00 86.80  ? 47   GLN A CA    1 
ATOM   332   C  C     . GLN A 1 43   ? 18.785  -48.002  18.431  1.00 97.01  ? 47   GLN A C     1 
ATOM   333   O  O     . GLN A 1 43   ? 18.295  -47.997  19.573  1.00 102.13 ? 47   GLN A O     1 
ATOM   334   C  CB    . GLN A 1 43   ? 18.153  -46.439  16.565  1.00 80.95  ? 47   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1 43   ? 16.840  -45.819  16.976  1.00 97.25  ? 47   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1 43   ? 15.687  -46.795  16.907  1.00 99.85  ? 47   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1 43   ? 14.849  -46.723  15.997  1.00 99.65  ? 47   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1 43   ? 15.630  -47.714  17.875  1.00 93.83  ? 47   GLN A NE2   1 
ATOM   339   N  N     . GLU A 1 44   ? 19.062  -49.113  17.745  1.00 104.22 ? 48   GLU A N     1 
ATOM   340   C  CA    . GLU A 1 44   ? 18.866  -50.460  18.279  1.00 106.55 ? 48   GLU A CA    1 
ATOM   341   C  C     . GLU A 1 44   ? 19.528  -50.625  19.638  1.00 104.94 ? 48   GLU A C     1 
ATOM   342   O  O     . GLU A 1 44   ? 18.883  -51.005  20.612  1.00 114.37 ? 48   GLU A O     1 
ATOM   343   C  CB    . GLU A 1 44   ? 19.433  -51.505  17.323  1.00 120.37 ? 48   GLU A CB    1 
ATOM   344   C  CG    . GLU A 1 44   ? 18.803  -51.539  15.944  1.00 132.20 ? 48   GLU A CG    1 
ATOM   345   C  CD    . GLU A 1 44   ? 19.622  -52.361  14.966  1.00 140.97 ? 48   GLU A CD    1 
ATOM   346   O  OE1   . GLU A 1 44   ? 20.378  -53.244  15.423  1.00 149.08 ? 48   GLU A OE1   1 
ATOM   347   O  OE2   . GLU A 1 44   ? 19.522  -52.115  13.747  1.00 144.33 ? 48   GLU A OE2   1 
ATOM   348   N  N     . VAL A 1 45   ? 20.825  -50.333  19.676  1.00 98.71  ? 49   VAL A N     1 
ATOM   349   C  CA    . VAL A 1 45   ? 21.638  -50.436  20.878  1.00 90.31  ? 49   VAL A CA    1 
ATOM   350   C  C     . VAL A 1 45   ? 21.092  -49.604  22.028  1.00 94.99  ? 49   VAL A C     1 
ATOM   351   O  O     . VAL A 1 45   ? 20.971  -50.095  23.152  1.00 94.42  ? 49   VAL A O     1 
ATOM   352   C  CB    . VAL A 1 45   ? 23.087  -49.992  20.609  1.00 86.77  ? 49   VAL A CB    1 
ATOM   353   C  CG1   . VAL A 1 45   ? 23.885  -49.965  21.907  1.00 80.50  ? 49   VAL A CG1   1 
ATOM   354   C  CG2   . VAL A 1 45   ? 23.746  -50.909  19.592  1.00 77.06  ? 49   VAL A CG2   1 
ATOM   355   N  N     . LEU A 1 46   ? 20.766  -48.344  21.753  1.00 92.66  ? 50   LEU A N     1 
ATOM   356   C  CA    . LEU A 1 46   ? 20.306  -47.444  22.811  1.00 86.48  ? 50   LEU A CA    1 
ATOM   357   C  C     . LEU A 1 46   ? 18.959  -47.878  23.384  1.00 90.62  ? 50   LEU A C     1 
ATOM   358   O  O     . LEU A 1 46   ? 18.777  -47.876  24.599  1.00 94.02  ? 50   LEU A O     1 
ATOM   359   C  CB    . LEU A 1 46   ? 20.228  -46.012  22.295  1.00 83.93  ? 50   LEU A CB    1 
ATOM   360   C  CG    . LEU A 1 46   ? 21.612  -45.419  22.033  1.00 87.91  ? 50   LEU A CG    1 
ATOM   361   C  CD1   . LEU A 1 46   ? 21.495  -44.062  21.393  1.00 101.69 ? 50   LEU A CD1   1 
ATOM   362   C  CD2   . LEU A 1 46   ? 22.410  -45.321  23.310  1.00 78.56  ? 50   LEU A CD2   1 
ATOM   363   N  N     . THR A 1 47   ? 18.020  -48.253  22.516  1.00 93.78  ? 51   THR A N     1 
ATOM   364   C  CA    . THR A 1 47   ? 16.742  -48.797  22.983  1.00 98.28  ? 51   THR A CA    1 
ATOM   365   C  C     . THR A 1 47   ? 16.953  -50.050  23.837  1.00 112.12 ? 51   THR A C     1 
ATOM   366   O  O     . THR A 1 47   ? 16.517  -50.125  24.991  1.00 118.26 ? 51   THR A O     1 
ATOM   367   C  CB    . THR A 1 47   ? 15.822  -49.145  21.809  1.00 95.83  ? 51   THR A CB    1 
ATOM   368   O  OG1   . THR A 1 47   ? 16.619  -49.423  20.651  1.00 115.29 ? 51   THR A OG1   1 
ATOM   369   C  CG2   . THR A 1 47   ? 14.905  -47.989  21.500  1.00 93.95  ? 51   THR A CG2   1 
ATOM   370   N  N     . HIS A 1 48   ? 17.629  -51.021  23.235  1.00 127.71 ? 52   HIS A N     1 
ATOM   371   C  CA    . HIS A 1 48   ? 18.011  -52.280  23.864  1.00 135.70 ? 52   HIS A CA    1 
ATOM   372   C  C     . HIS A 1 48   ? 18.541  -52.067  25.278  1.00 126.01 ? 52   HIS A C     1 
ATOM   373   O  O     . HIS A 1 48   ? 18.044  -52.659  26.241  1.00 133.78 ? 52   HIS A O     1 
ATOM   374   C  CB    . HIS A 1 48   ? 19.073  -52.972  23.000  1.00 155.74 ? 52   HIS A CB    1 
ATOM   375   C  CG    . HIS A 1 48   ? 19.211  -54.440  23.247  1.00 165.10 ? 52   HIS A CG    1 
ATOM   376   N  ND1   . HIS A 1 48   ? 19.406  -54.971  24.504  1.00 168.60 ? 52   HIS A ND1   1 
ATOM   377   C  CD2   . HIS A 1 48   ? 19.212  -55.488  22.391  1.00 169.81 ? 52   HIS A CD2   1 
ATOM   378   C  CE1   . HIS A 1 48   ? 19.506  -56.285  24.412  1.00 176.08 ? 52   HIS A CE1   1 
ATOM   379   N  NE2   . HIS A 1 48   ? 19.393  -56.624  23.141  1.00 176.30 ? 52   HIS A NE2   1 
ATOM   380   N  N     . LEU A 1 49   ? 19.547  -51.207  25.394  1.00 117.48 ? 53   LEU A N     1 
ATOM   381   C  CA    . LEU A 1 49   ? 20.188  -50.928  26.674  1.00 108.16 ? 53   LEU A CA    1 
ATOM   382   C  C     . LEU A 1 49   ? 19.220  -50.278  27.646  1.00 110.99 ? 53   LEU A C     1 
ATOM   383   O  O     . LEU A 1 49   ? 19.078  -50.719  28.779  1.00 112.97 ? 53   LEU A O     1 
ATOM   384   C  CB    . LEU A 1 49   ? 21.409  -50.029  26.472  1.00 88.17  ? 53   LEU A CB    1 
ATOM   385   C  CG    . LEU A 1 49   ? 22.229  -49.652  27.704  1.00 75.06  ? 53   LEU A CG    1 
ATOM   386   C  CD1   . LEU A 1 49   ? 23.676  -49.498  27.310  1.00 76.46  ? 53   LEU A CD1   1 
ATOM   387   C  CD2   . LEU A 1 49   ? 21.738  -48.382  28.328  1.00 79.33  ? 53   LEU A CD2   1 
ATOM   388   N  N     . LYS A 1 50   ? 18.570  -49.214  27.187  1.00 108.69 ? 54   LYS A N     1 
ATOM   389   C  CA    . LYS A 1 50   ? 17.582  -48.482  27.976  1.00 106.78 ? 54   LYS A CA    1 
ATOM   390   C  C     . LYS A 1 50   ? 16.586  -49.421  28.643  1.00 97.04  ? 54   LYS A C     1 
ATOM   391   O  O     . LYS A 1 50   ? 16.182  -49.197  29.780  1.00 79.76  ? 54   LYS A O     1 
ATOM   392   C  CB    . LYS A 1 50   ? 16.838  -47.476  27.093  1.00 108.86 ? 54   LYS A CB    1 
ATOM   393   C  CG    . LYS A 1 50   ? 15.793  -46.642  27.818  1.00 106.17 ? 54   LYS A CG    1 
ATOM   394   C  CD    . LYS A 1 50   ? 14.843  -45.991  26.820  1.00 110.08 ? 54   LYS A CD    1 
ATOM   395   C  CE    . LYS A 1 50   ? 13.987  -44.931  27.481  1.00 104.24 ? 54   LYS A CE    1 
ATOM   396   N  NZ    . LYS A 1 50   ? 12.533  -45.123  27.198  1.00 102.36 ? 54   LYS A NZ    1 
ATOM   397   N  N     . GLU A 1 51   ? 16.213  -50.484  27.934  1.00 118.24 ? 55   GLU A N     1 
ATOM   398   C  CA    . GLU A 1 51   ? 15.282  -51.472  28.479  1.00 126.88 ? 55   GLU A CA    1 
ATOM   399   C  C     . GLU A 1 51   ? 15.803  -52.207  29.725  1.00 113.29 ? 55   GLU A C     1 
ATOM   400   O  O     . GLU A 1 51   ? 15.023  -52.531  30.620  1.00 105.41 ? 55   GLU A O     1 
ATOM   401   C  CB    . GLU A 1 51   ? 14.920  -52.504  27.409  1.00 145.97 ? 55   GLU A CB    1 
ATOM   402   C  CG    . GLU A 1 51   ? 14.022  -51.981  26.304  1.00 163.50 ? 55   GLU A CG    1 
ATOM   403   C  CD    . GLU A 1 51   ? 13.645  -53.063  25.305  1.00 181.33 ? 55   GLU A CD    1 
ATOM   404   O  OE1   . GLU A 1 51   ? 13.257  -54.169  25.742  1.00 188.68 ? 55   GLU A OE1   1 
ATOM   405   O  OE2   . GLU A 1 51   ? 13.745  -52.810  24.085  1.00 186.63 ? 55   GLU A OE2   1 
ATOM   406   N  N     . HIS A 1 52   ? 17.109  -52.465  29.777  1.00 108.36 ? 56   HIS A N     1 
ATOM   407   C  CA    . HIS A 1 52   ? 17.704  -53.316  30.811  1.00 109.47 ? 56   HIS A CA    1 
ATOM   408   C  C     . HIS A 1 52   ? 17.340  -52.890  32.236  1.00 112.38 ? 56   HIS A C     1 
ATOM   409   O  O     . HIS A 1 52   ? 17.410  -51.709  32.572  1.00 123.74 ? 56   HIS A O     1 
ATOM   410   C  CB    . HIS A 1 52   ? 19.229  -53.342  30.659  1.00 112.12 ? 56   HIS A CB    1 
ATOM   411   C  CG    . HIS A 1 52   ? 19.909  -54.411  31.465  1.00 121.56 ? 56   HIS A CG    1 
ATOM   412   N  ND1   . HIS A 1 52   ? 21.090  -54.195  32.141  1.00 136.11 ? 56   HIS A ND1   1 
ATOM   413   C  CD2   . HIS A 1 52   ? 19.586  -55.707  31.684  1.00 114.96 ? 56   HIS A CD2   1 
ATOM   414   C  CE1   . HIS A 1 52   ? 21.458  -55.307  32.753  1.00 131.74 ? 56   HIS A CE1   1 
ATOM   415   N  NE2   . HIS A 1 52   ? 20.557  -56.238  32.498  1.00 124.40 ? 56   HIS A NE2   1 
ATOM   416   N  N     . PRO A 1 53   ? 16.945  -53.860  33.075  1.00 105.18 ? 57   PRO A N     1 
ATOM   417   C  CA    . PRO A 1 53   ? 16.582  -53.656  34.480  1.00 91.98  ? 57   PRO A CA    1 
ATOM   418   C  C     . PRO A 1 53   ? 17.674  -53.043  35.359  1.00 99.25  ? 57   PRO A C     1 
ATOM   419   O  O     . PRO A 1 53   ? 17.358  -52.625  36.471  1.00 115.76 ? 57   PRO A O     1 
ATOM   420   C  CB    . PRO A 1 53   ? 16.258  -55.078  34.958  1.00 81.66  ? 57   PRO A CB    1 
ATOM   421   C  CG    . PRO A 1 53   ? 16.867  -55.982  33.932  1.00 89.94  ? 57   PRO A CG    1 
ATOM   422   C  CD    . PRO A 1 53   ? 16.663  -55.245  32.667  1.00 98.26  ? 57   PRO A CD    1 
ATOM   423   N  N     . ASP A 1 54   ? 18.919  -52.991  34.896  1.00 96.48  ? 58   ASP A N     1 
ATOM   424   C  CA    . ASP A 1 54   ? 19.997  -52.471  35.735  1.00 103.59 ? 58   ASP A CA    1 
ATOM   425   C  C     . ASP A 1 54   ? 20.756  -51.311  35.098  1.00 107.24 ? 58   ASP A C     1 
ATOM   426   O  O     . ASP A 1 54   ? 21.766  -50.853  35.645  1.00 91.23  ? 58   ASP A O     1 
ATOM   427   C  CB    . ASP A 1 54   ? 20.984  -53.583  36.087  1.00 122.07 ? 58   ASP A CB    1 
ATOM   428   C  CG    . ASP A 1 54   ? 20.363  -54.666  36.944  1.00 140.04 ? 58   ASP A CG    1 
ATOM   429   O  OD1   . ASP A 1 54   ? 20.885  -55.800  36.941  1.00 145.63 ? 58   ASP A OD1   1 
ATOM   430   O  OD2   . ASP A 1 54   ? 19.349  -54.386  37.617  1.00 145.50 ? 58   ASP A OD2   1 
ATOM   431   N  N     . ALA A 1 55   ? 20.269  -50.826  33.958  1.00 104.72 ? 59   ALA A N     1 
ATOM   432   C  CA    . ALA A 1 55   ? 20.958  -49.760  33.238  1.00 91.17  ? 59   ALA A CA    1 
ATOM   433   C  C     . ALA A 1 55   ? 21.034  -48.488  34.080  1.00 97.87  ? 59   ALA A C     1 
ATOM   434   O  O     . ALA A 1 55   ? 22.006  -47.732  33.994  1.00 106.49 ? 59   ALA A O     1 
ATOM   435   C  CB    . ALA A 1 55   ? 20.279  -49.486  31.928  1.00 85.72  ? 59   ALA A CB    1 
ATOM   436   N  N     . TRP A 1 56   ? 20.015  -48.264  34.906  1.00 96.83  ? 60   TRP A N     1 
ATOM   437   C  CA    . TRP A 1 56   ? 19.953  -47.067  35.749  1.00 96.80  ? 60   TRP A CA    1 
ATOM   438   C  C     . TRP A 1 56   ? 21.143  -46.959  36.680  1.00 99.98  ? 60   TRP A C     1 
ATOM   439   O  O     . TRP A 1 56   ? 21.609  -45.869  36.979  1.00 99.97  ? 60   TRP A O     1 
ATOM   440   C  CB    . TRP A 1 56   ? 18.675  -47.055  36.574  1.00 89.23  ? 60   TRP A CB    1 
ATOM   441   C  CG    . TRP A 1 56   ? 18.570  -48.200  37.518  1.00 96.25  ? 60   TRP A CG    1 
ATOM   442   C  CD1   . TRP A 1 56   ? 18.257  -49.494  37.212  1.00 107.68 ? 60   TRP A CD1   1 
ATOM   443   C  CD2   . TRP A 1 56   ? 18.790  -48.165  38.930  1.00 104.32 ? 60   TRP A CD2   1 
ATOM   444   N  NE1   . TRP A 1 56   ? 18.272  -50.268  38.351  1.00 108.25 ? 60   TRP A NE1   1 
ATOM   445   C  CE2   . TRP A 1 56   ? 18.593  -49.473  39.419  1.00 105.83 ? 60   TRP A CE2   1 
ATOM   446   C  CE3   . TRP A 1 56   ? 19.134  -47.157  39.830  1.00 102.67 ? 60   TRP A CE3   1 
ATOM   447   C  CZ2   . TRP A 1 56   ? 18.723  -49.791  40.767  1.00 94.89  ? 60   TRP A CZ2   1 
ATOM   448   C  CZ3   . TRP A 1 56   ? 19.265  -47.483  41.163  1.00 100.24 ? 60   TRP A CZ3   1 
ATOM   449   C  CH2   . TRP A 1 56   ? 19.061  -48.785  41.617  1.00 91.80  ? 60   TRP A CH2   1 
ATOM   450   N  N     . THR A 1 57   ? 21.626  -48.109  37.129  1.00 112.17 ? 61   THR A N     1 
ATOM   451   C  CA    . THR A 1 57   ? 22.792  -48.190  37.998  1.00 101.07 ? 61   THR A CA    1 
ATOM   452   C  C     . THR A 1 57   ? 23.972  -47.419  37.408  1.00 96.85  ? 61   THR A C     1 
ATOM   453   O  O     . THR A 1 57   ? 24.822  -46.921  38.137  1.00 94.38  ? 61   THR A O     1 
ATOM   454   C  CB    . THR A 1 57   ? 23.191  -49.666  38.243  1.00 100.05 ? 61   THR A CB    1 
ATOM   455   O  OG1   . THR A 1 57   ? 22.095  -50.350  38.860  1.00 102.32 ? 61   THR A OG1   1 
ATOM   456   C  CG2   . THR A 1 57   ? 24.415  -49.765  39.133  1.00 110.86 ? 61   THR A CG2   1 
ATOM   457   N  N     . ARG A 1 58   ? 24.015  -47.287  36.086  1.00 98.21  ? 62   ARG A N     1 
ATOM   458   C  CA    . ARG A 1 58   ? 25.147  -46.612  35.465  1.00 96.89  ? 62   ARG A CA    1 
ATOM   459   C  C     . ARG A 1 58   ? 24.889  -45.131  35.136  1.00 94.31  ? 62   ARG A C     1 
ATOM   460   O  O     . ARG A 1 58   ? 25.830  -44.390  34.827  1.00 93.98  ? 62   ARG A O     1 
ATOM   461   C  CB    . ARG A 1 58   ? 25.569  -47.378  34.212  1.00 100.71 ? 62   ARG A CB    1 
ATOM   462   C  CG    . ARG A 1 58   ? 26.218  -48.720  34.529  1.00 100.58 ? 62   ARG A CG    1 
ATOM   463   C  CD    . ARG A 1 58   ? 26.746  -49.360  33.275  1.00 112.95 ? 62   ARG A CD    1 
ATOM   464   N  NE    . ARG A 1 58   ? 27.514  -50.569  33.528  1.00 131.42 ? 62   ARG A NE    1 
ATOM   465   C  CZ    . ARG A 1 58   ? 28.756  -50.583  33.995  1.00 142.52 ? 62   ARG A CZ    1 
ATOM   466   N  NH1   . ARG A 1 58   ? 29.378  -49.460  34.286  1.00 139.03 ? 62   ARG A NH1   1 
ATOM   467   N  NH2   . ARG A 1 58   ? 29.381  -51.722  34.174  1.00 161.04 ? 62   ARG A NH2   1 
ATOM   468   N  N     . VAL A 1 59   ? 23.634  -44.696  35.245  1.00 83.48  ? 63   VAL A N     1 
ATOM   469   C  CA    . VAL A 1 59   ? 23.262  -43.327  34.900  1.00 84.48  ? 63   VAL A CA    1 
ATOM   470   C  C     . VAL A 1 59   ? 24.098  -42.267  35.617  1.00 100.14 ? 63   VAL A C     1 
ATOM   471   O  O     . VAL A 1 59   ? 24.547  -41.307  34.992  1.00 110.37 ? 63   VAL A O     1 
ATOM   472   C  CB    . VAL A 1 59   ? 21.775  -43.056  35.200  1.00 89.01  ? 63   VAL A CB    1 
ATOM   473   C  CG1   . VAL A 1 59   ? 21.438  -41.575  34.985  1.00 77.38  ? 63   VAL A CG1   1 
ATOM   474   C  CG2   . VAL A 1 59   ? 20.901  -43.924  34.319  1.00 101.59 ? 63   VAL A CG2   1 
ATOM   475   N  N     . ASP A 1 60   ? 24.318  -42.441  36.917  1.00 106.37 ? 64   ASP A N     1 
ATOM   476   C  CA    . ASP A 1 60   ? 25.103  -41.468  37.673  1.00 109.05 ? 64   ASP A CA    1 
ATOM   477   C  C     . ASP A 1 60   ? 26.462  -41.285  37.013  1.00 107.90 ? 64   ASP A C     1 
ATOM   478   O  O     . ASP A 1 60   ? 26.894  -40.157  36.784  1.00 111.11 ? 64   ASP A O     1 
ATOM   479   C  CB    . ASP A 1 60   ? 25.248  -41.886  39.148  1.00 119.49 ? 64   ASP A CB    1 
ATOM   480   C  CG    . ASP A 1 60   ? 26.097  -43.133  39.338  1.00 129.66 ? 64   ASP A CG    1 
ATOM   481   O  OD1   . ASP A 1 60   ? 25.626  -44.234  38.986  1.00 133.50 ? 64   ASP A OD1   1 
ATOM   482   O  OD2   . ASP A 1 60   ? 27.228  -43.013  39.857  1.00 132.01 ? 64   ASP A OD2   1 
ATOM   483   N  N     . THR A 1 61   ? 27.094  -42.394  36.635  1.00 120.31 ? 65   THR A N     1 
ATOM   484   C  CA    . THR A 1 61   ? 28.404  -42.333  35.988  1.00 109.85 ? 65   THR A CA    1 
ATOM   485   C  C     . THR A 1 61   ? 28.280  -41.568  34.673  1.00 99.91  ? 65   THR A C     1 
ATOM   486   O  O     . THR A 1 61   ? 29.089  -40.687  34.359  1.00 92.39  ? 65   THR A O     1 
ATOM   487   C  CB    . THR A 1 61   ? 28.981  -43.732  35.718  1.00 101.56 ? 65   THR A CB    1 
ATOM   488   O  OG1   . THR A 1 61   ? 29.034  -44.470  36.945  1.00 117.66 ? 65   THR A OG1   1 
ATOM   489   C  CG2   . THR A 1 61   ? 30.377  -43.624  35.137  1.00 95.99  ? 65   THR A CG2   1 
ATOM   490   N  N     . ILE A 1 62   ? 27.227  -41.892  33.931  1.00 84.18  ? 66   ILE A N     1 
ATOM   491   C  CA    . ILE A 1 62   ? 26.926  -41.208  32.690  1.00 82.96  ? 66   ILE A CA    1 
ATOM   492   C  C     . ILE A 1 62   ? 26.786  -39.708  32.928  1.00 93.86  ? 66   ILE A C     1 
ATOM   493   O  O     . ILE A 1 62   ? 27.286  -38.902  32.140  1.00 100.43 ? 66   ILE A O     1 
ATOM   494   C  CB    . ILE A 1 62   ? 25.632  -41.761  32.049  1.00 78.98  ? 66   ILE A CB    1 
ATOM   495   C  CG1   . ILE A 1 62   ? 25.774  -43.258  31.784  1.00 83.97  ? 66   ILE A CG1   1 
ATOM   496   C  CG2   . ILE A 1 62   ? 25.298  -41.018  30.774  1.00 70.98  ? 66   ILE A CG2   1 
ATOM   497   C  CD1   . ILE A 1 62   ? 24.535  -43.883  31.197  1.00 75.23  ? 66   ILE A CD1   1 
ATOM   498   N  N     . LEU A 1 63   ? 26.124  -39.328  34.020  1.00 89.90  ? 67   LEU A N     1 
ATOM   499   C  CA    . LEU A 1 63   ? 25.896  -37.907  34.267  1.00 93.68  ? 67   LEU A CA    1 
ATOM   500   C  C     . LEU A 1 63   ? 27.164  -37.263  34.811  1.00 96.43  ? 67   LEU A C     1 
ATOM   501   O  O     . LEU A 1 63   ? 27.350  -36.059  34.726  1.00 84.41  ? 67   LEU A O     1 
ATOM   502   C  CB    . LEU A 1 63   ? 24.734  -37.697  35.236  1.00 92.26  ? 67   LEU A CB    1 
ATOM   503   C  CG    . LEU A 1 63   ? 23.333  -37.969  34.690  1.00 83.16  ? 67   LEU A CG    1 
ATOM   504   C  CD1   . LEU A 1 63   ? 22.271  -37.628  35.736  1.00 77.74  ? 67   LEU A CD1   1 
ATOM   505   C  CD2   . LEU A 1 63   ? 23.095  -37.190  33.407  1.00 74.94  ? 67   LEU A CD2   1 
ATOM   506   N  N     . GLU A 1 64   ? 28.057  -38.087  35.341  1.00 106.53 ? 68   GLU A N     1 
ATOM   507   C  CA    . GLU A 1 64   ? 29.229  -37.573  36.030  1.00 104.69 ? 68   GLU A CA    1 
ATOM   508   C  C     . GLU A 1 64   ? 30.381  -37.299  35.071  1.00 108.33 ? 68   GLU A C     1 
ATOM   509   O  O     . GLU A 1 64   ? 31.101  -36.317  35.230  1.00 96.65  ? 68   GLU A O     1 
ATOM   510   C  CB    . GLU A 1 64   ? 29.678  -38.557  37.118  1.00 113.59 ? 68   GLU A CB    1 
ATOM   511   C  CG    . GLU A 1 64   ? 30.307  -37.884  38.331  1.00 123.74 ? 68   GLU A CG    1 
ATOM   512   C  CD    . GLU A 1 64   ? 29.314  -37.037  39.098  1.00 118.29 ? 68   GLU A CD    1 
ATOM   513   O  OE1   . GLU A 1 64   ? 28.646  -37.579  40.002  1.00 132.46 ? 68   GLU A OE1   1 
ATOM   514   O  OE2   . GLU A 1 64   ? 29.197  -35.831  38.798  1.00 112.22 ? 68   GLU A OE2   1 
ATOM   515   N  N     . PHE A 1 65   ? 30.556  -38.169  34.079  1.00 108.59 ? 69   PHE A N     1 
ATOM   516   C  CA    . PHE A 1 65   ? 31.758  -38.133  33.253  1.00 92.46  ? 69   PHE A CA    1 
ATOM   517   C  C     . PHE A 1 65   ? 31.504  -37.755  31.785  1.00 91.83  ? 69   PHE A C     1 
ATOM   518   O  O     . PHE A 1 65   ? 32.421  -37.307  31.098  1.00 96.13  ? 69   PHE A O     1 
ATOM   519   C  CB    . PHE A 1 65   ? 32.468  -39.486  33.320  1.00 100.47 ? 69   PHE A CB    1 
ATOM   520   C  CG    . PHE A 1 65   ? 32.935  -39.862  34.696  1.00 115.85 ? 69   PHE A CG    1 
ATOM   521   C  CD1   . PHE A 1 65   ? 33.181  -38.893  35.657  1.00 122.56 ? 69   PHE A CD1   1 
ATOM   522   C  CD2   . PHE A 1 65   ? 33.135  -41.193  35.031  1.00 129.43 ? 69   PHE A CD2   1 
ATOM   523   C  CE1   . PHE A 1 65   ? 33.613  -39.246  36.929  1.00 116.17 ? 69   PHE A CE1   1 
ATOM   524   C  CE2   . PHE A 1 65   ? 33.568  -41.548  36.301  1.00 124.71 ? 69   PHE A CE2   1 
ATOM   525   C  CZ    . PHE A 1 65   ? 33.805  -40.571  37.246  1.00 114.94 ? 69   PHE A CZ    1 
ATOM   526   N  N     . SER A 1 66   ? 30.279  -37.931  31.300  1.00 80.82  ? 70   SER A N     1 
ATOM   527   C  CA    . SER A 1 66   ? 29.993  -37.617  29.907  1.00 96.34  ? 70   SER A CA    1 
ATOM   528   C  C     . SER A 1 66   ? 30.003  -36.111  29.668  1.00 112.49 ? 70   SER A C     1 
ATOM   529   O  O     . SER A 1 66   ? 29.545  -35.337  30.507  1.00 110.03 ? 70   SER A O     1 
ATOM   530   C  CB    . SER A 1 66   ? 28.651  -38.205  29.472  1.00 102.94 ? 70   SER A CB    1 
ATOM   531   O  OG    . SER A 1 66   ? 28.394  -37.925  28.099  1.00 94.31  ? 70   SER A OG    1 
ATOM   532   N  N     . GLN A 1 67   ? 30.513  -35.703  28.511  1.00 124.32 ? 71   GLN A N     1 
ATOM   533   C  CA    . GLN A 1 67   ? 30.724  -34.288  28.226  1.00 125.77 ? 71   GLN A CA    1 
ATOM   534   C  C     . GLN A 1 67   ? 29.683  -33.707  27.272  1.00 112.08 ? 71   GLN A C     1 
ATOM   535   O  O     . GLN A 1 67   ? 29.514  -32.493  27.204  1.00 114.63 ? 71   GLN A O     1 
ATOM   536   C  CB    . GLN A 1 67   ? 32.127  -34.077  27.656  1.00 140.18 ? 71   GLN A CB    1 
ATOM   537   C  CG    . GLN A 1 67   ? 33.248  -34.555  28.570  1.00 154.57 ? 71   GLN A CG    1 
ATOM   538   C  CD    . GLN A 1 67   ? 33.516  -33.605  29.723  1.00 162.15 ? 71   GLN A CD    1 
ATOM   539   O  OE1   . GLN A 1 67   ? 33.785  -32.423  29.517  1.00 164.35 ? 71   GLN A OE1   1 
ATOM   540   N  NE2   . GLN A 1 67   ? 33.444  -34.121  30.945  1.00 166.04 ? 71   GLN A NE2   1 
ATOM   541   N  N     . ASN A 1 68   ? 28.984  -34.568  26.538  1.00 105.93 ? 72   ASN A N     1 
ATOM   542   C  CA    . ASN A 1 68   ? 27.957  -34.090  25.615  1.00 104.90 ? 72   ASN A CA    1 
ATOM   543   C  C     . ASN A 1 68   ? 26.557  -34.190  26.221  1.00 96.11  ? 72   ASN A C     1 
ATOM   544   O  O     . ASN A 1 68   ? 26.247  -35.141  26.936  1.00 97.22  ? 72   ASN A O     1 
ATOM   545   C  CB    . ASN A 1 68   ? 28.015  -34.856  24.285  1.00 114.60 ? 72   ASN A CB    1 
ATOM   546   C  CG    . ASN A 1 68   ? 27.614  -36.305  24.427  1.00 125.67 ? 72   ASN A CG    1 
ATOM   547   O  OD1   . ASN A 1 68   ? 28.065  -37.000  25.341  1.00 143.24 ? 72   ASN A OD1   1 
ATOM   548   N  ND2   . ASN A 1 68   ? 26.752  -36.771  23.528  1.00 121.03 ? 72   ASN A ND2   1 
ATOM   549   N  N     . MET A 1 69   ? 25.719  -33.200  25.926  1.00 86.49  ? 73   MET A N     1 
ATOM   550   C  CA    . MET A 1 69   ? 24.371  -33.120  26.477  1.00 91.91  ? 73   MET A CA    1 
ATOM   551   C  C     . MET A 1 69   ? 23.502  -34.310  26.099  1.00 96.57  ? 73   MET A C     1 
ATOM   552   O  O     . MET A 1 69   ? 22.723  -34.795  26.914  1.00 100.89 ? 73   MET A O     1 
ATOM   553   C  CB    . MET A 1 69   ? 23.680  -31.835  26.013  1.00 101.68 ? 73   MET A CB    1 
ATOM   554   C  CG    . MET A 1 69   ? 22.239  -31.695  26.504  1.00 104.15 ? 73   MET A CG    1 
ATOM   555   S  SD    . MET A 1 69   ? 21.119  -30.867  25.356  1.00 156.54 ? 73   MET A SD    1 
ATOM   556   C  CE    . MET A 1 69   ? 22.035  -29.368  24.981  1.00 147.52 ? 73   MET A CE    1 
ATOM   557   N  N     . ASN A 1 70   ? 23.631  -34.769  24.858  1.00 109.59 ? 74   ASN A N     1 
ATOM   558   C  CA    . ASN A 1 70   ? 22.788  -35.842  24.341  1.00 103.00 ? 74   ASN A CA    1 
ATOM   559   C  C     . ASN A 1 70   ? 22.868  -37.111  25.186  1.00 93.19  ? 74   ASN A C     1 
ATOM   560   O  O     . ASN A 1 70   ? 21.845  -37.694  25.545  1.00 92.13  ? 74   ASN A O     1 
ATOM   561   C  CB    . ASN A 1 70   ? 23.167  -36.153  22.896  1.00 103.90 ? 74   ASN A CB    1 
ATOM   562   C  CG    . ASN A 1 70   ? 22.874  -35.005  21.958  1.00 104.14 ? 74   ASN A CG    1 
ATOM   563   O  OD1   . ASN A 1 70   ? 22.584  -33.890  22.395  1.00 96.50  ? 74   ASN A OD1   1 
ATOM   564   N  ND2   . ASN A 1 70   ? 22.951  -35.271  20.656  1.00 115.31 ? 74   ASN A ND2   1 
ATOM   565   N  N     . THR A 1 71   ? 24.089  -37.525  25.508  1.00 91.39  ? 75   THR A N     1 
ATOM   566   C  CA    . THR A 1 71   ? 24.308  -38.726  26.302  1.00 93.02  ? 75   THR A CA    1 
ATOM   567   C  C     . THR A 1 71   ? 23.700  -38.577  27.689  1.00 94.43  ? 75   THR A C     1 
ATOM   568   O  O     . THR A 1 71   ? 23.062  -39.507  28.194  1.00 99.54  ? 75   THR A O     1 
ATOM   569   C  CB    . THR A 1 71   ? 25.803  -39.049  26.432  1.00 90.48  ? 75   THR A CB    1 
ATOM   570   O  OG1   . THR A 1 71   ? 26.389  -39.130  25.126  1.00 105.37 ? 75   THR A OG1   1 
ATOM   571   C  CG2   . THR A 1 71   ? 26.001  -40.368  27.146  1.00 81.75  ? 75   THR A CG2   1 
ATOM   572   N  N     . LYS A 1 72   ? 23.901  -37.407  28.297  1.00 93.05  ? 76   LYS A N     1 
ATOM   573   C  CA    . LYS A 1 72   ? 23.291  -37.091  29.588  1.00 84.14  ? 76   LYS A CA    1 
ATOM   574   C  C     . LYS A 1 72   ? 21.780  -37.271  29.514  1.00 79.57  ? 76   LYS A C     1 
ATOM   575   O  O     . LYS A 1 72   ? 21.178  -37.932  30.354  1.00 88.82  ? 76   LYS A O     1 
ATOM   576   C  CB    . LYS A 1 72   ? 23.610  -35.658  30.021  1.00 81.71  ? 76   LYS A CB    1 
ATOM   577   C  CG    . LYS A 1 72   ? 25.071  -35.353  30.326  1.00 87.82  ? 76   LYS A CG    1 
ATOM   578   C  CD    . LYS A 1 72   ? 25.185  -33.931  30.873  1.00 95.20  ? 76   LYS A CD    1 
ATOM   579   C  CE    . LYS A 1 72   ? 26.613  -33.402  30.835  1.00 108.04 ? 76   LYS A CE    1 
ATOM   580   N  NZ    . LYS A 1 72   ? 27.468  -33.961  31.925  1.00 113.57 ? 76   LYS A NZ    1 
ATOM   581   N  N     . TYR A 1 73   ? 21.183  -36.676  28.488  1.00 75.16  ? 77   TYR A N     1 
ATOM   582   C  CA    . TYR A 1 73   ? 19.746  -36.738  28.261  1.00 67.47  ? 77   TYR A CA    1 
ATOM   583   C  C     . TYR A 1 73   ? 19.288  -38.186  28.182  1.00 80.21  ? 77   TYR A C     1 
ATOM   584   O  O     . TYR A 1 73   ? 18.274  -38.561  28.783  1.00 93.91  ? 77   TYR A O     1 
ATOM   585   C  CB    . TYR A 1 73   ? 19.381  -35.978  26.974  1.00 60.93  ? 77   TYR A CB    1 
ATOM   586   C  CG    . TYR A 1 73   ? 17.900  -35.738  26.793  1.00 65.33  ? 77   TYR A CG    1 
ATOM   587   C  CD1   . TYR A 1 73   ? 17.343  -34.500  27.055  1.00 67.26  ? 77   TYR A CD1   1 
ATOM   588   C  CD2   . TYR A 1 73   ? 17.059  -36.752  26.364  1.00 71.41  ? 77   TYR A CD2   1 
ATOM   589   C  CE1   . TYR A 1 73   ? 15.987  -34.280  26.904  1.00 66.86  ? 77   TYR A CE1   1 
ATOM   590   C  CE2   . TYR A 1 73   ? 15.705  -36.542  26.206  1.00 66.73  ? 77   TYR A CE2   1 
ATOM   591   C  CZ    . TYR A 1 73   ? 15.175  -35.307  26.480  1.00 68.90  ? 77   TYR A CZ    1 
ATOM   592   O  OH    . TYR A 1 73   ? 13.827  -35.098  26.324  1.00 85.49  ? 77   TYR A OH    1 
ATOM   593   N  N     . TYR A 1 74   ? 20.046  -38.993  27.439  1.00 85.33  ? 78   TYR A N     1 
ATOM   594   C  CA    . TYR A 1 74   ? 19.770  -40.419  27.308  1.00 76.25  ? 78   TYR A CA    1 
ATOM   595   C  C     . TYR A 1 74   ? 19.751  -41.094  28.677  1.00 80.76  ? 78   TYR A C     1 
ATOM   596   O  O     . TYR A 1 74   ? 18.799  -41.799  29.024  1.00 75.98  ? 78   TYR A O     1 
ATOM   597   C  CB    . TYR A 1 74   ? 20.809  -41.080  26.408  1.00 68.06  ? 78   TYR A CB    1 
ATOM   598   C  CG    . TYR A 1 74   ? 20.657  -42.584  26.312  1.00 73.47  ? 78   TYR A CG    1 
ATOM   599   C  CD1   . TYR A 1 74   ? 19.578  -43.151  25.651  1.00 83.85  ? 78   TYR A CD1   1 
ATOM   600   C  CD2   . TYR A 1 74   ? 21.588  -43.433  26.885  1.00 70.77  ? 78   TYR A CD2   1 
ATOM   601   C  CE1   . TYR A 1 74   ? 19.430  -44.514  25.572  1.00 84.64  ? 78   TYR A CE1   1 
ATOM   602   C  CE2   . TYR A 1 74   ? 21.450  -44.796  26.807  1.00 73.03  ? 78   TYR A CE2   1 
ATOM   603   C  CZ    . TYR A 1 74   ? 20.367  -45.334  26.154  1.00 82.73  ? 78   TYR A CZ    1 
ATOM   604   O  OH    . TYR A 1 74   ? 20.230  -46.702  26.070  1.00 82.03  ? 78   TYR A OH    1 
ATOM   605   N  N     . GLY A 1 75   ? 20.804  -40.850  29.456  1.00 85.53  ? 79   GLY A N     1 
ATOM   606   C  CA    . GLY A 1 75   ? 20.893  -41.353  30.813  1.00 91.87  ? 79   GLY A CA    1 
ATOM   607   C  C     . GLY A 1 75   ? 19.667  -40.986  31.623  1.00 91.68  ? 79   GLY A C     1 
ATOM   608   O  O     . GLY A 1 75   ? 19.152  -41.797  32.408  1.00 102.87 ? 79   GLY A O     1 
ATOM   609   N  N     . LEU A 1 76   ? 19.184  -39.764  31.421  1.00 74.44  ? 80   LEU A N     1 
ATOM   610   C  CA    . LEU A 1 76   ? 17.981  -39.320  32.105  1.00 77.02  ? 80   LEU A CA    1 
ATOM   611   C  C     . LEU A 1 76   ? 16.781  -40.144  31.675  1.00 86.86  ? 80   LEU A C     1 
ATOM   612   O  O     . LEU A 1 76   ? 15.931  -40.454  32.499  1.00 90.27  ? 80   LEU A O     1 
ATOM   613   C  CB    . LEU A 1 76   ? 17.721  -37.838  31.854  1.00 73.95  ? 80   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1 76   ? 18.720  -36.890  32.512  1.00 70.01  ? 80   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1 76   ? 18.374  -35.463  32.163  1.00 74.16  ? 80   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1 76   ? 18.730  -37.090  33.996  1.00 64.28  ? 80   LEU A CD2   1 
ATOM   617   N  N     . GLN A 1 77   ? 16.707  -40.498  30.392  1.00 87.02  ? 81   GLN A N     1 
ATOM   618   C  CA    . GLN A 1 77   ? 15.632  -41.382  29.926  1.00 82.45  ? 81   GLN A CA    1 
ATOM   619   C  C     . GLN A 1 77   ? 15.682  -42.722  30.661  1.00 80.99  ? 81   GLN A C     1 
ATOM   620   O  O     . GLN A 1 77   ? 14.661  -43.228  31.164  1.00 90.14  ? 81   GLN A O     1 
ATOM   621   C  CB    . GLN A 1 77   ? 15.729  -41.620  28.427  1.00 90.46  ? 81   GLN A CB    1 
ATOM   622   C  CG    . GLN A 1 77   ? 15.749  -40.360  27.579  1.00 92.04  ? 81   GLN A CG    1 
ATOM   623   C  CD    . GLN A 1 77   ? 15.552  -40.661  26.110  1.00 86.53  ? 81   GLN A CD    1 
ATOM   624   O  OE1   . GLN A 1 77   ? 16.458  -40.477  25.295  1.00 96.84  ? 81   GLN A OE1   1 
ATOM   625   N  NE2   . GLN A 1 77   ? 14.363  -41.139  25.764  1.00 85.19  ? 81   GLN A NE2   1 
ATOM   626   N  N     . ILE A 1 78   ? 16.891  -43.273  30.739  1.00 76.94  ? 82   ILE A N     1 
ATOM   627   C  CA    . ILE A 1 78   ? 17.137  -44.516  31.467  1.00 82.66  ? 82   ILE A CA    1 
ATOM   628   C  C     . ILE A 1 78   ? 16.610  -44.437  32.888  1.00 84.92  ? 82   ILE A C     1 
ATOM   629   O  O     . ILE A 1 78   ? 15.973  -45.370  33.379  1.00 84.03  ? 82   ILE A O     1 
ATOM   630   C  CB    . ILE A 1 78   ? 18.636  -44.854  31.533  1.00 88.71  ? 82   ILE A CB    1 
ATOM   631   C  CG1   . ILE A 1 78   ? 19.278  -44.792  30.142  1.00 87.06  ? 82   ILE A CG1   1 
ATOM   632   C  CG2   . ILE A 1 78   ? 18.835  -46.227  32.151  1.00 98.25  ? 82   ILE A CG2   1 
ATOM   633   C  CD1   . ILE A 1 78   ? 20.774  -45.039  30.164  1.00 78.27  ? 82   ILE A CD1   1 
ATOM   634   N  N     . LEU A 1 79   ? 16.885  -43.308  33.533  1.00 83.33  ? 83   LEU A N     1 
ATOM   635   C  CA    . LEU A 1 79   ? 16.463  -43.058  34.908  1.00 81.91  ? 83   LEU A CA    1 
ATOM   636   C  C     . LEU A 1 79   ? 14.945  -42.965  35.038  1.00 80.59  ? 83   LEU A C     1 
ATOM   637   O  O     . LEU A 1 79   ? 14.327  -43.571  35.928  1.00 96.96  ? 83   LEU A O     1 
ATOM   638   C  CB    . LEU A 1 79   ? 17.098  -41.766  35.399  1.00 85.89  ? 83   LEU A CB    1 
ATOM   639   C  CG    . LEU A 1 79   ? 17.475  -41.656  36.865  1.00 88.95  ? 83   LEU A CG    1 
ATOM   640   C  CD1   . LEU A 1 79   ? 18.128  -42.947  37.315  1.00 97.20  ? 83   LEU A CD1   1 
ATOM   641   C  CD2   . LEU A 1 79   ? 18.423  -40.487  37.030  1.00 86.40  ? 83   LEU A CD2   1 
ATOM   642   N  N     . GLU A 1 80   ? 14.362  -42.192  34.132  1.00 71.81  ? 84   GLU A N     1 
ATOM   643   C  CA    . GLU A 1 80   ? 12.934  -41.951  34.093  1.00 80.31  ? 84   GLU A CA    1 
ATOM   644   C  C     . GLU A 1 80   ? 12.199  -43.266  34.050  1.00 89.58  ? 84   GLU A C     1 
ATOM   645   O  O     . GLU A 1 80   ? 11.195  -43.437  34.734  1.00 86.86  ? 84   GLU A O     1 
ATOM   646   C  CB    . GLU A 1 80   ? 12.555  -41.100  32.881  1.00 84.38  ? 84   GLU A CB    1 
ATOM   647   C  CG    . GLU A 1 80   ? 11.139  -40.573  32.938  1.00 108.16 ? 84   GLU A CG    1 
ATOM   648   C  CD    . GLU A 1 80   ? 10.682  -39.970  31.627  1.00 124.50 ? 84   GLU A CD    1 
ATOM   649   O  OE1   . GLU A 1 80   ? 10.673  -40.698  30.613  1.00 129.28 ? 84   GLU A OE1   1 
ATOM   650   O  OE2   . GLU A 1 80   ? 10.319  -38.774  31.612  1.00 136.92 ? 84   GLU A OE2   1 
ATOM   651   N  N     . ASN A 1 81   ? 12.714  -44.200  33.252  1.00 95.69  ? 85   ASN A N     1 
ATOM   652   C  CA    . ASN A 1 81   ? 12.096  -45.520  33.163  1.00 98.29  ? 85   ASN A CA    1 
ATOM   653   C  C     . ASN A 1 81   ? 11.992  -46.239  34.520  1.00 89.28  ? 85   ASN A C     1 
ATOM   654   O  O     . ASN A 1 81   ? 10.913  -46.711  34.913  1.00 85.43  ? 85   ASN A O     1 
ATOM   655   C  CB    . ASN A 1 81   ? 12.863  -46.389  32.167  1.00 92.08  ? 85   ASN A CB    1 
ATOM   656   C  CG    . ASN A 1 81   ? 12.267  -47.759  32.023  1.00 94.10  ? 85   ASN A CG    1 
ATOM   657   O  OD1   . ASN A 1 81   ? 11.146  -47.908  31.542  1.00 96.65  ? 85   ASN A OD1   1 
ATOM   658   N  ND2   . ASN A 1 81   ? 13.008  -48.776  32.443  1.00 96.68  ? 85   ASN A ND2   1 
ATOM   659   N  N     . VAL A 1 82   ? 13.112  -46.325  35.230  1.00 80.91  ? 86   VAL A N     1 
ATOM   660   C  CA    . VAL A 1 82   ? 13.114  -46.953  36.542  1.00 86.20  ? 86   VAL A CA    1 
ATOM   661   C  C     . VAL A 1 82   ? 12.148  -46.264  37.470  1.00 89.07  ? 86   VAL A C     1 
ATOM   662   O  O     . VAL A 1 82   ? 11.349  -46.913  38.117  1.00 90.86  ? 86   VAL A O     1 
ATOM   663   C  CB    . VAL A 1 82   ? 14.484  -46.933  37.208  1.00 83.47  ? 86   VAL A CB    1 
ATOM   664   C  CG1   . VAL A 1 82   ? 14.385  -47.566  38.576  1.00 90.87  ? 86   VAL A CG1   1 
ATOM   665   C  CG2   . VAL A 1 82   ? 15.431  -47.707  36.391  1.00 105.46 ? 86   VAL A CG2   1 
ATOM   666   N  N     . ILE A 1 83   ? 12.215  -44.946  37.543  1.00 82.97  ? 87   ILE A N     1 
ATOM   667   C  CA    . ILE A 1 83   ? 11.311  -44.255  38.448  1.00 81.75  ? 87   ILE A CA    1 
ATOM   668   C  C     . ILE A 1 83   ? 9.857   -44.558  38.098  1.00 85.79  ? 87   ILE A C     1 
ATOM   669   O  O     . ILE A 1 83   ? 9.042   -44.829  38.978  1.00 102.18 ? 87   ILE A O     1 
ATOM   670   C  CB    . ILE A 1 83   ? 11.546  -42.749  38.427  1.00 75.18  ? 87   ILE A CB    1 
ATOM   671   C  CG1   . ILE A 1 83   ? 13.030  -42.468  38.623  1.00 68.36  ? 87   ILE A CG1   1 
ATOM   672   C  CG2   . ILE A 1 83   ? 10.730  -42.078  39.502  1.00 86.46  ? 87   ILE A CG2   1 
ATOM   673   C  CD1   . ILE A 1 83   ? 13.377  -41.021  38.583  1.00 68.74  ? 87   ILE A CD1   1 
ATOM   674   N  N     . LYS A 1 84   ? 9.549   -44.547  36.809  1.00 64.44  ? 88   LYS A N     1 
ATOM   675   C  CA    . LYS A 1 84   ? 8.197   -44.790  36.355  1.00 62.24  ? 88   LYS A CA    1 
ATOM   676   C  C     . LYS A 1 84   ? 7.700   -46.194  36.696  1.00 77.29  ? 88   LYS A C     1 
ATOM   677   O  O     . LYS A 1 84   ? 6.503   -46.375  36.909  1.00 89.18  ? 88   LYS A O     1 
ATOM   678   C  CB    . LYS A 1 84   ? 8.097   -44.566  34.843  1.00 69.11  ? 88   LYS A CB    1 
ATOM   679   C  CG    . LYS A 1 84   ? 8.112   -43.123  34.402  1.00 71.40  ? 88   LYS A CG    1 
ATOM   680   C  CD    . LYS A 1 84   ? 7.153   -42.918  33.247  1.00 84.44  ? 88   LYS A CD    1 
ATOM   681   C  CE    . LYS A 1 84   ? 7.407   -41.613  32.519  1.00 104.32 ? 88   LYS A CE    1 
ATOM   682   N  NZ    . LYS A 1 84   ? 8.391   -41.798  31.418  1.00 115.11 ? 88   LYS A NZ    1 
ATOM   683   N  N     . THR A 1 85   ? 8.591   -47.187  36.743  1.00 76.52  ? 89   THR A N     1 
ATOM   684   C  CA    . THR A 1 85   ? 8.106   -48.571  36.814  1.00 86.99  ? 89   THR A CA    1 
ATOM   685   C  C     . THR A 1 85   ? 8.579   -49.439  37.991  1.00 83.01  ? 89   THR A C     1 
ATOM   686   O  O     . THR A 1 85   ? 7.849   -50.323  38.435  1.00 77.30  ? 89   THR A O     1 
ATOM   687   C  CB    . THR A 1 85   ? 8.460   -49.334  35.503  1.00 90.75  ? 89   THR A CB    1 
ATOM   688   O  OG1   . THR A 1 85   ? 9.884   -49.340  35.303  1.00 73.85  ? 89   THR A OG1   1 
ATOM   689   C  CG2   . THR A 1 85   ? 7.776   -48.678  34.317  1.00 87.11  ? 89   THR A CG2   1 
ATOM   690   N  N     . ARG A 1 86   ? 9.794   -49.211  38.473  1.00 76.06  ? 90   ARG A N     1 
ATOM   691   C  CA    . ARG A 1 86   ? 10.385  -50.043  39.510  1.00 80.29  ? 90   ARG A CA    1 
ATOM   692   C  C     . ARG A 1 86   ? 10.878  -49.264  40.735  1.00 87.00  ? 90   ARG A C     1 
ATOM   693   O  O     . ARG A 1 86   ? 11.695  -49.773  41.502  1.00 99.83  ? 90   ARG A O     1 
ATOM   694   C  CB    . ARG A 1 86   ? 11.541  -50.848  38.920  1.00 88.09  ? 90   ARG A CB    1 
ATOM   695   C  CG    . ARG A 1 86   ? 11.096  -51.924  37.941  1.00 94.98  ? 90   ARG A CG    1 
ATOM   696   C  CD    . ARG A 1 86   ? 12.261  -52.750  37.426  1.00 109.43 ? 90   ARG A CD    1 
ATOM   697   N  NE    . ARG A 1 86   ? 13.112  -51.997  36.511  1.00 120.89 ? 90   ARG A NE    1 
ATOM   698   C  CZ    . ARG A 1 86   ? 14.405  -51.770  36.709  1.00 128.92 ? 90   ARG A CZ    1 
ATOM   699   N  NH1   . ARG A 1 86   ? 15.003  -52.245  37.795  1.00 134.09 ? 90   ARG A NH1   1 
ATOM   700   N  NH2   . ARG A 1 86   ? 15.099  -51.070  35.819  1.00 128.57 ? 90   ARG A NH2   1 
ATOM   701   N  N     . TRP A 1 87   ? 10.375  -48.049  40.931  1.00 84.17  ? 91   TRP A N     1 
ATOM   702   C  CA    . TRP A 1 87   ? 10.804  -47.213  42.053  1.00 90.19  ? 91   TRP A CA    1 
ATOM   703   C  C     . TRP A 1 87   ? 10.424  -47.841  43.397  1.00 101.34 ? 91   TRP A C     1 
ATOM   704   O  O     . TRP A 1 87   ? 11.187  -47.783  44.353  1.00 122.79 ? 91   TRP A O     1 
ATOM   705   C  CB    . TRP A 1 87   ? 10.200  -45.808  41.936  1.00 81.95  ? 91   TRP A CB    1 
ATOM   706   C  CG    . TRP A 1 87   ? 10.536  -44.883  43.084  1.00 87.53  ? 91   TRP A CG    1 
ATOM   707   C  CD1   . TRP A 1 87   ? 9.839   -44.738  44.254  1.00 92.24  ? 91   TRP A CD1   1 
ATOM   708   C  CD2   . TRP A 1 87   ? 11.642  -43.978  43.167  1.00 78.53  ? 91   TRP A CD2   1 
ATOM   709   N  NE1   . TRP A 1 87   ? 10.445  -43.807  45.061  1.00 82.33  ? 91   TRP A NE1   1 
ATOM   710   C  CE2   . TRP A 1 87   ? 11.557  -43.327  44.420  1.00 81.62  ? 91   TRP A CE2   1 
ATOM   711   C  CE3   . TRP A 1 87   ? 12.704  -43.665  42.313  1.00 76.62  ? 91   TRP A CE3   1 
ATOM   712   C  CZ2   . TRP A 1 87   ? 12.485  -42.374  44.835  1.00 83.16  ? 91   TRP A CZ2   1 
ATOM   713   C  CZ3   . TRP A 1 87   ? 13.624  -42.718  42.723  1.00 90.47  ? 91   TRP A CZ3   1 
ATOM   714   C  CH2   . TRP A 1 87   ? 13.508  -42.081  43.976  1.00 89.34  ? 91   TRP A CH2   1 
ATOM   715   N  N     . LYS A 1 88   ? 9.247   -48.455  43.456  1.00 98.73  ? 92   LYS A N     1 
ATOM   716   C  CA    . LYS A 1 88   ? 8.735   -49.032  44.693  1.00 78.70  ? 92   LYS A CA    1 
ATOM   717   C  C     . LYS A 1 88   ? 9.381   -50.370  45.061  1.00 94.88  ? 92   LYS A C     1 
ATOM   718   O  O     . LYS A 1 88   ? 9.027   -50.965  46.073  1.00 118.85 ? 92   LYS A O     1 
ATOM   719   C  CB    . LYS A 1 88   ? 7.218   -49.217  44.602  1.00 71.34  ? 92   LYS A CB    1 
ATOM   720   C  CG    . LYS A 1 88   ? 6.415   -47.937  44.645  1.00 75.97  ? 92   LYS A CG    1 
ATOM   721   C  CD    . LYS A 1 88   ? 4.924   -48.213  44.514  1.00 94.98  ? 92   LYS A CD    1 
ATOM   722   C  CE    . LYS A 1 88   ? 4.090   -46.966  44.776  1.00 103.57 ? 92   LYS A CE    1 
ATOM   723   N  NZ    . LYS A 1 88   ? 4.418   -45.836  43.855  1.00 94.16  ? 92   LYS A NZ    1 
ATOM   724   N  N     . ILE A 1 89   ? 10.320  -50.850  44.250  1.00 97.79  ? 93   ILE A N     1 
ATOM   725   C  CA    . ILE A 1 89   ? 11.008  -52.110  44.561  1.00 88.69  ? 93   ILE A CA    1 
ATOM   726   C  C     . ILE A 1 89   ? 12.523  -51.982  44.476  1.00 91.52  ? 93   ILE A C     1 
ATOM   727   O  O     . ILE A 1 89   ? 13.233  -52.993  44.527  1.00 86.79  ? 93   ILE A O     1 
ATOM   728   C  CB    . ILE A 1 89   ? 10.590  -53.264  43.629  1.00 82.70  ? 93   ILE A CB    1 
ATOM   729   C  CG1   . ILE A 1 89   ? 10.974  -52.944  42.169  1.00 86.98  ? 93   ILE A CG1   1 
ATOM   730   C  CG2   . ILE A 1 89   ? 9.103   -53.545  43.772  1.00 77.12  ? 93   ILE A CG2   1 
ATOM   731   C  CD1   . ILE A 1 89   ? 10.796  -54.108  41.219  1.00 81.31  ? 93   ILE A CD1   1 
ATOM   732   N  N     . LEU A 1 90   ? 13.019  -50.755  44.332  1.00 85.90  ? 94   LEU A N     1 
ATOM   733   C  CA    . LEU A 1 90   ? 14.446  -50.507  44.473  1.00 83.69  ? 94   LEU A CA    1 
ATOM   734   C  C     . LEU A 1 90   ? 14.793  -50.545  45.955  1.00 101.01 ? 94   LEU A C     1 
ATOM   735   O  O     . LEU A 1 90   ? 13.945  -50.235  46.797  1.00 107.28 ? 94   LEU A O     1 
ATOM   736   C  CB    . LEU A 1 90   ? 14.838  -49.159  43.878  1.00 83.46  ? 94   LEU A CB    1 
ATOM   737   C  CG    . LEU A 1 90   ? 14.595  -48.893  42.390  1.00 85.72  ? 94   LEU A CG    1 
ATOM   738   C  CD1   . LEU A 1 90   ? 15.103  -47.502  42.031  1.00 81.66  ? 94   LEU A CD1   1 
ATOM   739   C  CD2   . LEU A 1 90   ? 15.257  -49.955  41.524  1.00 80.19  ? 94   LEU A CD2   1 
ATOM   740   N  N     . PRO A 1 91   ? 16.032  -50.932  46.290  1.00 101.59 ? 95   PRO A N     1 
ATOM   741   C  CA    . PRO A 1 91   ? 16.453  -50.789  47.688  1.00 100.50 ? 95   PRO A CA    1 
ATOM   742   C  C     . PRO A 1 91   ? 16.389  -49.322  48.093  1.00 101.95 ? 95   PRO A C     1 
ATOM   743   O  O     . PRO A 1 91   ? 16.951  -48.478  47.402  1.00 113.35 ? 95   PRO A O     1 
ATOM   744   C  CB    . PRO A 1 91   ? 17.891  -51.322  47.695  1.00 104.51 ? 95   PRO A CB    1 
ATOM   745   C  CG    . PRO A 1 91   ? 18.321  -51.304  46.262  1.00 107.48 ? 95   PRO A CG    1 
ATOM   746   C  CD    . PRO A 1 91   ? 17.088  -51.507  45.443  1.00 100.76 ? 95   PRO A CD    1 
ATOM   747   N  N     . ARG A 1 92   ? 15.699  -49.035  49.192  1.00 105.39 ? 96   ARG A N     1 
ATOM   748   C  CA    . ARG A 1 92   ? 15.310  -47.672  49.546  1.00 93.83  ? 96   ARG A CA    1 
ATOM   749   C  C     . ARG A 1 92   ? 16.466  -46.668  49.614  1.00 96.64  ? 96   ARG A C     1 
ATOM   750   O  O     . ARG A 1 92   ? 16.285  -45.485  49.299  1.00 100.80 ? 96   ARG A O     1 
ATOM   751   C  CB    . ARG A 1 92   ? 14.570  -47.683  50.878  1.00 92.58  ? 96   ARG A CB    1 
ATOM   752   C  CG    . ARG A 1 92   ? 13.905  -46.367  51.219  1.00 83.94  ? 96   ARG A CG    1 
ATOM   753   C  CD    . ARG A 1 92   ? 12.913  -45.957  50.161  1.00 78.41  ? 96   ARG A CD    1 
ATOM   754   N  NE    . ARG A 1 92   ? 12.504  -44.566  50.303  1.00 86.49  ? 96   ARG A NE    1 
ATOM   755   C  CZ    . ARG A 1 92   ? 11.530  -44.002  49.601  1.00 97.23  ? 96   ARG A CZ    1 
ATOM   756   N  NH1   . ARG A 1 92   ? 10.861  -44.714  48.711  1.00 118.84 ? 96   ARG A NH1   1 
ATOM   757   N  NH2   . ARG A 1 92   ? 11.223  -42.729  49.788  1.00 96.75  ? 96   ARG A NH2   1 
ATOM   758   N  N     . ASN A 1 93   ? 17.650  -47.131  50.003  1.00 95.45  ? 97   ASN A N     1 
ATOM   759   C  CA    . ASN A 1 93   ? 18.806  -46.244  50.054  1.00 103.37 ? 97   ASN A CA    1 
ATOM   760   C  C     . ASN A 1 93   ? 19.205  -45.774  48.658  1.00 108.31 ? 97   ASN A C     1 
ATOM   761   O  O     . ASN A 1 93   ? 19.766  -44.688  48.495  1.00 111.05 ? 97   ASN A O     1 
ATOM   762   C  CB    . ASN A 1 93   ? 19.987  -46.926  50.745  1.00 111.06 ? 97   ASN A CB    1 
ATOM   763   C  CG    . ASN A 1 93   ? 20.371  -48.230  50.094  1.00 118.77 ? 97   ASN A CG    1 
ATOM   764   O  OD1   . ASN A 1 93   ? 19.512  -49.017  49.705  1.00 134.94 ? 97   ASN A OD1   1 
ATOM   765   N  ND2   . ASN A 1 93   ? 21.671  -48.468  49.970  1.00 125.78 ? 97   ASN A ND2   1 
ATOM   766   N  N     . GLN A 1 94   ? 18.898  -46.590  47.653  1.00 98.87  ? 98   GLN A N     1 
ATOM   767   C  CA    . GLN A 1 94   ? 19.121  -46.203  46.265  1.00 87.48  ? 98   GLN A CA    1 
ATOM   768   C  C     . GLN A 1 94   ? 18.118  -45.143  45.825  1.00 86.63  ? 98   GLN A C     1 
ATOM   769   O  O     . GLN A 1 94   ? 18.483  -44.184  45.151  1.00 80.16  ? 98   GLN A O     1 
ATOM   770   C  CB    . GLN A 1 94   ? 19.043  -47.416  45.337  1.00 92.99  ? 98   GLN A CB    1 
ATOM   771   C  CG    . GLN A 1 94   ? 20.187  -48.405  45.507  1.00 93.51  ? 98   GLN A CG    1 
ATOM   772   C  CD    . GLN A 1 94   ? 21.540  -47.771  45.252  1.00 103.49 ? 98   GLN A CD    1 
ATOM   773   O  OE1   . GLN A 1 94   ? 21.656  -46.777  44.518  1.00 99.18  ? 98   GLN A OE1   1 
ATOM   774   N  NE2   . GLN A 1 94   ? 22.578  -48.342  45.861  1.00 105.01 ? 98   GLN A NE2   1 
ATOM   775   N  N     . CYS A 1 95   ? 16.856  -45.316  46.205  1.00 86.63  ? 99   CYS A N     1 
ATOM   776   C  CA    . CYS A 1 95   ? 15.839  -44.299  45.944  1.00 85.72  ? 99   CYS A CA    1 
ATOM   777   C  C     . CYS A 1 95   ? 16.284  -42.968  46.532  1.00 93.82  ? 99   CYS A C     1 
ATOM   778   O  O     . CYS A 1 95   ? 16.262  -41.946  45.848  1.00 92.68  ? 99   CYS A O     1 
ATOM   779   C  CB    . CYS A 1 95   ? 14.487  -44.705  46.533  1.00 84.08  ? 99   CYS A CB    1 
ATOM   780   S  SG    . CYS A 1 95   ? 13.750  -46.164  45.814  1.00 123.19 ? 99   CYS A SG    1 
ATOM   781   N  N     . GLU A 1 96   ? 16.688  -42.999  47.803  1.00 102.18 ? 100  GLU A N     1 
ATOM   782   C  CA    . GLU A 1 96   ? 17.200  -41.815  48.480  1.00 110.22 ? 100  GLU A CA    1 
ATOM   783   C  C     . GLU A 1 96   ? 18.369  -41.230  47.704  1.00 105.49 ? 100  GLU A C     1 
ATOM   784   O  O     . GLU A 1 96   ? 18.423  -40.017  47.485  1.00 100.71 ? 100  GLU A O     1 
ATOM   785   C  CB    . GLU A 1 96   ? 17.627  -42.143  49.915  1.00 121.17 ? 100  GLU A CB    1 
ATOM   786   C  CG    . GLU A 1 96   ? 16.481  -42.527  50.842  1.00 126.70 ? 100  GLU A CG    1 
ATOM   787   C  CD    . GLU A 1 96   ? 15.439  -41.431  50.972  1.00 134.07 ? 100  GLU A CD    1 
ATOM   788   O  OE1   . GLU A 1 96   ? 15.809  -40.237  50.929  1.00 128.99 ? 100  GLU A OE1   1 
ATOM   789   O  OE2   . GLU A 1 96   ? 14.244  -41.766  51.113  1.00 147.02 ? 100  GLU A OE2   1 
ATOM   790   N  N     . GLY A 1 97   ? 19.286  -42.097  47.272  1.00 96.78  ? 101  GLY A N     1 
ATOM   791   C  CA    . GLY A 1 97   ? 20.438  -41.673  46.491  1.00 98.43  ? 101  GLY A CA    1 
ATOM   792   C  C     . GLY A 1 97   ? 20.068  -40.934  45.214  1.00 101.24 ? 101  GLY A C     1 
ATOM   793   O  O     . GLY A 1 97   ? 20.685  -39.920  44.869  1.00 104.98 ? 101  GLY A O     1 
ATOM   794   N  N     . ILE A 1 98   ? 19.055  -41.440  44.515  1.00 87.61  ? 102  ILE A N     1 
ATOM   795   C  CA    . ILE A 1 98   ? 18.577  -40.817  43.289  1.00 81.86  ? 102  ILE A CA    1 
ATOM   796   C  C     . ILE A 1 98   ? 17.953  -39.468  43.593  1.00 77.80  ? 102  ILE A C     1 
ATOM   797   O  O     . ILE A 1 98   ? 18.186  -38.499  42.888  1.00 87.97  ? 102  ILE A O     1 
ATOM   798   C  CB    . ILE A 1 98   ? 17.543  -41.710  42.563  1.00 80.95  ? 102  ILE A CB    1 
ATOM   799   C  CG1   . ILE A 1 98   ? 18.165  -43.056  42.186  1.00 69.63  ? 102  ILE A CG1   1 
ATOM   800   C  CG2   . ILE A 1 98   ? 17.004  -41.015  41.329  1.00 66.44  ? 102  ILE A CG2   1 
ATOM   801   C  CD1   . ILE A 1 98   ? 17.174  -44.031  41.610  1.00 69.51  ? 102  ILE A CD1   1 
ATOM   802   N  N     . LYS A 1 99   ? 17.151  -39.420  44.646  1.00 74.65  ? 103  LYS A N     1 
ATOM   803   C  CA    . LYS A 1 99   ? 16.518  -38.186  45.096  1.00 74.24  ? 103  LYS A CA    1 
ATOM   804   C  C     . LYS A 1 99   ? 17.562  -37.098  45.338  1.00 74.66  ? 103  LYS A C     1 
ATOM   805   O  O     . LYS A 1 99   ? 17.487  -36.005  44.782  1.00 82.14  ? 103  LYS A O     1 
ATOM   806   C  CB    . LYS A 1 99   ? 15.723  -38.458  46.368  1.00 88.29  ? 103  LYS A CB    1 
ATOM   807   C  CG    . LYS A 1 99   ? 14.784  -37.366  46.815  1.00 95.25  ? 103  LYS A CG    1 
ATOM   808   C  CD    . LYS A 1 99   ? 13.775  -37.974  47.774  1.00 97.51  ? 103  LYS A CD    1 
ATOM   809   C  CE    . LYS A 1 99   ? 13.365  -37.010  48.862  1.00 111.24 ? 103  LYS A CE    1 
ATOM   810   N  NZ    . LYS A 1 99   ? 12.450  -37.697  49.821  1.00 127.89 ? 103  LYS A NZ    1 
ATOM   811   N  N     . LYS A 1 100  ? 18.553  -37.416  46.158  1.00 78.24  ? 104  LYS A N     1 
ATOM   812   C  CA    . LYS A 1 100  ? 19.595  -36.456  46.462  1.00 87.42  ? 104  LYS A CA    1 
ATOM   813   C  C     . LYS A 1 100  ? 20.381  -36.074  45.214  1.00 89.43  ? 104  LYS A C     1 
ATOM   814   O  O     . LYS A 1 100  ? 20.548  -34.887  44.934  1.00 83.80  ? 104  LYS A O     1 
ATOM   815   C  CB    . LYS A 1 100  ? 20.516  -37.002  47.559  1.00 93.36  ? 104  LYS A CB    1 
ATOM   816   C  CG    . LYS A 1 100  ? 19.712  -37.614  48.676  1.00 97.23  ? 104  LYS A CG    1 
ATOM   817   C  CD    . LYS A 1 100  ? 20.443  -37.762  49.973  1.00 105.41 ? 104  LYS A CD    1 
ATOM   818   C  CE    . LYS A 1 100  ? 19.427  -38.141  51.042  1.00 118.49 ? 104  LYS A CE    1 
ATOM   819   N  NZ    . LYS A 1 100  ? 19.977  -39.085  52.045  1.00 128.11 ? 104  LYS A NZ    1 
ATOM   820   N  N     . TYR A 1 101  ? 20.833  -37.051  44.439  1.00 79.70  ? 105  TYR A N     1 
ATOM   821   C  CA    . TYR A 1 101  ? 21.597  -36.697  43.253  1.00 70.48  ? 105  TYR A CA    1 
ATOM   822   C  C     . TYR A 1 101  ? 20.800  -35.762  42.328  1.00 72.66  ? 105  TYR A C     1 
ATOM   823   O  O     . TYR A 1 101  ? 21.332  -34.766  41.824  1.00 66.54  ? 105  TYR A O     1 
ATOM   824   C  CB    . TYR A 1 101  ? 22.024  -37.935  42.494  1.00 80.30  ? 105  TYR A CB    1 
ATOM   825   C  CG    . TYR A 1 101  ? 23.118  -37.650  41.499  1.00 85.97  ? 105  TYR A CG    1 
ATOM   826   C  CD1   . TYR A 1 101  ? 24.455  -37.722  41.873  1.00 99.73  ? 105  TYR A CD1   1 
ATOM   827   C  CD2   . TYR A 1 101  ? 22.820  -37.300  40.188  1.00 75.08  ? 105  TYR A CD2   1 
ATOM   828   C  CE1   . TYR A 1 101  ? 25.463  -37.462  40.969  1.00 102.72 ? 105  TYR A CE1   1 
ATOM   829   C  CE2   . TYR A 1 101  ? 23.823  -37.031  39.280  1.00 84.66  ? 105  TYR A CE2   1 
ATOM   830   C  CZ    . TYR A 1 101  ? 25.144  -37.116  39.675  1.00 96.12  ? 105  TYR A CZ    1 
ATOM   831   O  OH    . TYR A 1 101  ? 26.154  -36.847  38.779  1.00 94.71  ? 105  TYR A OH    1 
ATOM   832   N  N     . VAL A 1 102  ? 19.513  -36.051  42.160  1.00 74.03  ? 106  VAL A N     1 
ATOM   833   C  CA    . VAL A 1 102  ? 18.679  -35.284  41.246  1.00 78.28  ? 106  VAL A CA    1 
ATOM   834   C  C     . VAL A 1 102  ? 18.420  -33.870  41.737  1.00 88.14  ? 106  VAL A C     1 
ATOM   835   O  O     . VAL A 1 102  ? 18.724  -32.919  41.016  1.00 94.20  ? 106  VAL A O     1 
ATOM   836   C  CB    . VAL A 1 102  ? 17.327  -35.981  40.979  1.00 70.65  ? 106  VAL A CB    1 
ATOM   837   C  CG1   . VAL A 1 102  ? 16.342  -35.008  40.352  1.00 67.40  ? 106  VAL A CG1   1 
ATOM   838   C  CG2   . VAL A 1 102  ? 17.526  -37.182  40.058  1.00 67.22  ? 106  VAL A CG2   1 
ATOM   839   N  N     . VAL A 1 103  ? 17.871  -33.705  42.943  1.00 99.16  ? 107  VAL A N     1 
ATOM   840   C  CA    . VAL A 1 103  ? 17.557  -32.338  43.377  1.00 99.76  ? 107  VAL A CA    1 
ATOM   841   C  C     . VAL A 1 103  ? 18.849  -31.556  43.574  1.00 89.62  ? 107  VAL A C     1 
ATOM   842   O  O     . VAL A 1 103  ? 18.877  -30.353  43.365  1.00 88.85  ? 107  VAL A O     1 
ATOM   843   C  CB    . VAL A 1 103  ? 16.691  -32.267  44.680  1.00 83.59  ? 107  VAL A CB    1 
ATOM   844   C  CG1   . VAL A 1 103  ? 15.871  -33.530  44.867  1.00 77.53  ? 107  VAL A CG1   1 
ATOM   845   C  CG2   . VAL A 1 103  ? 17.532  -31.958  45.901  1.00 88.06  ? 107  VAL A CG2   1 
ATOM   846   N  N     . GLY A 1 104  ? 19.925  -32.247  43.933  1.00 79.49  ? 108  GLY A N     1 
ATOM   847   C  CA    . GLY A 1 104  ? 21.215  -31.599  44.076  1.00 87.53  ? 108  GLY A CA    1 
ATOM   848   C  C     . GLY A 1 104  ? 21.711  -31.051  42.752  1.00 94.08  ? 108  GLY A C     1 
ATOM   849   O  O     . GLY A 1 104  ? 22.144  -29.900  42.660  1.00 82.23  ? 108  GLY A O     1 
ATOM   850   N  N     . LEU A 1 105  ? 21.640  -31.886  41.720  1.00 95.32  ? 109  LEU A N     1 
ATOM   851   C  CA    . LEU A 1 105  ? 22.054  -31.489  40.385  1.00 94.06  ? 109  LEU A CA    1 
ATOM   852   C  C     . LEU A 1 105  ? 21.205  -30.324  39.888  1.00 85.99  ? 109  LEU A C     1 
ATOM   853   O  O     . LEU A 1 105  ? 21.716  -29.390  39.262  1.00 85.95  ? 109  LEU A O     1 
ATOM   854   C  CB    . LEU A 1 105  ? 21.960  -32.678  39.424  1.00 103.17 ? 109  LEU A CB    1 
ATOM   855   C  CG    . LEU A 1 105  ? 22.694  -32.523  38.095  1.00 104.50 ? 109  LEU A CG    1 
ATOM   856   C  CD1   . LEU A 1 105  ? 24.113  -32.039  38.339  1.00 98.07  ? 109  LEU A CD1   1 
ATOM   857   C  CD2   . LEU A 1 105  ? 22.699  -33.842  37.354  1.00 114.79 ? 109  LEU A CD2   1 
ATOM   858   N  N     . ILE A 1 106  ? 19.909  -30.387  40.175  1.00 74.33  ? 110  ILE A N     1 
ATOM   859   C  CA    . ILE A 1 106  ? 18.993  -29.316  39.805  1.00 75.19  ? 110  ILE A CA    1 
ATOM   860   C  C     . ILE A 1 106  ? 19.356  -28.007  40.522  1.00 85.08  ? 110  ILE A C     1 
ATOM   861   O  O     . ILE A 1 106  ? 19.331  -26.947  39.908  1.00 81.28  ? 110  ILE A O     1 
ATOM   862   C  CB    . ILE A 1 106  ? 17.534  -29.682  40.122  1.00 67.16  ? 110  ILE A CB    1 
ATOM   863   C  CG1   . ILE A 1 106  ? 17.078  -30.835  39.248  1.00 70.89  ? 110  ILE A CG1   1 
ATOM   864   C  CG2   . ILE A 1 106  ? 16.613  -28.498  39.905  1.00 60.26  ? 110  ILE A CG2   1 
ATOM   865   C  CD1   . ILE A 1 106  ? 15.634  -31.218  39.458  1.00 81.62  ? 110  ILE A CD1   1 
ATOM   866   N  N     . ILE A 1 107  ? 19.698  -28.077  41.809  1.00 87.65  ? 111  ILE A N     1 
ATOM   867   C  CA    . ILE A 1 107  ? 20.144  -26.888  42.529  1.00 84.83  ? 111  ILE A CA    1 
ATOM   868   C  C     . ILE A 1 107  ? 21.396  -26.324  41.866  1.00 90.20  ? 111  ILE A C     1 
ATOM   869   O  O     . ILE A 1 107  ? 21.452  -25.145  41.551  1.00 100.27 ? 111  ILE A O     1 
ATOM   870   C  CB    . ILE A 1 107  ? 20.458  -27.168  44.024  1.00 112.46 ? 111  ILE A CB    1 
ATOM   871   C  CG1   . ILE A 1 107  ? 19.235  -27.713  44.773  1.00 113.75 ? 111  ILE A CG1   1 
ATOM   872   C  CG2   . ILE A 1 107  ? 20.957  -25.903  44.699  1.00 103.52 ? 111  ILE A CG2   1 
ATOM   873   C  CD1   . ILE A 1 107  ? 18.239  -26.666  45.214  1.00 108.16 ? 111  ILE A CD1   1 
ATOM   874   N  N     . LYS A 1 108  ? 22.394  -27.174  41.644  1.00 97.60  ? 112  LYS A N     1 
ATOM   875   C  CA    . LYS A 1 108  ? 23.676  -26.716  41.118  1.00 102.24 ? 112  LYS A CA    1 
ATOM   876   C  C     . LYS A 1 108  ? 23.543  -26.081  39.733  1.00 107.08 ? 112  LYS A C     1 
ATOM   877   O  O     . LYS A 1 108  ? 24.208  -25.088  39.445  1.00 101.73 ? 112  LYS A O     1 
ATOM   878   C  CB    . LYS A 1 108  ? 24.680  -27.870  41.061  1.00 116.19 ? 112  LYS A CB    1 
ATOM   879   C  CG    . LYS A 1 108  ? 26.121  -27.409  40.878  1.00 131.26 ? 112  LYS A CG    1 
ATOM   880   C  CD    . LYS A 1 108  ? 27.062  -28.573  40.601  1.00 133.38 ? 112  LYS A CD    1 
ATOM   881   C  CE    . LYS A 1 108  ? 26.898  -29.096  39.172  1.00 129.67 ? 112  LYS A CE    1 
ATOM   882   N  NZ    . LYS A 1 108  ? 27.244  -28.069  38.145  1.00 120.40 ? 112  LYS A NZ    1 
ATOM   883   N  N     . THR A 1 109  ? 22.690  -26.649  38.883  1.00 110.88 ? 113  THR A N     1 
ATOM   884   C  CA    . THR A 1 109  ? 22.526  -26.141  37.523  1.00 107.20 ? 113  THR A CA    1 
ATOM   885   C  C     . THR A 1 109  ? 21.633  -24.904  37.473  1.00 110.00 ? 113  THR A C     1 
ATOM   886   O  O     . THR A 1 109  ? 21.964  -23.915  36.821  1.00 116.74 ? 113  THR A O     1 
ATOM   887   C  CB    . THR A 1 109  ? 21.931  -27.208  36.591  1.00 108.03 ? 113  THR A CB    1 
ATOM   888   O  OG1   . THR A 1 109  ? 22.564  -28.468  36.838  1.00 115.17 ? 113  THR A OG1   1 
ATOM   889   C  CG2   . THR A 1 109  ? 22.139  -26.817  35.139  1.00 117.65 ? 113  THR A CG2   1 
ATOM   890   N  N     . SER A 1 110  ? 20.496  -24.972  38.158  1.00 107.23 ? 114  SER A N     1 
ATOM   891   C  CA    . SER A 1 110  ? 19.516  -23.890  38.141  1.00 104.83 ? 114  SER A CA    1 
ATOM   892   C  C     . SER A 1 110  ? 20.014  -22.661  38.888  1.00 116.74 ? 114  SER A C     1 
ATOM   893   O  O     . SER A 1 110  ? 19.634  -21.540  38.565  1.00 122.59 ? 114  SER A O     1 
ATOM   894   C  CB    . SER A 1 110  ? 18.192  -24.350  38.746  1.00 101.28 ? 114  SER A CB    1 
ATOM   895   O  OG    . SER A 1 110  ? 18.342  -24.692  40.113  1.00 102.83 ? 114  SER A OG    1 
ATOM   896   N  N     . SER A 1 111  ? 20.867  -22.869  39.887  1.00 118.79 ? 115  SER A N     1 
ATOM   897   C  CA    . SER A 1 111  ? 21.458  -21.749  40.615  1.00 123.58 ? 115  SER A CA    1 
ATOM   898   C  C     . SER A 1 111  ? 22.667  -21.210  39.858  1.00 144.00 ? 115  SER A C     1 
ATOM   899   O  O     . SER A 1 111  ? 23.546  -20.575  40.432  1.00 140.17 ? 115  SER A O     1 
ATOM   900   C  CB    . SER A 1 111  ? 21.854  -22.163  42.031  1.00 116.43 ? 115  SER A CB    1 
ATOM   901   O  OG    . SER A 1 111  ? 20.747  -22.712  42.725  1.00 118.29 ? 115  SER A OG    1 
ATOM   902   N  N     . ASP A 1 112  ? 22.705  -21.488  38.560  1.00 158.52 ? 116  ASP A N     1 
ATOM   903   C  CA    . ASP A 1 112  ? 23.681  -20.898  37.655  1.00 168.05 ? 116  ASP A CA    1 
ATOM   904   C  C     . ASP A 1 112  ? 22.954  -20.274  36.477  1.00 167.30 ? 116  ASP A C     1 
ATOM   905   O  O     . ASP A 1 112  ? 22.291  -20.979  35.714  1.00 174.52 ? 116  ASP A O     1 
ATOM   906   C  CB    . ASP A 1 112  ? 24.684  -21.940  37.158  1.00 188.65 ? 116  ASP A CB    1 
ATOM   907   C  CG    . ASP A 1 112  ? 25.674  -22.352  38.226  1.00 208.69 ? 116  ASP A CG    1 
ATOM   908   O  OD1   . ASP A 1 112  ? 25.908  -21.557  39.162  1.00 216.25 ? 116  ASP A OD1   1 
ATOM   909   O  OD2   . ASP A 1 112  ? 26.224  -23.470  38.128  1.00 220.43 ? 116  ASP A OD2   1 
ATOM   910   N  N     . PRO A 1 113  ? 23.067  -18.945  36.330  1.00 159.81 ? 117  PRO A N     1 
ATOM   911   C  CA    . PRO A 1 113  ? 22.483  -18.208  35.201  1.00 150.55 ? 117  PRO A CA    1 
ATOM   912   C  C     . PRO A 1 113  ? 22.987  -18.726  33.856  1.00 157.97 ? 117  PRO A C     1 
ATOM   913   O  O     . PRO A 1 113  ? 22.395  -18.439  32.816  1.00 138.99 ? 117  PRO A O     1 
ATOM   914   C  CB    . PRO A 1 113  ? 22.949  -16.772  35.440  1.00 137.31 ? 117  PRO A CB    1 
ATOM   915   C  CG    . PRO A 1 113  ? 23.154  -16.693  36.907  1.00 139.76 ? 117  PRO A CG    1 
ATOM   916   C  CD    . PRO A 1 113  ? 23.682  -18.039  37.315  1.00 149.92 ? 117  PRO A CD    1 
ATOM   917   N  N     . THR A 1 114  ? 24.071  -19.494  33.887  1.00 176.96 ? 118  THR A N     1 
ATOM   918   C  CA    . THR A 1 114  ? 24.597  -20.130  32.690  1.00 177.83 ? 118  THR A CA    1 
ATOM   919   C  C     . THR A 1 114  ? 23.620  -21.156  32.125  1.00 177.17 ? 118  THR A C     1 
ATOM   920   O  O     . THR A 1 114  ? 23.818  -21.630  31.016  1.00 181.26 ? 118  THR A O     1 
ATOM   921   C  CB    . THR A 1 114  ? 25.954  -20.818  32.962  1.00 179.89 ? 118  THR A CB    1 
ATOM   922   O  OG1   . THR A 1 114  ? 25.952  -21.395  34.277  1.00 182.81 ? 118  THR A OG1   1 
ATOM   923   C  CG2   . THR A 1 114  ? 27.085  -19.809  32.862  1.00 179.20 ? 118  THR A CG2   1 
ATOM   924   N  N     . CYS A 1 115  ? 22.563  -21.461  32.885  1.00 173.98 ? 119  CYS A N     1 
ATOM   925   C  CA    . CYS A 1 115  ? 21.542  -22.450  32.523  1.00 168.34 ? 119  CYS A CA    1 
ATOM   926   C  C     . CYS A 1 115  ? 21.016  -22.304  31.090  1.00 163.84 ? 119  CYS A C     1 
ATOM   927   O  O     . CYS A 1 115  ? 20.697  -23.300  30.437  1.00 165.46 ? 119  CYS A O     1 
ATOM   928   C  CB    . CYS A 1 115  ? 20.371  -22.375  33.507  1.00 166.06 ? 119  CYS A CB    1 
ATOM   929   S  SG    . CYS A 1 115  ? 19.243  -20.992  33.233  1.00 199.70 ? 119  CYS A SG    1 
ATOM   930   N  N     . VAL A 1 116  ? 20.930  -21.063  30.614  1.00 167.80 ? 120  VAL A N     1 
ATOM   931   C  CA    . VAL A 1 116  ? 20.484  -20.766  29.252  1.00 166.72 ? 120  VAL A CA    1 
ATOM   932   C  C     . VAL A 1 116  ? 21.489  -21.204  28.192  1.00 182.78 ? 120  VAL A C     1 
ATOM   933   O  O     . VAL A 1 116  ? 21.146  -21.920  27.248  1.00 175.08 ? 120  VAL A O     1 
ATOM   934   C  CB    . VAL A 1 116  ? 20.238  -19.262  29.060  1.00 154.85 ? 120  VAL A CB    1 
ATOM   935   C  CG1   . VAL A 1 116  ? 19.754  -18.981  27.643  1.00 144.03 ? 120  VAL A CG1   1 
ATOM   936   C  CG2   . VAL A 1 116  ? 19.256  -18.745  30.094  1.00 155.01 ? 120  VAL A CG2   1 
ATOM   937   N  N     . GLU A 1 117  ? 22.720  -20.718  28.338  1.00 209.03 ? 121  GLU A N     1 
ATOM   938   C  CA    . GLU A 1 117  ? 23.836  -21.118  27.488  1.00 220.37 ? 121  GLU A CA    1 
ATOM   939   C  C     . GLU A 1 117  ? 24.129  -22.576  27.752  1.00 221.22 ? 121  GLU A C     1 
ATOM   940   O  O     . GLU A 1 117  ? 24.560  -23.324  26.871  1.00 225.25 ? 121  GLU A O     1 
ATOM   941   C  CB    . GLU A 1 117  ? 25.076  -20.271  27.767  1.00 224.19 ? 121  GLU A CB    1 
ATOM   942   C  CG    . GLU A 1 117  ? 24.926  -18.803  27.433  1.00 225.84 ? 121  GLU A CG    1 
ATOM   943   C  CD    . GLU A 1 117  ? 26.162  -18.005  27.795  1.00 225.84 ? 121  GLU A CD    1 
ATOM   944   O  OE1   . GLU A 1 117  ? 27.265  -18.592  27.822  1.00 228.27 ? 121  GLU A OE1   1 
ATOM   945   O  OE2   . GLU A 1 117  ? 26.031  -16.792  28.061  1.00 223.15 ? 121  GLU A OE2   1 
ATOM   946   N  N     . LYS A 1 118  ? 23.891  -22.961  29.001  1.00 220.13 ? 122  LYS A N     1 
ATOM   947   C  CA    . LYS A 1 118  ? 23.816  -24.354  29.382  1.00 205.27 ? 122  LYS A CA    1 
ATOM   948   C  C     . LYS A 1 118  ? 22.630  -24.962  28.666  1.00 198.19 ? 122  LYS A C     1 
ATOM   949   O  O     . LYS A 1 118  ? 21.965  -24.334  27.845  1.00 198.70 ? 122  LYS A O     1 
ATOM   950   C  CB    . LYS A 1 118  ? 23.662  -24.499  30.896  1.00 193.47 ? 122  LYS A CB    1 
ATOM   951   C  CG    . LYS A 1 118  ? 24.108  -25.790  31.517  1.00 180.32 ? 122  LYS A CG    1 
ATOM   952   C  CD    . LYS A 1 118  ? 24.764  -25.507  32.844  1.00 165.32 ? 122  LYS A CD    1 
ATOM   953   C  CE    . LYS A 1 118  ? 25.316  -26.784  33.427  1.00 159.06 ? 122  LYS A CE    1 
ATOM   954   N  NZ    . LYS A 1 118  ? 25.794  -27.681  32.342  1.00 151.43 ? 122  LYS A NZ    1 
ATOM   955   N  N     . GLU A 1 119  ? 22.336  -26.189  29.021  1.00 176.41 ? 123  GLU A N     1 
ATOM   956   C  CA    . GLU A 1 119  ? 21.464  -26.989  28.222  1.00 146.07 ? 123  GLU A CA    1 
ATOM   957   C  C     . GLU A 1 119  ? 20.009  -26.890  28.695  1.00 121.45 ? 123  GLU A C     1 
ATOM   958   O  O     . GLU A 1 119  ? 19.548  -27.734  29.450  1.00 121.98 ? 123  GLU A O     1 
ATOM   959   C  CB    . GLU A 1 119  ? 22.021  -28.401  28.261  1.00 148.41 ? 123  GLU A CB    1 
ATOM   960   C  CG    . GLU A 1 119  ? 23.544  -28.418  28.047  1.00 155.37 ? 123  GLU A CG    1 
ATOM   961   C  CD    . GLU A 1 119  ? 24.330  -29.112  29.156  1.00 162.37 ? 123  GLU A CD    1 
ATOM   962   O  OE1   . GLU A 1 119  ? 24.361  -28.604  30.298  1.00 168.66 ? 123  GLU A OE1   1 
ATOM   963   O  OE2   . GLU A 1 119  ? 24.938  -30.166  28.875  1.00 155.52 ? 123  GLU A OE2   1 
ATOM   964   N  N     . LYS A 1 120  ? 19.309  -25.835  28.259  1.00 110.71 ? 124  LYS A N     1 
ATOM   965   C  CA    . LYS A 1 120  ? 17.888  -25.627  28.579  1.00 106.16 ? 124  LYS A CA    1 
ATOM   966   C  C     . LYS A 1 120  ? 17.105  -26.917  28.448  1.00 104.42 ? 124  LYS A C     1 
ATOM   967   O  O     . LYS A 1 120  ? 16.338  -27.301  29.330  1.00 112.96 ? 124  LYS A O     1 
ATOM   968   C  CB    . LYS A 1 120  ? 17.224  -24.605  27.653  1.00 117.50 ? 124  LYS A CB    1 
ATOM   969   C  CG    . LYS A 1 120  ? 17.974  -23.339  27.328  1.00 135.46 ? 124  LYS A CG    1 
ATOM   970   C  CD    . LYS A 1 120  ? 17.191  -22.605  26.240  1.00 142.40 ? 124  LYS A CD    1 
ATOM   971   C  CE    . LYS A 1 120  ? 17.222  -21.101  26.426  1.00 141.23 ? 124  LYS A CE    1 
ATOM   972   N  NZ    . LYS A 1 120  ? 16.237  -20.414  25.543  1.00 136.01 ? 124  LYS A NZ    1 
ATOM   973   N  N     . VAL A 1 121  ? 17.299  -27.549  27.297  1.00 100.39 ? 125  VAL A N     1 
ATOM   974   C  CA    . VAL A 1 121  ? 16.755  -28.858  26.968  1.00 88.05  ? 125  VAL A CA    1 
ATOM   975   C  C     . VAL A 1 121  ? 16.956  -29.841  28.098  1.00 87.02  ? 125  VAL A C     1 
ATOM   976   O  O     . VAL A 1 121  ? 16.018  -30.439  28.652  1.00 91.60  ? 125  VAL A O     1 
ATOM   977   C  CB    . VAL A 1 121  ? 17.459  -29.425  25.717  1.00 88.48  ? 125  VAL A CB    1 
ATOM   978   C  CG1   . VAL A 1 121  ? 16.695  -30.613  25.165  1.00 75.66  ? 125  VAL A CG1   1 
ATOM   979   C  CG2   . VAL A 1 121  ? 17.644  -28.339  24.670  1.00 90.61  ? 125  VAL A CG2   1 
ATOM   980   N  N     . TYR A 1 122  ? 18.228  -29.987  28.417  1.00 101.76 ? 126  TYR A N     1 
ATOM   981   C  CA    . TYR A 1 122  ? 18.699  -30.896  29.434  1.00 103.68 ? 126  TYR A CA    1 
ATOM   982   C  C     . TYR A 1 122  ? 18.076  -30.605  30.793  1.00 101.05 ? 126  TYR A C     1 
ATOM   983   O  O     . TYR A 1 122  ? 17.669  -31.520  31.513  1.00 103.54 ? 126  TYR A O     1 
ATOM   984   C  CB    . TYR A 1 122  ? 20.210  -30.797  29.504  1.00 110.54 ? 126  TYR A CB    1 
ATOM   985   C  CG    . TYR A 1 122  ? 20.821  -31.597  30.587  1.00 104.39 ? 126  TYR A CG    1 
ATOM   986   C  CD1   . TYR A 1 122  ? 20.596  -32.953  30.653  1.00 102.97 ? 126  TYR A CD1   1 
ATOM   987   C  CD2   . TYR A 1 122  ? 21.640  -31.006  31.538  1.00 108.14 ? 126  TYR A CD2   1 
ATOM   988   C  CE1   . TYR A 1 122  ? 21.154  -33.705  31.633  1.00 100.15 ? 126  TYR A CE1   1 
ATOM   989   C  CE2   . TYR A 1 122  ? 22.207  -31.755  32.533  1.00 107.11 ? 126  TYR A CE2   1 
ATOM   990   C  CZ    . TYR A 1 122  ? 21.958  -33.110  32.574  1.00 106.28 ? 126  TYR A CZ    1 
ATOM   991   O  OH    . TYR A 1 122  ? 22.509  -33.887  33.561  1.00 115.00 ? 126  TYR A OH    1 
ATOM   992   N  N     . ILE A 1 123  ? 17.991  -29.325  31.131  1.00 102.16 ? 127  ILE A N     1 
ATOM   993   C  CA    . ILE A 1 123  ? 17.394  -28.914  32.392  1.00 104.04 ? 127  ILE A CA    1 
ATOM   994   C  C     . ILE A 1 123  ? 15.926  -29.309  32.451  1.00 94.59  ? 127  ILE A C     1 
ATOM   995   O  O     . ILE A 1 123  ? 15.445  -29.784  33.477  1.00 98.50  ? 127  ILE A O     1 
ATOM   996   C  CB    . ILE A 1 123  ? 17.522  -27.404  32.610  1.00 101.41 ? 127  ILE A CB    1 
ATOM   997   C  CG1   . ILE A 1 123  ? 18.979  -26.985  32.443  1.00 108.15 ? 127  ILE A CG1   1 
ATOM   998   C  CG2   . ILE A 1 123  ? 17.012  -27.026  33.984  1.00 99.22  ? 127  ILE A CG2   1 
ATOM   999   C  CD1   . ILE A 1 123  ? 19.252  -25.587  32.892  1.00 116.00 ? 127  ILE A CD1   1 
ATOM   1000  N  N     . GLY A 1 124  ? 15.216  -29.108  31.348  1.00 84.40  ? 128  GLY A N     1 
ATOM   1001  C  CA    . GLY A 1 124  ? 13.831  -29.527  31.264  1.00 79.98  ? 128  GLY A CA    1 
ATOM   1002  C  C     . GLY A 1 124  ? 13.702  -31.008  31.550  1.00 85.42  ? 128  GLY A C     1 
ATOM   1003  O  O     . GLY A 1 124  ? 12.800  -31.434  32.278  1.00 99.94  ? 128  GLY A O     1 
ATOM   1004  N  N     . LYS A 1 125  ? 14.623  -31.796  31.001  1.00 77.54  ? 129  LYS A N     1 
ATOM   1005  C  CA    . LYS A 1 125  ? 14.612  -33.227  31.284  1.00 67.37  ? 129  LYS A CA    1 
ATOM   1006  C  C     . LYS A 1 125  ? 14.851  -33.519  32.774  1.00 67.65  ? 129  LYS A C     1 
ATOM   1007  O  O     . LYS A 1 125  ? 14.152  -34.343  33.363  1.00 64.32  ? 129  LYS A O     1 
ATOM   1008  C  CB    . LYS A 1 125  ? 15.648  -33.956  30.418  1.00 71.91  ? 129  LYS A CB    1 
ATOM   1009  C  CG    . LYS A 1 125  ? 15.400  -35.462  30.304  1.00 70.92  ? 129  LYS A CG    1 
ATOM   1010  C  CD    . LYS A 1 125  ? 13.984  -35.746  29.841  1.00 70.62  ? 129  LYS A CD    1 
ATOM   1011  C  CE    . LYS A 1 125  ? 13.681  -37.227  29.846  1.00 69.95  ? 129  LYS A CE    1 
ATOM   1012  N  NZ    . LYS A 1 125  ? 12.277  -37.483  29.418  1.00 69.54  ? 129  LYS A NZ    1 
ATOM   1013  N  N     . LEU A 1 126  ? 15.827  -32.840  33.375  1.00 78.52  ? 130  LEU A N     1 
ATOM   1014  C  CA    . LEU A 1 126  ? 16.089  -32.962  34.817  1.00 85.53  ? 130  LEU A CA    1 
ATOM   1015  C  C     . LEU A 1 126  ? 14.853  -32.685  35.680  1.00 83.56  ? 130  LEU A C     1 
ATOM   1016  O  O     . LEU A 1 126  ? 14.473  -33.492  36.546  1.00 79.02  ? 130  LEU A O     1 
ATOM   1017  C  CB    . LEU A 1 126  ? 17.208  -32.009  35.241  1.00 87.66  ? 130  LEU A CB    1 
ATOM   1018  C  CG    . LEU A 1 126  ? 18.623  -32.564  35.384  1.00 88.31  ? 130  LEU A CG    1 
ATOM   1019  C  CD1   . LEU A 1 126  ? 19.602  -31.431  35.650  1.00 97.47  ? 130  LEU A CD1   1 
ATOM   1020  C  CD2   . LEU A 1 126  ? 18.678  -33.584  36.490  1.00 82.87  ? 130  LEU A CD2   1 
ATOM   1021  N  N     . ASN A 1 127  ? 14.240  -31.530  35.442  1.00 80.81  ? 131  ASN A N     1 
ATOM   1022  C  CA    . ASN A 1 127  ? 13.033  -31.137  36.146  1.00 78.31  ? 131  ASN A CA    1 
ATOM   1023  C  C     . ASN A 1 127  ? 11.956  -32.191  35.989  1.00 77.68  ? 131  ASN A C     1 
ATOM   1024  O  O     . ASN A 1 127  ? 11.249  -32.520  36.942  1.00 73.76  ? 131  ASN A O     1 
ATOM   1025  C  CB    . ASN A 1 127  ? 12.531  -29.788  35.634  1.00 79.68  ? 131  ASN A CB    1 
ATOM   1026  C  CG    . ASN A 1 127  ? 13.496  -28.654  35.925  1.00 85.25  ? 131  ASN A CG    1 
ATOM   1027  O  OD1   . ASN A 1 127  ? 14.088  -28.591  36.991  1.00 82.78  ? 131  ASN A OD1   1 
ATOM   1028  N  ND2   . ASN A 1 127  ? 13.667  -27.761  34.964  1.00 105.28 ? 131  ASN A ND2   1 
ATOM   1029  N  N     . MET A 1 128  ? 11.850  -32.734  34.779  1.00 82.39  ? 132  MET A N     1 
ATOM   1030  C  CA    . MET A 1 128  ? 10.880  -33.786  34.511  1.00 78.59  ? 132  MET A CA    1 
ATOM   1031  C  C     . MET A 1 128  ? 11.159  -35.032  35.362  1.00 78.20  ? 132  MET A C     1 
ATOM   1032  O  O     . MET A 1 128  ? 10.233  -35.666  35.868  1.00 82.73  ? 132  MET A O     1 
ATOM   1033  C  CB    . MET A 1 128  ? 10.883  -34.141  33.034  1.00 92.47  ? 132  MET A CB    1 
ATOM   1034  C  CG    . MET A 1 128  ? 9.582   -34.742  32.577  1.00 111.96 ? 132  MET A CG    1 
ATOM   1035  S  SD    . MET A 1 128  ? 8.200   -33.784  33.230  1.00 77.23  ? 132  MET A SD    1 
ATOM   1036  C  CE    . MET A 1 128  ? 7.228   -35.129  33.946  1.00 74.57  ? 132  MET A CE    1 
ATOM   1037  N  N     . ILE A 1 129  ? 12.437  -35.368  35.520  1.00 68.12  ? 133  ILE A N     1 
ATOM   1038  C  CA    . ILE A 1 129  ? 12.843  -36.471  36.379  1.00 66.91  ? 133  ILE A CA    1 
ATOM   1039  C  C     . ILE A 1 129  ? 12.380  -36.228  37.815  1.00 81.63  ? 133  ILE A C     1 
ATOM   1040  O  O     . ILE A 1 129  ? 11.822  -37.128  38.468  1.00 70.41  ? 133  ILE A O     1 
ATOM   1041  C  CB    . ILE A 1 129  ? 14.367  -36.662  36.375  1.00 70.26  ? 133  ILE A CB    1 
ATOM   1042  C  CG1   . ILE A 1 129  ? 14.857  -37.011  34.977  1.00 76.76  ? 133  ILE A CG1   1 
ATOM   1043  C  CG2   . ILE A 1 129  ? 14.771  -37.746  37.379  1.00 82.71  ? 133  ILE A CG2   1 
ATOM   1044  C  CD1   . ILE A 1 129  ? 14.188  -38.223  34.379  1.00 79.10  ? 133  ILE A CD1   1 
ATOM   1045  N  N     . LEU A 1 130  ? 12.620  -35.009  38.301  1.00 88.03  ? 134  LEU A N     1 
ATOM   1046  C  CA    . LEU A 1 130  ? 12.193  -34.629  39.643  1.00 80.20  ? 134  LEU A CA    1 
ATOM   1047  C  C     . LEU A 1 130  ? 10.686  -34.778  39.787  1.00 80.33  ? 134  LEU A C     1 
ATOM   1048  O  O     . LEU A 1 130  ? 10.208  -35.303  40.785  1.00 86.03  ? 134  LEU A O     1 
ATOM   1049  C  CB    . LEU A 1 130  ? 12.613  -33.196  39.964  1.00 70.71  ? 134  LEU A CB    1 
ATOM   1050  C  CG    . LEU A 1 130  ? 12.008  -32.568  41.231  1.00 69.26  ? 134  LEU A CG    1 
ATOM   1051  C  CD1   . LEU A 1 130  ? 12.368  -33.374  42.468  1.00 71.22  ? 134  LEU A CD1   1 
ATOM   1052  C  CD2   . LEU A 1 130  ? 12.439  -31.124  41.390  1.00 66.11  ? 134  LEU A CD2   1 
ATOM   1053  N  N     . VAL A 1 131  ? 9.943   -34.319  38.786  1.00 77.02  ? 135  VAL A N     1 
ATOM   1054  C  CA    . VAL A 1 131  ? 8.488   -34.414  38.811  1.00 77.40  ? 135  VAL A CA    1 
ATOM   1055  C  C     . VAL A 1 131  ? 8.038   -35.877  38.820  1.00 85.98  ? 135  VAL A C     1 
ATOM   1056  O  O     . VAL A 1 131  ? 7.021   -36.214  39.424  1.00 87.73  ? 135  VAL A O     1 
ATOM   1057  C  CB    . VAL A 1 131  ? 7.856   -33.678  37.619  1.00 66.19  ? 135  VAL A CB    1 
ATOM   1058  C  CG1   . VAL A 1 131  ? 6.354   -33.892  37.595  1.00 64.77  ? 135  VAL A CG1   1 
ATOM   1059  C  CG2   . VAL A 1 131  ? 8.180   -32.199  37.698  1.00 66.52  ? 135  VAL A CG2   1 
ATOM   1060  N  N     . GLN A 1 132  ? 8.801   -36.748  38.166  1.00 82.54  ? 136  GLN A N     1 
ATOM   1061  C  CA    . GLN A 1 132  ? 8.485   -38.172  38.180  1.00 78.69  ? 136  GLN A CA    1 
ATOM   1062  C  C     . GLN A 1 132  ? 8.690   -38.761  39.565  1.00 76.67  ? 136  GLN A C     1 
ATOM   1063  O  O     . GLN A 1 132  ? 7.849   -39.514  40.063  1.00 81.44  ? 136  GLN A O     1 
ATOM   1064  C  CB    . GLN A 1 132  ? 9.333   -38.922  37.155  1.00 80.76  ? 136  GLN A CB    1 
ATOM   1065  C  CG    . GLN A 1 132  ? 8.946   -38.651  35.699  1.00 74.75  ? 136  GLN A CG    1 
ATOM   1066  C  CD    . GLN A 1 132  ? 7.524   -39.084  35.376  1.00 74.16  ? 136  GLN A CD    1 
ATOM   1067  O  OE1   . GLN A 1 132  ? 6.867   -38.489  34.535  1.00 81.30  ? 136  GLN A OE1   1 
ATOM   1068  N  NE2   . GLN A 1 132  ? 7.053   -40.131  36.035  1.00 83.23  ? 136  GLN A NE2   1 
ATOM   1069  N  N     . ILE A 1 133  ? 9.813   -38.407  40.186  1.00 82.51  ? 137  ILE A N     1 
ATOM   1070  C  CA    . ILE A 1 133  ? 10.078  -38.785  41.577  1.00 78.99  ? 137  ILE A CA    1 
ATOM   1071  C  C     . ILE A 1 133  ? 8.958   -38.316  42.496  1.00 70.83  ? 137  ILE A C     1 
ATOM   1072  O  O     . ILE A 1 133  ? 8.446   -39.083  43.289  1.00 78.85  ? 137  ILE A O     1 
ATOM   1073  C  CB    . ILE A 1 133  ? 11.405  -38.200  42.092  1.00 75.19  ? 137  ILE A CB    1 
ATOM   1074  C  CG1   . ILE A 1 133  ? 12.569  -38.675  41.222  1.00 74.76  ? 137  ILE A CG1   1 
ATOM   1075  C  CG2   . ILE A 1 133  ? 11.629  -38.585  43.549  1.00 73.45  ? 137  ILE A CG2   1 
ATOM   1076  C  CD1   . ILE A 1 133  ? 13.901  -38.082  41.605  1.00 81.75  ? 137  ILE A CD1   1 
ATOM   1077  N  N     . LEU A 1 134  ? 8.580   -37.051  42.376  1.00 66.65  ? 138  LEU A N     1 
ATOM   1078  C  CA    . LEU A 1 134  ? 7.482   -36.489  43.149  1.00 71.43  ? 138  LEU A CA    1 
ATOM   1079  C  C     . LEU A 1 134  ? 6.207   -37.280  42.947  1.00 71.87  ? 138  LEU A C     1 
ATOM   1080  O  O     . LEU A 1 134  ? 5.495   -37.584  43.900  1.00 72.36  ? 138  LEU A O     1 
ATOM   1081  C  CB    . LEU A 1 134  ? 7.253   -35.019  42.768  1.00 72.45  ? 138  LEU A CB    1 
ATOM   1082  C  CG    . LEU A 1 134  ? 8.268   -33.979  43.265  1.00 73.39  ? 138  LEU A CG    1 
ATOM   1083  C  CD1   . LEU A 1 134  ? 8.029   -32.658  42.563  1.00 74.47  ? 138  LEU A CD1   1 
ATOM   1084  C  CD2   . LEU A 1 134  ? 8.171   -33.820  44.765  1.00 64.48  ? 138  LEU A CD2   1 
ATOM   1085  N  N     . LYS A 1 135  ? 5.930   -37.611  41.692  1.00 77.15  ? 139  LYS A N     1 
ATOM   1086  C  CA    . LYS A 1 135  ? 4.752   -38.396  41.344  1.00 75.85  ? 139  LYS A CA    1 
ATOM   1087  C  C     . LYS A 1 135  ? 4.787   -39.717  42.080  1.00 68.37  ? 139  LYS A C     1 
ATOM   1088  O  O     . LYS A 1 135  ? 3.753   -40.237  42.488  1.00 69.58  ? 139  LYS A O     1 
ATOM   1089  C  CB    . LYS A 1 135  ? 4.672   -38.626  39.832  1.00 72.90  ? 139  LYS A CB    1 
ATOM   1090  C  CG    . LYS A 1 135  ? 3.676   -37.719  39.115  1.00 83.40  ? 139  LYS A CG    1 
ATOM   1091  C  CD    . LYS A 1 135  ? 3.826   -37.792  37.592  1.00 92.39  ? 139  LYS A CD    1 
ATOM   1092  C  CE    . LYS A 1 135  ? 3.630   -39.211  37.071  1.00 102.30 ? 139  LYS A CE    1 
ATOM   1093  N  NZ    . LYS A 1 135  ? 3.804   -39.285  35.599  1.00 107.22 ? 139  LYS A NZ    1 
ATOM   1094  N  N     . GLN A 1 136  ? 5.986   -40.255  42.271  1.00 77.96  ? 140  GLN A N     1 
ATOM   1095  C  CA    . GLN A 1 136  ? 6.103   -41.556  42.917  1.00 80.09  ? 140  GLN A CA    1 
ATOM   1096  C  C     . GLN A 1 136  ? 6.108   -41.464  44.452  1.00 90.55  ? 140  GLN A C     1 
ATOM   1097  O  O     . GLN A 1 136  ? 5.701   -42.417  45.121  1.00 106.39 ? 140  GLN A O     1 
ATOM   1098  C  CB    . GLN A 1 136  ? 7.356   -42.288  42.433  1.00 85.05  ? 140  GLN A CB    1 
ATOM   1099  C  CG    . GLN A 1 136  ? 7.240   -43.799  42.471  1.00 96.35  ? 140  GLN A CG    1 
ATOM   1100  C  CD    . GLN A 1 136  ? 6.322   -44.361  41.386  1.00 102.69 ? 140  GLN A CD    1 
ATOM   1101  O  OE1   . GLN A 1 136  ? 5.149   -43.994  41.290  1.00 97.23  ? 140  GLN A OE1   1 
ATOM   1102  N  NE2   . GLN A 1 136  ? 6.857   -45.267  40.571  1.00 112.42 ? 140  GLN A NE2   1 
ATOM   1103  N  N     . GLU A 1 137  ? 6.552   -40.339  45.019  1.00 85.23  ? 141  GLU A N     1 
ATOM   1104  C  CA    . GLU A 1 137  ? 6.554   -40.211  46.471  1.00 98.64  ? 141  GLU A CA    1 
ATOM   1105  C  C     . GLU A 1 137  ? 6.331   -38.779  46.993  1.00 106.05 ? 141  GLU A C     1 
ATOM   1106  O  O     . GLU A 1 137  ? 7.157   -38.219  47.715  1.00 103.31 ? 141  GLU A O     1 
ATOM   1107  C  CB    . GLU A 1 137  ? 7.850   -40.792  47.056  1.00 108.58 ? 141  GLU A CB    1 
ATOM   1108  C  CG    . GLU A 1 137  ? 9.162   -40.066  46.760  1.00 102.26 ? 141  GLU A CG    1 
ATOM   1109  C  CD    . GLU A 1 137  ? 10.317  -40.723  47.508  1.00 114.59 ? 141  GLU A CD    1 
ATOM   1110  O  OE1   . GLU A 1 137  ? 10.417  -41.973  47.441  1.00 113.14 ? 141  GLU A OE1   1 
ATOM   1111  O  OE2   . GLU A 1 137  ? 11.101  -40.005  48.177  1.00 118.19 ? 141  GLU A OE2   1 
ATOM   1112  N  N     . TRP A 1 138  ? 5.179   -38.208  46.661  1.00 103.33 ? 142  TRP A N     1 
ATOM   1113  C  CA    . TRP A 1 138  ? 4.755   -36.949  47.259  1.00 74.51  ? 142  TRP A CA    1 
ATOM   1114  C  C     . TRP A 1 138  ? 3.241   -36.935  47.428  1.00 78.34  ? 142  TRP A C     1 
ATOM   1115  O  O     . TRP A 1 138  ? 2.513   -37.305  46.513  1.00 87.06  ? 142  TRP A O     1 
ATOM   1116  C  CB    . TRP A 1 138  ? 5.209   -35.767  46.409  1.00 69.07  ? 142  TRP A CB    1 
ATOM   1117  C  CG    . TRP A 1 138  ? 4.681   -34.460  46.915  1.00 78.67  ? 142  TRP A CG    1 
ATOM   1118  C  CD1   . TRP A 1 138  ? 5.229   -33.680  47.887  1.00 68.92  ? 142  TRP A CD1   1 
ATOM   1119  C  CD2   . TRP A 1 138  ? 3.496   -33.782  46.476  1.00 80.51  ? 142  TRP A CD2   1 
ATOM   1120  N  NE1   . TRP A 1 138  ? 4.464   -32.567  48.087  1.00 70.37  ? 142  TRP A NE1   1 
ATOM   1121  C  CE2   . TRP A 1 138  ? 3.388   -32.602  47.240  1.00 75.32  ? 142  TRP A CE2   1 
ATOM   1122  C  CE3   . TRP A 1 138  ? 2.513   -34.062  45.515  1.00 68.12  ? 142  TRP A CE3   1 
ATOM   1123  C  CZ2   . TRP A 1 138  ? 2.343   -31.696  47.078  1.00 76.70  ? 142  TRP A CZ2   1 
ATOM   1124  C  CZ3   . TRP A 1 138  ? 1.476   -33.169  45.348  1.00 66.30  ? 142  TRP A CZ3   1 
ATOM   1125  C  CH2   . TRP A 1 138  ? 1.393   -31.996  46.135  1.00 80.15  ? 142  TRP A CH2   1 
ATOM   1126  N  N     . PRO A 1 139  ? 2.757   -36.496  48.600  1.00 83.29  ? 143  PRO A N     1 
ATOM   1127  C  CA    . PRO A 1 139  ? 3.536   -35.976  49.729  1.00 78.29  ? 143  PRO A CA    1 
ATOM   1128  C  C     . PRO A 1 139  ? 3.920   -37.016  50.783  1.00 80.58  ? 143  PRO A C     1 
ATOM   1129  O  O     . PRO A 1 139  ? 4.555   -36.661  51.760  1.00 91.08  ? 143  PRO A O     1 
ATOM   1130  C  CB    . PRO A 1 139  ? 2.598   -34.936  50.337  1.00 78.07  ? 143  PRO A CB    1 
ATOM   1131  C  CG    . PRO A 1 139  ? 1.241   -35.122  49.646  1.00 75.78  ? 143  PRO A CG    1 
ATOM   1132  C  CD    . PRO A 1 139  ? 1.315   -36.383  48.862  1.00 79.43  ? 143  PRO A CD    1 
ATOM   1133  N  N     . LYS A 1 140  ? 3.566   -38.277  50.567  1.00 96.82  ? 144  LYS A N     1 
ATOM   1134  C  CA    . LYS A 1 140  ? 3.748   -39.327  51.574  1.00 107.70 ? 144  LYS A CA    1 
ATOM   1135  C  C     . LYS A 1 140  ? 5.170   -39.420  52.135  1.00 95.20  ? 144  LYS A C     1 
ATOM   1136  O  O     . LYS A 1 140  ? 5.351   -39.609  53.326  1.00 80.84  ? 144  LYS A O     1 
ATOM   1137  C  CB    . LYS A 1 140  ? 3.344   -40.683  50.984  1.00 128.97 ? 144  LYS A CB    1 
ATOM   1138  C  CG    . LYS A 1 140  ? 3.634   -41.883  51.886  1.00 131.19 ? 144  LYS A CG    1 
ATOM   1139  C  CD    . LYS A 1 140  ? 2.449   -42.232  52.761  1.00 127.86 ? 144  LYS A CD    1 
ATOM   1140  C  CE    . LYS A 1 140  ? 2.599   -43.626  53.338  1.00 126.66 ? 144  LYS A CE    1 
ATOM   1141  N  NZ    . LYS A 1 140  ? 1.343   -44.097  53.981  1.00 129.57 ? 144  LYS A NZ    1 
ATOM   1142  N  N     . HIS A 1 141  ? 6.170   -39.285  51.271  1.00 95.06  ? 145  HIS A N     1 
ATOM   1143  C  CA    . HIS A 1 141  ? 7.566   -39.412  51.683  1.00 85.51  ? 145  HIS A CA    1 
ATOM   1144  C  C     . HIS A 1 141  ? 8.312   -38.114  51.448  1.00 83.89  ? 145  HIS A C     1 
ATOM   1145  O  O     . HIS A 1 141  ? 9.516   -38.019  51.674  1.00 89.92  ? 145  HIS A O     1 
ATOM   1146  C  CB    . HIS A 1 141  ? 8.249   -40.556  50.933  1.00 93.27  ? 145  HIS A CB    1 
ATOM   1147  C  CG    . HIS A 1 141  ? 7.568   -41.877  51.107  1.00 99.68  ? 145  HIS A CG    1 
ATOM   1148  N  ND1   . HIS A 1 141  ? 7.347   -42.744  50.058  1.00 106.56 ? 145  HIS A ND1   1 
ATOM   1149  C  CD2   . HIS A 1 141  ? 7.051   -42.475  52.205  1.00 94.57  ? 145  HIS A CD2   1 
ATOM   1150  C  CE1   . HIS A 1 141  ? 6.723   -43.819  50.504  1.00 114.34 ? 145  HIS A CE1   1 
ATOM   1151  N  NE2   . HIS A 1 141  ? 6.530   -43.680  51.803  1.00 105.34 ? 145  HIS A NE2   1 
ATOM   1152  N  N     . TRP A 1 142  ? 7.582   -37.116  50.979  1.00 75.05  ? 146  TRP A N     1 
ATOM   1153  C  CA    . TRP A 1 142  ? 8.142   -35.796  50.777  1.00 81.48  ? 146  TRP A CA    1 
ATOM   1154  C  C     . TRP A 1 142  ? 7.075   -34.780  51.161  1.00 87.69  ? 146  TRP A C     1 
ATOM   1155  O  O     . TRP A 1 142  ? 6.535   -34.084  50.309  1.00 95.25  ? 146  TRP A O     1 
ATOM   1156  C  CB    . TRP A 1 142  ? 8.591   -35.607  49.325  1.00 86.20  ? 146  TRP A CB    1 
ATOM   1157  C  CG    . TRP A 1 142  ? 9.672   -34.595  49.156  1.00 95.46  ? 146  TRP A CG    1 
ATOM   1158  C  CD1   . TRP A 1 142  ? 9.913   -33.513  49.947  1.00 94.34  ? 146  TRP A CD1   1 
ATOM   1159  C  CD2   . TRP A 1 142  ? 10.671  -34.576  48.135  1.00 105.19 ? 146  TRP A CD2   1 
ATOM   1160  N  NE1   . TRP A 1 142  ? 10.998  -32.816  49.479  1.00 99.28  ? 146  TRP A NE1   1 
ATOM   1161  C  CE2   . TRP A 1 142  ? 11.482  -33.451  48.365  1.00 107.91 ? 146  TRP A CE2   1 
ATOM   1162  C  CE3   . TRP A 1 142  ? 10.954  -35.398  47.042  1.00 104.07 ? 146  TRP A CE3   1 
ATOM   1163  C  CZ2   . TRP A 1 142  ? 12.560  -33.127  47.545  1.00 112.90 ? 146  TRP A CZ2   1 
ATOM   1164  C  CZ3   . TRP A 1 142  ? 12.028  -35.077  46.232  1.00 109.64 ? 146  TRP A CZ3   1 
ATOM   1165  C  CH2   . TRP A 1 142  ? 12.816  -33.951  46.487  1.00 112.94 ? 146  TRP A CH2   1 
ATOM   1166  N  N     . PRO A 1 143  ? 6.758   -34.693  52.459  1.00 76.56  ? 147  PRO A N     1 
ATOM   1167  C  CA    . PRO A 1 143  ? 5.609   -33.877  52.845  1.00 71.36  ? 147  PRO A CA    1 
ATOM   1168  C  C     . PRO A 1 143  ? 5.950   -32.402  52.949  1.00 71.61  ? 147  PRO A C     1 
ATOM   1169  O  O     . PRO A 1 143  ? 5.039   -31.582  52.942  1.00 80.71  ? 147  PRO A O     1 
ATOM   1170  C  CB    . PRO A 1 143  ? 5.220   -34.463  54.205  1.00 64.11  ? 147  PRO A CB    1 
ATOM   1171  C  CG    . PRO A 1 143  ? 6.503   -34.945  54.758  1.00 67.71  ? 147  PRO A CG    1 
ATOM   1172  C  CD    . PRO A 1 143  ? 7.372   -35.362  53.615  1.00 79.40  ? 147  PRO A CD    1 
ATOM   1173  N  N     . THR A 1 144  ? 7.236   -32.074  53.037  1.00 70.42  ? 148  THR A N     1 
ATOM   1174  C  CA    . THR A 1 144  ? 7.653   -30.684  53.196  1.00 74.49  ? 148  THR A CA    1 
ATOM   1175  C  C     . THR A 1 144  ? 8.111   -30.060  51.880  1.00 81.62  ? 148  THR A C     1 
ATOM   1176  O  O     . THR A 1 144  ? 8.699   -28.972  51.897  1.00 80.76  ? 148  THR A O     1 
ATOM   1177  C  CB    . THR A 1 144  ? 8.800   -30.545  54.208  1.00 67.95  ? 148  THR A CB    1 
ATOM   1178  O  OG1   . THR A 1 144  ? 9.982   -31.162  53.681  1.00 75.52  ? 148  THR A OG1   1 
ATOM   1179  C  CG2   . THR A 1 144  ? 8.426   -31.203  55.534  1.00 70.99  ? 148  THR A CG2   1 
ATOM   1180  N  N     . PHE A 1 145  ? 7.830   -30.723  50.755  1.00 72.34  ? 149  PHE A N     1 
ATOM   1181  C  CA    . PHE A 1 145  ? 8.368   -30.300  49.461  1.00 81.37  ? 149  PHE A CA    1 
ATOM   1182  C  C     . PHE A 1 145  ? 7.973   -28.896  49.043  1.00 76.30  ? 149  PHE A C     1 
ATOM   1183  O  O     . PHE A 1 145  ? 8.834   -28.087  48.690  1.00 82.19  ? 149  PHE A O     1 
ATOM   1184  C  CB    . PHE A 1 145  ? 7.943   -31.265  48.359  1.00 84.40  ? 149  PHE A CB    1 
ATOM   1185  C  CG    . PHE A 1 145  ? 8.306   -30.793  46.984  1.00 72.46  ? 149  PHE A CG    1 
ATOM   1186  C  CD1   . PHE A 1 145  ? 9.628   -30.815  46.554  1.00 64.63  ? 149  PHE A CD1   1 
ATOM   1187  C  CD2   . PHE A 1 145  ? 7.334   -30.307  46.121  1.00 76.00  ? 149  PHE A CD2   1 
ATOM   1188  C  CE1   . PHE A 1 145  ? 9.965   -30.359  45.297  1.00 60.64  ? 149  PHE A CE1   1 
ATOM   1189  C  CE2   . PHE A 1 145  ? 7.676   -29.858  44.859  1.00 59.48  ? 149  PHE A CE2   1 
ATOM   1190  C  CZ    . PHE A 1 145  ? 8.990   -29.884  44.458  1.00 60.20  ? 149  PHE A CZ    1 
ATOM   1191  N  N     . ILE A 1 146  ? 6.676   -28.613  49.058  1.00 70.30  ? 150  ILE A N     1 
ATOM   1192  C  CA    . ILE A 1 146  ? 6.200   -27.318  48.584  1.00 72.82  ? 150  ILE A CA    1 
ATOM   1193  C  C     . ILE A 1 146  ? 6.757   -26.194  49.440  1.00 79.97  ? 150  ILE A C     1 
ATOM   1194  O  O     . ILE A 1 146  ? 7.249   -25.202  48.908  1.00 93.70  ? 150  ILE A O     1 
ATOM   1195  C  CB    . ILE A 1 146  ? 4.670   -27.243  48.561  1.00 70.24  ? 150  ILE A CB    1 
ATOM   1196  C  CG1   . ILE A 1 146  ? 4.114   -28.189  47.494  1.00 67.02  ? 150  ILE A CG1   1 
ATOM   1197  C  CG2   . ILE A 1 146  ? 4.195   -25.821  48.290  1.00 67.88  ? 150  ILE A CG2   1 
ATOM   1198  C  CD1   . ILE A 1 146  ? 4.601   -27.893  46.115  1.00 67.50  ? 150  ILE A CD1   1 
ATOM   1199  N  N     . SER A 1 147  ? 6.694   -26.357  50.759  1.00 74.93  ? 151  SER A N     1 
ATOM   1200  C  CA    . SER A 1 147  ? 7.291   -25.389  51.675  1.00 75.02  ? 151  SER A CA    1 
ATOM   1201  C  C     . SER A 1 147  ? 8.773   -25.209  51.356  1.00 72.74  ? 151  SER A C     1 
ATOM   1202  O  O     . SER A 1 147  ? 9.280   -24.091  51.322  1.00 65.57  ? 151  SER A O     1 
ATOM   1203  C  CB    . SER A 1 147  ? 7.127   -25.836  53.128  1.00 73.76  ? 151  SER A CB    1 
ATOM   1204  O  OG    . SER A 1 147  ? 5.767   -26.027  53.440  1.00 89.54  ? 151  SER A OG    1 
ATOM   1205  N  N     . ASP A 1 148  ? 9.457   -26.325  51.121  1.00 65.03  ? 152  ASP A N     1 
ATOM   1206  C  CA    . ASP A 1 148  ? 10.889  -26.321  50.880  1.00 60.81  ? 152  ASP A CA    1 
ATOM   1207  C  C     . ASP A 1 148  ? 11.254  -25.504  49.651  1.00 78.12  ? 152  ASP A C     1 
ATOM   1208  O  O     . ASP A 1 148  ? 12.171  -24.688  49.713  1.00 80.16  ? 152  ASP A O     1 
ATOM   1209  C  CB    . ASP A 1 148  ? 11.403  -27.750  50.727  1.00 83.10  ? 152  ASP A CB    1 
ATOM   1210  C  CG    . ASP A 1 148  ? 11.567  -28.466  52.060  1.00 87.57  ? 152  ASP A CG    1 
ATOM   1211  O  OD1   . ASP A 1 148  ? 11.462  -27.802  53.105  1.00 94.04  ? 152  ASP A OD1   1 
ATOM   1212  O  OD2   . ASP A 1 148  ? 11.810  -29.694  52.060  1.00 93.46  ? 152  ASP A OD2   1 
ATOM   1213  N  N     . ILE A 1 149  ? 10.543  -25.711  48.541  1.00 81.93  ? 153  ILE A N     1 
ATOM   1214  C  CA    . ILE A 1 149  ? 10.887  -25.021  47.302  1.00 80.17  ? 153  ILE A CA    1 
ATOM   1215  C  C     . ILE A 1 149  ? 10.376  -23.594  47.272  1.00 71.39  ? 153  ILE A C     1 
ATOM   1216  O  O     . ILE A 1 149  ? 11.025  -22.721  46.708  1.00 71.52  ? 153  ILE A O     1 
ATOM   1217  C  CB    . ILE A 1 149  ? 10.354  -25.764  46.056  1.00 94.49  ? 153  ILE A CB    1 
ATOM   1218  C  CG1   . ILE A 1 149  ? 8.837   -25.935  46.121  1.00 95.93  ? 153  ILE A CG1   1 
ATOM   1219  C  CG2   . ILE A 1 149  ? 11.031  -27.104  45.911  1.00 111.46 ? 153  ILE A CG2   1 
ATOM   1220  C  CD1   . ILE A 1 149  ? 8.231   -26.336  44.794  1.00 104.03 ? 153  ILE A CD1   1 
ATOM   1221  N  N     . VAL A 1 150  ? 9.204   -23.362  47.854  1.00 75.51  ? 154  VAL A N     1 
ATOM   1222  C  CA    . VAL A 1 150  ? 8.652   -22.012  47.939  1.00 74.94  ? 154  VAL A CA    1 
ATOM   1223  C  C     . VAL A 1 150  ? 9.567   -21.143  48.789  1.00 64.64  ? 154  VAL A C     1 
ATOM   1224  O  O     . VAL A 1 150  ? 9.803   -19.992  48.494  1.00 69.12  ? 154  VAL A O     1 
ATOM   1225  C  CB    . VAL A 1 150  ? 7.220   -22.009  48.521  1.00 75.86  ? 154  VAL A CB    1 
ATOM   1226  C  CG1   . VAL A 1 150  ? 6.785   -20.600  48.874  1.00 64.17  ? 154  VAL A CG1   1 
ATOM   1227  C  CG2   . VAL A 1 150  ? 6.247   -22.627  47.517  1.00 83.50  ? 154  VAL A CG2   1 
ATOM   1228  N  N     . GLY A 1 151  ? 10.124  -21.737  49.827  1.00 62.16  ? 155  GLY A N     1 
ATOM   1229  C  CA    . GLY A 1 151  ? 11.081  -21.062  50.673  1.00 68.98  ? 155  GLY A CA    1 
ATOM   1230  C  C     . GLY A 1 151  ? 12.407  -20.867  49.978  1.00 68.30  ? 155  GLY A C     1 
ATOM   1231  O  O     . GLY A 1 151  ? 13.024  -19.818  50.087  1.00 90.18  ? 155  GLY A O     1 
ATOM   1232  N  N     . ALA A 1 152  ? 12.849  -21.887  49.257  1.00 74.54  ? 156  ALA A N     1 
ATOM   1233  C  CA    . ALA A 1 152  ? 14.135  -21.829  48.573  1.00 81.13  ? 156  ALA A CA    1 
ATOM   1234  C  C     . ALA A 1 152  ? 14.084  -20.889  47.369  1.00 82.38  ? 156  ALA A C     1 
ATOM   1235  O  O     . ALA A 1 152  ? 15.118  -20.548  46.798  1.00 84.45  ? 156  ALA A O     1 
ATOM   1236  C  CB    . ALA A 1 152  ? 14.566  -23.222  48.138  1.00 77.64  ? 156  ALA A CB    1 
ATOM   1237  N  N     . SER A 1 153  ? 12.881  -20.477  46.984  1.00 76.73  ? 157  SER A N     1 
ATOM   1238  C  CA    . SER A 1 153  ? 12.719  -19.570  45.858  1.00 86.41  ? 157  SER A CA    1 
ATOM   1239  C  C     . SER A 1 153  ? 13.141  -18.171  46.273  1.00 100.59 ? 157  SER A C     1 
ATOM   1240  O  O     . SER A 1 153  ? 13.566  -17.367  45.441  1.00 107.09 ? 157  SER A O     1 
ATOM   1241  C  CB    . SER A 1 153  ? 11.274  -19.565  45.354  1.00 78.34  ? 157  SER A CB    1 
ATOM   1242  O  OG    . SER A 1 153  ? 10.931  -20.818  44.804  1.00 74.99  ? 157  SER A OG    1 
ATOM   1243  N  N     . ARG A 1 154  ? 13.018  -17.888  47.566  1.00 104.32 ? 158  ARG A N     1 
ATOM   1244  C  CA    . ARG A 1 154  ? 13.414  -16.598  48.114  1.00 96.83  ? 158  ARG A CA    1 
ATOM   1245  C  C     . ARG A 1 154  ? 14.935  -16.476  48.168  1.00 97.80  ? 158  ARG A C     1 
ATOM   1246  O  O     . ARG A 1 154  ? 15.471  -15.392  48.361  1.00 106.35 ? 158  ARG A O     1 
ATOM   1247  C  CB    . ARG A 1 154  ? 12.810  -16.409  49.503  1.00 111.57 ? 158  ARG A CB    1 
ATOM   1248  C  CG    . ARG A 1 154  ? 11.297  -16.229  49.508  1.00 126.54 ? 158  ARG A CG    1 
ATOM   1249  C  CD    . ARG A 1 154  ? 10.900  -14.856  48.967  1.00 142.63 ? 158  ARG A CD    1 
ATOM   1250  N  NE    . ARG A 1 154  ? 9.449   -14.683  48.912  1.00 149.06 ? 158  ARG A NE    1 
ATOM   1251  C  CZ    . ARG A 1 154  ? 8.706   -14.239  49.922  1.00 153.20 ? 158  ARG A CZ    1 
ATOM   1252  N  NH1   . ARG A 1 154  ? 9.273   -13.923  51.082  1.00 155.80 ? 158  ARG A NH1   1 
ATOM   1253  N  NH2   . ARG A 1 154  ? 7.391   -14.114  49.776  1.00 146.87 ? 158  ARG A NH2   1 
ATOM   1254  N  N     . THR A 1 155  ? 15.622  -17.599  47.991  1.00 112.61 ? 159  THR A N     1 
ATOM   1255  C  CA    . THR A 1 155  ? 17.081  -17.624  47.959  1.00 115.17 ? 159  THR A CA    1 
ATOM   1256  C  C     . THR A 1 155  ? 17.622  -16.902  46.731  1.00 110.12 ? 159  THR A C     1 
ATOM   1257  O  O     . THR A 1 155  ? 18.225  -15.839  46.837  1.00 116.53 ? 159  THR A O     1 
ATOM   1258  C  CB    . THR A 1 155  ? 17.624  -19.071  47.959  1.00 111.78 ? 159  THR A CB    1 
ATOM   1259  O  OG1   . THR A 1 155  ? 17.192  -19.745  49.145  1.00 124.06 ? 159  THR A OG1   1 
ATOM   1260  C  CG2   . THR A 1 155  ? 19.144  -19.079  47.897  1.00 104.88 ? 159  THR A CG2   1 
ATOM   1261  N  N     . SER A 1 156  ? 17.400  -17.497  45.564  1.00 111.60 ? 160  SER A N     1 
ATOM   1262  C  CA    . SER A 1 156  ? 17.916  -16.965  44.310  1.00 104.54 ? 160  SER A CA    1 
ATOM   1263  C  C     . SER A 1 156  ? 16.790  -16.689  43.322  1.00 101.03 ? 160  SER A C     1 
ATOM   1264  O  O     . SER A 1 156  ? 15.677  -17.182  43.490  1.00 106.23 ? 160  SER A O     1 
ATOM   1265  C  CB    . SER A 1 156  ? 18.928  -17.938  43.701  1.00 104.67 ? 160  SER A CB    1 
ATOM   1266  O  OG    . SER A 1 156  ? 19.050  -17.738  42.307  1.00 116.48 ? 160  SER A OG    1 
ATOM   1267  N  N     . GLU A 1 157  ? 17.081  -15.896  42.296  1.00 95.27  ? 161  GLU A N     1 
ATOM   1268  C  CA    . GLU A 1 157  ? 16.097  -15.593  41.267  1.00 93.44  ? 161  GLU A CA    1 
ATOM   1269  C  C     . GLU A 1 157  ? 16.066  -16.684  40.201  1.00 94.58  ? 161  GLU A C     1 
ATOM   1270  O  O     . GLU A 1 157  ? 14.996  -17.061  39.719  1.00 91.89  ? 161  GLU A O     1 
ATOM   1271  C  CB    . GLU A 1 157  ? 16.387  -14.234  40.625  1.00 102.31 ? 161  GLU A CB    1 
ATOM   1272  C  CG    . GLU A 1 157  ? 16.008  -13.050  41.487  1.00 113.51 ? 161  GLU A CG    1 
ATOM   1273  C  CD    . GLU A 1 157  ? 16.098  -11.732  40.744  1.00 125.35 ? 161  GLU A CD    1 
ATOM   1274  O  OE1   . GLU A 1 157  ? 17.178  -11.430  40.195  1.00 133.64 ? 161  GLU A OE1   1 
ATOM   1275  O  OE2   . GLU A 1 157  ? 15.084  -11.001  40.702  1.00 125.62 ? 161  GLU A OE2   1 
ATOM   1276  N  N     . SER A 1 158  ? 17.242  -17.183  39.835  1.00 89.56  ? 162  SER A N     1 
ATOM   1277  C  CA    . SER A 1 158  ? 17.342  -18.256  38.858  1.00 98.26  ? 162  SER A CA    1 
ATOM   1278  C  C     . SER A 1 158  ? 16.737  -19.537  39.418  1.00 107.06 ? 162  SER A C     1 
ATOM   1279  O  O     . SER A 1 158  ? 15.977  -20.240  38.736  1.00 120.72 ? 162  SER A O     1 
ATOM   1280  C  CB    . SER A 1 158  ? 18.800  -18.477  38.459  1.00 99.77  ? 162  SER A CB    1 
ATOM   1281  O  OG    . SER A 1 158  ? 19.596  -18.754  39.592  1.00 102.78 ? 162  SER A OG    1 
ATOM   1282  N  N     . LEU A 1 159  ? 17.088  -19.827  40.668  1.00 100.79 ? 163  LEU A N     1 
ATOM   1283  C  CA    . LEU A 1 159  ? 16.536  -20.958  41.401  1.00 91.92  ? 163  LEU A CA    1 
ATOM   1284  C  C     . LEU A 1 159  ? 15.015  -20.876  41.412  1.00 93.37  ? 163  LEU A C     1 
ATOM   1285  O  O     . LEU A 1 159  ? 14.325  -21.857  41.176  1.00 101.42 ? 163  LEU A O     1 
ATOM   1286  C  CB    . LEU A 1 159  ? 17.081  -20.978  42.829  1.00 88.48  ? 163  LEU A CB    1 
ATOM   1287  C  CG    . LEU A 1 159  ? 17.319  -22.309  43.549  1.00 88.72  ? 163  LEU A CG    1 
ATOM   1288  C  CD1   . LEU A 1 159  ? 17.927  -22.051  44.933  1.00 97.53  ? 163  LEU A CD1   1 
ATOM   1289  C  CD2   . LEU A 1 159  ? 16.042  -23.124  43.680  1.00 79.98  ? 163  LEU A CD2   1 
ATOM   1290  N  N     . CYS A 1 160  ? 14.503  -19.682  41.673  1.00 97.13  ? 164  CYS A N     1 
ATOM   1291  C  CA    . CYS A 1 160  ? 13.067  -19.431  41.681  1.00 94.27  ? 164  CYS A CA    1 
ATOM   1292  C  C     . CYS A 1 160  ? 12.447  -19.675  40.307  1.00 94.19  ? 164  CYS A C     1 
ATOM   1293  O  O     . CYS A 1 160  ? 11.358  -20.233  40.206  1.00 97.22  ? 164  CYS A O     1 
ATOM   1294  C  CB    . CYS A 1 160  ? 12.787  -17.994  42.141  1.00 93.44  ? 164  CYS A CB    1 
ATOM   1295  S  SG    . CYS A 1 160  ? 11.055  -17.509  42.070  1.00 66.57  ? 164  CYS A SG    1 
ATOM   1296  N  N     . GLN A 1 161  ? 13.143  -19.245  39.258  1.00 89.49  ? 165  GLN A N     1 
ATOM   1297  C  CA    . GLN A 1 161  ? 12.696  -19.434  37.880  1.00 91.32  ? 165  GLN A CA    1 
ATOM   1298  C  C     . GLN A 1 161  ? 12.528  -20.911  37.530  1.00 85.00  ? 165  GLN A C     1 
ATOM   1299  O  O     . GLN A 1 161  ? 11.451  -21.360  37.087  1.00 84.16  ? 165  GLN A O     1 
ATOM   1300  C  CB    . GLN A 1 161  ? 13.694  -18.778  36.927  1.00 108.34 ? 165  GLN A CB    1 
ATOM   1301  C  CG    . GLN A 1 161  ? 13.617  -19.250  35.484  1.00 108.40 ? 165  GLN A CG    1 
ATOM   1302  C  CD    . GLN A 1 161  ? 14.903  -18.977  34.737  1.00 113.00 ? 165  GLN A CD    1 
ATOM   1303  O  OE1   . GLN A 1 161  ? 14.999  -18.008  33.991  1.00 117.64 ? 165  GLN A OE1   1 
ATOM   1304  N  NE2   . GLN A 1 161  ? 15.907  -19.829  34.942  1.00 119.18 ? 165  GLN A NE2   1 
ATOM   1305  N  N     . ASN A 1 162  ? 13.602  -21.666  37.739  1.00 79.10  ? 166  ASN A N     1 
ATOM   1306  C  CA    . ASN A 1 162  ? 13.551  -23.100  37.523  1.00 78.06  ? 166  ASN A CA    1 
ATOM   1307  C  C     . ASN A 1 162  ? 12.483  -23.755  38.385  1.00 77.38  ? 166  ASN A C     1 
ATOM   1308  O  O     . ASN A 1 162  ? 11.813  -24.681  37.933  1.00 75.86  ? 166  ASN A O     1 
ATOM   1309  C  CB    . ASN A 1 162  ? 14.906  -23.737  37.799  1.00 75.86  ? 166  ASN A CB    1 
ATOM   1310  C  CG    . ASN A 1 162  ? 14.963  -25.184  37.354  1.00 82.82  ? 166  ASN A CG    1 
ATOM   1311  O  OD1   . ASN A 1 162  ? 15.285  -25.482  36.207  1.00 74.68  ? 166  ASN A OD1   1 
ATOM   1312  N  ND2   . ASN A 1 162  ? 14.644  -26.090  38.265  1.00 96.23  ? 166  ASN A ND2   1 
ATOM   1313  N  N     . ASN A 1 163  ? 12.323  -23.266  39.614  1.00 70.45  ? 167  ASN A N     1 
ATOM   1314  C  CA    . ASN A 1 163  ? 11.287  -23.773  40.515  1.00 70.70  ? 167  ASN A CA    1 
ATOM   1315  C  C     . ASN A 1 163  ? 9.891   -23.543  39.943  1.00 70.42  ? 167  ASN A C     1 
ATOM   1316  O  O     . ASN A 1 163  ? 8.987   -24.364  40.128  1.00 68.68  ? 167  ASN A O     1 
ATOM   1317  C  CB    . ASN A 1 163  ? 11.398  -23.125  41.894  1.00 73.11  ? 167  ASN A CB    1 
ATOM   1318  C  CG    . ASN A 1 163  ? 12.526  -23.708  42.726  1.00 93.56  ? 167  ASN A CG    1 
ATOM   1319  O  OD1   . ASN A 1 163  ? 13.397  -24.408  42.209  1.00 101.28 ? 167  ASN A OD1   1 
ATOM   1320  N  ND2   . ASN A 1 163  ? 12.517  -23.418  44.021  1.00 104.32 ? 167  ASN A ND2   1 
ATOM   1321  N  N     . MET A 1 164  ? 9.721   -22.421  39.251  1.00 66.93  ? 168  MET A N     1 
ATOM   1322  C  CA    . MET A 1 164  ? 8.467   -22.120  38.586  1.00 70.48  ? 168  MET A CA    1 
ATOM   1323  C  C     . MET A 1 164  ? 8.241   -23.140  37.503  1.00 75.92  ? 168  MET A C     1 
ATOM   1324  O  O     . MET A 1 164  ? 7.118   -23.624  37.324  1.00 88.80  ? 168  MET A O     1 
ATOM   1325  C  CB    . MET A 1 164  ? 8.469   -20.705  37.988  1.00 75.96  ? 168  MET A CB    1 
ATOM   1326  C  CG    . MET A 1 164  ? 8.523   -19.577  39.009  1.00 79.96  ? 168  MET A CG    1 
ATOM   1327  S  SD    . MET A 1 164  ? 7.167   -19.626  40.180  1.00 83.01  ? 168  MET A SD    1 
ATOM   1328  C  CE    . MET A 1 164  ? 5.766   -19.815  39.115  1.00 142.63 ? 168  MET A CE    1 
ATOM   1329  N  N     . VAL A 1 165  ? 9.310   -23.458  36.772  1.00 72.81  ? 169  VAL A N     1 
ATOM   1330  C  CA    . VAL A 1 165  ? 9.214   -24.472  35.715  1.00 76.40  ? 169  VAL A CA    1 
ATOM   1331  C  C     . VAL A 1 165  ? 8.782   -25.826  36.306  1.00 74.98  ? 169  VAL A C     1 
ATOM   1332  O  O     . VAL A 1 165  ? 7.863   -26.471  35.814  1.00 78.80  ? 169  VAL A O     1 
ATOM   1333  C  CB    . VAL A 1 165  ? 10.547  -24.634  34.960  1.00 66.96  ? 169  VAL A CB    1 
ATOM   1334  C  CG1   . VAL A 1 165  ? 10.461  -25.761  33.962  1.00 60.09  ? 169  VAL A CG1   1 
ATOM   1335  C  CG2   . VAL A 1 165  ? 10.932  -23.336  34.292  1.00 58.80  ? 169  VAL A CG2   1 
ATOM   1336  N  N     . ILE A 1 166  ? 9.441   -26.235  37.384  1.00 73.32  ? 170  ILE A N     1 
ATOM   1337  C  CA    . ILE A 1 166  ? 9.105   -27.466  38.097  1.00 67.55  ? 170  ILE A CA    1 
ATOM   1338  C  C     . ILE A 1 166  ? 7.645   -27.514  38.524  1.00 65.17  ? 170  ILE A C     1 
ATOM   1339  O  O     . ILE A 1 166  ? 6.957   -28.500  38.306  1.00 75.50  ? 170  ILE A O     1 
ATOM   1340  C  CB    . ILE A 1 166  ? 9.983   -27.640  39.347  1.00 63.64  ? 170  ILE A CB    1 
ATOM   1341  C  CG1   . ILE A 1 166  ? 11.461  -27.674  38.953  1.00 66.39  ? 170  ILE A CG1   1 
ATOM   1342  C  CG2   . ILE A 1 166  ? 9.598   -28.901  40.088  1.00 63.34  ? 170  ILE A CG2   1 
ATOM   1343  C  CD1   . ILE A 1 166  ? 12.412  -27.672  40.108  1.00 65.84  ? 170  ILE A CD1   1 
ATOM   1344  N  N     . LEU A 1 167  ? 7.173   -26.440  39.137  1.00 65.03  ? 171  LEU A N     1 
ATOM   1345  C  CA    . LEU A 1 167  ? 5.780   -26.368  39.558  1.00 67.43  ? 171  LEU A CA    1 
ATOM   1346  C  C     . LEU A 1 167  ? 4.827   -26.471  38.374  1.00 64.36  ? 171  LEU A C     1 
ATOM   1347  O  O     . LEU A 1 167  ? 3.798   -27.131  38.463  1.00 67.93  ? 171  LEU A O     1 
ATOM   1348  C  CB    . LEU A 1 167  ? 5.520   -25.074  40.343  1.00 64.78  ? 171  LEU A CB    1 
ATOM   1349  C  CG    . LEU A 1 167  ? 6.044   -25.086  41.782  1.00 67.28  ? 171  LEU A CG    1 
ATOM   1350  C  CD1   . LEU A 1 167  ? 5.868   -23.724  42.421  1.00 75.43  ? 171  LEU A CD1   1 
ATOM   1351  C  CD2   . LEU A 1 167  ? 5.351   -26.157  42.597  1.00 63.26  ? 171  LEU A CD2   1 
ATOM   1352  N  N     . LYS A 1 168  ? 5.178   -25.829  37.266  1.00 65.96  ? 172  LYS A N     1 
ATOM   1353  C  CA    . LYS A 1 168  ? 4.352   -25.891  36.066  1.00 63.98  ? 172  LYS A CA    1 
ATOM   1354  C  C     . LYS A 1 168  ? 4.247   -27.319  35.558  1.00 72.03  ? 172  LYS A C     1 
ATOM   1355  O  O     . LYS A 1 168  ? 3.147   -27.822  35.309  1.00 68.23  ? 172  LYS A O     1 
ATOM   1356  C  CB    . LYS A 1 168  ? 4.913   -24.988  34.960  1.00 62.92  ? 172  LYS A CB    1 
ATOM   1357  C  CG    . LYS A 1 168  ? 4.138   -25.093  33.648  1.00 66.17  ? 172  LYS A CG    1 
ATOM   1358  C  CD    . LYS A 1 168  ? 4.908   -24.482  32.507  1.00 69.80  ? 172  LYS A CD    1 
ATOM   1359  C  CE    . LYS A 1 168  ? 6.245   -25.168  32.309  1.00 64.92  ? 172  LYS A CE    1 
ATOM   1360  N  NZ    . LYS A 1 168  ? 7.057   -24.481  31.262  1.00 76.57  ? 172  LYS A NZ    1 
ATOM   1361  N  N     . LEU A 1 169  ? 5.401   -27.961  35.404  1.00 69.14  ? 173  LEU A N     1 
ATOM   1362  C  CA    . LEU A 1 169  ? 5.458   -29.341  34.955  1.00 62.94  ? 173  LEU A CA    1 
ATOM   1363  C  C     . LEU A 1 169  ? 4.628   -30.248  35.863  1.00 65.33  ? 173  LEU A C     1 
ATOM   1364  O  O     . LEU A 1 169  ? 3.856   -31.079  35.383  1.00 68.11  ? 173  LEU A O     1 
ATOM   1365  C  CB    . LEU A 1 169  ? 6.907   -29.822  34.903  1.00 60.74  ? 173  LEU A CB    1 
ATOM   1366  C  CG    . LEU A 1 169  ? 7.746   -29.240  33.768  1.00 60.22  ? 173  LEU A CG    1 
ATOM   1367  C  CD1   . LEU A 1 169  ? 9.213   -29.565  33.969  1.00 68.58  ? 173  LEU A CD1   1 
ATOM   1368  C  CD2   . LEU A 1 169  ? 7.258   -29.787  32.455  1.00 68.13  ? 173  LEU A CD2   1 
ATOM   1369  N  N     . LEU A 1 170  ? 4.785   -30.076  37.173  1.00 68.57  ? 174  LEU A N     1 
ATOM   1370  C  CA    . LEU A 1 170  ? 4.019   -30.848  38.134  1.00 70.70  ? 174  LEU A CA    1 
ATOM   1371  C  C     . LEU A 1 170  ? 2.526   -30.639  37.920  1.00 64.88  ? 174  LEU A C     1 
ATOM   1372  O  O     . LEU A 1 170  ? 1.740   -31.583  37.982  1.00 71.35  ? 174  LEU A O     1 
ATOM   1373  C  CB    . LEU A 1 170  ? 4.411   -30.471  39.564  1.00 86.91  ? 174  LEU A CB    1 
ATOM   1374  C  CG    . LEU A 1 170  ? 3.671   -31.194  40.705  1.00 81.47  ? 174  LEU A CG    1 
ATOM   1375  C  CD1   . LEU A 1 170  ? 3.960   -32.662  40.687  1.00 73.82  ? 174  LEU A CD1   1 
ATOM   1376  C  CD2   . LEU A 1 170  ? 4.039   -30.589  42.034  1.00 82.55  ? 174  LEU A CD2   1 
ATOM   1377  N  N     . SER A 1 171  ? 2.142   -29.397  37.669  1.00 64.51  ? 175  SER A N     1 
ATOM   1378  C  CA    . SER A 1 171  ? 0.746   -29.078  37.415  1.00 70.14  ? 175  SER A CA    1 
ATOM   1379  C  C     . SER A 1 171  ? 0.251   -29.827  36.187  1.00 77.52  ? 175  SER A C     1 
ATOM   1380  O  O     . SER A 1 171  ? -0.841  -30.397  36.197  1.00 72.54  ? 175  SER A O     1 
ATOM   1381  C  CB    . SER A 1 171  ? 0.555   -27.567  37.231  1.00 67.24  ? 175  SER A CB    1 
ATOM   1382  O  OG    . SER A 1 171  ? -0.800  -27.263  36.947  1.00 74.32  ? 175  SER A OG    1 
ATOM   1383  N  N     . GLU A 1 172  ? 1.060   -29.822  35.132  1.00 73.73  ? 176  GLU A N     1 
ATOM   1384  C  CA    . GLU A 1 172  ? 0.696   -30.503  33.894  1.00 80.09  ? 176  GLU A CA    1 
ATOM   1385  C  C     . GLU A 1 172  ? 0.513   -31.998  34.121  1.00 74.41  ? 176  GLU A C     1 
ATOM   1386  O  O     . GLU A 1 172  ? -0.443  -32.594  33.628  1.00 76.76  ? 176  GLU A O     1 
ATOM   1387  C  CB    . GLU A 1 172  ? 1.754   -30.259  32.812  1.00 83.65  ? 176  GLU A CB    1 
ATOM   1388  C  CG    . GLU A 1 172  ? 1.859   -28.802  32.372  1.00 91.39  ? 176  GLU A CG    1 
ATOM   1389  C  CD    . GLU A 1 172  ? 2.880   -28.587  31.277  1.00 96.66  ? 176  GLU A CD    1 
ATOM   1390  O  OE1   . GLU A 1 172  ? 3.902   -29.303  31.255  1.00 100.99 ? 176  GLU A OE1   1 
ATOM   1391  O  OE2   . GLU A 1 172  ? 2.656   -27.700  30.432  1.00 101.19 ? 176  GLU A OE2   1 
ATOM   1392  N  N     . GLU A 1 173  ? 1.423   -32.591  34.884  1.00 67.83  ? 177  GLU A N     1 
ATOM   1393  C  CA    . GLU A 1 173  ? 1.384   -34.025  35.151  1.00 60.04  ? 177  GLU A CA    1 
ATOM   1394  C  C     . GLU A 1 173  ? 0.229   -34.437  36.057  1.00 59.52  ? 177  GLU A C     1 
ATOM   1395  O  O     . GLU A 1 173  ? -0.312  -35.526  35.921  1.00 77.16  ? 177  GLU A O     1 
ATOM   1396  C  CB    . GLU A 1 173  ? 2.705   -34.479  35.765  1.00 61.71  ? 177  GLU A CB    1 
ATOM   1397  C  CG    . GLU A 1 173  ? 3.889   -34.335  34.831  1.00 76.27  ? 177  GLU A CG    1 
ATOM   1398  C  CD    . GLU A 1 173  ? 3.688   -35.080  33.521  1.00 92.35  ? 177  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A 1 173  ? 3.500   -36.317  33.565  1.00 101.67 ? 177  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A 1 173  ? 3.704   -34.425  32.452  1.00 92.35  ? 177  GLU A OE2   1 
ATOM   1401  N  N     . VAL A 1 174  ? -0.160  -33.561  36.970  1.00 58.61  ? 178  VAL A N     1 
ATOM   1402  C  CA    . VAL A 1 174  ? -1.207  -33.890  37.926  1.00 60.01  ? 178  VAL A CA    1 
ATOM   1403  C  C     . VAL A 1 174  ? -2.608  -33.585  37.402  1.00 60.62  ? 178  VAL A C     1 
ATOM   1404  O  O     . VAL A 1 174  ? -3.518  -34.384  37.553  1.00 70.31  ? 178  VAL A O     1 
ATOM   1405  C  CB    . VAL A 1 174  ? -0.980  -33.141  39.273  1.00 65.54  ? 178  VAL A CB    1 
ATOM   1406  C  CG1   . VAL A 1 174  ? -2.176  -33.317  40.204  1.00 60.32  ? 178  VAL A CG1   1 
ATOM   1407  C  CG2   . VAL A 1 174  ? 0.294   -33.636  39.938  1.00 67.30  ? 178  VAL A CG2   1 
ATOM   1408  N  N     . PHE A 1 175  ? -2.780  -32.431  36.777  1.00 62.78  ? 179  PHE A N     1 
ATOM   1409  C  CA    . PHE A 1 175  ? -4.109  -31.992  36.356  1.00 66.60  ? 179  PHE A CA    1 
ATOM   1410  C  C     . PHE A 1 175  ? -4.419  -32.194  34.865  1.00 75.24  ? 179  PHE A C     1 
ATOM   1411  O  O     . PHE A 1 175  ? -5.572  -32.430  34.496  1.00 82.30  ? 179  PHE A O     1 
ATOM   1412  C  CB    . PHE A 1 175  ? -4.303  -30.516  36.707  1.00 57.45  ? 179  PHE A CB    1 
ATOM   1413  C  CG    . PHE A 1 175  ? -4.478  -30.263  38.170  1.00 60.21  ? 179  PHE A CG    1 
ATOM   1414  C  CD1   . PHE A 1 175  ? -5.734  -30.318  38.748  1.00 67.49  ? 179  PHE A CD1   1 
ATOM   1415  C  CD2   . PHE A 1 175  ? -3.388  -29.991  38.971  1.00 73.15  ? 179  PHE A CD2   1 
ATOM   1416  C  CE1   . PHE A 1 175  ? -5.903  -30.109  40.096  1.00 65.09  ? 179  PHE A CE1   1 
ATOM   1417  C  CE2   . PHE A 1 175  ? -3.545  -29.778  40.322  1.00 74.74  ? 179  PHE A CE2   1 
ATOM   1418  C  CZ    . PHE A 1 175  ? -4.805  -29.832  40.886  1.00 69.29  ? 179  PHE A CZ    1 
ATOM   1419  N  N     . ASP A 1 176  ? -3.399  -32.119  34.015  1.00 69.54  ? 180  ASP A N     1 
ATOM   1420  C  CA    . ASP A 1 176  ? -3.631  -32.107  32.571  1.00 76.64  ? 180  ASP A CA    1 
ATOM   1421  C  C     . ASP A 1 176  ? -3.402  -33.451  31.882  1.00 73.06  ? 180  ASP A C     1 
ATOM   1422  O  O     . ASP A 1 176  ? -4.065  -33.767  30.908  1.00 77.17  ? 180  ASP A O     1 
ATOM   1423  C  CB    . ASP A 1 176  ? -2.749  -31.047  31.911  1.00 80.48  ? 180  ASP A CB    1 
ATOM   1424  C  CG    . ASP A 1 176  ? -3.099  -29.640  32.358  1.00 93.43  ? 180  ASP A CG    1 
ATOM   1425  O  OD1   . ASP A 1 176  ? -4.307  -29.334  32.472  1.00 88.86  ? 180  ASP A OD1   1 
ATOM   1426  O  OD2   . ASP A 1 176  ? -2.168  -28.843  32.605  1.00 109.30 ? 180  ASP A OD2   1 
ATOM   1427  N  N     . PHE A 1 177  ? -2.467  -34.243  32.387  1.00 79.55  ? 181  PHE A N     1 
ATOM   1428  C  CA    . PHE A 1 177  ? -2.100  -35.486  31.718  1.00 71.96  ? 181  PHE A CA    1 
ATOM   1429  C  C     . PHE A 1 177  ? -2.127  -36.694  32.644  1.00 67.90  ? 181  PHE A C     1 
ATOM   1430  O  O     . PHE A 1 177  ? -1.467  -37.690  32.392  1.00 75.82  ? 181  PHE A O     1 
ATOM   1431  C  CB    . PHE A 1 177  ? -0.716  -35.343  31.093  1.00 68.00  ? 181  PHE A CB    1 
ATOM   1432  C  CG    . PHE A 1 177  ? -0.598  -34.176  30.161  1.00 66.46  ? 181  PHE A CG    1 
ATOM   1433  C  CD1   . PHE A 1 177  ? -1.325  -34.135  28.976  1.00 78.34  ? 181  PHE A CD1   1 
ATOM   1434  C  CD2   . PHE A 1 177  ? 0.251   -33.130  30.450  1.00 71.92  ? 181  PHE A CD2   1 
ATOM   1435  C  CE1   . PHE A 1 177  ? -1.219  -33.061  28.107  1.00 67.13  ? 181  PHE A CE1   1 
ATOM   1436  C  CE2   . PHE A 1 177  ? 0.368   -32.047  29.576  1.00 75.98  ? 181  PHE A CE2   1 
ATOM   1437  C  CZ    . PHE A 1 177  ? -0.366  -32.014  28.410  1.00 65.65  ? 181  PHE A CZ    1 
ATOM   1438  N  N     . SER A 1 178  ? -2.901  -36.600  33.715  1.00 87.78  ? 182  SER A N     1 
ATOM   1439  C  CA    . SER A 1 178  ? -2.962  -37.663  34.714  1.00 91.20  ? 182  SER A CA    1 
ATOM   1440  C  C     . SER A 1 178  ? -3.676  -38.901  34.169  1.00 97.96  ? 182  SER A C     1 
ATOM   1441  O  O     . SER A 1 178  ? -3.385  -40.025  34.584  1.00 107.83 ? 182  SER A O     1 
ATOM   1442  C  CB    . SER A 1 178  ? -3.656  -37.166  35.985  1.00 70.73  ? 182  SER A CB    1 
ATOM   1443  O  OG    . SER A 1 178  ? -4.921  -36.601  35.699  1.00 70.56  ? 182  SER A OG    1 
ATOM   1444  N  N     . SER A 1 179  ? -4.606  -38.693  33.239  1.00 87.42  ? 183  SER A N     1 
ATOM   1445  C  CA    . SER A 1 179  ? -5.385  -39.794  32.681  1.00 87.15  ? 183  SER A CA    1 
ATOM   1446  C  C     . SER A 1 179  ? -4.533  -40.721  31.823  1.00 90.17  ? 183  SER A C     1 
ATOM   1447  O  O     . SER A 1 179  ? -3.874  -40.279  30.883  1.00 84.51  ? 183  SER A O     1 
ATOM   1448  C  CB    . SER A 1 179  ? -6.553  -39.259  31.858  1.00 89.61  ? 183  SER A CB    1 
ATOM   1449  O  OG    . SER A 1 179  ? -7.194  -40.314  31.164  1.00 96.31  ? 183  SER A OG    1 
ATOM   1450  N  N     . GLY A 1 180  ? -4.548  -42.008  32.155  1.00 87.14  ? 184  GLY A N     1 
ATOM   1451  C  CA    . GLY A 1 180  ? -3.793  -42.995  31.408  1.00 81.51  ? 184  GLY A CA    1 
ATOM   1452  C  C     . GLY A 1 180  ? -2.386  -43.204  31.938  1.00 89.78  ? 184  GLY A C     1 
ATOM   1453  O  O     . GLY A 1 180  ? -1.708  -44.168  31.561  1.00 95.21  ? 184  GLY A O     1 
ATOM   1454  N  N     . GLN A 1 181  ? -1.941  -42.297  32.804  1.00 90.74  ? 185  GLN A N     1 
ATOM   1455  C  CA    . GLN A 1 181  ? -0.610  -42.391  33.391  1.00 85.89  ? 185  GLN A CA    1 
ATOM   1456  C  C     . GLN A 1 181  ? -0.675  -42.634  34.892  1.00 80.65  ? 185  GLN A C     1 
ATOM   1457  O  O     . GLN A 1 181  ? 0.181   -43.297  35.457  1.00 82.61  ? 185  GLN A O     1 
ATOM   1458  C  CB    . GLN A 1 181  ? 0.189   -41.119  33.111  1.00 74.78  ? 185  GLN A CB    1 
ATOM   1459  C  CG    . GLN A 1 181  ? 0.705   -40.994  31.709  1.00 79.04  ? 185  GLN A CG    1 
ATOM   1460  C  CD    . GLN A 1 181  ? 1.854   -40.016  31.605  1.00 103.61 ? 185  GLN A CD    1 
ATOM   1461  O  OE1   . GLN A 1 181  ? 1.661   -38.845  31.271  1.00 113.71 ? 185  GLN A OE1   1 
ATOM   1462  N  NE2   . GLN A 1 181  ? 3.062   -40.491  31.896  1.00 113.13 ? 185  GLN A NE2   1 
ATOM   1463  N  N     . ILE A 1 182  ? -1.690  -42.068  35.527  1.00 81.02  ? 186  ILE A N     1 
ATOM   1464  C  CA    . ILE A 1 182  ? -1.879  -42.192  36.964  1.00 77.20  ? 186  ILE A CA    1 
ATOM   1465  C  C     . ILE A 1 182  ? -3.256  -42.776  37.250  1.00 76.00  ? 186  ILE A C     1 
ATOM   1466  O  O     . ILE A 1 182  ? -4.239  -42.393  36.611  1.00 73.81  ? 186  ILE A O     1 
ATOM   1467  C  CB    . ILE A 1 182  ? -1.735  -40.824  37.674  1.00 74.45  ? 186  ILE A CB    1 
ATOM   1468  C  CG1   . ILE A 1 182  ? -0.356  -40.225  37.405  1.00 72.13  ? 186  ILE A CG1   1 
ATOM   1469  C  CG2   . ILE A 1 182  ? -1.967  -40.970  39.171  1.00 86.18  ? 186  ILE A CG2   1 
ATOM   1470  C  CD1   . ILE A 1 182  ? -0.185  -38.822  37.941  1.00 70.53  ? 186  ILE A CD1   1 
ATOM   1471  N  N     . THR A 1 183  ? -3.327  -43.699  38.203  1.00 77.52  ? 187  THR A N     1 
ATOM   1472  C  CA    . THR A 1 183  ? -4.599  -44.300  38.568  1.00 79.55  ? 187  THR A CA    1 
ATOM   1473  C  C     . THR A 1 183  ? -5.556  -43.215  39.070  1.00 84.39  ? 187  THR A C     1 
ATOM   1474  O  O     . THR A 1 183  ? -5.127  -42.180  39.586  1.00 82.73  ? 187  THR A O     1 
ATOM   1475  C  CB    . THR A 1 183  ? -4.425  -45.412  39.631  1.00 86.73  ? 187  THR A CB    1 
ATOM   1476  O  OG1   . THR A 1 183  ? -5.677  -46.067  39.851  1.00 113.70 ? 187  THR A OG1   1 
ATOM   1477  C  CG2   . THR A 1 183  ? -3.948  -44.855  40.936  1.00 79.04  ? 187  THR A CG2   1 
ATOM   1478  N  N     . GLN A 1 184  ? -6.849  -43.462  38.892  1.00 89.55  ? 188  GLN A N     1 
ATOM   1479  C  CA    . GLN A 1 184  ? -7.901  -42.496  39.197  1.00 98.81  ? 188  GLN A CA    1 
ATOM   1480  C  C     . GLN A 1 184  ? -7.805  -41.934  40.620  1.00 95.17  ? 188  GLN A C     1 
ATOM   1481  O  O     . GLN A 1 184  ? -7.766  -40.715  40.806  1.00 89.92  ? 188  GLN A O     1 
ATOM   1482  C  CB    . GLN A 1 184  ? -9.269  -43.147  38.979  1.00 115.38 ? 188  GLN A CB    1 
ATOM   1483  C  CG    . GLN A 1 184  ? -10.352 -42.211  38.473  1.00 115.81 ? 188  GLN A CG    1 
ATOM   1484  C  CD    . GLN A 1 184  ? -11.600 -42.958  38.032  1.00 124.37 ? 188  GLN A CD    1 
ATOM   1485  O  OE1   . GLN A 1 184  ? -11.599 -44.188  37.916  1.00 114.52 ? 188  GLN A OE1   1 
ATOM   1486  N  NE2   . GLN A 1 184  ? -12.674 -42.218  37.786  1.00 137.21 ? 188  GLN A NE2   1 
ATOM   1487  N  N     . VAL A 1 185  ? -7.752  -42.824  41.612  1.00 88.41  ? 189  VAL A N     1 
ATOM   1488  C  CA    . VAL A 1 185  ? -7.703  -42.418  43.012  1.00 76.20  ? 189  VAL A CA    1 
ATOM   1489  C  C     . VAL A 1 185  ? -6.423  -41.666  43.365  1.00 84.60  ? 189  VAL A C     1 
ATOM   1490  O  O     . VAL A 1 185  ? -6.473  -40.674  44.097  1.00 111.56 ? 189  VAL A O     1 
ATOM   1491  C  CB    . VAL A 1 185  ? -7.845  -43.634  43.964  1.00 85.16  ? 189  VAL A CB    1 
ATOM   1492  C  CG1   . VAL A 1 185  ? -9.306  -44.025  44.123  1.00 83.72  ? 189  VAL A CG1   1 
ATOM   1493  C  CG2   . VAL A 1 185  ? -7.010  -44.810  43.482  1.00 97.10  ? 189  VAL A CG2   1 
ATOM   1494  N  N     . LYS A 1 186  ? -5.282  -42.128  42.860  1.00 75.49  ? 190  LYS A N     1 
ATOM   1495  C  CA    . LYS A 1 186  ? -4.016  -41.445  43.129  1.00 79.25  ? 190  LYS A CA    1 
ATOM   1496  C  C     . LYS A 1 186  ? -4.032  -40.059  42.508  1.00 86.41  ? 190  LYS A C     1 
ATOM   1497  O  O     . LYS A 1 186  ? -3.506  -39.103  43.076  1.00 91.09  ? 190  LYS A O     1 
ATOM   1498  C  CB    . LYS A 1 186  ? -2.832  -42.239  42.589  1.00 60.96  ? 190  LYS A CB    1 
ATOM   1499  C  CG    . LYS A 1 186  ? -1.496  -41.877  43.170  1.00 75.32  ? 190  LYS A CG    1 
ATOM   1500  C  CD    . LYS A 1 186  ? -0.360  -42.363  42.310  1.00 78.33  ? 190  LYS A CD    1 
ATOM   1501  C  CE    . LYS A 1 186  ? 0.974   -42.154  42.984  1.00 97.91  ? 190  LYS A CE    1 
ATOM   1502  N  NZ    . LYS A 1 186  ? 2.092   -42.055  42.025  1.00 104.67 ? 190  LYS A NZ    1 
ATOM   1503  N  N     . SER A 1 187  ? -4.638  -39.969  41.329  1.00 89.27  ? 191  SER A N     1 
ATOM   1504  C  CA    . SER A 1 187  ? -4.812  -38.704  40.639  1.00 74.74  ? 191  SER A CA    1 
ATOM   1505  C  C     . SER A 1 187  ? -5.615  -37.745  41.508  1.00 80.68  ? 191  SER A C     1 
ATOM   1506  O  O     . SER A 1 187  ? -5.206  -36.603  41.729  1.00 91.50  ? 191  SER A O     1 
ATOM   1507  C  CB    . SER A 1 187  ? -5.510  -38.921  39.296  1.00 74.46  ? 191  SER A CB    1 
ATOM   1508  O  OG    . SER A 1 187  ? -5.745  -37.687  38.645  1.00 94.99  ? 191  SER A OG    1 
ATOM   1509  N  N     . LYS A 1 188  ? -6.758  -38.218  41.996  1.00 68.89  ? 192  LYS A N     1 
ATOM   1510  C  CA    . LYS A 1 188  ? -7.613  -37.414  42.863  1.00 66.87  ? 192  LYS A CA    1 
ATOM   1511  C  C     . LYS A 1 188  ? -6.841  -36.939  44.095  1.00 74.27  ? 192  LYS A C     1 
ATOM   1512  O  O     . LYS A 1 188  ? -6.954  -35.788  44.508  1.00 77.12  ? 192  LYS A O     1 
ATOM   1513  C  CB    . LYS A 1 188  ? -8.845  -38.214  43.279  1.00 68.47  ? 192  LYS A CB    1 
ATOM   1514  C  CG    . LYS A 1 188  ? -9.750  -37.511  44.274  1.00 80.47  ? 192  LYS A CG    1 
ATOM   1515  C  CD    . LYS A 1 188  ? -10.546 -36.407  43.627  1.00 99.54  ? 192  LYS A CD    1 
ATOM   1516  C  CE    . LYS A 1 188  ? -11.471 -35.741  44.632  1.00 111.79 ? 192  LYS A CE    1 
ATOM   1517  N  NZ    . LYS A 1 188  ? -10.705 -35.122  45.742  1.00 110.81 ? 192  LYS A NZ    1 
ATOM   1518  N  N     . HIS A 1 189  ? -6.037  -37.834  44.660  1.00 76.32  ? 193  HIS A N     1 
ATOM   1519  C  CA    . HIS A 1 189  ? -5.241  -37.527  45.837  1.00 72.72  ? 193  HIS A CA    1 
ATOM   1520  C  C     . HIS A 1 189  ? -4.217  -36.432  45.575  1.00 75.62  ? 193  HIS A C     1 
ATOM   1521  O  O     . HIS A 1 189  ? -4.101  -35.487  46.352  1.00 87.41  ? 193  HIS A O     1 
ATOM   1522  C  CB    . HIS A 1 189  ? -4.533  -38.782  46.344  1.00 77.90  ? 193  HIS A CB    1 
ATOM   1523  C  CG    . HIS A 1 189  ? -3.692  -38.545  47.558  1.00 82.40  ? 193  HIS A CG    1 
ATOM   1524  N  ND1   . HIS A 1 189  ? -4.214  -38.094  48.751  1.00 84.62  ? 193  HIS A ND1   1 
ATOM   1525  C  CD2   . HIS A 1 189  ? -2.359  -38.684  47.759  1.00 87.90  ? 193  HIS A CD2   1 
ATOM   1526  C  CE1   . HIS A 1 189  ? -3.239  -37.964  49.634  1.00 92.82  ? 193  HIS A CE1   1 
ATOM   1527  N  NE2   . HIS A 1 189  ? -2.104  -38.315  49.057  1.00 89.75  ? 193  HIS A NE2   1 
ATOM   1528  N  N     . LEU A 1 190  ? -3.466  -36.563  44.486  1.00 68.04  ? 194  LEU A N     1 
ATOM   1529  C  CA    . LEU A 1 190  ? -2.469  -35.558  44.124  1.00 68.94  ? 194  LEU A CA    1 
ATOM   1530  C  C     . LEU A 1 190  ? -3.113  -34.208  43.824  1.00 79.60  ? 194  LEU A C     1 
ATOM   1531  O  O     . LEU A 1 190  ? -2.596  -33.160  44.227  1.00 86.23  ? 194  LEU A O     1 
ATOM   1532  C  CB    . LEU A 1 190  ? -1.649  -36.016  42.921  1.00 61.99  ? 194  LEU A CB    1 
ATOM   1533  C  CG    . LEU A 1 190  ? -0.693  -37.165  43.215  1.00 62.85  ? 194  LEU A CG    1 
ATOM   1534  C  CD1   . LEU A 1 190  ? 0.101   -37.563  41.982  1.00 65.72  ? 194  LEU A CD1   1 
ATOM   1535  C  CD2   . LEU A 1 190  ? 0.227   -36.791  44.354  1.00 64.75  ? 194  LEU A CD2   1 
ATOM   1536  N  N     . LYS A 1 191  ? -4.239  -34.235  43.118  1.00 70.17  ? 195  LYS A N     1 
ATOM   1537  C  CA    . LYS A 1 191  ? -4.975  -33.012  42.829  1.00 68.86  ? 195  LYS A CA    1 
ATOM   1538  C  C     . LYS A 1 191  ? -5.386  -32.326  44.127  1.00 72.21  ? 195  LYS A C     1 
ATOM   1539  O  O     . LYS A 1 191  ? -5.239  -31.113  44.265  1.00 79.03  ? 195  LYS A O     1 
ATOM   1540  C  CB    . LYS A 1 191  ? -6.202  -33.305  41.971  1.00 67.92  ? 195  LYS A CB    1 
ATOM   1541  C  CG    . LYS A 1 191  ? -5.880  -33.719  40.550  1.00 73.21  ? 195  LYS A CG    1 
ATOM   1542  C  CD    . LYS A 1 191  ? -7.152  -34.065  39.787  1.00 77.11  ? 195  LYS A CD    1 
ATOM   1543  C  CE    . LYS A 1 191  ? -6.857  -34.625  38.425  1.00 76.04  ? 195  LYS A CE    1 
ATOM   1544  N  NZ    . LYS A 1 191  ? -8.097  -35.156  37.802  1.00 93.49  ? 195  LYS A NZ    1 
ATOM   1545  N  N     . ASP A 1 192  ? -5.896  -33.109  45.074  1.00 66.82  ? 196  ASP A N     1 
ATOM   1546  C  CA    . ASP A 1 192  ? -6.254  -32.591  46.384  1.00 67.56  ? 196  ASP A CA    1 
ATOM   1547  C  C     . ASP A 1 192  ? -5.056  -31.979  47.100  1.00 69.10  ? 196  ASP A C     1 
ATOM   1548  O  O     . ASP A 1 192  ? -5.165  -30.900  47.682  1.00 77.41  ? 196  ASP A O     1 
ATOM   1549  C  CB    . ASP A 1 192  ? -6.854  -33.700  47.237  1.00 90.01  ? 196  ASP A CB    1 
ATOM   1550  C  CG    . ASP A 1 192  ? -8.343  -33.840  47.040  1.00 99.76  ? 196  ASP A CG    1 
ATOM   1551  O  OD1   . ASP A 1 192  ? -8.862  -33.246  46.072  1.00 92.82  ? 196  ASP A OD1   1 
ATOM   1552  O  OD2   . ASP A 1 192  ? -8.995  -34.547  47.849  1.00 112.44 ? 196  ASP A OD2   1 
ATOM   1553  N  N     . SER A 1 193  ? -3.917  -32.670  47.059  1.00 65.16  ? 197  SER A N     1 
ATOM   1554  C  CA    . SER A 1 193  ? -2.699  -32.177  47.695  1.00 70.44  ? 197  SER A CA    1 
ATOM   1555  C  C     . SER A 1 193  ? -2.250  -30.835  47.120  1.00 79.73  ? 197  SER A C     1 
ATOM   1556  O  O     . SER A 1 193  ? -1.947  -29.901  47.868  1.00 94.44  ? 197  SER A O     1 
ATOM   1557  C  CB    . SER A 1 193  ? -1.572  -33.191  47.560  1.00 57.75  ? 197  SER A CB    1 
ATOM   1558  O  OG    . SER A 1 193  ? -1.861  -34.347  48.295  1.00 69.93  ? 197  SER A OG    1 
ATOM   1559  N  N     . MET A 1 194  ? -2.209  -30.734  45.794  1.00 72.36  ? 198  MET A N     1 
ATOM   1560  C  CA    . MET A 1 194  ? -1.780  -29.497  45.150  1.00 67.29  ? 198  MET A CA    1 
ATOM   1561  C  C     . MET A 1 194  ? -2.760  -28.360  45.410  1.00 72.72  ? 198  MET A C     1 
ATOM   1562  O  O     . MET A 1 194  ? -2.354  -27.247  45.721  1.00 84.20  ? 198  MET A O     1 
ATOM   1563  C  CB    . MET A 1 194  ? -1.601  -29.702  43.649  1.00 65.14  ? 198  MET A CB    1 
ATOM   1564  C  CG    . MET A 1 194  ? -0.304  -30.362  43.279  1.00 74.60  ? 198  MET A CG    1 
ATOM   1565  S  SD    . MET A 1 194  ? 0.318   -29.753  41.686  1.00 100.25 ? 198  MET A SD    1 
ATOM   1566  C  CE    . MET A 1 194  ? 0.673   -28.057  42.099  1.00 79.50  ? 198  MET A CE    1 
ATOM   1567  N  N     . CYS A 1 195  ? -4.048  -28.654  45.276  1.00 70.77  ? 199  CYS A N     1 
ATOM   1568  C  CA    . CYS A 1 195  ? -5.099  -27.668  45.488  1.00 73.48  ? 199  CYS A CA    1 
ATOM   1569  C  C     . CYS A 1 195  ? -5.022  -27.135  46.915  1.00 83.41  ? 199  CYS A C     1 
ATOM   1570  O  O     . CYS A 1 195  ? -5.239  -25.946  47.165  1.00 78.15  ? 199  CYS A O     1 
ATOM   1571  C  CB    . CYS A 1 195  ? -6.471  -28.286  45.217  1.00 77.79  ? 199  CYS A CB    1 
ATOM   1572  S  SG    . CYS A 1 195  ? -7.867  -27.144  45.246  1.00 83.05  ? 199  CYS A SG    1 
ATOM   1573  N  N     . ASN A 1 196  ? -4.695  -28.026  47.846  1.00 87.48  ? 200  ASN A N     1 
ATOM   1574  C  CA    . ASN A 1 196  ? -4.520  -27.658  49.243  1.00 75.37  ? 200  ASN A CA    1 
ATOM   1575  C  C     . ASN A 1 196  ? -3.318  -26.748  49.463  1.00 74.77  ? 200  ASN A C     1 
ATOM   1576  O  O     . ASN A 1 196  ? -3.419  -25.733  50.138  1.00 92.29  ? 200  ASN A O     1 
ATOM   1577  C  CB    . ASN A 1 196  ? -4.382  -28.920  50.099  1.00 84.30  ? 200  ASN A CB    1 
ATOM   1578  C  CG    . ASN A 1 196  ? -4.207  -28.614  51.566  1.00 66.11  ? 200  ASN A CG    1 
ATOM   1579  O  OD1   . ASN A 1 196  ? -5.181  -28.380  52.273  1.00 59.87  ? 200  ASN A OD1   1 
ATOM   1580  N  ND2   . ASN A 1 196  ? -2.963  -28.608  52.031  1.00 71.68  ? 200  ASN A ND2   1 
ATOM   1581  N  N     . GLU A 1 197  ? -2.180  -27.109  48.885  1.00 68.67  ? 201  GLU A N     1 
ATOM   1582  C  CA    . GLU A 1 197  ? -0.955  -26.362  49.121  1.00 67.61  ? 201  GLU A CA    1 
ATOM   1583  C  C     . GLU A 1 197  ? -0.767  -25.228  48.107  1.00 67.48  ? 201  GLU A C     1 
ATOM   1584  O  O     . GLU A 1 197  ? 0.340   -24.695  47.964  1.00 64.34  ? 201  GLU A O     1 
ATOM   1585  C  CB    . GLU A 1 197  ? 0.256   -27.304  49.094  1.00 79.30  ? 201  GLU A CB    1 
ATOM   1586  C  CG    . GLU A 1 197  ? 0.118   -28.499  50.036  1.00 105.35 ? 201  GLU A CG    1 
ATOM   1587  C  CD    . GLU A 1 197  ? 1.387   -29.339  50.156  1.00 105.78 ? 201  GLU A CD    1 
ATOM   1588  O  OE1   . GLU A 1 197  ? 2.478   -28.781  49.945  1.00 114.16 ? 201  GLU A OE1   1 
ATOM   1589  O  OE2   . GLU A 1 197  ? 1.295   -30.555  50.473  1.00 77.08  ? 201  GLU A OE2   1 
ATOM   1590  N  N     . PHE A 1 198  ? -1.842  -24.829  47.427  1.00 64.46  ? 202  PHE A N     1 
ATOM   1591  C  CA    . PHE A 1 198  ? -1.691  -23.863  46.342  1.00 75.97  ? 202  PHE A CA    1 
ATOM   1592  C  C     . PHE A 1 198  ? -1.463  -22.443  46.831  1.00 74.99  ? 202  PHE A C     1 
ATOM   1593  O  O     . PHE A 1 198  ? -0.607  -21.744  46.291  1.00 68.22  ? 202  PHE A O     1 
ATOM   1594  C  CB    . PHE A 1 198  ? -2.899  -23.874  45.397  1.00 76.35  ? 202  PHE A CB    1 
ATOM   1595  C  CG    . PHE A 1 198  ? -2.821  -22.820  44.330  1.00 68.68  ? 202  PHE A CG    1 
ATOM   1596  C  CD1   . PHE A 1 198  ? -1.803  -22.848  43.392  1.00 62.57  ? 202  PHE A CD1   1 
ATOM   1597  C  CD2   . PHE A 1 198  ? -3.735  -21.780  44.289  1.00 77.49  ? 202  PHE A CD2   1 
ATOM   1598  C  CE1   . PHE A 1 198  ? -1.707  -21.878  42.422  1.00 61.31  ? 202  PHE A CE1   1 
ATOM   1599  C  CE2   . PHE A 1 198  ? -3.649  -20.796  43.313  1.00 66.68  ? 202  PHE A CE2   1 
ATOM   1600  C  CZ    . PHE A 1 198  ? -2.632  -20.844  42.384  1.00 65.71  ? 202  PHE A CZ    1 
ATOM   1601  N  N     . SER A 1 199  ? -2.236  -22.014  47.827  1.00 77.89  ? 203  SER A N     1 
ATOM   1602  C  CA    . SER A 1 199  ? -2.141  -20.647  48.364  1.00 68.32  ? 203  SER A CA    1 
ATOM   1603  C  C     . SER A 1 199  ? -0.705  -20.183  48.618  1.00 59.53  ? 203  SER A C     1 
ATOM   1604  O  O     . SER A 1 199  ? -0.351  -19.042  48.374  1.00 71.59  ? 203  SER A O     1 
ATOM   1605  C  CB    . SER A 1 199  ? -2.943  -20.545  49.661  1.00 76.24  ? 203  SER A CB    1 
ATOM   1606  O  OG    . SER A 1 199  ? -2.625  -21.618  50.543  1.00 102.89 ? 203  SER A OG    1 
ATOM   1607  N  N     . GLN A 1 200  ? 0.120   -21.103  49.088  1.00 58.86  ? 204  GLN A N     1 
ATOM   1608  C  CA    . GLN A 1 200  ? 1.535   -20.864  49.329  1.00 65.89  ? 204  GLN A CA    1 
ATOM   1609  C  C     . GLN A 1 200  ? 2.236   -20.430  48.049  1.00 58.91  ? 204  GLN A C     1 
ATOM   1610  O  O     . GLN A 1 200  ? 2.853   -19.358  47.972  1.00 74.86  ? 204  GLN A O     1 
ATOM   1611  C  CB    . GLN A 1 200  ? 2.176   -22.143  49.911  1.00 59.81  ? 204  GLN A CB    1 
ATOM   1612  C  CG    . GLN A 1 200  ? 3.484   -21.932  50.645  1.00 79.39  ? 204  GLN A CG    1 
ATOM   1613  C  CD    . GLN A 1 200  ? 3.856   -23.119  51.522  1.00 94.51  ? 204  GLN A CD    1 
ATOM   1614  O  OE1   . GLN A 1 200  ? 3.403   -24.248  51.301  1.00 80.31  ? 204  GLN A OE1   1 
ATOM   1615  N  NE2   . GLN A 1 200  ? 4.673   -22.863  52.536  1.00 112.83 ? 204  GLN A NE2   1 
ATOM   1616  N  N     . ILE A 1 201  ? 2.113   -21.285  47.043  1.00 71.32  ? 205  ILE A N     1 
ATOM   1617  C  CA    . ILE A 1 201  ? 2.685   -21.053  45.726  1.00 73.64  ? 205  ILE A CA    1 
ATOM   1618  C  C     . ILE A 1 201  ? 2.149   -19.789  45.083  1.00 73.34  ? 205  ILE A C     1 
ATOM   1619  O  O     . ILE A 1 201  ? 2.899   -19.018  44.510  1.00 85.56  ? 205  ILE A O     1 
ATOM   1620  C  CB    . ILE A 1 201  ? 2.394   -22.221  44.777  1.00 72.46  ? 205  ILE A CB    1 
ATOM   1621  C  CG1   . ILE A 1 201  ? 2.900   -23.529  45.368  1.00 74.12  ? 205  ILE A CG1   1 
ATOM   1622  C  CG2   . ILE A 1 201  ? 3.013   -21.972  43.409  1.00 69.76  ? 205  ILE A CG2   1 
ATOM   1623  C  CD1   . ILE A 1 201  ? 2.541   -24.740  44.526  1.00 67.93  ? 205  ILE A CD1   1 
ATOM   1624  N  N     . PHE A 1 202  ? 0.841   -19.589  45.174  1.00 73.56  ? 206  PHE A N     1 
ATOM   1625  C  CA    . PHE A 1 202  ? 0.211   -18.407  44.613  1.00 80.21  ? 206  PHE A CA    1 
ATOM   1626  C  C     . PHE A 1 202  ? 0.744   -17.140  45.265  1.00 81.60  ? 206  PHE A C     1 
ATOM   1627  O  O     . PHE A 1 202  ? 0.845   -16.103  44.614  1.00 88.53  ? 206  PHE A O     1 
ATOM   1628  C  CB    . PHE A 1 202  ? -1.305  -18.478  44.764  1.00 80.25  ? 206  PHE A CB    1 
ATOM   1629  C  CG    . PHE A 1 202  ? -2.016  -17.269  44.230  1.00 79.78  ? 206  PHE A CG    1 
ATOM   1630  C  CD1   . PHE A 1 202  ? -2.241  -17.123  42.878  1.00 84.92  ? 206  PHE A CD1   1 
ATOM   1631  C  CD2   . PHE A 1 202  ? -2.457  -16.281  45.079  1.00 83.46  ? 206  PHE A CD2   1 
ATOM   1632  C  CE1   . PHE A 1 202  ? -2.895  -16.013  42.382  1.00 84.38  ? 206  PHE A CE1   1 
ATOM   1633  C  CE2   . PHE A 1 202  ? -3.112  -15.167  44.596  1.00 81.01  ? 206  PHE A CE2   1 
ATOM   1634  C  CZ    . PHE A 1 202  ? -3.330  -15.034  43.243  1.00 85.82  ? 206  PHE A CZ    1 
ATOM   1635  N  N     . GLN A 1 203  ? 1.084   -17.230  46.550  1.00 68.47  ? 207  GLN A N     1 
ATOM   1636  C  CA    . GLN A 1 203  ? 1.758   -16.124  47.219  1.00 82.11  ? 207  GLN A CA    1 
ATOM   1637  C  C     . GLN A 1 203  ? 3.141   -15.912  46.618  1.00 83.88  ? 207  GLN A C     1 
ATOM   1638  O  O     . GLN A 1 203  ? 3.564   -14.772  46.413  1.00 89.84  ? 207  GLN A O     1 
ATOM   1639  C  CB    . GLN A 1 203  ? 1.870   -16.370  48.728  1.00 82.42  ? 207  GLN A CB    1 
ATOM   1640  C  CG    . GLN A 1 203  ? 0.646   -15.967  49.511  1.00 88.21  ? 207  GLN A CG    1 
ATOM   1641  C  CD    . GLN A 1 203  ? 0.942   -15.830  50.983  1.00 114.34 ? 207  GLN A CD    1 
ATOM   1642  O  OE1   . GLN A 1 203  ? 1.228   -16.817  51.665  1.00 115.28 ? 207  GLN A OE1   1 
ATOM   1643  N  NE2   . GLN A 1 203  ? 0.894   -14.598  51.485  1.00 129.73 ? 207  GLN A NE2   1 
ATOM   1644  N  N     . LEU A 1 204  ? 3.845   -17.009  46.348  1.00 75.97  ? 208  LEU A N     1 
ATOM   1645  C  CA    . LEU A 1 204  ? 5.151   -16.917  45.688  1.00 73.29  ? 208  LEU A CA    1 
ATOM   1646  C  C     . LEU A 1 204  ? 5.019   -16.171  44.354  1.00 75.48  ? 208  LEU A C     1 
ATOM   1647  O  O     . LEU A 1 204  ? 5.770   -15.238  44.078  1.00 79.73  ? 208  LEU A O     1 
ATOM   1648  C  CB    . LEU A 1 204  ? 5.741   -18.317  45.462  1.00 79.04  ? 208  LEU A CB    1 
ATOM   1649  C  CG    . LEU A 1 204  ? 7.255   -18.560  45.401  1.00 80.19  ? 208  LEU A CG    1 
ATOM   1650  C  CD1   . LEU A 1 204  ? 7.529   -20.009  45.047  1.00 90.69  ? 208  LEU A CD1   1 
ATOM   1651  C  CD2   . LEU A 1 204  ? 7.958   -17.657  44.431  1.00 89.67  ? 208  LEU A CD2   1 
ATOM   1652  N  N     . CYS A 1 205  ? 4.056   -16.595  43.541  1.00 72.37  ? 209  CYS A N     1 
ATOM   1653  C  CA    . CYS A 1 205  ? 3.833   -16.059  42.211  1.00 76.42  ? 209  CYS A CA    1 
ATOM   1654  C  C     . CYS A 1 205  ? 3.433   -14.597  42.257  1.00 81.62  ? 209  CYS A C     1 
ATOM   1655  O  O     . CYS A 1 205  ? 3.898   -13.799  41.428  1.00 80.15  ? 209  CYS A O     1 
ATOM   1656  C  CB    . CYS A 1 205  ? 2.750   -16.865  41.486  1.00 84.88  ? 209  CYS A CB    1 
ATOM   1657  S  SG    . CYS A 1 205  ? 3.181   -18.578  41.131  1.00 93.36  ? 209  CYS A SG    1 
ATOM   1658  N  N     . GLN A 1 206  ? 2.556   -14.257  43.204  1.00 79.23  ? 210  GLN A N     1 
ATOM   1659  C  CA    . GLN A 1 206  ? 2.119   -12.872  43.381  1.00 75.56  ? 210  GLN A CA    1 
ATOM   1660  C  C     . GLN A 1 206  ? 3.296   -11.983  43.763  1.00 70.80  ? 210  GLN A C     1 
ATOM   1661  O  O     . GLN A 1 206  ? 3.476   -10.894  43.219  1.00 78.34  ? 210  GLN A O     1 
ATOM   1662  C  CB    . GLN A 1 206  ? 1.027   -12.778  44.439  1.00 75.51  ? 210  GLN A CB    1 
ATOM   1663  C  CG    . GLN A 1 206  ? -0.278  -12.195  43.937  1.00 88.97  ? 210  GLN A CG    1 
ATOM   1664  C  CD    . GLN A 1 206  ? -1.366  -12.216  44.993  1.00 112.01 ? 210  GLN A CD    1 
ATOM   1665  O  OE1   . GLN A 1 206  ? -1.140  -12.639  46.129  1.00 120.09 ? 210  GLN A OE1   1 
ATOM   1666  N  NE2   . GLN A 1 206  ? -2.558  -11.762  44.622  1.00 122.51 ? 210  GLN A NE2   1 
ATOM   1667  N  N     . PHE A 1 207  ? 4.111   -12.475  44.686  1.00 69.14  ? 211  PHE A N     1 
ATOM   1668  C  CA    . PHE A 1 207  ? 5.325   -11.782  45.092  1.00 78.64  ? 211  PHE A CA    1 
ATOM   1669  C  C     . PHE A 1 207  ? 6.245   -11.520  43.898  1.00 82.20  ? 211  PHE A C     1 
ATOM   1670  O  O     . PHE A 1 207  ? 6.667   -10.387  43.665  1.00 82.59  ? 211  PHE A O     1 
ATOM   1671  C  CB    . PHE A 1 207  ? 6.057   -12.596  46.163  1.00 80.34  ? 211  PHE A CB    1 
ATOM   1672  C  CG    . PHE A 1 207  ? 7.367   -12.006  46.584  1.00 88.35  ? 211  PHE A CG    1 
ATOM   1673  C  CD1   . PHE A 1 207  ? 7.414   -10.788  47.240  1.00 88.31  ? 211  PHE A CD1   1 
ATOM   1674  C  CD2   . PHE A 1 207  ? 8.552   -12.681  46.344  1.00 95.17  ? 211  PHE A CD2   1 
ATOM   1675  C  CE1   . PHE A 1 207  ? 8.623   -10.244  47.636  1.00 89.30  ? 211  PHE A CE1   1 
ATOM   1676  C  CE2   . PHE A 1 207  ? 9.761   -12.146  46.737  1.00 105.06 ? 211  PHE A CE2   1 
ATOM   1677  C  CZ    . PHE A 1 207  ? 9.797   -10.920  47.385  1.00 98.35  ? 211  PHE A CZ    1 
ATOM   1678  N  N     . VAL A 1 208  ? 6.538   -12.571  43.137  1.00 87.76  ? 212  VAL A N     1 
ATOM   1679  C  CA    . VAL A 1 208  ? 7.422   -12.467  41.976  1.00 86.95  ? 212  VAL A CA    1 
ATOM   1680  C  C     . VAL A 1 208  ? 6.885   -11.496  40.921  1.00 85.68  ? 212  VAL A C     1 
ATOM   1681  O  O     . VAL A 1 208  ? 7.613   -10.622  40.446  1.00 79.58  ? 212  VAL A O     1 
ATOM   1682  C  CB    . VAL A 1 208  ? 7.653   -13.836  41.317  1.00 75.67  ? 212  VAL A CB    1 
ATOM   1683  C  CG1   . VAL A 1 208  ? 8.444   -13.671  40.026  1.00 69.27  ? 212  VAL A CG1   1 
ATOM   1684  C  CG2   . VAL A 1 208  ? 8.387   -14.763  42.274  1.00 77.12  ? 212  VAL A CG2   1 
ATOM   1685  N  N     . MET A 1 209  ? 5.613   -11.651  40.565  1.00 77.23  ? 213  MET A N     1 
ATOM   1686  C  CA    . MET A 1 209  ? 4.982   -10.772  39.594  1.00 77.27  ? 213  MET A CA    1 
ATOM   1687  C  C     . MET A 1 209  ? 5.011   -9.313   40.031  1.00 96.00  ? 213  MET A C     1 
ATOM   1688  O  O     . MET A 1 209  ? 5.314   -8.424   39.223  1.00 107.97 ? 213  MET A O     1 
ATOM   1689  C  CB    . MET A 1 209  ? 3.537   -11.192  39.346  1.00 76.41  ? 213  MET A CB    1 
ATOM   1690  C  CG    . MET A 1 209  ? 3.380   -12.531  38.654  1.00 86.84  ? 213  MET A CG    1 
ATOM   1691  S  SD    . MET A 1 209  ? 1.721   -12.758  37.973  1.00 84.81  ? 213  MET A SD    1 
ATOM   1692  C  CE    . MET A 1 209  ? 0.740   -11.932  39.222  1.00 132.03 ? 213  MET A CE    1 
ATOM   1693  N  N     . GLU A 1 210  ? 4.696   -9.068   41.302  1.00 95.16  ? 214  GLU A N     1 
ATOM   1694  C  CA    . GLU A 1 210  ? 4.593   -7.700   41.805  1.00 100.92 ? 214  GLU A CA    1 
ATOM   1695  C  C     . GLU A 1 210  ? 5.942   -7.026   42.021  1.00 97.63  ? 214  GLU A C     1 
ATOM   1696  O  O     . GLU A 1 210  ? 6.033   -5.803   41.974  1.00 104.92 ? 214  GLU A O     1 
ATOM   1697  C  CB    . GLU A 1 210  ? 3.801   -7.671   43.114  1.00 110.14 ? 214  GLU A CB    1 
ATOM   1698  C  CG    . GLU A 1 210  ? 2.310   -7.923   42.950  1.00 122.82 ? 214  GLU A CG    1 
ATOM   1699  C  CD    . GLU A 1 210  ? 1.601   -8.090   44.279  1.00 128.54 ? 214  GLU A CD    1 
ATOM   1700  O  OE1   . GLU A 1 210  ? 0.371   -8.310   44.272  1.00 124.81 ? 214  GLU A OE1   1 
ATOM   1701  O  OE2   . GLU A 1 210  ? 2.273   -8.005   45.329  1.00 142.66 ? 214  GLU A OE2   1 
ATOM   1702  N  N     . ASN A 1 211  ? 6.990   -7.812   42.254  1.00 89.38  ? 215  ASN A N     1 
ATOM   1703  C  CA    . ASN A 1 211  ? 8.268   -7.222   42.644  1.00 96.91  ? 215  ASN A CA    1 
ATOM   1704  C  C     . ASN A 1 211  ? 9.424   -7.394   41.655  1.00 100.48 ? 215  ASN A C     1 
ATOM   1705  O  O     . ASN A 1 211  ? 10.208  -6.468   41.454  1.00 115.84 ? 215  ASN A O     1 
ATOM   1706  C  CB    . ASN A 1 211  ? 8.697   -7.781   44.007  1.00 104.62 ? 215  ASN A CB    1 
ATOM   1707  C  CG    . ASN A 1 211  ? 7.830   -7.274   45.145  1.00 109.99 ? 215  ASN A CG    1 
ATOM   1708  O  OD1   . ASN A 1 211  ? 6.695   -6.851   44.936  1.00 115.43 ? 215  ASN A OD1   1 
ATOM   1709  N  ND2   . ASN A 1 211  ? 8.368   -7.310   46.358  1.00 113.38 ? 215  ASN A ND2   1 
ATOM   1710  N  N     . SER A 1 212  ? 9.537   -8.567   41.044  1.00 91.54  ? 216  SER A N     1 
ATOM   1711  C  CA    . SER A 1 212  ? 10.733  -8.902   40.275  1.00 86.97  ? 216  SER A CA    1 
ATOM   1712  C  C     . SER A 1 212  ? 10.903  -8.067   38.998  1.00 95.28  ? 216  SER A C     1 
ATOM   1713  O  O     . SER A 1 212  ? 9.924   -7.706   38.329  1.00 85.83  ? 216  SER A O     1 
ATOM   1714  C  CB    . SER A 1 212  ? 10.723  -10.386  39.911  1.00 94.45  ? 216  SER A CB    1 
ATOM   1715  O  OG    . SER A 1 212  ? 11.948  -10.771  39.310  1.00 107.47 ? 216  SER A OG    1 
ATOM   1716  N  N     . GLN A 1 213  ? 12.159  -7.773   38.672  1.00 100.76 ? 217  GLN A N     1 
ATOM   1717  C  CA    . GLN A 1 213  ? 12.512  -7.066   37.448  1.00 101.67 ? 217  GLN A CA    1 
ATOM   1718  C  C     . GLN A 1 213  ? 13.239  -8.008   36.492  1.00 103.82 ? 217  GLN A C     1 
ATOM   1719  O  O     . GLN A 1 213  ? 13.662  -7.604   35.406  1.00 120.99 ? 217  GLN A O     1 
ATOM   1720  C  CB    . GLN A 1 213  ? 13.382  -5.852   37.765  1.00 120.28 ? 217  GLN A CB    1 
ATOM   1721  C  CG    . GLN A 1 213  ? 12.787  -4.935   38.822  1.00 138.77 ? 217  GLN A CG    1 
ATOM   1722  C  CD    . GLN A 1 213  ? 13.779  -3.909   39.334  1.00 153.22 ? 217  GLN A CD    1 
ATOM   1723  O  OE1   . GLN A 1 213  ? 14.574  -3.359   38.570  1.00 168.94 ? 217  GLN A OE1   1 
ATOM   1724  N  NE2   . GLN A 1 213  ? 13.744  -3.651   40.638  1.00 151.92 ? 217  GLN A NE2   1 
ATOM   1725  N  N     . ASN A 1 214  ? 13.379  -9.262   36.916  1.00 93.67  ? 218  ASN A N     1 
ATOM   1726  C  CA    . ASN A 1 214  ? 14.015  -10.307  36.119  1.00 81.66  ? 218  ASN A CA    1 
ATOM   1727  C  C     . ASN A 1 214  ? 13.054  -10.833  35.056  1.00 91.41  ? 218  ASN A C     1 
ATOM   1728  O  O     . ASN A 1 214  ? 12.039  -11.451  35.386  1.00 93.00  ? 218  ASN A O     1 
ATOM   1729  C  CB    . ASN A 1 214  ? 14.488  -11.439  37.032  1.00 83.54  ? 218  ASN A CB    1 
ATOM   1730  C  CG    . ASN A 1 214  ? 15.273  -12.510  36.295  1.00 96.51  ? 218  ASN A CG    1 
ATOM   1731  O  OD1   . ASN A 1 214  ? 14.771  -13.139  35.373  1.00 103.29 ? 218  ASN A OD1   1 
ATOM   1732  N  ND2   . ASN A 1 214  ? 16.510  -12.733  36.721  1.00 104.79 ? 218  ASN A ND2   1 
ATOM   1733  N  N     . ALA A 1 215  ? 13.376  -10.587  33.786  1.00 86.73  ? 219  ALA A N     1 
ATOM   1734  C  CA    . ALA A 1 215  ? 12.474  -10.931  32.692  1.00 78.85  ? 219  ALA A CA    1 
ATOM   1735  C  C     . ALA A 1 215  ? 12.292  -12.452  32.490  1.00 83.14  ? 219  ALA A C     1 
ATOM   1736  O  O     . ALA A 1 215  ? 11.151  -12.913  32.364  1.00 84.97  ? 219  ALA A O     1 
ATOM   1737  C  CB    . ALA A 1 215  ? 12.944  -10.274  31.409  1.00 82.19  ? 219  ALA A CB    1 
ATOM   1738  N  N     . PRO A 1 216  ? 13.394  -13.238  32.455  1.00 78.91  ? 220  PRO A N     1 
ATOM   1739  C  CA    . PRO A 1 216  ? 13.183  -14.689  32.358  1.00 83.12  ? 220  PRO A CA    1 
ATOM   1740  C  C     . PRO A 1 216  ? 12.304  -15.251  33.471  1.00 81.75  ? 220  PRO A C     1 
ATOM   1741  O  O     . PRO A 1 216  ? 11.388  -16.038  33.208  1.00 79.52  ? 220  PRO A O     1 
ATOM   1742  C  CB    . PRO A 1 216  ? 14.602  -15.254  32.460  1.00 79.16  ? 220  PRO A CB    1 
ATOM   1743  C  CG    . PRO A 1 216  ? 15.461  -14.184  31.903  1.00 78.83  ? 220  PRO A CG    1 
ATOM   1744  C  CD    . PRO A 1 216  ? 14.827  -12.895  32.329  1.00 71.59  ? 220  PRO A CD    1 
ATOM   1745  N  N     . LEU A 1 217  ? 12.584  -14.831  34.701  1.00 90.56  ? 221  LEU A N     1 
ATOM   1746  C  CA    . LEU A 1 217  ? 11.827  -15.275  35.871  1.00 83.59  ? 221  LEU A CA    1 
ATOM   1747  C  C     . LEU A 1 217  ? 10.350  -14.928  35.748  1.00 80.00  ? 221  LEU A C     1 
ATOM   1748  O  O     . LEU A 1 217  ? 9.480   -15.786  35.927  1.00 82.42  ? 221  LEU A O     1 
ATOM   1749  C  CB    . LEU A 1 217  ? 12.402  -14.656  37.140  1.00 79.94  ? 221  LEU A CB    1 
ATOM   1750  C  CG    . LEU A 1 217  ? 11.584  -14.795  38.427  1.00 81.97  ? 221  LEU A CG    1 
ATOM   1751  C  CD1   . LEU A 1 217  ? 11.267  -16.249  38.713  1.00 85.19  ? 221  LEU A CD1   1 
ATOM   1752  C  CD2   . LEU A 1 217  ? 12.312  -14.167  39.602  1.00 77.88  ? 221  LEU A CD2   1 
ATOM   1753  N  N     . VAL A 1 218  ? 10.078  -13.669  35.422  1.00 74.88  ? 222  VAL A N     1 
ATOM   1754  C  CA    . VAL A 1 218  ? 8.708   -13.199  35.250  1.00 79.72  ? 222  VAL A CA    1 
ATOM   1755  C  C     . VAL A 1 218  ? 7.981   -14.012  34.191  1.00 82.91  ? 222  VAL A C     1 
ATOM   1756  O  O     . VAL A 1 218  ? 6.833   -14.445  34.390  1.00 87.33  ? 222  VAL A O     1 
ATOM   1757  C  CB    . VAL A 1 218  ? 8.668   -11.702  34.869  1.00 65.88  ? 222  VAL A CB    1 
ATOM   1758  C  CG1   . VAL A 1 218  ? 7.315   -11.330  34.318  1.00 63.14  ? 222  VAL A CG1   1 
ATOM   1759  C  CG2   . VAL A 1 218  ? 9.003   -10.853  36.081  1.00 70.29  ? 222  VAL A CG2   1 
ATOM   1760  N  N     . HIS A 1 219  ? 8.660   -14.242  33.073  1.00 81.66  ? 223  HIS A N     1 
ATOM   1761  C  CA    . HIS A 1 219  ? 8.055   -14.991  31.974  1.00 81.50  ? 223  HIS A CA    1 
ATOM   1762  C  C     . HIS A 1 219  ? 7.712   -16.422  32.379  1.00 80.69  ? 223  HIS A C     1 
ATOM   1763  O  O     . HIS A 1 219  ? 6.585   -16.877  32.163  1.00 87.82  ? 223  HIS A O     1 
ATOM   1764  C  CB    . HIS A 1 219  ? 8.973   -15.018  30.767  1.00 77.02  ? 223  HIS A CB    1 
ATOM   1765  C  CG    . HIS A 1 219  ? 8.241   -15.135  29.474  1.00 86.82  ? 223  HIS A CG    1 
ATOM   1766  N  ND1   . HIS A 1 219  ? 7.819   -14.031  28.766  1.00 101.25 ? 223  HIS A ND1   1 
ATOM   1767  C  CD2   . HIS A 1 219  ? 7.820   -16.217  28.779  1.00 72.13  ? 223  HIS A CD2   1 
ATOM   1768  C  CE1   . HIS A 1 219  ? 7.183   -14.431  27.681  1.00 97.48  ? 223  HIS A CE1   1 
ATOM   1769  N  NE2   . HIS A 1 219  ? 7.166   -15.751  27.666  1.00 81.85  ? 223  HIS A NE2   1 
ATOM   1770  N  N     . ALA A 1 220  ? 8.685   -17.116  32.975  1.00 73.15  ? 224  ALA A N     1 
ATOM   1771  C  CA    . ALA A 1 220  ? 8.461   -18.461  33.487  1.00 63.24  ? 224  ALA A CA    1 
ATOM   1772  C  C     . ALA A 1 220  ? 7.260   -18.474  34.438  1.00 69.83  ? 224  ALA A C     1 
ATOM   1773  O  O     . ALA A 1 220  ? 6.409   -19.384  34.372  1.00 76.60  ? 224  ALA A O     1 
ATOM   1774  C  CB    . ALA A 1 220  ? 9.703   -18.977  34.171  1.00 59.08  ? 224  ALA A CB    1 
ATOM   1775  N  N     . THR A 1 221  ? 7.182   -17.450  35.289  1.00 54.80  ? 225  THR A N     1 
ATOM   1776  C  CA    . THR A 1 221  ? 6.086   -17.328  36.236  1.00 57.55  ? 225  THR A CA    1 
ATOM   1777  C  C     . THR A 1 221  ? 4.738   -17.228  35.535  1.00 61.80  ? 225  THR A C     1 
ATOM   1778  O  O     . THR A 1 221  ? 3.764   -17.859  35.954  1.00 63.55  ? 225  THR A O     1 
ATOM   1779  C  CB    . THR A 1 221  ? 6.274   -16.101  37.154  1.00 69.04  ? 225  THR A CB    1 
ATOM   1780  O  OG1   . THR A 1 221  ? 7.444   -16.270  37.966  1.00 68.91  ? 225  THR A OG1   1 
ATOM   1781  C  CG2   . THR A 1 221  ? 5.069   -15.907  38.058  1.00 60.84  ? 225  THR A CG2   1 
ATOM   1782  N  N     . LEU A 1 222  ? 4.683   -16.438  34.467  1.00 64.36  ? 226  LEU A N     1 
ATOM   1783  C  CA    . LEU A 1 222  ? 3.450   -16.294  33.690  1.00 67.08  ? 226  LEU A CA    1 
ATOM   1784  C  C     . LEU A 1 222  ? 3.054   -17.594  32.972  1.00 70.76  ? 226  LEU A C     1 
ATOM   1785  O  O     . LEU A 1 222  ? 1.879   -18.001  32.988  1.00 75.83  ? 226  LEU A O     1 
ATOM   1786  C  CB    . LEU A 1 222  ? 3.604   -15.161  32.679  1.00 72.32  ? 226  LEU A CB    1 
ATOM   1787  C  CG    . LEU A 1 222  ? 3.763   -13.755  33.272  1.00 67.72  ? 226  LEU A CG    1 
ATOM   1788  C  CD1   . LEU A 1 222  ? 4.006   -12.733  32.178  1.00 73.88  ? 226  LEU A CD1   1 
ATOM   1789  C  CD2   . LEU A 1 222  ? 2.533   -13.384  34.081  1.00 62.39  ? 226  LEU A CD2   1 
ATOM   1790  N  N     . GLU A 1 223  ? 4.039   -18.245  32.357  1.00 70.63  ? 227  GLU A N     1 
ATOM   1791  C  CA    . GLU A 1 223  ? 3.822   -19.520  31.683  1.00 75.94  ? 227  GLU A CA    1 
ATOM   1792  C  C     . GLU A 1 223  ? 3.265   -20.565  32.645  1.00 77.83  ? 227  GLU A C     1 
ATOM   1793  O  O     . GLU A 1 223  ? 2.418   -21.378  32.271  1.00 89.63  ? 227  GLU A O     1 
ATOM   1794  C  CB    . GLU A 1 223  ? 5.125   -20.020  31.049  1.00 87.62  ? 227  GLU A CB    1 
ATOM   1795  C  CG    . GLU A 1 223  ? 5.413   -19.450  29.661  1.00 108.93 ? 227  GLU A CG    1 
ATOM   1796  C  CD    . GLU A 1 223  ? 4.537   -20.073  28.578  1.00 133.10 ? 227  GLU A CD    1 
ATOM   1797  O  OE1   . GLU A 1 223  ? 3.842   -21.074  28.870  1.00 144.25 ? 227  GLU A OE1   1 
ATOM   1798  O  OE2   . GLU A 1 223  ? 4.546   -19.564  27.434  1.00 134.06 ? 227  GLU A OE2   1 
ATOM   1799  N  N     . THR A 1 224  ? 3.741   -20.531  33.886  1.00 73.03  ? 228  THR A N     1 
ATOM   1800  C  CA    . THR A 1 224  ? 3.265   -21.432  34.939  1.00 65.88  ? 228  THR A CA    1 
ATOM   1801  C  C     . THR A 1 224  ? 1.833   -21.083  35.363  1.00 67.81  ? 228  THR A C     1 
ATOM   1802  O  O     . THR A 1 224  ? 0.947   -21.950  35.520  1.00 71.71  ? 228  THR A O     1 
ATOM   1803  C  CB    . THR A 1 224  ? 4.204   -21.365  36.159  1.00 66.24  ? 228  THR A CB    1 
ATOM   1804  O  OG1   . THR A 1 224  ? 5.554   -21.564  35.724  1.00 86.20  ? 228  THR A OG1   1 
ATOM   1805  C  CG2   . THR A 1 224  ? 3.858   -22.414  37.174  1.00 65.22  ? 228  THR A CG2   1 
ATOM   1806  N  N     . LEU A 1 225  ? 1.619   -19.786  35.533  1.00 71.52  ? 229  LEU A N     1 
ATOM   1807  C  CA    . LEU A 1 225  ? 0.310   -19.247  35.856  1.00 69.71  ? 229  LEU A CA    1 
ATOM   1808  C  C     . LEU A 1 225  ? -0.736  -19.685  34.840  1.00 73.03  ? 229  LEU A C     1 
ATOM   1809  O  O     . LEU A 1 225  ? -1.890  -19.852  35.192  1.00 67.09  ? 229  LEU A O     1 
ATOM   1810  C  CB    . LEU A 1 225  ? 0.370   -17.717  35.936  1.00 68.72  ? 229  LEU A CB    1 
ATOM   1811  C  CG    . LEU A 1 225  ? -0.966  -16.988  36.122  1.00 69.62  ? 229  LEU A CG    1 
ATOM   1812  C  CD1   . LEU A 1 225  ? -1.613  -17.405  37.414  1.00 60.13  ? 229  LEU A CD1   1 
ATOM   1813  C  CD2   . LEU A 1 225  ? -0.787  -15.471  36.040  1.00 76.39  ? 229  LEU A CD2   1 
ATOM   1814  N  N     . LEU A 1 226  ? -0.331  -19.883  33.587  1.00 77.88  ? 230  LEU A N     1 
ATOM   1815  C  CA    . LEU A 1 226  ? -1.250  -20.372  32.544  1.00 73.04  ? 230  LEU A CA    1 
ATOM   1816  C  C     . LEU A 1 226  ? -1.910  -21.726  32.878  1.00 71.60  ? 230  LEU A C     1 
ATOM   1817  O  O     . LEU A 1 226  ? -3.148  -21.858  32.882  1.00 84.44  ? 230  LEU A O     1 
ATOM   1818  C  CB    . LEU A 1 226  ? -0.501  -20.470  31.219  1.00 74.16  ? 230  LEU A CB    1 
ATOM   1819  C  CG    . LEU A 1 226  ? -1.275  -20.454  29.896  1.00 58.29  ? 230  LEU A CG    1 
ATOM   1820  C  CD1   . LEU A 1 226  ? -2.284  -19.343  29.856  1.00 53.22  ? 230  LEU A CD1   1 
ATOM   1821  C  CD2   . LEU A 1 226  ? -0.298  -20.340  28.768  1.00 54.42  ? 230  LEU A CD2   1 
ATOM   1822  N  N     . ARG A 1 227  ? -1.082  -22.720  33.189  1.00 64.55  ? 231  ARG A N     1 
ATOM   1823  C  CA    . ARG A 1 227  ? -1.580  -24.019  33.644  1.00 58.10  ? 231  ARG A CA    1 
ATOM   1824  C  C     . ARG A 1 227  ? -2.364  -23.913  34.946  1.00 61.98  ? 231  ARG A C     1 
ATOM   1825  O  O     . ARG A 1 227  ? -3.429  -24.544  35.129  1.00 87.77  ? 231  ARG A O     1 
ATOM   1826  C  CB    . ARG A 1 227  ? -0.417  -24.990  33.818  1.00 68.42  ? 231  ARG A CB    1 
ATOM   1827  C  CG    . ARG A 1 227  ? 0.612   -24.950  32.686  1.00 73.00  ? 231  ARG A CG    1 
ATOM   1828  C  CD    . ARG A 1 227  ? -0.030  -25.220  31.331  1.00 94.52  ? 231  ARG A CD    1 
ATOM   1829  N  NE    . ARG A 1 227  ? 0.944   -25.715  30.361  1.00 111.06 ? 231  ARG A NE    1 
ATOM   1830  C  CZ    . ARG A 1 227  ? 1.608   -24.947  29.495  1.00 110.35 ? 231  ARG A CZ    1 
ATOM   1831  N  NH1   . ARG A 1 227  ? 1.408   -23.629  29.458  1.00 82.30  ? 231  ARG A NH1   1 
ATOM   1832  N  NH2   . ARG A 1 227  ? 2.477   -25.498  28.656  1.00 120.27 ? 231  ARG A NH2   1 
ATOM   1833  N  N     . PHE A 1 228  ? -1.848  -23.109  35.867  1.00 60.46  ? 232  PHE A N     1 
ATOM   1834  C  CA    . PHE A 1 228  ? -2.566  -22.980  37.127  1.00 67.55  ? 232  PHE A CA    1 
ATOM   1835  C  C     . PHE A 1 228  ? -3.958  -22.421  36.859  1.00 68.92  ? 232  PHE A C     1 
ATOM   1836  O  O     . PHE A 1 228  ? -4.933  -22.852  37.474  1.00 70.02  ? 232  PHE A O     1 
ATOM   1837  C  CB    . PHE A 1 228  ? -1.777  -22.127  38.114  1.00 74.49  ? 232  PHE A CB    1 
ATOM   1838  C  CG    . PHE A 1 228  ? -0.590  -22.838  38.676  1.00 81.01  ? 232  PHE A CG    1 
ATOM   1839  C  CD1   . PHE A 1 228  ? -0.616  -24.214  38.821  1.00 87.93  ? 232  PHE A CD1   1 
ATOM   1840  C  CD2   . PHE A 1 228  ? 0.552   -22.156  39.036  1.00 87.73  ? 232  PHE A CD2   1 
ATOM   1841  C  CE1   . PHE A 1 228  ? 0.462   -24.892  39.336  1.00 87.97  ? 232  PHE A CE1   1 
ATOM   1842  C  CE2   . PHE A 1 228  ? 1.635   -22.836  39.551  1.00 93.89  ? 232  PHE A CE2   1 
ATOM   1843  C  CZ    . PHE A 1 228  ? 1.592   -24.208  39.694  1.00 92.35  ? 232  PHE A CZ    1 
ATOM   1844  N  N     . LEU A 1 229  ? -4.051  -21.514  35.891  1.00 62.91  ? 233  LEU A N     1 
ATOM   1845  C  CA    . LEU A 1 229  ? -5.336  -20.994  35.456  1.00 71.33  ? 233  LEU A CA    1 
ATOM   1846  C  C     . LEU A 1 229  ? -6.171  -22.133  34.913  1.00 71.34  ? 233  LEU A C     1 
ATOM   1847  O  O     . LEU A 1 229  ? -7.392  -22.130  35.042  1.00 74.56  ? 233  LEU A O     1 
ATOM   1848  C  CB    . LEU A 1 229  ? -5.171  -19.908  34.392  1.00 66.63  ? 233  LEU A CB    1 
ATOM   1849  C  CG    . LEU A 1 229  ? -4.662  -18.542  34.831  1.00 76.43  ? 233  LEU A CG    1 
ATOM   1850  C  CD1   . LEU A 1 229  ? -4.723  -17.589  33.653  1.00 84.43  ? 233  LEU A CD1   1 
ATOM   1851  C  CD2   . LEU A 1 229  ? -5.456  -18.006  36.025  1.00 66.40  ? 233  LEU A CD2   1 
ATOM   1852  N  N     . ASN A 1 230  ? -5.514  -23.112  34.296  1.00 70.01  ? 234  ASN A N     1 
ATOM   1853  C  CA    . ASN A 1 230  ? -6.257  -24.294  33.859  1.00 85.37  ? 234  ASN A CA    1 
ATOM   1854  C  C     . ASN A 1 230  ? -6.962  -24.968  35.026  1.00 80.86  ? 234  ASN A C     1 
ATOM   1855  O  O     . ASN A 1 230  ? -8.072  -25.461  34.865  1.00 76.10  ? 234  ASN A O     1 
ATOM   1856  C  CB    . ASN A 1 230  ? -5.361  -25.318  33.143  1.00 77.47  ? 234  ASN A CB    1 
ATOM   1857  C  CG    . ASN A 1 230  ? -5.220  -25.035  31.672  1.00 89.98  ? 234  ASN A CG    1 
ATOM   1858  O  OD1   . ASN A 1 230  ? -5.652  -23.981  31.177  1.00 100.28 ? 234  ASN A OD1   1 
ATOM   1859  N  ND2   . ASN A 1 230  ? -4.597  -25.966  30.957  1.00 97.32  ? 234  ASN A ND2   1 
ATOM   1860  N  N     . TRP A 1 231  ? -6.354  -24.994  36.211  1.00 91.94  ? 235  TRP A N     1 
ATOM   1861  C  CA    . TRP A 1 231  ? -7.066  -25.725  37.291  1.00 78.26  ? 235  TRP A CA    1 
ATOM   1862  C  C     . TRP A 1 231  ? -7.446  -25.051  38.626  1.00 83.36  ? 235  TRP A C     1 
ATOM   1863  O  O     . TRP A 1 231  ? -8.261  -25.617  39.361  1.00 77.12  ? 235  TRP A O     1 
ATOM   1864  C  CB    . TRP A 1 231  ? -6.281  -26.984  37.658  1.00 62.35  ? 235  TRP A CB    1 
ATOM   1865  C  CG    . TRP A 1 231  ? -4.979  -26.746  38.326  1.00 62.03  ? 235  TRP A CG    1 
ATOM   1866  C  CD1   . TRP A 1 231  ? -3.749  -26.679  37.730  1.00 68.08  ? 235  TRP A CD1   1 
ATOM   1867  C  CD2   . TRP A 1 231  ? -4.757  -26.569  39.720  1.00 64.24  ? 235  TRP A CD2   1 
ATOM   1868  N  NE1   . TRP A 1 231  ? -2.780  -26.468  38.666  1.00 68.25  ? 235  TRP A NE1   1 
ATOM   1869  C  CE2   . TRP A 1 231  ? -3.370  -26.388  39.899  1.00 72.00  ? 235  TRP A CE2   1 
ATOM   1870  C  CE3   . TRP A 1 231  ? -5.594  -26.529  40.835  1.00 62.63  ? 235  TRP A CE3   1 
ATOM   1871  C  CZ2   . TRP A 1 231  ? -2.804  -26.175  41.156  1.00 64.79  ? 235  TRP A CZ2   1 
ATOM   1872  C  CZ3   . TRP A 1 231  ? -5.029  -26.328  42.078  1.00 73.31  ? 235  TRP A CZ3   1 
ATOM   1873  C  CH2   . TRP A 1 231  ? -3.648  -26.157  42.230  1.00 77.98  ? 235  TRP A CH2   1 
ATOM   1874  N  N     . ILE A 1 232  ? -6.900  -23.882  38.962  1.00 84.35  ? 236  ILE A N     1 
ATOM   1875  C  CA    . ILE A 1 232  ? -7.038  -23.365  40.344  1.00 67.44  ? 236  ILE A CA    1 
ATOM   1876  C  C     . ILE A 1 232  ? -8.425  -22.796  40.684  1.00 75.73  ? 236  ILE A C     1 
ATOM   1877  O  O     . ILE A 1 232  ? -9.190  -22.440  39.784  1.00 80.40  ? 236  ILE A O     1 
ATOM   1878  C  CB    . ILE A 1 232  ? -5.988  -22.276  40.628  1.00 61.30  ? 236  ILE A CB    1 
ATOM   1879  C  CG1   . ILE A 1 232  ? -6.173  -21.071  39.679  1.00 57.24  ? 236  ILE A CG1   1 
ATOM   1880  C  CG2   . ILE A 1 232  ? -4.594  -22.876  40.566  1.00 63.60  ? 236  ILE A CG2   1 
ATOM   1881  C  CD1   . ILE A 1 232  ? -5.096  -20.022  39.805  1.00 55.00  ? 236  ILE A CD1   1 
ATOM   1882  N  N     . PRO A 1 233  ? -8.752  -22.712  41.991  1.00 82.95  ? 237  PRO A N     1 
ATOM   1883  C  CA    . PRO A 1 233  ? -10.012 -22.122  42.459  1.00 80.09  ? 237  PRO A CA    1 
ATOM   1884  C  C     . PRO A 1 233  ? -10.198 -20.667  42.038  1.00 80.45  ? 237  PRO A C     1 
ATOM   1885  O  O     . PRO A 1 233  ? -9.256  -19.883  42.105  1.00 80.33  ? 237  PRO A O     1 
ATOM   1886  C  CB    . PRO A 1 233  ? -9.900  -22.241  43.986  1.00 52.64  ? 237  PRO A CB    1 
ATOM   1887  C  CG    . PRO A 1 233  ? -9.021  -23.383  44.210  1.00 52.72  ? 237  PRO A CG    1 
ATOM   1888  C  CD    . PRO A 1 233  ? -8.012  -23.334  43.106  1.00 82.42  ? 237  PRO A CD    1 
ATOM   1889  N  N     . LEU A 1 234  ? -11.423 -20.320  41.653  1.00 74.19  ? 238  LEU A N     1 
ATOM   1890  C  CA    . LEU A 1 234  ? -11.719 -19.030  41.040  1.00 75.27  ? 238  LEU A CA    1 
ATOM   1891  C  C     . LEU A 1 234  ? -11.483 -17.825  41.946  1.00 75.66  ? 238  LEU A C     1 
ATOM   1892  O  O     . LEU A 1 234  ? -11.395 -16.692  41.474  1.00 85.36  ? 238  LEU A O     1 
ATOM   1893  C  CB    . LEU A 1 234  ? -13.163 -19.014  40.546  1.00 72.00  ? 238  LEU A CB    1 
ATOM   1894  C  CG    . LEU A 1 234  ? -13.459 -20.033  39.451  1.00 74.82  ? 238  LEU A CG    1 
ATOM   1895  C  CD1   . LEU A 1 234  ? -14.876 -19.884  38.954  1.00 74.91  ? 238  LEU A CD1   1 
ATOM   1896  C  CD2   . LEU A 1 234  ? -12.462 -19.902  38.318  1.00 75.56  ? 238  LEU A CD2   1 
ATOM   1897  N  N     . GLY A 1 235  ? -11.382 -18.064  43.245  1.00 71.44  ? 239  GLY A N     1 
ATOM   1898  C  CA    . GLY A 1 235  ? -11.131 -16.991  44.186  1.00 70.47  ? 239  GLY A CA    1 
ATOM   1899  C  C     . GLY A 1 235  ? -9.775  -16.362  43.943  1.00 71.75  ? 239  GLY A C     1 
ATOM   1900  O  O     . GLY A 1 235  ? -9.614  -15.153  44.077  1.00 78.70  ? 239  GLY A O     1 
ATOM   1901  N  N     . TYR A 1 236  ? -8.798  -17.184  43.575  1.00 64.34  ? 240  TYR A N     1 
ATOM   1902  C  CA    . TYR A 1 236  ? -7.449  -16.701  43.328  1.00 73.69  ? 240  TYR A CA    1 
ATOM   1903  C  C     . TYR A 1 236  ? -7.406  -15.817  42.088  1.00 75.43  ? 240  TYR A C     1 
ATOM   1904  O  O     . TYR A 1 236  ? -6.520  -14.976  41.943  1.00 86.91  ? 240  TYR A O     1 
ATOM   1905  C  CB    . TYR A 1 236  ? -6.482  -17.874  43.163  1.00 80.06  ? 240  TYR A CB    1 
ATOM   1906  C  CG    . TYR A 1 236  ? -6.265  -18.681  44.418  1.00 83.85  ? 240  TYR A CG    1 
ATOM   1907  C  CD1   . TYR A 1 236  ? -5.456  -18.204  45.445  1.00 82.52  ? 240  TYR A CD1   1 
ATOM   1908  C  CD2   . TYR A 1 236  ? -6.870  -19.917  44.581  1.00 85.60  ? 240  TYR A CD2   1 
ATOM   1909  C  CE1   . TYR A 1 236  ? -5.258  -18.935  46.594  1.00 93.65  ? 240  TYR A CE1   1 
ATOM   1910  C  CE2   . TYR A 1 236  ? -6.678  -20.657  45.737  1.00 96.44  ? 240  TYR A CE2   1 
ATOM   1911  C  CZ    . TYR A 1 236  ? -5.869  -20.160  46.736  1.00 101.39 ? 240  TYR A CZ    1 
ATOM   1912  O  OH    . TYR A 1 236  ? -5.670  -20.893  47.882  1.00 119.44 ? 240  TYR A OH    1 
ATOM   1913  N  N     . ILE A 1 237  ? -8.370  -16.012  41.196  1.00 73.17  ? 241  ILE A N     1 
ATOM   1914  C  CA    . ILE A 1 237  ? -8.387  -15.301  39.928  1.00 83.46  ? 241  ILE A CA    1 
ATOM   1915  C  C     . ILE A 1 237  ? -9.197  -14.011  40.006  1.00 83.83  ? 241  ILE A C     1 
ATOM   1916  O  O     . ILE A 1 237  ? -8.712  -12.937  39.640  1.00 79.85  ? 241  ILE A O     1 
ATOM   1917  C  CB    . ILE A 1 237  ? -8.968  -16.177  38.809  1.00 82.32  ? 241  ILE A CB    1 
ATOM   1918  C  CG1   . ILE A 1 237  ? -8.142  -17.458  38.652  1.00 70.99  ? 241  ILE A CG1   1 
ATOM   1919  C  CG2   . ILE A 1 237  ? -9.041  -15.388  37.509  1.00 79.10  ? 241  ILE A CG2   1 
ATOM   1920  C  CD1   . ILE A 1 237  ? -8.813  -18.507  37.812  1.00 69.92  ? 241  ILE A CD1   1 
ATOM   1921  N  N     . PHE A 1 238  ? -10.427 -14.125  40.492  1.00 75.62  ? 242  PHE A N     1 
ATOM   1922  C  CA    . PHE A 1 238  ? -11.375 -13.027  40.404  1.00 70.34  ? 242  PHE A CA    1 
ATOM   1923  C  C     . PHE A 1 238  ? -11.513 -12.226  41.694  1.00 79.41  ? 242  PHE A C     1 
ATOM   1924  O  O     . PHE A 1 238  ? -12.313 -11.290  41.766  1.00 80.93  ? 242  PHE A O     1 
ATOM   1925  C  CB    . PHE A 1 238  ? -12.744 -13.558  39.988  1.00 72.36  ? 242  PHE A CB    1 
ATOM   1926  C  CG    . PHE A 1 238  ? -12.771 -14.147  38.607  1.00 78.35  ? 242  PHE A CG    1 
ATOM   1927  C  CD1   . PHE A 1 238  ? -12.846 -13.331  37.495  1.00 80.48  ? 242  PHE A CD1   1 
ATOM   1928  C  CD2   . PHE A 1 238  ? -12.717 -15.514  38.423  1.00 79.12  ? 242  PHE A CD2   1 
ATOM   1929  C  CE1   . PHE A 1 238  ? -12.865 -13.864  36.226  1.00 80.02  ? 242  PHE A CE1   1 
ATOM   1930  C  CE2   . PHE A 1 238  ? -12.737 -16.055  37.154  1.00 80.71  ? 242  PHE A CE2   1 
ATOM   1931  C  CZ    . PHE A 1 238  ? -12.813 -15.231  36.056  1.00 82.30  ? 242  PHE A CZ    1 
ATOM   1932  N  N     . GLU A 1 239  ? -10.737 -12.576  42.712  1.00 76.97  ? 243  GLU A N     1 
ATOM   1933  C  CA    . GLU A 1 239  ? -10.835 -11.869  43.983  1.00 69.62  ? 243  GLU A CA    1 
ATOM   1934  C  C     . GLU A 1 239  ? -9.466  -11.419  44.483  1.00 72.12  ? 243  GLU A C     1 
ATOM   1935  O  O     . GLU A 1 239  ? -9.312  -11.036  45.639  1.00 72.24  ? 243  GLU A O     1 
ATOM   1936  C  CB    . GLU A 1 239  ? -11.527 -12.742  45.024  1.00 69.89  ? 243  GLU A CB    1 
ATOM   1937  C  CG    . GLU A 1 239  ? -12.880 -13.258  44.569  1.00 84.79  ? 243  GLU A CG    1 
ATOM   1938  C  CD    . GLU A 1 239  ? -13.893 -13.347  45.687  1.00 104.46 ? 243  GLU A CD    1 
ATOM   1939  O  OE1   . GLU A 1 239  ? -13.548 -13.872  46.765  1.00 119.98 ? 243  GLU A OE1   1 
ATOM   1940  O  OE2   . GLU A 1 239  ? -15.034 -12.880  45.487  1.00 110.04 ? 243  GLU A OE2   1 
ATOM   1941  N  N     . THR A 1 240  ? -8.478  -11.458  43.598  1.00 65.63  ? 244  THR A N     1 
ATOM   1942  C  CA    . THR A 1 240  ? -7.159  -10.912  43.891  1.00 66.48  ? 244  THR A CA    1 
ATOM   1943  C  C     . THR A 1 240  ? -6.797  -9.863   42.841  1.00 78.75  ? 244  THR A C     1 
ATOM   1944  O  O     . THR A 1 240  ? -7.562  -9.620   41.912  1.00 96.86  ? 244  THR A O     1 
ATOM   1945  C  CB    . THR A 1 240  ? -6.079  -12.014  43.922  1.00 67.56  ? 244  THR A CB    1 
ATOM   1946  O  OG1   . THR A 1 240  ? -5.802  -12.455  42.586  1.00 78.03  ? 244  THR A OG1   1 
ATOM   1947  C  CG2   . THR A 1 240  ? -6.537  -13.193  44.756  1.00 59.56  ? 244  THR A CG2   1 
ATOM   1948  N  N     . LYS A 1 241  ? -5.622  -9.257   42.981  1.00 81.98  ? 245  LYS A N     1 
ATOM   1949  C  CA    . LYS A 1 241  ? -5.184  -8.218   42.055  1.00 92.27  ? 245  LYS A CA    1 
ATOM   1950  C  C     . LYS A 1 241  ? -4.738  -8.788   40.712  1.00 94.62  ? 245  LYS A C     1 
ATOM   1951  O  O     . LYS A 1 241  ? -4.405  -8.033   39.796  1.00 104.13 ? 245  LYS A O     1 
ATOM   1952  C  CB    . LYS A 1 241  ? -4.042  -7.404   42.667  1.00 105.26 ? 245  LYS A CB    1 
ATOM   1953  C  CG    . LYS A 1 241  ? -4.456  -6.535   43.839  1.00 116.22 ? 245  LYS A CG    1 
ATOM   1954  C  CD    . LYS A 1 241  ? -5.503  -5.516   43.425  1.00 126.74 ? 245  LYS A CD    1 
ATOM   1955  C  CE    . LYS A 1 241  ? -4.975  -4.586   42.341  1.00 128.17 ? 245  LYS A CE    1 
ATOM   1956  N  NZ    . LYS A 1 241  ? -6.006  -3.608   41.897  1.00 129.98 ? 245  LYS A NZ    1 
ATOM   1957  N  N     . LEU A 1 242  ? -4.747  -10.115  40.609  1.00 88.21  ? 246  LEU A N     1 
ATOM   1958  C  CA    . LEU A 1 242  ? -4.226  -10.846  39.448  1.00 81.91  ? 246  LEU A CA    1 
ATOM   1959  C  C     . LEU A 1 242  ? -4.588  -10.236  38.100  1.00 73.38  ? 246  LEU A C     1 
ATOM   1960  O  O     . LEU A 1 242  ? -3.703  -9.811   37.361  1.00 81.42  ? 246  LEU A O     1 
ATOM   1961  C  CB    . LEU A 1 242  ? -4.707  -12.295  39.491  1.00 69.97  ? 246  LEU A CB    1 
ATOM   1962  C  CG    . LEU A 1 242  ? -4.106  -13.238  38.454  1.00 67.68  ? 246  LEU A CG    1 
ATOM   1963  C  CD1   . LEU A 1 242  ? -2.598  -13.347  38.633  1.00 67.66  ? 246  LEU A CD1   1 
ATOM   1964  C  CD2   . LEU A 1 242  ? -4.769  -14.612  38.524  1.00 68.75  ? 246  LEU A CD2   1 
ATOM   1965  N  N     . ILE A 1 243  ? -5.883  -10.186  37.791  1.00 71.02  ? 247  ILE A N     1 
ATOM   1966  C  CA    . ILE A 1 243  ? -6.360  -9.671   36.501  1.00 73.23  ? 247  ILE A CA    1 
ATOM   1967  C  C     . ILE A 1 243  ? -5.778  -8.282   36.188  1.00 83.98  ? 247  ILE A C     1 
ATOM   1968  O  O     . ILE A 1 243  ? -5.276  -8.020   35.085  1.00 86.92  ? 247  ILE A O     1 
ATOM   1969  C  CB    . ILE A 1 243  ? -7.903  -9.618   36.477  1.00 70.79  ? 247  ILE A CB    1 
ATOM   1970  C  CG1   . ILE A 1 243  ? -8.484  -11.033  36.552  1.00 73.05  ? 247  ILE A CG1   1 
ATOM   1971  C  CG2   . ILE A 1 243  ? -8.405  -8.901   35.248  1.00 68.34  ? 247  ILE A CG2   1 
ATOM   1972  C  CD1   . ILE A 1 243  ? -9.987  -11.104  36.407  1.00 75.38  ? 247  ILE A CD1   1 
ATOM   1973  N  N     . SER A 1 244  ? -5.800  -7.409   37.191  1.00 97.52  ? 248  SER A N     1 
ATOM   1974  C  CA    . SER A 1 244  ? -5.214  -6.080   37.063  1.00 86.17  ? 248  SER A CA    1 
ATOM   1975  C  C     . SER A 1 244  ? -3.719  -6.171   36.796  1.00 80.23  ? 248  SER A C     1 
ATOM   1976  O  O     . SER A 1 244  ? -3.232  -5.592   35.845  1.00 86.59  ? 248  SER A O     1 
ATOM   1977  C  CB    . SER A 1 244  ? -5.463  -5.251   38.316  1.00 88.83  ? 248  SER A CB    1 
ATOM   1978  O  OG    . SER A 1 244  ? -6.843  -5.185   38.606  1.00 108.98 ? 248  SER A OG    1 
ATOM   1979  N  N     . THR A 1 245  ? -2.999  -6.914   37.628  1.00 71.43  ? 249  THR A N     1 
ATOM   1980  C  CA    . THR A 1 245  ? -1.547  -7.026   37.516  1.00 70.93  ? 249  THR A CA    1 
ATOM   1981  C  C     . THR A 1 245  ? -1.112  -7.487   36.123  1.00 80.31  ? 249  THR A C     1 
ATOM   1982  O  O     . THR A 1 245  ? -0.141  -6.964   35.556  1.00 94.71  ? 249  THR A O     1 
ATOM   1983  C  CB    . THR A 1 245  ? -0.995  -7.995   38.579  1.00 77.17  ? 249  THR A CB    1 
ATOM   1984  O  OG1   . THR A 1 245  ? -1.584  -7.689   39.847  1.00 74.61  ? 249  THR A OG1   1 
ATOM   1985  C  CG2   . THR A 1 245  ? 0.515   -7.878   38.683  1.00 79.37  ? 249  THR A CG2   1 
ATOM   1986  N  N     . LEU A 1 246  ? -1.853  -8.449   35.576  1.00 80.77  ? 250  LEU A N     1 
ATOM   1987  C  CA    . LEU A 1 246  ? -1.611  -8.956   34.229  1.00 75.99  ? 250  LEU A CA    1 
ATOM   1988  C  C     . LEU A 1 246  ? -1.816  -7.853   33.191  1.00 80.90  ? 250  LEU A C     1 
ATOM   1989  O  O     . LEU A 1 246  ? -0.995  -7.676   32.288  1.00 76.37  ? 250  LEU A O     1 
ATOM   1990  C  CB    . LEU A 1 246  ? -2.535  -10.133  33.912  1.00 65.51  ? 250  LEU A CB    1 
ATOM   1991  C  CG    . LEU A 1 246  ? -2.199  -11.476  34.537  1.00 66.33  ? 250  LEU A CG    1 
ATOM   1992  C  CD1   . LEU A 1 246  ? -3.334  -12.458  34.331  1.00 73.15  ? 250  LEU A CD1   1 
ATOM   1993  C  CD2   . LEU A 1 246  ? -0.905  -12.012  33.950  1.00 76.12  ? 250  LEU A CD2   1 
ATOM   1994  N  N     . ILE A 1 247  ? -2.913  -7.111   33.322  1.00 79.85  ? 251  ILE A N     1 
ATOM   1995  C  CA    . ILE A 1 247  ? -3.244  -6.111   32.316  1.00 82.28  ? 251  ILE A CA    1 
ATOM   1996  C  C     . ILE A 1 247  ? -2.369  -4.843   32.374  1.00 90.05  ? 251  ILE A C     1 
ATOM   1997  O  O     . ILE A 1 247  ? -1.988  -4.291   31.333  1.00 89.45  ? 251  ILE A O     1 
ATOM   1998  C  CB    . ILE A 1 247  ? -4.719  -5.711   32.438  1.00 80.55  ? 251  ILE A CB    1 
ATOM   1999  C  CG1   . ILE A 1 247  ? -5.607  -6.928   32.198  1.00 67.75  ? 251  ILE A CG1   1 
ATOM   2000  C  CG2   . ILE A 1 247  ? -5.062  -4.632   31.434  1.00 79.07  ? 251  ILE A CG2   1 
ATOM   2001  C  CD1   . ILE A 1 247  ? -7.080  -6.642   32.339  1.00 67.82  ? 251  ILE A CD1   1 
ATOM   2002  N  N     . TYR A 1 248  ? -2.052  -4.383   33.581  1.00 86.24  ? 252  TYR A N     1 
ATOM   2003  C  CA    . TYR A 1 248  ? -1.309  -3.142   33.756  1.00 83.12  ? 252  TYR A CA    1 
ATOM   2004  C  C     . TYR A 1 248  ? 0.199   -3.340   33.651  1.00 91.99  ? 252  TYR A C     1 
ATOM   2005  O  O     . TYR A 1 248  ? 0.901   -2.482   33.099  1.00 103.22 ? 252  TYR A O     1 
ATOM   2006  C  CB    . TYR A 1 248  ? -1.645  -2.506   35.103  1.00 78.73  ? 252  TYR A CB    1 
ATOM   2007  C  CG    . TYR A 1 248  ? -2.958  -1.758   35.131  1.00 91.10  ? 252  TYR A CG    1 
ATOM   2008  C  CD1   . TYR A 1 248  ? -3.247  -0.783   34.187  1.00 100.14 ? 252  TYR A CD1   1 
ATOM   2009  C  CD2   . TYR A 1 248  ? -3.909  -2.029   36.103  1.00 103.90 ? 252  TYR A CD2   1 
ATOM   2010  C  CE1   . TYR A 1 248  ? -4.446  -0.102   34.209  1.00 108.01 ? 252  TYR A CE1   1 
ATOM   2011  C  CE2   . TYR A 1 248  ? -5.111  -1.352   36.133  1.00 112.55 ? 252  TYR A CE2   1 
ATOM   2012  C  CZ    . TYR A 1 248  ? -5.374  -0.391   35.185  1.00 115.51 ? 252  TYR A CZ    1 
ATOM   2013  O  OH    . TYR A 1 248  ? -6.572  0.284    35.219  1.00 129.14 ? 252  TYR A OH    1 
ATOM   2014  N  N     . LYS A 1 249  ? 0.705   -4.459   34.167  1.00 78.59  ? 253  LYS A N     1 
ATOM   2015  C  CA    . LYS A 1 249  ? 2.156   -4.605   34.259  1.00 82.66  ? 253  LYS A CA    1 
ATOM   2016  C  C     . LYS A 1 249  ? 2.778   -5.495   33.191  1.00 81.21  ? 253  LYS A C     1 
ATOM   2017  O  O     . LYS A 1 249  ? 3.989   -5.462   32.988  1.00 93.33  ? 253  LYS A O     1 
ATOM   2018  C  CB    . LYS A 1 249  ? 2.548   -5.134   35.640  1.00 86.70  ? 253  LYS A CB    1 
ATOM   2019  C  CG    . LYS A 1 249  ? 2.339   -4.131   36.769  1.00 101.46 ? 253  LYS A CG    1 
ATOM   2020  C  CD    . LYS A 1 249  ? 2.839   -4.680   38.085  1.00 110.88 ? 253  LYS A CD    1 
ATOM   2021  C  CE    . LYS A 1 249  ? 2.709   -3.647   39.197  1.00 132.50 ? 253  LYS A CE    1 
ATOM   2022  N  NZ    . LYS A 1 249  ? 3.178   -4.180   40.513  1.00 136.61 ? 253  LYS A NZ    1 
ATOM   2023  N  N     . PHE A 1 250  ? 1.967   -6.287   32.503  1.00 76.16  ? 254  PHE A N     1 
ATOM   2024  C  CA    . PHE A 1 250  ? 2.531   -7.296   31.617  1.00 76.81  ? 254  PHE A CA    1 
ATOM   2025  C  C     . PHE A 1 250  ? 1.951   -7.314   30.191  1.00 74.17  ? 254  PHE A C     1 
ATOM   2026  O  O     . PHE A 1 250  ? 2.664   -7.629   29.239  1.00 74.75  ? 254  PHE A O     1 
ATOM   2027  C  CB    . PHE A 1 250  ? 2.367   -8.671   32.253  1.00 72.82  ? 254  PHE A CB    1 
ATOM   2028  C  CG    . PHE A 1 250  ? 3.045   -8.803   33.579  1.00 80.16  ? 254  PHE A CG    1 
ATOM   2029  C  CD1   . PHE A 1 250  ? 4.422   -8.692   33.682  1.00 78.46  ? 254  PHE A CD1   1 
ATOM   2030  C  CD2   . PHE A 1 250  ? 2.309   -9.036   34.731  1.00 91.43  ? 254  PHE A CD2   1 
ATOM   2031  C  CE1   . PHE A 1 250  ? 5.048   -8.812   34.908  1.00 84.43  ? 254  PHE A CE1   1 
ATOM   2032  C  CE2   . PHE A 1 250  ? 2.936   -9.157   35.961  1.00 88.76  ? 254  PHE A CE2   1 
ATOM   2033  C  CZ    . PHE A 1 250  ? 4.305   -9.047   36.044  1.00 89.14  ? 254  PHE A CZ    1 
ATOM   2034  N  N     . LEU A 1 251  ? 0.675   -6.971   30.042  1.00 61.62  ? 255  LEU A N     1 
ATOM   2035  C  CA    . LEU A 1 251  ? 0.023   -7.089   28.749  1.00 63.16  ? 255  LEU A CA    1 
ATOM   2036  C  C     . LEU A 1 251  ? 0.632   -6.156   27.702  1.00 73.54  ? 255  LEU A C     1 
ATOM   2037  O  O     . LEU A 1 251  ? 0.680   -6.504   26.520  1.00 71.68  ? 255  LEU A O     1 
ATOM   2038  C  CB    . LEU A 1 251  ? -1.481  -6.820   28.876  1.00 63.60  ? 255  LEU A CB    1 
ATOM   2039  C  CG    . LEU A 1 251  ? -2.285  -6.926   27.565  1.00 62.17  ? 255  LEU A CG    1 
ATOM   2040  C  CD1   . LEU A 1 251  ? -2.035  -8.252   26.874  1.00 65.95  ? 255  LEU A CD1   1 
ATOM   2041  C  CD2   . LEU A 1 251  ? -3.778  -6.740   27.819  1.00 66.64  ? 255  LEU A CD2   1 
ATOM   2042  N  N     . ASN A 1 252  ? 1.099   -4.982   28.126  1.00 73.62  ? 256  ASN A N     1 
ATOM   2043  C  CA    . ASN A 1 252  ? 1.573   -3.983   27.177  1.00 80.53  ? 256  ASN A CA    1 
ATOM   2044  C  C     . ASN A 1 252  ? 3.035   -4.152   26.779  1.00 91.89  ? 256  ASN A C     1 
ATOM   2045  O  O     . ASN A 1 252  ? 3.419   -3.812   25.660  1.00 121.63 ? 256  ASN A O     1 
ATOM   2046  C  CB    . ASN A 1 252  ? 1.348   -2.577   27.728  1.00 94.83  ? 256  ASN A CB    1 
ATOM   2047  C  CG    . ASN A 1 252  ? 1.908   -2.397   29.124  1.00 118.59 ? 256  ASN A CG    1 
ATOM   2048  O  OD1   . ASN A 1 252  ? 3.056   -2.742   29.397  1.00 135.48 ? 256  ASN A OD1   1 
ATOM   2049  N  ND2   . ASN A 1 252  ? 1.091   -1.857   30.022  1.00 125.35 ? 256  ASN A ND2   1 
ATOM   2050  N  N     . VAL A 1 253  ? 3.850   -4.686   27.677  1.00 76.24  ? 257  VAL A N     1 
ATOM   2051  C  CA    . VAL A 1 253  ? 5.259   -4.891   27.372  1.00 72.70  ? 257  VAL A CA    1 
ATOM   2052  C  C     . VAL A 1 253  ? 5.398   -6.094   26.448  1.00 87.17  ? 257  VAL A C     1 
ATOM   2053  O  O     . VAL A 1 253  ? 4.885   -7.171   26.747  1.00 100.26 ? 257  VAL A O     1 
ATOM   2054  C  CB    . VAL A 1 253  ? 6.100   -5.082   28.663  1.00 74.07  ? 257  VAL A CB    1 
ATOM   2055  C  CG1   . VAL A 1 253  ? 5.361   -5.929   29.663  1.00 78.45  ? 257  VAL A CG1   1 
ATOM   2056  C  CG2   . VAL A 1 253  ? 7.464   -5.664   28.342  1.00 88.46  ? 257  VAL A CG2   1 
ATOM   2057  N  N     . PRO A 1 254  ? 6.081   -5.905   25.308  1.00 99.84  ? 258  PRO A N     1 
ATOM   2058  C  CA    . PRO A 1 254  ? 6.196   -6.868   24.204  1.00 100.11 ? 258  PRO A CA    1 
ATOM   2059  C  C     . PRO A 1 254  ? 6.500   -8.301   24.620  1.00 90.72  ? 258  PRO A C     1 
ATOM   2060  O  O     . PRO A 1 254  ? 5.728   -9.200   24.293  1.00 94.87  ? 258  PRO A O     1 
ATOM   2061  C  CB    . PRO A 1 254  ? 7.355   -6.301   23.379  1.00 94.20  ? 258  PRO A CB    1 
ATOM   2062  C  CG    . PRO A 1 254  ? 7.231   -4.842   23.564  1.00 103.96 ? 258  PRO A CG    1 
ATOM   2063  C  CD    . PRO A 1 254  ? 6.781   -4.647   24.999  1.00 100.44 ? 258  PRO A CD    1 
ATOM   2064  N  N     . MET A 1 255  ? 7.597   -8.513   25.336  1.00 83.51  ? 259  MET A N     1 
ATOM   2065  C  CA    . MET A 1 255  ? 8.036   -9.868   25.639  1.00 76.75  ? 259  MET A CA    1 
ATOM   2066  C  C     . MET A 1 255  ? 7.088   -10.608  26.575  1.00 80.92  ? 259  MET A C     1 
ATOM   2067  O  O     . MET A 1 255  ? 7.301   -11.782  26.849  1.00 96.23  ? 259  MET A O     1 
ATOM   2068  C  CB    . MET A 1 255  ? 9.443   -9.853   26.242  1.00 79.11  ? 259  MET A CB    1 
ATOM   2069  C  CG    . MET A 1 255  ? 9.514   -9.306   27.653  1.00 73.66  ? 259  MET A CG    1 
ATOM   2070  S  SD    . MET A 1 255  ? 11.169  -9.424   28.347  1.00 162.88 ? 259  MET A SD    1 
ATOM   2071  C  CE    . MET A 1 255  ? 12.083  -8.387   27.211  1.00 118.77 ? 259  MET A CE    1 
ATOM   2072  N  N     . PHE A 1 256  ? 6.046   -9.933   27.058  1.00 67.72  ? 260  PHE A N     1 
ATOM   2073  C  CA    . PHE A 1 256  ? 5.108   -10.563  27.985  1.00 75.18  ? 260  PHE A CA    1 
ATOM   2074  C  C     . PHE A 1 256  ? 3.674   -10.539  27.466  1.00 73.42  ? 260  PHE A C     1 
ATOM   2075  O  O     . PHE A 1 256  ? 2.777   -11.163  28.053  1.00 93.89  ? 260  PHE A O     1 
ATOM   2076  C  CB    . PHE A 1 256  ? 5.163   -9.882   29.362  1.00 84.17  ? 260  PHE A CB    1 
ATOM   2077  C  CG    . PHE A 1 256  ? 6.494   -9.997   30.048  1.00 81.01  ? 260  PHE A CG    1 
ATOM   2078  C  CD1   . PHE A 1 256  ? 7.154   -11.208  30.105  1.00 90.18  ? 260  PHE A CD1   1 
ATOM   2079  C  CD2   . PHE A 1 256  ? 7.088   -8.889   30.624  1.00 73.52  ? 260  PHE A CD2   1 
ATOM   2080  C  CE1   . PHE A 1 256  ? 8.379   -11.315  30.736  1.00 100.88 ? 260  PHE A CE1   1 
ATOM   2081  C  CE2   . PHE A 1 256  ? 8.313   -8.989   31.246  1.00 82.21  ? 260  PHE A CE2   1 
ATOM   2082  C  CZ    . PHE A 1 256  ? 8.961   -10.201  31.307  1.00 93.25  ? 260  PHE A CZ    1 
ATOM   2083  N  N     . ARG A 1 257  ? 3.464   -9.825   26.364  1.00 68.99  ? 261  ARG A N     1 
ATOM   2084  C  CA    . ARG A 1 257  ? 2.118   -9.582   25.854  1.00 72.81  ? 261  ARG A CA    1 
ATOM   2085  C  C     . ARG A 1 257  ? 1.392   -10.867  25.455  1.00 67.82  ? 261  ARG A C     1 
ATOM   2086  O  O     . ARG A 1 257  ? 0.193   -11.010  25.710  1.00 73.86  ? 261  ARG A O     1 
ATOM   2087  C  CB    . ARG A 1 257  ? 2.159   -8.614   24.656  1.00 75.71  ? 261  ARG A CB    1 
ATOM   2088  C  CG    . ARG A 1 257  ? 2.780   -9.185   23.400  1.00 76.94  ? 261  ARG A CG    1 
ATOM   2089  C  CD    . ARG A 1 257  ? 2.777   -8.191   22.249  1.00 77.59  ? 261  ARG A CD    1 
ATOM   2090  N  NE    . ARG A 1 257  ? 3.488   -8.724   21.091  1.00 76.60  ? 261  ARG A NE    1 
ATOM   2091  C  CZ    . ARG A 1 257  ? 3.528   -8.135   19.904  1.00 100.68 ? 261  ARG A CZ    1 
ATOM   2092  N  NH1   . ARG A 1 257  ? 2.903   -6.979   19.711  1.00 111.97 ? 261  ARG A NH1   1 
ATOM   2093  N  NH2   . ARG A 1 257  ? 4.196   -8.701   18.911  1.00 108.57 ? 261  ARG A NH2   1 
ATOM   2094  N  N     . ASN A 1 258  ? 2.112   -11.803  24.843  1.00 61.24  ? 262  ASN A N     1 
ATOM   2095  C  CA    . ASN A 1 258  ? 1.478   -13.029  24.379  1.00 67.83  ? 262  ASN A CA    1 
ATOM   2096  C  C     . ASN A 1 258  ? 0.999   -13.894  25.525  1.00 74.96  ? 262  ASN A C     1 
ATOM   2097  O  O     . ASN A 1 258  ? -0.193  -14.202  25.609  1.00 75.41  ? 262  ASN A O     1 
ATOM   2098  C  CB    . ASN A 1 258  ? 2.426   -13.824  23.493  1.00 72.17  ? 262  ASN A CB    1 
ATOM   2099  C  CG    . ASN A 1 258  ? 2.387   -13.356  22.038  1.00 72.08  ? 262  ASN A CG    1 
ATOM   2100  O  OD1   . ASN A 1 258  ? 1.356   -12.877  21.558  1.00 60.80  ? 262  ASN A OD1   1 
ATOM   2101  N  ND2   . ASN A 1 258  ? 3.514   -13.490  21.334  1.00 65.57  ? 262  ASN A ND2   1 
ATOM   2102  N  N     . VAL A 1 259  ? 1.920   -14.260  26.417  1.00 74.04  ? 263  VAL A N     1 
ATOM   2103  C  CA    . VAL A 1 259  ? 1.576   -15.087  27.574  1.00 68.48  ? 263  VAL A CA    1 
ATOM   2104  C  C     . VAL A 1 259  ? 0.494   -14.425  28.394  1.00 65.57  ? 263  VAL A C     1 
ATOM   2105  O  O     . VAL A 1 259  ? -0.458  -15.088  28.834  1.00 64.05  ? 263  VAL A O     1 
ATOM   2106  C  CB    . VAL A 1 259  ? 2.787   -15.350  28.471  1.00 70.60  ? 263  VAL A CB    1 
ATOM   2107  C  CG1   . VAL A 1 259  ? 2.572   -16.607  29.287  1.00 67.98  ? 263  VAL A CG1   1 
ATOM   2108  C  CG2   . VAL A 1 259  ? 4.023   -15.497  27.631  1.00 95.13  ? 263  VAL A CG2   1 
ATOM   2109  N  N     . SER A 1 260  ? 0.636   -13.114  28.576  1.00 64.19  ? 264  SER A N     1 
ATOM   2110  C  CA    . SER A 1 260  ? -0.332  -12.358  29.354  1.00 75.41  ? 264  SER A CA    1 
ATOM   2111  C  C     . SER A 1 260  ? -1.720  -12.446  28.727  1.00 73.51  ? 264  SER A C     1 
ATOM   2112  O  O     . SER A 1 260  ? -2.720  -12.682  29.414  1.00 75.73  ? 264  SER A O     1 
ATOM   2113  C  CB    . SER A 1 260  ? 0.100   -10.901  29.481  1.00 87.06  ? 264  SER A CB    1 
ATOM   2114  O  OG    . SER A 1 260  ? -0.744  -10.201  30.374  1.00 115.39 ? 264  SER A OG    1 
ATOM   2115  N  N     . LEU A 1 261  ? -1.777  -12.281  27.413  1.00 67.87  ? 265  LEU A N     1 
ATOM   2116  C  CA    . LEU A 1 261  ? -3.053  -12.313  26.711  1.00 64.16  ? 265  LEU A CA    1 
ATOM   2117  C  C     . LEU A 1 261  ? -3.666  -13.710  26.715  1.00 65.41  ? 265  LEU A C     1 
ATOM   2118  O  O     . LEU A 1 261  ? -4.887  -13.858  26.722  1.00 73.73  ? 265  LEU A O     1 
ATOM   2119  C  CB    . LEU A 1 261  ? -2.889  -11.815  25.272  1.00 59.98  ? 265  LEU A CB    1 
ATOM   2120  C  CG    . LEU A 1 261  ? -4.179  -11.677  24.453  1.00 56.54  ? 265  LEU A CG    1 
ATOM   2121  C  CD1   . LEU A 1 261  ? -5.181  -10.767  25.152  1.00 58.49  ? 265  LEU A CD1   1 
ATOM   2122  C  CD2   . LEU A 1 261  ? -3.866  -11.169  23.078  1.00 60.66  ? 265  LEU A CD2   1 
ATOM   2123  N  N     . LYS A 1 262  ? -2.817  -14.732  26.711  1.00 60.96  ? 266  LYS A N     1 
ATOM   2124  C  CA    . LYS A 1 262  ? -3.299  -16.111  26.776  1.00 62.60  ? 266  LYS A CA    1 
ATOM   2125  C  C     . LYS A 1 262  ? -3.916  -16.398  28.144  1.00 66.90  ? 266  LYS A C     1 
ATOM   2126  O  O     . LYS A 1 262  ? -5.015  -16.964  28.230  1.00 68.69  ? 266  LYS A O     1 
ATOM   2127  C  CB    . LYS A 1 262  ? -2.169  -17.098  26.465  1.00 65.63  ? 266  LYS A CB    1 
ATOM   2128  C  CG    . LYS A 1 262  ? -1.577  -16.914  25.063  1.00 57.73  ? 266  LYS A CG    1 
ATOM   2129  C  CD    . LYS A 1 262  ? -0.958  -18.186  24.507  1.00 59.77  ? 266  LYS A CD    1 
ATOM   2130  C  CE    . LYS A 1 262  ? 0.363   -18.510  25.183  1.00 78.40  ? 266  LYS A CE    1 
ATOM   2131  N  NZ    . LYS A 1 262  ? 1.003   -19.707  24.553  1.00 99.65  ? 266  LYS A NZ    1 
ATOM   2132  N  N     . CYS A 1 263  ? -3.221  -15.976  29.201  1.00 63.17  ? 267  CYS A N     1 
ATOM   2133  C  CA    . CYS A 1 263  ? -3.778  -16.004  30.554  1.00 56.59  ? 267  CYS A CA    1 
ATOM   2134  C  C     . CYS A 1 263  ? -5.136  -15.312  30.607  1.00 64.06  ? 267  CYS A C     1 
ATOM   2135  O  O     . CYS A 1 263  ? -6.108  -15.849  31.150  1.00 68.58  ? 267  CYS A O     1 
ATOM   2136  C  CB    . CYS A 1 263  ? -2.830  -15.340  31.556  1.00 53.69  ? 267  CYS A CB    1 
ATOM   2137  S  SG    . CYS A 1 263  ? -1.350  -16.275  31.947  1.00 80.44  ? 267  CYS A SG    1 
ATOM   2138  N  N     . LEU A 1 264  ? -5.192  -14.115  30.034  1.00 56.20  ? 268  LEU A N     1 
ATOM   2139  C  CA    . LEU A 1 264  ? -6.423  -13.349  30.001  1.00 55.28  ? 268  LEU A CA    1 
ATOM   2140  C  C     . LEU A 1 264  ? -7.533  -14.089  29.260  1.00 59.42  ? 268  LEU A C     1 
ATOM   2141  O  O     . LEU A 1 264  ? -8.697  -13.984  29.630  1.00 54.15  ? 268  LEU A O     1 
ATOM   2142  C  CB    . LEU A 1 264  ? -6.173  -11.980  29.362  1.00 59.36  ? 268  LEU A CB    1 
ATOM   2143  C  CG    . LEU A 1 264  ? -5.286  -11.023  30.163  1.00 66.55  ? 268  LEU A CG    1 
ATOM   2144  C  CD1   . LEU A 1 264  ? -5.059  -9.735   29.409  1.00 72.08  ? 268  LEU A CD1   1 
ATOM   2145  C  CD2   . LEU A 1 264  ? -5.880  -10.751  31.543  1.00 57.18  ? 268  LEU A CD2   1 
ATOM   2146  N  N     . THR A 1 265  ? -7.171  -14.834  28.216  1.00 65.90  ? 269  THR A N     1 
ATOM   2147  C  CA    . THR A 1 265  ? -8.159  -15.567  27.429  1.00 68.75  ? 269  THR A CA    1 
ATOM   2148  C  C     . THR A 1 265  ? -8.715  -16.731  28.249  1.00 77.17  ? 269  THR A C     1 
ATOM   2149  O  O     . THR A 1 265  ? -9.928  -16.993  28.246  1.00 75.25  ? 269  THR A O     1 
ATOM   2150  C  CB    . THR A 1 265  ? -7.567  -16.100  26.108  1.00 72.26  ? 269  THR A CB    1 
ATOM   2151  O  OG1   . THR A 1 265  ? -6.998  -15.021  25.355  1.00 68.63  ? 269  THR A OG1   1 
ATOM   2152  C  CG2   . THR A 1 265  ? -8.648  -16.774  25.262  1.00 74.59  ? 269  THR A CG2   1 
ATOM   2153  N  N     . GLU A 1 266  ? -7.828  -17.425  28.961  1.00 75.77  ? 270  GLU A N     1 
ATOM   2154  C  CA    . GLU A 1 266  ? -8.261  -18.488  29.864  1.00 65.03  ? 270  GLU A CA    1 
ATOM   2155  C  C     . GLU A 1 266  ? -9.225  -17.931  30.906  1.00 69.67  ? 270  GLU A C     1 
ATOM   2156  O  O     . GLU A 1 266  ? -10.306 -18.485  31.107  1.00 77.42  ? 270  GLU A O     1 
ATOM   2157  C  CB    . GLU A 1 266  ? -7.066  -19.151  30.546  1.00 60.23  ? 270  GLU A CB    1 
ATOM   2158  C  CG    . GLU A 1 266  ? -6.071  -19.757  29.590  1.00 82.76  ? 270  GLU A CG    1 
ATOM   2159  C  CD    . GLU A 1 266  ? -6.754  -20.472  28.430  1.00 104.64 ? 270  GLU A CD    1 
ATOM   2160  O  OE1   . GLU A 1 266  ? -7.398  -21.519  28.671  1.00 109.05 ? 270  GLU A OE1   1 
ATOM   2161  O  OE2   . GLU A 1 266  ? -6.654  -19.979  27.279  1.00 97.60  ? 270  GLU A OE2   1 
ATOM   2162  N  N     . ILE A 1 267  ? -8.842  -16.829  31.549  1.00 58.79  ? 271  ILE A N     1 
ATOM   2163  C  CA    . ILE A 1 267  ? -9.713  -16.190  32.533  1.00 61.71  ? 271  ILE A CA    1 
ATOM   2164  C  C     . ILE A 1 267  ? -11.055 -15.803  31.902  1.00 77.35  ? 271  ILE A C     1 
ATOM   2165  O  O     . ILE A 1 267  ? -12.116 -15.989  32.510  1.00 75.02  ? 271  ILE A O     1 
ATOM   2166  C  CB    . ILE A 1 267  ? -9.048  -14.940  33.148  1.00 56.99  ? 271  ILE A CB    1 
ATOM   2167  C  CG1   . ILE A 1 267  ? -7.810  -15.333  33.946  1.00 53.42  ? 271  ILE A CG1   1 
ATOM   2168  C  CG2   . ILE A 1 267  ? -10.021 -14.176  34.005  1.00 51.06  ? 271  ILE A CG2   1 
ATOM   2169  C  CD1   . ILE A 1 267  ? -7.046  -14.166  34.506  1.00 60.44  ? 271  ILE A CD1   1 
ATOM   2170  N  N     . ALA A 1 268  ? -11.000 -15.291  30.673  1.00 75.75  ? 272  ALA A N     1 
ATOM   2171  C  CA    . ALA A 1 268  ? -12.184 -14.821  29.963  1.00 64.12  ? 272  ALA A CA    1 
ATOM   2172  C  C     . ALA A 1 268  ? -13.106 -15.978  29.610  1.00 75.32  ? 272  ALA A C     1 
ATOM   2173  O  O     . ALA A 1 268  ? -14.308 -15.779  29.413  1.00 70.63  ? 272  ALA A O     1 
ATOM   2174  C  CB    . ALA A 1 268  ? -11.784 -14.074  28.719  1.00 61.06  ? 272  ALA A CB    1 
ATOM   2175  N  N     . GLY A 1 269  ? -12.541 -17.182  29.527  1.00 76.45  ? 273  GLY A N     1 
ATOM   2176  C  CA    . GLY A 1 269  ? -13.318 -18.365  29.200  1.00 71.75  ? 273  GLY A CA    1 
ATOM   2177  C  C     . GLY A 1 269  ? -14.282 -18.805  30.292  1.00 68.84  ? 273  GLY A C     1 
ATOM   2178  O  O     . GLY A 1 269  ? -15.270 -19.481  30.014  1.00 75.66  ? 273  GLY A O     1 
ATOM   2179  N  N     . VAL A 1 270  ? -14.006 -18.413  31.532  1.00 65.18  ? 274  VAL A N     1 
ATOM   2180  C  CA    . VAL A 1 270  ? -14.808 -18.846  32.672  1.00 67.83  ? 274  VAL A CA    1 
ATOM   2181  C  C     . VAL A 1 270  ? -16.223 -18.278  32.621  1.00 79.79  ? 274  VAL A C     1 
ATOM   2182  O  O     . VAL A 1 270  ? -16.412 -17.082  32.420  1.00 95.96  ? 274  VAL A O     1 
ATOM   2183  C  CB    . VAL A 1 270  ? -14.137 -18.438  34.002  1.00 72.92  ? 274  VAL A CB    1 
ATOM   2184  C  CG1   . VAL A 1 270  ? -14.970 -18.878  35.189  1.00 75.47  ? 274  VAL A CG1   1 
ATOM   2185  C  CG2   . VAL A 1 270  ? -12.726 -19.017  34.093  1.00 57.49  ? 274  VAL A CG2   1 
ATOM   2186  N  N     . SER A 1 271  ? -17.215 -19.145  32.803  1.00 84.05  ? 275  SER A N     1 
ATOM   2187  C  CA    . SER A 1 271  ? -18.616 -18.721  32.806  1.00 96.78  ? 275  SER A CA    1 
ATOM   2188  C  C     . SER A 1 271  ? -19.211 -18.826  34.206  1.00 97.51  ? 275  SER A C     1 
ATOM   2189  O  O     . SER A 1 271  ? -19.674 -19.893  34.609  1.00 102.08 ? 275  SER A O     1 
ATOM   2190  C  CB    . SER A 1 271  ? -19.442 -19.560  31.826  1.00 108.89 ? 275  SER A CB    1 
ATOM   2191  O  OG    . SER A 1 271  ? -19.575 -20.893  32.281  1.00 120.29 ? 275  SER A OG    1 
ATOM   2192  N  N     . VAL A 1 272  ? -19.202 -17.715  34.940  1.00 96.96  ? 276  VAL A N     1 
ATOM   2193  C  CA    . VAL A 1 272  ? -19.599 -17.719  36.341  1.00 97.51  ? 276  VAL A CA    1 
ATOM   2194  C  C     . VAL A 1 272  ? -20.406 -16.472  36.712  1.00 114.39 ? 276  VAL A C     1 
ATOM   2195  O  O     . VAL A 1 272  ? -20.054 -15.350  36.346  1.00 126.06 ? 276  VAL A O     1 
ATOM   2196  C  CB    . VAL A 1 272  ? -18.360 -17.839  37.246  1.00 97.91  ? 276  VAL A CB    1 
ATOM   2197  C  CG1   . VAL A 1 272  ? -18.621 -17.243  38.623  1.00 115.72 ? 276  VAL A CG1   1 
ATOM   2198  C  CG2   . VAL A 1 272  ? -17.943 -19.289  37.361  1.00 97.69  ? 276  VAL A CG2   1 
ATOM   2199  N  N     . SER A 1 273  ? -21.485 -16.682  37.458  1.00 115.85 ? 277  SER A N     1 
ATOM   2200  C  CA    . SER A 1 273  ? -22.464 -15.637  37.736  1.00 114.85 ? 277  SER A CA    1 
ATOM   2201  C  C     . SER A 1 273  ? -21.991 -14.544  38.693  1.00 116.47 ? 277  SER A C     1 
ATOM   2202  O  O     . SER A 1 273  ? -22.533 -13.441  38.689  1.00 113.01 ? 277  SER A O     1 
ATOM   2203  C  CB    . SER A 1 273  ? -23.736 -16.275  38.300  1.00 131.99 ? 277  SER A CB    1 
ATOM   2204  O  OG    . SER A 1 273  ? -24.074 -17.452  37.584  1.00 148.30 ? 277  SER A OG    1 
ATOM   2205  N  N     . GLN A 1 274  ? -20.990 -14.839  39.516  1.00 125.94 ? 278  GLN A N     1 
ATOM   2206  C  CA    . GLN A 1 274  ? -20.670 -13.956  40.641  1.00 143.80 ? 278  GLN A CA    1 
ATOM   2207  C  C     . GLN A 1 274  ? -19.668 -12.841  40.330  1.00 138.94 ? 278  GLN A C     1 
ATOM   2208  O  O     . GLN A 1 274  ? -19.523 -11.907  41.124  1.00 151.27 ? 278  GLN A O     1 
ATOM   2209  C  CB    . GLN A 1 274  ? -20.137 -14.776  41.821  1.00 159.66 ? 278  GLN A CB    1 
ATOM   2210  C  CG    . GLN A 1 274  ? -20.995 -15.972  42.192  1.00 171.41 ? 278  GLN A CG    1 
ATOM   2211  C  CD    . GLN A 1 274  ? -20.545 -17.243  41.498  1.00 177.73 ? 278  GLN A CD    1 
ATOM   2212  O  OE1   . GLN A 1 274  ? -19.430 -17.720  41.716  1.00 177.85 ? 278  GLN A OE1   1 
ATOM   2213  N  NE2   . GLN A 1 274  ? -21.408 -17.795  40.652  1.00 181.09 ? 278  GLN A NE2   1 
ATOM   2214  N  N     . TYR A 1 275  ? -18.980 -12.922  39.195  1.00 115.79 ? 279  TYR A N     1 
ATOM   2215  C  CA    . TYR A 1 275  ? -17.882 -11.993  38.940  1.00 96.65  ? 279  TYR A CA    1 
ATOM   2216  C  C     . TYR A 1 275  ? -18.115 -11.061  37.754  1.00 96.98  ? 279  TYR A C     1 
ATOM   2217  O  O     . TYR A 1 275  ? -17.157 -10.639  37.095  1.00 100.27 ? 279  TYR A O     1 
ATOM   2218  C  CB    . TYR A 1 275  ? -16.584 -12.767  38.729  1.00 101.56 ? 279  TYR A CB    1 
ATOM   2219  C  CG    . TYR A 1 275  ? -16.200 -13.639  39.901  1.00 106.85 ? 279  TYR A CG    1 
ATOM   2220  C  CD1   . TYR A 1 275  ? -15.959 -13.089  41.155  1.00 97.91  ? 279  TYR A CD1   1 
ATOM   2221  C  CD2   . TYR A 1 275  ? -16.065 -15.011  39.755  1.00 112.24 ? 279  TYR A CD2   1 
ATOM   2222  C  CE1   . TYR A 1 275  ? -15.599 -13.879  42.222  1.00 96.34  ? 279  TYR A CE1   1 
ATOM   2223  C  CE2   . TYR A 1 275  ? -15.709 -15.812  40.828  1.00 97.98  ? 279  TYR A CE2   1 
ATOM   2224  C  CZ    . TYR A 1 275  ? -15.476 -15.238  42.053  1.00 98.13  ? 279  TYR A CZ    1 
ATOM   2225  O  OH    . TYR A 1 275  ? -15.119 -16.032  43.115  1.00 114.82 ? 279  TYR A OH    1 
ATOM   2226  N  N     . GLU A 1 276  ? -19.382 -10.736  37.502  1.00 103.92 ? 280  GLU A N     1 
ATOM   2227  C  CA    . GLU A 1 276  ? -19.777 -9.868   36.394  1.00 82.87  ? 280  GLU A CA    1 
ATOM   2228  C  C     . GLU A 1 276  ? -18.895 -8.622   36.302  1.00 88.15  ? 280  GLU A C     1 
ATOM   2229  O  O     . GLU A 1 276  ? -18.275 -8.366   35.267  1.00 107.72 ? 280  GLU A O     1 
ATOM   2230  C  CB    . GLU A 1 276  ? -21.252 -9.489   36.545  1.00 88.42  ? 280  GLU A CB    1 
ATOM   2231  C  CG    . GLU A 1 276  ? -21.755 -8.433   35.584  1.00 120.55 ? 280  GLU A CG    1 
ATOM   2232  C  CD    . GLU A 1 276  ? -23.271 -8.410   35.492  1.00 145.19 ? 280  GLU A CD    1 
ATOM   2233  O  OE1   . GLU A 1 276  ? -23.873 -9.497   35.359  1.00 150.67 ? 280  GLU A OE1   1 
ATOM   2234  O  OE2   . GLU A 1 276  ? -23.862 -7.310   35.559  1.00 156.87 ? 280  GLU A OE2   1 
ATOM   2235  N  N     . GLU A 1 277  ? -18.797 -7.883   37.401  1.00 88.75  ? 281  GLU A N     1 
ATOM   2236  C  CA    . GLU A 1 277  ? -18.005 -6.661   37.420  1.00 87.54  ? 281  GLU A CA    1 
ATOM   2237  C  C     . GLU A 1 277  ? -16.542 -6.933   37.090  1.00 90.18  ? 281  GLU A C     1 
ATOM   2238  O  O     . GLU A 1 277  ? -15.941 -6.215   36.281  1.00 100.53 ? 281  GLU A O     1 
ATOM   2239  C  CB    . GLU A 1 277  ? -18.139 -5.962   38.774  1.00 93.95  ? 281  GLU A CB    1 
ATOM   2240  C  CG    . GLU A 1 277  ? -19.509 -5.333   38.986  1.00 98.02  ? 281  GLU A CG    1 
ATOM   2241  C  CD    . GLU A 1 277  ? -19.844 -4.305   37.924  1.00 113.38 ? 281  GLU A CD    1 
ATOM   2242  O  OE1   . GLU A 1 277  ? -18.929 -3.571   37.493  1.00 125.07 ? 281  GLU A OE1   1 
ATOM   2243  O  OE2   . GLU A 1 277  ? -21.019 -4.234   37.510  1.00 120.11 ? 281  GLU A OE2   1 
ATOM   2244  N  N     . GLN A 1 278  ? -15.986 -7.995   37.668  1.00 84.88  ? 282  GLN A N     1 
ATOM   2245  C  CA    . GLN A 1 278  ? -14.595 -8.338   37.402  1.00 81.73  ? 282  GLN A CA    1 
ATOM   2246  C  C     . GLN A 1 278  ? -14.427 -8.585   35.909  1.00 89.51  ? 282  GLN A C     1 
ATOM   2247  O  O     . GLN A 1 278  ? -13.460 -8.114   35.297  1.00 101.00 ? 282  GLN A O     1 
ATOM   2248  C  CB    . GLN A 1 278  ? -14.155 -9.553   38.229  1.00 77.42  ? 282  GLN A CB    1 
ATOM   2249  C  CG    . GLN A 1 278  ? -13.923 -9.242   39.716  1.00 79.09  ? 282  GLN A CG    1 
ATOM   2250  C  CD    . GLN A 1 278  ? -15.199 -9.313   40.549  1.00 91.56  ? 282  GLN A CD    1 
ATOM   2251  O  OE1   . GLN A 1 278  ? -16.311 -9.254   40.020  1.00 94.06  ? 282  GLN A OE1   1 
ATOM   2252  N  NE2   . GLN A 1 278  ? -15.038 -9.448   41.861  1.00 111.23 ? 282  GLN A NE2   1 
ATOM   2253  N  N     . PHE A 1 279  ? -15.413 -9.249   35.312  1.00 85.27  ? 283  PHE A N     1 
ATOM   2254  C  CA    . PHE A 1 279  ? -15.345 -9.542   33.886  1.00 76.47  ? 283  PHE A CA    1 
ATOM   2255  C  C     . PHE A 1 279  ? -15.345 -8.237   33.096  1.00 70.86  ? 283  PHE A C     1 
ATOM   2256  O  O     . PHE A 1 279  ? -14.527 -8.056   32.183  1.00 61.45  ? 283  PHE A O     1 
ATOM   2257  C  CB    . PHE A 1 279  ? -16.503 -10.439  33.451  1.00 75.98  ? 283  PHE A CB    1 
ATOM   2258  C  CG    . PHE A 1 279  ? -16.287 -11.895  33.751  1.00 76.56  ? 283  PHE A CG    1 
ATOM   2259  C  CD1   . PHE A 1 279  ? -15.246 -12.586  33.159  1.00 76.78  ? 283  PHE A CD1   1 
ATOM   2260  C  CD2   . PHE A 1 279  ? -17.132 -12.579  34.613  1.00 73.08  ? 283  PHE A CD2   1 
ATOM   2261  C  CE1   . PHE A 1 279  ? -15.043 -13.936  33.428  1.00 76.05  ? 283  PHE A CE1   1 
ATOM   2262  C  CE2   . PHE A 1 279  ? -16.935 -13.925  34.876  1.00 71.85  ? 283  PHE A CE2   1 
ATOM   2263  C  CZ    . PHE A 1 279  ? -15.889 -14.604  34.281  1.00 67.76  ? 283  PHE A CZ    1 
ATOM   2264  N  N     . VAL A 1 280  ? -16.220 -7.315   33.493  1.00 73.85  ? 284  VAL A N     1 
ATOM   2265  C  CA    . VAL A 1 280  ? -16.338 -6.050   32.788  1.00 74.13  ? 284  VAL A CA    1 
ATOM   2266  C  C     . VAL A 1 280  ? -14.983 -5.371   32.875  1.00 73.50  ? 284  VAL A C     1 
ATOM   2267  O  O     . VAL A 1 280  ? -14.455 -4.853   31.881  1.00 77.74  ? 284  VAL A O     1 
ATOM   2268  C  CB    . VAL A 1 280  ? -17.445 -5.173   33.378  1.00 70.41  ? 284  VAL A CB    1 
ATOM   2269  C  CG1   . VAL A 1 280  ? -17.465 -3.813   32.693  1.00 73.06  ? 284  VAL A CG1   1 
ATOM   2270  C  CG2   . VAL A 1 280  ? -18.797 -5.866   33.227  1.00 71.49  ? 284  VAL A CG2   1 
ATOM   2271  N  N     . THR A 1 281  ? -14.380 -5.476   34.052  1.00 70.35  ? 285  THR A N     1 
ATOM   2272  C  CA    . THR A 1 281  ? -13.114 -4.814   34.294  1.00 81.43  ? 285  THR A CA    1 
ATOM   2273  C  C     . THR A 1 281  ? -12.116 -5.394   33.313  1.00 79.49  ? 285  THR A C     1 
ATOM   2274  O  O     . THR A 1 281  ? -11.463 -4.670   32.545  1.00 84.35  ? 285  THR A O     1 
ATOM   2275  C  CB    . THR A 1 281  ? -12.658 -4.999   35.739  1.00 79.02  ? 285  THR A CB    1 
ATOM   2276  O  OG1   . THR A 1 281  ? -13.585 -4.332   36.602  1.00 95.59  ? 285  THR A OG1   1 
ATOM   2277  C  CG2   . THR A 1 281  ? -11.276 -4.424   35.934  1.00 83.04  ? 285  THR A CG2   1 
ATOM   2278  N  N     . LEU A 1 282  ? -12.101 -6.724   33.284  1.00 72.72  ? 286  LEU A N     1 
ATOM   2279  C  CA    . LEU A 1 282  ? -11.207 -7.487   32.439  1.00 70.19  ? 286  LEU A CA    1 
ATOM   2280  C  C     . LEU A 1 282  ? -11.297 -6.986   31.014  1.00 76.60  ? 286  LEU A C     1 
ATOM   2281  O  O     . LEU A 1 282  ? -10.277 -6.735   30.374  1.00 84.31  ? 286  LEU A O     1 
ATOM   2282  C  CB    . LEU A 1 282  ? -11.553 -8.976   32.511  1.00 63.01  ? 286  LEU A CB    1 
ATOM   2283  C  CG    . LEU A 1 282  ? -10.845 -9.951   31.575  1.00 67.37  ? 286  LEU A CG    1 
ATOM   2284  C  CD1   . LEU A 1 282  ? -9.394  -10.120  31.957  1.00 72.69  ? 286  LEU A CD1   1 
ATOM   2285  C  CD2   . LEU A 1 282  ? -11.557 -11.282  31.575  1.00 62.27  ? 286  LEU A CD2   1 
ATOM   2286  N  N     . PHE A 1 283  ? -12.519 -6.798   30.530  1.00 70.54  ? 287  PHE A N     1 
ATOM   2287  C  CA    . PHE A 1 283  ? -12.684 -6.444   29.130  1.00 82.48  ? 287  PHE A CA    1 
ATOM   2288  C  C     . PHE A 1 283  ? -12.109 -5.047   28.915  1.00 89.19  ? 287  PHE A C     1 
ATOM   2289  O  O     . PHE A 1 283  ? -11.228 -4.838   28.065  1.00 76.18  ? 287  PHE A O     1 
ATOM   2290  C  CB    . PHE A 1 283  ? -14.153 -6.512   28.727  1.00 79.92  ? 287  PHE A CB    1 
ATOM   2291  C  CG    . PHE A 1 283  ? -14.394 -6.287   27.269  1.00 82.28  ? 287  PHE A CG    1 
ATOM   2292  C  CD1   . PHE A 1 283  ? -14.218 -7.307   26.346  1.00 80.31  ? 287  PHE A CD1   1 
ATOM   2293  C  CD2   . PHE A 1 283  ? -14.812 -5.055   26.823  1.00 97.46  ? 287  PHE A CD2   1 
ATOM   2294  C  CE1   . PHE A 1 283  ? -14.456 -7.098   25.010  1.00 79.71  ? 287  PHE A CE1   1 
ATOM   2295  C  CE2   . PHE A 1 283  ? -15.051 -4.837   25.478  1.00 105.32 ? 287  PHE A CE2   1 
ATOM   2296  C  CZ    . PHE A 1 283  ? -14.870 -5.863   24.573  1.00 94.56  ? 287  PHE A CZ    1 
ATOM   2297  N  N     . THR A 1 284  ? -12.548 -4.118   29.763  1.00 91.57  ? 288  THR A N     1 
ATOM   2298  C  CA    . THR A 1 284  ? -12.255 -2.706   29.573  1.00 74.19  ? 288  THR A CA    1 
ATOM   2299  C  C     . THR A 1 284  ? -10.752 -2.512   29.517  1.00 75.65  ? 288  THR A C     1 
ATOM   2300  O  O     . THR A 1 284  ? -10.196 -2.019   28.527  1.00 78.14  ? 288  THR A O     1 
ATOM   2301  C  CB    . THR A 1 284  ? -12.869 -1.869   30.694  1.00 84.84  ? 288  THR A CB    1 
ATOM   2302  O  OG1   . THR A 1 284  ? -14.287 -1.800   30.498  1.00 77.97  ? 288  THR A OG1   1 
ATOM   2303  C  CG2   . THR A 1 284  ? -12.296 -0.461   30.688  1.00 112.42 ? 288  THR A CG2   1 
ATOM   2304  N  N     . LEU A 1 285  ? -10.091 -2.981   30.561  1.00 80.09  ? 289  LEU A N     1 
ATOM   2305  C  CA    . LEU A 1 285  ? -8.668  -2.764   30.707  1.00 84.08  ? 289  LEU A CA    1 
ATOM   2306  C  C     . LEU A 1 285  ? -7.937  -3.487   29.589  1.00 77.81  ? 289  LEU A C     1 
ATOM   2307  O  O     . LEU A 1 285  ? -7.003  -2.922   28.999  1.00 80.31  ? 289  LEU A O     1 
ATOM   2308  C  CB    . LEU A 1 285  ? -8.194  -3.219   32.094  1.00 92.12  ? 289  LEU A CB    1 
ATOM   2309  C  CG    . LEU A 1 285  ? -8.435  -2.244   33.260  1.00 96.57  ? 289  LEU A CG    1 
ATOM   2310  C  CD1   . LEU A 1 285  ? -9.822  -1.610   33.243  1.00 97.99  ? 289  LEU A CD1   1 
ATOM   2311  C  CD2   . LEU A 1 285  ? -8.208  -2.943   34.594  1.00 92.72  ? 289  LEU A CD2   1 
ATOM   2312  N  N     . THR A 1 286  ? -8.402  -4.690   29.242  1.00 70.10  ? 290  THR A N     1 
ATOM   2313  C  CA    . THR A 1 286  ? -7.674  -5.461   28.241  1.00 71.14  ? 290  THR A CA    1 
ATOM   2314  C  C     . THR A 1 286  ? -7.744  -4.655   26.950  1.00 79.02  ? 290  THR A C     1 
ATOM   2315  O  O     . THR A 1 286  ? -6.731  -4.458   26.265  1.00 77.44  ? 290  THR A O     1 
ATOM   2316  C  CB    . THR A 1 286  ? -8.235  -6.873   28.039  1.00 66.69  ? 290  THR A CB    1 
ATOM   2317  O  OG1   . THR A 1 286  ? -8.300  -7.543   29.302  1.00 67.96  ? 290  THR A OG1   1 
ATOM   2318  C  CG2   . THR A 1 286  ? -7.338  -7.667   27.097  1.00 66.43  ? 290  THR A CG2   1 
ATOM   2319  N  N     . MET A 1 287  ? -8.928  -4.104   26.685  1.00 79.78  ? 291  MET A N     1 
ATOM   2320  C  CA    . MET A 1 287  ? -9.133  -3.380   25.451  1.00 82.11  ? 291  MET A CA    1 
ATOM   2321  C  C     . MET A 1 287  ? -8.188  -2.203   25.436  1.00 82.51  ? 291  MET A C     1 
ATOM   2322  O  O     . MET A 1 287  ? -7.497  -1.961   24.439  1.00 96.06  ? 291  MET A O     1 
ATOM   2323  C  CB    . MET A 1 287  ? -10.586 -2.922   25.306  1.00 89.18  ? 291  MET A CB    1 
ATOM   2324  C  CG    . MET A 1 287  ? -11.526 -3.994   24.793  1.00 97.94  ? 291  MET A CG    1 
ATOM   2325  S  SD    . MET A 1 287  ? -11.041 -4.624   23.179  1.00 86.58  ? 291  MET A SD    1 
ATOM   2326  C  CE    . MET A 1 287  ? -11.029 -3.104   22.228  1.00 97.44  ? 291  MET A CE    1 
ATOM   2327  N  N     . MET A 1 288  ? -8.113  -1.507   26.566  1.00 88.92  ? 292  MET A N     1 
ATOM   2328  C  CA    . MET A 1 288  ? -7.380  -0.259   26.591  1.00 82.34  ? 292  MET A CA    1 
ATOM   2329  C  C     . MET A 1 288  ? -5.903  -0.549   26.402  1.00 89.93  ? 292  MET A C     1 
ATOM   2330  O  O     . MET A 1 288  ? -5.155  0.311    25.956  1.00 107.69 ? 292  MET A O     1 
ATOM   2331  C  CB    . MET A 1 288  ? -7.625  0.506    27.891  1.00 84.26  ? 292  MET A CB    1 
ATOM   2332  C  CG    . MET A 1 288  ? -6.659  0.175    29.006  1.00 100.19 ? 292  MET A CG    1 
ATOM   2333  S  SD    . MET A 1 288  ? -6.273  1.597    30.054  1.00 102.05 ? 292  MET A SD    1 
ATOM   2334  C  CE    . MET A 1 288  ? -5.187  2.524    28.966  1.00 125.42 ? 292  MET A CE    1 
ATOM   2335  N  N     . GLN A 1 289  ? -5.484  -1.771   26.701  1.00 85.61  ? 293  GLN A N     1 
ATOM   2336  C  CA    . GLN A 1 289  ? -4.077  -2.104   26.537  1.00 79.13  ? 293  GLN A CA    1 
ATOM   2337  C  C     . GLN A 1 289  ? -3.840  -2.534   25.098  1.00 86.63  ? 293  GLN A C     1 
ATOM   2338  O  O     . GLN A 1 289  ? -2.812  -2.207   24.489  1.00 92.44  ? 293  GLN A O     1 
ATOM   2339  C  CB    . GLN A 1 289  ? -3.648  -3.188   27.525  1.00 74.96  ? 293  GLN A CB    1 
ATOM   2340  C  CG    . GLN A 1 289  ? -3.566  -2.682   28.951  1.00 85.73  ? 293  GLN A CG    1 
ATOM   2341  C  CD    . GLN A 1 289  ? -2.638  -1.500   29.092  1.00 96.59  ? 293  GLN A CD    1 
ATOM   2342  O  OE1   . GLN A 1 289  ? -1.430  -1.618   28.904  1.00 100.45 ? 293  GLN A OE1   1 
ATOM   2343  N  NE2   . GLN A 1 289  ? -3.202  -0.346   29.411  1.00 109.53 ? 293  GLN A NE2   1 
ATOM   2344  N  N     . LEU A 1 290  ? -4.823  -3.229   24.537  1.00 94.49  ? 294  LEU A N     1 
ATOM   2345  C  CA    . LEU A 1 290  ? -4.703  -3.740   23.174  1.00 86.76  ? 294  LEU A CA    1 
ATOM   2346  C  C     . LEU A 1 290  ? -4.528  -2.601   22.185  1.00 88.37  ? 294  LEU A C     1 
ATOM   2347  O  O     . LEU A 1 290  ? -3.660  -2.650   21.312  1.00 93.76  ? 294  LEU A O     1 
ATOM   2348  C  CB    . LEU A 1 290  ? -5.925  -4.585   22.809  1.00 77.86  ? 294  LEU A CB    1 
ATOM   2349  C  CG    . LEU A 1 290  ? -5.959  -5.970   23.446  1.00 68.50  ? 294  LEU A CG    1 
ATOM   2350  C  CD1   . LEU A 1 290  ? -7.309  -6.607   23.221  1.00 72.85  ? 294  LEU A CD1   1 
ATOM   2351  C  CD2   . LEU A 1 290  ? -4.834  -6.833   22.902  1.00 67.33  ? 294  LEU A CD2   1 
ATOM   2352  N  N     . LYS A 1 291  ? -5.329  -1.556   22.359  1.00 95.71  ? 295  LYS A N     1 
ATOM   2353  C  CA    . LYS A 1 291  ? -5.302  -0.413   21.457  1.00 88.09  ? 295  LYS A CA    1 
ATOM   2354  C  C     . LYS A 1 291  ? -3.942  0.280    21.446  1.00 94.88  ? 295  LYS A C     1 
ATOM   2355  O  O     . LYS A 1 291  ? -3.644  1.044    20.533  1.00 101.61 ? 295  LYS A O     1 
ATOM   2356  C  CB    . LYS A 1 291  ? -6.403  0.581    21.828  1.00 76.17  ? 295  LYS A CB    1 
ATOM   2357  C  CG    . LYS A 1 291  ? -7.804  0.029    21.626  1.00 76.38  ? 295  LYS A CG    1 
ATOM   2358  C  CD    . LYS A 1 291  ? -8.853  1.110    21.750  1.00 79.50  ? 295  LYS A CD    1 
ATOM   2359  C  CE    . LYS A 1 291  ? -8.821  1.764    23.112  1.00 85.00  ? 295  LYS A CE    1 
ATOM   2360  N  NZ    . LYS A 1 291  ? -9.778  2.908    23.194  1.00 93.44  ? 295  LYS A NZ    1 
ATOM   2361  N  N     . GLN A 1 292  ? -3.108  0.003    22.443  1.00 93.31  ? 296  GLN A N     1 
ATOM   2362  C  CA    . GLN A 1 292  ? -1.792  0.625    22.478  1.00 87.14  ? 296  GLN A CA    1 
ATOM   2363  C  C     . GLN A 1 292  ? -0.809  -0.128   21.591  1.00 90.22  ? 296  GLN A C     1 
ATOM   2364  O  O     . GLN A 1 292  ? 0.068   0.474    20.973  1.00 99.05  ? 296  GLN A O     1 
ATOM   2365  C  CB    . GLN A 1 292  ? -1.265  0.690    23.910  1.00 93.59  ? 296  GLN A CB    1 
ATOM   2366  C  CG    . GLN A 1 292  ? -2.256  1.273    24.902  1.00 117.66 ? 296  GLN A CG    1 
ATOM   2367  C  CD    . GLN A 1 292  ? -2.488  2.758    24.713  1.00 127.12 ? 296  GLN A CD    1 
ATOM   2368  O  OE1   . GLN A 1 292  ? -1.625  3.473    24.205  1.00 139.28 ? 296  GLN A OE1   1 
ATOM   2369  N  NE2   . GLN A 1 292  ? -3.662  3.230    25.123  1.00 127.45 ? 296  GLN A NE2   1 
ATOM   2370  N  N     . MET A 1 293  ? -0.966  -1.447   21.521  1.00 91.28  ? 297  MET A N     1 
ATOM   2371  C  CA    . MET A 1 293  ? 0.001   -2.284   20.816  1.00 84.58  ? 297  MET A CA    1 
ATOM   2372  C  C     . MET A 1 293  ? -0.469  -2.592   19.415  1.00 91.93  ? 297  MET A C     1 
ATOM   2373  O  O     . MET A 1 293  ? 0.330   -2.825   18.516  1.00 101.92 ? 297  MET A O     1 
ATOM   2374  C  CB    . MET A 1 293  ? 0.237   -3.581   21.576  1.00 93.98  ? 297  MET A CB    1 
ATOM   2375  C  CG    . MET A 1 293  ? 0.720   -3.381   23.024  1.00 89.76  ? 297  MET A CG    1 
ATOM   2376  S  SD    . MET A 1 293  ? 0.587   -4.892   23.931  1.00 138.90 ? 297  MET A SD    1 
ATOM   2377  C  CE    . MET A 1 293  ? -1.192  -5.084   24.007  1.00 112.43 ? 297  MET A CE    1 
ATOM   2378  N  N     . LEU A 1 294  ? -1.783  -2.586   19.240  1.00 94.43  ? 298  LEU A N     1 
ATOM   2379  C  CA    . LEU A 1 294  ? -2.379  -2.772   17.928  1.00 85.36  ? 298  LEU A CA    1 
ATOM   2380  C  C     . LEU A 1 294  ? -3.452  -1.721   17.687  1.00 88.78  ? 298  LEU A C     1 
ATOM   2381  O  O     . LEU A 1 294  ? -4.640  -2.013   17.784  1.00 95.63  ? 298  LEU A O     1 
ATOM   2382  C  CB    . LEU A 1 294  ? -2.971  -4.173   17.801  1.00 86.45  ? 298  LEU A CB    1 
ATOM   2383  C  CG    . LEU A 1 294  ? -3.099  -4.694   16.370  1.00 85.66  ? 298  LEU A CG    1 
ATOM   2384  C  CD1   . LEU A 1 294  ? -1.725  -4.820   15.741  1.00 73.06  ? 298  LEU A CD1   1 
ATOM   2385  C  CD2   . LEU A 1 294  ? -3.820  -6.016   16.342  1.00 95.62  ? 298  LEU A CD2   1 
ATOM   2386  N  N     . PRO A 1 295  ? -3.028  -0.483   17.382  1.00 90.84  ? 299  PRO A N     1 
ATOM   2387  C  CA    . PRO A 1 295  ? -3.959  0.627    17.158  1.00 93.57  ? 299  PRO A CA    1 
ATOM   2388  C  C     . PRO A 1 295  ? -4.979  0.286    16.081  1.00 89.18  ? 299  PRO A C     1 
ATOM   2389  O  O     . PRO A 1 295  ? -4.646  -0.421   15.132  1.00 88.86  ? 299  PRO A O     1 
ATOM   2390  C  CB    . PRO A 1 295  ? -3.041  1.768    16.714  1.00 99.31  ? 299  PRO A CB    1 
ATOM   2391  C  CG    . PRO A 1 295  ? -1.708  1.425    17.302  1.00 93.90  ? 299  PRO A CG    1 
ATOM   2392  C  CD    . PRO A 1 295  ? -1.626  -0.067   17.215  1.00 92.61  ? 299  PRO A CD    1 
ATOM   2393  N  N     . LEU A 1 296  ? -6.205  0.777    16.233  1.00 91.64  ? 300  LEU A N     1 
ATOM   2394  C  CA    . LEU A 1 296  ? -7.284  0.438    15.308  1.00 93.70  ? 300  LEU A CA    1 
ATOM   2395  C  C     . LEU A 1 296  ? -7.085  1.020    13.906  1.00 102.26 ? 300  LEU A C     1 
ATOM   2396  O  O     . LEU A 1 296  ? -7.871  0.760    13.001  1.00 110.58 ? 300  LEU A O     1 
ATOM   2397  C  CB    . LEU A 1 296  ? -8.622  0.902    15.883  1.00 84.05  ? 300  LEU A CB    1 
ATOM   2398  C  CG    . LEU A 1 296  ? -9.078  0.093    17.096  1.00 81.03  ? 300  LEU A CG    1 
ATOM   2399  C  CD1   . LEU A 1 296  ? -10.309 0.718    17.724  1.00 79.95  ? 300  LEU A CD1   1 
ATOM   2400  C  CD2   . LEU A 1 296  ? -9.350  -1.354   16.686  1.00 76.01  ? 300  LEU A CD2   1 
ATOM   2401  N  N     . ASN A 1 297  ? -6.028  1.804    13.737  1.00 104.74 ? 301  ASN A N     1 
ATOM   2402  C  CA    . ASN A 1 297  ? -5.686  2.371    12.443  1.00 106.18 ? 301  ASN A CA    1 
ATOM   2403  C  C     . ASN A 1 297  ? -4.779  1.441    11.648  1.00 104.95 ? 301  ASN A C     1 
ATOM   2404  O  O     . ASN A 1 297  ? -4.313  1.787    10.563  1.00 120.06 ? 301  ASN A O     1 
ATOM   2405  C  CB    . ASN A 1 297  ? -5.019  3.738    12.624  1.00 110.49 ? 301  ASN A CB    1 
ATOM   2406  C  CG    . ASN A 1 297  ? -3.807  3.688    13.538  1.00 113.84 ? 301  ASN A CG    1 
ATOM   2407  O  OD1   . ASN A 1 297  ? -2.889  2.894    13.332  1.00 123.64 ? 301  ASN A OD1   1 
ATOM   2408  N  ND2   . ASN A 1 297  ? -3.806  4.533    14.567  1.00 111.99 ? 301  ASN A ND2   1 
ATOM   2409  N  N     . THR A 1 298  ? -4.537  0.256    12.195  1.00 88.37  ? 302  THR A N     1 
ATOM   2410  C  CA    . THR A 1 298  ? -3.610  -0.695   11.589  1.00 100.35 ? 302  THR A CA    1 
ATOM   2411  C  C     . THR A 1 298  ? -4.275  -1.563   10.524  1.00 101.52 ? 302  THR A C     1 
ATOM   2412  O  O     . THR A 1 298  ? -5.409  -2.020   10.692  1.00 100.05 ? 302  THR A O     1 
ATOM   2413  C  CB    . THR A 1 298  ? -2.982  -1.628   12.657  1.00 83.51  ? 302  THR A CB    1 
ATOM   2414  O  OG1   . THR A 1 298  ? -2.448  -0.844   13.730  1.00 92.26  ? 302  THR A OG1   1 
ATOM   2415  C  CG2   . THR A 1 298  ? -1.873  -2.481   12.055  1.00 84.26  ? 302  THR A CG2   1 
ATOM   2416  N  N     . ASN A 1 299  ? -3.569  -1.772   9.417   1.00 97.98  ? 303  ASN A N     1 
ATOM   2417  C  CA    . ASN A 1 299  ? -3.949  -2.799   8.460   1.00 104.96 ? 303  ASN A CA    1 
ATOM   2418  C  C     . ASN A 1 299  ? -3.505  -4.141   9.033   1.00 109.72 ? 303  ASN A C     1 
ATOM   2419  O  O     . ASN A 1 299  ? -2.361  -4.558   8.841   1.00 116.08 ? 303  ASN A O     1 
ATOM   2420  C  CB    . ASN A 1 299  ? -3.313  -2.544   7.090   1.00 102.55 ? 303  ASN A CB    1 
ATOM   2421  C  CG    . ASN A 1 299  ? -3.793  -3.511   6.023   1.00 107.14 ? 303  ASN A CG    1 
ATOM   2422  O  OD1   . ASN A 1 299  ? -4.133  -4.658   6.307   1.00 113.32 ? 303  ASN A OD1   1 
ATOM   2423  N  ND2   . ASN A 1 299  ? -3.811  -3.050   4.780   1.00 118.64 ? 303  ASN A ND2   1 
ATOM   2424  N  N     . ILE A 1 300  ? -4.410  -4.812   9.738   1.00 97.43  ? 304  ILE A N     1 
ATOM   2425  C  CA    . ILE A 1 300  ? -4.072  -6.057   10.410  1.00 88.95  ? 304  ILE A CA    1 
ATOM   2426  C  C     . ILE A 1 300  ? -3.766  -7.150   9.393   1.00 84.02  ? 304  ILE A C     1 
ATOM   2427  O  O     . ILE A 1 300  ? -2.989  -8.067   9.677   1.00 87.14  ? 304  ILE A O     1 
ATOM   2428  C  CB    . ILE A 1 300  ? -5.204  -6.507   11.361  1.00 83.34  ? 304  ILE A CB    1 
ATOM   2429  C  CG1   . ILE A 1 300  ? -5.570  -5.362   12.314  1.00 89.06  ? 304  ILE A CG1   1 
ATOM   2430  C  CG2   . ILE A 1 300  ? -4.792  -7.741   12.152  1.00 79.12  ? 304  ILE A CG2   1 
ATOM   2431  C  CD1   . ILE A 1 300  ? -6.231  -5.805   13.599  1.00 84.97  ? 304  ILE A CD1   1 
ATOM   2432  N  N     . ARG A 1 301  ? -4.365  -7.043   8.210   1.00 72.95  ? 305  ARG A N     1 
ATOM   2433  C  CA    . ARG A 1 301  ? -4.077  -7.983   7.134   1.00 79.73  ? 305  ARG A CA    1 
ATOM   2434  C  C     . ARG A 1 301  ? -2.602  -7.904   6.722   1.00 87.61  ? 305  ARG A C     1 
ATOM   2435  O  O     . ARG A 1 301  ? -1.908  -8.927   6.605   1.00 88.41  ? 305  ARG A O     1 
ATOM   2436  C  CB    . ARG A 1 301  ? -4.991  -7.709   5.944   1.00 86.57  ? 305  ARG A CB    1 
ATOM   2437  C  CG    . ARG A 1 301  ? -4.644  -8.473   4.691   1.00 89.91  ? 305  ARG A CG    1 
ATOM   2438  C  CD    . ARG A 1 301  ? -5.477  -8.004   3.515   1.00 98.88  ? 305  ARG A CD    1 
ATOM   2439  N  NE    . ARG A 1 301  ? -4.747  -8.152   2.262   1.00 108.54 ? 305  ARG A NE    1 
ATOM   2440  C  CZ    . ARG A 1 301  ? -4.103  -7.155   1.657   1.00 123.40 ? 305  ARG A CZ    1 
ATOM   2441  N  NH1   . ARG A 1 301  ? -3.459  -7.377   0.514   1.00 137.36 ? 305  ARG A NH1   1 
ATOM   2442  N  NH2   . ARG A 1 301  ? -4.106  -5.927   2.188   1.00 119.21 ? 305  ARG A NH2   1 
ATOM   2443  N  N     . LEU A 1 302  ? -2.125  -6.680   6.526   1.00 85.78  ? 306  LEU A N     1 
ATOM   2444  C  CA    . LEU A 1 302  ? -0.727  -6.448   6.185   1.00 96.01  ? 306  LEU A CA    1 
ATOM   2445  C  C     . LEU A 1 302  ? 0.178   -6.671   7.382   1.00 92.62  ? 306  LEU A C     1 
ATOM   2446  O  O     . LEU A 1 302  ? 1.249   -7.259   7.258   1.00 98.95  ? 306  LEU A O     1 
ATOM   2447  C  CB    . LEU A 1 302  ? -0.530  -5.030   5.642   1.00 107.56 ? 306  LEU A CB    1 
ATOM   2448  C  CG    . LEU A 1 302  ? -0.881  -4.799   4.173   1.00 98.04  ? 306  LEU A CG    1 
ATOM   2449  C  CD1   . LEU A 1 302  ? -0.573  -3.366   3.786   1.00 104.78 ? 306  LEU A CD1   1 
ATOM   2450  C  CD2   . LEU A 1 302  ? -0.122  -5.781   3.297   1.00 93.94  ? 306  LEU A CD2   1 
ATOM   2451  N  N     . ALA A 1 303  ? -0.258  -6.191   8.542   1.00 94.83  ? 307  ALA A N     1 
ATOM   2452  C  CA    . ALA A 1 303  ? 0.513   -6.336   9.774   1.00 89.59  ? 307  ALA A CA    1 
ATOM   2453  C  C     . ALA A 1 303  ? 0.766   -7.809   10.078  1.00 87.00  ? 307  ALA A C     1 
ATOM   2454  O  O     . ALA A 1 303  ? 1.804   -8.171   10.633  1.00 93.24  ? 307  ALA A O     1 
ATOM   2455  C  CB    . ALA A 1 303  ? -0.200  -5.670   10.933  1.00 98.89  ? 307  ALA A CB    1 
ATOM   2456  N  N     . TYR A 1 304  ? -0.185  -8.654   9.701   1.00 74.35  ? 308  TYR A N     1 
ATOM   2457  C  CA    . TYR A 1 304  ? -0.032  -10.087  9.857   1.00 74.16  ? 308  TYR A CA    1 
ATOM   2458  C  C     . TYR A 1 304  ? 0.850   -10.647  8.763   1.00 86.02  ? 308  TYR A C     1 
ATOM   2459  O  O     . TYR A 1 304  ? 1.743   -11.463  9.042   1.00 77.80  ? 308  TYR A O     1 
ATOM   2460  C  CB    . TYR A 1 304  ? -1.387  -10.790  9.830   1.00 72.05  ? 308  TYR A CB    1 
ATOM   2461  C  CG    . TYR A 1 304  ? -1.295  -12.284  10.027  1.00 68.51  ? 308  TYR A CG    1 
ATOM   2462  C  CD1   . TYR A 1 304  ? -1.216  -12.839  11.302  1.00 81.63  ? 308  TYR A CD1   1 
ATOM   2463  C  CD2   . TYR A 1 304  ? -1.281  -13.138  8.946   1.00 54.01  ? 308  TYR A CD2   1 
ATOM   2464  C  CE1   . TYR A 1 304  ? -1.130  -14.204  11.479  1.00 82.29  ? 308  TYR A CE1   1 
ATOM   2465  C  CE2   . TYR A 1 304  ? -1.197  -14.505  9.112   1.00 72.47  ? 308  TYR A CE2   1 
ATOM   2466  C  CZ    . TYR A 1 304  ? -1.120  -15.034  10.379  1.00 82.88  ? 308  TYR A CZ    1 
ATOM   2467  O  OH    . TYR A 1 304  ? -1.037  -16.396  10.546  1.00 91.11  ? 308  TYR A OH    1 
ATOM   2468  N  N     . SER A 1 305  ? 0.587   -10.219  7.522   1.00 103.18 ? 309  SER A N     1 
ATOM   2469  C  CA    . SER A 1 305  ? 1.300   -10.746  6.354   1.00 95.73  ? 309  SER A CA    1 
ATOM   2470  C  C     . SER A 1 305  ? 2.812   -10.532  6.437   1.00 94.03  ? 309  SER A C     1 
ATOM   2471  O  O     . SER A 1 305  ? 3.588   -11.470  6.278   1.00 92.21  ? 309  SER A O     1 
ATOM   2472  C  CB    . SER A 1 305  ? 0.763   -10.111  5.083   1.00 101.93 ? 309  SER A CB    1 
ATOM   2473  O  OG    . SER A 1 305  ? 1.284   -10.753  3.938   1.00 121.02 ? 309  SER A OG    1 
ATOM   2474  N  N     . ASN A 1 306  ? 3.224   -9.298   6.699   1.00 104.84 ? 310  ASN A N     1 
ATOM   2475  C  CA    . ASN A 1 306  ? 4.641   -8.972   6.807   1.00 118.11 ? 310  ASN A CA    1 
ATOM   2476  C  C     . ASN A 1 306  ? 5.221   -9.409   8.145   1.00 121.58 ? 310  ASN A C     1 
ATOM   2477  O  O     . ASN A 1 306  ? 6.384   -9.809   8.226   1.00 120.81 ? 310  ASN A O     1 
ATOM   2478  C  CB    . ASN A 1 306  ? 4.864   -7.466   6.625   1.00 129.24 ? 310  ASN A CB    1 
ATOM   2479  C  CG    . ASN A 1 306  ? 4.079   -6.889   5.454   1.00 135.59 ? 310  ASN A CG    1 
ATOM   2480  O  OD1   . ASN A 1 306  ? 3.858   -7.557   4.443   1.00 133.63 ? 310  ASN A OD1   1 
ATOM   2481  N  ND2   . ASN A 1 306  ? 3.652   -5.638   5.591   1.00 135.51 ? 310  ASN A ND2   1 
ATOM   2482  N  N     . GLY A 1 307  ? 4.390   -9.339   9.183   1.00 117.09 ? 311  GLY A N     1 
ATOM   2483  C  CA    . GLY A 1 307  ? 4.827   -9.496   10.563  1.00 112.44 ? 311  GLY A CA    1 
ATOM   2484  C  C     . GLY A 1 307  ? 5.611   -10.743  10.926  1.00 99.34  ? 311  GLY A C     1 
ATOM   2485  O  O     . GLY A 1 307  ? 5.527   -11.770  10.248  1.00 94.13  ? 311  GLY A O     1 
ATOM   2486  N  N     . LYS A 1 308  ? 6.376   -10.644  12.011  1.00 90.41  ? 312  LYS A N     1 
ATOM   2487  C  CA    . LYS A 1 308  ? 7.165   -11.761  12.504  1.00 95.29  ? 312  LYS A CA    1 
ATOM   2488  C  C     . LYS A 1 308  ? 6.270   -12.737  13.267  1.00 103.28 ? 312  LYS A C     1 
ATOM   2489  O  O     . LYS A 1 308  ? 5.088   -12.458  13.484  1.00 103.30 ? 312  LYS A O     1 
ATOM   2490  C  CB    . LYS A 1 308  ? 8.304   -11.257  13.388  1.00 97.08  ? 312  LYS A CB    1 
ATOM   2491  C  CG    . LYS A 1 308  ? 9.059   -10.080  12.795  1.00 106.21 ? 312  LYS A CG    1 
ATOM   2492  C  CD    . LYS A 1 308  ? 10.409  -9.870   13.465  1.00 120.47 ? 312  LYS A CD    1 
ATOM   2493  C  CE    . LYS A 1 308  ? 11.175  -8.712   12.829  1.00 132.41 ? 312  LYS A CE    1 
ATOM   2494  N  NZ    . LYS A 1 308  ? 10.503  -7.399   13.047  1.00 135.15 ? 312  LYS A NZ    1 
ATOM   2495  N  N     . ASP A 1 309  ? 6.835   -13.875  13.669  1.00 100.87 ? 313  ASP A N     1 
ATOM   2496  C  CA    . ASP A 1 309  ? 6.057   -14.949  14.291  1.00 94.51  ? 313  ASP A CA    1 
ATOM   2497  C  C     . ASP A 1 309  ? 5.288   -14.508  15.536  1.00 87.14  ? 313  ASP A C     1 
ATOM   2498  O  O     . ASP A 1 309  ? 4.133   -14.890  15.714  1.00 73.90  ? 313  ASP A O     1 
ATOM   2499  C  CB    . ASP A 1 309  ? 6.964   -16.130  14.644  1.00 94.99  ? 313  ASP A CB    1 
ATOM   2500  C  CG    . ASP A 1 309  ? 7.111   -17.115  13.498  1.00 119.97 ? 313  ASP A CG    1 
ATOM   2501  O  OD1   . ASP A 1 309  ? 6.193   -17.190  12.652  1.00 133.02 ? 313  ASP A OD1   1 
ATOM   2502  O  OD2   . ASP A 1 309  ? 8.138   -17.825  13.444  1.00 123.01 ? 313  ASP A OD2   1 
ATOM   2503  N  N     . ASP A 1 310  ? 5.919   -13.702  16.387  1.00 86.06  ? 314  ASP A N     1 
ATOM   2504  C  CA    . ASP A 1 310  ? 5.281   -13.268  17.626  1.00 93.81  ? 314  ASP A CA    1 
ATOM   2505  C  C     . ASP A 1 310  ? 4.175   -12.250  17.369  1.00 92.32  ? 314  ASP A C     1 
ATOM   2506  O  O     . ASP A 1 310  ? 3.216   -12.152  18.133  1.00 95.05  ? 314  ASP A O     1 
ATOM   2507  C  CB    . ASP A 1 310  ? 6.315   -12.692  18.594  1.00 113.25 ? 314  ASP A CB    1 
ATOM   2508  C  CG    . ASP A 1 310  ? 7.243   -11.700  17.935  1.00 133.54 ? 314  ASP A CG    1 
ATOM   2509  O  OD1   . ASP A 1 310  ? 7.771   -12.012  16.848  1.00 144.79 ? 314  ASP A OD1   1 
ATOM   2510  O  OD2   . ASP A 1 310  ? 7.444   -10.605  18.505  1.00 141.27 ? 314  ASP A OD2   1 
ATOM   2511  N  N     . GLU A 1 311  ? 4.315   -11.495  16.285  1.00 92.42  ? 315  GLU A N     1 
ATOM   2512  C  CA    . GLU A 1 311  ? 3.295   -10.536  15.870  1.00 92.20  ? 315  GLU A CA    1 
ATOM   2513  C  C     . GLU A 1 311  ? 2.044   -11.280  15.422  1.00 81.16  ? 315  GLU A C     1 
ATOM   2514  O  O     . GLU A 1 311  ? 0.913   -10.961  15.820  1.00 81.01  ? 315  GLU A O     1 
ATOM   2515  C  CB    . GLU A 1 311  ? 3.821   -9.658   14.738  1.00 115.75 ? 315  GLU A CB    1 
ATOM   2516  C  CG    . GLU A 1 311  ? 3.684   -8.166   14.970  1.00 129.34 ? 315  GLU A CG    1 
ATOM   2517  C  CD    . GLU A 1 311  ? 4.249   -7.357   13.819  1.00 145.92 ? 315  GLU A CD    1 
ATOM   2518  O  OE1   . GLU A 1 311  ? 5.313   -7.742   13.286  1.00 149.56 ? 315  GLU A OE1   1 
ATOM   2519  O  OE2   . GLU A 1 311  ? 3.623   -6.345   13.440  1.00 164.32 ? 315  GLU A OE2   1 
ATOM   2520  N  N     . GLN A 1 312  ? 2.270   -12.289  14.589  1.00 76.15  ? 316  GLN A N     1 
ATOM   2521  C  CA    . GLN A 1 312  ? 1.210   -13.154  14.097  1.00 74.58  ? 316  GLN A CA    1 
ATOM   2522  C  C     . GLN A 1 312  ? 0.514   -13.855  15.246  1.00 71.66  ? 316  GLN A C     1 
ATOM   2523  O  O     . GLN A 1 312  ? -0.723  -13.881  15.331  1.00 81.65  ? 316  GLN A O     1 
ATOM   2524  C  CB    . GLN A 1 312  ? 1.782   -14.177  13.114  1.00 72.84  ? 316  GLN A CB    1 
ATOM   2525  C  CG    . GLN A 1 312  ? 2.424   -13.555  11.893  1.00 78.63  ? 316  GLN A CG    1 
ATOM   2526  C  CD    . GLN A 1 312  ? 2.822   -14.582  10.856  1.00 82.85  ? 316  GLN A CD    1 
ATOM   2527  O  OE1   . GLN A 1 312  ? 3.379   -15.630  11.182  1.00 85.96  ? 316  GLN A OE1   1 
ATOM   2528  N  NE2   . GLN A 1 312  ? 2.533   -14.288  9.594   1.00 87.83  ? 316  GLN A NE2   1 
ATOM   2529  N  N     . ASN A 1 313  ? 1.327   -14.418  16.133  1.00 75.68  ? 317  ASN A N     1 
ATOM   2530  C  CA    . ASN A 1 313  ? 0.826   -15.068  17.334  1.00 74.45  ? 317  ASN A CA    1 
ATOM   2531  C  C     . ASN A 1 313  ? -0.026  -14.113  18.156  1.00 74.36  ? 317  ASN A C     1 
ATOM   2532  O  O     . ASN A 1 313  ? -1.068  -14.497  18.668  1.00 71.56  ? 317  ASN A O     1 
ATOM   2533  C  CB    . ASN A 1 313  ? 1.979   -15.605  18.177  1.00 78.83  ? 317  ASN A CB    1 
ATOM   2534  C  CG    . ASN A 1 313  ? 2.580   -16.870  17.604  1.00 80.92  ? 317  ASN A CG    1 
ATOM   2535  O  OD1   . ASN A 1 313  ? 1.938   -17.572  16.833  1.00 84.43  ? 317  ASN A OD1   1 
ATOM   2536  N  ND2   . ASN A 1 313  ? 3.815   -17.169  17.987  1.00 82.97  ? 317  ASN A ND2   1 
ATOM   2537  N  N     . PHE A 1 314  ? 0.405   -12.860  18.257  1.00 77.31  ? 318  PHE A N     1 
ATOM   2538  C  CA    . PHE A 1 314  ? -0.351  -11.891  19.029  1.00 76.08  ? 318  PHE A CA    1 
ATOM   2539  C  C     . PHE A 1 314  ? -1.695  -11.586  18.379  1.00 72.05  ? 318  PHE A C     1 
ATOM   2540  O  O     . PHE A 1 314  ? -2.697  -11.412  19.079  1.00 79.51  ? 318  PHE A O     1 
ATOM   2541  C  CB    . PHE A 1 314  ? 0.442   -10.602  19.218  1.00 79.20  ? 318  PHE A CB    1 
ATOM   2542  C  CG    . PHE A 1 314  ? -0.241  -9.609   20.116  1.00 84.09  ? 318  PHE A CG    1 
ATOM   2543  C  CD1   . PHE A 1 314  ? -0.265  -9.802   21.489  1.00 91.71  ? 318  PHE A CD1   1 
ATOM   2544  C  CD2   . PHE A 1 314  ? -0.863  -8.490   19.593  1.00 88.77  ? 318  PHE A CD2   1 
ATOM   2545  C  CE1   . PHE A 1 314  ? -0.891  -8.894   22.324  1.00 91.02  ? 318  PHE A CE1   1 
ATOM   2546  C  CE2   . PHE A 1 314  ? -1.493  -7.585   20.418  1.00 84.77  ? 318  PHE A CE2   1 
ATOM   2547  C  CZ    . PHE A 1 314  ? -1.506  -7.786   21.785  1.00 87.99  ? 318  PHE A CZ    1 
ATOM   2548  N  N     . ILE A 1 315  ? -1.722  -11.525  17.049  1.00 75.00  ? 319  ILE A N     1 
ATOM   2549  C  CA    . ILE A 1 315  ? -2.981  -11.283  16.338  1.00 69.04  ? 319  ILE A CA    1 
ATOM   2550  C  C     . ILE A 1 315  ? -3.958  -12.444  16.524  1.00 73.91  ? 319  ILE A C     1 
ATOM   2551  O  O     . ILE A 1 315  ? -5.155  -12.241  16.798  1.00 75.21  ? 319  ILE A O     1 
ATOM   2552  C  CB    . ILE A 1 315  ? -2.746  -11.050  14.844  1.00 67.48  ? 319  ILE A CB    1 
ATOM   2553  C  CG1   . ILE A 1 315  ? -2.033  -9.709   14.631  1.00 70.09  ? 319  ILE A CG1   1 
ATOM   2554  C  CG2   . ILE A 1 315  ? -4.066  -11.087  14.082  1.00 62.46  ? 319  ILE A CG2   1 
ATOM   2555  C  CD1   . ILE A 1 315  ? -1.714  -9.410   13.179  1.00 63.14  ? 319  ILE A CD1   1 
ATOM   2556  N  N     . GLN A 1 316  ? -3.444  -13.663  16.393  1.00 74.17  ? 320  GLN A N     1 
ATOM   2557  C  CA    . GLN A 1 316  ? -4.271  -14.845  16.616  1.00 72.27  ? 320  GLN A CA    1 
ATOM   2558  C  C     . GLN A 1 316  ? -4.798  -14.895  18.047  1.00 72.63  ? 320  GLN A C     1 
ATOM   2559  O  O     . GLN A 1 316  ? -5.994  -15.127  18.260  1.00 71.30  ? 320  GLN A O     1 
ATOM   2560  C  CB    . GLN A 1 316  ? -3.490  -16.117  16.308  1.00 79.34  ? 320  GLN A CB    1 
ATOM   2561  C  CG    . GLN A 1 316  ? -4.326  -17.387  16.402  1.00 76.21  ? 320  GLN A CG    1 
ATOM   2562  C  CD    . GLN A 1 316  ? -3.566  -18.614  15.948  1.00 81.39  ? 320  GLN A CD    1 
ATOM   2563  O  OE1   . GLN A 1 316  ? -2.390  -18.783  16.269  1.00 90.11  ? 320  GLN A OE1   1 
ATOM   2564  N  NE2   . GLN A 1 316  ? -4.233  -19.477  15.194  1.00 83.62  ? 320  GLN A NE2   1 
ATOM   2565  N  N     . ASN A 1 317  ? -3.904  -14.663  19.011  1.00 67.81  ? 321  ASN A N     1 
ATOM   2566  C  CA    . ASN A 1 317  ? -4.258  -14.663  20.425  1.00 67.63  ? 321  ASN A CA    1 
ATOM   2567  C  C     . ASN A 1 317  ? -5.313  -13.604  20.715  1.00 78.10  ? 321  ASN A C     1 
ATOM   2568  O  O     . ASN A 1 317  ? -6.195  -13.806  21.562  1.00 89.59  ? 321  ASN A O     1 
ATOM   2569  C  CB    . ASN A 1 317  ? -3.022  -14.426  21.299  1.00 66.28  ? 321  ASN A CB    1 
ATOM   2570  C  CG    . ASN A 1 317  ? -2.023  -15.562  21.226  1.00 72.14  ? 321  ASN A CG    1 
ATOM   2571  O  OD1   . ASN A 1 317  ? -2.271  -16.585  20.591  1.00 88.51  ? 321  ASN A OD1   1 
ATOM   2572  N  ND2   . ASN A 1 317  ? -0.874  -15.377  21.862  1.00 67.90  ? 321  ASN A ND2   1 
ATOM   2573  N  N     . LEU A 1 318  ? -5.205  -12.477  20.015  1.00 63.50  ? 322  LEU A N     1 
ATOM   2574  C  CA    . LEU A 1 318  ? -6.170  -11.401  20.128  1.00 56.92  ? 322  LEU A CA    1 
ATOM   2575  C  C     . LEU A 1 318  ? -7.547  -11.859  19.664  1.00 66.60  ? 322  LEU A C     1 
ATOM   2576  O  O     . LEU A 1 318  ? -8.553  -11.657  20.361  1.00 66.33  ? 322  LEU A O     1 
ATOM   2577  C  CB    . LEU A 1 318  ? -5.712  -10.196  19.313  1.00 67.11  ? 322  LEU A CB    1 
ATOM   2578  C  CG    . LEU A 1 318  ? -6.765  -9.127   18.992  1.00 72.15  ? 322  LEU A CG    1 
ATOM   2579  C  CD1   . LEU A 1 318  ? -7.281  -8.501   20.281  1.00 78.86  ? 322  LEU A CD1   1 
ATOM   2580  C  CD2   . LEU A 1 318  ? -6.188  -8.074   18.086  1.00 57.58  ? 322  LEU A CD2   1 
ATOM   2581  N  N     . SER A 1 319  ? -7.587  -12.473  18.482  1.00 68.63  ? 323  SER A N     1 
ATOM   2582  C  CA    . SER A 1 319  ? -8.841  -12.987  17.943  1.00 72.07  ? 323  SER A CA    1 
ATOM   2583  C  C     . SER A 1 319  ? -9.455  -13.998  18.908  1.00 73.31  ? 323  SER A C     1 
ATOM   2584  O  O     . SER A 1 319  ? -10.668 -14.029  19.110  1.00 70.15  ? 323  SER A O     1 
ATOM   2585  C  CB    . SER A 1 319  ? -8.623  -13.629  16.574  1.00 76.18  ? 323  SER A CB    1 
ATOM   2586  O  OG    . SER A 1 319  ? -7.807  -14.780  16.680  1.00 89.23  ? 323  SER A OG    1 
ATOM   2587  N  N     . LEU A 1 320  ? -8.603  -14.821  19.510  1.00 74.39  ? 324  LEU A N     1 
ATOM   2588  C  CA    . LEU A 1 320  ? -9.055  -15.804  20.493  1.00 70.02  ? 324  LEU A CA    1 
ATOM   2589  C  C     . LEU A 1 320  ? -9.675  -15.124  21.705  1.00 66.59  ? 324  LEU A C     1 
ATOM   2590  O  O     . LEU A 1 320  ? -10.772 -15.497  22.128  1.00 61.85  ? 324  LEU A O     1 
ATOM   2591  C  CB    . LEU A 1 320  ? -7.899  -16.711  20.928  1.00 65.75  ? 324  LEU A CB    1 
ATOM   2592  C  CG    . LEU A 1 320  ? -7.420  -17.739  19.895  1.00 57.84  ? 324  LEU A CG    1 
ATOM   2593  C  CD1   . LEU A 1 320  ? -6.154  -18.439  20.350  1.00 56.16  ? 324  LEU A CD1   1 
ATOM   2594  C  CD2   . LEU A 1 320  ? -8.518  -18.742  19.606  1.00 56.39  ? 324  LEU A CD2   1 
ATOM   2595  N  N     . PHE A 1 321  ? -8.982  -14.125  22.248  1.00 62.97  ? 325  PHE A N     1 
ATOM   2596  C  CA    . PHE A 1 321  ? -9.483  -13.401  23.409  1.00 62.40  ? 325  PHE A CA    1 
ATOM   2597  C  C     . PHE A 1 321  ? -10.839 -12.763  23.148  1.00 66.23  ? 325  PHE A C     1 
ATOM   2598  O  O     . PHE A 1 321  ? -11.789 -12.939  23.928  1.00 66.87  ? 325  PHE A O     1 
ATOM   2599  C  CB    . PHE A 1 321  ? -8.504  -12.319  23.846  1.00 70.29  ? 325  PHE A CB    1 
ATOM   2600  C  CG    . PHE A 1 321  ? -9.047  -11.431  24.937  1.00 77.14  ? 325  PHE A CG    1 
ATOM   2601  C  CD1   . PHE A 1 321  ? -9.079  -11.867  26.254  1.00 68.54  ? 325  PHE A CD1   1 
ATOM   2602  C  CD2   . PHE A 1 321  ? -9.545  -10.170  24.642  1.00 76.85  ? 325  PHE A CD2   1 
ATOM   2603  C  CE1   . PHE A 1 321  ? -9.591  -11.068  27.249  1.00 64.76  ? 325  PHE A CE1   1 
ATOM   2604  C  CE2   . PHE A 1 321  ? -10.050 -9.362   25.635  1.00 78.54  ? 325  PHE A CE2   1 
ATOM   2605  C  CZ    . PHE A 1 321  ? -10.078 -9.819   26.942  1.00 82.44  ? 325  PHE A CZ    1 
ATOM   2606  N  N     . LEU A 1 322  ? -10.931 -12.022  22.049  1.00 62.79  ? 326  LEU A N     1 
ATOM   2607  C  CA    . LEU A 1 322  ? -12.174 -11.329  21.732  1.00 64.74  ? 326  LEU A CA    1 
ATOM   2608  C  C     . LEU A 1 322  ? -13.312 -12.301  21.437  1.00 66.64  ? 326  LEU A C     1 
ATOM   2609  O  O     . LEU A 1 322  ? -14.436 -12.101  21.892  1.00 69.10  ? 326  LEU A O     1 
ATOM   2610  C  CB    . LEU A 1 322  ? -11.968 -10.377  20.559  1.00 67.10  ? 326  LEU A CB    1 
ATOM   2611  C  CG    . LEU A 1 322  ? -11.049 -9.184   20.847  1.00 72.31  ? 326  LEU A CG    1 
ATOM   2612  C  CD1   . LEU A 1 322  ? -10.875 -8.339   19.607  1.00 79.91  ? 326  LEU A CD1   1 
ATOM   2613  C  CD2   . LEU A 1 322  ? -11.590 -8.347   21.997  1.00 59.93  ? 326  LEU A CD2   1 
ATOM   2614  N  N     . CYS A 1 323  ? -13.013 -13.367  20.702  1.00 64.15  ? 327  CYS A N     1 
ATOM   2615  C  CA    . CYS A 1 323  ? -14.033 -14.351  20.359  1.00 65.64  ? 327  CYS A CA    1 
ATOM   2616  C  C     . CYS A 1 323  ? -14.561 -15.034  21.612  1.00 64.25  ? 327  CYS A C     1 
ATOM   2617  O  O     . CYS A 1 323  ? -15.780 -15.083  21.839  1.00 60.15  ? 327  CYS A O     1 
ATOM   2618  C  CB    . CYS A 1 323  ? -13.482 -15.390  19.370  1.00 67.96  ? 327  CYS A CB    1 
ATOM   2619  S  SG    . CYS A 1 323  ? -14.673 -16.670  18.890  1.00 86.09  ? 327  CYS A SG    1 
ATOM   2620  N  N     . THR A 1 324  ? -13.635 -15.551  22.417  1.00 62.39  ? 328  THR A N     1 
ATOM   2621  C  CA    . THR A 1 324  ? -13.965 -16.200  23.683  1.00 63.25  ? 328  THR A CA    1 
ATOM   2622  C  C     . THR A 1 324  ? -14.822 -15.312  24.574  1.00 70.42  ? 328  THR A C     1 
ATOM   2623  O  O     . THR A 1 324  ? -15.951 -15.678  24.954  1.00 76.14  ? 328  THR A O     1 
ATOM   2624  C  CB    . THR A 1 324  ? -12.708 -16.567  24.476  1.00 63.04  ? 328  THR A CB    1 
ATOM   2625  O  OG1   . THR A 1 324  ? -11.886 -17.449  23.709  1.00 71.27  ? 328  THR A OG1   1 
ATOM   2626  C  CG2   . THR A 1 324  ? -13.087 -17.235  25.782  1.00 70.88  ? 328  THR A CG2   1 
ATOM   2627  N  N     . PHE A 1 325  ? -14.274 -14.139  24.897  1.00 69.54  ? 329  PHE A N     1 
ATOM   2628  C  CA    . PHE A 1 325  ? -14.935 -13.234  25.817  1.00 68.86  ? 329  PHE A CA    1 
ATOM   2629  C  C     . PHE A 1 325  ? -16.301 -12.830  25.297  1.00 69.81  ? 329  PHE A C     1 
ATOM   2630  O  O     . PHE A 1 325  ? -17.263 -12.827  26.057  1.00 77.91  ? 329  PHE A O     1 
ATOM   2631  C  CB    . PHE A 1 325  ? -14.098 -11.986  26.080  1.00 68.23  ? 329  PHE A CB    1 
ATOM   2632  C  CG    . PHE A 1 325  ? -14.659 -11.112  27.169  1.00 78.87  ? 329  PHE A CG    1 
ATOM   2633  C  CD1   . PHE A 1 325  ? -14.113 -11.131  28.436  1.00 97.79  ? 329  PHE A CD1   1 
ATOM   2634  C  CD2   . PHE A 1 325  ? -15.746 -10.282  26.930  1.00 79.23  ? 329  PHE A CD2   1 
ATOM   2635  C  CE1   . PHE A 1 325  ? -14.636 -10.335  29.444  1.00 100.41 ? 329  PHE A CE1   1 
ATOM   2636  C  CE2   . PHE A 1 325  ? -16.272 -9.495   27.928  1.00 84.11  ? 329  PHE A CE2   1 
ATOM   2637  C  CZ    . PHE A 1 325  ? -15.716 -9.517   29.185  1.00 93.12  ? 329  PHE A CZ    1 
ATOM   2638  N  N     . LEU A 1 326  ? -16.395 -12.468  24.023  1.00 61.82  ? 330  LEU A N     1 
ATOM   2639  C  CA    . LEU A 1 326  ? -17.668 -11.999  23.501  1.00 66.32  ? 330  LEU A CA    1 
ATOM   2640  C  C     . LEU A 1 326  ? -18.704 -13.114  23.496  1.00 73.19  ? 330  LEU A C     1 
ATOM   2641  O  O     . LEU A 1 326  ? -19.859 -12.879  23.849  1.00 72.23  ? 330  LEU A O     1 
ATOM   2642  C  CB    . LEU A 1 326  ? -17.497 -11.423  22.098  1.00 79.33  ? 330  LEU A CB    1 
ATOM   2643  C  CG    . LEU A 1 326  ? -16.862 -10.036  22.039  1.00 79.91  ? 330  LEU A CG    1 
ATOM   2644  C  CD1   . LEU A 1 326  ? -16.754 -9.562   20.607  1.00 85.99  ? 330  LEU A CD1   1 
ATOM   2645  C  CD2   . LEU A 1 326  ? -17.663 -9.061   22.881  1.00 73.02  ? 330  LEU A CD2   1 
ATOM   2646  N  N     . LYS A 1 327  ? -18.293 -14.318  23.099  1.00 78.59  ? 331  LYS A N     1 
ATOM   2647  C  CA    . LYS A 1 327  ? -19.204 -15.461  23.083  1.00 73.85  ? 331  LYS A CA    1 
ATOM   2648  C  C     . LYS A 1 327  ? -19.740 -15.760  24.487  1.00 79.50  ? 331  LYS A C     1 
ATOM   2649  O  O     . LYS A 1 327  ? -20.924 -16.067  24.653  1.00 84.38  ? 331  LYS A O     1 
ATOM   2650  C  CB    . LYS A 1 327  ? -18.519 -16.699  22.514  1.00 69.83  ? 331  LYS A CB    1 
ATOM   2651  C  CG    . LYS A 1 327  ? -18.397 -16.688  21.009  1.00 81.37  ? 331  LYS A CG    1 
ATOM   2652  C  CD    . LYS A 1 327  ? -17.568 -17.859  20.495  1.00 90.11  ? 331  LYS A CD    1 
ATOM   2653  C  CE    . LYS A 1 327  ? -18.238 -19.188  20.799  1.00 105.51 ? 331  LYS A CE    1 
ATOM   2654  N  NZ    . LYS A 1 327  ? -17.451 -20.333  20.252  1.00 115.44 ? 331  LYS A NZ    1 
ATOM   2655  N  N     . GLU A 1 328  ? -18.884 -15.655  25.500  1.00 73.41  ? 332  GLU A N     1 
ATOM   2656  C  CA    . GLU A 1 328  ? -19.314 -16.026  26.840  1.00 83.58  ? 332  GLU A CA    1 
ATOM   2657  C  C     . GLU A 1 328  ? -19.987 -14.885  27.617  1.00 84.30  ? 332  GLU A C     1 
ATOM   2658  O  O     . GLU A 1 328  ? -20.745 -15.141  28.545  1.00 94.53  ? 332  GLU A O     1 
ATOM   2659  C  CB    . GLU A 1 328  ? -18.122 -16.571  27.633  1.00 91.42  ? 332  GLU A CB    1 
ATOM   2660  C  CG    . GLU A 1 328  ? -18.520 -17.435  28.822  1.00 93.73  ? 332  GLU A CG    1 
ATOM   2661  C  CD    . GLU A 1 328  ? -19.187 -18.726  28.397  1.00 110.91 ? 332  GLU A CD    1 
ATOM   2662  O  OE1   . GLU A 1 328  ? -18.535 -19.528  27.692  1.00 123.82 ? 332  GLU A OE1   1 
ATOM   2663  O  OE2   . GLU A 1 328  ? -20.364 -18.933  28.761  1.00 112.87 ? 332  GLU A OE2   1 
ATOM   2664  N  N     . HIS A 1 329  ? -19.720 -13.637  27.242  1.00 82.92  ? 333  HIS A N     1 
ATOM   2665  C  CA    . HIS A 1 329  ? -20.146 -12.491  28.041  1.00 80.56  ? 333  HIS A CA    1 
ATOM   2666  C  C     . HIS A 1 329  ? -20.612 -11.257  27.261  1.00 89.86  ? 333  HIS A C     1 
ATOM   2667  O  O     . HIS A 1 329  ? -20.525 -10.143  27.781  1.00 78.84  ? 333  HIS A O     1 
ATOM   2668  C  CB    . HIS A 1 329  ? -19.008 -12.036  28.952  1.00 82.94  ? 333  HIS A CB    1 
ATOM   2669  C  CG    . HIS A 1 329  ? -18.387 -13.133  29.756  1.00 88.57  ? 333  HIS A CG    1 
ATOM   2670  N  ND1   . HIS A 1 329  ? -17.326 -13.877  29.289  1.00 93.55  ? 333  HIS A ND1   1 
ATOM   2671  C  CD2   . HIS A 1 329  ? -18.656 -13.598  31.000  1.00 82.95  ? 333  HIS A CD2   1 
ATOM   2672  C  CE1   . HIS A 1 329  ? -16.975 -14.762  30.204  1.00 90.99  ? 333  HIS A CE1   1 
ATOM   2673  N  NE2   . HIS A 1 329  ? -17.768 -14.617  31.250  1.00 91.98  ? 333  HIS A NE2   1 
ATOM   2674  N  N     . ASP A 1 330  ? -21.093 -11.427  26.033  1.00 99.87  ? 334  ASP A N     1 
ATOM   2675  C  CA    . ASP A 1 330  ? -21.558 -10.280  25.255  1.00 93.95  ? 334  ASP A CA    1 
ATOM   2676  C  C     . ASP A 1 330  ? -22.666 -9.527   25.988  1.00 91.87  ? 334  ASP A C     1 
ATOM   2677  O  O     . ASP A 1 330  ? -22.663 -8.303   26.041  1.00 98.32  ? 334  ASP A O     1 
ATOM   2678  C  CB    . ASP A 1 330  ? -22.043 -10.714  23.864  1.00 102.81 ? 334  ASP A CB    1 
ATOM   2679  C  CG    . ASP A 1 330  ? -22.868 -11.985  23.897  1.00 113.17 ? 334  ASP A CG    1 
ATOM   2680  O  OD1   . ASP A 1 330  ? -23.302 -12.388  24.996  1.00 128.74 ? 334  ASP A OD1   1 
ATOM   2681  O  OD2   . ASP A 1 330  ? -23.081 -12.579  22.815  1.00 112.23 ? 334  ASP A OD2   1 
ATOM   2682  N  N     . GLN A 1 331  ? -23.595 -10.279  26.567  1.00 86.24  ? 335  GLN A N     1 
ATOM   2683  C  CA    . GLN A 1 331  ? -24.731 -9.725   27.296  1.00 94.89  ? 335  GLN A CA    1 
ATOM   2684  C  C     . GLN A 1 331  ? -24.318 -8.694   28.350  1.00 98.64  ? 335  GLN A C     1 
ATOM   2685  O  O     . GLN A 1 331  ? -24.964 -7.658   28.492  1.00 102.08 ? 335  GLN A O     1 
ATOM   2686  C  CB    . GLN A 1 331  ? -25.516 -10.852  27.975  1.00 110.21 ? 335  GLN A CB    1 
ATOM   2687  C  CG    . GLN A 1 331  ? -25.770 -12.066  27.095  1.00 111.46 ? 335  GLN A CG    1 
ATOM   2688  C  CD    . GLN A 1 331  ? -26.964 -11.895  26.175  1.00 103.53 ? 335  GLN A CD    1 
ATOM   2689  O  OE1   . GLN A 1 331  ? -27.496 -10.795  26.024  1.00 89.42  ? 335  GLN A OE1   1 
ATOM   2690  N  NE2   . GLN A 1 331  ? -27.399 -12.991  25.563  1.00 107.91 ? 335  GLN A NE2   1 
ATOM   2691  N  N     . LEU A 1 332  ? -23.254 -8.994   29.092  1.00 90.98  ? 336  LEU A N     1 
ATOM   2692  C  CA    . LEU A 1 332  ? -22.759 -8.106   30.141  1.00 96.97  ? 336  LEU A CA    1 
ATOM   2693  C  C     . LEU A 1 332  ? -22.477 -6.709   29.616  1.00 109.81 ? 336  LEU A C     1 
ATOM   2694  O  O     . LEU A 1 332  ? -22.922 -5.714   30.195  1.00 121.96 ? 336  LEU A O     1 
ATOM   2695  C  CB    . LEU A 1 332  ? -21.483 -8.667   30.770  1.00 92.27  ? 336  LEU A CB    1 
ATOM   2696  C  CG    . LEU A 1 332  ? -21.579 -9.698   31.892  1.00 95.78  ? 336  LEU A CG    1 
ATOM   2697  C  CD1   . LEU A 1 332  ? -21.990 -11.064  31.351  1.00 115.13 ? 336  LEU A CD1   1 
ATOM   2698  C  CD2   . LEU A 1 332  ? -20.242 -9.786   32.598  1.00 96.48  ? 336  LEU A CD2   1 
ATOM   2699  N  N     . ILE A 1 333  ? -21.731 -6.647   28.517  1.00 107.17 ? 337  ILE A N     1 
ATOM   2700  C  CA    . ILE A 1 333  ? -21.320 -5.375   27.932  1.00 102.31 ? 337  ILE A CA    1 
ATOM   2701  C  C     . ILE A 1 333  ? -22.462 -4.710   27.160  1.00 102.60 ? 337  ILE A C     1 
ATOM   2702  O  O     . ILE A 1 333  ? -22.538 -3.482   27.076  1.00 108.23 ? 337  ILE A O     1 
ATOM   2703  C  CB    . ILE A 1 333  ? -20.116 -5.568   27.008  1.00 92.99  ? 337  ILE A CB    1 
ATOM   2704  C  CG1   . ILE A 1 333  ? -19.013 -6.309   27.752  1.00 90.60  ? 337  ILE A CG1   1 
ATOM   2705  C  CG2   . ILE A 1 333  ? -19.590 -4.233   26.515  1.00 101.60 ? 337  ILE A CG2   1 
ATOM   2706  C  CD1   . ILE A 1 333  ? -17.820 -6.580   26.891  1.00 98.64  ? 337  ILE A CD1   1 
ATOM   2707  N  N     . GLU A 1 334  ? -23.352 -5.525   26.602  1.00 95.40  ? 338  GLU A N     1 
ATOM   2708  C  CA    . GLU A 1 334  ? -24.523 -5.008   25.903  1.00 93.18  ? 338  GLU A CA    1 
ATOM   2709  C  C     . GLU A 1 334  ? -25.378 -4.113   26.801  1.00 104.01 ? 338  GLU A C     1 
ATOM   2710  O  O     . GLU A 1 334  ? -25.869 -3.075   26.364  1.00 102.15 ? 338  GLU A O     1 
ATOM   2711  C  CB    . GLU A 1 334  ? -25.374 -6.157   25.360  1.00 97.33  ? 338  GLU A CB    1 
ATOM   2712  C  CG    . GLU A 1 334  ? -24.791 -6.850   24.133  1.00 96.86  ? 338  GLU A CG    1 
ATOM   2713  C  CD    . GLU A 1 334  ? -25.655 -8.001   23.656  1.00 96.52  ? 338  GLU A CD    1 
ATOM   2714  O  OE1   . GLU A 1 334  ? -26.736 -8.223   24.241  1.00 108.54 ? 338  GLU A OE1   1 
ATOM   2715  O  OE2   . GLU A 1 334  ? -25.255 -8.687   22.698  1.00 99.15  ? 338  GLU A OE2   1 
ATOM   2716  N  N     . LYS A 1 335  ? -25.548 -4.510   28.059  1.00 109.05 ? 339  LYS A N     1 
ATOM   2717  C  CA    . LYS A 1 335  ? -26.410 -3.769   28.972  1.00 118.77 ? 339  LYS A CA    1 
ATOM   2718  C  C     . LYS A 1 335  ? -25.638 -2.722   29.780  1.00 118.76 ? 339  LYS A C     1 
ATOM   2719  O  O     . LYS A 1 335  ? -25.913 -2.500   30.954  1.00 130.30 ? 339  LYS A O     1 
ATOM   2720  C  CB    . LYS A 1 335  ? -27.142 -4.732   29.910  1.00 124.43 ? 339  LYS A CB    1 
ATOM   2721  C  CG    . LYS A 1 335  ? -26.240 -5.650   30.715  1.00 131.50 ? 339  LYS A CG    1 
ATOM   2722  C  CD    . LYS A 1 335  ? -27.059 -6.550   31.627  1.00 138.30 ? 339  LYS A CD    1 
ATOM   2723  C  CE    . LYS A 1 335  ? -26.168 -7.343   32.571  1.00 140.56 ? 339  LYS A CE    1 
ATOM   2724  N  NZ    . LYS A 1 335  ? -25.413 -6.453   33.498  1.00 139.43 ? 339  LYS A NZ    1 
ATOM   2725  N  N     . ARG A 1 336  ? -24.677 -2.076   29.133  1.00 116.80 ? 340  ARG A N     1 
ATOM   2726  C  CA    . ARG A 1 336  ? -23.924 -0.975   29.727  1.00 105.73 ? 340  ARG A CA    1 
ATOM   2727  C  C     . ARG A 1 336  ? -23.559 0.051    28.656  1.00 113.71 ? 340  ARG A C     1 
ATOM   2728  O  O     . ARG A 1 336  ? -22.559 -0.112   27.952  1.00 124.13 ? 340  ARG A O     1 
ATOM   2729  C  CB    . ARG A 1 336  ? -22.658 -1.492   30.410  1.00 94.49  ? 340  ARG A CB    1 
ATOM   2730  C  CG    . ARG A 1 336  ? -22.876 -2.078   31.791  1.00 100.56 ? 340  ARG A CG    1 
ATOM   2731  C  CD    . ARG A 1 336  ? -21.595 -2.694   32.343  1.00 107.37 ? 340  ARG A CD    1 
ATOM   2732  N  NE    . ARG A 1 336  ? -21.718 -3.062   33.752  1.00 113.69 ? 340  ARG A NE    1 
ATOM   2733  C  CZ    . ARG A 1 336  ? -22.236 -4.209   34.179  1.00 108.52 ? 340  ARG A CZ    1 
ATOM   2734  N  NH1   . ARG A 1 336  ? -22.682 -5.106   33.309  1.00 103.49 ? 340  ARG A NH1   1 
ATOM   2735  N  NH2   . ARG A 1 336  ? -22.311 -4.457   35.477  1.00 106.34 ? 340  ARG A NH2   1 
ATOM   2736  N  N     . LEU A 1 337  ? -24.373 1.100    28.535  1.00 113.20 ? 341  LEU A N     1 
ATOM   2737  C  CA    . LEU A 1 337  ? -24.194 2.119    27.497  1.00 103.91 ? 341  LEU A CA    1 
ATOM   2738  C  C     . LEU A 1 337  ? -22.798 2.724    27.560  1.00 94.81  ? 341  LEU A C     1 
ATOM   2739  O  O     . LEU A 1 337  ? -22.160 2.969    26.537  1.00 99.95  ? 341  LEU A O     1 
ATOM   2740  C  CB    . LEU A 1 337  ? -25.251 3.218    27.636  1.00 111.87 ? 341  LEU A CB    1 
ATOM   2741  C  CG    . LEU A 1 337  ? -25.785 3.901    26.371  1.00 119.30 ? 341  LEU A CG    1 
ATOM   2742  C  CD1   . LEU A 1 337  ? -26.957 4.812    26.721  1.00 120.94 ? 341  LEU A CD1   1 
ATOM   2743  C  CD2   . LEU A 1 337  ? -24.705 4.691    25.643  1.00 127.81 ? 341  LEU A CD2   1 
ATOM   2744  N  N     . ASN A 1 338  ? -22.311 2.919    28.777  1.00 96.58  ? 342  ASN A N     1 
ATOM   2745  C  CA    . ASN A 1 338  ? -20.986 3.478    29.012  1.00 101.45 ? 342  ASN A CA    1 
ATOM   2746  C  C     . ASN A 1 338  ? -19.847 2.627    28.453  1.00 99.81  ? 342  ASN A C     1 
ATOM   2747  O  O     . ASN A 1 338  ? -18.681 2.981    28.572  1.00 110.83 ? 342  ASN A O     1 
ATOM   2748  C  CB    . ASN A 1 338  ? -20.781 3.693    30.516  1.00 110.58 ? 342  ASN A CB    1 
ATOM   2749  C  CG    . ASN A 1 338  ? -21.217 2.498    31.340  1.00 117.25 ? 342  ASN A CG    1 
ATOM   2750  O  OD1   . ASN A 1 338  ? -22.412 2.243    31.503  1.00 123.63 ? 342  ASN A OD1   1 
ATOM   2751  N  ND2   . ASN A 1 338  ? -20.249 1.760    31.868  1.00 117.23 ? 342  ASN A ND2   1 
ATOM   2752  N  N     . LEU A 1 339  ? -20.188 1.500    27.847  1.00 91.43  ? 343  LEU A N     1 
ATOM   2753  C  CA    . LEU A 1 339  ? -19.189 0.612    27.268  1.00 105.40 ? 343  LEU A CA    1 
ATOM   2754  C  C     . LEU A 1 339  ? -19.301 0.494    25.739  1.00 111.92 ? 343  LEU A C     1 
ATOM   2755  O  O     . LEU A 1 339  ? -18.515 -0.228   25.117  1.00 103.35 ? 343  LEU A O     1 
ATOM   2756  C  CB    . LEU A 1 339  ? -19.298 -0.778   27.892  1.00 105.96 ? 343  LEU A CB    1 
ATOM   2757  C  CG    . LEU A 1 339  ? -18.939 -0.877   29.372  1.00 98.35  ? 343  LEU A CG    1 
ATOM   2758  C  CD1   . LEU A 1 339  ? -19.034 -2.314   29.837  1.00 102.78 ? 343  LEU A CD1   1 
ATOM   2759  C  CD2   . LEU A 1 339  ? -17.549 -0.327   29.617  1.00 92.13  ? 343  LEU A CD2   1 
ATOM   2760  N  N     . ARG A 1 340  ? -20.266 1.203    25.148  1.00 107.60 ? 344  ARG A N     1 
ATOM   2761  C  CA    . ARG A 1 340  ? -20.495 1.156    23.704  1.00 106.18 ? 344  ARG A CA    1 
ATOM   2762  C  C     . ARG A 1 340  ? -19.208 1.243    22.900  1.00 107.26 ? 344  ARG A C     1 
ATOM   2763  O  O     . ARG A 1 340  ? -18.874 0.321    22.147  1.00 110.14 ? 344  ARG A O     1 
ATOM   2764  C  CB    . ARG A 1 340  ? -21.428 2.282    23.273  1.00 111.12 ? 344  ARG A CB    1 
ATOM   2765  C  CG    . ARG A 1 340  ? -22.891 1.956    23.434  1.00 113.67 ? 344  ARG A CG    1 
ATOM   2766  C  CD    . ARG A 1 340  ? -23.224 0.652    22.738  1.00 114.40 ? 344  ARG A CD    1 
ATOM   2767  N  NE    . ARG A 1 340  ? -24.341 -0.009   23.401  1.00 115.91 ? 344  ARG A NE    1 
ATOM   2768  C  CZ    . ARG A 1 340  ? -24.229 -0.691   24.537  1.00 120.28 ? 344  ARG A CZ    1 
ATOM   2769  N  NH1   . ARG A 1 340  ? -23.047 -0.804   25.138  1.00 117.07 ? 344  ARG A NH1   1 
ATOM   2770  N  NH2   . ARG A 1 340  ? -25.298 -1.261   25.076  1.00 128.90 ? 344  ARG A NH2   1 
ATOM   2771  N  N     . GLU A 1 341  ? -18.489 2.350    23.082  1.00 102.05 ? 345  GLU A N     1 
ATOM   2772  C  CA    . GLU A 1 341  ? -17.239 2.602    22.375  1.00 101.71 ? 345  GLU A CA    1 
ATOM   2773  C  C     . GLU A 1 341  ? -16.292 1.409    22.441  1.00 100.85 ? 345  GLU A C     1 
ATOM   2774  O  O     . GLU A 1 341  ? -15.662 1.056    21.444  1.00 88.69  ? 345  GLU A O     1 
ATOM   2775  C  CB    . GLU A 1 341  ? -16.548 3.843    22.940  1.00 106.16 ? 345  GLU A CB    1 
ATOM   2776  C  CG    . GLU A 1 341  ? -16.365 4.970    21.928  1.00 123.90 ? 345  GLU A CG    1 
ATOM   2777  C  CD    . GLU A 1 341  ? -15.537 4.558    20.726  1.00 122.05 ? 345  GLU A CD    1 
ATOM   2778  O  OE1   . GLU A 1 341  ? -14.309 4.393    20.871  1.00 125.37 ? 345  GLU A OE1   1 
ATOM   2779  O  OE2   . GLU A 1 341  ? -16.118 4.395    19.635  1.00 123.72 ? 345  GLU A OE2   1 
ATOM   2780  N  N     . THR A 1 342  ? -16.215 0.774    23.608  1.00 99.38  ? 346  THR A N     1 
ATOM   2781  C  CA    . THR A 1 342  ? -15.336 -0.380   23.771  1.00 95.43  ? 346  THR A CA    1 
ATOM   2782  C  C     . THR A 1 342  ? -15.870 -1.575   22.985  1.00 80.80  ? 346  THR A C     1 
ATOM   2783  O  O     . THR A 1 342  ? -15.126 -2.205   22.229  1.00 80.13  ? 346  THR A O     1 
ATOM   2784  C  CB    . THR A 1 342  ? -15.172 -0.772   25.248  1.00 102.39 ? 346  THR A CB    1 
ATOM   2785  O  OG1   . THR A 1 342  ? -16.397 -1.333   25.736  1.00 115.28 ? 346  THR A OG1   1 
ATOM   2786  C  CG2   . THR A 1 342  ? -14.800 0.451    26.086  1.00 94.44  ? 346  THR A CG2   1 
ATOM   2787  N  N     . LEU A 1 343  ? -17.160 -1.858   23.155  1.00 65.93  ? 347  LEU A N     1 
ATOM   2788  C  CA    . LEU A 1 343  ? -17.816 -2.940   22.434  1.00 70.53  ? 347  LEU A CA    1 
ATOM   2789  C  C     . LEU A 1 343  ? -17.558 -2.800   20.933  1.00 85.81  ? 347  LEU A C     1 
ATOM   2790  O  O     . LEU A 1 343  ? -17.020 -3.724   20.294  1.00 79.08  ? 347  LEU A O     1 
ATOM   2791  C  CB    . LEU A 1 343  ? -19.320 -2.950   22.720  1.00 69.61  ? 347  LEU A CB    1 
ATOM   2792  C  CG    . LEU A 1 343  ? -20.171 -3.898   21.857  1.00 80.59  ? 347  LEU A CG    1 
ATOM   2793  C  CD1   . LEU A 1 343  ? -19.905 -5.354   22.210  1.00 70.60  ? 347  LEU A CD1   1 
ATOM   2794  C  CD2   . LEU A 1 343  ? -21.655 -3.575   21.980  1.00 90.34  ? 347  LEU A CD2   1 
ATOM   2795  N  N     . MET A 1 344  ? -17.917 -1.632   20.397  1.00 83.94  ? 348  MET A N     1 
ATOM   2796  C  CA    . MET A 1 344  ? -17.631 -1.286   19.013  1.00 80.24  ? 348  MET A CA    1 
ATOM   2797  C  C     . MET A 1 344  ? -16.173 -1.571   18.670  1.00 74.55  ? 348  MET A C     1 
ATOM   2798  O  O     . MET A 1 344  ? -15.894 -2.281   17.695  1.00 74.38  ? 348  MET A O     1 
ATOM   2799  C  CB    . MET A 1 344  ? -17.957 0.180    18.749  1.00 80.04  ? 348  MET A CB    1 
ATOM   2800  C  CG    . MET A 1 344  ? -19.443 0.483    18.686  1.00 74.12  ? 348  MET A CG    1 
ATOM   2801  S  SD    . MET A 1 344  ? -20.297 -0.596   17.510  1.00 85.77  ? 348  MET A SD    1 
ATOM   2802  C  CE    . MET A 1 344  ? -21.950 0.082    17.567  1.00 99.68  ? 348  MET A CE    1 
ATOM   2803  N  N     . GLU A 1 345  ? -15.255 -1.046   19.485  1.00 63.21  ? 349  GLU A N     1 
ATOM   2804  C  CA    . GLU A 1 345  ? -13.833 -1.241   19.233  1.00 64.23  ? 349  GLU A CA    1 
ATOM   2805  C  C     . GLU A 1 345  ? -13.549 -2.731   19.069  1.00 81.85  ? 349  GLU A C     1 
ATOM   2806  O  O     . GLU A 1 345  ? -12.918 -3.137   18.089  1.00 81.01  ? 349  GLU A O     1 
ATOM   2807  C  CB    . GLU A 1 345  ? -12.985 -0.649   20.356  1.00 61.55  ? 349  GLU A CB    1 
ATOM   2808  C  CG    . GLU A 1 345  ? -12.838 0.852    20.305  1.00 85.51  ? 349  GLU A CG    1 
ATOM   2809  C  CD    . GLU A 1 345  ? -12.227 1.446    21.562  1.00 98.70  ? 349  GLU A CD    1 
ATOM   2810  O  OE1   . GLU A 1 345  ? -12.045 0.703    22.547  1.00 93.34  ? 349  GLU A OE1   1 
ATOM   2811  O  OE2   . GLU A 1 345  ? -11.923 2.660    21.561  1.00 108.63 ? 349  GLU A OE2   1 
ATOM   2812  N  N     . ALA A 1 346  ? -14.071 -3.539   19.997  1.00 84.89  ? 350  ALA A N     1 
ATOM   2813  C  CA    . ALA A 1 346  ? -13.883 -4.981   19.948  1.00 65.45  ? 350  ALA A CA    1 
ATOM   2814  C  C     . ALA A 1 346  ? -14.341 -5.506   18.600  1.00 64.19  ? 350  ALA A C     1 
ATOM   2815  O  O     . ALA A 1 346  ? -13.571 -6.150   17.882  1.00 62.03  ? 350  ALA A O     1 
ATOM   2816  C  CB    . ALA A 1 346  ? -14.636 -5.655   21.072  1.00 57.37  ? 350  ALA A CB    1 
ATOM   2817  N  N     . LEU A 1 347  ? -15.583 -5.182   18.241  1.00 68.56  ? 351  LEU A N     1 
ATOM   2818  C  CA    . LEU A 1 347  ? -16.139 -5.596   16.955  1.00 73.69  ? 351  LEU A CA    1 
ATOM   2819  C  C     . LEU A 1 347  ? -15.278 -5.078   15.812  1.00 81.46  ? 351  LEU A C     1 
ATOM   2820  O  O     . LEU A 1 347  ? -14.986 -5.805   14.859  1.00 92.81  ? 351  LEU A O     1 
ATOM   2821  C  CB    . LEU A 1 347  ? -17.571 -5.097   16.795  1.00 71.16  ? 351  LEU A CB    1 
ATOM   2822  C  CG    . LEU A 1 347  ? -18.567 -5.620   17.824  1.00 80.81  ? 351  LEU A CG    1 
ATOM   2823  C  CD1   . LEU A 1 347  ? -19.877 -4.859   17.744  1.00 95.99  ? 351  LEU A CD1   1 
ATOM   2824  C  CD2   . LEU A 1 347  ? -18.802 -7.093   17.598  1.00 76.27  ? 351  LEU A CD2   1 
ATOM   2825  N  N     . HIS A 1 348  ? -14.844 -3.827   15.932  1.00 77.75  ? 352  HIS A N     1 
ATOM   2826  C  CA    . HIS A 1 348  ? -14.013 -3.218   14.908  1.00 85.54  ? 352  HIS A CA    1 
ATOM   2827  C  C     . HIS A 1 348  ? -12.757 -4.061   14.764  1.00 85.34  ? 352  HIS A C     1 
ATOM   2828  O  O     . HIS A 1 348  ? -12.381 -4.447   13.644  1.00 78.73  ? 352  HIS A O     1 
ATOM   2829  C  CB    . HIS A 1 348  ? -13.689 -1.764   15.268  1.00 89.19  ? 352  HIS A CB    1 
ATOM   2830  C  CG    . HIS A 1 348  ? -12.814 -1.068   14.275  1.00 88.37  ? 352  HIS A CG    1 
ATOM   2831  N  ND1   . HIS A 1 348  ? -11.754 -0.270   14.651  1.00 85.58  ? 352  HIS A ND1   1 
ATOM   2832  C  CD2   . HIS A 1 348  ? -12.841 -1.042   12.922  1.00 93.88  ? 352  HIS A CD2   1 
ATOM   2833  C  CE1   . HIS A 1 348  ? -11.157 0.204    13.572  1.00 92.76  ? 352  HIS A CE1   1 
ATOM   2834  N  NE2   . HIS A 1 348  ? -11.800 -0.245   12.510  1.00 97.85  ? 352  HIS A NE2   1 
ATOM   2835  N  N     . TYR A 1 349  ? -12.157 -4.402   15.909  1.00 82.58  ? 353  TYR A N     1 
ATOM   2836  C  CA    . TYR A 1 349  ? -10.975 -5.264   15.924  1.00 67.08  ? 353  TYR A CA    1 
ATOM   2837  C  C     . TYR A 1 349  ? -11.264 -6.534   15.147  1.00 64.91  ? 353  TYR A C     1 
ATOM   2838  O  O     . TYR A 1 349  ? -10.501 -6.917   14.258  1.00 69.44  ? 353  TYR A O     1 
ATOM   2839  C  CB    . TYR A 1 349  ? -10.553 -5.611   17.347  1.00 59.82  ? 353  TYR A CB    1 
ATOM   2840  C  CG    . TYR A 1 349  ? -9.383  -4.804   17.853  1.00 67.20  ? 353  TYR A CG    1 
ATOM   2841  C  CD1   . TYR A 1 349  ? -8.161  -4.849   17.198  1.00 70.24  ? 353  TYR A CD1   1 
ATOM   2842  C  CD2   . TYR A 1 349  ? -9.491  -4.013   19.000  1.00 60.14  ? 353  TYR A CD2   1 
ATOM   2843  C  CE1   . TYR A 1 349  ? -7.083  -4.119   17.656  1.00 74.46  ? 353  TYR A CE1   1 
ATOM   2844  C  CE2   . TYR A 1 349  ? -8.420  -3.285   19.458  1.00 70.81  ? 353  TYR A CE2   1 
ATOM   2845  C  CZ    . TYR A 1 349  ? -7.218  -3.341   18.786  1.00 81.10  ? 353  TYR A CZ    1 
ATOM   2846  O  OH    . TYR A 1 349  ? -6.146  -2.608   19.244  1.00 94.98  ? 353  TYR A OH    1 
ATOM   2847  N  N     . MET A 1 350  ? -12.407 -7.146   15.445  1.00 70.96  ? 354  MET A N     1 
ATOM   2848  C  CA    . MET A 1 350  ? -12.773 -8.399   14.811  1.00 70.97  ? 354  MET A CA    1 
ATOM   2849  C  C     . MET A 1 350  ? -12.765 -8.212   13.309  1.00 75.02  ? 354  MET A C     1 
ATOM   2850  O  O     . MET A 1 350  ? -12.136 -8.999   12.584  1.00 77.07  ? 354  MET A O     1 
ATOM   2851  C  CB    . MET A 1 350  ? -14.138 -8.886   15.298  1.00 73.79  ? 354  MET A CB    1 
ATOM   2852  C  CG    . MET A 1 350  ? -14.138 -9.349   16.750  1.00 78.77  ? 354  MET A CG    1 
ATOM   2853  S  SD    . MET A 1 350  ? -12.866 -10.597  17.071  1.00 92.36  ? 354  MET A SD    1 
ATOM   2854  C  CE    . MET A 1 350  ? -13.382 -11.899  15.948  1.00 81.26  ? 354  MET A CE    1 
ATOM   2855  N  N     . LEU A 1 351  ? -13.394 -7.130   12.850  1.00 80.94  ? 355  LEU A N     1 
ATOM   2856  C  CA    . LEU A 1 351  ? -13.495 -6.886   11.417  1.00 78.85  ? 355  LEU A CA    1 
ATOM   2857  C  C     . LEU A 1 351  ? -12.101 -6.791   10.824  1.00 72.72  ? 355  LEU A C     1 
ATOM   2858  O  O     . LEU A 1 351  ? -11.802 -7.435   9.816   1.00 67.82  ? 355  LEU A O     1 
ATOM   2859  C  CB    . LEU A 1 351  ? -14.296 -5.626   11.131  1.00 72.04  ? 355  LEU A CB    1 
ATOM   2860  C  CG    . LEU A 1 351  ? -15.802 -5.788   11.335  1.00 68.79  ? 355  LEU A CG    1 
ATOM   2861  C  CD1   . LEU A 1 351  ? -16.510 -4.451   11.295  1.00 73.88  ? 355  LEU A CD1   1 
ATOM   2862  C  CD2   . LEU A 1 351  ? -16.379 -6.733   10.310  1.00 61.97  ? 355  LEU A CD2   1 
ATOM   2863  N  N     . LEU A 1 352  ? -11.225 -6.052   11.494  1.00 56.29  ? 356  LEU A N     1 
ATOM   2864  C  CA    . LEU A 1 352  ? -9.875  -5.902   10.982  1.00 63.10  ? 356  LEU A CA    1 
ATOM   2865  C  C     . LEU A 1 352  ? -9.223  -7.275   10.902  1.00 77.70  ? 356  LEU A C     1 
ATOM   2866  O  O     . LEU A 1 352  ? -8.675  -7.651   9.866   1.00 79.69  ? 356  LEU A O     1 
ATOM   2867  C  CB    . LEU A 1 352  ? -9.071  -4.936   11.860  1.00 62.68  ? 356  LEU A CB    1 
ATOM   2868  C  CG    . LEU A 1 352  ? -9.457  -3.457   11.725  1.00 60.71  ? 356  LEU A CG    1 
ATOM   2869  C  CD1   . LEU A 1 352  ? -8.625  -2.598   12.640  1.00 51.02  ? 356  LEU A CD1   1 
ATOM   2870  C  CD2   . LEU A 1 352  ? -9.306  -3.013   10.274  1.00 49.73  ? 356  LEU A CD2   1 
ATOM   2871  N  N     . VAL A 1 353  ? -9.364  -8.051   11.974  1.00 86.70  ? 357  VAL A N     1 
ATOM   2872  C  CA    . VAL A 1 353  ? -8.727  -9.361   12.051  1.00 78.39  ? 357  VAL A CA    1 
ATOM   2873  C  C     . VAL A 1 353  ? -9.289  -10.266  10.967  1.00 71.97  ? 357  VAL A C     1 
ATOM   2874  O  O     . VAL A 1 353  ? -8.589  -11.139  10.435  1.00 75.42  ? 357  VAL A O     1 
ATOM   2875  C  CB    . VAL A 1 353  ? -8.919  -10.018  13.448  1.00 73.50  ? 357  VAL A CB    1 
ATOM   2876  C  CG1   . VAL A 1 353  ? -8.327  -11.402  13.476  1.00 72.55  ? 357  VAL A CG1   1 
ATOM   2877  C  CG2   . VAL A 1 353  ? -8.270  -9.165   14.528  1.00 66.58  ? 357  VAL A CG2   1 
ATOM   2878  N  N     . SER A 1 354  ? -10.545 -10.031  10.606  1.00 61.80  ? 358  SER A N     1 
ATOM   2879  C  CA    . SER A 1 354  ? -11.186 -10.887  9.617   1.00 69.68  ? 358  SER A CA    1 
ATOM   2880  C  C     . SER A 1 354  ? -10.552 -10.739  8.234   1.00 74.14  ? 358  SER A C     1 
ATOM   2881  O  O     . SER A 1 354  ? -10.560 -11.668  7.432   1.00 84.04  ? 358  SER A O     1 
ATOM   2882  C  CB    . SER A 1 354  ? -12.677 -10.585  9.534   1.00 62.34  ? 358  SER A CB    1 
ATOM   2883  O  OG    . SER A 1 354  ? -13.261 -10.623  10.824  1.00 63.51  ? 358  SER A OG    1 
ATOM   2884  N  N     . GLU A 1 355  ? -9.973  -9.579   7.952   1.00 77.02  ? 359  GLU A N     1 
ATOM   2885  C  CA    . GLU A 1 355  ? -9.455  -9.362   6.608   1.00 86.28  ? 359  GLU A CA    1 
ATOM   2886  C  C     . GLU A 1 355  ? -8.124  -10.087  6.421   1.00 90.79  ? 359  GLU A C     1 
ATOM   2887  O  O     . GLU A 1 355  ? -7.604  -10.168  5.298   1.00 98.40  ? 359  GLU A O     1 
ATOM   2888  C  CB    . GLU A 1 355  ? -9.311  -7.866   6.312   1.00 87.89  ? 359  GLU A CB    1 
ATOM   2889  C  CG    . GLU A 1 355  ? -10.614 -7.078   6.449   1.00 104.87 ? 359  GLU A CG    1 
ATOM   2890  C  CD    . GLU A 1 355  ? -11.703 -7.510   5.467   1.00 111.96 ? 359  GLU A CD    1 
ATOM   2891  O  OE1   . GLU A 1 355  ? -11.387 -8.163   4.443   1.00 107.10 ? 359  GLU A OE1   1 
ATOM   2892  O  OE2   . GLU A 1 355  ? -12.885 -7.187   5.722   1.00 123.96 ? 359  GLU A OE2   1 
ATOM   2893  N  N     . VAL A 1 356  ? -7.594  -10.626  7.521   1.00 71.03  ? 360  VAL A N     1 
ATOM   2894  C  CA    . VAL A 1 356  ? -6.348  -11.383  7.496   1.00 63.05  ? 360  VAL A CA    1 
ATOM   2895  C  C     . VAL A 1 356  ? -6.482  -12.627  6.622   1.00 67.39  ? 360  VAL A C     1 
ATOM   2896  O  O     . VAL A 1 356  ? -7.431  -13.401  6.760   1.00 69.42  ? 360  VAL A O     1 
ATOM   2897  C  CB    . VAL A 1 356  ? -5.920  -11.788  8.923   1.00 63.15  ? 360  VAL A CB    1 
ATOM   2898  C  CG1   . VAL A 1 356  ? -4.770  -12.795  8.895   1.00 56.02  ? 360  VAL A CG1   1 
ATOM   2899  C  CG2   . VAL A 1 356  ? -5.532  -10.560  9.719   1.00 53.86  ? 360  VAL A CG2   1 
ATOM   2900  N  N     . GLU A 1 357  ? -5.534  -12.808  5.709   1.00 82.87  ? 361  GLU A N     1 
ATOM   2901  C  CA    . GLU A 1 357  ? -5.572  -13.951  4.803   1.00 103.60 ? 361  GLU A CA    1 
ATOM   2902  C  C     . GLU A 1 357  ? -4.857  -15.149  5.422   1.00 106.32 ? 361  GLU A C     1 
ATOM   2903  O  O     . GLU A 1 357  ? -3.686  -15.414  5.142   1.00 119.77 ? 361  GLU A O     1 
ATOM   2904  C  CB    . GLU A 1 357  ? -4.959  -13.583  3.451   1.00 119.70 ? 361  GLU A CB    1 
ATOM   2905  C  CG    . GLU A 1 357  ? -5.771  -12.534  2.700   1.00 133.02 ? 361  GLU A CG    1 
ATOM   2906  C  CD    . GLU A 1 357  ? -5.069  -12.017  1.465   1.00 145.66 ? 361  GLU A CD    1 
ATOM   2907  O  OE1   . GLU A 1 357  ? -4.811  -12.823  0.544   1.00 153.96 ? 361  GLU A OE1   1 
ATOM   2908  O  OE2   . GLU A 1 357  ? -4.773  -10.802  1.420   1.00 145.54 ? 361  GLU A OE2   1 
ATOM   2909  N  N     . GLU A 1 358  ? -5.583  -15.849  6.285   1.00 94.21  ? 362  GLU A N     1 
ATOM   2910  C  CA    . GLU A 1 358  ? -5.092  -17.026  6.975   1.00 78.23  ? 362  GLU A CA    1 
ATOM   2911  C  C     . GLU A 1 358  ? -6.305  -17.770  7.504   1.00 86.83  ? 362  GLU A C     1 
ATOM   2912  O  O     . GLU A 1 358  ? -6.980  -17.294  8.414   1.00 96.36  ? 362  GLU A O     1 
ATOM   2913  C  CB    . GLU A 1 358  ? -4.137  -16.643  8.102   1.00 89.99  ? 362  GLU A CB    1 
ATOM   2914  C  CG    . GLU A 1 358  ? -3.783  -17.786  9.045   1.00 100.45 ? 362  GLU A CG    1 
ATOM   2915  C  CD    . GLU A 1 358  ? -3.043  -18.914  8.357   1.00 119.05 ? 362  GLU A CD    1 
ATOM   2916  O  OE1   . GLU A 1 358  ? -1.946  -18.662  7.814   1.00 129.78 ? 362  GLU A OE1   1 
ATOM   2917  O  OE2   . GLU A 1 358  ? -3.560  -20.052  8.357   1.00 125.69 ? 362  GLU A OE2   1 
ATOM   2918  N  N     . THR A 1 359  ? -6.581  -18.933  6.919   1.00 90.44  ? 363  THR A N     1 
ATOM   2919  C  CA    . THR A 1 359  ? -7.844  -19.638  7.147   1.00 83.80  ? 363  THR A CA    1 
ATOM   2920  C  C     . THR A 1 359  ? -8.130  -19.961  8.615   1.00 82.72  ? 363  THR A C     1 
ATOM   2921  O  O     . THR A 1 359  ? -9.289  -19.977  9.024   1.00 87.88  ? 363  THR A O     1 
ATOM   2922  C  CB    . THR A 1 359  ? -7.904  -20.947  6.338   1.00 73.69  ? 363  THR A CB    1 
ATOM   2923  O  OG1   . THR A 1 359  ? -6.623  -21.582  6.374   1.00 96.86  ? 363  THR A OG1   1 
ATOM   2924  C  CG2   . THR A 1 359  ? -8.268  -20.651  4.903   1.00 74.46  ? 363  THR A CG2   1 
ATOM   2925  N  N     . GLU A 1 360  ? -7.090  -20.216  9.402   1.00 74.32  ? 364  GLU A N     1 
ATOM   2926  C  CA    . GLU A 1 360  ? -7.293  -20.543  10.810  1.00 83.56  ? 364  GLU A CA    1 
ATOM   2927  C  C     . GLU A 1 360  ? -7.861  -19.348  11.572  1.00 83.55  ? 364  GLU A C     1 
ATOM   2928  O  O     . GLU A 1 360  ? -8.890  -19.456  12.265  1.00 88.03  ? 364  GLU A O     1 
ATOM   2929  C  CB    . GLU A 1 360  ? -5.986  -21.009  11.450  1.00 90.01  ? 364  GLU A CB    1 
ATOM   2930  C  CG    . GLU A 1 360  ? -5.510  -22.359  10.934  1.00 91.39  ? 364  GLU A CG    1 
ATOM   2931  C  CD    . GLU A 1 360  ? -6.607  -23.408  10.985  1.00 96.15  ? 364  GLU A CD    1 
ATOM   2932  O  OE1   . GLU A 1 360  ? -7.235  -23.567  12.052  1.00 98.23  ? 364  GLU A OE1   1 
ATOM   2933  O  OE2   . GLU A 1 360  ? -6.850  -24.064  9.951   1.00 99.16  ? 364  GLU A OE2   1 
ATOM   2934  N  N     . ILE A 1 361  ? -7.191  -18.208  11.430  1.00 73.11  ? 365  ILE A N     1 
ATOM   2935  C  CA    . ILE A 1 361  ? -7.652  -16.970  12.031  1.00 69.82  ? 365  ILE A CA    1 
ATOM   2936  C  C     . ILE A 1 361  ? -9.062  -16.615  11.580  1.00 70.86  ? 365  ILE A C     1 
ATOM   2937  O  O     . ILE A 1 361  ? -9.923  -16.229  12.382  1.00 83.01  ? 365  ILE A O     1 
ATOM   2938  C  CB    . ILE A 1 361  ? -6.713  -15.816  11.690  1.00 59.98  ? 365  ILE A CB    1 
ATOM   2939  C  CG1   . ILE A 1 361  ? -5.328  -16.070  12.285  1.00 68.87  ? 365  ILE A CG1   1 
ATOM   2940  C  CG2   . ILE A 1 361  ? -7.263  -14.518  12.235  1.00 56.36  ? 365  ILE A CG2   1 
ATOM   2941  C  CD1   . ILE A 1 361  ? -4.380  -14.929  12.093  1.00 79.15  ? 365  ILE A CD1   1 
ATOM   2942  N  N     . PHE A 1 362  ? -9.305  -16.764  10.286  1.00 60.27  ? 366  PHE A N     1 
ATOM   2943  C  CA    . PHE A 1 362  ? -10.613 -16.438  9.748   1.00 64.64  ? 366  PHE A CA    1 
ATOM   2944  C  C     . PHE A 1 362  ? -11.686 -17.374  10.281  1.00 66.86  ? 366  PHE A C     1 
ATOM   2945  O  O     . PHE A 1 362  ? -12.825 -16.964  10.444  1.00 72.79  ? 366  PHE A O     1 
ATOM   2946  C  CB    . PHE A 1 362  ? -10.603 -16.467  8.208   1.00 64.01  ? 366  PHE A CB    1 
ATOM   2947  C  CG    . PHE A 1 362  ? -11.904 -16.040  7.598   1.00 62.14  ? 366  PHE A CG    1 
ATOM   2948  C  CD1   . PHE A 1 362  ? -12.179 -14.701  7.409   1.00 66.41  ? 366  PHE A CD1   1 
ATOM   2949  C  CD2   . PHE A 1 362  ? -12.864 -16.973  7.254   1.00 67.83  ? 366  PHE A CD2   1 
ATOM   2950  C  CE1   . PHE A 1 362  ? -13.380 -14.300  6.865   1.00 79.40  ? 366  PHE A CE1   1 
ATOM   2951  C  CE2   . PHE A 1 362  ? -14.068 -16.584  6.716   1.00 74.39  ? 366  PHE A CE2   1 
ATOM   2952  C  CZ    . PHE A 1 362  ? -14.329 -15.248  6.516   1.00 81.42  ? 366  PHE A CZ    1 
ATOM   2953  N  N     . LYS A 1 363  ? -11.329 -18.627  10.538  1.00 68.11  ? 367  LYS A N     1 
ATOM   2954  C  CA    . LYS A 1 363  ? -12.284 -19.570  11.123  1.00 74.49  ? 367  LYS A CA    1 
ATOM   2955  C  C     . LYS A 1 363  ? -12.592 -19.160  12.556  1.00 65.74  ? 367  LYS A C     1 
ATOM   2956  O  O     . LYS A 1 363  ? -13.742 -19.224  13.000  1.00 62.28  ? 367  LYS A O     1 
ATOM   2957  C  CB    . LYS A 1 363  ? -11.758 -21.009  11.089  1.00 75.16  ? 367  LYS A CB    1 
ATOM   2958  C  CG    . LYS A 1 363  ? -11.837 -21.683  9.735   1.00 70.13  ? 367  LYS A CG    1 
ATOM   2959  C  CD    . LYS A 1 363  ? -11.407 -23.134  9.813   1.00 73.94  ? 367  LYS A CD    1 
ATOM   2960  C  CE    . LYS A 1 363  ? -10.047 -23.273  10.489  1.00 80.04  ? 367  LYS A CE    1 
ATOM   2961  N  NZ    . LYS A 1 363  ? -9.625  -24.693  10.612  1.00 82.32  ? 367  LYS A NZ    1 
ATOM   2962  N  N     . ILE A 1 364  ? -11.555 -18.722  13.265  1.00 60.07  ? 368  ILE A N     1 
ATOM   2963  C  CA    . ILE A 1 364  ? -11.725 -18.189  14.613  1.00 62.89  ? 368  ILE A CA    1 
ATOM   2964  C  C     . ILE A 1 364  ? -12.713 -17.022  14.629  1.00 66.88  ? 368  ILE A C     1 
ATOM   2965  O  O     . ILE A 1 364  ? -13.616 -16.985  15.469  1.00 67.34  ? 368  ILE A O     1 
ATOM   2966  C  CB    . ILE A 1 364  ? -10.386 -17.731  15.212  1.00 60.56  ? 368  ILE A CB    1 
ATOM   2967  C  CG1   . ILE A 1 364  ? -9.445  -18.924  15.385  1.00 61.18  ? 368  ILE A CG1   1 
ATOM   2968  C  CG2   . ILE A 1 364  ? -10.604 -17.044  16.555  1.00 59.91  ? 368  ILE A CG2   1 
ATOM   2969  C  CD1   . ILE A 1 364  ? -8.060  -18.555  15.875  1.00 56.55  ? 368  ILE A CD1   1 
ATOM   2970  N  N     . CYS A 1 365  ? -12.556 -16.085  13.694  1.00 73.23  ? 369  CYS A N     1 
ATOM   2971  C  CA    . CYS A 1 365  ? -13.464 -14.935  13.606  1.00 65.26  ? 369  CYS A CA    1 
ATOM   2972  C  C     . CYS A 1 365  ? -14.882 -15.326  13.183  1.00 63.32  ? 369  CYS A C     1 
ATOM   2973  O  O     . CYS A 1 365  ? -15.878 -14.880  13.765  1.00 62.02  ? 369  CYS A O     1 
ATOM   2974  C  CB    . CYS A 1 365  ? -12.922 -13.907  12.627  1.00 56.41  ? 369  CYS A CB    1 
ATOM   2975  S  SG    . CYS A 1 365  ? -11.286 -13.277  13.043  1.00 76.98  ? 369  CYS A SG    1 
ATOM   2976  N  N     . LEU A 1 366  ? -14.961 -16.171  12.164  1.00 62.78  ? 370  LEU A N     1 
ATOM   2977  C  CA    . LEU A 1 366  ? -16.233 -16.630  11.625  1.00 66.91  ? 370  LEU A CA    1 
ATOM   2978  C  C     . LEU A 1 366  ? -17.037 -17.382  12.676  1.00 74.12  ? 370  LEU A C     1 
ATOM   2979  O  O     . LEU A 1 366  ? -18.269 -17.378  12.647  1.00 67.43  ? 370  LEU A O     1 
ATOM   2980  C  CB    . LEU A 1 366  ? -15.996 -17.515  10.402  1.00 60.64  ? 370  LEU A CB    1 
ATOM   2981  C  CG    . LEU A 1 366  ? -17.202 -18.226  9.793   1.00 64.83  ? 370  LEU A CG    1 
ATOM   2982  C  CD1   . LEU A 1 366  ? -18.229 -17.231  9.271   1.00 57.29  ? 370  LEU A CD1   1 
ATOM   2983  C  CD2   . LEU A 1 366  ? -16.736 -19.172  8.692   1.00 65.64  ? 370  LEU A CD2   1 
ATOM   2984  N  N     . GLU A 1 367  ? -16.332 -18.024  13.602  1.00 80.10  ? 371  GLU A N     1 
ATOM   2985  C  CA    . GLU A 1 367  ? -16.987 -18.689  14.721  1.00 77.38  ? 371  GLU A CA    1 
ATOM   2986  C  C     . GLU A 1 367  ? -17.836 -17.676  15.473  1.00 73.02  ? 371  GLU A C     1 
ATOM   2987  O  O     . GLU A 1 367  ? -19.039 -17.884  15.696  1.00 80.32  ? 371  GLU A O     1 
ATOM   2988  C  CB    . GLU A 1 367  ? -15.951 -19.330  15.640  1.00 83.11  ? 371  GLU A CB    1 
ATOM   2989  C  CG    . GLU A 1 367  ? -16.501 -20.389  16.573  1.00 93.24  ? 371  GLU A CG    1 
ATOM   2990  C  CD    . GLU A 1 367  ? -15.427 -21.352  17.037  1.00 107.72 ? 371  GLU A CD    1 
ATOM   2991  O  OE1   . GLU A 1 367  ? -14.838 -22.045  16.176  1.00 104.42 ? 371  GLU A OE1   1 
ATOM   2992  O  OE2   . GLU A 1 367  ? -15.168 -21.410  18.260  1.00 115.98 ? 371  GLU A OE2   1 
ATOM   2993  N  N     . TYR A 1 368  ? -17.207 -16.559  15.824  1.00 71.70  ? 372  TYR A N     1 
ATOM   2994  C  CA    . TYR A 1 368  ? -17.896 -15.478  16.513  1.00 66.41  ? 372  TYR A CA    1 
ATOM   2995  C  C     . TYR A 1 368  ? -18.989 -14.835  15.658  1.00 76.74  ? 372  TYR A C     1 
ATOM   2996  O  O     . TYR A 1 368  ? -20.062 -14.512  16.182  1.00 71.04  ? 372  TYR A O     1 
ATOM   2997  C  CB    . TYR A 1 368  ? -16.915 -14.399  16.954  1.00 64.48  ? 372  TYR A CB    1 
ATOM   2998  C  CG    . TYR A 1 368  ? -17.641 -13.160  17.425  1.00 72.91  ? 372  TYR A CG    1 
ATOM   2999  C  CD1   . TYR A 1 368  ? -18.395 -13.186  18.591  1.00 74.58  ? 372  TYR A CD1   1 
ATOM   3000  C  CD2   . TYR A 1 368  ? -17.604 -11.976  16.694  1.00 76.63  ? 372  TYR A CD2   1 
ATOM   3001  C  CE1   . TYR A 1 368  ? -19.077 -12.080  19.019  1.00 73.40  ? 372  TYR A CE1   1 
ATOM   3002  C  CE2   . TYR A 1 368  ? -18.286 -10.860  17.126  1.00 73.73  ? 372  TYR A CE2   1 
ATOM   3003  C  CZ    . TYR A 1 368  ? -19.023 -10.924  18.289  1.00 74.54  ? 372  TYR A CZ    1 
ATOM   3004  O  OH    . TYR A 1 368  ? -19.716 -9.830   18.747  1.00 90.50  ? 372  TYR A OH    1 
ATOM   3005  N  N     . TRP A 1 369  ? -18.724 -14.632  14.362  1.00 70.88  ? 373  TRP A N     1 
ATOM   3006  C  CA    . TRP A 1 369  ? -19.728 -14.008  13.507  1.00 58.37  ? 373  TRP A CA    1 
ATOM   3007  C  C     . TRP A 1 369  ? -20.978 -14.875  13.465  1.00 61.66  ? 373  TRP A C     1 
ATOM   3008  O  O     . TRP A 1 369  ? -22.105 -14.372  13.570  1.00 63.16  ? 373  TRP A O     1 
ATOM   3009  C  CB    . TRP A 1 369  ? -19.205 -13.769  12.089  1.00 69.76  ? 373  TRP A CB    1 
ATOM   3010  C  CG    . TRP A 1 369  ? -18.106 -12.749  11.968  1.00 64.42  ? 373  TRP A CG    1 
ATOM   3011  C  CD1   . TRP A 1 369  ? -16.944 -12.881  11.258  1.00 60.79  ? 373  TRP A CD1   1 
ATOM   3012  C  CD2   . TRP A 1 369  ? -18.057 -11.454  12.572  1.00 59.82  ? 373  TRP A CD2   1 
ATOM   3013  N  NE1   . TRP A 1 369  ? -16.179 -11.751  11.380  1.00 54.39  ? 373  TRP A NE1   1 
ATOM   3014  C  CE2   . TRP A 1 369  ? -16.838 -10.861  12.188  1.00 57.89  ? 373  TRP A CE2   1 
ATOM   3015  C  CE3   . TRP A 1 369  ? -18.917 -10.738  13.408  1.00 64.44  ? 373  TRP A CE3   1 
ATOM   3016  C  CZ2   . TRP A 1 369  ? -16.462 -9.589   12.617  1.00 60.79  ? 373  TRP A CZ2   1 
ATOM   3017  C  CZ3   . TRP A 1 369  ? -18.543 -9.479   13.826  1.00 60.10  ? 373  TRP A CZ3   1 
ATOM   3018  C  CH2   . TRP A 1 369  ? -17.330 -8.917   13.432  1.00 59.16  ? 373  TRP A CH2   1 
ATOM   3019  N  N     . ASN A 1 370  ? -20.773 -16.181  13.333  1.00 61.53  ? 374  ASN A N     1 
ATOM   3020  C  CA    . ASN A 1 370  ? -21.884 -17.120  13.298  1.00 65.64  ? 374  ASN A CA    1 
ATOM   3021  C  C     . ASN A 1 370  ? -22.620 -17.137  14.636  1.00 73.50  ? 374  ASN A C     1 
ATOM   3022  O  O     . ASN A 1 370  ? -23.850 -17.262  14.688  1.00 68.64  ? 374  ASN A O     1 
ATOM   3023  C  CB    . ASN A 1 370  ? -21.406 -18.520  12.946  1.00 61.75  ? 374  ASN A CB    1 
ATOM   3024  C  CG    . ASN A 1 370  ? -22.550 -19.454  12.642  1.00 73.69  ? 374  ASN A CG    1 
ATOM   3025  O  OD1   . ASN A 1 370  ? -23.207 -19.968  13.550  1.00 88.51  ? 374  ASN A OD1   1 
ATOM   3026  N  ND2   . ASN A 1 370  ? -22.797 -19.684  11.359  1.00 68.96  ? 374  ASN A ND2   1 
ATOM   3027  N  N     . HIS A 1 371  ? -21.859 -17.005  15.720  1.00 78.07  ? 375  HIS A N     1 
ATOM   3028  C  CA    . HIS A 1 371  ? -22.467 -16.859  17.037  1.00 87.17  ? 375  HIS A CA    1 
ATOM   3029  C  C     . HIS A 1 371  ? -23.418 -15.663  17.081  1.00 85.42  ? 375  HIS A C     1 
ATOM   3030  O  O     . HIS A 1 371  ? -24.589 -15.802  17.454  1.00 75.04  ? 375  HIS A O     1 
ATOM   3031  C  CB    . HIS A 1 371  ? -21.397 -16.705  18.119  1.00 85.54  ? 375  HIS A CB    1 
ATOM   3032  C  CG    . HIS A 1 371  ? -21.944 -16.270  19.439  1.00 79.12  ? 375  HIS A CG    1 
ATOM   3033  N  ND1   . HIS A 1 371  ? -22.742 -17.081  20.218  1.00 86.70  ? 375  HIS A ND1   1 
ATOM   3034  C  CD2   . HIS A 1 371  ? -21.816 -15.104  20.116  1.00 91.07  ? 375  HIS A CD2   1 
ATOM   3035  C  CE1   . HIS A 1 371  ? -23.075 -16.434  21.321  1.00 102.88 ? 375  HIS A CE1   1 
ATOM   3036  N  NE2   . HIS A 1 371  ? -22.524 -15.234  21.286  1.00 100.37 ? 375  HIS A NE2   1 
ATOM   3037  N  N     . LEU A 1 372  ? -22.906 -14.498  16.685  1.00 85.84  ? 376  LEU A N     1 
ATOM   3038  C  CA    . LEU A 1 372  ? -23.675 -13.256  16.698  1.00 70.78  ? 376  LEU A CA    1 
ATOM   3039  C  C     . LEU A 1 372  ? -24.930 -13.347  15.833  1.00 69.12  ? 376  LEU A C     1 
ATOM   3040  O  O     . LEU A 1 372  ? -26.033 -13.010  16.272  1.00 66.37  ? 376  LEU A O     1 
ATOM   3041  C  CB    . LEU A 1 372  ? -22.802 -12.099  16.230  1.00 68.31  ? 376  LEU A CB    1 
ATOM   3042  C  CG    . LEU A 1 372  ? -23.471 -10.727  16.162  1.00 72.36  ? 376  LEU A CG    1 
ATOM   3043  C  CD1   . LEU A 1 372  ? -24.047 -10.355  17.512  1.00 67.56  ? 376  LEU A CD1   1 
ATOM   3044  C  CD2   . LEU A 1 372  ? -22.479 -9.666   15.682  1.00 68.52  ? 376  LEU A CD2   1 
ATOM   3045  N  N     . ALA A 1 373  ? -24.755 -13.814  14.604  1.00 66.82  ? 377  ALA A N     1 
ATOM   3046  C  CA    . ALA A 1 373  ? -25.865 -13.933  13.669  1.00 68.95  ? 377  ALA A CA    1 
ATOM   3047  C  C     . ALA A 1 373  ? -26.924 -14.893  14.204  1.00 80.54  ? 377  ALA A C     1 
ATOM   3048  O  O     . ALA A 1 373  ? -28.128 -14.635  14.085  1.00 77.53  ? 377  ALA A O     1 
ATOM   3049  C  CB    . ALA A 1 373  ? -25.364 -14.392  12.314  1.00 66.85  ? 377  ALA A CB    1 
ATOM   3050  N  N     . ALA A 1 374  ? -26.467 -15.993  14.806  1.00 85.47  ? 378  ALA A N     1 
ATOM   3051  C  CA    . ALA A 1 374  ? -27.372 -16.976  15.402  1.00 81.47  ? 378  ALA A CA    1 
ATOM   3052  C  C     . ALA A 1 374  ? -28.179 -16.368  16.550  1.00 91.70  ? 378  ALA A C     1 
ATOM   3053  O  O     . ALA A 1 374  ? -29.401 -16.528  16.619  1.00 102.14 ? 378  ALA A O     1 
ATOM   3054  C  CB    . ALA A 1 374  ? -26.601 -18.176  15.886  1.00 73.43  ? 378  ALA A CB    1 
ATOM   3055  N  N     . GLU A 1 375  ? -27.483 -15.673  17.447  1.00 82.36  ? 379  GLU A N     1 
ATOM   3056  C  CA    . GLU A 1 375  ? -28.119 -15.019  18.583  1.00 79.94  ? 379  GLU A CA    1 
ATOM   3057  C  C     . GLU A 1 375  ? -29.187 -14.035  18.124  1.00 84.16  ? 379  GLU A C     1 
ATOM   3058  O  O     . GLU A 1 375  ? -30.341 -14.124  18.539  1.00 88.64  ? 379  GLU A O     1 
ATOM   3059  C  CB    . GLU A 1 375  ? -27.076 -14.297  19.439  1.00 89.45  ? 379  GLU A CB    1 
ATOM   3060  C  CG    . GLU A 1 375  ? -26.080 -15.218  20.130  1.00 105.83 ? 379  GLU A CG    1 
ATOM   3061  C  CD    . GLU A 1 375  ? -26.489 -15.573  21.549  1.00 119.96 ? 379  GLU A CD    1 
ATOM   3062  O  OE1   . GLU A 1 375  ? -26.369 -14.702  22.442  1.00 125.18 ? 379  GLU A OE1   1 
ATOM   3063  O  OE2   . GLU A 1 375  ? -26.927 -16.723  21.771  1.00 119.60 ? 379  GLU A OE2   1 
ATOM   3064  N  N     . LEU A 1 376  ? -28.796 -13.105  17.257  1.00 86.44  ? 380  LEU A N     1 
ATOM   3065  C  CA    . LEU A 1 376  ? -29.722 -12.098  16.750  1.00 81.18  ? 380  LEU A CA    1 
ATOM   3066  C  C     . LEU A 1 376  ? -30.894 -12.740  16.014  1.00 91.84  ? 380  LEU A C     1 
ATOM   3067  O  O     . LEU A 1 376  ? -32.005 -12.205  16.029  1.00 93.69  ? 380  LEU A O     1 
ATOM   3068  C  CB    . LEU A 1 376  ? -29.002 -11.113  15.829  1.00 77.10  ? 380  LEU A CB    1 
ATOM   3069  C  CG    . LEU A 1 376  ? -27.926 -10.228  16.456  1.00 80.64  ? 380  LEU A CG    1 
ATOM   3070  C  CD1   . LEU A 1 376  ? -27.474 -9.159   15.478  1.00 85.13  ? 380  LEU A CD1   1 
ATOM   3071  C  CD2   . LEU A 1 376  ? -28.433 -9.602   17.741  1.00 85.13  ? 380  LEU A CD2   1 
ATOM   3072  N  N     . TYR A 1 377  ? -30.643 -13.883  15.374  1.00 90.62  ? 381  TYR A N     1 
ATOM   3073  C  CA    . TYR A 1 377  ? -31.695 -14.606  14.675  1.00 82.97  ? 381  TYR A CA    1 
ATOM   3074  C  C     . TYR A 1 377  ? -32.701 -15.211  15.654  1.00 95.60  ? 381  TYR A C     1 
ATOM   3075  O  O     . TYR A 1 377  ? -33.909 -15.151  15.421  1.00 106.24 ? 381  TYR A O     1 
ATOM   3076  C  CB    . TYR A 1 377  ? -31.102 -15.702  13.792  1.00 84.76  ? 381  TYR A CB    1 
ATOM   3077  C  CG    . TYR A 1 377  ? -32.139 -16.444  12.972  1.00 92.84  ? 381  TYR A CG    1 
ATOM   3078  C  CD1   . TYR A 1 377  ? -32.832 -15.804  11.954  1.00 96.17  ? 381  TYR A CD1   1 
ATOM   3079  C  CD2   . TYR A 1 377  ? -32.431 -17.777  13.222  1.00 88.39  ? 381  TYR A CD2   1 
ATOM   3080  C  CE1   . TYR A 1 377  ? -33.782 -16.471  11.204  1.00 104.99 ? 381  TYR A CE1   1 
ATOM   3081  C  CE2   . TYR A 1 377  ? -33.381 -18.451  12.478  1.00 101.42 ? 381  TYR A CE2   1 
ATOM   3082  C  CZ    . TYR A 1 377  ? -34.053 -17.794  11.468  1.00 105.16 ? 381  TYR A CZ    1 
ATOM   3083  O  OH    . TYR A 1 377  ? -34.998 -18.460  10.719  1.00 107.62 ? 381  TYR A OH    1 
ATOM   3084  N  N     . ARG A 1 378  ? -32.208 -15.789  16.748  1.00 103.84 ? 382  ARG A N     1 
ATOM   3085  C  CA    . ARG A 1 378  ? -33.093 -16.386  17.747  1.00 102.60 ? 382  ARG A CA    1 
ATOM   3086  C  C     . ARG A 1 378  ? -33.853 -15.320  18.527  1.00 97.73  ? 382  ARG A C     1 
ATOM   3087  O  O     . ARG A 1 378  ? -34.960 -15.563  18.999  1.00 98.79  ? 382  ARG A O     1 
ATOM   3088  C  CB    . ARG A 1 378  ? -32.309 -17.281  18.705  1.00 109.91 ? 382  ARG A CB    1 
ATOM   3089  C  CG    . ARG A 1 378  ? -31.983 -18.650  18.122  1.00 127.51 ? 382  ARG A CG    1 
ATOM   3090  C  CD    . ARG A 1 378  ? -31.563 -19.638  19.196  1.00 138.19 ? 382  ARG A CD    1 
ATOM   3091  N  NE    . ARG A 1 378  ? -30.313 -19.253  19.842  1.00 144.15 ? 382  ARG A NE    1 
ATOM   3092  C  CZ    . ARG A 1 378  ? -29.107 -19.515  19.348  1.00 143.10 ? 382  ARG A CZ    1 
ATOM   3093  N  NH1   . ARG A 1 378  ? -28.021 -19.128  20.004  1.00 151.59 ? 382  ARG A NH1   1 
ATOM   3094  N  NH2   . ARG A 1 378  ? -28.988 -20.161  18.195  1.00 136.43 ? 382  ARG A NH2   1 
ATOM   3095  N  N     . GLU A 1 379  ? -33.257 -14.140  18.659  1.00 95.41  ? 383  GLU A N     1 
ATOM   3096  C  CA    . GLU A 1 379  ? -33.942 -13.005  19.273  1.00 93.88  ? 383  GLU A CA    1 
ATOM   3097  C  C     . GLU A 1 379  ? -35.191 -12.667  18.467  1.00 103.27 ? 383  GLU A C     1 
ATOM   3098  O  O     . GLU A 1 379  ? -36.287 -12.558  19.016  1.00 104.10 ? 383  GLU A O     1 
ATOM   3099  C  CB    . GLU A 1 379  ? -33.019 -11.789  19.352  1.00 88.14  ? 383  GLU A CB    1 
ATOM   3100  C  CG    . GLU A 1 379  ? -33.654 -10.576  19.993  1.00 95.90  ? 383  GLU A CG    1 
ATOM   3101  C  CD    . GLU A 1 379  ? -32.922 -9.292   19.661  1.00 103.42 ? 383  GLU A CD    1 
ATOM   3102  O  OE1   . GLU A 1 379  ? -32.371 -9.199   18.544  1.00 123.23 ? 383  GLU A OE1   1 
ATOM   3103  O  OE2   . GLU A 1 379  ? -32.904 -8.374   20.509  1.00 89.95  ? 383  GLU A OE2   1 
ATOM   3104  N  N     . SER A 1 380  ? -35.007 -12.510  17.159  1.00 104.65 ? 384  SER A N     1 
ATOM   3105  C  CA    . SER A 1 380  ? -36.108 -12.280  16.230  1.00 99.39  ? 384  SER A CA    1 
ATOM   3106  C  C     . SER A 1 380  ? -35.688 -12.645  14.814  1.00 104.34 ? 384  SER A C     1 
ATOM   3107  O  O     . SER A 1 380  ? -34.667 -12.163  14.327  1.00 115.84 ? 384  SER A O     1 
ATOM   3108  C  CB    . SER A 1 380  ? -36.565 -10.827  16.279  1.00 102.60 ? 384  SER A CB    1 
ATOM   3109  O  OG    . SER A 1 380  ? -37.530 -10.575  15.272  1.00 104.56 ? 384  SER A OG    1 
ATOM   3110  N  N     . PRO A 1 381  ? -36.474 -13.504  14.149  1.00 110.02 ? 385  PRO A N     1 
ATOM   3111  C  CA    . PRO A 1 381  ? -36.136 -14.009  12.813  1.00 109.83 ? 385  PRO A CA    1 
ATOM   3112  C  C     . PRO A 1 381  ? -36.737 -13.193  11.668  1.00 121.15 ? 385  PRO A C     1 
ATOM   3113  O  O     . PRO A 1 381  ? -36.740 -13.667  10.532  1.00 133.82 ? 385  PRO A O     1 
ATOM   3114  C  CB    . PRO A 1 381  ? -36.733 -15.412  12.829  1.00 103.50 ? 385  PRO A CB    1 
ATOM   3115  C  CG    . PRO A 1 381  ? -37.971 -15.246  13.667  1.00 103.62 ? 385  PRO A CG    1 
ATOM   3116  C  CD    . PRO A 1 381  ? -37.656 -14.185  14.706  1.00 103.58 ? 385  PRO A CD    1 
ATOM   3117  N  N     . PHE A 1 382  ? -37.234 -11.994  11.954  1.00 125.59 ? 386  PHE A N     1 
ATOM   3118  C  CA    . PHE A 1 382  ? -37.895 -11.194  10.929  1.00 126.21 ? 386  PHE A CA    1 
ATOM   3119  C  C     . PHE A 1 382  ? -37.038 -10.010  10.484  1.00 133.21 ? 386  PHE A C     1 
ATOM   3120  O  O     . PHE A 1 382  ? -36.220 -9.503   11.250  1.00 142.19 ? 386  PHE A O     1 
ATOM   3121  C  CB    . PHE A 1 382  ? -39.253 -10.708  11.436  1.00 127.40 ? 386  PHE A CB    1 
ATOM   3122  C  CG    . PHE A 1 382  ? -40.087 -11.793  12.057  1.00 125.30 ? 386  PHE A CG    1 
ATOM   3123  C  CD1   . PHE A 1 382  ? -40.498 -12.881  11.308  1.00 117.94 ? 386  PHE A CD1   1 
ATOM   3124  C  CD2   . PHE A 1 382  ? -40.460 -11.723  13.391  1.00 129.70 ? 386  PHE A CD2   1 
ATOM   3125  C  CE1   . PHE A 1 382  ? -41.263 -13.883  11.875  1.00 117.93 ? 386  PHE A CE1   1 
ATOM   3126  C  CE2   . PHE A 1 382  ? -41.227 -12.720  13.965  1.00 125.25 ? 386  PHE A CE2   1 
ATOM   3127  C  CZ    . PHE A 1 382  ? -41.628 -13.802  13.205  1.00 123.19 ? 386  PHE A CZ    1 
ATOM   3128  N  N     . SER A 1 383  ? -37.236 -9.574   9.243   1.00 132.85 ? 387  SER A N     1 
ATOM   3129  C  CA    . SER A 1 383  ? -36.419 -8.518   8.651   1.00 122.36 ? 387  SER A CA    1 
ATOM   3130  C  C     . SER A 1 383  ? -36.707 -7.136   9.236   1.00 137.57 ? 387  SER A C     1 
ATOM   3131  O  O     . SER A 1 383  ? -37.471 -7.000   10.191  1.00 146.08 ? 387  SER A O     1 
ATOM   3132  C  CB    . SER A 1 383  ? -36.618 -8.481   7.139   1.00 105.20 ? 387  SER A CB    1 
ATOM   3133  O  OG    . SER A 1 383  ? -36.051 -9.622   6.531   1.00 107.31 ? 387  SER A OG    1 
ATOM   3134  N  N     . THR A 1 384  ? -36.078 -6.121   8.647   1.00 136.34 ? 388  THR A N     1 
ATOM   3135  C  CA    . THR A 1 384  ? -36.174 -4.734   9.101   1.00 144.12 ? 388  THR A CA    1 
ATOM   3136  C  C     . THR A 1 384  ? -37.608 -4.279   9.364   1.00 158.93 ? 388  THR A C     1 
ATOM   3137  O  O     . THR A 1 384  ? -38.420 -4.178   8.442   1.00 168.13 ? 388  THR A O     1 
ATOM   3138  C  CB    . THR A 1 384  ? -35.541 -3.773   8.070   1.00 143.57 ? 388  THR A CB    1 
ATOM   3139  O  OG1   . THR A 1 384  ? -34.155 -4.092   7.904   1.00 140.42 ? 388  THR A OG1   1 
ATOM   3140  C  CG2   . THR A 1 384  ? -35.672 -2.327   8.532   1.00 145.57 ? 388  THR A CG2   1 
ATOM   3141  N  N     . ASP A 1 397  ? -40.288 -1.452   16.874  1.00 150.85 ? 401  ASP A N     1 
ATOM   3142  C  CA    . ASP A 1 397  ? -40.368 -2.392   15.763  1.00 155.83 ? 401  ASP A CA    1 
ATOM   3143  C  C     . ASP A 1 397  ? -39.044 -3.132   15.598  1.00 151.33 ? 401  ASP A C     1 
ATOM   3144  O  O     . ASP A 1 397  ? -38.986 -4.201   14.983  1.00 154.33 ? 401  ASP A O     1 
ATOM   3145  C  CB    . ASP A 1 397  ? -40.745 -1.661   14.469  1.00 165.31 ? 401  ASP A CB    1 
ATOM   3146  C  CG    . ASP A 1 397  ? -41.082 -2.613   13.335  1.00 166.74 ? 401  ASP A CG    1 
ATOM   3147  O  OD1   . ASP A 1 397  ? -41.433 -3.779   13.615  1.00 165.98 ? 401  ASP A OD1   1 
ATOM   3148  O  OD2   . ASP A 1 397  ? -41.004 -2.191   12.162  1.00 169.15 ? 401  ASP A OD2   1 
ATOM   3149  N  N     . VAL A 1 398  ? -37.982 -2.556   16.156  1.00 137.06 ? 402  VAL A N     1 
ATOM   3150  C  CA    . VAL A 1 398  ? -36.661 -3.169   16.090  1.00 122.71 ? 402  VAL A CA    1 
ATOM   3151  C  C     . VAL A 1 398  ? -36.267 -3.764   17.437  1.00 123.99 ? 402  VAL A C     1 
ATOM   3152  O  O     . VAL A 1 398  ? -36.362 -3.097   18.466  1.00 129.80 ? 402  VAL A O     1 
ATOM   3153  C  CB    . VAL A 1 398  ? -35.586 -2.154   15.660  1.00 115.50 ? 402  VAL A CB    1 
ATOM   3154  C  CG1   . VAL A 1 398  ? -34.313 -2.875   15.243  1.00 102.44 ? 402  VAL A CG1   1 
ATOM   3155  C  CG2   . VAL A 1 398  ? -36.103 -1.280   14.526  1.00 120.07 ? 402  VAL A CG2   1 
ATOM   3156  N  N     . PRO A 1 399  ? -35.837 -5.037   17.435  1.00 122.27 ? 403  PRO A N     1 
ATOM   3157  C  CA    . PRO A 1 399  ? -35.327 -5.705   18.640  1.00 121.04 ? 403  PRO A CA    1 
ATOM   3158  C  C     . PRO A 1 399  ? -34.112 -4.988   19.233  1.00 120.53 ? 403  PRO A C     1 
ATOM   3159  O  O     . PRO A 1 399  ? -33.332 -4.403   18.486  1.00 132.98 ? 403  PRO A O     1 
ATOM   3160  C  CB    . PRO A 1 399  ? -34.945 -7.098   18.128  1.00 114.65 ? 403  PRO A CB    1 
ATOM   3161  C  CG    . PRO A 1 399  ? -35.812 -7.307   16.935  1.00 113.18 ? 403  PRO A CG    1 
ATOM   3162  C  CD    . PRO A 1 399  ? -35.936 -5.960   16.291  1.00 114.66 ? 403  PRO A CD    1 
ATOM   3163  N  N     . PRO A 1 400  ? -33.953 -5.040   20.564  1.00 114.27 ? 404  PRO A N     1 
ATOM   3164  C  CA    . PRO A 1 400  ? -32.884 -4.321   21.274  1.00 113.75 ? 404  PRO A CA    1 
ATOM   3165  C  C     . PRO A 1 400  ? -31.459 -4.765   20.903  1.00 112.96 ? 404  PRO A C     1 
ATOM   3166  O  O     . PRO A 1 400  ? -30.675 -3.936   20.429  1.00 118.85 ? 404  PRO A O     1 
ATOM   3167  C  CB    . PRO A 1 400  ? -33.176 -4.627   22.745  1.00 111.57 ? 404  PRO A CB    1 
ATOM   3168  C  CG    . PRO A 1 400  ? -33.996 -5.869   22.726  1.00 116.55 ? 404  PRO A CG    1 
ATOM   3169  C  CD    . PRO A 1 400  ? -34.826 -5.782   21.487  1.00 112.07 ? 404  PRO A CD    1 
ATOM   3170  N  N     . ARG A 1 401  ? -31.128 -6.036   21.120  1.00 105.89 ? 405  ARG A N     1 
ATOM   3171  C  CA    . ARG A 1 401  ? -29.781 -6.549   20.846  1.00 92.12  ? 405  ARG A CA    1 
ATOM   3172  C  C     . ARG A 1 401  ? -29.347 -6.252   19.400  1.00 91.55  ? 405  ARG A C     1 
ATOM   3173  O  O     . ARG A 1 401  ? -28.194 -5.838   19.117  1.00 93.08  ? 405  ARG A O     1 
ATOM   3174  C  CB    . ARG A 1 401  ? -29.729 -8.058   21.130  1.00 85.76  ? 405  ARG A CB    1 
ATOM   3175  C  CG    . ARG A 1 401  ? -29.906 -8.441   22.602  1.00 92.67  ? 405  ARG A CG    1 
ATOM   3176  C  CD    . ARG A 1 401  ? -29.560 -9.906   22.838  1.00 93.26  ? 405  ARG A CD    1 
ATOM   3177  N  NE    . ARG A 1 401  ? -28.146 -10.181  22.587  1.00 89.56  ? 405  ARG A NE    1 
ATOM   3178  C  CZ    . ARG A 1 401  ? -27.615 -11.401  22.533  1.00 90.76  ? 405  ARG A CZ    1 
ATOM   3179  N  NH1   . ARG A 1 401  ? -28.384 -12.467  22.710  1.00 102.68 ? 405  ARG A NH1   1 
ATOM   3180  N  NH2   . ARG A 1 401  ? -26.317 -11.555  22.301  1.00 78.88  ? 405  ARG A NH2   1 
ATOM   3181  N  N     . ARG A 1 402  ? -30.293 -6.432   18.485  1.00 91.29  ? 406  ARG A N     1 
ATOM   3182  C  CA    . ARG A 1 402  ? -30.033 -6.162   17.078  1.00 87.28  ? 406  ARG A CA    1 
ATOM   3183  C  C     . ARG A 1 402  ? -29.762 -4.682   16.864  1.00 94.69  ? 406  ARG A C     1 
ATOM   3184  O  O     . ARG A 1 402  ? -28.848 -4.312   16.139  1.00 112.25 ? 406  ARG A O     1 
ATOM   3185  C  CB    . ARG A 1 402  ? -31.200 -6.605   16.203  1.00 79.80  ? 406  ARG A CB    1 
ATOM   3186  C  CG    . ARG A 1 402  ? -30.898 -6.472   14.727  1.00 85.13  ? 406  ARG A CG    1 
ATOM   3187  C  CD    . ARG A 1 402  ? -32.139 -6.660   13.882  1.00 88.19  ? 406  ARG A CD    1 
ATOM   3188  N  NE    . ARG A 1 402  ? -32.760 -7.956   14.118  1.00 88.81  ? 406  ARG A NE    1 
ATOM   3189  C  CZ    . ARG A 1 402  ? -33.740 -8.452   13.373  1.00 95.06  ? 406  ARG A CZ    1 
ATOM   3190  N  NH1   . ARG A 1 402  ? -34.202 -7.761   12.340  1.00 97.31  ? 406  ARG A NH1   1 
ATOM   3191  N  NH2   . ARG A 1 402  ? -34.254 -9.641   13.653  1.00 100.17 ? 406  ARG A NH2   1 
ATOM   3192  N  N     . GLN A 1 403  ? -30.555 -3.838   17.511  1.00 94.76  ? 407  GLN A N     1 
ATOM   3193  C  CA    . GLN A 1 403  ? -30.376 -2.397   17.410  1.00 96.30  ? 407  GLN A CA    1 
ATOM   3194  C  C     . GLN A 1 403  ? -28.999 -1.999   17.920  1.00 91.81  ? 407  GLN A C     1 
ATOM   3195  O  O     . GLN A 1 403  ? -28.428 -1.006   17.476  1.00 96.88  ? 407  GLN A O     1 
ATOM   3196  C  CB    . GLN A 1 403  ? -31.472 -1.655   18.186  1.00 110.06 ? 407  GLN A CB    1 
ATOM   3197  C  CG    . GLN A 1 403  ? -31.486 -0.151   17.954  1.00 114.89 ? 407  GLN A CG    1 
ATOM   3198  C  CD    . GLN A 1 403  ? -31.645 0.206    16.486  1.00 124.47 ? 407  GLN A CD    1 
ATOM   3199  O  OE1   . GLN A 1 403  ? -32.269 -0.528   15.717  1.00 131.41 ? 407  GLN A OE1   1 
ATOM   3200  N  NE2   . GLN A 1 403  ? -31.074 1.336    16.089  1.00 129.04 ? 407  GLN A NE2   1 
ATOM   3201  N  N     . LEU A 1 404  ? -28.472 -2.776   18.861  1.00 92.02  ? 408  LEU A N     1 
ATOM   3202  C  CA    . LEU A 1 404  ? -27.115 -2.547   19.344  1.00 83.71  ? 408  LEU A CA    1 
ATOM   3203  C  C     . LEU A 1 404  ? -26.115 -2.813   18.236  1.00 81.24  ? 408  LEU A C     1 
ATOM   3204  O  O     . LEU A 1 404  ? -25.147 -2.072   18.070  1.00 77.86  ? 408  LEU A O     1 
ATOM   3205  C  CB    . LEU A 1 404  ? -26.790 -3.431   20.548  1.00 73.98  ? 408  LEU A CB    1 
ATOM   3206  C  CG    . LEU A 1 404  ? -27.431 -3.055   21.872  1.00 88.69  ? 408  LEU A CG    1 
ATOM   3207  C  CD1   . LEU A 1 404  ? -26.937 -3.994   22.961  1.00 86.04  ? 408  LEU A CD1   1 
ATOM   3208  C  CD2   . LEU A 1 404  ? -27.108 -1.614   22.213  1.00 107.27 ? 408  LEU A CD2   1 
ATOM   3209  N  N     . TYR A 1 405  ? -26.336 -3.888   17.485  1.00 79.30  ? 409  TYR A N     1 
ATOM   3210  C  CA    . TYR A 1 405  ? -25.349 -4.247   16.460  1.00 82.86  ? 409  TYR A CA    1 
ATOM   3211  C  C     . TYR A 1 405  ? -25.649 -3.732   15.038  1.00 95.63  ? 409  TYR A C     1 
ATOM   3212  O  O     . TYR A 1 405  ? -24.957 -4.099   14.077  1.00 85.96  ? 409  TYR A O     1 
ATOM   3213  C  CB    . TYR A 1 405  ? -25.187 -5.763   16.408  1.00 76.29  ? 409  TYR A CB    1 
ATOM   3214  C  CG    . TYR A 1 405  ? -24.602 -6.357   17.653  1.00 79.16  ? 409  TYR A CG    1 
ATOM   3215  C  CD1   . TYR A 1 405  ? -23.232 -6.360   17.866  1.00 79.88  ? 409  TYR A CD1   1 
ATOM   3216  C  CD2   . TYR A 1 405  ? -25.422 -6.922   18.624  1.00 81.39  ? 409  TYR A CD2   1 
ATOM   3217  C  CE1   . TYR A 1 405  ? -22.694 -6.913   19.018  1.00 88.73  ? 409  TYR A CE1   1 
ATOM   3218  C  CE2   . TYR A 1 405  ? -24.894 -7.473   19.767  1.00 82.01  ? 409  TYR A CE2   1 
ATOM   3219  C  CZ    . TYR A 1 405  ? -23.532 -7.468   19.961  1.00 93.32  ? 409  TYR A CZ    1 
ATOM   3220  O  OH    . TYR A 1 405  ? -23.003 -8.020   21.104  1.00 101.80 ? 409  TYR A OH    1 
ATOM   3221  N  N     . LEU A 1 406  ? -26.668 -2.888   14.903  1.00 93.48  ? 410  LEU A N     1 
ATOM   3222  C  CA    . LEU A 1 406  ? -27.062 -2.361   13.597  1.00 91.25  ? 410  LEU A CA    1 
ATOM   3223  C  C     . LEU A 1 406  ? -25.962 -1.574   12.858  1.00 96.60  ? 410  LEU A C     1 
ATOM   3224  O  O     . LEU A 1 406  ? -25.847 -1.691   11.641  1.00 117.31 ? 410  LEU A O     1 
ATOM   3225  C  CB    . LEU A 1 406  ? -28.304 -1.486   13.748  1.00 90.57  ? 410  LEU A CB    1 
ATOM   3226  C  CG    . LEU A 1 406  ? -29.061 -1.216   12.454  1.00 103.01 ? 410  LEU A CG    1 
ATOM   3227  C  CD1   . LEU A 1 406  ? -29.371 -2.529   11.764  1.00 106.35 ? 410  LEU A CD1   1 
ATOM   3228  C  CD2   . LEU A 1 406  ? -30.338 -0.433   12.721  1.00 113.09 ? 410  LEU A CD2   1 
ATOM   3229  N  N     . PRO A 1 407  ? -25.149 -0.772   13.578  1.00 84.73  ? 411  PRO A N     1 
ATOM   3230  C  CA    . PRO A 1 407  ? -24.083 -0.065   12.855  1.00 73.65  ? 411  PRO A CA    1 
ATOM   3231  C  C     . PRO A 1 407  ? -23.027 -0.935   12.157  1.00 83.40  ? 411  PRO A C     1 
ATOM   3232  O  O     . PRO A 1 407  ? -22.249 -0.375   11.393  1.00 109.89 ? 411  PRO A O     1 
ATOM   3233  C  CB    . PRO A 1 407  ? -23.414 0.764    13.958  1.00 73.10  ? 411  PRO A CB    1 
ATOM   3234  C  CG    . PRO A 1 407  ? -24.481 0.990    14.956  1.00 80.34  ? 411  PRO A CG    1 
ATOM   3235  C  CD    . PRO A 1 407  ? -25.290 -0.265   14.958  1.00 85.98  ? 411  PRO A CD    1 
ATOM   3236  N  N     . MET A 1 408  ? -22.992 -2.249   12.374  1.00 72.19  ? 412  MET A N     1 
ATOM   3237  C  CA    . MET A 1 408  ? -21.907 -3.073   11.806  1.00 74.19  ? 412  MET A CA    1 
ATOM   3238  C  C     . MET A 1 408  ? -22.337 -4.378   11.086  1.00 74.93  ? 412  MET A C     1 
ATOM   3239  O  O     . MET A 1 408  ? -21.530 -5.050   10.390  1.00 81.93  ? 412  MET A O     1 
ATOM   3240  C  CB    . MET A 1 408  ? -20.910 -3.403   12.921  1.00 82.55  ? 412  MET A CB    1 
ATOM   3241  C  CG    . MET A 1 408  ? -21.537 -4.047   14.141  1.00 94.77  ? 412  MET A CG    1 
ATOM   3242  S  SD    . MET A 1 408  ? -21.665 -5.830   13.953  1.00 112.61 ? 412  MET A SD    1 
ATOM   3243  C  CE    . MET A 1 408  ? -19.932 -6.266   13.899  1.00 164.77 ? 412  MET A CE    1 
ATOM   3244  N  N     . LEU A 1 409  ? -23.608 -4.738   11.237  1.00 72.08  ? 413  LEU A N     1 
ATOM   3245  C  CA    . LEU A 1 409  ? -24.109 -5.981   10.659  1.00 76.36  ? 413  LEU A CA    1 
ATOM   3246  C  C     . LEU A 1 409  ? -23.877 -6.054   9.158   1.00 79.13  ? 413  LEU A C     1 
ATOM   3247  O  O     . LEU A 1 409  ? -23.487 -7.102   8.635   1.00 92.41  ? 413  LEU A O     1 
ATOM   3248  C  CB    . LEU A 1 409  ? -25.600 -6.158   10.963  1.00 85.57  ? 413  LEU A CB    1 
ATOM   3249  C  CG    . LEU A 1 409  ? -25.962 -6.717   12.345  1.00 79.25  ? 413  LEU A CG    1 
ATOM   3250  C  CD1   . LEU A 1 409  ? -27.458 -6.960   12.438  1.00 77.67  ? 413  LEU A CD1   1 
ATOM   3251  C  CD2   . LEU A 1 409  ? -25.191 -7.993   12.628  1.00 70.07  ? 413  LEU A CD2   1 
ATOM   3252  N  N     . PHE A 1 410  ? -24.103 -4.939   8.471   1.00 74.98  ? 414  PHE A N     1 
ATOM   3253  C  CA    . PHE A 1 410  ? -23.939 -4.900   7.025   1.00 79.48  ? 414  PHE A CA    1 
ATOM   3254  C  C     . PHE A 1 410  ? -22.481 -5.118   6.635   1.00 81.32  ? 414  PHE A C     1 
ATOM   3255  O  O     . PHE A 1 410  ? -22.191 -5.592   5.538   1.00 99.25  ? 414  PHE A O     1 
ATOM   3256  C  CB    . PHE A 1 410  ? -24.465 -3.576   6.454   1.00 74.54  ? 414  PHE A CB    1 
ATOM   3257  C  CG    . PHE A 1 410  ? -23.620 -2.386   6.787   1.00 73.59  ? 414  PHE A CG    1 
ATOM   3258  C  CD1   . PHE A 1 410  ? -22.672 -1.918   5.896   1.00 69.48  ? 414  PHE A CD1   1 
ATOM   3259  C  CD2   . PHE A 1 410  ? -23.777 -1.732   7.996   1.00 91.67  ? 414  PHE A CD2   1 
ATOM   3260  C  CE1   . PHE A 1 410  ? -21.896 -0.820   6.200   1.00 82.58  ? 414  PHE A CE1   1 
ATOM   3261  C  CE2   . PHE A 1 410  ? -23.001 -0.627   8.314   1.00 91.95  ? 414  PHE A CE2   1 
ATOM   3262  C  CZ    . PHE A 1 410  ? -22.060 -0.170   7.409   1.00 95.88  ? 414  PHE A CZ    1 
ATOM   3263  N  N     . LYS A 1 411  ? -21.568 -4.769   7.536   1.00 72.50  ? 415  LYS A N     1 
ATOM   3264  C  CA    . LYS A 1 411  ? -20.150 -5.032   7.323   1.00 74.21  ? 415  LYS A CA    1 
ATOM   3265  C  C     . LYS A 1 411  ? -19.892 -6.514   7.404   1.00 87.51  ? 415  LYS A C     1 
ATOM   3266  O  O     . LYS A 1 411  ? -19.011 -7.041   6.710   1.00 85.33  ? 415  LYS A O     1 
ATOM   3267  C  CB    . LYS A 1 411  ? -19.280 -4.301   8.347   1.00 69.71  ? 415  LYS A CB    1 
ATOM   3268  C  CG    . LYS A 1 411  ? -19.100 -2.819   8.061   1.00 67.18  ? 415  LYS A CG    1 
ATOM   3269  C  CD    . LYS A 1 411  ? -18.642 -2.601   6.644   1.00 78.44  ? 415  LYS A CD    1 
ATOM   3270  C  CE    . LYS A 1 411  ? -18.007 -1.246   6.475   1.00 86.76  ? 415  LYS A CE    1 
ATOM   3271  N  NZ    . LYS A 1 411  ? -16.804 -1.114   7.342   1.00 89.36  ? 415  LYS A NZ    1 
ATOM   3272  N  N     . VAL A 1 412  ? -20.659 -7.190   8.259   1.00 90.07  ? 416  VAL A N     1 
ATOM   3273  C  CA    . VAL A 1 412  ? -20.547 -8.658   8.314   1.00 73.78  ? 416  VAL A CA    1 
ATOM   3274  C  C     . VAL A 1 412  ? -21.149 -9.353   7.077   1.00 78.54  ? 416  VAL A C     1 
ATOM   3275  O  O     . VAL A 1 412  ? -20.555 -10.300  6.541   1.00 82.24  ? 416  VAL A O     1 
ATOM   3276  C  CB    . VAL A 1 412  ? -21.200 -9.226   9.580   1.00 60.02  ? 416  VAL A CB    1 
ATOM   3277  C  CG1   . VAL A 1 412  ? -20.966 -10.718  9.663   1.00 56.89  ? 416  VAL A CG1   1 
ATOM   3278  C  CG2   . VAL A 1 412  ? -20.637 -8.535   10.795  1.00 57.31  ? 416  VAL A CG2   1 
ATOM   3279  N  N     . ARG A 1 413  ? -22.322 -8.899   6.633   1.00 68.39  ? 417  ARG A N     1 
ATOM   3280  C  CA    . ARG A 1 413  ? -22.896 -9.399   5.378   1.00 64.55  ? 417  ARG A CA    1 
ATOM   3281  C  C     . ARG A 1 413  ? -21.903 -9.203   4.237   1.00 68.37  ? 417  ARG A C     1 
ATOM   3282  O  O     . ARG A 1 413  ? -21.655 -10.099  3.433   1.00 74.49  ? 417  ARG A O     1 
ATOM   3283  C  CB    . ARG A 1 413  ? -24.205 -8.688   5.037   1.00 64.81  ? 417  ARG A CB    1 
ATOM   3284  C  CG    . ARG A 1 413  ? -25.347 -8.949   5.981   1.00 79.41  ? 417  ARG A CG    1 
ATOM   3285  C  CD    . ARG A 1 413  ? -26.634 -8.324   5.464   1.00 84.17  ? 417  ARG A CD    1 
ATOM   3286  N  NE    . ARG A 1 413  ? -27.712 -8.407   6.446   1.00 90.24  ? 417  ARG A NE    1 
ATOM   3287  C  CZ    . ARG A 1 413  ? -27.975 -7.467   7.344   1.00 91.50  ? 417  ARG A CZ    1 
ATOM   3288  N  NH1   . ARG A 1 413  ? -27.241 -6.367   7.383   1.00 93.73  ? 417  ARG A NH1   1 
ATOM   3289  N  NH2   . ARG A 1 413  ? -28.971 -7.627   8.204   1.00 95.46  ? 417  ARG A NH2   1 
ATOM   3290  N  N     . LEU A 1 414  ? -21.328 -8.010   4.199   1.00 65.16  ? 418  LEU A N     1 
ATOM   3291  C  CA    . LEU A 1 414  ? -20.351 -7.645   3.194   1.00 71.80  ? 418  LEU A CA    1 
ATOM   3292  C  C     . LEU A 1 414  ? -19.147 -8.561   3.254   1.00 69.43  ? 418  LEU A C     1 
ATOM   3293  O  O     . LEU A 1 414  ? -18.612 -8.961   2.233   1.00 82.02  ? 418  LEU A O     1 
ATOM   3294  C  CB    . LEU A 1 414  ? -19.926 -6.184   3.379   1.00 72.94  ? 418  LEU A CB    1 
ATOM   3295  C  CG    . LEU A 1 414  ? -19.338 -5.460   2.167   1.00 60.47  ? 418  LEU A CG    1 
ATOM   3296  C  CD1   . LEU A 1 414  ? -20.121 -5.814   0.914   1.00 60.96  ? 418  LEU A CD1   1 
ATOM   3297  C  CD2   . LEU A 1 414  ? -19.376 -3.977   2.433   1.00 64.49  ? 418  LEU A CD2   1 
ATOM   3298  N  N     . LEU A 1 415  ? -18.732 -8.901   4.464   1.00 70.14  ? 419  LEU A N     1 
ATOM   3299  C  CA    . LEU A 1 415  ? -17.616 -9.821   4.665   1.00 71.20  ? 419  LEU A CA    1 
ATOM   3300  C  C     . LEU A 1 415  ? -17.922 -11.217  4.124   1.00 71.99  ? 419  LEU A C     1 
ATOM   3301  O  O     . LEU A 1 415  ? -17.108 -11.805  3.407   1.00 80.19  ? 419  LEU A O     1 
ATOM   3302  C  CB    . LEU A 1 415  ? -17.262 -9.906   6.149   1.00 67.84  ? 419  LEU A CB    1 
ATOM   3303  C  CG    . LEU A 1 415  ? -16.173 -10.915  6.500   1.00 73.88  ? 419  LEU A CG    1 
ATOM   3304  C  CD1   . LEU A 1 415  ? -14.849 -10.545  5.864   1.00 67.82  ? 419  LEU A CD1   1 
ATOM   3305  C  CD2   . LEU A 1 415  ? -16.038 -11.035  8.023   1.00 84.36  ? 419  LEU A CD2   1 
ATOM   3306  N  N     . MET A 1 416  ? -19.098 -11.738  4.465   1.00 71.13  ? 420  MET A N     1 
ATOM   3307  C  CA    . MET A 1 416  ? -19.510 -13.063  4.009   1.00 74.88  ? 420  MET A CA    1 
ATOM   3308  C  C     . MET A 1 416  ? -19.577 -13.138  2.492   1.00 69.83  ? 420  MET A C     1 
ATOM   3309  O  O     . MET A 1 416  ? -19.058 -14.076  1.887   1.00 74.90  ? 420  MET A O     1 
ATOM   3310  C  CB    . MET A 1 416  ? -20.869 -13.443  4.599   1.00 83.33  ? 420  MET A CB    1 
ATOM   3311  C  CG    . MET A 1 416  ? -20.869 -13.646  6.107   1.00 87.21  ? 420  MET A CG    1 
ATOM   3312  S  SD    . MET A 1 416  ? -19.661 -14.874  6.627   1.00 65.04  ? 420  MET A SD    1 
ATOM   3313  C  CE    . MET A 1 416  ? -18.425 -13.808  7.412   1.00 62.13  ? 420  MET A CE    1 
ATOM   3314  N  N     . VAL A 1 417  ? -20.222 -12.149  1.880   1.00 76.61  ? 421  VAL A N     1 
ATOM   3315  C  CA    . VAL A 1 417  ? -20.346 -12.122  0.423   1.00 68.91  ? 421  VAL A CA    1 
ATOM   3316  C  C     . VAL A 1 417  ? -18.973 -11.974  -0.234  1.00 63.57  ? 421  VAL A C     1 
ATOM   3317  O  O     . VAL A 1 417  ? -18.673 -12.638  -1.222  1.00 66.42  ? 421  VAL A O     1 
ATOM   3318  C  CB    . VAL A 1 417  ? -21.270 -10.986  -0.040  1.00 61.03  ? 421  VAL A CB    1 
ATOM   3319  C  CG1   . VAL A 1 417  ? -21.302 -10.910  -1.551  1.00 64.27  ? 421  VAL A CG1   1 
ATOM   3320  C  CG2   . VAL A 1 417  ? -22.670 -11.188  0.517   1.00 61.10  ? 421  VAL A CG2   1 
ATOM   3321  N  N     . SER A 1 418  ? -18.130 -11.129  0.347   1.00 69.45  ? 422  SER A N     1 
ATOM   3322  C  CA    . SER A 1 418  ? -16.821 -10.823  -0.224  1.00 64.42  ? 422  SER A CA    1 
ATOM   3323  C  C     . SER A 1 418  ? -15.814 -11.964  -0.116  1.00 63.46  ? 422  SER A C     1 
ATOM   3324  O  O     . SER A 1 418  ? -14.949 -12.115  -0.979  1.00 61.28  ? 422  SER A O     1 
ATOM   3325  C  CB    . SER A 1 418  ? -16.237 -9.579   0.444   1.00 69.25  ? 422  SER A CB    1 
ATOM   3326  O  OG    . SER A 1 418  ? -14.849 -9.469   0.188   1.00 86.21  ? 422  SER A OG    1 
ATOM   3327  N  N     . ARG A 1 419  ? -15.907 -12.761  0.944   1.00 72.01  ? 423  ARG A N     1 
ATOM   3328  C  CA    . ARG A 1 419  ? -14.894 -13.795  1.170   1.00 73.84  ? 423  ARG A CA    1 
ATOM   3329  C  C     . ARG A 1 419  ? -15.453 -15.216  1.161   1.00 64.74  ? 423  ARG A C     1 
ATOM   3330  O  O     . ARG A 1 419  ? -14.808 -16.133  1.658   1.00 62.70  ? 423  ARG A O     1 
ATOM   3331  C  CB    . ARG A 1 419  ? -14.169 -13.541  2.492   1.00 60.91  ? 423  ARG A CB    1 
ATOM   3332  C  CG    . ARG A 1 419  ? -13.357 -12.265  2.515   1.00 66.51  ? 423  ARG A CG    1 
ATOM   3333  C  CD    . ARG A 1 419  ? -12.353 -12.271  3.650   1.00 78.43  ? 423  ARG A CD    1 
ATOM   3334  N  NE    . ARG A 1 419  ? -11.345 -13.315  3.487   1.00 89.80  ? 423  ARG A NE    1 
ATOM   3335  C  CZ    . ARG A 1 419  ? -10.387 -13.572  4.375   1.00 103.46 ? 423  ARG A CZ    1 
ATOM   3336  N  NH1   . ARG A 1 419  ? -10.303 -12.863  5.494   1.00 112.42 ? 423  ARG A NH1   1 
ATOM   3337  N  NH2   . ARG A 1 419  ? -9.512  -14.542  4.146   1.00 122.74 ? 423  ARG A NH2   1 
ATOM   3338  N  N     . MET A 1 420  ? -16.639 -15.390  0.583   1.00 61.37  ? 424  MET A N     1 
ATOM   3339  C  CA    . MET A 1 420  ? -17.314 -16.684  0.540   1.00 59.72  ? 424  MET A CA    1 
ATOM   3340  C  C     . MET A 1 420  ? -16.419 -17.776  -0.047  1.00 64.20  ? 424  MET A C     1 
ATOM   3341  O  O     . MET A 1 420  ? -15.841 -17.614  -1.126  1.00 63.73  ? 424  MET A O     1 
ATOM   3342  C  CB    . MET A 1 420  ? -18.604 -16.580  -0.271  1.00 61.61  ? 424  MET A CB    1 
ATOM   3343  C  CG    . MET A 1 420  ? -19.383 -17.874  -0.369  1.00 68.41  ? 424  MET A CG    1 
ATOM   3344  S  SD    . MET A 1 420  ? -19.950 -18.429  1.256   1.00 68.27  ? 424  MET A SD    1 
ATOM   3345  C  CE    . MET A 1 420  ? -21.068 -17.105  1.698   1.00 62.58  ? 424  MET A CE    1 
ATOM   3346  N  N     . ALA A 1 421  ? -16.304 -18.885  0.681   1.00 69.34  ? 425  ALA A N     1 
ATOM   3347  C  CA    . ALA A 1 421  ? -15.467 -20.010  0.271   1.00 69.13  ? 425  ALA A CA    1 
ATOM   3348  C  C     . ALA A 1 421  ? -16.124 -20.794  -0.860  1.00 72.11  ? 425  ALA A C     1 
ATOM   3349  O  O     . ALA A 1 421  ? -17.337 -20.689  -1.066  1.00 75.37  ? 425  ALA A O     1 
ATOM   3350  C  CB    . ALA A 1 421  ? -15.194 -20.919  1.462   1.00 76.14  ? 425  ALA A CB    1 
ATOM   3351  N  N     . LYS A 1 422  ? -15.325 -21.577  -1.586  1.00 64.66  ? 426  LYS A N     1 
ATOM   3352  C  CA    . LYS A 1 422  ? -15.854 -22.404  -2.675  1.00 71.00  ? 426  LYS A CA    1 
ATOM   3353  C  C     . LYS A 1 422  ? -16.837 -23.452  -2.144  1.00 70.72  ? 426  LYS A C     1 
ATOM   3354  O  O     . LYS A 1 422  ? -16.588 -24.089  -1.112  1.00 75.81  ? 426  LYS A O     1 
ATOM   3355  C  CB    . LYS A 1 422  ? -14.721 -23.084  -3.451  1.00 80.64  ? 426  LYS A CB    1 
ATOM   3356  C  CG    . LYS A 1 422  ? -13.887 -24.065  -2.648  1.00 109.13 ? 426  LYS A CG    1 
ATOM   3357  C  CD    . LYS A 1 422  ? -12.897 -24.797  -3.539  1.00 124.36 ? 426  LYS A CD    1 
ATOM   3358  C  CE    . LYS A 1 422  ? -12.093 -25.822  -2.751  1.00 133.60 ? 426  LYS A CE    1 
ATOM   3359  N  NZ    . LYS A 1 422  ? -11.142 -26.563  -3.625  1.00 143.29 ? 426  LYS A NZ    1 
ATOM   3360  N  N     . PRO A 1 423  ? -17.971 -23.617  -2.840  1.00 69.27  ? 427  PRO A N     1 
ATOM   3361  C  CA    . PRO A 1 423  ? -19.076 -24.468  -2.386  1.00 69.87  ? 427  PRO A CA    1 
ATOM   3362  C  C     . PRO A 1 423  ? -18.727 -25.957  -2.332  1.00 75.10  ? 427  PRO A C     1 
ATOM   3363  O  O     . PRO A 1 423  ? -19.088 -26.616  -1.361  1.00 101.15 ? 427  PRO A O     1 
ATOM   3364  C  CB    . PRO A 1 423  ? -20.164 -24.205  -3.426  1.00 86.91  ? 427  PRO A CB    1 
ATOM   3365  C  CG    . PRO A 1 423  ? -19.431 -23.740  -4.644  1.00 87.91  ? 427  PRO A CG    1 
ATOM   3366  C  CD    . PRO A 1 423  ? -18.269 -22.955  -4.121  1.00 77.16  ? 427  PRO A CD    1 
ATOM   3367  N  N     . GLU A 1 424  ? -18.051 -26.482  -3.349  1.00 65.60  ? 428  GLU A N     1 
ATOM   3368  C  CA    . GLU A 1 424  ? -17.658 -27.887  -3.348  1.00 75.44  ? 428  GLU A CA    1 
ATOM   3369  C  C     . GLU A 1 424  ? -16.170 -28.041  -3.609  1.00 69.05  ? 428  GLU A C     1 
ATOM   3370  O  O     . GLU A 1 424  ? -15.516 -27.119  -4.055  1.00 66.85  ? 428  GLU A O     1 
ATOM   3371  C  CB    . GLU A 1 424  ? -18.452 -28.678  -4.389  1.00 94.57  ? 428  GLU A CB    1 
ATOM   3372  C  CG    . GLU A 1 424  ? -18.087 -28.366  -5.822  1.00 108.65 ? 428  GLU A CG    1 
ATOM   3373  C  CD    . GLU A 1 424  ? -18.874 -27.199  -6.382  1.00 126.27 ? 428  GLU A CD    1 
ATOM   3374  O  OE1   . GLU A 1 424  ? -20.123 -27.273  -6.383  1.00 132.06 ? 428  GLU A OE1   1 
ATOM   3375  O  OE2   . GLU A 1 424  ? -18.245 -26.208  -6.818  1.00 132.18 ? 428  GLU A OE2   1 
ATOM   3376  N  N     . GLU A 1 425  ? -15.631 -29.216  -3.319  1.00 83.85  ? 429  GLU A N     1 
ATOM   3377  C  CA    . GLU A 1 425  ? -14.216 -29.458  -3.554  1.00 89.37  ? 429  GLU A CA    1 
ATOM   3378  C  C     . GLU A 1 425  ? -13.993 -30.644  -4.480  1.00 102.18 ? 429  GLU A C     1 
ATOM   3379  O  O     . GLU A 1 425  ? -14.144 -31.806  -4.086  1.00 111.97 ? 429  GLU A O     1 
ATOM   3380  C  CB    . GLU A 1 425  ? -13.479 -29.684  -2.238  1.00 97.91  ? 429  GLU A CB    1 
ATOM   3381  C  CG    . GLU A 1 425  ? -11.971 -29.647  -2.398  1.00 97.42  ? 429  GLU A CG    1 
ATOM   3382  C  CD    . GLU A 1 425  ? -11.281 -29.137  -1.155  1.00 95.69  ? 429  GLU A CD    1 
ATOM   3383  O  OE1   . GLU A 1 425  ? -11.706 -29.525  -0.048  1.00 85.91  ? 429  GLU A OE1   1 
ATOM   3384  O  OE2   . GLU A 1 425  ? -10.325 -28.343  -1.291  1.00 101.94 ? 429  GLU A OE2   1 
ATOM   3385  N  N     . VAL A 1 426  ? -13.639 -30.329  -5.721  1.00 102.47 ? 430  VAL A N     1 
ATOM   3386  C  CA    . VAL A 1 426  ? -13.334 -31.331  -6.728  1.00 86.79  ? 430  VAL A CA    1 
ATOM   3387  C  C     . VAL A 1 426  ? -11.836 -31.634  -6.692  1.00 87.06  ? 430  VAL A C     1 
ATOM   3388  O  O     . VAL A 1 426  ? -11.015 -30.744  -6.480  1.00 94.60  ? 430  VAL A O     1 
ATOM   3389  C  CB    . VAL A 1 426  ? -13.767 -30.859  -8.141  1.00 105.20 ? 430  VAL A CB    1 
ATOM   3390  C  CG1   . VAL A 1 426  ? -12.973 -29.625  -8.581  1.00 101.51 ? 430  VAL A CG1   1 
ATOM   3391  C  CG2   . VAL A 1 426  ? -13.625 -31.975  -9.149  1.00 100.34 ? 430  VAL A CG2   1 
ATOM   3392  N  N     . LEU A 1 427  ? -11.481 -32.898  -6.877  1.00 89.60  ? 431  LEU A N     1 
ATOM   3393  C  CA    . LEU A 1 427  ? -10.088 -33.312  -6.767  1.00 93.60  ? 431  LEU A CA    1 
ATOM   3394  C  C     . LEU A 1 427  ? -9.723  -34.330  -7.841  1.00 96.58  ? 431  LEU A C     1 
ATOM   3395  O  O     . LEU A 1 427  ? -10.445 -35.292  -8.056  1.00 92.98  ? 431  LEU A O     1 
ATOM   3396  C  CB    . LEU A 1 427  ? -9.823  -33.892  -5.371  1.00 90.54  ? 431  LEU A CB    1 
ATOM   3397  C  CG    . LEU A 1 427  ? -8.398  -34.313  -5.012  1.00 87.81  ? 431  LEU A CG    1 
ATOM   3398  C  CD1   . LEU A 1 427  ? -7.472  -33.114  -4.945  1.00 91.12  ? 431  LEU A CD1   1 
ATOM   3399  C  CD2   . LEU A 1 427  ? -8.394  -35.071  -3.703  1.00 96.96  ? 431  LEU A CD2   1 
ATOM   3400  N  N     . VAL A 1 428  ? -8.602  -34.119  -8.520  1.00 101.92 ? 432  VAL A N     1 
ATOM   3401  C  CA    . VAL A 1 428  ? -8.134  -35.086  -9.506  1.00 104.63 ? 432  VAL A CA    1 
ATOM   3402  C  C     . VAL A 1 428  ? -7.382  -36.216  -8.814  1.00 112.35 ? 432  VAL A C     1 
ATOM   3403  O  O     . VAL A 1 428  ? -6.312  -36.001  -8.247  1.00 117.72 ? 432  VAL A O     1 
ATOM   3404  C  CB    . VAL A 1 428  ? -7.221  -34.436  -10.557 1.00 105.38 ? 432  VAL A CB    1 
ATOM   3405  C  CG1   . VAL A 1 428  ? -6.795  -35.466  -11.589 1.00 107.01 ? 432  VAL A CG1   1 
ATOM   3406  C  CG2   . VAL A 1 428  ? -7.926  -33.260  -11.220 1.00 100.91 ? 432  VAL A CG2   1 
ATOM   3407  N  N     . VAL A 1 429  ? -7.947  -37.419  -8.855  1.00 112.40 ? 433  VAL A N     1 
ATOM   3408  C  CA    . VAL A 1 429  ? -7.366  -38.560  -8.146  1.00 110.84 ? 433  VAL A CA    1 
ATOM   3409  C  C     . VAL A 1 429  ? -7.173  -39.761  -9.067  1.00 118.22 ? 433  VAL A C     1 
ATOM   3410  O  O     . VAL A 1 429  ? -8.100  -40.146  -9.771  1.00 132.25 ? 433  VAL A O     1 
ATOM   3411  C  CB    . VAL A 1 429  ? -8.253  -38.999  -6.969  1.00 107.01 ? 433  VAL A CB    1 
ATOM   3412  C  CG1   . VAL A 1 429  ? -7.564  -40.097  -6.160  1.00 109.83 ? 433  VAL A CG1   1 
ATOM   3413  C  CG2   . VAL A 1 429  ? -8.594  -37.816  -6.082  1.00 114.41 ? 433  VAL A CG2   1 
ATOM   3414  N  N     . GLU A 1 430  ? -5.987  -40.365  -9.061  1.00 110.56 ? 434  GLU A N     1 
ATOM   3415  C  CA    . GLU A 1 430  ? -5.801  -41.583  -9.834  1.00 98.29  ? 434  GLU A CA    1 
ATOM   3416  C  C     . GLU A 1 430  ? -6.131  -42.821  -8.994  1.00 92.87  ? 434  GLU A C     1 
ATOM   3417  O  O     . GLU A 1 430  ? -5.682  -42.977  -7.865  1.00 98.37  ? 434  GLU A O     1 
ATOM   3418  C  CB    . GLU A 1 430  ? -4.382  -41.664  -10.415 1.00 110.04 ? 434  GLU A CB    1 
ATOM   3419  C  CG    . GLU A 1 430  ? -3.259  -41.949  -9.439  1.00 124.41 ? 434  GLU A CG    1 
ATOM   3420  C  CD    . GLU A 1 430  ? -1.998  -42.427  -10.145 1.00 138.60 ? 434  GLU A CD    1 
ATOM   3421  O  OE1   . GLU A 1 430  ? -0.920  -42.430  -9.510  1.00 151.22 ? 434  GLU A OE1   1 
ATOM   3422  O  OE2   . GLU A 1 430  ? -2.086  -42.804  -11.335 1.00 126.93 ? 434  GLU A OE2   1 
ATOM   3423  N  N     . ASN A 1 431  ? -6.947  -43.686  -9.581  1.00 104.89 ? 435  ASN A N     1 
ATOM   3424  C  CA    . ASN A 1 431  ? -7.487  -44.892  -8.959  1.00 109.74 ? 435  ASN A CA    1 
ATOM   3425  C  C     . ASN A 1 431  ? -6.400  -45.908  -8.560  1.00 105.29 ? 435  ASN A C     1 
ATOM   3426  O  O     . ASN A 1 431  ? -5.213  -45.673  -8.784  1.00 91.71  ? 435  ASN A O     1 
ATOM   3427  C  CB    . ASN A 1 431  ? -8.507  -45.505  -9.941  1.00 132.36 ? 435  ASN A CB    1 
ATOM   3428  C  CG    . ASN A 1 431  ? -9.135  -46.785  -9.437  1.00 153.80 ? 435  ASN A CG    1 
ATOM   3429  O  OD1   . ASN A 1 431  ? -8.993  -47.838  -10.059 1.00 159.83 ? 435  ASN A OD1   1 
ATOM   3430  N  ND2   . ASN A 1 431  ? -9.818  -46.709  -8.299  1.00 161.44 ? 435  ASN A ND2   1 
ATOM   3431  N  N     . ASP A 1 432  ? -6.807  -47.012  -7.931  1.00 128.96 ? 436  ASP A N     1 
ATOM   3432  C  CA    . ASP A 1 432  ? -5.932  -48.164  -7.703  1.00 137.49 ? 436  ASP A CA    1 
ATOM   3433  C  C     . ASP A 1 432  ? -5.339  -48.622  -9.033  1.00 127.65 ? 436  ASP A C     1 
ATOM   3434  O  O     . ASP A 1 432  ? -4.217  -49.124  -9.102  1.00 119.54 ? 436  ASP A O     1 
ATOM   3435  C  CB    . ASP A 1 432  ? -6.701  -49.321  -7.052  1.00 150.04 ? 436  ASP A CB    1 
ATOM   3436  C  CG    . ASP A 1 432  ? -7.647  -48.860  -5.957  1.00 157.00 ? 436  ASP A CG    1 
ATOM   3437  O  OD1   . ASP A 1 432  ? -7.228  -48.828  -4.780  1.00 162.83 ? 436  ASP A OD1   1 
ATOM   3438  O  OD2   . ASP A 1 432  ? -8.814  -48.539  -6.272  1.00 160.23 ? 436  ASP A OD2   1 
ATOM   3439  N  N     . GLN A 1 433  ? -6.125  -48.450  -10.088 1.00 122.07 ? 437  GLN A N     1 
ATOM   3440  C  CA    . GLN A 1 433  ? -5.677  -48.683  -11.453 1.00 116.80 ? 437  GLN A CA    1 
ATOM   3441  C  C     . GLN A 1 433  ? -5.245  -47.353  -12.067 1.00 118.35 ? 437  GLN A C     1 
ATOM   3442  O  O     . GLN A 1 433  ? -5.068  -46.362  -11.361 1.00 123.93 ? 437  GLN A O     1 
ATOM   3443  C  CB    . GLN A 1 433  ? -6.785  -49.334  -12.281 1.00 111.00 ? 437  GLN A CB    1 
ATOM   3444  C  CG    . GLN A 1 433  ? -7.016  -50.811  -11.961 1.00 121.00 ? 437  GLN A CG    1 
ATOM   3445  C  CD    . GLN A 1 433  ? -7.473  -51.047  -10.531 1.00 131.97 ? 437  GLN A CD    1 
ATOM   3446  O  OE1   . GLN A 1 433  ? -8.535  -50.577  -10.120 1.00 130.22 ? 437  GLN A OE1   1 
ATOM   3447  N  NE2   . GLN A 1 433  ? -6.664  -51.772  -9.763  1.00 138.16 ? 437  GLN A NE2   1 
ATOM   3448  N  N     . GLY A 1 434  ? -5.089  -47.320  -13.382 1.00 125.25 ? 438  GLY A N     1 
ATOM   3449  C  CA    . GLY A 1 434  ? -4.518  -46.157  -14.032 1.00 125.24 ? 438  GLY A CA    1 
ATOM   3450  C  C     . GLY A 1 434  ? -5.390  -44.917  -14.044 1.00 125.19 ? 438  GLY A C     1 
ATOM   3451  O  O     . GLY A 1 434  ? -4.880  -43.800  -14.011 1.00 125.71 ? 438  GLY A O     1 
ATOM   3452  N  N     . GLU A 1 435  ? -6.704  -45.118  -14.074 1.00 131.15 ? 439  GLU A N     1 
ATOM   3453  C  CA    . GLU A 1 435  ? -7.656  -44.050  -14.374 1.00 126.86 ? 439  GLU A CA    1 
ATOM   3454  C  C     . GLU A 1 435  ? -7.591  -42.845  -13.446 1.00 118.38 ? 439  GLU A C     1 
ATOM   3455  O  O     . GLU A 1 435  ? -7.609  -42.982  -12.231 1.00 117.45 ? 439  GLU A O     1 
ATOM   3456  C  CB    . GLU A 1 435  ? -9.075  -44.613  -14.358 1.00 133.37 ? 439  GLU A CB    1 
ATOM   3457  C  CG    . GLU A 1 435  ? -9.275  -45.774  -15.307 1.00 144.88 ? 439  GLU A CG    1 
ATOM   3458  C  CD    . GLU A 1 435  ? -10.575 -46.501  -15.059 1.00 151.29 ? 439  GLU A CD    1 
ATOM   3459  O  OE1   . GLU A 1 435  ? -11.090 -46.424  -13.924 1.00 148.72 ? 439  GLU A OE1   1 
ATOM   3460  O  OE2   . GLU A 1 435  ? -11.081 -47.146  -15.999 1.00 159.68 ? 439  GLU A OE2   1 
ATOM   3461  N  N     . VAL A 1 436  ? -7.520  -41.661  -14.044 1.00 113.60 ? 440  VAL A N     1 
ATOM   3462  C  CA    . VAL A 1 436  ? -7.617  -40.410  -13.309 1.00 102.26 ? 440  VAL A CA    1 
ATOM   3463  C  C     . VAL A 1 436  ? -9.068  -39.930  -13.307 1.00 105.91 ? 440  VAL A C     1 
ATOM   3464  O  O     . VAL A 1 436  ? -9.602  -39.500  -14.326 1.00 109.92 ? 440  VAL A O     1 
ATOM   3465  C  CB    . VAL A 1 436  ? -6.689  -39.318  -13.900 1.00 95.99  ? 440  VAL A CB    1 
ATOM   3466  C  CG1   . VAL A 1 436  ? -5.249  -39.552  -13.461 1.00 90.15  ? 440  VAL A CG1   1 
ATOM   3467  C  CG2   . VAL A 1 436  ? -6.781  -39.280  -15.421 1.00 110.30 ? 440  VAL A CG2   1 
ATOM   3468  N  N     . VAL A 1 437  ? -9.709  -40.023  -12.151 1.00 112.69 ? 441  VAL A N     1 
ATOM   3469  C  CA    . VAL A 1 437  ? -11.101 -39.624  -12.016 1.00 111.70 ? 441  VAL A CA    1 
ATOM   3470  C  C     . VAL A 1 437  ? -11.247 -38.346  -11.193 1.00 114.95 ? 441  VAL A C     1 
ATOM   3471  O  O     . VAL A 1 437  ? -10.313 -37.909  -10.513 1.00 114.88 ? 441  VAL A O     1 
ATOM   3472  C  CB    . VAL A 1 437  ? -11.945 -40.734  -11.363 1.00 113.65 ? 441  VAL A CB    1 
ATOM   3473  C  CG1   . VAL A 1 437  ? -11.676 -42.068  -12.041 1.00 118.43 ? 441  VAL A CG1   1 
ATOM   3474  C  CG2   . VAL A 1 437  ? -11.649 -40.823  -9.873  1.00 117.03 ? 441  VAL A CG2   1 
ATOM   3475  N  N     . ARG A 1 438  ? -12.428 -37.749  -11.279 1.00 113.18 ? 442  ARG A N     1 
ATOM   3476  C  CA    . ARG A 1 438  ? -12.768 -36.583  -10.483 1.00 109.24 ? 442  ARG A CA    1 
ATOM   3477  C  C     . ARG A 1 438  ? -13.500 -37.023  -9.226  1.00 113.22 ? 442  ARG A C     1 
ATOM   3478  O  O     . ARG A 1 438  ? -14.605 -37.562  -9.286  1.00 118.60 ? 442  ARG A O     1 
ATOM   3479  C  CB    . ARG A 1 438  ? -13.619 -35.600  -11.292 1.00 96.50  ? 442  ARG A CB    1 
ATOM   3480  C  CG    . ARG A 1 438  ? -12.889 -34.323  -11.677 1.00 79.96  ? 442  ARG A CG    1 
ATOM   3481  C  CD    . ARG A 1 438  ? -13.568 -33.629  -12.847 1.00 87.34  ? 442  ARG A CD    1 
ATOM   3482  N  NE    . ARG A 1 438  ? -15.015 -33.527  -12.673 1.00 90.50  ? 442  ARG A NE    1 
ATOM   3483  C  CZ    . ARG A 1 438  ? -15.665 -32.384  -12.487 1.00 94.24  ? 442  ARG A CZ    1 
ATOM   3484  N  NH1   . ARG A 1 438  ? -14.999 -31.236  -12.444 1.00 92.97  ? 442  ARG A NH1   1 
ATOM   3485  N  NH2   . ARG A 1 438  ? -16.984 -32.392  -12.342 1.00 90.84  ? 442  ARG A NH2   1 
ATOM   3486  N  N     . GLU A 1 439  ? -12.861 -36.790  -8.088  1.00 118.94 ? 443  GLU A N     1 
ATOM   3487  C  CA    . GLU A 1 439  ? -13.391 -37.177  -6.792  1.00 122.72 ? 443  GLU A CA    1 
ATOM   3488  C  C     . GLU A 1 439  ? -13.895 -35.945  -6.050  1.00 114.68 ? 443  GLU A C     1 
ATOM   3489  O  O     . GLU A 1 439  ? -13.131 -35.014  -5.792  1.00 104.89 ? 443  GLU A O     1 
ATOM   3490  C  CB    . GLU A 1 439  ? -12.313 -37.896  -5.973  1.00 129.05 ? 443  GLU A CB    1 
ATOM   3491  C  CG    . GLU A 1 439  ? -12.834 -38.978  -5.044  1.00 133.81 ? 443  GLU A CG    1 
ATOM   3492  C  CD    . GLU A 1 439  ? -11.768 -39.472  -4.079  1.00 141.71 ? 443  GLU A CD    1 
ATOM   3493  O  OE1   . GLU A 1 439  ? -11.073 -40.459  -4.405  1.00 149.10 ? 443  GLU A OE1   1 
ATOM   3494  O  OE2   . GLU A 1 439  ? -11.623 -38.870  -2.992  1.00 144.84 ? 443  GLU A OE2   1 
ATOM   3495  N  N     . PHE A 1 440  ? -15.185 -35.935  -5.729  1.00 103.73 ? 444  PHE A N     1 
ATOM   3496  C  CA    . PHE A 1 440  ? -15.759 -34.858  -4.938  1.00 98.62  ? 444  PHE A CA    1 
ATOM   3497  C  C     . PHE A 1 440  ? -15.616 -35.144  -3.449  1.00 105.04 ? 444  PHE A C     1 
ATOM   3498  O  O     . PHE A 1 440  ? -16.228 -36.080  -2.932  1.00 116.63 ? 444  PHE A O     1 
ATOM   3499  C  CB    . PHE A 1 440  ? -17.230 -34.651  -5.292  1.00 91.44  ? 444  PHE A CB    1 
ATOM   3500  C  CG    . PHE A 1 440  ? -17.444 -33.871  -6.554  1.00 105.11 ? 444  PHE A CG    1 
ATOM   3501  C  CD1   . PHE A 1 440  ? -17.630 -32.496  -6.510  1.00 109.69 ? 444  PHE A CD1   1 
ATOM   3502  C  CD2   . PHE A 1 440  ? -17.454 -34.506  -7.785  1.00 105.21 ? 444  PHE A CD2   1 
ATOM   3503  C  CE1   . PHE A 1 440  ? -17.823 -31.770  -7.668  1.00 107.53 ? 444  PHE A CE1   1 
ATOM   3504  C  CE2   . PHE A 1 440  ? -17.648 -33.784  -8.947  1.00 103.06 ? 444  PHE A CE2   1 
ATOM   3505  C  CZ    . PHE A 1 440  ? -17.832 -32.416  -8.887  1.00 109.93 ? 444  PHE A CZ    1 
ATOM   3506  N  N     . MET A 1 441  ? -14.802 -34.343  -2.765  1.00 99.99  ? 445  MET A N     1 
ATOM   3507  C  CA    . MET A 1 441  ? -14.648 -34.476  -1.319  1.00 83.94  ? 445  MET A CA    1 
ATOM   3508  C  C     . MET A 1 441  ? -15.973 -34.142  -0.649  1.00 91.11  ? 445  MET A C     1 
ATOM   3509  O  O     . MET A 1 441  ? -16.638 -33.184  -1.026  1.00 100.50 ? 445  MET A O     1 
ATOM   3510  C  CB    . MET A 1 441  ? -13.539 -33.565  -0.809  1.00 87.80  ? 445  MET A CB    1 
ATOM   3511  C  CG    . MET A 1 441  ? -12.238 -33.647  -1.611  1.00 69.99  ? 445  MET A CG    1 
ATOM   3512  S  SD    . MET A 1 441  ? -11.260 -35.104  -1.248  1.00 113.07 ? 445  MET A SD    1 
ATOM   3513  C  CE    . MET A 1 441  ? -10.715 -34.746  0.413   1.00 121.50 ? 445  MET A CE    1 
ATOM   3514  N  N     . LYS A 1 442  ? -16.371 -34.938  0.335   1.00 98.53  ? 446  LYS A N     1 
ATOM   3515  C  CA    . LYS A 1 442  ? -17.691 -34.768  0.930   1.00 113.74 ? 446  LYS A CA    1 
ATOM   3516  C  C     . LYS A 1 442  ? -17.653 -34.023  2.259   1.00 113.21 ? 446  LYS A C     1 
ATOM   3517  O  O     . LYS A 1 442  ? -18.512 -33.174  2.521   1.00 110.49 ? 446  LYS A O     1 
ATOM   3518  C  CB    . LYS A 1 442  ? -18.375 -36.126  1.115   1.00 132.15 ? 446  LYS A CB    1 
ATOM   3519  C  CG    . LYS A 1 442  ? -18.799 -36.780  -0.197  1.00 141.47 ? 446  LYS A CG    1 
ATOM   3520  C  CD    . LYS A 1 442  ? -20.020 -37.672  -0.014  1.00 139.61 ? 446  LYS A CD    1 
ATOM   3521  C  CE    . LYS A 1 442  ? -20.488 -38.244  -1.345  1.00 135.49 ? 446  LYS A CE    1 
ATOM   3522  N  NZ    . LYS A 1 442  ? -21.810 -38.923  -1.230  1.00 133.67 ? 446  LYS A NZ    1 
ATOM   3523  N  N     . ASP A 1 443  ? -16.660 -34.323  3.093   1.00 109.96 ? 447  ASP A N     1 
ATOM   3524  C  CA    . ASP A 1 443  ? -16.604 -33.716  4.423   1.00 116.40 ? 447  ASP A CA    1 
ATOM   3525  C  C     . ASP A 1 443  ? -15.185 -33.304  4.802   1.00 115.01 ? 447  ASP A C     1 
ATOM   3526  O  O     . ASP A 1 443  ? -14.400 -34.119  5.291   1.00 125.05 ? 447  ASP A O     1 
ATOM   3527  C  CB    . ASP A 1 443  ? -17.165 -34.682  5.468   1.00 131.08 ? 447  ASP A CB    1 
ATOM   3528  C  CG    . ASP A 1 443  ? -17.743 -33.970  6.666   1.00 144.86 ? 447  ASP A CG    1 
ATOM   3529  O  OD1   . ASP A 1 443  ? -17.271 -32.858  6.980   1.00 153.38 ? 447  ASP A OD1   1 
ATOM   3530  O  OD2   . ASP A 1 443  ? -18.673 -34.523  7.292   1.00 149.35 ? 447  ASP A OD2   1 
ATOM   3531  N  N     . THR A 1 444  ? -14.864 -32.034  4.576   1.00 93.36  ? 448  THR A N     1 
ATOM   3532  C  CA    . THR A 1 444  ? -13.530 -31.511  4.860   1.00 76.23  ? 448  THR A CA    1 
ATOM   3533  C  C     . THR A 1 444  ? -13.607 -30.181  5.589   1.00 73.12  ? 448  THR A C     1 
ATOM   3534  O  O     . THR A 1 444  ? -14.693 -29.641  5.792   1.00 77.63  ? 448  THR A O     1 
ATOM   3535  C  CB    . THR A 1 444  ? -12.702 -31.317  3.566   1.00 77.16  ? 448  THR A CB    1 
ATOM   3536  O  OG1   . THR A 1 444  ? -13.437 -30.494  2.662   1.00 73.98  ? 448  THR A OG1   1 
ATOM   3537  C  CG2   . THR A 1 444  ? -12.411 -32.652  2.895   1.00 75.15  ? 448  THR A CG2   1 
ATOM   3538  N  N     . ASP A 1 445  ? -12.446 -29.650  5.957   1.00 63.57  ? 449  ASP A N     1 
ATOM   3539  C  CA    . ASP A 1 445  ? -12.374 -28.398  6.696   1.00 66.65  ? 449  ASP A CA    1 
ATOM   3540  C  C     . ASP A 1 445  ? -12.850 -27.232  5.839   1.00 75.55  ? 449  ASP A C     1 
ATOM   3541  O  O     . ASP A 1 445  ? -13.500 -26.303  6.332   1.00 82.68  ? 449  ASP A O     1 
ATOM   3542  C  CB    . ASP A 1 445  ? -10.944 -28.148  7.193   1.00 76.98  ? 449  ASP A CB    1 
ATOM   3543  C  CG    . ASP A 1 445  ? -10.886 -27.123  8.319   1.00 97.30  ? 449  ASP A CG    1 
ATOM   3544  O  OD1   . ASP A 1 445  ? -11.024 -27.515  9.494   1.00 111.27 ? 449  ASP A OD1   1 
ATOM   3545  O  OD2   . ASP A 1 445  ? -10.702 -25.924  8.034   1.00 110.76 ? 449  ASP A OD2   1 
ATOM   3546  N  N     . SER A 1 446  ? -12.523 -27.292  4.552   1.00 80.78  ? 450  SER A N     1 
ATOM   3547  C  CA    . SER A 1 446  ? -12.874 -26.228  3.617   1.00 68.02  ? 450  SER A CA    1 
ATOM   3548  C  C     . SER A 1 446  ? -14.377 -26.166  3.352   1.00 73.00  ? 450  SER A C     1 
ATOM   3549  O  O     . SER A 1 446  ? -14.984 -25.097  3.344   1.00 88.02  ? 450  SER A O     1 
ATOM   3550  C  CB    . SER A 1 446  ? -12.116 -26.421  2.316   1.00 61.95  ? 450  SER A CB    1 
ATOM   3551  O  OG    . SER A 1 446  ? -12.373 -27.701  1.776   1.00 81.80  ? 450  SER A OG    1 
ATOM   3552  N  N     . ILE A 1 447  ? -14.980 -27.329  3.151   1.00 67.30  ? 451  ILE A N     1 
ATOM   3553  C  CA    . ILE A 1 447  ? -16.418 -27.408  2.937   1.00 79.13  ? 451  ILE A CA    1 
ATOM   3554  C  C     . ILE A 1 447  ? -17.166 -27.037  4.206   1.00 72.82  ? 451  ILE A C     1 
ATOM   3555  O  O     . ILE A 1 447  ? -18.260 -26.477  4.158   1.00 77.83  ? 451  ILE A O     1 
ATOM   3556  C  CB    . ILE A 1 447  ? -16.849 -28.819  2.476   1.00 86.42  ? 451  ILE A CB    1 
ATOM   3557  C  CG1   . ILE A 1 447  ? -16.032 -29.241  1.257   1.00 95.65  ? 451  ILE A CG1   1 
ATOM   3558  C  CG2   . ILE A 1 447  ? -18.333 -28.850  2.145   1.00 80.89  ? 451  ILE A CG2   1 
ATOM   3559  C  CD1   . ILE A 1 447  ? -16.256 -30.677  0.866   1.00 104.77 ? 451  ILE A CD1   1 
ATOM   3560  N  N     . ASN A 1 448  ? -16.566 -27.345  5.349   1.00 78.23  ? 452  ASN A N     1 
ATOM   3561  C  CA    . ASN A 1 448  ? -17.138 -26.939  6.626   1.00 79.58  ? 452  ASN A CA    1 
ATOM   3562  C  C     . ASN A 1 448  ? -17.123 -25.422  6.745   1.00 71.82  ? 452  ASN A C     1 
ATOM   3563  O  O     . ASN A 1 448  ? -18.113 -24.797  7.137   1.00 71.57  ? 452  ASN A O     1 
ATOM   3564  C  CB    . ASN A 1 448  ? -16.383 -27.587  7.792   1.00 73.61  ? 452  ASN A CB    1 
ATOM   3565  C  CG    . ASN A 1 448  ? -16.931 -27.181  9.131   1.00 69.43  ? 452  ASN A CG    1 
ATOM   3566  O  OD1   . ASN A 1 448  ? -18.090 -27.459  9.445   1.00 71.46  ? 452  ASN A OD1   1 
ATOM   3567  N  ND2   . ASN A 1 448  ? -16.107 -26.500  9.930   1.00 69.49  ? 452  ASN A ND2   1 
ATOM   3568  N  N     . LEU A 1 449  ? -15.985 -24.840  6.383   1.00 69.38  ? 453  LEU A N     1 
ATOM   3569  C  CA    . LEU A 1 449  ? -15.837 -23.391  6.291   1.00 69.08  ? 453  LEU A CA    1 
ATOM   3570  C  C     . LEU A 1 449  ? -16.943 -22.779  5.438   1.00 71.41  ? 453  LEU A C     1 
ATOM   3571  O  O     . LEU A 1 449  ? -17.601 -21.814  5.847   1.00 79.57  ? 453  LEU A O     1 
ATOM   3572  C  CB    . LEU A 1 449  ? -14.467 -23.039  5.716   1.00 51.31  ? 453  LEU A CB    1 
ATOM   3573  C  CG    . LEU A 1 449  ? -14.215 -21.581  5.384   1.00 57.83  ? 453  LEU A CG    1 
ATOM   3574  C  CD1   . LEU A 1 449  ? -14.082 -20.742  6.653   1.00 49.65  ? 453  LEU A CD1   1 
ATOM   3575  C  CD2   . LEU A 1 449  ? -12.968 -21.450  4.496   1.00 60.72  ? 453  LEU A CD2   1 
ATOM   3576  N  N     . TYR A 1 450  ? -17.163 -23.361  4.262   1.00 67.18  ? 454  TYR A N     1 
ATOM   3577  C  CA    . TYR A 1 450  ? -18.227 -22.883  3.393   1.00 66.71  ? 454  TYR A CA    1 
ATOM   3578  C  C     . TYR A 1 450  ? -19.591 -22.972  4.052   1.00 69.62  ? 454  TYR A C     1 
ATOM   3579  O  O     . TYR A 1 450  ? -20.353 -22.014  4.031   1.00 66.84  ? 454  TYR A O     1 
ATOM   3580  C  CB    . TYR A 1 450  ? -18.276 -23.653  2.073   1.00 62.00  ? 454  TYR A CB    1 
ATOM   3581  C  CG    . TYR A 1 450  ? -19.549 -23.347  1.313   1.00 62.38  ? 454  TYR A CG    1 
ATOM   3582  C  CD1   . TYR A 1 450  ? -19.745 -22.105  0.712   1.00 65.73  ? 454  TYR A CD1   1 
ATOM   3583  C  CD2   . TYR A 1 450  ? -20.573 -24.274  1.241   1.00 60.89  ? 454  TYR A CD2   1 
ATOM   3584  C  CE1   . TYR A 1 450  ? -20.911 -21.811  0.052   1.00 62.63  ? 454  TYR A CE1   1 
ATOM   3585  C  CE2   . TYR A 1 450  ? -21.745 -23.987  0.568   1.00 66.12  ? 454  TYR A CE2   1 
ATOM   3586  C  CZ    . TYR A 1 450  ? -21.909 -22.759  -0.023  1.00 63.98  ? 454  TYR A CZ    1 
ATOM   3587  O  OH    . TYR A 1 450  ? -23.079 -22.489  -0.694  1.00 64.04  ? 454  TYR A OH    1 
ATOM   3588  N  N     . LYS A 1 451  ? -19.907 -24.130  4.620   1.00 69.17  ? 455  LYS A N     1 
ATOM   3589  C  CA    . LYS A 1 451  ? -21.212 -24.336  5.249   1.00 68.77  ? 455  LYS A CA    1 
ATOM   3590  C  C     . LYS A 1 451  ? -21.458 -23.338  6.372   1.00 70.53  ? 455  LYS A C     1 
ATOM   3591  O  O     . LYS A 1 451  ? -22.585 -22.878  6.568   1.00 75.52  ? 455  LYS A O     1 
ATOM   3592  C  CB    . LYS A 1 451  ? -21.333 -25.765  5.777   1.00 77.86  ? 455  LYS A CB    1 
ATOM   3593  C  CG    . LYS A 1 451  ? -21.383 -26.820  4.679   1.00 91.67  ? 455  LYS A CG    1 
ATOM   3594  C  CD    . LYS A 1 451  ? -21.514 -28.216  5.261   1.00 102.03 ? 455  LYS A CD    1 
ATOM   3595  C  CE    . LYS A 1 451  ? -21.592 -29.264  4.169   1.00 102.79 ? 455  LYS A CE    1 
ATOM   3596  N  NZ    . LYS A 1 451  ? -21.627 -30.642  4.742   1.00 106.47 ? 455  LYS A NZ    1 
ATOM   3597  N  N     . ASN A 1 452  ? -20.395 -22.987  7.091   1.00 70.31  ? 456  ASN A N     1 
ATOM   3598  C  CA    . ASN A 1 452  ? -20.502 -22.012  8.172   1.00 75.74  ? 456  ASN A CA    1 
ATOM   3599  C  C     . ASN A 1 452  ? -20.721 -20.598  7.652   1.00 73.59  ? 456  ASN A C     1 
ATOM   3600  O  O     . ASN A 1 452  ? -21.539 -19.844  8.208   1.00 69.99  ? 456  ASN A O     1 
ATOM   3601  C  CB    . ASN A 1 452  ? -19.257 -22.052  9.063   1.00 79.04  ? 456  ASN A CB    1 
ATOM   3602  C  CG    . ASN A 1 452  ? -19.221 -23.273  9.953   1.00 81.87  ? 456  ASN A CG    1 
ATOM   3603  O  OD1   . ASN A 1 452  ? -20.260 -23.754  10.414  1.00 89.46  ? 456  ASN A OD1   1 
ATOM   3604  N  ND2   . ASN A 1 452  ? -18.022 -23.790  10.195  1.00 84.91  ? 456  ASN A ND2   1 
ATOM   3605  N  N     . MET A 1 453  ? -19.995 -20.233  6.592   1.00 76.12  ? 457  MET A N     1 
ATOM   3606  C  CA    . MET A 1 453  ? -20.198 -18.916  5.978   1.00 64.33  ? 457  MET A CA    1 
ATOM   3607  C  C     . MET A 1 453  ? -21.615 -18.794  5.410   1.00 64.14  ? 457  MET A C     1 
ATOM   3608  O  O     . MET A 1 453  ? -22.274 -17.771  5.578   1.00 85.12  ? 457  MET A O     1 
ATOM   3609  C  CB    . MET A 1 453  ? -19.166 -18.650  4.893   1.00 54.05  ? 457  MET A CB    1 
ATOM   3610  C  CG    . MET A 1 453  ? -17.743 -18.535  5.423   1.00 58.71  ? 457  MET A CG    1 
ATOM   3611  S  SD    . MET A 1 453  ? -16.534 -17.854  4.229   1.00 58.02  ? 457  MET A SD    1 
ATOM   3612  C  CE    . MET A 1 453  ? -17.067 -16.142  4.189   1.00 100.75 ? 457  MET A CE    1 
ATOM   3613  N  N     . ARG A 1 454  ? -22.084 -19.857  4.767   1.00 58.31  ? 458  ARG A N     1 
ATOM   3614  C  CA    . ARG A 1 454  ? -23.445 -19.929  4.248   1.00 60.98  ? 458  ARG A CA    1 
ATOM   3615  C  C     . ARG A 1 454  ? -24.466 -19.787  5.369   1.00 69.16  ? 458  ARG A C     1 
ATOM   3616  O  O     . ARG A 1 454  ? -25.473 -19.097  5.213   1.00 72.82  ? 458  ARG A O     1 
ATOM   3617  C  CB    . ARG A 1 454  ? -23.668 -21.251  3.497   1.00 59.25  ? 458  ARG A CB    1 
ATOM   3618  C  CG    . ARG A 1 454  ? -25.071 -21.428  2.938   1.00 74.16  ? 458  ARG A CG    1 
ATOM   3619  C  CD    . ARG A 1 454  ? -25.292 -22.848  2.442   1.00 99.57  ? 458  ARG A CD    1 
ATOM   3620  N  NE    . ARG A 1 454  ? -25.233 -23.823  3.531   1.00 127.73 ? 458  ARG A NE    1 
ATOM   3621  C  CZ    . ARG A 1 454  ? -25.188 -25.141  3.361   1.00 130.41 ? 458  ARG A CZ    1 
ATOM   3622  N  NH1   . ARG A 1 454  ? -25.190 -25.655  2.140   1.00 125.76 ? 458  ARG A NH1   1 
ATOM   3623  N  NH2   . ARG A 1 454  ? -25.134 -25.946  4.413   1.00 133.42 ? 458  ARG A NH2   1 
ATOM   3624  N  N     . GLU A 1 455  ? -24.202 -20.446  6.494   1.00 78.27  ? 459  GLU A N     1 
ATOM   3625  C  CA    . GLU A 1 455  ? -25.093 -20.385  7.650   1.00 88.77  ? 459  GLU A CA    1 
ATOM   3626  C  C     . GLU A 1 455  ? -25.197 -18.961  8.196   1.00 83.98  ? 459  GLU A C     1 
ATOM   3627  O  O     . GLU A 1 455  ? -26.302 -18.437  8.406   1.00 80.31  ? 459  GLU A O     1 
ATOM   3628  C  CB    . GLU A 1 455  ? -24.608 -21.340  8.741   1.00 95.48  ? 459  GLU A CB    1 
ATOM   3629  C  CG    . GLU A 1 455  ? -25.459 -21.355  9.997   1.00 109.05 ? 459  GLU A CG    1 
ATOM   3630  C  CD    . GLU A 1 455  ? -25.028 -22.429  10.973  1.00 121.69 ? 459  GLU A CD    1 
ATOM   3631  O  OE1   . GLU A 1 455  ? -24.779 -23.566  10.527  1.00 133.70 ? 459  GLU A OE1   1 
ATOM   3632  O  OE2   . GLU A 1 455  ? -24.929 -22.137  12.182  1.00 126.34 ? 459  GLU A OE2   1 
ATOM   3633  N  N     . THR A 1 456  ? -24.039 -18.341  8.415   1.00 70.57  ? 460  THR A N     1 
ATOM   3634  C  CA    . THR A 1 456  ? -23.984 -16.968  8.898   1.00 70.14  ? 460  THR A CA    1 
ATOM   3635  C  C     . THR A 1 456  ? -24.720 -16.027  7.953   1.00 85.31  ? 460  THR A C     1 
ATOM   3636  O  O     . THR A 1 456  ? -25.561 -15.217  8.390   1.00 95.54  ? 460  THR A O     1 
ATOM   3637  C  CB    . THR A 1 456  ? -22.534 -16.480  9.047   1.00 73.31  ? 460  THR A CB    1 
ATOM   3638  O  OG1   . THR A 1 456  ? -21.788 -17.402  9.855   1.00 71.06  ? 460  THR A OG1   1 
ATOM   3639  C  CG2   . THR A 1 456  ? -22.499 -15.090  9.685   1.00 69.51  ? 460  THR A CG2   1 
ATOM   3640  N  N     . LEU A 1 457  ? -24.406 -16.146  6.662   1.00 77.86  ? 461  LEU A N     1 
ATOM   3641  C  CA    . LEU A 1 457  ? -24.989 -15.271  5.662   1.00 72.07  ? 461  LEU A CA    1 
ATOM   3642  C  C     . LEU A 1 457  ? -26.498 -15.472  5.525   1.00 79.20  ? 461  LEU A C     1 
ATOM   3643  O  O     . LEU A 1 457  ? -27.217 -14.522  5.220   1.00 98.42  ? 461  LEU A O     1 
ATOM   3644  C  CB    . LEU A 1 457  ? -24.306 -15.477  4.317   1.00 72.94  ? 461  LEU A CB    1 
ATOM   3645  C  CG    . LEU A 1 457  ? -24.809 -14.635  3.139   1.00 67.77  ? 461  LEU A CG    1 
ATOM   3646  C  CD1   . LEU A 1 457  ? -24.750 -13.157  3.454   1.00 69.90  ? 461  LEU A CD1   1 
ATOM   3647  C  CD2   . LEU A 1 457  ? -24.015 -14.959  1.874   1.00 66.11  ? 461  LEU A CD2   1 
ATOM   3648  N  N     . VAL A 1 458  ? -26.978 -16.692  5.751   1.00 70.71  ? 462  VAL A N     1 
ATOM   3649  C  CA    . VAL A 1 458  ? -28.418 -16.959  5.710   1.00 66.62  ? 462  VAL A CA    1 
ATOM   3650  C  C     . VAL A 1 458  ? -29.113 -16.325  6.916   1.00 73.59  ? 462  VAL A C     1 
ATOM   3651  O  O     . VAL A 1 458  ? -30.182 -15.702  6.782   1.00 76.36  ? 462  VAL A O     1 
ATOM   3652  C  CB    . VAL A 1 458  ? -28.720 -18.474  5.669   1.00 55.75  ? 462  VAL A CB    1 
ATOM   3653  C  CG1   . VAL A 1 458  ? -30.150 -18.752  6.114   1.00 57.22  ? 462  VAL A CG1   1 
ATOM   3654  C  CG2   . VAL A 1 458  ? -28.490 -19.018  4.277   1.00 48.16  ? 462  VAL A CG2   1 
ATOM   3655  N  N     . TYR A 1 459  ? -28.503 -16.489  8.091   1.00 80.84  ? 463  TYR A N     1 
ATOM   3656  C  CA    . TYR A 1 459  ? -28.948 -15.783  9.296   1.00 79.00  ? 463  TYR A CA    1 
ATOM   3657  C  C     . TYR A 1 459  ? -29.152 -14.303  8.991   1.00 74.12  ? 463  TYR A C     1 
ATOM   3658  O  O     . TYR A 1 459  ? -30.272 -13.753  9.089   1.00 73.33  ? 463  TYR A O     1 
ATOM   3659  C  CB    . TYR A 1 459  ? -27.924 -15.938  10.425  1.00 84.55  ? 463  TYR A CB    1 
ATOM   3660  C  CG    . TYR A 1 459  ? -27.969 -17.243  11.210  1.00 91.71  ? 463  TYR A CG    1 
ATOM   3661  C  CD1   . TYR A 1 459  ? -29.173 -17.875  11.499  1.00 87.97  ? 463  TYR A CD1   1 
ATOM   3662  C  CD2   . TYR A 1 459  ? -26.795 -17.826  11.686  1.00 96.06  ? 463  TYR A CD2   1 
ATOM   3663  C  CE1   . TYR A 1 459  ? -29.203 -19.049  12.228  1.00 92.46  ? 463  TYR A CE1   1 
ATOM   3664  C  CE2   . TYR A 1 459  ? -26.816 -18.998  12.416  1.00 101.73 ? 463  TYR A CE2   1 
ATOM   3665  C  CZ    . TYR A 1 459  ? -28.020 -19.607  12.686  1.00 103.08 ? 463  TYR A CZ    1 
ATOM   3666  O  OH    . TYR A 1 459  ? -28.037 -20.779  13.414  1.00 110.45 ? 463  TYR A OH    1 
ATOM   3667  N  N     . LEU A 1 460  ? -28.052 -13.673  8.579   1.00 83.80  ? 464  LEU A N     1 
ATOM   3668  C  CA    . LEU A 1 460  ? -28.034 -12.238  8.301   1.00 80.56  ? 464  LEU A CA    1 
ATOM   3669  C  C     . LEU A 1 460  ? -28.996 -11.852  7.173   1.00 76.09  ? 464  LEU A C     1 
ATOM   3670  O  O     . LEU A 1 460  ? -29.523 -10.736  7.149   1.00 75.51  ? 464  LEU A O     1 
ATOM   3671  C  CB    . LEU A 1 460  ? -26.618 -11.789  7.955   1.00 67.57  ? 464  LEU A CB    1 
ATOM   3672  C  CG    . LEU A 1 460  ? -25.617 -11.959  9.092   1.00 68.49  ? 464  LEU A CG    1 
ATOM   3673  C  CD1   . LEU A 1 460  ? -24.199 -11.849  8.580   1.00 67.97  ? 464  LEU A CD1   1 
ATOM   3674  C  CD2   . LEU A 1 460  ? -25.882 -10.936  10.183  1.00 67.81  ? 464  LEU A CD2   1 
ATOM   3675  N  N     . THR A 1 461  ? -29.231 -12.778  6.249   1.00 68.24  ? 465  THR A N     1 
ATOM   3676  C  CA    . THR A 1 461  ? -30.146 -12.533  5.146   1.00 63.08  ? 465  THR A CA    1 
ATOM   3677  C  C     . THR A 1 461  ? -31.570 -12.443  5.670   1.00 72.50  ? 465  THR A C     1 
ATOM   3678  O  O     . THR A 1 461  ? -32.332 -11.584  5.244   1.00 84.13  ? 465  THR A O     1 
ATOM   3679  C  CB    . THR A 1 461  ? -30.064 -13.632  4.073   1.00 73.14  ? 465  THR A CB    1 
ATOM   3680  O  OG1   . THR A 1 461  ? -28.727 -13.710  3.564   1.00 86.50  ? 465  THR A OG1   1 
ATOM   3681  C  CG2   . THR A 1 461  ? -31.016 -13.341  2.924   1.00 63.41  ? 465  THR A CG2   1 
ATOM   3682  N  N     . HIS A 1 462  ? -31.933 -13.327  6.594   1.00 77.87  ? 466  HIS A N     1 
ATOM   3683  C  CA    . HIS A 1 462  ? -33.263 -13.256  7.192   1.00 80.12  ? 466  HIS A CA    1 
ATOM   3684  C  C     . HIS A 1 462  ? -33.423 -11.977  7.989   1.00 83.99  ? 466  HIS A C     1 
ATOM   3685  O  O     . HIS A 1 462  ? -34.493 -11.371  7.988   1.00 89.65  ? 466  HIS A O     1 
ATOM   3686  C  CB    . HIS A 1 462  ? -33.528 -14.454  8.093   1.00 75.01  ? 466  HIS A CB    1 
ATOM   3687  C  CG    . HIS A 1 462  ? -33.837 -15.708  7.343   1.00 82.17  ? 466  HIS A CG    1 
ATOM   3688  N  ND1   . HIS A 1 462  ? -34.679 -15.739  6.253   1.00 96.58  ? 466  HIS A ND1   1 
ATOM   3689  C  CD2   . HIS A 1 462  ? -33.398 -16.977  7.515   1.00 91.08  ? 466  HIS A CD2   1 
ATOM   3690  C  CE1   . HIS A 1 462  ? -34.753 -16.974  5.790   1.00 84.89  ? 466  HIS A CE1   1 
ATOM   3691  N  NE2   . HIS A 1 462  ? -33.980 -17.744  6.536   1.00 84.48  ? 466  HIS A NE2   1 
ATOM   3692  N  N     . LEU A 1 463  ? -32.355 -11.565  8.667   1.00 79.68  ? 467  LEU A N     1 
ATOM   3693  C  CA    . LEU A 1 463  ? -32.424 -10.319  9.431   1.00 90.05  ? 467  LEU A CA    1 
ATOM   3694  C  C     . LEU A 1 463  ? -32.723 -9.102   8.546   1.00 96.19  ? 467  LEU A C     1 
ATOM   3695  O  O     . LEU A 1 463  ? -33.244 -8.088   9.030   1.00 106.46 ? 467  LEU A O     1 
ATOM   3696  C  CB    . LEU A 1 463  ? -31.126 -10.083  10.208  1.00 87.76  ? 467  LEU A CB    1 
ATOM   3697  C  CG    . LEU A 1 463  ? -30.769 -11.063  11.330  1.00 83.39  ? 467  LEU A CG    1 
ATOM   3698  C  CD1   . LEU A 1 463  ? -29.865 -10.388  12.335  1.00 88.45  ? 467  LEU A CD1   1 
ATOM   3699  C  CD2   . LEU A 1 463  ? -32.009 -11.612  12.016  1.00 85.69  ? 467  LEU A CD2   1 
ATOM   3700  N  N     . ASP A 1 464  ? -32.397 -9.206   7.258   1.00 96.85  ? 468  ASP A N     1 
ATOM   3701  C  CA    . ASP A 1 464  ? -32.625 -8.113   6.308   1.00 94.90  ? 468  ASP A CA    1 
ATOM   3702  C  C     . ASP A 1 464  ? -32.473 -8.579   4.854   1.00 95.77  ? 468  ASP A C     1 
ATOM   3703  O  O     . ASP A 1 464  ? -31.359 -8.680   4.337   1.00 88.72  ? 468  ASP A O     1 
ATOM   3704  C  CB    . ASP A 1 464  ? -31.654 -6.963   6.580   1.00 97.59  ? 468  ASP A CB    1 
ATOM   3705  C  CG    . ASP A 1 464  ? -32.088 -5.662   5.937   1.00 108.18 ? 468  ASP A CG    1 
ATOM   3706  O  OD1   . ASP A 1 464  ? -32.557 -5.686   4.783   1.00 124.26 ? 468  ASP A OD1   1 
ATOM   3707  O  OD2   . ASP A 1 464  ? -31.953 -4.606   6.590   1.00 110.83 ? 468  ASP A OD2   1 
ATOM   3708  N  N     . TYR A 1 465  ? -33.594 -8.857   4.196   1.00 93.10  ? 469  TYR A N     1 
ATOM   3709  C  CA    . TYR A 1 465  ? -33.585 -9.275   2.798   1.00 95.54  ? 469  TYR A CA    1 
ATOM   3710  C  C     . TYR A 1 465  ? -33.072 -8.149   1.896   1.00 91.99  ? 469  TYR A C     1 
ATOM   3711  O  O     . TYR A 1 465  ? -32.258 -8.367   0.980   1.00 88.98  ? 469  TYR A O     1 
ATOM   3712  C  CB    . TYR A 1 465  ? -34.993 -9.703   2.370   1.00 110.67 ? 469  TYR A CB    1 
ATOM   3713  C  CG    . TYR A 1 465  ? -35.546 -10.871  3.160   1.00 124.24 ? 469  TYR A CG    1 
ATOM   3714  C  CD1   . TYR A 1 465  ? -34.746 -11.960  3.476   1.00 133.98 ? 469  TYR A CD1   1 
ATOM   3715  C  CD2   . TYR A 1 465  ? -36.865 -10.880  3.598   1.00 136.03 ? 469  TYR A CD2   1 
ATOM   3716  C  CE1   . TYR A 1 465  ? -35.241 -13.028  4.203   1.00 141.64 ? 469  TYR A CE1   1 
ATOM   3717  C  CE2   . TYR A 1 465  ? -37.371 -11.945  4.325   1.00 144.05 ? 469  TYR A CE2   1 
ATOM   3718  C  CZ    . TYR A 1 465  ? -36.553 -13.016  4.625   1.00 144.43 ? 469  TYR A CZ    1 
ATOM   3719  O  OH    . TYR A 1 465  ? -37.046 -14.079  5.348   1.00 143.88 ? 469  TYR A OH    1 
ATOM   3720  N  N     . VAL A 1 466  ? -33.551 -6.941   2.181   1.00 97.33  ? 470  VAL A N     1 
ATOM   3721  C  CA    . VAL A 1 466  ? -33.222 -5.749   1.406   1.00 92.98  ? 470  VAL A CA    1 
ATOM   3722  C  C     . VAL A 1 466  ? -31.716 -5.501   1.364   1.00 92.51  ? 470  VAL A C     1 
ATOM   3723  O  O     . VAL A 1 466  ? -31.143 -5.311   0.292   1.00 94.58  ? 470  VAL A O     1 
ATOM   3724  C  CB    . VAL A 1 466  ? -33.911 -4.503   1.978   1.00 104.77 ? 470  VAL A CB    1 
ATOM   3725  C  CG1   . VAL A 1 466  ? -33.912 -3.388   0.951   1.00 122.32 ? 470  VAL A CG1   1 
ATOM   3726  C  CG2   . VAL A 1 466  ? -35.331 -4.833   2.407   1.00 114.45 ? 470  VAL A CG2   1 
ATOM   3727  N  N     . ASP A 1 467  ? -31.083 -5.518   2.533   1.00 89.49  ? 471  ASP A N     1 
ATOM   3728  C  CA    . ASP A 1 467  ? -29.658 -5.233   2.651   1.00 92.08  ? 471  ASP A CA    1 
ATOM   3729  C  C     . ASP A 1 467  ? -28.813 -6.264   1.904   1.00 91.01  ? 471  ASP A C     1 
ATOM   3730  O  O     . ASP A 1 467  ? -27.792 -5.928   1.296   1.00 91.80  ? 471  ASP A O     1 
ATOM   3731  C  CB    . ASP A 1 467  ? -29.249 -5.186   4.122   1.00 100.71 ? 471  ASP A CB    1 
ATOM   3732  C  CG    . ASP A 1 467  ? -27.934 -4.468   4.340   1.00 113.85 ? 471  ASP A CG    1 
ATOM   3733  O  OD1   . ASP A 1 467  ? -27.629 -3.531   3.572   1.00 114.59 ? 471  ASP A OD1   1 
ATOM   3734  O  OD2   . ASP A 1 467  ? -27.209 -4.834   5.288   1.00 124.29 ? 471  ASP A OD2   1 
ATOM   3735  N  N     . THR A 1 468  ? -29.239 -7.523   1.947   1.00 83.97  ? 472  THR A N     1 
ATOM   3736  C  CA    . THR A 1 468  ? -28.485 -8.592   1.300   1.00 82.66  ? 472  THR A CA    1 
ATOM   3737  C  C     . THR A 1 468  ? -28.563 -8.479   -0.219  1.00 79.78  ? 472  THR A C     1 
ATOM   3738  O  O     . THR A 1 468  ? -27.529 -8.471   -0.908  1.00 75.47  ? 472  THR A O     1 
ATOM   3739  C  CB    . THR A 1 468  ? -28.988 -9.979   1.722   1.00 75.69  ? 472  THR A CB    1 
ATOM   3740  O  OG1   . THR A 1 468  ? -28.986 -10.071  3.151   1.00 91.56  ? 472  THR A OG1   1 
ATOM   3741  C  CG2   . THR A 1 468  ? -28.091 -11.059  1.147   1.00 63.08  ? 472  THR A CG2   1 
ATOM   3742  N  N     . GLU A 1 469  ? -29.786 -8.395   -0.737  1.00 75.50  ? 473  GLU A N     1 
ATOM   3743  C  CA    . GLU A 1 469  ? -29.972 -8.255   -2.178  1.00 84.30  ? 473  GLU A CA    1 
ATOM   3744  C  C     . GLU A 1 469  ? -29.263 -7.007   -2.682  1.00 89.27  ? 473  GLU A C     1 
ATOM   3745  O  O     . GLU A 1 469  ? -28.675 -7.001   -3.765  1.00 87.28  ? 473  GLU A O     1 
ATOM   3746  C  CB    . GLU A 1 469  ? -31.455 -8.199   -2.538  1.00 94.34  ? 473  GLU A CB    1 
ATOM   3747  C  CG    . GLU A 1 469  ? -31.719 -7.655   -3.937  1.00 114.81 ? 473  GLU A CG    1 
ATOM   3748  C  CD    . GLU A 1 469  ? -33.185 -7.716   -4.321  1.00 132.98 ? 473  GLU A CD    1 
ATOM   3749  O  OE1   . GLU A 1 469  ? -33.934 -8.483   -3.678  1.00 138.08 ? 473  GLU A OE1   1 
ATOM   3750  O  OE2   . GLU A 1 469  ? -33.588 -6.998   -5.263  1.00 137.39 ? 473  GLU A OE2   1 
ATOM   3751  N  N     . ARG A 1 470  ? -29.307 -5.954   -1.877  1.00 89.53  ? 474  ARG A N     1 
ATOM   3752  C  CA    . ARG A 1 470  ? -28.654 -4.717   -2.242  1.00 82.45  ? 474  ARG A CA    1 
ATOM   3753  C  C     . ARG A 1 470  ? -27.144 -4.875   -2.320  1.00 80.15  ? 474  ARG A C     1 
ATOM   3754  O  O     . ARG A 1 470  ? -26.504 -4.383   -3.248  1.00 98.03  ? 474  ARG A O     1 
ATOM   3755  C  CB    . ARG A 1 470  ? -29.004 -3.634   -1.249  1.00 79.87  ? 474  ARG A CB    1 
ATOM   3756  C  CG    . ARG A 1 470  ? -28.759 -2.282   -1.792  1.00 83.57  ? 474  ARG A CG    1 
ATOM   3757  C  CD    . ARG A 1 470  ? -28.397 -1.398   -0.694  1.00 87.98  ? 474  ARG A CD    1 
ATOM   3758  N  NE    . ARG A 1 470  ? -26.974 -1.424   -0.369  1.00 91.66  ? 474  ARG A NE    1 
ATOM   3759  C  CZ    . ARG A 1 470  ? -26.483 -1.864   0.787   1.00 114.14 ? 474  ARG A CZ    1 
ATOM   3760  N  NH1   . ARG A 1 470  ? -25.173 -1.846   1.005   1.00 123.46 ? 474  ARG A NH1   1 
ATOM   3761  N  NH2   . ARG A 1 470  ? -27.300 -2.323   1.732   1.00 112.38 ? 474  ARG A NH2   1 
ATOM   3762  N  N     . ILE A 1 471  ? -26.577 -5.562   -1.339  1.00 77.34  ? 475  ILE A N     1 
ATOM   3763  C  CA    . ILE A 1 471  ? -25.148 -5.830   -1.338  1.00 79.46  ? 475  ILE A CA    1 
ATOM   3764  C  C     . ILE A 1 471  ? -24.744 -6.603   -2.583  1.00 78.77  ? 475  ILE A C     1 
ATOM   3765  O  O     . ILE A 1 471  ? -23.868 -6.180   -3.322  1.00 84.85  ? 475  ILE A O     1 
ATOM   3766  C  CB    . ILE A 1 471  ? -24.712 -6.624   -0.089  1.00 75.28  ? 475  ILE A CB    1 
ATOM   3767  C  CG1   . ILE A 1 471  ? -24.679 -5.711   1.134   1.00 64.80  ? 475  ILE A CG1   1 
ATOM   3768  C  CG2   . ILE A 1 471  ? -23.341 -7.250   -0.307  1.00 73.92  ? 475  ILE A CG2   1 
ATOM   3769  C  CD1   . ILE A 1 471  ? -24.060 -6.343   2.343   1.00 71.54  ? 475  ILE A CD1   1 
ATOM   3770  N  N     . MET A 1 472  ? -25.409 -7.725   -2.828  1.00 79.01  ? 476  MET A N     1 
ATOM   3771  C  CA    . MET A 1 472  ? -25.046 -8.587   -3.951  1.00 78.58  ? 476  MET A CA    1 
ATOM   3772  C  C     . MET A 1 472  ? -25.234 -7.884   -5.289  1.00 88.25  ? 476  MET A C     1 
ATOM   3773  O  O     . MET A 1 472  ? -24.420 -8.035   -6.202  1.00 92.52  ? 476  MET A O     1 
ATOM   3774  C  CB    . MET A 1 472  ? -25.862 -9.881   -3.910  1.00 76.95  ? 476  MET A CB    1 
ATOM   3775  C  CG    . MET A 1 472  ? -25.588 -10.724  -2.665  1.00 76.53  ? 476  MET A CG    1 
ATOM   3776  S  SD    . MET A 1 472  ? -26.568 -12.232  -2.573  1.00 90.64  ? 476  MET A SD    1 
ATOM   3777  C  CE    . MET A 1 472  ? -25.862 -13.003  -1.124  1.00 85.26  ? 476  MET A CE    1 
ATOM   3778  N  N     . THR A 1 473  ? -26.303 -7.103   -5.399  1.00 92.62  ? 477  THR A N     1 
ATOM   3779  C  CA    . THR A 1 473  ? -26.568 -6.349   -6.625  1.00 87.12  ? 477  THR A CA    1 
ATOM   3780  C  C     . THR A 1 473  ? -25.480 -5.306   -6.857  1.00 81.66  ? 477  THR A C     1 
ATOM   3781  O  O     . THR A 1 473  ? -25.052 -5.091   -7.982  1.00 87.20  ? 477  THR A O     1 
ATOM   3782  C  CB    . THR A 1 473  ? -27.945 -5.653   -6.588  1.00 83.20  ? 477  THR A CB    1 
ATOM   3783  O  OG1   . THR A 1 473  ? -28.949 -6.600   -6.205  1.00 89.59  ? 477  THR A OG1   1 
ATOM   3784  C  CG2   . THR A 1 473  ? -28.292 -5.087   -7.942  1.00 81.50  ? 477  THR A CG2   1 
ATOM   3785  N  N     . GLU A 1 474  ? -25.021 -4.669   -5.786  1.00 80.04  ? 478  GLU A N     1 
ATOM   3786  C  CA    . GLU A 1 474  ? -23.908 -3.732   -5.898  1.00 85.00  ? 478  GLU A CA    1 
ATOM   3787  C  C     . GLU A 1 474  ? -22.621 -4.437   -6.326  1.00 83.95  ? 478  GLU A C     1 
ATOM   3788  O  O     . GLU A 1 474  ? -21.850 -3.891   -7.109  1.00 83.54  ? 478  GLU A O     1 
ATOM   3789  C  CB    . GLU A 1 474  ? -23.685 -2.986   -4.577  1.00 92.06  ? 478  GLU A CB    1 
ATOM   3790  C  CG    . GLU A 1 474  ? -24.473 -1.694   -4.469  1.00 106.23 ? 478  GLU A CG    1 
ATOM   3791  C  CD    . GLU A 1 474  ? -24.161 -0.922   -3.205  1.00 121.47 ? 478  GLU A CD    1 
ATOM   3792  O  OE1   . GLU A 1 474  ? -23.488 -1.481   -2.313  1.00 132.45 ? 478  GLU A OE1   1 
ATOM   3793  O  OE2   . GLU A 1 474  ? -24.587 0.248    -3.101  1.00 129.19 ? 478  GLU A OE2   1 
ATOM   3794  N  N     . LYS A 1 475  ? -22.387 -5.641   -5.807  1.00 78.25  ? 479  LYS A N     1 
ATOM   3795  C  CA    . LYS A 1 475  ? -21.198 -6.408   -6.174  1.00 70.09  ? 479  LYS A CA    1 
ATOM   3796  C  C     . LYS A 1 475  ? -21.233 -6.751   -7.662  1.00 75.35  ? 479  LYS A C     1 
ATOM   3797  O  O     . LYS A 1 475  ? -20.214 -6.691   -8.353  1.00 73.07  ? 479  LYS A O     1 
ATOM   3798  C  CB    . LYS A 1 475  ? -21.098 -7.693   -5.352  1.00 70.72  ? 479  LYS A CB    1 
ATOM   3799  C  CG    . LYS A 1 475  ? -21.291 -7.522   -3.859  1.00 70.06  ? 479  LYS A CG    1 
ATOM   3800  C  CD    . LYS A 1 475  ? -20.115 -6.839   -3.218  1.00 80.23  ? 479  LYS A CD    1 
ATOM   3801  C  CE    . LYS A 1 475  ? -18.863 -7.684   -3.341  1.00 86.61  ? 479  LYS A CE    1 
ATOM   3802  N  NZ    . LYS A 1 475  ? -17.743 -7.146   -2.527  1.00 94.22  ? 479  LYS A NZ    1 
ATOM   3803  N  N     . LEU A 1 476  ? -22.417 -7.122   -8.141  1.00 72.74  ? 480  LEU A N     1 
ATOM   3804  C  CA    . LEU A 1 476  ? -22.601 -7.491   -9.534  1.00 71.52  ? 480  LEU A CA    1 
ATOM   3805  C  C     . LEU A 1 476  ? -22.419 -6.271   -10.429 1.00 84.29  ? 480  LEU A C     1 
ATOM   3806  O  O     . LEU A 1 476  ? -21.812 -6.364   -11.512 1.00 86.92  ? 480  LEU A O     1 
ATOM   3807  C  CB    . LEU A 1 476  ? -23.980 -8.115   -9.738  1.00 76.30  ? 480  LEU A CB    1 
ATOM   3808  C  CG    . LEU A 1 476  ? -24.246 -8.806   -11.075 1.00 85.56  ? 480  LEU A CG    1 
ATOM   3809  C  CD1   . LEU A 1 476  ? -23.018 -9.574   -11.540 1.00 78.31  ? 480  LEU A CD1   1 
ATOM   3810  C  CD2   . LEU A 1 476  ? -25.442 -9.737   -10.947 1.00 96.65  ? 480  LEU A CD2   1 
ATOM   3811  N  N     . HIS A 1 477  ? -22.947 -5.132   -9.977  1.00 83.27  ? 481  HIS A N     1 
ATOM   3812  C  CA    . HIS A 1 477  ? -22.703 -3.856   -10.646 1.00 79.08  ? 481  HIS A CA    1 
ATOM   3813  C  C     . HIS A 1 477  ? -21.206 -3.635   -10.788 1.00 72.34  ? 481  HIS A C     1 
ATOM   3814  O  O     . HIS A 1 477  ? -20.716 -3.304   -11.866 1.00 83.42  ? 481  HIS A O     1 
ATOM   3815  C  CB    . HIS A 1 477  ? -23.337 -2.695   -9.877  1.00 70.14  ? 481  HIS A CB    1 
ATOM   3816  C  CG    . HIS A 1 477  ? -24.792 -2.505   -10.161 1.00 68.71  ? 481  HIS A CG    1 
ATOM   3817  N  ND1   . HIS A 1 477  ? -25.446 -3.169   -11.176 1.00 71.25  ? 481  HIS A ND1   1 
ATOM   3818  C  CD2   . HIS A 1 477  ? -25.722 -1.729   -9.557  1.00 65.40  ? 481  HIS A CD2   1 
ATOM   3819  C  CE1   . HIS A 1 477  ? -26.717 -2.807   -11.187 1.00 76.48  ? 481  HIS A CE1   1 
ATOM   3820  N  NE2   . HIS A 1 477  ? -26.910 -1.933   -10.216 1.00 71.00  ? 481  HIS A NE2   1 
ATOM   3821  N  N     . ASN A 1 478  ? -20.486 -3.847   -9.693  1.00 62.51  ? 482  ASN A N     1 
ATOM   3822  C  CA    . ASN A 1 478  ? -19.039 -3.681   -9.677  1.00 72.23  ? 482  ASN A CA    1 
ATOM   3823  C  C     . ASN A 1 478  ? -18.320 -4.687   -10.561 1.00 67.33  ? 482  ASN A C     1 
ATOM   3824  O  O     . ASN A 1 478  ? -17.168 -4.481   -10.935 1.00 70.36  ? 482  ASN A O     1 
ATOM   3825  C  CB    . ASN A 1 478  ? -18.507 -3.780   -8.245  1.00 79.35  ? 482  ASN A CB    1 
ATOM   3826  C  CG    . ASN A 1 478  ? -18.820 -2.546   -7.428  1.00 82.82  ? 482  ASN A CG    1 
ATOM   3827  O  OD1   . ASN A 1 478  ? -18.874 -1.438   -7.960  1.00 84.83  ? 482  ASN A OD1   1 
ATOM   3828  N  ND2   . ASN A 1 478  ? -19.028 -2.729   -6.131  1.00 90.95  ? 482  ASN A ND2   1 
ATOM   3829  N  N     . GLN A 1 479  ? -18.988 -5.787   -10.882 1.00 66.60  ? 483  GLN A N     1 
ATOM   3830  C  CA    . GLN A 1 479  ? -18.430 -6.722   -11.851 1.00 66.18  ? 483  GLN A CA    1 
ATOM   3831  C  C     . GLN A 1 479  ? -18.626 -6.159   -13.257 1.00 78.31  ? 483  GLN A C     1 
ATOM   3832  O  O     . GLN A 1 479  ? -17.739 -6.245   -14.105 1.00 78.51  ? 483  GLN A O     1 
ATOM   3833  C  CB    . GLN A 1 479  ? -19.075 -8.104   -11.724 1.00 61.97  ? 483  GLN A CB    1 
ATOM   3834  C  CG    . GLN A 1 479  ? -18.674 -8.851   -10.454 1.00 63.92  ? 483  GLN A CG    1 
ATOM   3835  C  CD    . GLN A 1 479  ? -17.168 -9.018   -10.334 1.00 62.75  ? 483  GLN A CD    1 
ATOM   3836  O  OE1   . GLN A 1 479  ? -16.510 -9.496   -11.258 1.00 71.91  ? 483  GLN A OE1   1 
ATOM   3837  N  NE2   . GLN A 1 479  ? -16.614 -8.604   -9.202  1.00 60.64  ? 483  GLN A NE2   1 
ATOM   3838  N  N     . VAL A 1 480  ? -19.791 -5.563   -13.491 1.00 81.24  ? 484  VAL A N     1 
ATOM   3839  C  CA    . VAL A 1 480  ? -20.124 -5.026   -14.808 1.00 85.65  ? 484  VAL A CA    1 
ATOM   3840  C  C     . VAL A 1 480  ? -19.288 -3.793   -15.167 1.00 99.52  ? 484  VAL A C     1 
ATOM   3841  O  O     . VAL A 1 480  ? -18.764 -3.698   -16.283 1.00 100.33 ? 484  VAL A O     1 
ATOM   3842  C  CB    . VAL A 1 480  ? -21.614 -4.664   -14.899 1.00 78.20  ? 484  VAL A CB    1 
ATOM   3843  C  CG1   . VAL A 1 480  ? -21.914 -3.959   -16.198 1.00 74.38  ? 484  VAL A CG1   1 
ATOM   3844  C  CG2   . VAL A 1 480  ? -22.468 -5.908   -14.744 1.00 72.56  ? 484  VAL A CG2   1 
ATOM   3845  N  N     . ASN A 1 481  ? -19.162 -2.852   -14.231 1.00 101.21 ? 485  ASN A N     1 
ATOM   3846  C  CA    . ASN A 1 481  ? -18.389 -1.639   -14.483 1.00 92.98  ? 485  ASN A CA    1 
ATOM   3847  C  C     . ASN A 1 481  ? -16.895 -1.833   -14.241 1.00 89.56  ? 485  ASN A C     1 
ATOM   3848  O  O     . ASN A 1 481  ? -16.134 -0.873   -14.192 1.00 104.24 ? 485  ASN A O     1 
ATOM   3849  C  CB    . ASN A 1 481  ? -18.909 -0.477   -13.633 1.00 102.23 ? 485  ASN A CB    1 
ATOM   3850  C  CG    . ASN A 1 481  ? -18.988 -0.811   -12.160 1.00 97.68  ? 485  ASN A CG    1 
ATOM   3851  O  OD1   . ASN A 1 481  ? -17.976 -1.070   -11.511 1.00 84.41  ? 485  ASN A OD1   1 
ATOM   3852  N  ND2   . ASN A 1 481  ? -20.196 -0.779   -11.615 1.00 113.10 ? 485  ASN A ND2   1 
ATOM   3853  N  N     . GLY A 1 482  ? -16.484 -3.085   -14.079 1.00 86.23  ? 486  GLY A N     1 
ATOM   3854  C  CA    . GLY A 1 482  ? -15.078 -3.442   -14.063 1.00 75.30  ? 486  GLY A CA    1 
ATOM   3855  C  C     . GLY A 1 482  ? -14.259 -2.937   -12.900 1.00 71.74  ? 486  GLY A C     1 
ATOM   3856  O  O     . GLY A 1 482  ? -13.038 -3.039   -12.920 1.00 74.89  ? 486  GLY A O     1 
ATOM   3857  N  N     . THR A 1 483  ? -14.920 -2.415   -11.873 1.00 88.10  ? 487  THR A N     1 
ATOM   3858  C  CA    . THR A 1 483  ? -14.207 -1.884   -10.710 1.00 88.26  ? 487  THR A CA    1 
ATOM   3859  C  C     . THR A 1 483  ? -13.650 -3.002   -9.836  1.00 102.67 ? 487  THR A C     1 
ATOM   3860  O  O     . THR A 1 483  ? -12.537 -2.899   -9.313  1.00 109.50 ? 487  THR A O     1 
ATOM   3861  C  CB    . THR A 1 483  ? -15.104 -0.991   -9.836  1.00 87.80  ? 487  THR A CB    1 
ATOM   3862  O  OG1   . THR A 1 483  ? -15.899 -0.138   -10.667 1.00 90.04  ? 487  THR A OG1   1 
ATOM   3863  C  CG2   . THR A 1 483  ? -14.250 -0.137   -8.927  1.00 107.59 ? 487  THR A CG2   1 
ATOM   3864  N  N     . GLU A 1 484  ? -14.431 -4.067   -9.678  1.00 103.49 ? 488  GLU A N     1 
ATOM   3865  C  CA    . GLU A 1 484  ? -14.012 -5.208   -8.871  1.00 94.32  ? 488  GLU A CA    1 
ATOM   3866  C  C     . GLU A 1 484  ? -13.961 -6.483   -9.710  1.00 94.57  ? 488  GLU A C     1 
ATOM   3867  O  O     . GLU A 1 484  ? -14.112 -7.592   -9.179  1.00 90.74  ? 488  GLU A O     1 
ATOM   3868  C  CB    . GLU A 1 484  ? -14.957 -5.396   -7.679  1.00 91.01  ? 488  GLU A CB    1 
ATOM   3869  C  CG    . GLU A 1 484  ? -14.912 -4.276   -6.664  1.00 87.99  ? 488  GLU A CG    1 
ATOM   3870  C  CD    . GLU A 1 484  ? -15.912 -4.453   -5.548  1.00 88.06  ? 488  GLU A CD    1 
ATOM   3871  O  OE1   . GLU A 1 484  ? -16.703 -5.409   -5.611  1.00 93.16  ? 488  GLU A OE1   1 
ATOM   3872  O  OE2   . GLU A 1 484  ? -15.909 -3.635   -4.606  1.00 109.62 ? 488  GLU A OE2   1 
ATOM   3873  N  N     . TRP A 1 485  ? -13.755 -6.321   -11.017 1.00 93.76  ? 489  TRP A N     1 
ATOM   3874  C  CA    . TRP A 1 485  ? -13.795 -7.458   -11.936 1.00 85.77  ? 489  TRP A CA    1 
ATOM   3875  C  C     . TRP A 1 485  ? -12.544 -8.319   -11.895 1.00 83.15  ? 489  TRP A C     1 
ATOM   3876  O  O     . TRP A 1 485  ? -11.437 -7.859   -12.180 1.00 81.68  ? 489  TRP A O     1 
ATOM   3877  C  CB    . TRP A 1 485  ? -14.024 -6.999   -13.370 1.00 85.98  ? 489  TRP A CB    1 
ATOM   3878  C  CG    . TRP A 1 485  ? -13.627 -8.043   -14.373 1.00 75.67  ? 489  TRP A CG    1 
ATOM   3879  C  CD1   . TRP A 1 485  ? -12.448 -8.124   -15.049 1.00 80.53  ? 489  TRP A CD1   1 
ATOM   3880  C  CD2   . TRP A 1 485  ? -14.405 -9.169   -14.792 1.00 71.94  ? 489  TRP A CD2   1 
ATOM   3881  N  NE1   . TRP A 1 485  ? -12.442 -9.230   -15.864 1.00 67.76  ? 489  TRP A NE1   1 
ATOM   3882  C  CE2   . TRP A 1 485  ? -13.637 -9.883   -15.730 1.00 58.68  ? 489  TRP A CE2   1 
ATOM   3883  C  CE3   . TRP A 1 485  ? -15.677 -9.643   -14.465 1.00 85.20  ? 489  TRP A CE3   1 
ATOM   3884  C  CZ2   . TRP A 1 485  ? -14.095 -11.036  -16.349 1.00 54.54  ? 489  TRP A CZ2   1 
ATOM   3885  C  CZ3   . TRP A 1 485  ? -16.134 -10.800  -15.084 1.00 86.75  ? 489  TRP A CZ3   1 
ATOM   3886  C  CH2   . TRP A 1 485  ? -15.344 -11.479  -16.015 1.00 67.73  ? 489  TRP A CH2   1 
ATOM   3887  N  N     . SER A 1 486  ? -12.758 -9.582   -11.559 1.00 91.04  ? 490  SER A N     1 
ATOM   3888  C  CA    . SER A 1 486  ? -11.715 -10.589  -11.515 1.00 89.62  ? 490  SER A CA    1 
ATOM   3889  C  C     . SER A 1 486  ? -12.445 -11.915  -11.557 1.00 90.55  ? 490  SER A C     1 
ATOM   3890  O  O     . SER A 1 486  ? -13.588 -11.996  -11.086 1.00 99.79  ? 490  SER A O     1 
ATOM   3891  C  CB    . SER A 1 486  ? -10.856 -10.445  -10.253 1.00 98.18  ? 490  SER A CB    1 
ATOM   3892  O  OG    . SER A 1 486  ? -10.013 -11.560  -10.042 1.00 111.73 ? 490  SER A OG    1 
ATOM   3893  N  N     . TRP A 1 487  ? -11.823 -12.943  -12.132 1.00 78.89  ? 491  TRP A N     1 
ATOM   3894  C  CA    . TRP A 1 487  ? -12.453 -14.261  -12.148 1.00 77.09  ? 491  TRP A CA    1 
ATOM   3895  C  C     . TRP A 1 487  ? -12.766 -14.712  -10.727 1.00 75.90  ? 491  TRP A C     1 
ATOM   3896  O  O     . TRP A 1 487  ? -13.874 -15.172  -10.437 1.00 79.12  ? 491  TRP A O     1 
ATOM   3897  C  CB    . TRP A 1 487  ? -11.565 -15.278  -12.855 1.00 85.05  ? 491  TRP A CB    1 
ATOM   3898  C  CG    . TRP A 1 487  ? -11.379 -14.986  -14.317 1.00 86.60  ? 491  TRP A CG    1 
ATOM   3899  C  CD1   . TRP A 1 487  ? -11.990 -14.012  -15.033 1.00 73.54  ? 491  TRP A CD1   1 
ATOM   3900  C  CD2   . TRP A 1 487  ? -10.525 -15.685  -15.232 1.00 93.16  ? 491  TRP A CD2   1 
ATOM   3901  N  NE1   . TRP A 1 487  ? -11.570 -14.050  -16.334 1.00 87.89  ? 491  TRP A NE1   1 
ATOM   3902  C  CE2   . TRP A 1 487  ? -10.671 -15.071  -16.483 1.00 91.71  ? 491  TRP A CE2   1 
ATOM   3903  C  CE3   . TRP A 1 487  ? -9.653  -16.771  -15.110 1.00 96.57  ? 491  TRP A CE3   1 
ATOM   3904  C  CZ2   . TRP A 1 487  ? -9.980  -15.503  -17.611 1.00 103.82 ? 491  TRP A CZ2   1 
ATOM   3905  C  CZ3   . TRP A 1 487  ? -8.967  -17.200  -16.231 1.00 98.13  ? 491  TRP A CZ3   1 
ATOM   3906  C  CH2   . TRP A 1 487  ? -9.135  -16.567  -17.464 1.00 105.12 ? 491  TRP A CH2   1 
ATOM   3907  N  N     . LYS A 1 488  ? -11.791 -14.531  -9.840  1.00 75.53  ? 492  LYS A N     1 
ATOM   3908  C  CA    . LYS A 1 488  ? -11.954 -14.869  -8.434  1.00 67.55  ? 492  LYS A CA    1 
ATOM   3909  C  C     . LYS A 1 488  ? -13.152 -14.154  -7.803  1.00 73.02  ? 492  LYS A C     1 
ATOM   3910  O  O     . LYS A 1 488  ? -13.997 -14.792  -7.164  1.00 84.93  ? 492  LYS A O     1 
ATOM   3911  C  CB    . LYS A 1 488  ? -10.677 -14.538  -7.655  1.00 64.19  ? 492  LYS A CB    1 
ATOM   3912  C  CG    . LYS A 1 488  ? -10.785 -14.784  -6.154  1.00 82.68  ? 492  LYS A CG    1 
ATOM   3913  C  CD    . LYS A 1 488  ? -9.639  -14.113  -5.404  1.00 93.86  ? 492  LYS A CD    1 
ATOM   3914  C  CE    . LYS A 1 488  ? -9.761  -14.304  -3.896  1.00 102.70 ? 492  LYS A CE    1 
ATOM   3915  N  NZ    . LYS A 1 488  ? -9.530  -15.717  -3.489  1.00 110.55 ? 492  LYS A NZ    1 
ATOM   3916  N  N     . ASN A 1 489  ? -13.225 -12.840  -7.999  1.00 71.37  ? 493  ASN A N     1 
ATOM   3917  C  CA    . ASN A 1 489  ? -14.272 -12.023  -7.390  1.00 71.74  ? 493  ASN A CA    1 
ATOM   3918  C  C     . ASN A 1 489  ? -15.675 -12.372  -7.880  1.00 73.05  ? 493  ASN A C     1 
ATOM   3919  O  O     . ASN A 1 489  ? -16.627 -12.460  -7.094  1.00 79.64  ? 493  ASN A O     1 
ATOM   3920  C  CB    . ASN A 1 489  ? -13.989 -10.548  -7.647  1.00 80.08  ? 493  ASN A CB    1 
ATOM   3921  C  CG    . ASN A 1 489  ? -12.780 -10.050  -6.883  1.00 91.18  ? 493  ASN A CG    1 
ATOM   3922  O  OD1   . ASN A 1 489  ? -11.765 -9.688   -7.472  1.00 94.57  ? 493  ASN A OD1   1 
ATOM   3923  N  ND2   . ASN A 1 489  ? -12.883 -10.033  -5.561  1.00 101.43 ? 493  ASN A ND2   1 
ATOM   3924  N  N     . LEU A 1 490  ? -15.794 -12.571  -9.187  1.00 76.76  ? 494  LEU A N     1 
ATOM   3925  C  CA    . LEU A 1 490  ? -17.048 -13.011  -9.789  1.00 78.24  ? 494  LEU A CA    1 
ATOM   3926  C  C     . LEU A 1 490  ? -17.475 -14.373  -9.232  1.00 83.10  ? 494  LEU A C     1 
ATOM   3927  O  O     . LEU A 1 490  ? -18.639 -14.570  -8.836  1.00 78.76  ? 494  LEU A O     1 
ATOM   3928  C  CB    . LEU A 1 490  ? -16.909 -13.076  -11.310 1.00 65.54  ? 494  LEU A CB    1 
ATOM   3929  C  CG    . LEU A 1 490  ? -18.122 -13.588  -12.081 1.00 63.01  ? 494  LEU A CG    1 
ATOM   3930  C  CD1   . LEU A 1 490  ? -19.324 -12.701  -11.851 1.00 61.17  ? 494  LEU A CD1   1 
ATOM   3931  C  CD2   . LEU A 1 490  ? -17.798 -13.704  -13.565 1.00 64.44  ? 494  LEU A CD2   1 
ATOM   3932  N  N     . ASN A 1 491  ? -16.521 -15.304  -9.195  1.00 75.25  ? 495  ASN A N     1 
ATOM   3933  C  CA    . ASN A 1 491  ? -16.780 -16.626  -8.642  1.00 77.25  ? 495  ASN A CA    1 
ATOM   3934  C  C     . ASN A 1 491  ? -17.309 -16.528  -7.219  1.00 73.25  ? 495  ASN A C     1 
ATOM   3935  O  O     . ASN A 1 491  ? -18.338 -17.117  -6.898  1.00 69.19  ? 495  ASN A O     1 
ATOM   3936  C  CB    . ASN A 1 491  ? -15.518 -17.493  -8.676  1.00 75.55  ? 495  ASN A CB    1 
ATOM   3937  C  CG    . ASN A 1 491  ? -15.119 -17.888  -10.081 1.00 72.27  ? 495  ASN A CG    1 
ATOM   3938  O  OD1   . ASN A 1 491  ? -15.886 -17.719  -11.029 1.00 73.48  ? 495  ASN A OD1   1 
ATOM   3939  N  ND2   . ASN A 1 491  ? -13.911 -18.421  -10.223 1.00 77.08  ? 495  ASN A ND2   1 
ATOM   3940  N  N     . THR A 1 492  ? -16.612 -15.759  -6.389  1.00 57.97  ? 496  THR A N     1 
ATOM   3941  C  CA    . THR A 1 492  ? -16.991 -15.573  -4.996  1.00 52.56  ? 496  THR A CA    1 
ATOM   3942  C  C     . THR A 1 492  ? -18.408 -15.020  -4.864  1.00 63.96  ? 496  THR A C     1 
ATOM   3943  O  O     . THR A 1 492  ? -19.227 -15.534  -4.080  1.00 69.98  ? 496  THR A O     1 
ATOM   3944  C  CB    . THR A 1 492  ? -16.037 -14.628  -4.285  1.00 52.66  ? 496  THR A CB    1 
ATOM   3945  O  OG1   . THR A 1 492  ? -14.687 -14.971  -4.608  1.00 64.26  ? 496  THR A OG1   1 
ATOM   3946  C  CG2   . THR A 1 492  ? -16.233 -14.712  -2.764  1.00 51.86  ? 496  THR A CG2   1 
ATOM   3947  N  N     . LEU A 1 493  ? -18.691 -13.975  -5.634  1.00 55.00  ? 497  LEU A N     1 
ATOM   3948  C  CA    . LEU A 1 493  ? -20.010 -13.362  -5.629  1.00 61.33  ? 497  LEU A CA    1 
ATOM   3949  C  C     . LEU A 1 493  ? -21.095 -14.374  -5.941  1.00 65.37  ? 497  LEU A C     1 
ATOM   3950  O  O     . LEU A 1 493  ? -22.108 -14.436  -5.238  1.00 69.13  ? 497  LEU A O     1 
ATOM   3951  C  CB    . LEU A 1 493  ? -20.077 -12.209  -6.639  1.00 70.17  ? 497  LEU A CB    1 
ATOM   3952  C  CG    . LEU A 1 493  ? -21.489 -11.651  -6.859  1.00 68.96  ? 497  LEU A CG    1 
ATOM   3953  C  CD1   . LEU A 1 493  ? -22.076 -11.114  -5.543  1.00 72.07  ? 497  LEU A CD1   1 
ATOM   3954  C  CD2   . LEU A 1 493  ? -21.491 -10.599  -7.923  1.00 67.36  ? 497  LEU A CD2   1 
ATOM   3955  N  N     . CYS A 1 494  ? -20.884 -15.162  -6.996  1.00 65.54  ? 498  CYS A N     1 
ATOM   3956  C  CA    . CYS A 1 494  ? -21.903 -16.116  -7.420  1.00 63.52  ? 498  CYS A CA    1 
ATOM   3957  C  C     . CYS A 1 494  ? -22.041 -17.268  -6.422  1.00 70.59  ? 498  CYS A C     1 
ATOM   3958  O  O     . CYS A 1 494  ? -23.140 -17.800  -6.212  1.00 66.11  ? 498  CYS A O     1 
ATOM   3959  C  CB    . CYS A 1 494  ? -21.581 -16.638  -8.805  1.00 64.75  ? 498  CYS A CB    1 
ATOM   3960  S  SG    . CYS A 1 494  ? -21.475 -15.293  -10.023 1.00 78.48  ? 498  CYS A SG    1 
ATOM   3961  N  N     . TRP A 1 495  ? -20.931 -17.631  -5.786  1.00 76.39  ? 499  TRP A N     1 
ATOM   3962  C  CA    . TRP A 1 495  ? -20.947 -18.620  -4.722  1.00 54.39  ? 499  TRP A CA    1 
ATOM   3963  C  C     . TRP A 1 495  ? -21.833 -18.134  -3.589  1.00 73.76  ? 499  TRP A C     1 
ATOM   3964  O  O     . TRP A 1 495  ? -22.597 -18.920  -3.022  1.00 87.24  ? 499  TRP A O     1 
ATOM   3965  C  CB    . TRP A 1 495  ? -19.539 -18.886  -4.210  1.00 47.70  ? 499  TRP A CB    1 
ATOM   3966  C  CG    . TRP A 1 495  ? -18.672 -19.599  -5.180  1.00 54.80  ? 499  TRP A CG    1 
ATOM   3967  C  CD1   . TRP A 1 495  ? -19.072 -20.278  -6.298  1.00 56.69  ? 499  TRP A CD1   1 
ATOM   3968  C  CD2   . TRP A 1 495  ? -17.242 -19.697  -5.142  1.00 51.21  ? 499  TRP A CD2   1 
ATOM   3969  N  NE1   . TRP A 1 495  ? -17.979 -20.783  -6.959  1.00 55.48  ? 499  TRP A NE1   1 
ATOM   3970  C  CE2   . TRP A 1 495  ? -16.846 -20.443  -6.269  1.00 52.74  ? 499  TRP A CE2   1 
ATOM   3971  C  CE3   . TRP A 1 495  ? -16.259 -19.211  -4.279  1.00 53.38  ? 499  TRP A CE3   1 
ATOM   3972  C  CZ2   . TRP A 1 495  ? -15.514 -20.721  -6.546  1.00 57.42  ? 499  TRP A CZ2   1 
ATOM   3973  C  CZ3   . TRP A 1 495  ? -14.938 -19.498  -4.554  1.00 57.11  ? 499  TRP A CZ3   1 
ATOM   3974  C  CH2   . TRP A 1 495  ? -14.578 -20.249  -5.672  1.00 55.16  ? 499  TRP A CH2   1 
ATOM   3975  N  N     . ALA A 1 496  ? -21.731 -16.843  -3.263  1.00 68.33  ? 500  ALA A N     1 
ATOM   3976  C  CA    . ALA A 1 496  ? -22.584 -16.250  -2.234  1.00 65.54  ? 500  ALA A CA    1 
ATOM   3977  C  C     . ALA A 1 496  ? -24.050 -16.258  -2.651  1.00 70.71  ? 500  ALA A C     1 
ATOM   3978  O  O     . ALA A 1 496  ? -24.916 -16.704  -1.910  1.00 90.85  ? 500  ALA A O     1 
ATOM   3979  C  CB    . ALA A 1 496  ? -22.134 -14.835  -1.925  1.00 53.03  ? 500  ALA A CB    1 
ATOM   3980  N  N     . ILE A 1 497  ? -24.311 -15.745  -3.846  1.00 72.01  ? 501  ILE A N     1 
ATOM   3981  C  CA    . ILE A 1 497  ? -25.652 -15.708  -4.418  1.00 83.34  ? 501  ILE A CA    1 
ATOM   3982  C  C     . ILE A 1 497  ? -26.334 -17.074  -4.344  1.00 79.41  ? 501  ILE A C     1 
ATOM   3983  O  O     . ILE A 1 497  ? -27.502 -17.178  -3.949  1.00 74.79  ? 501  ILE A O     1 
ATOM   3984  C  CB    . ILE A 1 497  ? -25.614 -15.231  -5.894  1.00 79.90  ? 501  ILE A CB    1 
ATOM   3985  C  CG1   . ILE A 1 497  ? -25.131 -13.786  -5.968  1.00 81.96  ? 501  ILE A CG1   1 
ATOM   3986  C  CG2   . ILE A 1 497  ? -26.986 -15.364  -6.543  1.00 73.59  ? 501  ILE A CG2   1 
ATOM   3987  C  CD1   . ILE A 1 497  ? -25.039 -13.249  -7.383  1.00 83.62  ? 501  ILE A CD1   1 
ATOM   3988  N  N     . GLY A 1 498  ? -25.599 -18.117  -4.722  1.00 71.12  ? 502  GLY A N     1 
ATOM   3989  C  CA    . GLY A 1 498  ? -26.117 -19.465  -4.627  1.00 75.88  ? 502  GLY A CA    1 
ATOM   3990  C  C     . GLY A 1 498  ? -26.245 -19.924  -3.181  1.00 78.27  ? 502  GLY A C     1 
ATOM   3991  O  O     . GLY A 1 498  ? -27.139 -20.703  -2.835  1.00 77.06  ? 502  GLY A O     1 
ATOM   3992  N  N     . SER A 1 499  ? -25.356 -19.429  -2.325  1.00 72.98  ? 503  SER A N     1 
ATOM   3993  C  CA    . SER A 1 499  ? -25.329 -19.850  -0.930  1.00 64.27  ? 503  SER A CA    1 
ATOM   3994  C  C     . SER A 1 499  ? -26.589 -19.439  -0.180  1.00 75.04  ? 503  SER A C     1 
ATOM   3995  O  O     . SER A 1 499  ? -27.010 -20.130  0.744   1.00 89.46  ? 503  SER A O     1 
ATOM   3996  C  CB    . SER A 1 499  ? -24.093 -19.287  -0.223  1.00 71.14  ? 503  SER A CB    1 
ATOM   3997  O  OG    . SER A 1 499  ? -24.232 -17.904  0.052   1.00 85.60  ? 503  SER A OG    1 
ATOM   3998  N  N     . ILE A 1 500  ? -27.199 -18.321  -0.567  1.00 82.84  ? 504  ILE A N     1 
ATOM   3999  C  CA    . ILE A 1 500  ? -28.419 -17.876  0.112   1.00 79.07  ? 504  ILE A CA    1 
ATOM   4000  C  C     . ILE A 1 500  ? -29.694 -18.424  -0.527  1.00 82.80  ? 504  ILE A C     1 
ATOM   4001  O  O     . ILE A 1 500  ? -30.774 -17.866  -0.320  1.00 80.84  ? 504  ILE A O     1 
ATOM   4002  C  CB    . ILE A 1 500  ? -28.538 -16.339  0.156   1.00 71.26  ? 504  ILE A CB    1 
ATOM   4003  C  CG1   . ILE A 1 500  ? -28.546 -15.751  -1.257  1.00 71.31  ? 504  ILE A CG1   1 
ATOM   4004  C  CG2   . ILE A 1 500  ? -27.426 -15.748  0.991   1.00 71.49  ? 504  ILE A CG2   1 
ATOM   4005  C  CD1   . ILE A 1 500  ? -29.202 -14.390  -1.346  1.00 76.14  ? 504  ILE A CD1   1 
ATOM   4006  N  N     . SER A 1 501  ? -29.576 -19.504  -1.298  1.00 74.93  ? 505  SER A N     1 
ATOM   4007  C  CA    . SER A 1 501  ? -30.742 -20.062  -1.975  1.00 76.92  ? 505  SER A CA    1 
ATOM   4008  C  C     . SER A 1 501  ? -31.792 -20.554  -0.983  1.00 88.91  ? 505  SER A C     1 
ATOM   4009  O  O     . SER A 1 501  ? -31.487 -21.285  -0.048  1.00 98.81  ? 505  SER A O     1 
ATOM   4010  C  CB    . SER A 1 501  ? -30.336 -21.202  -2.899  1.00 82.16  ? 505  SER A CB    1 
ATOM   4011  O  OG    . SER A 1 501  ? -31.469 -21.694  -3.600  1.00 90.96  ? 505  SER A OG    1 
ATOM   4012  N  N     . GLY A 1 502  ? -33.035 -20.139  -1.192  1.00 99.80  ? 506  GLY A N     1 
ATOM   4013  C  CA    . GLY A 1 502  ? -34.139 -20.558  -0.346  1.00 93.24  ? 506  GLY A CA    1 
ATOM   4014  C  C     . GLY A 1 502  ? -34.398 -19.639  0.827   1.00 91.19  ? 506  GLY A C     1 
ATOM   4015  O  O     . GLY A 1 502  ? -35.429 -19.751  1.485   1.00 107.80 ? 506  GLY A O     1 
ATOM   4016  N  N     . ALA A 1 503  ? -33.467 -18.723  1.087   1.00 83.06  ? 507  ALA A N     1 
ATOM   4017  C  CA    . ALA A 1 503  ? -33.574 -17.828  2.242   1.00 74.46  ? 507  ALA A CA    1 
ATOM   4018  C  C     . ALA A 1 503  ? -34.625 -16.740  2.035   1.00 85.27  ? 507  ALA A C     1 
ATOM   4019  O  O     . ALA A 1 503  ? -35.174 -16.218  2.998   1.00 97.19  ? 507  ALA A O     1 
ATOM   4020  C  CB    . ALA A 1 503  ? -32.227 -17.199  2.554   1.00 65.91  ? 507  ALA A CB    1 
ATOM   4021  N  N     . MET A 1 504  ? -34.898 -16.399  0.781   1.00 86.50  ? 508  MET A N     1 
ATOM   4022  C  CA    . MET A 1 504  ? -35.890 -15.378  0.470   1.00 80.08  ? 508  MET A CA    1 
ATOM   4023  C  C     . MET A 1 504  ? -37.223 -16.001  0.091   1.00 78.34  ? 508  MET A C     1 
ATOM   4024  O  O     . MET A 1 504  ? -37.289 -17.176  -0.252  1.00 92.96  ? 508  MET A O     1 
ATOM   4025  C  CB    . MET A 1 504  ? -35.392 -14.479  -0.662  1.00 86.48  ? 508  MET A CB    1 
ATOM   4026  C  CG    . MET A 1 504  ? -34.264 -13.538  -0.259  1.00 89.91  ? 508  MET A CG    1 
ATOM   4027  S  SD    . MET A 1 504  ? -33.562 -12.671  -1.673  1.00 98.23  ? 508  MET A SD    1 
ATOM   4028  C  CE    . MET A 1 504  ? -32.987 -14.077  -2.644  1.00 125.72 ? 508  MET A CE    1 
ATOM   4029  N  N     . HIS A 1 505  ? -38.288 -15.213  0.159   1.00 82.71  ? 509  HIS A N     1 
ATOM   4030  C  CA    . HIS A 1 505  ? -39.594 -15.672  -0.299  1.00 95.36  ? 509  HIS A CA    1 
ATOM   4031  C  C     . HIS A 1 505  ? -39.571 -15.845  -1.818  1.00 97.62  ? 509  HIS A C     1 
ATOM   4032  O  O     . HIS A 1 505  ? -38.857 -15.123  -2.518  1.00 93.67  ? 509  HIS A O     1 
ATOM   4033  C  CB    . HIS A 1 505  ? -40.692 -14.698  0.131   1.00 110.91 ? 509  HIS A CB    1 
ATOM   4034  C  CG    . HIS A 1 505  ? -40.810 -14.549  1.615   1.00 127.54 ? 509  HIS A CG    1 
ATOM   4035  N  ND1   . HIS A 1 505  ? -41.099 -15.608  2.448   1.00 133.11 ? 509  HIS A ND1   1 
ATOM   4036  C  CD2   . HIS A 1 505  ? -40.671 -13.467  2.416   1.00 138.85 ? 509  HIS A CD2   1 
ATOM   4037  C  CE1   . HIS A 1 505  ? -41.135 -15.185  3.698   1.00 142.52 ? 509  HIS A CE1   1 
ATOM   4038  N  NE2   . HIS A 1 505  ? -40.880 -13.888  3.707   1.00 141.30 ? 509  HIS A NE2   1 
ATOM   4039  N  N     . GLU A 1 506  ? -40.351 -16.804  -2.315  1.00 110.48 ? 510  GLU A N     1 
ATOM   4040  C  CA    . GLU A 1 506  ? -40.256 -17.252  -3.707  1.00 114.33 ? 510  GLU A CA    1 
ATOM   4041  C  C     . GLU A 1 506  ? -40.437 -16.135  -4.734  1.00 119.48 ? 510  GLU A C     1 
ATOM   4042  O  O     . GLU A 1 506  ? -39.720 -16.089  -5.731  1.00 133.55 ? 510  GLU A O     1 
ATOM   4043  C  CB    . GLU A 1 506  ? -41.277 -18.361  -3.973  1.00 114.63 ? 510  GLU A CB    1 
ATOM   4044  C  CG    . GLU A 1 506  ? -41.224 -18.926  -5.384  1.00 118.65 ? 510  GLU A CG    1 
ATOM   4045  C  CD    . GLU A 1 506  ? -42.123 -20.134  -5.573  1.00 127.66 ? 510  GLU A CD    1 
ATOM   4046  O  OE1   . GLU A 1 506  ? -42.476 -20.778  -4.562  1.00 135.77 ? 510  GLU A OE1   1 
ATOM   4047  O  OE2   . GLU A 1 506  ? -42.477 -20.439  -6.733  1.00 125.35 ? 510  GLU A OE2   1 
ATOM   4048  N  N     . GLU A 1 507  ? -41.389 -15.241  -4.495  1.00 122.61 ? 511  GLU A N     1 
ATOM   4049  C  CA    . GLU A 1 507  ? -41.623 -14.128  -5.410  1.00 120.08 ? 511  GLU A CA    1 
ATOM   4050  C  C     . GLU A 1 507  ? -40.471 -13.125  -5.334  1.00 114.39 ? 511  GLU A C     1 
ATOM   4051  O  O     . GLU A 1 507  ? -40.015 -12.610  -6.357  1.00 118.89 ? 511  GLU A O     1 
ATOM   4052  C  CB    . GLU A 1 507  ? -42.960 -13.455  -5.100  1.00 130.06 ? 511  GLU A CB    1 
ATOM   4053  C  CG    . GLU A 1 507  ? -44.161 -14.341  -5.411  1.00 144.72 ? 511  GLU A CG    1 
ATOM   4054  C  CD    . GLU A 1 507  ? -45.400 -13.963  -4.620  1.00 158.18 ? 511  GLU A CD    1 
ATOM   4055  O  OE1   . GLU A 1 507  ? -45.817 -12.786  -4.678  1.00 165.89 ? 511  GLU A OE1   1 
ATOM   4056  O  OE2   . GLU A 1 507  ? -45.957 -14.847  -3.935  1.00 163.07 ? 511  GLU A OE2   1 
ATOM   4057  N  N     . ASP A 1 508  ? -39.999 -12.866  -4.118  1.00 107.18 ? 512  ASP A N     1 
ATOM   4058  C  CA    . ASP A 1 508  ? -38.807 -12.049  -3.914  1.00 105.65 ? 512  ASP A CA    1 
ATOM   4059  C  C     . ASP A 1 508  ? -37.609 -12.684  -4.613  1.00 102.83 ? 512  ASP A C     1 
ATOM   4060  O  O     . ASP A 1 508  ? -36.858 -12.011  -5.322  1.00 89.53  ? 512  ASP A O     1 
ATOM   4061  C  CB    . ASP A 1 508  ? -38.508 -11.881  -2.423  1.00 115.75 ? 512  ASP A CB    1 
ATOM   4062  C  CG    . ASP A 1 508  ? -39.615 -11.162  -1.683  1.00 134.13 ? 512  ASP A CG    1 
ATOM   4063  O  OD1   . ASP A 1 508  ? -40.203 -10.220  -2.256  1.00 143.49 ? 512  ASP A OD1   1 
ATOM   4064  O  OD2   . ASP A 1 508  ? -39.896 -11.540  -0.525  1.00 145.98 ? 512  ASP A OD2   1 
ATOM   4065  N  N     . GLU A 1 509  ? -37.442 -13.988  -4.401  1.00 108.56 ? 513  GLU A N     1 
ATOM   4066  C  CA    . GLU A 1 509  ? -36.338 -14.742  -4.982  1.00 98.71  ? 513  GLU A CA    1 
ATOM   4067  C  C     . GLU A 1 509  ? -36.353 -14.662  -6.504  1.00 97.92  ? 513  GLU A C     1 
ATOM   4068  O  O     . GLU A 1 509  ? -35.308 -14.523  -7.136  1.00 104.39 ? 513  GLU A O     1 
ATOM   4069  C  CB    . GLU A 1 509  ? -36.403 -16.202  -4.530  1.00 94.84  ? 513  GLU A CB    1 
ATOM   4070  C  CG    . GLU A 1 509  ? -35.239 -17.057  -5.001  1.00 100.65 ? 513  GLU A CG    1 
ATOM   4071  C  CD    . GLU A 1 509  ? -35.419 -18.521  -4.662  1.00 109.73 ? 513  GLU A CD    1 
ATOM   4072  O  OE1   . GLU A 1 509  ? -36.176 -19.210  -5.380  1.00 112.40 ? 513  GLU A OE1   1 
ATOM   4073  O  OE2   . GLU A 1 509  ? -34.812 -18.981  -3.673  1.00 116.83 ? 513  GLU A OE2   1 
ATOM   4074  N  N     . LYS A 1 510  ? -37.546 -14.755  -7.084  1.00 88.55  ? 514  LYS A N     1 
ATOM   4075  C  CA    . LYS A 1 510  ? -37.721 -14.655  -8.531  1.00 83.58  ? 514  LYS A CA    1 
ATOM   4076  C  C     . LYS A 1 510  ? -37.335 -13.263  -9.021  1.00 90.54  ? 514  LYS A C     1 
ATOM   4077  O  O     . LYS A 1 510  ? -36.546 -13.109  -9.953  1.00 96.35  ? 514  LYS A O     1 
ATOM   4078  C  CB    . LYS A 1 510  ? -39.168 -14.973  -8.914  1.00 72.65  ? 514  LYS A CB    1 
ATOM   4079  C  CG    . LYS A 1 510  ? -39.601 -14.425  -10.253 1.00 86.75  ? 514  LYS A CG    1 
ATOM   4080  C  CD    . LYS A 1 510  ? -41.032 -14.843  -10.564 1.00 94.72  ? 514  LYS A CD    1 
ATOM   4081  C  CE    . LYS A 1 510  ? -41.557 -14.176  -11.821 1.00 98.02  ? 514  LYS A CE    1 
ATOM   4082  N  NZ    . LYS A 1 510  ? -42.922 -14.664  -12.158 1.00 105.32 ? 514  LYS A NZ    1 
ATOM   4083  N  N     . ARG A 1 511  ? -37.897 -12.254  -8.368  1.00 86.15  ? 515  ARG A N     1 
ATOM   4084  C  CA    . ARG A 1 511  ? -37.625 -10.859  -8.683  1.00 87.59  ? 515  ARG A CA    1 
ATOM   4085  C  C     . ARG A 1 511  ? -36.128 -10.557  -8.650  1.00 90.65  ? 515  ARG A C     1 
ATOM   4086  O  O     . ARG A 1 511  ? -35.619 -9.821   -9.489  1.00 104.95 ? 515  ARG A O     1 
ATOM   4087  C  CB    . ARG A 1 511  ? -38.390 -9.961   -7.703  1.00 107.05 ? 515  ARG A CB    1 
ATOM   4088  C  CG    . ARG A 1 511  ? -38.195 -8.471   -7.875  1.00 122.55 ? 515  ARG A CG    1 
ATOM   4089  C  CD    . ARG A 1 511  ? -39.113 -7.722   -6.920  1.00 130.49 ? 515  ARG A CD    1 
ATOM   4090  N  NE    . ARG A 1 511  ? -38.738 -6.321   -6.750  1.00 131.63 ? 515  ARG A NE    1 
ATOM   4091  C  CZ    . ARG A 1 511  ? -37.873 -5.888   -5.838  1.00 134.32 ? 515  ARG A CZ    1 
ATOM   4092  N  NH1   . ARG A 1 511  ? -37.289 -6.753   -5.016  1.00 137.84 ? 515  ARG A NH1   1 
ATOM   4093  N  NH2   . ARG A 1 511  ? -37.590 -4.594   -5.748  1.00 135.40 ? 515  ARG A NH2   1 
ATOM   4094  N  N     . PHE A 1 512  ? -35.428 -11.148  -7.687  1.00 92.30  ? 516  PHE A N     1 
ATOM   4095  C  CA    . PHE A 1 512  ? -33.991 -10.934  -7.508  1.00 89.13  ? 516  PHE A CA    1 
ATOM   4096  C  C     . PHE A 1 512  ? -33.190 -11.679  -8.573  1.00 79.79  ? 516  PHE A C     1 
ATOM   4097  O  O     . PHE A 1 512  ? -32.254 -11.135  -9.173  1.00 75.78  ? 516  PHE A O     1 
ATOM   4098  C  CB    . PHE A 1 512  ? -33.582 -11.373  -6.088  1.00 85.81  ? 516  PHE A CB    1 
ATOM   4099  C  CG    . PHE A 1 512  ? -32.095 -11.476  -5.865  1.00 80.91  ? 516  PHE A CG    1 
ATOM   4100  C  CD1   . PHE A 1 512  ? -31.274 -10.376  -6.017  1.00 84.69  ? 516  PHE A CD1   1 
ATOM   4101  C  CD2   . PHE A 1 512  ? -31.527 -12.677  -5.471  1.00 76.33  ? 516  PHE A CD2   1 
ATOM   4102  C  CE1   . PHE A 1 512  ? -29.909 -10.476  -5.795  1.00 84.74  ? 516  PHE A CE1   1 
ATOM   4103  C  CE2   . PHE A 1 512  ? -30.165 -12.784  -5.249  1.00 68.48  ? 516  PHE A CE2   1 
ATOM   4104  C  CZ    . PHE A 1 512  ? -29.355 -11.684  -5.409  1.00 73.26  ? 516  PHE A CZ    1 
ATOM   4105  N  N     . LEU A 1 513  ? -33.576 -12.928  -8.809  1.00 79.78  ? 517  LEU A N     1 
ATOM   4106  C  CA    . LEU A 1 513  ? -32.910 -13.770  -9.796  1.00 79.41  ? 517  LEU A CA    1 
ATOM   4107  C  C     . LEU A 1 513  ? -32.976 -13.173  -11.195 1.00 84.81  ? 517  LEU A C     1 
ATOM   4108  O  O     . LEU A 1 513  ? -31.951 -13.067  -11.862 1.00 83.10  ? 517  LEU A O     1 
ATOM   4109  C  CB    . LEU A 1 513  ? -33.515 -15.170  -9.813  1.00 78.28  ? 517  LEU A CB    1 
ATOM   4110  C  CG    . LEU A 1 513  ? -32.887 -16.154  -8.831  1.00 86.26  ? 517  LEU A CG    1 
ATOM   4111  C  CD1   . LEU A 1 513  ? -33.399 -17.557  -9.100  1.00 95.78  ? 517  LEU A CD1   1 
ATOM   4112  C  CD2   . LEU A 1 513  ? -31.367 -16.105  -8.916  1.00 73.31  ? 517  LEU A CD2   1 
ATOM   4113  N  N     . VAL A 1 514  ? -34.175 -12.794  -11.632 1.00 81.58  ? 518  VAL A N     1 
ATOM   4114  C  CA    . VAL A 1 514  ? -34.358 -12.147  -12.933 1.00 85.20  ? 518  VAL A CA    1 
ATOM   4115  C  C     . VAL A 1 514  ? -33.300 -11.071  -13.162 1.00 92.03  ? 518  VAL A C     1 
ATOM   4116  O  O     . VAL A 1 514  ? -32.635 -11.059  -14.206 1.00 92.99  ? 518  VAL A O     1 
ATOM   4117  C  CB    . VAL A 1 514  ? -35.754 -11.511  -13.058 1.00 91.50  ? 518  VAL A CB    1 
ATOM   4118  C  CG1   . VAL A 1 514  ? -35.822 -10.603  -14.271 1.00 91.99  ? 518  VAL A CG1   1 
ATOM   4119  C  CG2   . VAL A 1 514  ? -36.828 -12.585  -13.119 1.00 91.05  ? 518  VAL A CG2   1 
ATOM   4120  N  N     . THR A 1 515  ? -33.133 -10.197  -12.170 1.00 87.67  ? 519  THR A N     1 
ATOM   4121  C  CA    . THR A 1 515  ? -32.109 -9.160   -12.210 1.00 83.72  ? 519  THR A CA    1 
ATOM   4122  C  C     . THR A 1 515  ? -30.717 -9.769   -12.338 1.00 89.19  ? 519  THR A C     1 
ATOM   4123  O  O     . THR A 1 515  ? -29.932 -9.362   -13.199 1.00 94.53  ? 519  THR A O     1 
ATOM   4124  C  CB    . THR A 1 515  ? -32.156 -8.283   -10.953 1.00 93.04  ? 519  THR A CB    1 
ATOM   4125  O  OG1   . THR A 1 515  ? -33.505 -7.870   -10.712 1.00 104.19 ? 519  THR A OG1   1 
ATOM   4126  C  CG2   . THR A 1 515  ? -31.272 -7.060   -11.114 1.00 94.91  ? 519  THR A CG2   1 
ATOM   4127  N  N     . VAL A 1 516  ? -30.424 -10.753  -11.490 1.00 90.32  ? 520  VAL A N     1 
ATOM   4128  C  CA    . VAL A 1 516  ? -29.100 -11.385  -11.477 1.00 81.87  ? 520  VAL A CA    1 
ATOM   4129  C  C     . VAL A 1 516  ? -28.692 -12.008  -12.824 1.00 80.21  ? 520  VAL A C     1 
ATOM   4130  O  O     . VAL A 1 516  ? -27.629 -11.688  -13.358 1.00 81.84  ? 520  VAL A O     1 
ATOM   4131  C  CB    . VAL A 1 516  ? -29.015 -12.472  -10.391 1.00 69.95  ? 520  VAL A CB    1 
ATOM   4132  C  CG1   . VAL A 1 516  ? -27.692 -13.203  -10.480 1.00 64.93  ? 520  VAL A CG1   1 
ATOM   4133  C  CG2   . VAL A 1 516  ? -29.193 -11.853  -9.021  1.00 66.12  ? 520  VAL A CG2   1 
ATOM   4134  N  N     . ILE A 1 517  ? -29.523 -12.892  -13.368 1.00 75.27  ? 521  ILE A N     1 
ATOM   4135  C  CA    . ILE A 1 517  ? -29.204 -13.545  -14.633 1.00 79.75  ? 521  ILE A CA    1 
ATOM   4136  C  C     . ILE A 1 517  ? -29.286 -12.564  -15.808 1.00 85.74  ? 521  ILE A C     1 
ATOM   4137  O  O     . ILE A 1 517  ? -28.535 -12.687  -16.764 1.00 86.12  ? 521  ILE A O     1 
ATOM   4138  C  CB    . ILE A 1 517  ? -30.130 -14.760  -14.903 1.00 93.28  ? 521  ILE A CB    1 
ATOM   4139  C  CG1   . ILE A 1 517  ? -29.870 -15.865  -13.889 1.00 93.43  ? 521  ILE A CG1   1 
ATOM   4140  C  CG2   . ILE A 1 517  ? -29.899 -15.337  -16.302 1.00 93.73  ? 521  ILE A CG2   1 
ATOM   4141  C  CD1   . ILE A 1 517  ? -30.921 -15.965  -12.825 1.00 105.95 ? 521  ILE A CD1   1 
ATOM   4142  N  N     . LYS A 1 518  ? -30.184 -11.586  -15.740 1.00 90.64  ? 522  LYS A N     1 
ATOM   4143  C  CA    . LYS A 1 518  ? -30.258 -10.596  -16.810 1.00 97.51  ? 522  LYS A CA    1 
ATOM   4144  C  C     . LYS A 1 518  ? -28.940 -9.827   -16.887 1.00 91.61  ? 522  LYS A C     1 
ATOM   4145  O  O     . LYS A 1 518  ? -28.341 -9.682   -17.960 1.00 104.95 ? 522  LYS A O     1 
ATOM   4146  C  CB    . LYS A 1 518  ? -31.432 -9.637   -16.596 1.00 106.34 ? 522  LYS A CB    1 
ATOM   4147  C  CG    . LYS A 1 518  ? -32.034 -9.087   -17.885 1.00 121.33 ? 522  LYS A CG    1 
ATOM   4148  C  CD    . LYS A 1 518  ? -33.207 -8.155   -17.595 1.00 132.69 ? 522  LYS A CD    1 
ATOM   4149  C  CE    . LYS A 1 518  ? -34.483 -8.920   -17.265 1.00 133.74 ? 522  LYS A CE    1 
ATOM   4150  N  NZ    . LYS A 1 518  ? -35.122 -9.514   -18.479 1.00 132.00 ? 522  LYS A NZ    1 
ATOM   4151  N  N     . ASP A 1 519  ? -28.471 -9.368   -15.733 1.00 77.36  ? 523  ASP A N     1 
ATOM   4152  C  CA    . ASP A 1 519  ? -27.237 -8.599   -15.673 1.00 85.12  ? 523  ASP A CA    1 
ATOM   4153  C  C     . ASP A 1 519  ? -26.004 -9.448   -15.963 1.00 83.86  ? 523  ASP A C     1 
ATOM   4154  O  O     . ASP A 1 519  ? -25.031 -8.961   -16.532 1.00 89.29  ? 523  ASP A O     1 
ATOM   4155  C  CB    . ASP A 1 519  ? -27.105 -7.924   -14.304 1.00 99.72  ? 523  ASP A CB    1 
ATOM   4156  C  CG    . ASP A 1 519  ? -28.198 -6.898   -14.055 1.00 117.79 ? 523  ASP A CG    1 
ATOM   4157  O  OD1   . ASP A 1 519  ? -28.740 -6.349   -15.042 1.00 125.19 ? 523  ASP A OD1   1 
ATOM   4158  O  OD2   . ASP A 1 519  ? -28.514 -6.639   -12.873 1.00 126.65 ? 523  ASP A OD2   1 
ATOM   4159  N  N     . LEU A 1 520  ? -26.042 -10.718  -15.576 1.00 87.10  ? 524  LEU A N     1 
ATOM   4160  C  CA    . LEU A 1 520  ? -24.919 -11.619  -15.838 1.00 80.33  ? 524  LEU A CA    1 
ATOM   4161  C  C     . LEU A 1 520  ? -24.836 -11.994  -17.321 1.00 76.96  ? 524  LEU A C     1 
ATOM   4162  O  O     . LEU A 1 520  ? -23.745 -12.129  -17.871 1.00 76.46  ? 524  LEU A O     1 
ATOM   4163  C  CB    . LEU A 1 520  ? -25.027 -12.878  -14.978 1.00 73.42  ? 524  LEU A CB    1 
ATOM   4164  C  CG    . LEU A 1 520  ? -24.390 -12.777  -13.593 1.00 74.20  ? 524  LEU A CG    1 
ATOM   4165  C  CD1   . LEU A 1 520  ? -24.628 -14.042  -12.790 1.00 71.13  ? 524  LEU A CD1   1 
ATOM   4166  C  CD2   . LEU A 1 520  ? -22.906 -12.506  -13.722 1.00 77.99  ? 524  LEU A CD2   1 
ATOM   4167  N  N     . LEU A 1 521  ? -25.992 -12.162  -17.957 1.00 69.47  ? 525  LEU A N     1 
ATOM   4168  C  CA    . LEU A 1 521  ? -26.064 -12.397  -19.396 1.00 62.86  ? 525  LEU A CA    1 
ATOM   4169  C  C     . LEU A 1 521  ? -25.508 -11.187  -20.120 1.00 85.44  ? 525  LEU A C     1 
ATOM   4170  O  O     . LEU A 1 521  ? -24.677 -11.317  -21.034 1.00 87.64  ? 525  LEU A O     1 
ATOM   4171  C  CB    . LEU A 1 521  ? -27.502 -12.663  -19.843 1.00 54.03  ? 525  LEU A CB    1 
ATOM   4172  C  CG    . LEU A 1 521  ? -28.061 -14.059  -19.590 1.00 65.44  ? 525  LEU A CG    1 
ATOM   4173  C  CD1   . LEU A 1 521  ? -29.530 -14.132  -19.968 1.00 62.95  ? 525  LEU A CD1   1 
ATOM   4174  C  CD2   . LEU A 1 521  ? -27.255 -15.101  -20.337 1.00 69.39  ? 525  LEU A CD2   1 
ATOM   4175  N  N     . GLY A 1 522  ? -25.970 -10.009  -19.697 1.00 88.75  ? 526  GLY A N     1 
ATOM   4176  C  CA    . GLY A 1 522  ? -25.469 -8.760   -20.235 1.00 73.70  ? 526  GLY A CA    1 
ATOM   4177  C  C     . GLY A 1 522  ? -23.965 -8.663   -20.102 1.00 71.74  ? 526  GLY A C     1 
ATOM   4178  O  O     . GLY A 1 522  ? -23.283 -8.226   -21.009 1.00 74.86  ? 526  GLY A O     1 
ATOM   4179  N  N     . LEU A 1 523  ? -23.446 -9.087   -18.958 1.00 80.57  ? 527  LEU A N     1 
ATOM   4180  C  CA    . LEU A 1 523  ? -22.009 -9.042   -18.705 1.00 78.70  ? 527  LEU A CA    1 
ATOM   4181  C  C     . LEU A 1 523  ? -21.271 -10.027  -19.599 1.00 91.22  ? 527  LEU A C     1 
ATOM   4182  O  O     . LEU A 1 523  ? -20.135 -9.774   -20.001 1.00 88.74  ? 527  LEU A O     1 
ATOM   4183  C  CB    . LEU A 1 523  ? -21.705 -9.335   -17.231 1.00 68.02  ? 527  LEU A CB    1 
ATOM   4184  C  CG    . LEU A 1 523  ? -20.229 -9.278   -16.833 1.00 73.82  ? 527  LEU A CG    1 
ATOM   4185  C  CD1   . LEU A 1 523  ? -19.650 -7.905   -17.078 1.00 77.37  ? 527  LEU A CD1   1 
ATOM   4186  C  CD2   . LEU A 1 523  ? -20.056 -9.677   -15.378 1.00 88.29  ? 527  LEU A CD2   1 
ATOM   4187  N  N     . CYS A 1 524  ? -21.918 -11.149  -19.908 1.00 94.67  ? 528  CYS A N     1 
ATOM   4188  C  CA    . CYS A 1 524  ? -21.305 -12.158  -20.761 1.00 87.61  ? 528  CYS A CA    1 
ATOM   4189  C  C     . CYS A 1 524  ? -21.188 -11.650  -22.189 1.00 87.23  ? 528  CYS A C     1 
ATOM   4190  O  O     . CYS A 1 524  ? -20.154 -11.826  -22.832 1.00 87.79  ? 528  CYS A O     1 
ATOM   4191  C  CB    . CYS A 1 524  ? -22.101 -13.456  -20.732 1.00 89.59  ? 528  CYS A CB    1 
ATOM   4192  S  SG    . CYS A 1 524  ? -21.248 -14.827  -21.579 1.00 84.27  ? 528  CYS A SG    1 
ATOM   4193  N  N     . GLU A 1 525  ? -22.251 -11.021  -22.681 1.00 88.07  ? 529  GLU A N     1 
ATOM   4194  C  CA    . GLU A 1 525  ? -22.211 -10.392  -24.001 1.00 85.68  ? 529  GLU A CA    1 
ATOM   4195  C  C     . GLU A 1 525  ? -21.198 -9.249   -24.025 1.00 86.89  ? 529  GLU A C     1 
ATOM   4196  O  O     . GLU A 1 525  ? -20.507 -9.032   -25.015 1.00 84.42  ? 529  GLU A O     1 
ATOM   4197  C  CB    . GLU A 1 525  ? -23.597 -9.874   -24.396 1.00 92.56  ? 529  GLU A CB    1 
ATOM   4198  C  CG    . GLU A 1 525  ? -24.536 -10.947  -24.925 1.00 120.72 ? 529  GLU A CG    1 
ATOM   4199  C  CD    . GLU A 1 525  ? -24.291 -11.267  -26.392 1.00 136.01 ? 529  GLU A CD    1 
ATOM   4200  O  OE1   . GLU A 1 525  ? -24.477 -10.362  -27.236 1.00 135.21 ? 529  GLU A OE1   1 
ATOM   4201  O  OE2   . GLU A 1 525  ? -23.912 -12.420  -26.700 1.00 140.67 ? 529  GLU A OE2   1 
ATOM   4202  N  N     . GLN A 1 526  ? -21.111 -8.533   -22.910 1.00 96.48  ? 530  GLN A N     1 
ATOM   4203  C  CA    . GLN A 1 526  ? -20.282 -7.339   -22.792 1.00 93.87  ? 530  GLN A CA    1 
ATOM   4204  C  C     . GLN A 1 526  ? -18.786 -7.646   -22.845 1.00 82.48  ? 530  GLN A C     1 
ATOM   4205  O  O     . GLN A 1 526  ? -18.065 -7.074   -23.644 1.00 88.59  ? 530  GLN A O     1 
ATOM   4206  C  CB    . GLN A 1 526  ? -20.627 -6.614   -21.488 1.00 107.81 ? 530  GLN A CB    1 
ATOM   4207  C  CG    . GLN A 1 526  ? -19.810 -5.378   -21.190 1.00 106.13 ? 530  GLN A CG    1 
ATOM   4208  C  CD    . GLN A 1 526  ? -20.159 -4.787   -19.842 1.00 107.13 ? 530  GLN A CD    1 
ATOM   4209  O  OE1   . GLN A 1 526  ? -21.334 -4.624   -19.511 1.00 108.40 ? 530  GLN A OE1   1 
ATOM   4210  N  NE2   . GLN A 1 526  ? -19.139 -4.474   -19.049 1.00 112.16 ? 530  GLN A NE2   1 
ATOM   4211  N  N     . LYS A 1 527  ? -18.322 -8.542   -21.979 1.00 90.37  ? 531  LYS A N     1 
ATOM   4212  C  CA    . LYS A 1 527  ? -16.910 -8.923   -21.927 1.00 90.12  ? 531  LYS A CA    1 
ATOM   4213  C  C     . LYS A 1 527  ? -16.435 -9.499   -23.247 1.00 96.11  ? 531  LYS A C     1 
ATOM   4214  O  O     . LYS A 1 527  ? -17.207 -10.125  -23.972 1.00 101.72 ? 531  LYS A O     1 
ATOM   4215  C  CB    . LYS A 1 527  ? -16.662 -9.951   -20.818 1.00 89.74  ? 531  LYS A CB    1 
ATOM   4216  C  CG    . LYS A 1 527  ? -16.543 -9.359   -19.432 1.00 92.25  ? 531  LYS A CG    1 
ATOM   4217  C  CD    . LYS A 1 527  ? -15.471 -8.287   -19.389 1.00 94.55  ? 531  LYS A CD    1 
ATOM   4218  C  CE    . LYS A 1 527  ? -15.448 -7.606   -18.043 1.00 89.24  ? 531  LYS A CE    1 
ATOM   4219  N  NZ    . LYS A 1 527  ? -14.792 -6.279   -18.101 1.00 110.59 ? 531  LYS A NZ    1 
ATOM   4220  N  N     . ARG A 1 528  ? -15.161 -9.294   -23.559 1.00 103.76 ? 532  ARG A N     1 
ATOM   4221  C  CA    . ARG A 1 528  ? -14.604 -9.871   -24.775 1.00 106.98 ? 532  ARG A CA    1 
ATOM   4222  C  C     . ARG A 1 528  ? -13.483 -10.852  -24.454 1.00 98.67  ? 532  ARG A C     1 
ATOM   4223  O  O     . ARG A 1 528  ? -12.718 -10.656  -23.517 1.00 98.44  ? 532  ARG A O     1 
ATOM   4224  C  CB    . ARG A 1 528  ? -14.124 -8.771   -25.739 1.00 122.93 ? 532  ARG A CB    1 
ATOM   4225  C  CG    . ARG A 1 528  ? -13.118 -7.765   -25.196 1.00 132.27 ? 532  ARG A CG    1 
ATOM   4226  C  CD    . ARG A 1 528  ? -13.101 -6.536   -26.104 1.00 137.79 ? 532  ARG A CD    1 
ATOM   4227  N  NE    . ARG A 1 528  ? -11.918 -5.692   -25.945 1.00 144.39 ? 532  ARG A NE    1 
ATOM   4228  C  CZ    . ARG A 1 528  ? -11.086 -5.382   -26.939 1.00 153.05 ? 532  ARG A CZ    1 
ATOM   4229  N  NH1   . ARG A 1 528  ? -10.034 -4.603   -26.709 1.00 150.71 ? 532  ARG A NH1   1 
ATOM   4230  N  NH2   . ARG A 1 528  ? -11.305 -5.845   -28.167 1.00 161.70 ? 532  ARG A NH2   1 
ATOM   4231  N  N     . GLY A 1 529  ? -13.411 -11.919  -25.238 1.00 106.00 ? 533  GLY A N     1 
ATOM   4232  C  CA    . GLY A 1 529  ? -12.466 -12.991  -24.998 1.00 104.39 ? 533  GLY A CA    1 
ATOM   4233  C  C     . GLY A 1 529  ? -13.189 -14.235  -24.512 1.00 100.61 ? 533  GLY A C     1 
ATOM   4234  O  O     . GLY A 1 529  ? -14.063 -14.148  -23.637 1.00 101.38 ? 533  GLY A O     1 
ATOM   4235  N  N     . LYS A 1 530  ? -12.825 -15.391  -25.068 1.00 95.30  ? 534  LYS A N     1 
ATOM   4236  C  CA    . LYS A 1 530  ? -13.503 -16.639  -24.743 1.00 86.28  ? 534  LYS A CA    1 
ATOM   4237  C  C     . LYS A 1 530  ? -13.311 -17.059  -23.279 1.00 89.97  ? 534  LYS A C     1 
ATOM   4238  O  O     . LYS A 1 530  ? -14.182 -17.700  -22.698 1.00 86.02  ? 534  LYS A O     1 
ATOM   4239  C  CB    . LYS A 1 530  ? -13.027 -17.756  -25.671 1.00 88.72  ? 534  LYS A CB    1 
ATOM   4240  C  CG    . LYS A 1 530  ? -13.827 -17.880  -26.954 1.00 101.34 ? 534  LYS A CG    1 
ATOM   4241  C  CD    . LYS A 1 530  ? -13.184 -18.866  -27.923 1.00 113.25 ? 534  LYS A CD    1 
ATOM   4242  C  CE    . LYS A 1 530  ? -13.195 -20.290  -27.378 1.00 117.12 ? 534  LYS A CE    1 
ATOM   4243  N  NZ    . LYS A 1 530  ? -14.539 -20.926  -27.467 1.00 118.20 ? 534  LYS A NZ    1 
ATOM   4244  N  N     . ASP A 1 531  ? -12.174 -16.703  -22.689 1.00 86.58  ? 535  ASP A N     1 
ATOM   4245  C  CA    . ASP A 1 531  ? -11.904 -17.038  -21.293 1.00 93.73  ? 535  ASP A CA    1 
ATOM   4246  C  C     . ASP A 1 531  ? -12.927 -16.401  -20.349 1.00 95.30  ? 535  ASP A C     1 
ATOM   4247  O  O     . ASP A 1 531  ? -13.605 -17.094  -19.576 1.00 106.48 ? 535  ASP A O     1 
ATOM   4248  C  CB    . ASP A 1 531  ? -10.496 -16.592  -20.900 1.00 103.37 ? 535  ASP A CB    1 
ATOM   4249  C  CG    . ASP A 1 531  ? -9.420  -17.268  -21.715 1.00 120.07 ? 535  ASP A CG    1 
ATOM   4250  O  OD1   . ASP A 1 531  ? -9.551  -18.472  -21.992 1.00 121.69 ? 535  ASP A OD1   1 
ATOM   4251  O  OD2   . ASP A 1 531  ? -8.439  -16.594  -22.080 1.00 133.20 ? 535  ASP A OD2   1 
ATOM   4252  N  N     . ASN A 1 532  ? -13.019 -15.076  -20.417 1.00 88.40  ? 536  ASN A N     1 
ATOM   4253  C  CA    . ASN A 1 532  ? -13.984 -14.314  -19.638 1.00 84.76  ? 536  ASN A CA    1 
ATOM   4254  C  C     . ASN A 1 532  ? -15.404 -14.838  -19.827 1.00 85.09  ? 536  ASN A C     1 
ATOM   4255  O  O     . ASN A 1 532  ? -16.118 -15.086  -18.845 1.00 84.17  ? 536  ASN A O     1 
ATOM   4256  C  CB    . ASN A 1 532  ? -13.922 -12.836  -20.026 1.00 93.44  ? 536  ASN A CB    1 
ATOM   4257  C  CG    . ASN A 1 532  ? -12.552 -12.231  -19.808 1.00 90.86  ? 536  ASN A CG    1 
ATOM   4258  O  OD1   . ASN A 1 532  ? -11.995 -12.310  -18.717 1.00 79.52  ? 536  ASN A OD1   1 
ATOM   4259  N  ND2   . ASN A 1 532  ? -11.997 -11.629  -20.852 1.00 90.36  ? 536  ASN A ND2   1 
ATOM   4260  N  N     . LYS A 1 533  ? -15.802 -15.010  -21.089 1.00 75.50  ? 537  LYS A N     1 
ATOM   4261  C  CA    . LYS A 1 533  ? -17.140 -15.494  -21.404 1.00 74.05  ? 537  LYS A CA    1 
ATOM   4262  C  C     . LYS A 1 533  ? -17.387 -16.885  -20.823 1.00 83.67  ? 537  LYS A C     1 
ATOM   4263  O  O     . LYS A 1 533  ? -18.492 -17.193  -20.368 1.00 90.71  ? 537  LYS A O     1 
ATOM   4264  C  CB    . LYS A 1 533  ? -17.350 -15.511  -22.904 1.00 73.93  ? 537  LYS A CB    1 
ATOM   4265  C  CG    . LYS A 1 533  ? -17.270 -14.142  -23.539 1.00 74.83  ? 537  LYS A CG    1 
ATOM   4266  C  CD    . LYS A 1 533  ? -17.332 -14.242  -25.057 1.00 73.87  ? 537  LYS A CD    1 
ATOM   4267  C  CE    . LYS A 1 533  ? -17.414 -12.880  -25.678 1.00 72.35  ? 537  LYS A CE    1 
ATOM   4268  N  NZ    . LYS A 1 533  ? -18.654 -12.185  -25.267 1.00 76.42  ? 537  LYS A NZ    1 
ATOM   4269  N  N     . ALA A 1 534  ? -16.352 -17.718  -20.829 1.00 83.83  ? 538  ALA A N     1 
ATOM   4270  C  CA    . ALA A 1 534  ? -16.447 -19.062  -20.267 1.00 74.81  ? 538  ALA A CA    1 
ATOM   4271  C  C     . ALA A 1 534  ? -16.686 -18.998  -18.763 1.00 67.76  ? 538  ALA A C     1 
ATOM   4272  O  O     . ALA A 1 534  ? -17.577 -19.675  -18.243 1.00 64.26  ? 538  ALA A O     1 
ATOM   4273  C  CB    . ALA A 1 534  ? -15.189 -19.861  -20.574 1.00 67.07  ? 538  ALA A CB    1 
ATOM   4274  N  N     . ILE A 1 535  ? -15.895 -18.177  -18.071 1.00 71.03  ? 539  ILE A N     1 
ATOM   4275  C  CA    . ILE A 1 535  ? -16.058 -17.992  -16.624 1.00 71.41  ? 539  ILE A CA    1 
ATOM   4276  C  C     . ILE A 1 535  ? -17.453 -17.478  -16.261 1.00 78.40  ? 539  ILE A C     1 
ATOM   4277  O  O     . ILE A 1 535  ? -18.135 -18.040  -15.393 1.00 90.73  ? 539  ILE A O     1 
ATOM   4278  C  CB    . ILE A 1 535  ? -15.021 -17.018  -16.063 1.00 73.75  ? 539  ILE A CB    1 
ATOM   4279  C  CG1   . ILE A 1 535  ? -13.608 -17.572  -16.254 1.00 81.23  ? 539  ILE A CG1   1 
ATOM   4280  C  CG2   . ILE A 1 535  ? -15.279 -16.758  -14.589 1.00 85.14  ? 539  ILE A CG2   1 
ATOM   4281  C  CD1   . ILE A 1 535  ? -13.338 -18.828  -15.461 1.00 86.85  ? 539  ILE A CD1   1 
ATOM   4282  N  N     . ILE A 1 536  ? -17.870 -16.408  -16.933 1.00 73.51  ? 540  ILE A N     1 
ATOM   4283  C  CA    . ILE A 1 536  ? -19.188 -15.820  -16.718 1.00 76.92  ? 540  ILE A CA    1 
ATOM   4284  C  C     . ILE A 1 536  ? -20.303 -16.839  -16.952 1.00 75.47  ? 540  ILE A C     1 
ATOM   4285  O  O     . ILE A 1 536  ? -21.220 -16.968  -16.130 1.00 71.46  ? 540  ILE A O     1 
ATOM   4286  C  CB    . ILE A 1 536  ? -19.419 -14.607  -17.638 1.00 75.40  ? 540  ILE A CB    1 
ATOM   4287  C  CG1   . ILE A 1 536  ? -18.375 -13.525  -17.361 1.00 79.36  ? 540  ILE A CG1   1 
ATOM   4288  C  CG2   . ILE A 1 536  ? -20.818 -14.055  -17.443 1.00 76.05  ? 540  ILE A CG2   1 
ATOM   4289  C  CD1   . ILE A 1 536  ? -18.487 -12.313  -18.264 1.00 81.14  ? 540  ILE A CD1   1 
ATOM   4290  N  N     . ALA A 1 537  ? -20.213 -17.565  -18.064 1.00 68.85  ? 541  ALA A N     1 
ATOM   4291  C  CA    . ALA A 1 537  ? -21.191 -18.601  -18.384 1.00 71.99  ? 541  ALA A CA    1 
ATOM   4292  C  C     . ALA A 1 537  ? -21.250 -19.653  -17.268 1.00 76.37  ? 541  ALA A C     1 
ATOM   4293  O  O     . ALA A 1 537  ? -22.335 -20.027  -16.801 1.00 77.30  ? 541  ALA A O     1 
ATOM   4294  C  CB    . ALA A 1 537  ? -20.862 -19.252  -19.710 1.00 67.98  ? 541  ALA A CB    1 
ATOM   4295  N  N     . SER A 1 538  ? -20.075 -20.118  -16.850 1.00 64.40  ? 542  SER A N     1 
ATOM   4296  C  CA    . SER A 1 538  ? -19.962 -21.071  -15.755 1.00 66.14  ? 542  SER A CA    1 
ATOM   4297  C  C     . SER A 1 538  ? -20.696 -20.585  -14.508 1.00 70.45  ? 542  SER A C     1 
ATOM   4298  O  O     . SER A 1 538  ? -21.469 -21.338  -13.894 1.00 68.02  ? 542  SER A O     1 
ATOM   4299  C  CB    . SER A 1 538  ? -18.491 -21.330  -15.425 1.00 68.66  ? 542  SER A CB    1 
ATOM   4300  O  OG    . SER A 1 538  ? -17.787 -21.840  -16.550 1.00 75.64  ? 542  SER A OG    1 
ATOM   4301  N  N     . ASN A 1 539  ? -20.469 -19.325  -14.145 1.00 70.25  ? 543  ASN A N     1 
ATOM   4302  C  CA    . ASN A 1 539  ? -21.125 -18.767  -12.965 1.00 74.34  ? 543  ASN A CA    1 
ATOM   4303  C  C     . ASN A 1 539  ? -22.642 -18.653  -13.122 1.00 76.88  ? 543  ASN A C     1 
ATOM   4304  O  O     . ASN A 1 539  ? -23.404 -18.922  -12.181 1.00 83.25  ? 543  ASN A O     1 
ATOM   4305  C  CB    . ASN A 1 539  ? -20.536 -17.406  -12.631 1.00 69.88  ? 543  ASN A CB    1 
ATOM   4306  C  CG    . ASN A 1 539  ? -19.213 -17.512  -11.904 1.00 73.67  ? 543  ASN A CG    1 
ATOM   4307  O  OD1   . ASN A 1 539  ? -19.162 -17.940  -10.749 1.00 82.61  ? 543  ASN A OD1   1 
ATOM   4308  N  ND2   . ASN A 1 539  ? -18.132 -17.121  -12.575 1.00 75.84  ? 543  ASN A ND2   1 
ATOM   4309  N  N     . ILE A 1 540  ? -23.076 -18.265  -14.316 1.00 73.40  ? 544  ILE A N     1 
ATOM   4310  C  CA    . ILE A 1 540  ? -24.499 -18.173  -14.615 1.00 77.01  ? 544  ILE A CA    1 
ATOM   4311  C  C     . ILE A 1 540  ? -25.159 -19.524  -14.400 1.00 83.23  ? 544  ILE A C     1 
ATOM   4312  O  O     . ILE A 1 540  ? -26.181 -19.625  -13.703 1.00 81.04  ? 544  ILE A O     1 
ATOM   4313  C  CB    . ILE A 1 540  ? -24.755 -17.701  -16.063 1.00 65.23  ? 544  ILE A CB    1 
ATOM   4314  C  CG1   . ILE A 1 540  ? -24.286 -16.263  -16.239 1.00 68.78  ? 544  ILE A CG1   1 
ATOM   4315  C  CG2   . ILE A 1 540  ? -26.229 -17.799  -16.401 1.00 63.62  ? 544  ILE A CG2   1 
ATOM   4316  C  CD1   . ILE A 1 540  ? -24.384 -15.772  -17.665 1.00 84.72  ? 544  ILE A CD1   1 
ATOM   4317  N  N     . MET A 1 541  ? -24.561 -20.557  -14.999 1.00 86.29  ? 545  MET A N     1 
ATOM   4318  C  CA    . MET A 1 541  ? -25.036 -21.922  -14.815 1.00 76.79  ? 545  MET A CA    1 
ATOM   4319  C  C     . MET A 1 541  ? -25.088 -22.274  -13.342 1.00 76.38  ? 545  MET A C     1 
ATOM   4320  O  O     . MET A 1 541  ? -26.108 -22.772  -12.875 1.00 73.49  ? 545  MET A O     1 
ATOM   4321  C  CB    . MET A 1 541  ? -24.144 -22.936  -15.496 1.00 78.95  ? 545  MET A CB    1 
ATOM   4322  C  CG    . MET A 1 541  ? -23.996 -22.845  -17.001 1.00 86.66  ? 545  MET A CG    1 
ATOM   4323  S  SD    . MET A 1 541  ? -22.606 -23.996  -17.371 1.00 89.80  ? 545  MET A SD    1 
ATOM   4324  C  CE    . MET A 1 541  ? -22.403 -23.804  -19.086 1.00 81.99  ? 545  MET A CE    1 
ATOM   4325  N  N     . TYR A 1 542  ? -23.991 -22.028  -12.620 1.00 61.83  ? 546  TYR A N     1 
ATOM   4326  C  CA    . TYR A 1 542  ? -23.936 -22.401  -11.211 1.00 59.78  ? 546  TYR A CA    1 
ATOM   4327  C  C     . TYR A 1 542  ? -25.125 -21.832  -10.456 1.00 64.99  ? 546  TYR A C     1 
ATOM   4328  O  O     . TYR A 1 542  ? -25.854 -22.569  -9.781  1.00 75.57  ? 546  TYR A O     1 
ATOM   4329  C  CB    . TYR A 1 542  ? -22.640 -21.935  -10.554 1.00 61.71  ? 546  TYR A CB    1 
ATOM   4330  C  CG    . TYR A 1 542  ? -22.630 -22.235  -9.068  1.00 65.89  ? 546  TYR A CG    1 
ATOM   4331  C  CD1   . TYR A 1 542  ? -22.385 -23.518  -8.603  1.00 61.30  ? 546  TYR A CD1   1 
ATOM   4332  C  CD2   . TYR A 1 542  ? -22.892 -21.239  -8.134  1.00 66.86  ? 546  TYR A CD2   1 
ATOM   4333  C  CE1   . TYR A 1 542  ? -22.388 -23.797  -7.248  1.00 80.27  ? 546  TYR A CE1   1 
ATOM   4334  C  CE2   . TYR A 1 542  ? -22.898 -21.506  -6.790  1.00 69.63  ? 546  TYR A CE2   1 
ATOM   4335  C  CZ    . TYR A 1 542  ? -22.650 -22.789  -6.346  1.00 77.30  ? 546  TYR A CZ    1 
ATOM   4336  O  OH    . TYR A 1 542  ? -22.664 -23.065  -4.998  1.00 69.51  ? 546  TYR A OH    1 
ATOM   4337  N  N     . ILE A 1 543  ? -25.318 -20.523  -10.588 1.00 62.36  ? 547  ILE A N     1 
ATOM   4338  C  CA    . ILE A 1 543  ? -26.452 -19.857  -9.961  1.00 70.27  ? 547  ILE A CA    1 
ATOM   4339  C  C     . ILE A 1 543  ? -27.771 -20.528  -10.353 1.00 75.92  ? 547  ILE A C     1 
ATOM   4340  O  O     . ILE A 1 543  ? -28.588 -20.849  -9.484  1.00 74.98  ? 547  ILE A O     1 
ATOM   4341  C  CB    . ILE A 1 543  ? -26.497 -18.359  -10.329 1.00 65.89  ? 547  ILE A CB    1 
ATOM   4342  C  CG1   . ILE A 1 543  ? -25.340 -17.628  -9.658  1.00 60.87  ? 547  ILE A CG1   1 
ATOM   4343  C  CG2   . ILE A 1 543  ? -27.822 -17.735  -9.923  1.00 62.94  ? 547  ILE A CG2   1 
ATOM   4344  C  CD1   . ILE A 1 543  ? -25.368 -16.133  -9.857  1.00 66.15  ? 547  ILE A CD1   1 
ATOM   4345  N  N     . VAL A 1 544  ? -27.967 -20.752  -11.653 1.00 68.53  ? 548  VAL A N     1 
ATOM   4346  C  CA    . VAL A 1 544  ? -29.184 -21.399  -12.149 1.00 71.65  ? 548  VAL A CA    1 
ATOM   4347  C  C     . VAL A 1 544  ? -29.412 -22.763  -11.486 1.00 79.80  ? 548  VAL A C     1 
ATOM   4348  O  O     . VAL A 1 544  ? -30.520 -23.076  -11.044 1.00 81.49  ? 548  VAL A O     1 
ATOM   4349  C  CB    . VAL A 1 544  ? -29.137 -21.572  -13.684 1.00 65.79  ? 548  VAL A CB    1 
ATOM   4350  C  CG1   . VAL A 1 544  ? -30.214 -22.524  -14.156 1.00 62.46  ? 548  VAL A CG1   1 
ATOM   4351  C  CG2   . VAL A 1 544  ? -29.280 -20.217  -14.363 1.00 71.59  ? 548  VAL A CG2   1 
ATOM   4352  N  N     . GLY A 1 545  ? -28.353 -23.561  -11.409 1.00 73.89  ? 549  GLY A N     1 
ATOM   4353  C  CA    . GLY A 1 545  ? -28.413 -24.880  -10.815 1.00 80.73  ? 549  GLY A CA    1 
ATOM   4354  C  C     . GLY A 1 545  ? -28.659 -24.848  -9.313  1.00 87.73  ? 549  GLY A C     1 
ATOM   4355  O  O     . GLY A 1 545  ? -29.163 -25.818  -8.746  1.00 89.06  ? 549  GLY A O     1 
ATOM   4356  N  N     . GLN A 1 546  ? -28.313 -23.741  -8.662  1.00 80.20  ? 550  GLN A N     1 
ATOM   4357  C  CA    . GLN A 1 546  ? -28.537 -23.622  -7.226  1.00 65.15  ? 550  GLN A CA    1 
ATOM   4358  C  C     . GLN A 1 546  ? -29.945 -23.119  -6.897  1.00 72.30  ? 550  GLN A C     1 
ATOM   4359  O  O     . GLN A 1 546  ? -30.295 -22.991  -5.714  1.00 69.28  ? 550  GLN A O     1 
ATOM   4360  C  CB    . GLN A 1 546  ? -27.506 -22.685  -6.592  1.00 67.60  ? 550  GLN A CB    1 
ATOM   4361  C  CG    . GLN A 1 546  ? -26.087 -23.197  -6.638  1.00 73.69  ? 550  GLN A CG    1 
ATOM   4362  C  CD    . GLN A 1 546  ? -25.928 -24.529  -5.927  1.00 78.53  ? 550  GLN A CD    1 
ATOM   4363  O  OE1   . GLN A 1 546  ? -26.528 -24.757  -4.882  1.00 79.31  ? 550  GLN A OE1   1 
ATOM   4364  N  NE2   . GLN A 1 546  ? -25.127 -25.421  -6.500  1.00 90.64  ? 550  GLN A NE2   1 
ATOM   4365  N  N     . TYR A 1 547  ? -30.745 -22.818  -7.922  1.00 73.01  ? 551  TYR A N     1 
ATOM   4366  C  CA    . TYR A 1 547  ? -32.087 -22.280  -7.689  1.00 69.51  ? 551  TYR A CA    1 
ATOM   4367  C  C     . TYR A 1 547  ? -33.162 -23.083  -8.409  1.00 83.10  ? 551  TYR A C     1 
ATOM   4368  O  O     . TYR A 1 547  ? -33.767 -22.595  -9.361  1.00 89.57  ? 551  TYR A O     1 
ATOM   4369  C  CB    . TYR A 1 547  ? -32.161 -20.814  -8.121  1.00 60.81  ? 551  TYR A CB    1 
ATOM   4370  C  CG    . TYR A 1 547  ? -31.569 -19.837  -7.130  1.00 65.51  ? 551  TYR A CG    1 
ATOM   4371  C  CD1   . TYR A 1 547  ? -32.276 -19.458  -5.994  1.00 72.31  ? 551  TYR A CD1   1 
ATOM   4372  C  CD2   . TYR A 1 547  ? -30.312 -19.284  -7.332  1.00 63.89  ? 551  TYR A CD2   1 
ATOM   4373  C  CE1   . TYR A 1 547  ? -31.747 -18.565  -5.083  1.00 74.88  ? 551  TYR A CE1   1 
ATOM   4374  C  CE2   . TYR A 1 547  ? -29.773 -18.387  -6.427  1.00 73.26  ? 551  TYR A CE2   1 
ATOM   4375  C  CZ    . TYR A 1 547  ? -30.495 -18.029  -5.300  1.00 79.09  ? 551  TYR A CZ    1 
ATOM   4376  O  OH    . TYR A 1 547  ? -29.968 -17.134  -4.386  1.00 76.22  ? 551  TYR A OH    1 
ATOM   4377  N  N     . PRO A 1 548  ? -33.419 -24.316  -7.939  1.00 88.79  ? 552  PRO A N     1 
ATOM   4378  C  CA    . PRO A 1 548  ? -34.354 -25.225  -8.617  1.00 78.23  ? 552  PRO A CA    1 
ATOM   4379  C  C     . PRO A 1 548  ? -35.818 -24.807  -8.470  1.00 80.26  ? 552  PRO A C     1 
ATOM   4380  O  O     . PRO A 1 548  ? -36.617 -25.126  -9.353  1.00 85.34  ? 552  PRO A O     1 
ATOM   4381  C  CB    . PRO A 1 548  ? -34.102 -26.561  -7.926  1.00 67.62  ? 552  PRO A CB    1 
ATOM   4382  C  CG    . PRO A 1 548  ? -33.644 -26.183  -6.569  1.00 76.73  ? 552  PRO A CG    1 
ATOM   4383  C  CD    . PRO A 1 548  ? -32.852 -24.918  -6.720  1.00 82.79  ? 552  PRO A CD    1 
ATOM   4384  N  N     . ARG A 1 549  ? -36.161 -24.115  -7.384  1.00 74.99  ? 553  ARG A N     1 
ATOM   4385  C  CA    . ARG A 1 549  ? -37.521 -23.603  -7.198  1.00 80.33  ? 553  ARG A CA    1 
ATOM   4386  C  C     . ARG A 1 549  ? -37.922 -22.704  -8.369  1.00 87.75  ? 553  ARG A C     1 
ATOM   4387  O  O     . ARG A 1 549  ? -39.030 -22.811  -8.921  1.00 95.56  ? 553  ARG A O     1 
ATOM   4388  C  CB    . ARG A 1 549  ? -37.619 -22.835  -5.884  1.00 79.82  ? 553  ARG A CB    1 
ATOM   4389  C  CG    . ARG A 1 549  ? -38.979 -22.214  -5.614  1.00 92.08  ? 553  ARG A CG    1 
ATOM   4390  C  CD    . ARG A 1 549  ? -39.120 -21.790  -4.152  1.00 94.44  ? 553  ARG A CD    1 
ATOM   4391  N  NE    . ARG A 1 549  ? -38.256 -20.664  -3.804  1.00 96.72  ? 553  ARG A NE    1 
ATOM   4392  C  CZ    . ARG A 1 549  ? -38.062 -20.232  -2.561  1.00 99.08  ? 553  ARG A CZ    1 
ATOM   4393  N  NH1   . ARG A 1 549  ? -38.666 -20.842  -1.550  1.00 111.92 ? 553  ARG A NH1   1 
ATOM   4394  N  NH2   . ARG A 1 549  ? -37.261 -19.199  -2.329  1.00 99.28  ? 553  ARG A NH2   1 
ATOM   4395  N  N     . PHE A 1 550  ? -36.991 -21.833  -8.747  1.00 78.81  ? 554  PHE A N     1 
ATOM   4396  C  CA    . PHE A 1 550  ? -37.156 -20.918  -9.864  1.00 73.29  ? 554  PHE A CA    1 
ATOM   4397  C  C     . PHE A 1 550  ? -37.387 -21.666  -11.173 1.00 82.51  ? 554  PHE A C     1 
ATOM   4398  O  O     . PHE A 1 550  ? -38.284 -21.329  -11.941 1.00 95.57  ? 554  PHE A O     1 
ATOM   4399  C  CB    . PHE A 1 550  ? -35.921 -20.024  -9.966  1.00 87.37  ? 554  PHE A CB    1 
ATOM   4400  C  CG    . PHE A 1 550  ? -36.021 -18.951  -11.014 1.00 89.64  ? 554  PHE A CG    1 
ATOM   4401  C  CD1   . PHE A 1 550  ? -36.772 -17.810  -10.789 1.00 100.96 ? 554  PHE A CD1   1 
ATOM   4402  C  CD2   . PHE A 1 550  ? -35.335 -19.070  -12.207 1.00 91.16  ? 554  PHE A CD2   1 
ATOM   4403  C  CE1   . PHE A 1 550  ? -36.853 -16.819  -11.742 1.00 106.32 ? 554  PHE A CE1   1 
ATOM   4404  C  CE2   . PHE A 1 550  ? -35.414 -18.083  -13.167 1.00 101.60 ? 554  PHE A CE2   1 
ATOM   4405  C  CZ    . PHE A 1 550  ? -36.173 -16.956  -12.935 1.00 110.49 ? 554  PHE A CZ    1 
ATOM   4406  N  N     . LEU A 1 551  ? -36.576 -22.691  -11.418 1.00 81.58  ? 555  LEU A N     1 
ATOM   4407  C  CA    . LEU A 1 551  ? -36.683 -23.482  -12.642 1.00 80.90  ? 555  LEU A CA    1 
ATOM   4408  C  C     . LEU A 1 551  ? -38.001 -24.246  -12.707 1.00 89.95  ? 555  LEU A C     1 
ATOM   4409  O  O     . LEU A 1 551  ? -38.630 -24.331  -13.763 1.00 97.84  ? 555  LEU A O     1 
ATOM   4410  C  CB    . LEU A 1 551  ? -35.516 -24.464  -12.756 1.00 73.05  ? 555  LEU A CB    1 
ATOM   4411  C  CG    . LEU A 1 551  ? -34.129 -23.844  -12.907 1.00 77.03  ? 555  LEU A CG    1 
ATOM   4412  C  CD1   . LEU A 1 551  ? -33.066 -24.931  -12.993 1.00 68.14  ? 555  LEU A CD1   1 
ATOM   4413  C  CD2   . LEU A 1 551  ? -34.084 -22.938  -14.135 1.00 86.50  ? 555  LEU A CD2   1 
ATOM   4414  N  N     . ARG A 1 552  ? -38.410 -24.810  -11.577 1.00 84.74  ? 556  ARG A N     1 
ATOM   4415  C  CA    . ARG A 1 552  ? -39.639 -25.585  -11.524 1.00 86.09  ? 556  ARG A CA    1 
ATOM   4416  C  C     . ARG A 1 552  ? -40.838 -24.682  -11.748 1.00 94.90  ? 556  ARG A C     1 
ATOM   4417  O  O     . ARG A 1 552  ? -41.827 -25.091  -12.361 1.00 94.48  ? 556  ARG A O     1 
ATOM   4418  C  CB    . ARG A 1 552  ? -39.762 -26.319  -10.187 1.00 78.17  ? 556  ARG A CB    1 
ATOM   4419  C  CG    . ARG A 1 552  ? -38.724 -27.412  -9.990  1.00 84.61  ? 556  ARG A CG    1 
ATOM   4420  C  CD    . ARG A 1 552  ? -39.059 -28.287  -8.795  1.00 86.73  ? 556  ARG A CD    1 
ATOM   4421  N  NE    . ARG A 1 552  ? -38.887 -27.582  -7.533  1.00 85.05  ? 556  ARG A NE    1 
ATOM   4422  C  CZ    . ARG A 1 552  ? -37.929 -27.853  -6.655  1.00 91.15  ? 556  ARG A CZ    1 
ATOM   4423  N  NH1   . ARG A 1 552  ? -37.062 -28.827  -6.896  1.00 93.24  ? 556  ARG A NH1   1 
ATOM   4424  N  NH2   . ARG A 1 552  ? -37.845 -27.160  -5.529  1.00 98.69  ? 556  ARG A NH2   1 
ATOM   4425  N  N     . ALA A 1 553  ? -40.738 -23.448  -11.261 1.00 100.13 ? 557  ALA A N     1 
ATOM   4426  C  CA    . ALA A 1 553  ? -41.835 -22.495  -11.389 1.00 99.21  ? 557  ALA A CA    1 
ATOM   4427  C  C     . ALA A 1 553  ? -42.105 -22.101  -12.842 1.00 98.27  ? 557  ALA A C     1 
ATOM   4428  O  O     . ALA A 1 553  ? -43.242 -21.803  -13.204 1.00 105.65 ? 557  ALA A O     1 
ATOM   4429  C  CB    . ALA A 1 553  ? -41.551 -21.260  -10.559 1.00 111.56 ? 557  ALA A CB    1 
ATOM   4430  N  N     . HIS A 1 554  ? -41.064 -22.107  -13.670 1.00 99.58  ? 558  HIS A N     1 
ATOM   4431  C  CA    . HIS A 1 554  ? -41.179 -21.636  -15.050 1.00 93.37  ? 558  HIS A CA    1 
ATOM   4432  C  C     . HIS A 1 554  ? -40.576 -22.618  -16.056 1.00 85.48  ? 558  HIS A C     1 
ATOM   4433  O  O     . HIS A 1 554  ? -39.353 -22.690  -16.201 1.00 82.56  ? 558  HIS A O     1 
ATOM   4434  C  CB    . HIS A 1 554  ? -40.506 -20.272  -15.181 1.00 102.49 ? 558  HIS A CB    1 
ATOM   4435  C  CG    . HIS A 1 554  ? -40.812 -19.342  -14.047 1.00 110.86 ? 558  HIS A CG    1 
ATOM   4436  N  ND1   . HIS A 1 554  ? -41.956 -18.574  -13.996 1.00 115.39 ? 558  HIS A ND1   1 
ATOM   4437  C  CD2   . HIS A 1 554  ? -40.124 -19.064  -12.915 1.00 112.14 ? 558  HIS A CD2   1 
ATOM   4438  C  CE1   . HIS A 1 554  ? -41.957 -17.861  -12.885 1.00 117.09 ? 558  HIS A CE1   1 
ATOM   4439  N  NE2   . HIS A 1 554  ? -40.856 -18.140  -12.211 1.00 108.73 ? 558  HIS A NE2   1 
ATOM   4440  N  N     . TRP A 1 555  ? -41.436 -23.352  -16.761 1.00 92.41  ? 559  TRP A N     1 
ATOM   4441  C  CA    . TRP A 1 555  ? -40.987 -24.447  -17.626 1.00 98.21  ? 559  TRP A CA    1 
ATOM   4442  C  C     . TRP A 1 555  ? -40.218 -24.006  -18.868 1.00 94.62  ? 559  TRP A C     1 
ATOM   4443  O  O     . TRP A 1 555  ? -39.217 -24.625  -19.226 1.00 91.77  ? 559  TRP A O     1 
ATOM   4444  C  CB    . TRP A 1 555  ? -42.175 -25.304  -18.064 1.00 99.85  ? 559  TRP A CB    1 
ATOM   4445  C  CG    . TRP A 1 555  ? -41.882 -26.113  -19.300 1.00 98.58  ? 559  TRP A CG    1 
ATOM   4446  C  CD1   . TRP A 1 555  ? -42.439 -25.952  -20.538 1.00 96.80  ? 559  TRP A CD1   1 
ATOM   4447  C  CD2   . TRP A 1 555  ? -40.948 -27.196  -19.419 1.00 100.46 ? 559  TRP A CD2   1 
ATOM   4448  N  NE1   . TRP A 1 555  ? -41.916 -26.873  -21.417 1.00 107.94 ? 559  TRP A NE1   1 
ATOM   4449  C  CE2   . TRP A 1 555  ? -40.999 -27.647  -20.755 1.00 104.50 ? 559  TRP A CE2   1 
ATOM   4450  C  CE3   . TRP A 1 555  ? -40.081 -27.833  -18.526 1.00 90.73  ? 559  TRP A CE3   1 
ATOM   4451  C  CZ2   . TRP A 1 555  ? -40.209 -28.698  -21.218 1.00 95.27  ? 559  TRP A CZ2   1 
ATOM   4452  C  CZ3   . TRP A 1 555  ? -39.301 -28.874  -18.987 1.00 83.89  ? 559  TRP A CZ3   1 
ATOM   4453  C  CH2   . TRP A 1 555  ? -39.369 -29.297  -20.320 1.00 94.52  ? 559  TRP A CH2   1 
ATOM   4454  N  N     . LYS A 1 556  ? -40.694 -22.957  -19.533 1.00 97.33  ? 560  LYS A N     1 
ATOM   4455  C  CA    . LYS A 1 556  ? -40.051 -22.476  -20.754 1.00 98.60  ? 560  LYS A CA    1 
ATOM   4456  C  C     . LYS A 1 556  ? -38.597 -22.121  -20.486 1.00 92.32  ? 560  LYS A C     1 
ATOM   4457  O  O     . LYS A 1 556  ? -37.697 -22.446  -21.270 1.00 88.16  ? 560  LYS A O     1 
ATOM   4458  C  CB    . LYS A 1 556  ? -40.792 -21.261  -21.321 1.00 102.68 ? 560  LYS A CB    1 
ATOM   4459  C  CG    . LYS A 1 556  ? -42.283 -21.470  -21.543 1.00 114.45 ? 560  LYS A CG    1 
ATOM   4460  C  CD    . LYS A 1 556  ? -42.556 -22.658  -22.461 1.00 121.13 ? 560  LYS A CD    1 
ATOM   4461  C  CE    . LYS A 1 556  ? -41.973 -22.451  -23.851 1.00 114.94 ? 560  LYS A CE    1 
ATOM   4462  N  NZ    . LYS A 1 556  ? -42.164 -23.658  -24.709 1.00 113.55 ? 560  LYS A NZ    1 
ATOM   4463  N  N     . PHE A 1 557  ? -38.377 -21.469  -19.353 1.00 86.89  ? 561  PHE A N     1 
ATOM   4464  C  CA    . PHE A 1 557  ? -37.041 -21.061  -18.957 1.00 94.10  ? 561  PHE A CA    1 
ATOM   4465  C  C     . PHE A 1 557  ? -36.161 -22.269  -18.657 1.00 93.69  ? 561  PHE A C     1 
ATOM   4466  O  O     . PHE A 1 557  ? -34.992 -22.299  -19.036 1.00 93.67  ? 561  PHE A O     1 
ATOM   4467  C  CB    . PHE A 1 557  ? -37.096 -20.137  -17.740 1.00 94.94  ? 561  PHE A CB    1 
ATOM   4468  C  CG    . PHE A 1 557  ? -35.761 -19.592  -17.344 1.00 81.68  ? 561  PHE A CG    1 
ATOM   4469  C  CD1   . PHE A 1 557  ? -35.155 -18.606  -18.102 1.00 77.35  ? 561  PHE A CD1   1 
ATOM   4470  C  CD2   . PHE A 1 557  ? -35.105 -20.074  -16.227 1.00 76.92  ? 561  PHE A CD2   1 
ATOM   4471  C  CE1   . PHE A 1 557  ? -33.923 -18.105  -17.753 1.00 79.42  ? 561  PHE A CE1   1 
ATOM   4472  C  CE2   . PHE A 1 557  ? -33.870 -19.577  -15.868 1.00 80.90  ? 561  PHE A CE2   1 
ATOM   4473  C  CZ    . PHE A 1 557  ? -33.278 -18.590  -16.632 1.00 87.46  ? 561  PHE A CZ    1 
ATOM   4474  N  N     . LEU A 1 558  ? -36.728 -23.258  -17.973 1.00 84.61  ? 562  LEU A N     1 
ATOM   4475  C  CA    . LEU A 1 558  ? -36.004 -24.485  -17.652 1.00 84.39  ? 562  LEU A CA    1 
ATOM   4476  C  C     . LEU A 1 558  ? -35.552 -25.196  -18.921 1.00 85.22  ? 562  LEU A C     1 
ATOM   4477  O  O     . LEU A 1 558  ? -34.388 -25.596  -19.047 1.00 78.03  ? 562  LEU A O     1 
ATOM   4478  C  CB    . LEU A 1 558  ? -36.875 -25.420  -16.815 1.00 83.90  ? 562  LEU A CB    1 
ATOM   4479  C  CG    . LEU A 1 558  ? -36.300 -26.807  -16.535 1.00 80.93  ? 562  LEU A CG    1 
ATOM   4480  C  CD1   . LEU A 1 558  ? -34.928 -26.687  -15.893 1.00 85.80  ? 562  LEU A CD1   1 
ATOM   4481  C  CD2   . LEU A 1 558  ? -37.242 -27.596  -15.636 1.00 81.55  ? 562  LEU A CD2   1 
ATOM   4482  N  N     . LYS A 1 559  ? -36.491 -25.340  -19.852 1.00 89.98  ? 563  LYS A N     1 
ATOM   4483  C  CA    . LYS A 1 559  ? -36.235 -25.930  -21.159 1.00 87.60  ? 563  LYS A CA    1 
ATOM   4484  C  C     . LYS A 1 559  ? -35.103 -25.196  -21.870 1.00 84.55  ? 563  LYS A C     1 
ATOM   4485  O  O     . LYS A 1 559  ? -34.170 -25.817  -22.391 1.00 82.79  ? 563  LYS A O     1 
ATOM   4486  C  CB    . LYS A 1 559  ? -37.509 -25.891  -21.996 1.00 93.81  ? 563  LYS A CB    1 
ATOM   4487  C  CG    . LYS A 1 559  ? -37.391 -26.512  -23.371 1.00 103.81 ? 563  LYS A CG    1 
ATOM   4488  C  CD    . LYS A 1 559  ? -38.378 -25.856  -24.326 1.00 119.84 ? 563  LYS A CD    1 
ATOM   4489  C  CE    . LYS A 1 559  ? -38.370 -26.530  -25.681 1.00 119.27 ? 563  LYS A CE    1 
ATOM   4490  N  NZ    . LYS A 1 559  ? -38.702 -25.557  -26.758 1.00 119.85 ? 563  LYS A NZ    1 
ATOM   4491  N  N     . THR A 1 560  ? -35.193 -23.869  -21.867 1.00 84.47  ? 564  THR A N     1 
ATOM   4492  C  CA    . THR A 1 560  ? -34.164 -23.012  -22.444 1.00 89.90  ? 564  THR A CA    1 
ATOM   4493  C  C     . THR A 1 560  ? -32.794 -23.311  -21.845 1.00 92.04  ? 564  THR A C     1 
ATOM   4494  O  O     . THR A 1 560  ? -31.815 -23.529  -22.568 1.00 82.65  ? 564  THR A O     1 
ATOM   4495  C  CB    . THR A 1 560  ? -34.494 -21.530  -22.217 1.00 88.56  ? 564  THR A CB    1 
ATOM   4496  O  OG1   . THR A 1 560  ? -35.854 -21.282  -22.594 1.00 89.62  ? 564  THR A OG1   1 
ATOM   4497  C  CG2   . THR A 1 560  ? -33.566 -20.647  -23.025 1.00 90.12  ? 564  THR A CG2   1 
ATOM   4498  N  N     . VAL A 1 561  ? -32.743 -23.317  -20.516 1.00 92.57  ? 565  VAL A N     1 
ATOM   4499  C  CA    . VAL A 1 561  ? -31.518 -23.592  -19.772 1.00 84.48  ? 565  VAL A CA    1 
ATOM   4500  C  C     . VAL A 1 561  ? -30.915 -24.931  -20.184 1.00 79.11  ? 565  VAL A C     1 
ATOM   4501  O  O     . VAL A 1 561  ? -29.782 -24.983  -20.653 1.00 80.99  ? 565  VAL A O     1 
ATOM   4502  C  CB    . VAL A 1 561  ? -31.767 -23.583  -18.253 1.00 77.63  ? 565  VAL A CB    1 
ATOM   4503  C  CG1   . VAL A 1 561  ? -30.566 -24.131  -17.509 1.00 70.89  ? 565  VAL A CG1   1 
ATOM   4504  C  CG2   . VAL A 1 561  ? -32.076 -22.169  -17.775 1.00 86.96  ? 565  VAL A CG2   1 
ATOM   4505  N  N     . VAL A 1 562  ? -31.687 -26.005  -20.042 1.00 69.76  ? 566  VAL A N     1 
ATOM   4506  C  CA    . VAL A 1 562  ? -31.218 -27.340  -20.424 1.00 75.53  ? 566  VAL A CA    1 
ATOM   4507  C  C     . VAL A 1 562  ? -30.703 -27.398  -21.869 1.00 80.23  ? 566  VAL A C     1 
ATOM   4508  O  O     . VAL A 1 562  ? -29.643 -27.981  -22.139 1.00 85.47  ? 566  VAL A O     1 
ATOM   4509  C  CB    . VAL A 1 562  ? -32.325 -28.394  -20.251 1.00 75.33  ? 566  VAL A CB    1 
ATOM   4510  C  CG1   . VAL A 1 562  ? -31.810 -29.766  -20.607 1.00 69.93  ? 566  VAL A CG1   1 
ATOM   4511  C  CG2   . VAL A 1 562  ? -32.839 -28.385  -18.806 1.00 86.09  ? 566  VAL A CG2   1 
ATOM   4512  N  N     . ASN A 1 563  ? -31.434 -26.782  -22.794 1.00 78.51  ? 567  ASN A N     1 
ATOM   4513  C  CA    . ASN A 1 563  ? -30.968 -26.704  -24.179 1.00 81.04  ? 567  ASN A CA    1 
ATOM   4514  C  C     . ASN A 1 563  ? -29.611 -26.006  -24.280 1.00 86.66  ? 567  ASN A C     1 
ATOM   4515  O  O     . ASN A 1 563  ? -28.743 -26.415  -25.056 1.00 88.10  ? 567  ASN A O     1 
ATOM   4516  C  CB    . ASN A 1 563  ? -31.991 -25.984  -25.052 1.00 89.55  ? 567  ASN A CB    1 
ATOM   4517  C  CG    . ASN A 1 563  ? -33.225 -26.818  -25.307 1.00 90.38  ? 567  ASN A CG    1 
ATOM   4518  O  OD1   . ASN A 1 563  ? -34.353 -26.358  -25.133 1.00 101.30 ? 567  ASN A OD1   1 
ATOM   4519  N  ND2   . ASN A 1 563  ? -33.018 -28.055  -25.723 1.00 93.58  ? 567  ASN A ND2   1 
ATOM   4520  N  N     . LYS A 1 564  ? -29.429 -24.960  -23.480 1.00 87.40  ? 568  LYS A N     1 
ATOM   4521  C  CA    . LYS A 1 564  ? -28.155 -24.262  -23.437 1.00 79.19  ? 568  LYS A CA    1 
ATOM   4522  C  C     . LYS A 1 564  ? -27.054 -25.189  -22.935 1.00 85.75  ? 568  LYS A C     1 
ATOM   4523  O  O     . LYS A 1 564  ? -25.933 -25.165  -23.453 1.00 74.75  ? 568  LYS A O     1 
ATOM   4524  C  CB    . LYS A 1 564  ? -28.246 -23.023  -22.549 1.00 68.55  ? 568  LYS A CB    1 
ATOM   4525  C  CG    . LYS A 1 564  ? -27.384 -21.897  -23.041 1.00 71.50  ? 568  LYS A CG    1 
ATOM   4526  C  CD    . LYS A 1 564  ? -27.710 -21.644  -24.493 1.00 92.94  ? 568  LYS A CD    1 
ATOM   4527  C  CE    . LYS A 1 564  ? -26.794 -20.619  -25.070 1.00 83.87  ? 568  LYS A CE    1 
ATOM   4528  N  NZ    . LYS A 1 564  ? -26.994 -20.368  -26.510 1.00 76.79  ? 568  LYS A NZ    1 
ATOM   4529  N  N     . LEU A 1 565  ? -27.380 -25.990  -21.920 1.00 86.85  ? 569  LEU A N     1 
ATOM   4530  C  CA    . LEU A 1 565  ? -26.448 -26.978  -21.387 1.00 84.87  ? 569  LEU A CA    1 
ATOM   4531  C  C     . LEU A 1 565  ? -25.985 -27.892  -22.512 1.00 81.21  ? 569  LEU A C     1 
ATOM   4532  O  O     . LEU A 1 565  ? -24.775 -28.094  -22.722 1.00 89.73  ? 569  LEU A O     1 
ATOM   4533  C  CB    . LEU A 1 565  ? -27.093 -27.801  -20.267 1.00 82.92  ? 569  LEU A CB    1 
ATOM   4534  C  CG    . LEU A 1 565  ? -27.111 -27.275  -18.829 1.00 77.17  ? 569  LEU A CG    1 
ATOM   4535  C  CD1   . LEU A 1 565  ? -27.680 -25.897  -18.745 1.00 80.90  ? 569  LEU A CD1   1 
ATOM   4536  C  CD2   . LEU A 1 565  ? -27.935 -28.198  -17.956 1.00 83.45  ? 569  LEU A CD2   1 
ATOM   4537  N  N     . PHE A 1 566  ? -26.959 -28.423  -23.245 1.00 63.20  ? 570  PHE A N     1 
ATOM   4538  C  CA    . PHE A 1 566  ? -26.662 -29.307  -24.358 1.00 60.93  ? 570  PHE A CA    1 
ATOM   4539  C  C     . PHE A 1 566  ? -25.770 -28.610  -25.374 1.00 69.80  ? 570  PHE A C     1 
ATOM   4540  O  O     . PHE A 1 566  ? -24.872 -29.226  -25.942 1.00 91.30  ? 570  PHE A O     1 
ATOM   4541  C  CB    . PHE A 1 566  ? -27.953 -29.790  -25.020 1.00 67.26  ? 570  PHE A CB    1 
ATOM   4542  C  CG    . PHE A 1 566  ? -28.792 -30.673  -24.139 1.00 68.32  ? 570  PHE A CG    1 
ATOM   4543  C  CD1   . PHE A 1 566  ? -28.221 -31.362  -23.084 1.00 78.36  ? 570  PHE A CD1   1 
ATOM   4544  C  CD2   . PHE A 1 566  ? -30.150 -30.803  -24.358 1.00 66.94  ? 570  PHE A CD2   1 
ATOM   4545  C  CE1   . PHE A 1 566  ? -28.987 -32.165  -22.259 1.00 83.70  ? 570  PHE A CE1   1 
ATOM   4546  C  CE2   . PHE A 1 566  ? -30.926 -31.602  -23.543 1.00 80.25  ? 570  PHE A CE2   1 
ATOM   4547  C  CZ    . PHE A 1 566  ? -30.342 -32.288  -22.489 1.00 84.25  ? 570  PHE A CZ    1 
ATOM   4548  N  N     . GLU A 1 567  ? -26.007 -27.318  -25.588 1.00 80.97  ? 571  GLU A N     1 
ATOM   4549  C  CA    . GLU A 1 567  ? -25.208 -26.550  -26.541 1.00 79.37  ? 571  GLU A CA    1 
ATOM   4550  C  C     . GLU A 1 567  ? -23.766 -26.398  -26.065 1.00 77.86  ? 571  GLU A C     1 
ATOM   4551  O  O     . GLU A 1 567  ? -22.822 -26.503  -26.854 1.00 67.99  ? 571  GLU A O     1 
ATOM   4552  C  CB    . GLU A 1 567  ? -25.832 -25.178  -26.769 1.00 84.44  ? 571  GLU A CB    1 
ATOM   4553  C  CG    . GLU A 1 567  ? -25.091 -24.317  -27.778 1.00 99.11  ? 571  GLU A CG    1 
ATOM   4554  C  CD    . GLU A 1 567  ? -25.723 -22.953  -27.943 1.00 109.42 ? 571  GLU A CD    1 
ATOM   4555  O  OE1   . GLU A 1 567  ? -26.941 -22.829  -27.687 1.00 110.62 ? 571  GLU A OE1   1 
ATOM   4556  O  OE2   . GLU A 1 567  ? -24.999 -22.007  -28.321 1.00 122.61 ? 571  GLU A OE2   1 
ATOM   4557  N  N     . PHE A 1 568  ? -23.605 -26.169  -24.765 1.00 86.41  ? 572  PHE A N     1 
ATOM   4558  C  CA    . PHE A 1 568  ? -22.293 -25.943  -24.171 1.00 81.57  ? 572  PHE A CA    1 
ATOM   4559  C  C     . PHE A 1 568  ? -21.519 -27.244  -23.994 1.00 78.38  ? 572  PHE A C     1 
ATOM   4560  O  O     . PHE A 1 568  ? -20.314 -27.226  -23.734 1.00 75.81  ? 572  PHE A O     1 
ATOM   4561  C  CB    . PHE A 1 568  ? -22.433 -25.233  -22.832 1.00 73.29  ? 572  PHE A CB    1 
ATOM   4562  C  CG    . PHE A 1 568  ? -22.750 -23.774  -22.950 1.00 80.62  ? 572  PHE A CG    1 
ATOM   4563  C  CD1   . PHE A 1 568  ? -22.337 -23.039  -24.044 1.00 91.56  ? 572  PHE A CD1   1 
ATOM   4564  C  CD2   . PHE A 1 568  ? -23.464 -23.129  -21.957 1.00 79.62  ? 572  PHE A CD2   1 
ATOM   4565  C  CE1   . PHE A 1 568  ? -22.633 -21.679  -24.131 1.00 92.89  ? 572  PHE A CE1   1 
ATOM   4566  C  CE2   . PHE A 1 568  ? -23.749 -21.780  -22.035 1.00 82.50  ? 572  PHE A CE2   1 
ATOM   4567  C  CZ    . PHE A 1 568  ? -23.338 -21.058  -23.128 1.00 80.42  ? 572  PHE A CZ    1 
ATOM   4568  N  N     . MET A 1 569  ? -22.210 -28.374  -24.148 1.00 77.10  ? 573  MET A N     1 
ATOM   4569  C  CA    . MET A 1 569  ? -21.539 -29.677  -24.100 1.00 77.03  ? 573  MET A CA    1 
ATOM   4570  C  C     . MET A 1 569  ? -20.683 -29.944  -25.348 1.00 77.51  ? 573  MET A C     1 
ATOM   4571  O  O     . MET A 1 569  ? -20.068 -31.006  -25.464 1.00 78.20  ? 573  MET A O     1 
ATOM   4572  C  CB    . MET A 1 569  ? -22.561 -30.798  -23.916 1.00 60.50  ? 573  MET A CB    1 
ATOM   4573  C  CG    . MET A 1 569  ? -23.160 -30.834  -22.535 1.00 59.19  ? 573  MET A CG    1 
ATOM   4574  S  SD    . MET A 1 569  ? -24.462 -32.061  -22.371 1.00 65.93  ? 573  MET A SD    1 
ATOM   4575  C  CE    . MET A 1 569  ? -24.926 -31.841  -20.653 1.00 62.06  ? 573  MET A CE    1 
ATOM   4576  N  N     . HIS A 1 570  ? -20.644 -28.981  -26.268 1.00 76.14  ? 574  HIS A N     1 
ATOM   4577  C  CA    . HIS A 1 570  ? -19.776 -29.074  -27.432 1.00 73.42  ? 574  HIS A CA    1 
ATOM   4578  C  C     . HIS A 1 570  ? -18.653 -28.051  -27.366 1.00 76.18  ? 574  HIS A C     1 
ATOM   4579  O  O     . HIS A 1 570  ? -17.678 -28.151  -28.108 1.00 77.25  ? 574  HIS A O     1 
ATOM   4580  C  CB    . HIS A 1 570  ? -20.580 -28.889  -28.716 1.00 62.55  ? 574  HIS A CB    1 
ATOM   4581  C  CG    . HIS A 1 570  ? -21.580 -29.977  -28.962 1.00 75.44  ? 574  HIS A CG    1 
ATOM   4582  N  ND1   . HIS A 1 570  ? -22.925 -29.725  -29.123 1.00 87.90  ? 574  HIS A ND1   1 
ATOM   4583  C  CD2   . HIS A 1 570  ? -21.431 -31.318  -29.078 1.00 71.49  ? 574  HIS A CD2   1 
ATOM   4584  C  CE1   . HIS A 1 570  ? -23.563 -30.864  -29.324 1.00 84.62  ? 574  HIS A CE1   1 
ATOM   4585  N  NE2   . HIS A 1 570  ? -22.681 -31.846  -29.296 1.00 81.25  ? 574  HIS A NE2   1 
ATOM   4586  N  N     . GLU A 1 571  ? -18.802 -27.073  -26.476 1.00 72.35  ? 575  GLU A N     1 
ATOM   4587  C  CA    . GLU A 1 571  ? -17.827 -25.996  -26.328 1.00 81.07  ? 575  GLU A CA    1 
ATOM   4588  C  C     . GLU A 1 571  ? -16.422 -26.529  -26.077 1.00 88.29  ? 575  GLU A C     1 
ATOM   4589  O  O     . GLU A 1 571  ? -16.202 -27.337  -25.188 1.00 100.55 ? 575  GLU A O     1 
ATOM   4590  C  CB    . GLU A 1 571  ? -18.243 -25.052  -25.197 1.00 83.29  ? 575  GLU A CB    1 
ATOM   4591  C  CG    . GLU A 1 571  ? -17.293 -23.885  -24.978 1.00 78.15  ? 575  GLU A CG    1 
ATOM   4592  C  CD    . GLU A 1 571  ? -17.339 -22.868  -26.101 1.00 86.05  ? 575  GLU A CD    1 
ATOM   4593  O  OE1   . GLU A 1 571  ? -18.449 -22.403  -26.448 1.00 80.68  ? 575  GLU A OE1   1 
ATOM   4594  O  OE2   . GLU A 1 571  ? -16.261 -22.537  -26.638 1.00 90.18  ? 575  GLU A OE2   1 
ATOM   4595  N  N     . THR A 1 572  ? -15.474 -26.062  -26.877 1.00 93.24  ? 576  THR A N     1 
ATOM   4596  C  CA    . THR A 1 572  ? -14.109 -26.575  -26.847 1.00 92.76  ? 576  THR A CA    1 
ATOM   4597  C  C     . THR A 1 572  ? -13.317 -26.075  -25.646 1.00 93.31  ? 576  THR A C     1 
ATOM   4598  O  O     . THR A 1 572  ? -12.321 -26.686  -25.253 1.00 97.18  ? 576  THR A O     1 
ATOM   4599  C  CB    . THR A 1 572  ? -13.348 -26.198  -28.131 1.00 84.67  ? 576  THR A CB    1 
ATOM   4600  O  OG1   . THR A 1 572  ? -13.646 -24.841  -28.484 1.00 79.81  ? 576  THR A OG1   1 
ATOM   4601  C  CG2   . THR A 1 572  ? -13.777 -27.091  -29.265 1.00 95.04  ? 576  THR A CG2   1 
ATOM   4602  N  N     . HIS A 1 573  ? -13.751 -24.962  -25.065 1.00 88.60  ? 577  HIS A N     1 
ATOM   4603  C  CA    . HIS A 1 573  ? -13.063 -24.421  -23.895 1.00 108.43 ? 577  HIS A CA    1 
ATOM   4604  C  C     . HIS A 1 573  ? -13.157 -25.394  -22.728 1.00 120.24 ? 577  HIS A C     1 
ATOM   4605  O  O     . HIS A 1 573  ? -14.225 -25.958  -22.461 1.00 123.80 ? 577  HIS A O     1 
ATOM   4606  C  CB    . HIS A 1 573  ? -13.645 -23.069  -23.494 1.00 114.66 ? 577  HIS A CB    1 
ATOM   4607  C  CG    . HIS A 1 573  ? -12.609 -22.068  -23.095 1.00 124.11 ? 577  HIS A CG    1 
ATOM   4608  N  ND1   . HIS A 1 573  ? -12.011 -21.216  -23.998 1.00 127.75 ? 577  HIS A ND1   1 
ATOM   4609  C  CD2   . HIS A 1 573  ? -12.049 -21.796  -21.893 1.00 128.27 ? 577  HIS A CD2   1 
ATOM   4610  C  CE1   . HIS A 1 573  ? -11.133 -20.456  -23.369 1.00 126.30 ? 577  HIS A CE1   1 
ATOM   4611  N  NE2   . HIS A 1 573  ? -11.138 -20.787  -22.090 1.00 123.78 ? 577  HIS A NE2   1 
ATOM   4612  N  N     . ASP A 1 574  ? -12.036 -25.611  -22.046 1.00 129.51 ? 578  ASP A N     1 
ATOM   4613  C  CA    . ASP A 1 574  ? -12.032 -26.508  -20.895 1.00 133.08 ? 578  ASP A CA    1 
ATOM   4614  C  C     . ASP A 1 574  ? -12.786 -25.857  -19.738 1.00 110.44 ? 578  ASP A C     1 
ATOM   4615  O  O     . ASP A 1 574  ? -12.674 -24.647  -19.508 1.00 85.88  ? 578  ASP A O     1 
ATOM   4616  C  CB    . ASP A 1 574  ? -10.604 -26.867  -20.472 1.00 144.36 ? 578  ASP A CB    1 
ATOM   4617  C  CG    . ASP A 1 574  ? -9.887  -25.714  -19.802 1.00 150.71 ? 578  ASP A CG    1 
ATOM   4618  O  OD1   . ASP A 1 574  ? -9.961  -24.581  -20.323 1.00 150.68 ? 578  ASP A OD1   1 
ATOM   4619  O  OD2   . ASP A 1 574  ? -9.255  -25.941  -18.749 1.00 156.42 ? 578  ASP A OD2   1 
ATOM   4620  N  N     . GLY A 1 575  ? -13.568 -26.662  -19.030 1.00 94.53  ? 579  GLY A N     1 
ATOM   4621  C  CA    . GLY A 1 575  ? -14.377 -26.156  -17.946 1.00 90.00  ? 579  GLY A CA    1 
ATOM   4622  C  C     . GLY A 1 575  ? -15.837 -26.043  -18.324 1.00 90.85  ? 579  GLY A C     1 
ATOM   4623  O  O     . GLY A 1 575  ? -16.713 -26.429  -17.548 1.00 110.48 ? 579  GLY A O     1 
ATOM   4624  N  N     . VAL A 1 576  ? -16.104 -25.519  -19.516 1.00 70.54  ? 580  VAL A N     1 
ATOM   4625  C  CA    . VAL A 1 576  ? -17.478 -25.292  -19.956 1.00 65.04  ? 580  VAL A CA    1 
ATOM   4626  C  C     . VAL A 1 576  ? -18.249 -26.596  -20.111 1.00 69.97  ? 580  VAL A C     1 
ATOM   4627  O  O     . VAL A 1 576  ? -19.421 -26.677  -19.755 1.00 77.05  ? 580  VAL A O     1 
ATOM   4628  C  CB    . VAL A 1 576  ? -17.526 -24.514  -21.287 1.00 64.41  ? 580  VAL A CB    1 
ATOM   4629  C  CG1   . VAL A 1 576  ? -18.967 -24.304  -21.729 1.00 71.18  ? 580  VAL A CG1   1 
ATOM   4630  C  CG2   . VAL A 1 576  ? -16.825 -23.178  -21.143 1.00 69.24  ? 580  VAL A CG2   1 
ATOM   4631  N  N     . GLN A 1 577  ? -17.591 -27.621  -20.636 1.00 76.27  ? 581  GLN A N     1 
ATOM   4632  C  CA    . GLN A 1 577  ? -18.225 -28.931  -20.757 1.00 68.94  ? 581  GLN A CA    1 
ATOM   4633  C  C     . GLN A 1 577  ? -18.452 -29.541  -19.380 1.00 77.10  ? 581  GLN A C     1 
ATOM   4634  O  O     . GLN A 1 577  ? -19.560 -29.997  -19.063 1.00 80.00  ? 581  GLN A O     1 
ATOM   4635  C  CB    . GLN A 1 577  ? -17.379 -29.867  -21.615 1.00 62.70  ? 581  GLN A CB    1 
ATOM   4636  C  CG    . GLN A 1 577  ? -17.383 -29.520  -23.086 1.00 69.90  ? 581  GLN A CG    1 
ATOM   4637  C  CD    . GLN A 1 577  ? -16.624 -30.523  -23.914 1.00 68.00  ? 581  GLN A CD    1 
ATOM   4638  O  OE1   . GLN A 1 577  ? -15.558 -30.998  -23.514 1.00 64.82  ? 581  GLN A OE1   1 
ATOM   4639  N  NE2   . GLN A 1 577  ? -17.167 -30.855  -25.081 1.00 71.31  ? 581  GLN A NE2   1 
ATOM   4640  N  N     . ASP A 1 578  ? -17.397 -29.538  -18.566 1.00 70.41  ? 582  ASP A N     1 
ATOM   4641  C  CA    . ASP A 1 578  ? -17.480 -30.021  -17.195 1.00 75.45  ? 582  ASP A CA    1 
ATOM   4642  C  C     . ASP A 1 578  ? -18.606 -29.328  -16.446 1.00 83.86  ? 582  ASP A C     1 
ATOM   4643  O  O     . ASP A 1 578  ? -19.430 -29.982  -15.811 1.00 103.04 ? 582  ASP A O     1 
ATOM   4644  C  CB    . ASP A 1 578  ? -16.156 -29.804  -16.465 1.00 77.53  ? 582  ASP A CB    1 
ATOM   4645  C  CG    . ASP A 1 578  ? -15.237 -31.002  -16.559 1.00 83.27  ? 582  ASP A CG    1 
ATOM   4646  O  OD1   . ASP A 1 578  ? -15.729 -32.103  -16.883 1.00 87.40  ? 582  ASP A OD1   1 
ATOM   4647  O  OD2   . ASP A 1 578  ? -14.023 -30.846  -16.303 1.00 85.01  ? 582  ASP A OD2   1 
ATOM   4648  N  N     . MET A 1 579  ? -18.646 -28.005  -16.539 1.00 72.99  ? 583  MET A N     1 
ATOM   4649  C  CA    . MET A 1 579  ? -19.668 -27.233  -15.851 1.00 81.27  ? 583  MET A CA    1 
ATOM   4650  C  C     . MET A 1 579  ? -21.056 -27.545  -16.386 1.00 75.73  ? 583  MET A C     1 
ATOM   4651  O  O     . MET A 1 579  ? -22.022 -27.606  -15.628 1.00 74.43  ? 583  MET A O     1 
ATOM   4652  C  CB    . MET A 1 579  ? -19.394 -25.732  -15.970 1.00 94.12  ? 583  MET A CB    1 
ATOM   4653  C  CG    . MET A 1 579  ? -20.226 -24.900  -15.007 1.00 105.13 ? 583  MET A CG    1 
ATOM   4654  S  SD    . MET A 1 579  ? -19.923 -25.347  -13.283 1.00 192.87 ? 583  MET A SD    1 
ATOM   4655  C  CE    . MET A 1 579  ? -21.233 -24.465  -12.474 1.00 66.87  ? 583  MET A CE    1 
ATOM   4656  N  N     . ALA A 1 580  ? -21.152 -27.736  -17.698 1.00 67.33  ? 584  ALA A N     1 
ATOM   4657  C  CA    . ALA A 1 580  ? -22.434 -28.030  -18.327 1.00 67.54  ? 584  ALA A CA    1 
ATOM   4658  C  C     . ALA A 1 580  ? -22.993 -29.343  -17.796 1.00 77.14  ? 584  ALA A C     1 
ATOM   4659  O  O     . ALA A 1 580  ? -24.179 -29.432  -17.451 1.00 92.88  ? 584  ALA A O     1 
ATOM   4660  C  CB    . ALA A 1 580  ? -22.290 -28.083  -19.840 1.00 66.99  ? 584  ALA A CB    1 
ATOM   4661  N  N     . CYS A 1 581  ? -22.130 -30.351  -17.710 1.00 63.81  ? 585  CYS A N     1 
ATOM   4662  C  CA    . CYS A 1 581  ? -22.544 -31.643  -17.187 1.00 57.78  ? 585  CYS A CA    1 
ATOM   4663  C  C     . CYS A 1 581  ? -22.891 -31.576  -15.699 1.00 65.52  ? 585  CYS A C     1 
ATOM   4664  O  O     . CYS A 1 581  ? -23.952 -32.053  -15.286 1.00 70.08  ? 585  CYS A O     1 
ATOM   4665  C  CB    . CYS A 1 581  ? -21.457 -32.677  -17.444 1.00 66.45  ? 585  CYS A CB    1 
ATOM   4666  S  SG    . CYS A 1 581  ? -21.179 -33.009  -19.228 1.00 70.39  ? 585  CYS A SG    1 
ATOM   4667  N  N     . ASP A 1 582  ? -22.013 -30.965  -14.905 1.00 73.05  ? 586  ASP A N     1 
ATOM   4668  C  CA    . ASP A 1 582  ? -22.229 -30.818  -13.455 1.00 71.72  ? 586  ASP A CA    1 
ATOM   4669  C  C     . ASP A 1 582  ? -23.565 -30.109  -13.142 1.00 72.58  ? 586  ASP A C     1 
ATOM   4670  O  O     . ASP A 1 582  ? -24.367 -30.535  -12.272 1.00 82.49  ? 586  ASP A O     1 
ATOM   4671  C  CB    . ASP A 1 582  ? -21.053 -30.060  -12.825 1.00 76.18  ? 586  ASP A CB    1 
ATOM   4672  C  CG    . ASP A 1 582  ? -19.723 -30.811  -12.965 1.00 86.70  ? 586  ASP A CG    1 
ATOM   4673  O  OD1   . ASP A 1 582  ? -19.749 -32.046  -13.192 1.00 94.20  ? 586  ASP A OD1   1 
ATOM   4674  O  OD2   . ASP A 1 582  ? -18.650 -30.168  -12.838 1.00 78.99  ? 586  ASP A OD2   1 
ATOM   4675  N  N     . THR A 1 583  ? -23.823 -29.048  -13.896 1.00 71.04  ? 587  THR A N     1 
ATOM   4676  C  CA    . THR A 1 583  ? -25.063 -28.301  -13.759 1.00 67.59  ? 587  THR A CA    1 
ATOM   4677  C  C     . THR A 1 583  ? -26.232 -29.176  -14.168 1.00 73.16  ? 587  THR A C     1 
ATOM   4678  O  O     . THR A 1 583  ? -27.273 -29.194  -13.488 1.00 71.23  ? 587  THR A O     1 
ATOM   4679  C  CB    . THR A 1 583  ? -25.066 -27.018  -14.610 1.00 62.33  ? 587  THR A CB    1 
ATOM   4680  O  OG1   . THR A 1 583  ? -23.863 -26.275  -14.372 1.00 65.62  ? 587  THR A OG1   1 
ATOM   4681  C  CG2   . THR A 1 583  ? -26.263 -26.153  -14.251 1.00 62.15  ? 587  THR A CG2   1 
ATOM   4682  N  N     . PHE A 1 584  ? -26.051 -29.909  -15.267 1.00 68.42  ? 588  PHE A N     1 
ATOM   4683  C  CA    . PHE A 1 584  ? -27.114 -30.759  -15.789 1.00 69.45  ? 588  PHE A CA    1 
ATOM   4684  C  C     . PHE A 1 584  ? -27.543 -31.838  -14.806 1.00 76.75  ? 588  PHE A C     1 
ATOM   4685  O  O     . PHE A 1 584  ? -28.730 -32.124  -14.680 1.00 81.35  ? 588  PHE A O     1 
ATOM   4686  C  CB    . PHE A 1 584  ? -26.695 -31.417  -17.100 1.00 62.61  ? 588  PHE A CB    1 
ATOM   4687  C  CG    . PHE A 1 584  ? -27.797 -32.189  -17.762 1.00 65.29  ? 588  PHE A CG    1 
ATOM   4688  C  CD1   . PHE A 1 584  ? -29.029 -31.604  -17.979 1.00 65.77  ? 588  PHE A CD1   1 
ATOM   4689  C  CD2   . PHE A 1 584  ? -27.601 -33.496  -18.170 1.00 76.79  ? 588  PHE A CD2   1 
ATOM   4690  C  CE1   . PHE A 1 584  ? -30.048 -32.305  -18.590 1.00 65.26  ? 588  PHE A CE1   1 
ATOM   4691  C  CE2   . PHE A 1 584  ? -28.615 -34.206  -18.784 1.00 72.10  ? 588  PHE A CE2   1 
ATOM   4692  C  CZ    . PHE A 1 584  ? -29.841 -33.607  -18.994 1.00 68.94  ? 588  PHE A CZ    1 
ATOM   4693  N  N     . ILE A 1 585  ? -26.584 -32.446  -14.119 1.00 70.72  ? 589  ILE A N     1 
ATOM   4694  C  CA    . ILE A 1 585  ? -26.931 -33.489  -13.161 1.00 79.45  ? 589  ILE A CA    1 
ATOM   4695  C  C     . ILE A 1 585  ? -27.608 -32.867  -11.935 1.00 72.59  ? 589  ILE A C     1 
ATOM   4696  O  O     . ILE A 1 585  ? -28.533 -33.475  -11.371 1.00 61.51  ? 589  ILE A O     1 
ATOM   4697  C  CB    . ILE A 1 585  ? -25.698 -34.338  -12.754 1.00 54.86  ? 589  ILE A CB    1 
ATOM   4698  C  CG1   . ILE A 1 585  ? -26.151 -35.606  -12.042 1.00 57.19  ? 589  ILE A CG1   1 
ATOM   4699  C  CG2   . ILE A 1 585  ? -24.731 -33.553  -11.910 1.00 63.17  ? 589  ILE A CG2   1 
ATOM   4700  C  CD1   . ILE A 1 585  ? -25.100 -36.693  -12.070 1.00 57.10  ? 589  ILE A CD1   1 
ATOM   4701  N  N     . LYS A 1 586  ? -27.194 -31.654  -11.547 1.00 65.16  ? 590  LYS A N     1 
ATOM   4702  C  CA    . LYS A 1 586  ? -27.944 -30.952  -10.494 1.00 55.60  ? 590  LYS A CA    1 
ATOM   4703  C  C     . LYS A 1 586  ? -29.411 -30.700  -10.872 1.00 69.98  ? 590  LYS A C     1 
ATOM   4704  O  O     . LYS A 1 586  ? -30.335 -31.053  -10.117 1.00 74.79  ? 590  LYS A O     1 
ATOM   4705  C  CB    . LYS A 1 586  ? -27.299 -29.621  -10.162 1.00 57.99  ? 590  LYS A CB    1 
ATOM   4706  C  CG    . LYS A 1 586  ? -26.066 -29.709  -9.307  1.00 60.48  ? 590  LYS A CG    1 
ATOM   4707  C  CD    . LYS A 1 586  ? -25.581 -28.316  -8.964  1.00 75.96  ? 590  LYS A CD    1 
ATOM   4708  C  CE    . LYS A 1 586  ? -24.405 -28.362  -8.021  1.00 89.48  ? 590  LYS A CE    1 
ATOM   4709  N  NZ    . LYS A 1 586  ? -23.310 -29.207  -8.562  1.00 98.15  ? 590  LYS A NZ    1 
ATOM   4710  N  N     . ILE A 1 587  ? -29.612 -30.082  -12.036 1.00 72.75  ? 591  ILE A N     1 
ATOM   4711  C  CA    . ILE A 1 587  ? -30.943 -29.716  -12.506 1.00 76.74  ? 591  ILE A CA    1 
ATOM   4712  C  C     . ILE A 1 587  ? -31.795 -30.964  -12.698 1.00 81.23  ? 591  ILE A C     1 
ATOM   4713  O  O     . ILE A 1 587  ? -33.002 -30.958  -12.430 1.00 85.87  ? 591  ILE A O     1 
ATOM   4714  C  CB    . ILE A 1 587  ? -30.864 -28.904  -13.820 1.00 74.30  ? 591  ILE A CB    1 
ATOM   4715  C  CG1   . ILE A 1 587  ? -30.221 -27.539  -13.554 1.00 73.26  ? 591  ILE A CG1   1 
ATOM   4716  C  CG2   . ILE A 1 587  ? -32.236 -28.727  -14.439 1.00 83.32  ? 591  ILE A CG2   1 
ATOM   4717  C  CD1   . ILE A 1 587  ? -30.173 -26.633  -14.767 1.00 81.90  ? 591  ILE A CD1   1 
ATOM   4718  N  N     . ALA A 1 588  ? -31.153 -32.041  -13.138 1.00 76.70  ? 592  ALA A N     1 
ATOM   4719  C  CA    . ALA A 1 588  ? -31.840 -33.311  -13.341 1.00 74.76  ? 592  ALA A CA    1 
ATOM   4720  C  C     . ALA A 1 588  ? -32.329 -33.880  -12.013 1.00 76.84  ? 592  ALA A C     1 
ATOM   4721  O  O     . ALA A 1 588  ? -33.483 -34.305  -11.897 1.00 71.88  ? 592  ALA A O     1 
ATOM   4722  C  CB    . ALA A 1 588  ? -30.930 -34.307  -14.042 1.00 83.08  ? 592  ALA A CB    1 
ATOM   4723  N  N     . GLN A 1 589  ? -31.457 -33.887  -11.008 1.00 80.40  ? 593  GLN A N     1 
ATOM   4724  C  CA    . GLN A 1 589  ? -31.860 -34.380  -9.695  1.00 76.95  ? 593  GLN A CA    1 
ATOM   4725  C  C     . GLN A 1 589  ? -32.979 -33.540  -9.090  1.00 77.21  ? 593  GLN A C     1 
ATOM   4726  O  O     . GLN A 1 589  ? -33.940 -34.079  -8.544  1.00 94.05  ? 593  GLN A O     1 
ATOM   4727  C  CB    . GLN A 1 589  ? -30.671 -34.411  -8.737  1.00 78.99  ? 593  GLN A CB    1 
ATOM   4728  C  CG    . GLN A 1 589  ? -29.625 -35.441  -9.088  1.00 90.09  ? 593  GLN A CG    1 
ATOM   4729  C  CD    . GLN A 1 589  ? -28.551 -35.568  -8.037  1.00 98.35  ? 593  GLN A CD    1 
ATOM   4730  O  OE1   . GLN A 1 589  ? -28.770 -36.166  -6.984  1.00 112.24 ? 593  GLN A OE1   1 
ATOM   4731  N  NE2   . GLN A 1 589  ? -27.380 -35.003  -8.313  1.00 94.06  ? 593  GLN A NE2   1 
ATOM   4732  N  N     . LYS A 1 590  ? -32.863 -32.222  -9.202  1.00 68.36  ? 594  LYS A N     1 
ATOM   4733  C  CA    . LYS A 1 590  ? -33.763 -31.333  -8.475  1.00 78.63  ? 594  LYS A CA    1 
ATOM   4734  C  C     . LYS A 1 590  ? -35.013 -30.919  -9.261  1.00 87.51  ? 594  LYS A C     1 
ATOM   4735  O  O     . LYS A 1 590  ? -35.888 -30.234  -8.724  1.00 95.01  ? 594  LYS A O     1 
ATOM   4736  C  CB    . LYS A 1 590  ? -32.986 -30.096  -8.011  1.00 72.29  ? 594  LYS A CB    1 
ATOM   4737  C  CG    . LYS A 1 590  ? -31.889 -30.438  -7.013  1.00 82.31  ? 594  LYS A CG    1 
ATOM   4738  C  CD    . LYS A 1 590  ? -31.125 -29.220  -6.535  1.00 92.88  ? 594  LYS A CD    1 
ATOM   4739  C  CE    . LYS A 1 590  ? -30.078 -28.788  -7.535  1.00 106.18 ? 594  LYS A CE    1 
ATOM   4740  N  NZ    . LYS A 1 590  ? -29.154 -27.782  -6.948  1.00 115.54 ? 594  LYS A NZ    1 
ATOM   4741  N  N     . CYS A 1 591  ? -35.101 -31.334  -10.522 1.00 81.05  ? 595  CYS A N     1 
ATOM   4742  C  CA    . CYS A 1 591  ? -36.274 -31.043  -11.340 1.00 79.86  ? 595  CYS A CA    1 
ATOM   4743  C  C     . CYS A 1 591  ? -36.684 -32.256  -12.175 1.00 94.06  ? 595  CYS A C     1 
ATOM   4744  O  O     . CYS A 1 591  ? -37.182 -32.108  -13.292 1.00 95.20  ? 595  CYS A O     1 
ATOM   4745  C  CB    . CYS A 1 591  ? -36.007 -29.850  -12.261 1.00 85.29  ? 595  CYS A CB    1 
ATOM   4746  S  SG    . CYS A 1 591  ? -35.353 -28.373  -11.470 1.00 90.65  ? 595  CYS A SG    1 
ATOM   4747  N  N     . ARG A 1 592  ? -36.476 -33.450  -11.626 1.00 98.77  ? 596  ARG A N     1 
ATOM   4748  C  CA    . ARG A 1 592  ? -36.676 -34.696  -12.365 1.00 86.44  ? 596  ARG A CA    1 
ATOM   4749  C  C     . ARG A 1 592  ? -38.097 -34.858  -12.929 1.00 88.92  ? 596  ARG A C     1 
ATOM   4750  O  O     . ARG A 1 592  ? -38.281 -35.247  -14.091 1.00 103.79 ? 596  ARG A O     1 
ATOM   4751  C  CB    . ARG A 1 592  ? -36.314 -35.886  -11.467 1.00 85.59  ? 596  ARG A CB    1 
ATOM   4752  C  CG    . ARG A 1 592  ? -36.876 -35.816  -10.048 1.00 87.62  ? 596  ARG A CG    1 
ATOM   4753  C  CD    . ARG A 1 592  ? -36.720 -37.142  -9.317  1.00 86.53  ? 596  ARG A CD    1 
ATOM   4754  N  NE    . ARG A 1 592  ? -35.325 -37.467  -9.033  1.00 97.28  ? 596  ARG A NE    1 
ATOM   4755  C  CZ    . ARG A 1 592  ? -34.760 -37.349  -7.838  1.00 103.10 ? 596  ARG A CZ    1 
ATOM   4756  N  NH1   . ARG A 1 592  ? -35.472 -36.915  -6.808  1.00 117.41 ? 596  ARG A NH1   1 
ATOM   4757  N  NH2   . ARG A 1 592  ? -33.484 -37.668  -7.670  1.00 102.07 ? 596  ARG A NH2   1 
ATOM   4758  N  N     . ARG A 1 593  ? -39.101 -34.523  -12.126 1.00 88.34  ? 597  ARG A N     1 
ATOM   4759  C  CA    . ARG A 1 593  ? -40.491 -34.698  -12.539 1.00 89.96  ? 597  ARG A CA    1 
ATOM   4760  C  C     . ARG A 1 593  ? -40.837 -33.875  -13.788 1.00 88.52  ? 597  ARG A C     1 
ATOM   4761  O  O     . ARG A 1 593  ? -41.618 -34.307  -14.645 1.00 98.48  ? 597  ARG A O     1 
ATOM   4762  C  CB    . ARG A 1 593  ? -41.435 -34.338  -11.389 1.00 104.27 ? 597  ARG A CB    1 
ATOM   4763  C  CG    . ARG A 1 593  ? -41.385 -35.302  -10.209 1.00 116.75 ? 597  ARG A CG    1 
ATOM   4764  C  CD    . ARG A 1 593  ? -42.326 -34.849  -9.103  1.00 129.38 ? 597  ARG A CD    1 
ATOM   4765  N  NE    . ARG A 1 593  ? -42.454 -35.831  -8.030  1.00 141.99 ? 597  ARG A NE    1 
ATOM   4766  C  CZ    . ARG A 1 593  ? -43.263 -35.687  -6.984  1.00 159.24 ? 597  ARG A CZ    1 
ATOM   4767  N  NH1   . ARG A 1 593  ? -44.014 -34.597  -6.871  1.00 165.16 ? 597  ARG A NH1   1 
ATOM   4768  N  NH2   . ARG A 1 593  ? -43.325 -36.629  -6.050  1.00 165.14 ? 597  ARG A NH2   1 
ATOM   4769  N  N     . HIS A 1 594  ? -40.220 -32.710  -13.925 1.00 89.12  ? 598  HIS A N     1 
ATOM   4770  C  CA    . HIS A 1 594  ? -40.539 -31.834  -15.047 1.00 93.03  ? 598  HIS A CA    1 
ATOM   4771  C  C     . HIS A 1 594  ? -40.036 -32.398  -16.371 1.00 93.98  ? 598  HIS A C     1 
ATOM   4772  O  O     . HIS A 1 594  ? -40.287 -31.816  -17.431 1.00 100.46 ? 598  HIS A O     1 
ATOM   4773  C  CB    . HIS A 1 594  ? -39.963 -30.437  -14.817 1.00 96.30  ? 598  HIS A CB    1 
ATOM   4774  C  CG    . HIS A 1 594  ? -40.611 -29.705  -13.685 1.00 94.03  ? 598  HIS A CG    1 
ATOM   4775  N  ND1   . HIS A 1 594  ? -40.486 -30.109  -12.373 1.00 93.88  ? 598  HIS A ND1   1 
ATOM   4776  C  CD2   . HIS A 1 594  ? -41.406 -28.610  -13.668 1.00 95.35  ? 598  HIS A CD2   1 
ATOM   4777  C  CE1   . HIS A 1 594  ? -41.172 -29.290  -11.596 1.00 99.37  ? 598  HIS A CE1   1 
ATOM   4778  N  NE2   . HIS A 1 594  ? -41.735 -28.369  -12.356 1.00 103.59 ? 598  HIS A NE2   1 
ATOM   4779  N  N     . PHE A 1 595  ? -39.344 -33.531  -16.322 1.00 95.70  ? 599  PHE A N     1 
ATOM   4780  C  CA    . PHE A 1 595  ? -38.883 -34.135  -17.560 1.00 97.69  ? 599  PHE A CA    1 
ATOM   4781  C  C     . PHE A 1 595  ? -39.748 -35.332  -17.943 1.00 104.20 ? 599  PHE A C     1 
ATOM   4782  O  O     . PHE A 1 595  ? -39.752 -35.753  -19.104 1.00 94.68  ? 599  PHE A O     1 
ATOM   4783  C  CB    . PHE A 1 595  ? -37.416 -34.539  -17.438 1.00 96.18  ? 599  PHE A CB    1 
ATOM   4784  C  CG    . PHE A 1 595  ? -36.492 -33.378  -17.232 1.00 93.01  ? 599  PHE A CG    1 
ATOM   4785  C  CD1   . PHE A 1 595  ? -36.144 -32.556  -18.290 1.00 95.30  ? 599  PHE A CD1   1 
ATOM   4786  C  CD2   . PHE A 1 595  ? -35.975 -33.102  -15.980 1.00 82.33  ? 599  PHE A CD2   1 
ATOM   4787  C  CE1   . PHE A 1 595  ? -35.297 -31.479  -18.102 1.00 89.71  ? 599  PHE A CE1   1 
ATOM   4788  C  CE2   . PHE A 1 595  ? -35.123 -32.026  -15.782 1.00 69.84  ? 599  PHE A CE2   1 
ATOM   4789  C  CZ    . PHE A 1 595  ? -34.787 -31.214  -16.843 1.00 79.37  ? 599  PHE A CZ    1 
ATOM   4790  N  N     . VAL A 1 596  ? -40.487 -35.871  -16.975 1.00 107.49 ? 600  VAL A N     1 
ATOM   4791  C  CA    . VAL A 1 596  ? -41.288 -37.056  -17.257 1.00 106.63 ? 600  VAL A CA    1 
ATOM   4792  C  C     . VAL A 1 596  ? -42.695 -36.668  -17.657 1.00 110.96 ? 600  VAL A C     1 
ATOM   4793  O  O     . VAL A 1 596  ? -43.278 -37.247  -18.572 1.00 120.71 ? 600  VAL A O     1 
ATOM   4794  C  CB    . VAL A 1 596  ? -41.355 -38.017  -16.054 1.00 116.02 ? 600  VAL A CB    1 
ATOM   4795  C  CG1   . VAL A 1 596  ? -40.085 -38.816  -15.951 1.00 116.07 ? 600  VAL A CG1   1 
ATOM   4796  C  CG2   . VAL A 1 596  ? -41.591 -37.265  -14.765 1.00 121.63 ? 600  VAL A CG2   1 
ATOM   4797  N  N     . GLN A 1 597  ? -43.239 -35.682  -16.955 1.00 118.50 ? 601  GLN A N     1 
ATOM   4798  C  CA    . GLN A 1 597  ? -44.596 -35.233  -17.198 1.00 126.09 ? 601  GLN A CA    1 
ATOM   4799  C  C     . GLN A 1 597  ? -44.635 -34.318  -18.413 1.00 124.46 ? 601  GLN A C     1 
ATOM   4800  O  O     . GLN A 1 597  ? -43.630 -33.699  -18.777 1.00 129.48 ? 601  GLN A O     1 
ATOM   4801  C  CB    . GLN A 1 597  ? -45.152 -34.517  -15.967 1.00 137.11 ? 601  GLN A CB    1 
ATOM   4802  C  CG    . GLN A 1 597  ? -45.320 -35.415  -14.751 1.00 149.15 ? 601  GLN A CG    1 
ATOM   4803  C  CD    . GLN A 1 597  ? -45.902 -34.675  -13.555 1.00 165.06 ? 601  GLN A CD    1 
ATOM   4804  O  OE1   . GLN A 1 597  ? -46.228 -33.489  -13.642 1.00 174.99 ? 601  GLN A OE1   1 
ATOM   4805  N  NE2   . GLN A 1 597  ? -46.034 -35.374  -12.432 1.00 165.31 ? 601  GLN A NE2   1 
ATOM   4806  N  N     . VAL A 1 598  ? -45.802 -34.242  -19.042 1.00 120.39 ? 602  VAL A N     1 
ATOM   4807  C  CA    . VAL A 1 598  ? -45.981 -33.386  -20.200 1.00 111.36 ? 602  VAL A CA    1 
ATOM   4808  C  C     . VAL A 1 598  ? -46.258 -31.956  -19.750 1.00 111.84 ? 602  VAL A C     1 
ATOM   4809  O  O     . VAL A 1 598  ? -47.194 -31.703  -18.989 1.00 110.28 ? 602  VAL A O     1 
ATOM   4810  C  CB    . VAL A 1 598  ? -47.128 -33.880  -21.086 1.00 112.89 ? 602  VAL A CB    1 
ATOM   4811  C  CG1   . VAL A 1 598  ? -47.016 -33.280  -22.474 1.00 119.01 ? 602  VAL A CG1   1 
ATOM   4812  C  CG2   . VAL A 1 598  ? -47.115 -35.396  -21.159 1.00 115.42 ? 602  VAL A CG2   1 
ATOM   4813  N  N     . GLN A 1 599  ? -45.436 -31.025  -20.220 1.00 115.38 ? 603  GLN A N     1 
ATOM   4814  C  CA    . GLN A 1 599  ? -45.563 -29.626  -19.825 1.00 117.19 ? 603  GLN A CA    1 
ATOM   4815  C  C     . GLN A 1 599  ? -46.487 -28.859  -20.766 1.00 119.97 ? 603  GLN A C     1 
ATOM   4816  O  O     . GLN A 1 599  ? -46.678 -29.251  -21.925 1.00 121.70 ? 603  GLN A O     1 
ATOM   4817  C  CB    . GLN A 1 599  ? -44.187 -28.958  -19.782 1.00 112.53 ? 603  GLN A CB    1 
ATOM   4818  C  CG    . GLN A 1 599  ? -43.219 -29.598  -18.793 1.00 103.99 ? 603  GLN A CG    1 
ATOM   4819  C  CD    . GLN A 1 599  ? -43.552 -29.268  -17.358 1.00 98.72  ? 603  GLN A CD    1 
ATOM   4820  O  OE1   . GLN A 1 599  ? -43.799 -28.111  -17.014 1.00 97.18  ? 603  GLN A OE1   1 
ATOM   4821  N  NE2   . GLN A 1 599  ? -43.568 -30.286  -16.508 1.00 101.49 ? 603  GLN A NE2   1 
ATOM   4822  N  N     . VAL A 1 600  ? -47.053 -27.765  -20.260 1.00 122.80 ? 604  VAL A N     1 
ATOM   4823  C  CA    . VAL A 1 600  ? -47.948 -26.922  -21.043 1.00 120.55 ? 604  VAL A CA    1 
ATOM   4824  C  C     . VAL A 1 600  ? -47.240 -26.356  -22.272 1.00 126.77 ? 604  VAL A C     1 
ATOM   4825  O  O     . VAL A 1 600  ? -46.234 -25.652  -22.153 1.00 131.13 ? 604  VAL A O     1 
ATOM   4826  C  CB    . VAL A 1 600  ? -48.503 -25.762  -20.201 1.00 114.23 ? 604  VAL A CB    1 
ATOM   4827  C  CG1   . VAL A 1 600  ? -49.389 -24.861  -21.049 1.00 116.46 ? 604  VAL A CG1   1 
ATOM   4828  C  CG2   . VAL A 1 600  ? -49.272 -26.298  -19.005 1.00 115.20 ? 604  VAL A CG2   1 
ATOM   4829  N  N     . GLY A 1 601  ? -47.770 -26.673  -23.448 1.00 127.14 ? 605  GLY A N     1 
ATOM   4830  C  CA    . GLY A 1 601  ? -47.181 -26.220  -24.694 1.00 135.69 ? 605  GLY A CA    1 
ATOM   4831  C  C     . GLY A 1 601  ? -46.265 -27.266  -25.297 1.00 140.12 ? 605  GLY A C     1 
ATOM   4832  O  O     . GLY A 1 601  ? -45.538 -26.993  -26.256 1.00 140.39 ? 605  GLY A O     1 
ATOM   4833  N  N     . GLU A 1 602  ? -46.297 -28.467  -24.730 1.00 133.64 ? 606  GLU A N     1 
ATOM   4834  C  CA    . GLU A 1 602  ? -45.479 -29.567  -25.222 1.00 129.16 ? 606  GLU A CA    1 
ATOM   4835  C  C     . GLU A 1 602  ? -46.352 -30.783  -25.521 1.00 127.87 ? 606  GLU A C     1 
ATOM   4836  O  O     . GLU A 1 602  ? -47.326 -31.045  -24.811 1.00 128.81 ? 606  GLU A O     1 
ATOM   4837  C  CB    . GLU A 1 602  ? -44.392 -29.927  -24.205 1.00 126.82 ? 606  GLU A CB    1 
ATOM   4838  C  CG    . GLU A 1 602  ? -43.473 -28.773  -23.822 1.00 127.39 ? 606  GLU A CG    1 
ATOM   4839  C  CD    . GLU A 1 602  ? -42.486 -28.407  -24.925 1.00 129.01 ? 606  GLU A CD    1 
ATOM   4840  O  OE1   . GLU A 1 602  ? -42.351 -29.189  -25.896 1.00 126.61 ? 606  GLU A OE1   1 
ATOM   4841  O  OE2   . GLU A 1 602  ? -41.841 -27.337  -24.812 1.00 128.53 ? 606  GLU A OE2   1 
ATOM   4842  N  N     . VAL A 1 603  ? -46.006 -31.522  -26.571 1.00 123.14 ? 607  VAL A N     1 
ATOM   4843  C  CA    . VAL A 1 603  ? -46.763 -32.712  -26.937 1.00 124.30 ? 607  VAL A CA    1 
ATOM   4844  C  C     . VAL A 1 603  ? -46.130 -33.959  -26.326 1.00 128.41 ? 607  VAL A C     1 
ATOM   4845  O  O     . VAL A 1 603  ? -46.799 -34.973  -26.118 1.00 128.56 ? 607  VAL A O     1 
ATOM   4846  C  CB    . VAL A 1 603  ? -46.857 -32.882  -28.470 1.00 117.44 ? 607  VAL A CB    1 
ATOM   4847  C  CG1   . VAL A 1 603  ? -47.557 -31.688  -29.092 1.00 116.25 ? 607  VAL A CG1   1 
ATOM   4848  C  CG2   . VAL A 1 603  ? -45.475 -33.070  -29.079 1.00 115.47 ? 607  VAL A CG2   1 
ATOM   4849  N  N     . MET A 1 604  ? -44.838 -33.870  -26.031 1.00 127.74 ? 608  MET A N     1 
ATOM   4850  C  CA    . MET A 1 604  ? -44.078 -35.006  -25.528 1.00 130.11 ? 608  MET A CA    1 
ATOM   4851  C  C     . MET A 1 604  ? -43.224 -34.566  -24.344 1.00 136.53 ? 608  MET A C     1 
ATOM   4852  O  O     . MET A 1 604  ? -42.751 -33.428  -24.310 1.00 144.70 ? 608  MET A O     1 
ATOM   4853  C  CB    . MET A 1 604  ? -43.197 -35.589  -26.638 1.00 129.68 ? 608  MET A CB    1 
ATOM   4854  C  CG    . MET A 1 604  ? -43.169 -37.108  -26.712 1.00 129.64 ? 608  MET A CG    1 
ATOM   4855  S  SD    . MET A 1 604  ? -42.137 -37.705  -28.067 1.00 302.88 ? 608  MET A SD    1 
ATOM   4856  C  CE    . MET A 1 604  ? -42.598 -39.437  -28.122 1.00 159.42 ? 608  MET A CE    1 
ATOM   4857  N  N     . PRO A 1 605  ? -43.034 -35.457  -23.357 1.00 123.72 ? 609  PRO A N     1 
ATOM   4858  C  CA    . PRO A 1 605  ? -42.111 -35.138  -22.263 1.00 110.51 ? 609  PRO A CA    1 
ATOM   4859  C  C     . PRO A 1 605  ? -40.680 -34.977  -22.766 1.00 107.53 ? 609  PRO A C     1 
ATOM   4860  O  O     . PRO A 1 605  ? -40.276 -35.660  -23.711 1.00 118.62 ? 609  PRO A O     1 
ATOM   4861  C  CB    . PRO A 1 605  ? -42.235 -36.343  -21.329 1.00 103.58 ? 609  PRO A CB    1 
ATOM   4862  C  CG    . PRO A 1 605  ? -42.826 -37.429  -22.156 1.00 106.96 ? 609  PRO A CG    1 
ATOM   4863  C  CD    . PRO A 1 605  ? -43.708 -36.750  -23.151 1.00 114.63 ? 609  PRO A CD    1 
ATOM   4864  N  N     . PHE A 1 606  ? -39.931 -34.081  -22.134 1.00 91.49  ? 610  PHE A N     1 
ATOM   4865  C  CA    . PHE A 1 606  ? -38.593 -33.713  -22.589 1.00 90.48  ? 610  PHE A CA    1 
ATOM   4866  C  C     . PHE A 1 606  ? -37.643 -34.915  -22.679 1.00 95.31  ? 610  PHE A C     1 
ATOM   4867  O  O     . PHE A 1 606  ? -36.749 -34.964  -23.542 1.00 92.14  ? 610  PHE A O     1 
ATOM   4868  C  CB    . PHE A 1 606  ? -38.014 -32.649  -21.653 1.00 85.83  ? 610  PHE A CB    1 
ATOM   4869  C  CG    . PHE A 1 606  ? -36.942 -31.813  -22.276 1.00 87.88  ? 610  PHE A CG    1 
ATOM   4870  C  CD1   . PHE A 1 606  ? -37.237 -30.956  -23.323 1.00 93.95  ? 610  PHE A CD1   1 
ATOM   4871  C  CD2   . PHE A 1 606  ? -35.642 -31.873  -21.812 1.00 91.14  ? 610  PHE A CD2   1 
ATOM   4872  C  CE1   . PHE A 1 606  ? -36.254 -30.178  -23.900 1.00 99.99  ? 610  PHE A CE1   1 
ATOM   4873  C  CE2   . PHE A 1 606  ? -34.652 -31.098  -22.384 1.00 96.30  ? 610  PHE A CE2   1 
ATOM   4874  C  CZ    . PHE A 1 606  ? -34.959 -30.247  -23.430 1.00 99.04  ? 610  PHE A CZ    1 
ATOM   4875  N  N     . ILE A 1 607  ? -37.849 -35.879  -21.782 1.00 96.48  ? 611  ILE A N     1 
ATOM   4876  C  CA    . ILE A 1 607  ? -37.009 -37.069  -21.704 1.00 99.20  ? 611  ILE A CA    1 
ATOM   4877  C  C     . ILE A 1 607  ? -36.970 -37.813  -23.037 1.00 94.81  ? 611  ILE A C     1 
ATOM   4878  O  O     . ILE A 1 607  ? -35.922 -38.328  -23.432 1.00 104.37 ? 611  ILE A O     1 
ATOM   4879  C  CB    . ILE A 1 607  ? -37.494 -38.024  -20.578 1.00 85.22  ? 611  ILE A CB    1 
ATOM   4880  C  CG1   . ILE A 1 607  ? -36.621 -39.276  -20.511 1.00 80.57  ? 611  ILE A CG1   1 
ATOM   4881  C  CG2   . ILE A 1 607  ? -38.960 -38.393  -20.768 1.00 90.83  ? 611  ILE A CG2   1 
ATOM   4882  C  CD1   . ILE A 1 607  ? -35.218 -39.014  -20.021 1.00 79.82  ? 611  ILE A CD1   1 
ATOM   4883  N  N     . ASP A 1 608  ? -38.102 -37.841  -23.737 1.00 81.57  ? 612  ASP A N     1 
ATOM   4884  C  CA    . ASP A 1 608  ? -38.181 -38.519  -25.023 1.00 77.41  ? 612  ASP A CA    1 
ATOM   4885  C  C     . ASP A 1 608  ? -37.302 -37.814  -26.055 1.00 80.82  ? 612  ASP A C     1 
ATOM   4886  O  O     . ASP A 1 608  ? -36.600 -38.458  -26.827 1.00 82.99  ? 612  ASP A O     1 
ATOM   4887  C  CB    . ASP A 1 608  ? -39.625 -38.587  -25.506 1.00 79.15  ? 612  ASP A CB    1 
ATOM   4888  C  CG    . ASP A 1 608  ? -40.459 -39.573  -24.712 1.00 104.75 ? 612  ASP A CG    1 
ATOM   4889  O  OD1   . ASP A 1 608  ? -40.267 -39.666  -23.484 1.00 113.34 ? 612  ASP A OD1   1 
ATOM   4890  O  OD2   . ASP A 1 608  ? -41.304 -40.272  -25.314 1.00 132.79 ? 612  ASP A OD2   1 
ATOM   4891  N  N     . GLU A 1 609  ? -37.331 -36.487  -26.043 1.00 83.43  ? 613  GLU A N     1 
ATOM   4892  C  CA    . GLU A 1 609  ? -36.504 -35.679  -26.932 1.00 87.43  ? 613  GLU A CA    1 
ATOM   4893  C  C     . GLU A 1 609  ? -35.019 -35.942  -26.675 1.00 86.85  ? 613  GLU A C     1 
ATOM   4894  O  O     . GLU A 1 609  ? -34.247 -36.233  -27.603 1.00 91.88  ? 613  GLU A O     1 
ATOM   4895  C  CB    . GLU A 1 609  ? -36.836 -34.197  -26.738 1.00 95.11  ? 613  GLU A CB    1 
ATOM   4896  C  CG    . GLU A 1 609  ? -36.305 -33.266  -27.812 1.00 109.77 ? 613  GLU A CG    1 
ATOM   4897  C  CD    . GLU A 1 609  ? -36.809 -31.845  -27.634 1.00 121.66 ? 613  GLU A CD    1 
ATOM   4898  O  OE1   . GLU A 1 609  ? -38.015 -31.673  -27.351 1.00 127.27 ? 613  GLU A OE1   1 
ATOM   4899  O  OE2   . GLU A 1 609  ? -35.997 -30.903  -27.765 1.00 130.13 ? 613  GLU A OE2   1 
ATOM   4900  N  N     . ILE A 1 610  ? -34.632 -35.845  -25.405 1.00 87.39  ? 614  ILE A N     1 
ATOM   4901  C  CA    . ILE A 1 610  ? -33.256 -36.118  -24.997 1.00 80.22  ? 614  ILE A CA    1 
ATOM   4902  C  C     . ILE A 1 610  ? -32.795 -37.489  -25.476 1.00 80.70  ? 614  ILE A C     1 
ATOM   4903  O  O     . ILE A 1 610  ? -31.737 -37.621  -26.094 1.00 91.89  ? 614  ILE A O     1 
ATOM   4904  C  CB    . ILE A 1 610  ? -33.093 -36.058  -23.470 1.00 77.51  ? 614  ILE A CB    1 
ATOM   4905  C  CG1   . ILE A 1 610  ? -33.513 -34.691  -22.934 1.00 75.47  ? 614  ILE A CG1   1 
ATOM   4906  C  CG2   . ILE A 1 610  ? -31.655 -36.364  -23.081 1.00 71.90  ? 614  ILE A CG2   1 
ATOM   4907  C  CD1   . ILE A 1 610  ? -33.300 -34.546  -21.452 1.00 84.88  ? 614  ILE A CD1   1 
ATOM   4908  N  N     . LEU A 1 611  ? -33.602 -38.505  -25.187 1.00 82.09  ? 615  LEU A N     1 
ATOM   4909  C  CA    . LEU A 1 611  ? -33.281 -39.879  -25.558 1.00 84.65  ? 615  LEU A CA    1 
ATOM   4910  C  C     . LEU A 1 611  ? -33.182 -40.025  -27.074 1.00 88.81  ? 615  LEU A C     1 
ATOM   4911  O  O     . LEU A 1 611  ? -32.390 -40.816  -27.582 1.00 95.81  ? 615  LEU A O     1 
ATOM   4912  C  CB    . LEU A 1 611  ? -34.326 -40.848  -25.003 1.00 77.71  ? 615  LEU A CB    1 
ATOM   4913  C  CG    . LEU A 1 611  ? -34.328 -41.024  -23.485 1.00 78.81  ? 615  LEU A CG    1 
ATOM   4914  C  CD1   . LEU A 1 611  ? -35.479 -41.915  -23.054 1.00 90.20  ? 615  LEU A CD1   1 
ATOM   4915  C  CD2   . LEU A 1 611  ? -33.006 -41.585  -23.008 1.00 78.22  ? 615  LEU A CD2   1 
ATOM   4916  N  N     . ASN A 1 612  ? -33.985 -39.254  -27.795 1.00 84.87  ? 616  ASN A N     1 
ATOM   4917  C  CA    . ASN A 1 612  ? -33.956 -39.292  -29.249 1.00 80.35  ? 616  ASN A CA    1 
ATOM   4918  C  C     . ASN A 1 612  ? -32.749 -38.556  -29.817 1.00 94.34  ? 616  ASN A C     1 
ATOM   4919  O  O     . ASN A 1 612  ? -32.431 -38.719  -30.990 1.00 107.59 ? 616  ASN A O     1 
ATOM   4920  C  CB    . ASN A 1 612  ? -35.242 -38.706  -29.827 1.00 83.91  ? 616  ASN A CB    1 
ATOM   4921  C  CG    . ASN A 1 612  ? -36.451 -39.578  -29.552 1.00 95.43  ? 616  ASN A CG    1 
ATOM   4922  O  OD1   . ASN A 1 612  ? -36.337 -40.796  -29.450 1.00 101.54 ? 616  ASN A OD1   1 
ATOM   4923  N  ND2   . ASN A 1 612  ? -37.616 -38.955  -29.420 1.00 111.42 ? 616  ASN A ND2   1 
ATOM   4924  N  N     . ASN A 1 613  ? -32.070 -37.748  -29.001 1.00 88.09  ? 617  ASN A N     1 
ATOM   4925  C  CA    . ASN A 1 613  ? -30.879 -37.047  -29.493 1.00 79.45  ? 617  ASN A CA    1 
ATOM   4926  C  C     . ASN A 1 613  ? -29.588 -37.281  -28.694 1.00 86.22  ? 617  ASN A C     1 
ATOM   4927  O  O     . ASN A 1 613  ? -28.632 -36.504  -28.819 1.00 86.28  ? 617  ASN A O     1 
ATOM   4928  C  CB    . ASN A 1 613  ? -31.161 -35.550  -29.557 1.00 86.29  ? 617  ASN A CB    1 
ATOM   4929  C  CG    . ASN A 1 613  ? -32.139 -35.194  -30.652 1.00 104.16 ? 617  ASN A CG    1 
ATOM   4930  O  OD1   . ASN A 1 613  ? -31.787 -35.182  -31.832 1.00 113.65 ? 617  ASN A OD1   1 
ATOM   4931  N  ND2   . ASN A 1 613  ? -33.375 -34.897  -30.268 1.00 110.45 ? 617  ASN A ND2   1 
ATOM   4932  N  N     . ILE A 1 614  ? -29.556 -38.357  -27.907 1.00 83.67  ? 618  ILE A N     1 
ATOM   4933  C  CA    . ILE A 1 614  ? -28.434 -38.642  -27.001 1.00 83.26  ? 618  ILE A CA    1 
ATOM   4934  C  C     . ILE A 1 614  ? -27.037 -38.492  -27.610 1.00 84.31  ? 618  ILE A C     1 
ATOM   4935  O  O     . ILE A 1 614  ? -26.216 -37.724  -27.100 1.00 91.19  ? 618  ILE A O     1 
ATOM   4936  C  CB    . ILE A 1 614  ? -28.529 -40.067  -26.430 1.00 90.29  ? 618  ILE A CB    1 
ATOM   4937  C  CG1   . ILE A 1 614  ? -29.769 -40.215  -25.552 1.00 96.11  ? 618  ILE A CG1   1 
ATOM   4938  C  CG2   . ILE A 1 614  ? -27.292 -40.394  -25.610 1.00 89.77  ? 618  ILE A CG2   1 
ATOM   4939  C  CD1   . ILE A 1 614  ? -29.889 -41.571  -24.898 1.00 105.61 ? 618  ILE A CD1   1 
ATOM   4940  N  N     . ASN A 1 615  ? -26.767 -39.223  -28.688 1.00 86.96  ? 619  ASN A N     1 
ATOM   4941  C  CA    . ASN A 1 615  ? -25.420 -39.258  -29.252 1.00 82.94  ? 619  ASN A CA    1 
ATOM   4942  C  C     . ASN A 1 615  ? -24.990 -37.921  -29.831 1.00 82.94  ? 619  ASN A C     1 
ATOM   4943  O  O     . ASN A 1 615  ? -23.825 -37.527  -29.725 1.00 93.75  ? 619  ASN A O     1 
ATOM   4944  C  CB    . ASN A 1 615  ? -25.308 -40.329  -30.329 1.00 81.30  ? 619  ASN A CB    1 
ATOM   4945  C  CG    . ASN A 1 615  ? -23.900 -40.428  -30.896 1.00 97.30  ? 619  ASN A CG    1 
ATOM   4946  O  OD1   . ASN A 1 615  ? -23.562 -39.760  -31.878 1.00 106.22 ? 619  ASN A OD1   1 
ATOM   4947  N  ND2   . ASN A 1 615  ? -23.070 -41.260  -30.274 1.00 100.46 ? 619  ASN A ND2   1 
ATOM   4948  N  N     . THR A 1 616  ? -25.932 -37.217  -30.444 1.00 82.07  ? 620  THR A N     1 
ATOM   4949  C  CA    . THR A 1 616  ? -25.626 -35.908  -31.001 1.00 87.76  ? 620  THR A CA    1 
ATOM   4950  C  C     . THR A 1 616  ? -25.314 -34.965  -29.858 1.00 87.04  ? 620  THR A C     1 
ATOM   4951  O  O     . THR A 1 616  ? -24.471 -34.087  -29.987 1.00 96.19  ? 620  THR A O     1 
ATOM   4952  C  CB    . THR A 1 616  ? -26.788 -35.343  -31.854 1.00 91.54  ? 620  THR A CB    1 
ATOM   4953  O  OG1   . THR A 1 616  ? -27.728 -34.679  -31.004 1.00 102.20 ? 620  THR A OG1   1 
ATOM   4954  C  CG2   . THR A 1 616  ? -27.490 -36.460  -32.622 1.00 85.33  ? 620  THR A CG2   1 
ATOM   4955  N  N     . ILE A 1 617  ? -25.991 -35.168  -28.731 1.00 83.32  ? 621  ILE A N     1 
ATOM   4956  C  CA    . ILE A 1 617  ? -25.734 -34.367  -27.536 1.00 75.11  ? 621  ILE A CA    1 
ATOM   4957  C  C     . ILE A 1 617  ? -24.346 -34.634  -26.948 1.00 73.96  ? 621  ILE A C     1 
ATOM   4958  O  O     . ILE A 1 617  ? -23.628 -33.690  -26.590 1.00 69.97  ? 621  ILE A O     1 
ATOM   4959  C  CB    . ILE A 1 617  ? -26.791 -34.622  -26.440 1.00 74.94  ? 621  ILE A CB    1 
ATOM   4960  C  CG1   . ILE A 1 617  ? -28.166 -34.125  -26.884 1.00 75.99  ? 621  ILE A CG1   1 
ATOM   4961  C  CG2   . ILE A 1 617  ? -26.404 -33.932  -25.152 1.00 75.10  ? 621  ILE A CG2   1 
ATOM   4962  C  CD1   . ILE A 1 617  ? -29.255 -34.339  -25.854 1.00 71.18  ? 621  ILE A CD1   1 
ATOM   4963  N  N     . ILE A 1 618  ? -23.953 -35.907  -26.871 1.00 69.96  ? 622  ILE A N     1 
ATOM   4964  C  CA    . ILE A 1 618  ? -22.748 -36.267  -26.125 1.00 67.05  ? 622  ILE A CA    1 
ATOM   4965  C  C     . ILE A 1 618  ? -21.528 -36.632  -26.968 1.00 68.85  ? 622  ILE A C     1 
ATOM   4966  O  O     . ILE A 1 618  ? -20.569 -37.199  -26.437 1.00 75.79  ? 622  ILE A O     1 
ATOM   4967  C  CB    . ILE A 1 618  ? -23.029 -37.450  -25.177 1.00 63.94  ? 622  ILE A CB    1 
ATOM   4968  C  CG1   . ILE A 1 618  ? -23.318 -38.716  -25.977 1.00 61.97  ? 622  ILE A CG1   1 
ATOM   4969  C  CG2   . ILE A 1 618  ? -24.190 -37.123  -24.249 1.00 68.50  ? 622  ILE A CG2   1 
ATOM   4970  C  CD1   . ILE A 1 618  ? -23.333 -39.965  -25.144 1.00 63.40  ? 622  ILE A CD1   1 
ATOM   4971  N  N     . CYS A 1 619  ? -21.550 -36.307  -28.260 1.00 64.29  ? 623  CYS A N     1 
ATOM   4972  C  CA    . CYS A 1 619  ? -20.489 -36.755  -29.166 1.00 65.51  ? 623  CYS A CA    1 
ATOM   4973  C  C     . CYS A 1 619  ? -19.123 -36.140  -28.854 1.00 81.68  ? 623  CYS A C     1 
ATOM   4974  O  O     . CYS A 1 619  ? -18.091 -36.759  -29.108 1.00 92.70  ? 623  CYS A O     1 
ATOM   4975  C  CB    . CYS A 1 619  ? -20.873 -36.475  -30.624 1.00 72.66  ? 623  CYS A CB    1 
ATOM   4976  S  SG    . CYS A 1 619  ? -21.295 -34.780  -31.084 1.00 89.32  ? 623  CYS A SG    1 
ATOM   4977  N  N     . ASP A 1 620  ? -19.115 -34.940  -28.283 1.00 83.02  ? 624  ASP A N     1 
ATOM   4978  C  CA    . ASP A 1 620  ? -17.861 -34.230  -28.030 1.00 73.97  ? 624  ASP A CA    1 
ATOM   4979  C  C     . ASP A 1 620  ? -17.390 -34.355  -26.583 1.00 75.74  ? 624  ASP A C     1 
ATOM   4980  O  O     . ASP A 1 620  ? -16.274 -33.942  -26.245 1.00 76.36  ? 624  ASP A O     1 
ATOM   4981  C  CB    . ASP A 1 620  ? -18.003 -32.756  -28.401 1.00 78.50  ? 624  ASP A CB    1 
ATOM   4982  C  CG    . ASP A 1 620  ? -18.049 -32.535  -29.904 1.00 86.96  ? 624  ASP A CG    1 
ATOM   4983  O  OD1   . ASP A 1 620  ? -17.313 -33.236  -30.635 1.00 85.88  ? 624  ASP A OD1   1 
ATOM   4984  O  OD2   . ASP A 1 620  ? -18.822 -31.664  -30.354 1.00 103.18 ? 624  ASP A OD2   1 
ATOM   4985  N  N     . LEU A 1 621  ? -18.236 -34.927  -25.731 1.00 75.26  ? 625  LEU A N     1 
ATOM   4986  C  CA    . LEU A 1 621  ? -17.880 -35.133  -24.328 1.00 68.43  ? 625  LEU A CA    1 
ATOM   4987  C  C     . LEU A 1 621  ? -16.863 -36.249  -24.161 1.00 63.49  ? 625  LEU A C     1 
ATOM   4988  O  O     . LEU A 1 621  ? -16.831 -37.195  -24.932 1.00 75.88  ? 625  LEU A O     1 
ATOM   4989  C  CB    . LEU A 1 621  ? -19.121 -35.451  -23.491 1.00 69.36  ? 625  LEU A CB    1 
ATOM   4990  C  CG    . LEU A 1 621  ? -20.186 -34.362  -23.359 1.00 65.18  ? 625  LEU A CG    1 
ATOM   4991  C  CD1   . LEU A 1 621  ? -21.307 -34.828  -22.450 1.00 57.49  ? 625  LEU A CD1   1 
ATOM   4992  C  CD2   . LEU A 1 621  ? -19.571 -33.069  -22.858 1.00 58.85  ? 625  LEU A CD2   1 
ATOM   4993  N  N     . GLN A 1 622  ? -16.032 -36.127  -23.137 1.00 72.14  ? 626  GLN A N     1 
ATOM   4994  C  CA    . GLN A 1 622  ? -15.109 -37.190  -22.758 1.00 84.52  ? 626  GLN A CA    1 
ATOM   4995  C  C     . GLN A 1 622  ? -15.896 -38.262  -21.992 1.00 92.78  ? 626  GLN A C     1 
ATOM   4996  O  O     . GLN A 1 622  ? -17.025 -38.006  -21.573 1.00 92.45  ? 626  GLN A O     1 
ATOM   4997  C  CB    . GLN A 1 622  ? -13.962 -36.616  -21.915 1.00 95.56  ? 626  GLN A CB    1 
ATOM   4998  C  CG    . GLN A 1 622  ? -14.311 -36.414  -20.459 1.00 118.96 ? 626  GLN A CG    1 
ATOM   4999  C  CD    . GLN A 1 622  ? -13.471 -35.337  -19.815 1.00 136.73 ? 626  GLN A CD    1 
ATOM   5000  O  OE1   . GLN A 1 622  ? -13.141 -34.331  -20.450 1.00 141.44 ? 626  GLN A OE1   1 
ATOM   5001  N  NE2   . GLN A 1 622  ? -13.114 -35.540  -18.549 1.00 145.51 ? 626  GLN A NE2   1 
ATOM   5002  N  N     . PRO A 1 623  ? -15.319 -39.470  -21.830 1.00 100.24 ? 627  PRO A N     1 
ATOM   5003  C  CA    . PRO A 1 623  ? -15.997 -40.588  -21.151 1.00 98.74  ? 627  PRO A CA    1 
ATOM   5004  C  C     . PRO A 1 623  ? -16.665 -40.264  -19.804 1.00 84.14  ? 627  PRO A C     1 
ATOM   5005  O  O     . PRO A 1 623  ? -17.866 -40.529  -19.626 1.00 85.22  ? 627  PRO A O     1 
ATOM   5006  C  CB    . PRO A 1 623  ? -14.860 -41.587  -20.947 1.00 101.26 ? 627  PRO A CB    1 
ATOM   5007  C  CG    . PRO A 1 623  ? -13.994 -41.379  -22.138 1.00 104.43 ? 627  PRO A CG    1 
ATOM   5008  C  CD    . PRO A 1 623  ? -14.050 -39.905  -22.447 1.00 94.26  ? 627  PRO A CD    1 
ATOM   5009  N  N     . GLN A 1 624  ? -15.898 -39.706  -18.872 1.00 68.76  ? 628  GLN A N     1 
ATOM   5010  C  CA    . GLN A 1 624  ? -16.415 -39.400  -17.538 1.00 64.29  ? 628  GLN A CA    1 
ATOM   5011  C  C     . GLN A 1 624  ? -17.622 -38.461  -17.585 1.00 68.06  ? 628  GLN A C     1 
ATOM   5012  O  O     . GLN A 1 624  ? -18.621 -38.660  -16.866 1.00 80.50  ? 628  GLN A O     1 
ATOM   5013  C  CB    . GLN A 1 624  ? -15.315 -38.797  -16.676 1.00 71.79  ? 628  GLN A CB    1 
ATOM   5014  C  CG    . GLN A 1 624  ? -14.104 -39.700  -16.513 1.00 107.82 ? 628  GLN A CG    1 
ATOM   5015  C  CD    . GLN A 1 624  ? -13.215 -39.285  -15.356 1.00 141.67 ? 628  GLN A CD    1 
ATOM   5016  O  OE1   . GLN A 1 624  ? -13.687 -39.067  -14.239 1.00 153.62 ? 628  GLN A OE1   1 
ATOM   5017  N  NE2   . GLN A 1 624  ? -11.918 -39.170  -15.620 1.00 156.14 ? 628  GLN A NE2   1 
ATOM   5018  N  N     . GLN A 1 625  ? -17.534 -37.458  -18.455 1.00 63.84  ? 629  GLN A N     1 
ATOM   5019  C  CA    . GLN A 1 625  ? -18.636 -36.528  -18.671 1.00 55.41  ? 629  GLN A CA    1 
ATOM   5020  C  C     . GLN A 1 625  ? -19.867 -37.260  -19.199 1.00 60.64  ? 629  GLN A C     1 
ATOM   5021  O  O     . GLN A 1 625  ? -21.001 -36.940  -18.840 1.00 61.94  ? 629  GLN A O     1 
ATOM   5022  C  CB    . GLN A 1 625  ? -18.217 -35.419  -19.632 1.00 58.68  ? 629  GLN A CB    1 
ATOM   5023  C  CG    . GLN A 1 625  ? -17.051 -34.576  -19.123 1.00 73.57  ? 629  GLN A CG    1 
ATOM   5024  C  CD    . GLN A 1 625  ? -16.663 -33.443  -20.070 1.00 82.72  ? 629  GLN A CD    1 
ATOM   5025  O  OE1   . GLN A 1 625  ? -16.674 -33.596  -21.295 1.00 80.53  ? 629  GLN A OE1   1 
ATOM   5026  N  NE2   . GLN A 1 625  ? -16.312 -32.301  -19.497 1.00 90.91  ? 629  GLN A NE2   1 
ATOM   5027  N  N     . VAL A 1 626  ? -19.637 -38.266  -20.033 1.00 57.85  ? 630  VAL A N     1 
ATOM   5028  C  CA    . VAL A 1 626  ? -20.729 -39.062  -20.575 1.00 64.16  ? 630  VAL A CA    1 
ATOM   5029  C  C     . VAL A 1 626  ? -21.419 -39.812  -19.456 1.00 69.00  ? 630  VAL A C     1 
ATOM   5030  O  O     . VAL A 1 626  ? -22.651 -39.840  -19.379 1.00 74.25  ? 630  VAL A O     1 
ATOM   5031  C  CB    . VAL A 1 626  ? -20.244 -40.065  -21.655 1.00 57.30  ? 630  VAL A CB    1 
ATOM   5032  C  CG1   . VAL A 1 626  ? -21.340 -41.057  -21.978 1.00 53.58  ? 630  VAL A CG1   1 
ATOM   5033  C  CG2   . VAL A 1 626  ? -19.788 -39.323  -22.894 1.00 57.22  ? 630  VAL A CG2   1 
ATOM   5034  N  N     . HIS A 1 627  ? -20.622 -40.410  -18.576 1.00 69.49  ? 631  HIS A N     1 
ATOM   5035  C  CA    . HIS A 1 627  ? -21.183 -41.084  -17.401 1.00 72.82  ? 631  HIS A CA    1 
ATOM   5036  C  C     . HIS A 1 627  ? -22.031 -40.146  -16.558 1.00 68.81  ? 631  HIS A C     1 
ATOM   5037  O  O     . HIS A 1 627  ? -23.134 -40.510  -16.120 1.00 65.09  ? 631  HIS A O     1 
ATOM   5038  C  CB    . HIS A 1 627  ? -20.074 -41.685  -16.544 1.00 61.91  ? 631  HIS A CB    1 
ATOM   5039  C  CG    . HIS A 1 627  ? -19.215 -42.661  -17.284 1.00 67.11  ? 631  HIS A CG    1 
ATOM   5040  N  ND1   . HIS A 1 627  ? -17.924 -42.951  -16.903 1.00 60.76  ? 631  HIS A ND1   1 
ATOM   5041  C  CD2   . HIS A 1 627  ? -19.460 -43.407  -18.388 1.00 69.60  ? 631  HIS A CD2   1 
ATOM   5042  C  CE1   . HIS A 1 627  ? -17.414 -43.843  -17.733 1.00 68.80  ? 631  HIS A CE1   1 
ATOM   5043  N  NE2   . HIS A 1 627  ? -18.326 -44.139  -18.641 1.00 70.75  ? 631  HIS A NE2   1 
ATOM   5044  N  N     . THR A 1 628  ? -21.512 -38.941  -16.330 1.00 70.26  ? 632  THR A N     1 
ATOM   5045  C  CA    . THR A 1 628  ? -22.278 -37.927  -15.606 1.00 69.47  ? 632  THR A CA    1 
ATOM   5046  C  C     . THR A 1 628  ? -23.625 -37.679  -16.289 1.00 74.04  ? 632  THR A C     1 
ATOM   5047  O  O     . THR A 1 628  ? -24.677 -37.650  -15.633 1.00 74.21  ? 632  THR A O     1 
ATOM   5048  C  CB    . THR A 1 628  ? -21.514 -36.608  -15.502 1.00 77.18  ? 632  THR A CB    1 
ATOM   5049  O  OG1   . THR A 1 628  ? -20.332 -36.805  -14.721 1.00 89.88  ? 632  THR A OG1   1 
ATOM   5050  C  CG2   . THR A 1 628  ? -22.373 -35.546  -14.850 1.00 87.24  ? 632  THR A CG2   1 
ATOM   5051  N  N     . PHE A 1 629  ? -23.582 -37.529  -17.612 1.00 64.48  ? 633  PHE A N     1 
ATOM   5052  C  CA    . PHE A 1 629  ? -24.783 -37.346  -18.417 1.00 62.25  ? 633  PHE A CA    1 
ATOM   5053  C  C     . PHE A 1 629  ? -25.800 -38.470  -18.198 1.00 65.61  ? 633  PHE A C     1 
ATOM   5054  O  O     . PHE A 1 629  ? -26.978 -38.223  -17.889 1.00 69.72  ? 633  PHE A O     1 
ATOM   5055  C  CB    . PHE A 1 629  ? -24.403 -37.258  -19.900 1.00 64.51  ? 633  PHE A CB    1 
ATOM   5056  C  CG    . PHE A 1 629  ? -25.547 -36.898  -20.798 1.00 64.81  ? 633  PHE A CG    1 
ATOM   5057  C  CD1   . PHE A 1 629  ? -25.820 -35.575  -21.092 1.00 65.77  ? 633  PHE A CD1   1 
ATOM   5058  C  CD2   . PHE A 1 629  ? -26.350 -37.881  -21.348 1.00 66.26  ? 633  PHE A CD2   1 
ATOM   5059  C  CE1   . PHE A 1 629  ? -26.876 -35.237  -21.920 1.00 69.35  ? 633  PHE A CE1   1 
ATOM   5060  C  CE2   . PHE A 1 629  ? -27.404 -37.550  -22.173 1.00 76.83  ? 633  PHE A CE2   1 
ATOM   5061  C  CZ    . PHE A 1 629  ? -27.667 -36.223  -22.461 1.00 72.93  ? 633  PHE A CZ    1 
ATOM   5062  N  N     . TYR A 1 630  ? -25.337 -39.705  -18.362 1.00 59.68  ? 634  TYR A N     1 
ATOM   5063  C  CA    . TYR A 1 630  ? -26.193 -40.871  -18.191 1.00 62.60  ? 634  TYR A CA    1 
ATOM   5064  C  C     . TYR A 1 630  ? -26.797 -40.957  -16.792 1.00 66.34  ? 634  TYR A C     1 
ATOM   5065  O  O     . TYR A 1 630  ? -27.949 -41.364  -16.631 1.00 71.50  ? 634  TYR A O     1 
ATOM   5066  C  CB    . TYR A 1 630  ? -25.412 -42.146  -18.506 1.00 64.19  ? 634  TYR A CB    1 
ATOM   5067  C  CG    . TYR A 1 630  ? -25.480 -42.516  -19.966 1.00 67.70  ? 634  TYR A CG    1 
ATOM   5068  C  CD1   . TYR A 1 630  ? -26.317 -43.519  -20.399 1.00 69.41  ? 634  TYR A CD1   1 
ATOM   5069  C  CD2   . TYR A 1 630  ? -24.728 -41.836  -20.916 1.00 73.09  ? 634  TYR A CD2   1 
ATOM   5070  C  CE1   . TYR A 1 630  ? -26.392 -43.856  -21.742 1.00 74.58  ? 634  TYR A CE1   1 
ATOM   5071  C  CE2   . TYR A 1 630  ? -24.796 -42.163  -22.244 1.00 69.83  ? 634  TYR A CE2   1 
ATOM   5072  C  CZ    . TYR A 1 630  ? -25.633 -43.173  -22.657 1.00 75.48  ? 634  TYR A CZ    1 
ATOM   5073  O  OH    . TYR A 1 630  ? -25.708 -43.508  -23.993 1.00 87.97  ? 634  TYR A OH    1 
ATOM   5074  N  N     . GLU A 1 631  ? -26.016 -40.576  -15.787 1.00 63.89  ? 635  GLU A N     1 
ATOM   5075  C  CA    . GLU A 1 631  ? -26.497 -40.540  -14.417 1.00 64.04  ? 635  GLU A CA    1 
ATOM   5076  C  C     . GLU A 1 631  ? -27.641 -39.528  -14.287 1.00 67.86  ? 635  GLU A C     1 
ATOM   5077  O  O     . GLU A 1 631  ? -28.726 -39.826  -13.751 1.00 73.01  ? 635  GLU A O     1 
ATOM   5078  C  CB    . GLU A 1 631  ? -25.338 -40.192  -13.491 1.00 84.16  ? 635  GLU A CB    1 
ATOM   5079  C  CG    . GLU A 1 631  ? -25.607 -40.336  -12.001 1.00 88.72  ? 635  GLU A CG    1 
ATOM   5080  C  CD    . GLU A 1 631  ? -24.351 -40.106  -11.183 1.00 85.00  ? 635  GLU A CD    1 
ATOM   5081  O  OE1   . GLU A 1 631  ? -23.241 -40.229  -11.747 1.00 92.13  ? 635  GLU A OE1   1 
ATOM   5082  O  OE2   . GLU A 1 631  ? -24.473 -39.794  -9.982  1.00 76.54  ? 635  GLU A OE2   1 
ATOM   5083  N  N     . ALA A 1 632  ? -27.390 -38.335  -14.820 1.00 68.32  ? 636  ALA A N     1 
ATOM   5084  C  CA    . ALA A 1 632  ? -28.366 -37.247  -14.823 1.00 62.40  ? 636  ALA A CA    1 
ATOM   5085  C  C     . ALA A 1 632  ? -29.692 -37.670  -15.453 1.00 72.54  ? 636  ALA A C     1 
ATOM   5086  O  O     . ALA A 1 632  ? -30.754 -37.473  -14.846 1.00 71.06  ? 636  ALA A O     1 
ATOM   5087  C  CB    . ALA A 1 632  ? -27.805 -36.044  -15.547 1.00 54.22  ? 636  ALA A CB    1 
ATOM   5088  N  N     . VAL A 1 633  ? -29.632 -38.247  -16.655 1.00 65.69  ? 637  VAL A N     1 
ATOM   5089  C  CA    . VAL A 1 633  ? -30.839 -38.723  -17.329 1.00 65.12  ? 637  VAL A CA    1 
ATOM   5090  C  C     . VAL A 1 633  ? -31.490 -39.857  -16.533 1.00 67.58  ? 637  VAL A C     1 
ATOM   5091  O  O     . VAL A 1 633  ? -32.723 -39.960  -16.443 1.00 75.43  ? 637  VAL A O     1 
ATOM   5092  C  CB    . VAL A 1 633  ? -30.527 -39.200  -18.767 1.00 70.21  ? 637  VAL A CB    1 
ATOM   5093  C  CG1   . VAL A 1 633  ? -31.736 -39.882  -19.389 1.00 66.18  ? 637  VAL A CG1   1 
ATOM   5094  C  CG2   . VAL A 1 633  ? -30.071 -38.033  -19.633 1.00 64.52  ? 637  VAL A CG2   1 
ATOM   5095  N  N     . GLY A 1 634  ? -30.646 -40.699  -15.948 1.00 66.31  ? 638  GLY A N     1 
ATOM   5096  C  CA    . GLY A 1 634  ? -31.096 -41.782  -15.095 1.00 75.24  ? 638  GLY A CA    1 
ATOM   5097  C  C     . GLY A 1 634  ? -32.028 -41.317  -13.988 1.00 76.53  ? 638  GLY A C     1 
ATOM   5098  O  O     . GLY A 1 634  ? -33.013 -41.990  -13.678 1.00 77.39  ? 638  GLY A O     1 
ATOM   5099  N  N     . TYR A 1 635  ? -31.722 -40.168  -13.385 1.00 77.53  ? 639  TYR A N     1 
ATOM   5100  C  CA    . TYR A 1 635  ? -32.641 -39.592  -12.394 1.00 72.55  ? 639  TYR A CA    1 
ATOM   5101  C  C     . TYR A 1 635  ? -34.005 -39.268  -12.999 1.00 82.47  ? 639  TYR A C     1 
ATOM   5102  O  O     . TYR A 1 635  ? -35.039 -39.550  -12.394 1.00 83.54  ? 639  TYR A O     1 
ATOM   5103  C  CB    . TYR A 1 635  ? -32.054 -38.332  -11.762 1.00 63.93  ? 639  TYR A CB    1 
ATOM   5104  C  CG    . TYR A 1 635  ? -30.829 -38.610  -10.921 1.00 70.56  ? 639  TYR A CG    1 
ATOM   5105  C  CD1   . TYR A 1 635  ? -30.926 -39.332  -9.744  1.00 66.16  ? 639  TYR A CD1   1 
ATOM   5106  C  CD2   . TYR A 1 635  ? -29.572 -38.160  -11.310 1.00 72.00  ? 639  TYR A CD2   1 
ATOM   5107  C  CE1   . TYR A 1 635  ? -29.810 -39.599  -8.976  1.00 61.75  ? 639  TYR A CE1   1 
ATOM   5108  C  CE2   . TYR A 1 635  ? -28.449 -38.431  -10.550 1.00 65.45  ? 639  TYR A CE2   1 
ATOM   5109  C  CZ    . TYR A 1 635  ? -28.580 -39.148  -9.385  1.00 67.32  ? 639  TYR A CZ    1 
ATOM   5110  O  OH    . TYR A 1 635  ? -27.472 -39.414  -8.623  1.00 78.66  ? 639  TYR A OH    1 
ATOM   5111  N  N     . MET A 1 636  ? -34.003 -38.673  -14.190 1.00 85.49  ? 640  MET A N     1 
ATOM   5112  C  CA    . MET A 1 636  ? -35.240 -38.351  -14.897 1.00 77.11  ? 640  MET A CA    1 
ATOM   5113  C  C     . MET A 1 636  ? -36.076 -39.602  -15.107 1.00 78.20  ? 640  MET A C     1 
ATOM   5114  O  O     . MET A 1 636  ? -37.281 -39.592  -14.881 1.00 81.36  ? 640  MET A O     1 
ATOM   5115  C  CB    . MET A 1 636  ? -34.950 -37.701  -16.251 1.00 75.89  ? 640  MET A CB    1 
ATOM   5116  C  CG    . MET A 1 636  ? -34.112 -36.447  -16.196 1.00 78.95  ? 640  MET A CG    1 
ATOM   5117  S  SD    . MET A 1 636  ? -33.856 -35.760  -17.850 1.00 84.25  ? 640  MET A SD    1 
ATOM   5118  C  CE    . MET A 1 636  ? -32.942 -34.279  -17.478 1.00 108.38 ? 640  MET A CE    1 
ATOM   5119  N  N     . ILE A 1 637  ? -35.432 -40.679  -15.544 1.00 82.98  ? 641  ILE A N     1 
ATOM   5120  C  CA    . ILE A 1 637  ? -36.151 -41.933  -15.788 1.00 84.04  ? 641  ILE A CA    1 
ATOM   5121  C  C     . ILE A 1 637  ? -36.678 -42.522  -14.478 1.00 88.91  ? 641  ILE A C     1 
ATOM   5122  O  O     . ILE A 1 637  ? -37.783 -43.076  -14.429 1.00 86.37  ? 641  ILE A O     1 
ATOM   5123  C  CB    . ILE A 1 637  ? -35.265 -42.957  -16.499 1.00 77.52  ? 641  ILE A CB    1 
ATOM   5124  C  CG1   . ILE A 1 637  ? -34.955 -42.461  -17.904 1.00 78.60  ? 641  ILE A CG1   1 
ATOM   5125  C  CG2   . ILE A 1 637  ? -35.939 -44.307  -16.549 1.00 80.23  ? 641  ILE A CG2   1 
ATOM   5126  C  CD1   . ILE A 1 637  ? -34.451 -43.534  -18.817 1.00 83.81  ? 641  ILE A CD1   1 
ATOM   5127  N  N     . GLY A 1 638  ? -35.892 -42.387  -13.414 1.00 89.72  ? 642  GLY A N     1 
ATOM   5128  C  CA    . GLY A 1 638  ? -36.343 -42.787  -12.095 1.00 80.28  ? 642  GLY A CA    1 
ATOM   5129  C  C     . GLY A 1 638  ? -37.606 -42.054  -11.685 1.00 82.81  ? 642  GLY A C     1 
ATOM   5130  O  O     . GLY A 1 638  ? -38.424 -42.587  -10.946 1.00 75.13  ? 642  GLY A O     1 
ATOM   5131  N  N     . ALA A 1 639  ? -37.772 -40.833  -12.185 1.00 93.51  ? 643  ALA A N     1 
ATOM   5132  C  CA    . ALA A 1 639  ? -38.933 -40.014  -11.848 1.00 98.54  ? 643  ALA A CA    1 
ATOM   5133  C  C     . ALA A 1 639  ? -40.231 -40.515  -12.486 1.00 99.85  ? 643  ALA A C     1 
ATOM   5134  O  O     . ALA A 1 639  ? -41.317 -40.155  -12.034 1.00 103.81 ? 643  ALA A O     1 
ATOM   5135  C  CB    . ALA A 1 639  ? -38.685 -38.564  -12.248 1.00 102.96 ? 643  ALA A CB    1 
ATOM   5136  N  N     . GLN A 1 640  ? -40.127 -41.334  -13.529 1.00 102.73 ? 644  GLN A N     1 
ATOM   5137  C  CA    . GLN A 1 640  ? -41.318 -41.870  -14.200 1.00 97.55  ? 644  GLN A CA    1 
ATOM   5138  C  C     . GLN A 1 640  ? -41.898 -43.068  -13.447 1.00 109.37 ? 644  GLN A C     1 
ATOM   5139  O  O     . GLN A 1 640  ? -41.224 -44.081  -13.265 1.00 120.07 ? 644  GLN A O     1 
ATOM   5140  C  CB    . GLN A 1 640  ? -40.995 -42.267  -15.640 1.00 85.83  ? 644  GLN A CB    1 
ATOM   5141  C  CG    . GLN A 1 640  ? -42.159 -42.903  -16.385 1.00 86.30  ? 644  GLN A CG    1 
ATOM   5142  C  CD    . GLN A 1 640  ? -43.394 -42.023  -16.397 1.00 100.28 ? 644  GLN A CD    1 
ATOM   5143  O  OE1   . GLN A 1 640  ? -44.263 -42.130  -15.518 1.00 108.47 ? 644  GLN A OE1   1 
ATOM   5144  N  NE2   . GLN A 1 640  ? -43.482 -41.143  -17.396 1.00 102.28 ? 644  GLN A NE2   1 
ATOM   5145  N  N     . THR A 1 641  ? -43.154 -42.952  -13.027 1.00 111.96 ? 645  THR A N     1 
ATOM   5146  C  CA    . THR A 1 641  ? -43.755 -43.929  -12.121 1.00 118.86 ? 645  THR A CA    1 
ATOM   5147  C  C     . THR A 1 641  ? -44.432 -45.108  -12.818 1.00 126.03 ? 645  THR A C     1 
ATOM   5148  O  O     . THR A 1 641  ? -44.428 -46.222  -12.291 1.00 128.48 ? 645  THR A O     1 
ATOM   5149  C  CB    . THR A 1 641  ? -44.791 -43.258  -11.195 1.00 111.23 ? 645  THR A CB    1 
ATOM   5150  O  OG1   . THR A 1 641  ? -45.579 -42.327  -11.948 1.00 115.85 ? 645  THR A OG1   1 
ATOM   5151  C  CG2   . THR A 1 641  ? -44.092 -42.521  -10.065 1.00 104.74 ? 645  THR A CG2   1 
ATOM   5152  N  N     . ASP A 1 642  ? -45.018 -44.871  -13.989 1.00 125.95 ? 646  ASP A N     1 
ATOM   5153  C  CA    . ASP A 1 642  ? -45.707 -45.940  -14.707 1.00 130.71 ? 646  ASP A CA    1 
ATOM   5154  C  C     . ASP A 1 642  ? -44.705 -46.978  -15.209 1.00 130.87 ? 646  ASP A C     1 
ATOM   5155  O  O     . ASP A 1 642  ? -43.892 -46.691  -16.092 1.00 134.98 ? 646  ASP A O     1 
ATOM   5156  C  CB    . ASP A 1 642  ? -46.524 -45.378  -15.870 1.00 136.19 ? 646  ASP A CB    1 
ATOM   5157  C  CG    . ASP A 1 642  ? -47.484 -46.397  -16.452 1.00 139.21 ? 646  ASP A CG    1 
ATOM   5158  O  OD1   . ASP A 1 642  ? -48.551 -46.627  -15.842 1.00 145.89 ? 646  ASP A OD1   1 
ATOM   5159  O  OD2   . ASP A 1 642  ? -47.173 -46.966  -17.520 1.00 138.40 ? 646  ASP A OD2   1 
ATOM   5160  N  N     . GLN A 1 643  ? -44.781 -48.179  -14.639 1.00 116.80 ? 647  GLN A N     1 
ATOM   5161  C  CA    . GLN A 1 643  ? -43.783 -49.228  -14.846 1.00 117.02 ? 647  GLN A CA    1 
ATOM   5162  C  C     . GLN A 1 643  ? -43.472 -49.521  -16.312 1.00 114.17 ? 647  GLN A C     1 
ATOM   5163  O  O     . GLN A 1 643  ? -42.308 -49.705  -16.674 1.00 116.40 ? 647  GLN A O     1 
ATOM   5164  C  CB    . GLN A 1 643  ? -44.236 -50.519  -14.163 1.00 130.27 ? 647  GLN A CB    1 
ATOM   5165  C  CG    . GLN A 1 643  ? -43.278 -51.686  -14.353 1.00 139.18 ? 647  GLN A CG    1 
ATOM   5166  C  CD    . GLN A 1 643  ? -43.769 -52.958  -13.695 1.00 149.42 ? 647  GLN A CD    1 
ATOM   5167  O  OE1   . GLN A 1 643  ? -44.948 -53.306  -13.788 1.00 156.08 ? 647  GLN A OE1   1 
ATOM   5168  N  NE2   . GLN A 1 643  ? -42.864 -53.659  -13.019 1.00 153.02 ? 647  GLN A NE2   1 
ATOM   5169  N  N     . THR A 1 644  ? -44.507 -49.562  -17.147 1.00 115.40 ? 648  THR A N     1 
ATOM   5170  C  CA    . THR A 1 644  ? -44.342 -49.871  -18.565 1.00 104.02 ? 648  THR A CA    1 
ATOM   5171  C  C     . THR A 1 644  ? -43.553 -48.780  -19.283 1.00 103.27 ? 648  THR A C     1 
ATOM   5172  O  O     . THR A 1 644  ? -42.489 -49.034  -19.869 1.00 112.32 ? 648  THR A O     1 
ATOM   5173  C  CB    . THR A 1 644  ? -45.699 -50.042  -19.258 1.00 100.99 ? 648  THR A CB    1 
ATOM   5174  O  OG1   . THR A 1 644  ? -46.508 -50.959  -18.512 1.00 97.54  ? 648  THR A OG1   1 
ATOM   5175  C  CG2   . THR A 1 644  ? -45.511 -50.562  -20.676 1.00 109.60 ? 648  THR A CG2   1 
ATOM   5176  N  N     . VAL A 1 645  ? -44.096 -47.567  -19.231 1.00 99.30  ? 649  VAL A N     1 
ATOM   5177  C  CA    . VAL A 1 645  ? -43.467 -46.393  -19.818 1.00 87.44  ? 649  VAL A CA    1 
ATOM   5178  C  C     . VAL A 1 645  ? -42.023 -46.295  -19.362 1.00 91.02  ? 649  VAL A C     1 
ATOM   5179  O  O     . VAL A 1 645  ? -41.120 -46.023  -20.156 1.00 97.36  ? 649  VAL A O     1 
ATOM   5180  C  CB    . VAL A 1 645  ? -44.214 -45.104  -19.432 1.00 76.80  ? 649  VAL A CB    1 
ATOM   5181  C  CG1   . VAL A 1 645  ? -43.563 -43.896  -20.081 1.00 71.37  ? 649  VAL A CG1   1 
ATOM   5182  C  CG2   . VAL A 1 645  ? -45.681 -45.201  -19.824 1.00 88.67  ? 649  VAL A CG2   1 
ATOM   5183  N  N     . GLN A 1 646  ? -41.813 -46.544  -18.074 1.00 92.56  ? 650  GLN A N     1 
ATOM   5184  C  CA    . GLN A 1 646  ? -40.481 -46.490  -17.491 1.00 89.02  ? 650  GLN A CA    1 
ATOM   5185  C  C     . GLN A 1 646  ? -39.575 -47.569  -18.072 1.00 89.20  ? 650  GLN A C     1 
ATOM   5186  O  O     . GLN A 1 646  ? -38.390 -47.334  -18.292 1.00 89.93  ? 650  GLN A O     1 
ATOM   5187  C  CB    . GLN A 1 646  ? -40.556 -46.637  -15.978 1.00 85.82  ? 650  GLN A CB    1 
ATOM   5188  C  CG    . GLN A 1 646  ? -39.210 -46.496  -15.293 1.00 89.53  ? 650  GLN A CG    1 
ATOM   5189  C  CD    . GLN A 1 646  ? -39.303 -46.668  -13.800 1.00 93.64  ? 650  GLN A CD    1 
ATOM   5190  O  OE1   . GLN A 1 646  ? -39.863 -47.654  -13.308 1.00 100.69 ? 650  GLN A OE1   1 
ATOM   5191  N  NE2   . GLN A 1 646  ? -38.759 -45.703  -13.062 1.00 87.04  ? 650  GLN A NE2   1 
ATOM   5192  N  N     . GLU A 1 647  ? -40.135 -48.753  -18.315 1.00 93.36  ? 651  GLU A N     1 
ATOM   5193  C  CA    . GLU A 1 647  ? -39.362 -49.851  -18.887 1.00 100.38 ? 651  GLU A CA    1 
ATOM   5194  C  C     . GLU A 1 647  ? -38.890 -49.497  -20.290 1.00 104.05 ? 651  GLU A C     1 
ATOM   5195  O  O     . GLU A 1 647  ? -37.731 -49.729  -20.637 1.00 105.52 ? 651  GLU A O     1 
ATOM   5196  C  CB    . GLU A 1 647  ? -40.177 -51.144  -18.919 1.00 102.68 ? 651  GLU A CB    1 
ATOM   5197  C  CG    . GLU A 1 647  ? -40.150 -51.942  -17.632 1.00 109.54 ? 651  GLU A CG    1 
ATOM   5198  C  CD    . GLU A 1 647  ? -40.912 -53.252  -17.744 1.00 121.72 ? 651  GLU A CD    1 
ATOM   5199  O  OE1   . GLU A 1 647  ? -41.141 -53.706  -18.888 1.00 129.32 ? 651  GLU A OE1   1 
ATOM   5200  O  OE2   . GLU A 1 647  ? -41.286 -53.825  -16.693 1.00 117.12 ? 651  GLU A OE2   1 
ATOM   5201  N  N     . HIS A 1 648  ? -39.789 -48.925  -21.086 1.00 107.37 ? 652  HIS A N     1 
ATOM   5202  C  CA    . HIS A 1 648  ? -39.439 -48.510  -22.442 1.00 97.50  ? 652  HIS A CA    1 
ATOM   5203  C  C     . HIS A 1 648  ? -38.397 -47.392  -22.426 1.00 100.42 ? 652  HIS A C     1 
ATOM   5204  O  O     . HIS A 1 648  ? -37.463 -47.369  -23.242 1.00 109.21 ? 652  HIS A O     1 
ATOM   5205  C  CB    . HIS A 1 648  ? -40.687 -48.065  -23.201 1.00 98.90  ? 652  HIS A CB    1 
ATOM   5206  C  CG    . HIS A 1 648  ? -41.699 -49.155  -23.387 1.00 112.65 ? 652  HIS A CG    1 
ATOM   5207  N  ND1   . HIS A 1 648  ? -43.016 -48.902  -23.702 1.00 118.20 ? 652  HIS A ND1   1 
ATOM   5208  C  CD2   . HIS A 1 648  ? -41.585 -50.502  -23.298 1.00 116.31 ? 652  HIS A CD2   1 
ATOM   5209  C  CE1   . HIS A 1 648  ? -43.671 -50.045  -23.798 1.00 120.55 ? 652  HIS A CE1   1 
ATOM   5210  N  NE2   . HIS A 1 648  ? -42.827 -51.032  -23.556 1.00 119.44 ? 652  HIS A NE2   1 
ATOM   5211  N  N     . LEU A 1 649  ? -38.558 -46.471  -21.481 1.00 98.71  ? 653  LEU A N     1 
ATOM   5212  C  CA    . LEU A 1 649  ? -37.600 -45.386  -21.309 1.00 99.57  ? 653  LEU A CA    1 
ATOM   5213  C  C     . LEU A 1 649  ? -36.216 -45.934  -20.987 1.00 96.83  ? 653  LEU A C     1 
ATOM   5214  O  O     . LEU A 1 649  ? -35.231 -45.508  -21.580 1.00 89.48  ? 653  LEU A O     1 
ATOM   5215  C  CB    . LEU A 1 649  ? -38.054 -44.420  -20.213 1.00 96.22  ? 653  LEU A CB    1 
ATOM   5216  C  CG    . LEU A 1 649  ? -39.216 -43.499  -20.587 1.00 100.77 ? 653  LEU A CG    1 
ATOM   5217  C  CD1   . LEU A 1 649  ? -39.546 -42.546  -19.451 1.00 92.25  ? 653  LEU A CD1   1 
ATOM   5218  C  CD2   . LEU A 1 649  ? -38.904 -42.731  -21.863 1.00 111.61 ? 653  LEU A CD2   1 
ATOM   5219  N  N     . ILE A 1 650  ? -36.150 -46.890  -20.063 1.00 92.39  ? 654  ILE A N     1 
ATOM   5220  C  CA    . ILE A 1 650  ? -34.885 -47.528  -19.709 1.00 85.03  ? 654  ILE A CA    1 
ATOM   5221  C  C     . ILE A 1 650  ? -34.296 -48.250  -20.917 1.00 84.12  ? 654  ILE A C     1 
ATOM   5222  O  O     . ILE A 1 650  ? -33.083 -48.241  -21.138 1.00 82.19  ? 654  ILE A O     1 
ATOM   5223  C  CB    . ILE A 1 650  ? -35.055 -48.530  -18.539 1.00 73.12  ? 654  ILE A CB    1 
ATOM   5224  C  CG1   . ILE A 1 650  ? -35.490 -47.798  -17.270 1.00 70.78  ? 654  ILE A CG1   1 
ATOM   5225  C  CG2   . ILE A 1 650  ? -33.756 -49.281  -18.273 1.00 64.68  ? 654  ILE A CG2   1 
ATOM   5226  C  CD1   . ILE A 1 650  ? -35.536 -48.668  -16.048 1.00 64.44  ? 654  ILE A CD1   1 
ATOM   5227  N  N     . GLU A 1 651  ? -35.167 -48.863  -21.712 1.00 91.07  ? 655  GLU A N     1 
ATOM   5228  C  CA    . GLU A 1 651  ? -34.720 -49.594  -22.894 1.00 93.51  ? 655  GLU A CA    1 
ATOM   5229  C  C     . GLU A 1 651  ? -34.052 -48.675  -23.915 1.00 90.94  ? 655  GLU A C     1 
ATOM   5230  O  O     . GLU A 1 651  ? -32.977 -49.006  -24.428 1.00 95.12  ? 655  GLU A O     1 
ATOM   5231  C  CB    . GLU A 1 651  ? -35.890 -50.346  -23.537 1.00 97.45  ? 655  GLU A CB    1 
ATOM   5232  C  CG    . GLU A 1 651  ? -36.294 -51.605  -22.779 1.00 109.75 ? 655  GLU A CG    1 
ATOM   5233  C  CD    . GLU A 1 651  ? -37.557 -52.245  -23.321 1.00 114.15 ? 655  GLU A CD    1 
ATOM   5234  O  OE1   . GLU A 1 651  ? -37.994 -51.857  -24.424 1.00 111.93 ? 655  GLU A OE1   1 
ATOM   5235  O  OE2   . GLU A 1 651  ? -38.115 -53.131  -22.640 1.00 118.92 ? 655  GLU A OE2   1 
ATOM   5236  N  N     . LYS A 1 652  ? -34.663 -47.524  -24.204 1.00 86.25  ? 656  LYS A N     1 
ATOM   5237  C  CA    . LYS A 1 652  ? -34.055 -46.600  -25.166 1.00 79.32  ? 656  LYS A CA    1 
ATOM   5238  C  C     . LYS A 1 652  ? -32.807 -45.951  -24.578 1.00 75.79  ? 656  LYS A C     1 
ATOM   5239  O  O     . LYS A 1 652  ? -31.810 -45.720  -25.258 1.00 86.26  ? 656  LYS A O     1 
ATOM   5240  C  CB    . LYS A 1 652  ? -35.046 -45.522  -25.597 1.00 74.76  ? 656  LYS A CB    1 
ATOM   5241  C  CG    . LYS A 1 652  ? -34.606 -44.791  -26.862 1.00 77.53  ? 656  LYS A CG    1 
ATOM   5242  C  CD    . LYS A 1 652  ? -35.385 -43.511  -27.094 1.00 91.99  ? 656  LYS A CD    1 
ATOM   5243  C  CE    . LYS A 1 652  ? -36.843 -43.778  -27.409 1.00 101.12 ? 656  LYS A CE    1 
ATOM   5244  N  NZ    . LYS A 1 652  ? -37.566 -42.501  -27.685 1.00 109.63 ? 656  LYS A NZ    1 
ATOM   5245  N  N     . TYR A 1 653  ? -32.902 -45.656  -23.293 1.00 75.80  ? 657  TYR A N     1 
ATOM   5246  C  CA    . TYR A 1 653  ? -31.831 -45.093  -22.481 1.00 74.18  ? 657  TYR A CA    1 
ATOM   5247  C  C     . TYR A 1 653  ? -30.514 -45.847  -22.622 1.00 70.18  ? 657  TYR A C     1 
ATOM   5248  O  O     . TYR A 1 653  ? -29.459 -45.239  -22.802 1.00 70.88  ? 657  TYR A O     1 
ATOM   5249  C  CB    . TYR A 1 653  ? -32.320 -45.096  -21.034 1.00 81.09  ? 657  TYR A CB    1 
ATOM   5250  C  CG    . TYR A 1 653  ? -31.378 -44.681  -19.936 1.00 88.15  ? 657  TYR A CG    1 
ATOM   5251  C  CD1   . TYR A 1 653  ? -30.585 -43.549  -20.044 1.00 75.49  ? 657  TYR A CD1   1 
ATOM   5252  C  CD2   . TYR A 1 653  ? -31.346 -45.397  -18.744 1.00 94.65  ? 657  TYR A CD2   1 
ATOM   5253  C  CE1   . TYR A 1 653  ? -29.749 -43.178  -19.010 1.00 78.29  ? 657  TYR A CE1   1 
ATOM   5254  C  CE2   . TYR A 1 653  ? -30.527 -45.030  -17.709 1.00 81.14  ? 657  TYR A CE2   1 
ATOM   5255  C  CZ    . TYR A 1 653  ? -29.730 -43.924  -17.844 1.00 80.57  ? 657  TYR A CZ    1 
ATOM   5256  O  OH    . TYR A 1 653  ? -28.908 -43.561  -16.806 1.00 89.96  ? 657  TYR A OH    1 
ATOM   5257  N  N     . MET A 1 654  ? -30.588 -47.172  -22.560 1.00 71.44  ? 658  MET A N     1 
ATOM   5258  C  CA    . MET A 1 654  ? -29.396 -48.011  -22.576 1.00 78.33  ? 658  MET A CA    1 
ATOM   5259  C  C     . MET A 1 654  ? -29.090 -48.596  -23.958 1.00 91.24  ? 658  MET A C     1 
ATOM   5260  O  O     . MET A 1 654  ? -28.323 -49.551  -24.074 1.00 92.79  ? 658  MET A O     1 
ATOM   5261  C  CB    . MET A 1 654  ? -29.548 -49.144  -21.559 1.00 61.62  ? 658  MET A CB    1 
ATOM   5262  C  CG    . MET A 1 654  ? -29.494 -48.688  -20.124 1.00 70.43  ? 658  MET A CG    1 
ATOM   5263  S  SD    . MET A 1 654  ? -27.848 -48.088  -19.659 1.00 78.67  ? 658  MET A SD    1 
ATOM   5264  C  CE    . MET A 1 654  ? -28.063 -46.339  -19.746 1.00 116.09 ? 658  MET A CE    1 
ATOM   5265  N  N     . LEU A 1 655  ? -29.684 -48.020  -24.998 1.00 90.20  ? 659  LEU A N     1 
ATOM   5266  C  CA    . LEU A 1 655  ? -29.532 -48.543  -26.350 1.00 86.52  ? 659  LEU A CA    1 
ATOM   5267  C  C     . LEU A 1 655  ? -28.076 -48.521  -26.824 1.00 82.05  ? 659  LEU A C     1 
ATOM   5268  O  O     . LEU A 1 655  ? -27.487 -49.560  -27.121 1.00 81.85  ? 659  LEU A O     1 
ATOM   5269  C  CB    . LEU A 1 655  ? -30.401 -47.745  -27.319 1.00 89.12  ? 659  LEU A CB    1 
ATOM   5270  C  CG    . LEU A 1 655  ? -30.773 -48.463  -28.610 1.00 86.01  ? 659  LEU A CG    1 
ATOM   5271  C  CD1   . LEU A 1 655  ? -31.691 -49.635  -28.291 1.00 92.75  ? 659  LEU A CD1   1 
ATOM   5272  C  CD2   . LEU A 1 655  ? -31.422 -47.504  -29.596 1.00 84.98  ? 659  LEU A CD2   1 
ATOM   5273  N  N     . LEU A 1 656  ? -27.504 -47.323  -26.891 1.00 78.96  ? 660  LEU A N     1 
ATOM   5274  C  CA    . LEU A 1 656  ? -26.141 -47.132  -27.382 1.00 83.82  ? 660  LEU A CA    1 
ATOM   5275  C  C     . LEU A 1 656  ? -25.098 -48.009  -26.674 1.00 94.23  ? 660  LEU A C     1 
ATOM   5276  O  O     . LEU A 1 656  ? -24.315 -48.676  -27.355 1.00 89.83  ? 660  LEU A O     1 
ATOM   5277  C  CB    . LEU A 1 656  ? -25.738 -45.655  -27.271 1.00 96.55  ? 660  LEU A CB    1 
ATOM   5278  C  CG    . LEU A 1 656  ? -26.074 -44.700  -28.422 1.00 93.59  ? 660  LEU A CG    1 
ATOM   5279  C  CD1   . LEU A 1 656  ? -27.559 -44.704  -28.755 1.00 101.74 ? 660  LEU A CD1   1 
ATOM   5280  C  CD2   . LEU A 1 656  ? -25.611 -43.289  -28.069 1.00 87.45  ? 660  LEU A CD2   1 
ATOM   5281  N  N     . PRO A 1 657  ? -25.076 -48.021  -25.319 1.00 92.83  ? 661  PRO A N     1 
ATOM   5282  C  CA    . PRO A 1 657  ? -24.071 -48.886  -24.683 1.00 78.86  ? 661  PRO A CA    1 
ATOM   5283  C  C     . PRO A 1 657  ? -24.332 -50.377  -24.922 1.00 75.10  ? 661  PRO A C     1 
ATOM   5284  O  O     . PRO A 1 657  ? -23.382 -51.152  -25.067 1.00 77.89  ? 661  PRO A O     1 
ATOM   5285  C  CB    . PRO A 1 657  ? -24.198 -48.535  -23.198 1.00 72.08  ? 661  PRO A CB    1 
ATOM   5286  C  CG    . PRO A 1 657  ? -25.579 -48.020  -23.053 1.00 76.96  ? 661  PRO A CG    1 
ATOM   5287  C  CD    . PRO A 1 657  ? -25.863 -47.280  -24.312 1.00 82.97  ? 661  PRO A CD    1 
ATOM   5288  N  N     . ASN A 1 658  ? -25.603 -50.765  -24.966 1.00 73.65  ? 662  ASN A N     1 
ATOM   5289  C  CA    . ASN A 1 658  ? -25.964 -52.153  -25.237 1.00 71.92  ? 662  ASN A CA    1 
ATOM   5290  C  C     . ASN A 1 658  ? -25.557 -52.604  -26.634 1.00 80.83  ? 662  ASN A C     1 
ATOM   5291  O  O     . ASN A 1 658  ? -25.313 -53.777  -26.849 1.00 90.84  ? 662  ASN A O     1 
ATOM   5292  C  CB    . ASN A 1 658  ? -27.467 -52.375  -25.061 1.00 73.22  ? 662  ASN A CB    1 
ATOM   5293  C  CG    . ASN A 1 658  ? -27.861 -52.600  -23.620 1.00 73.86  ? 662  ASN A CG    1 
ATOM   5294  O  OD1   . ASN A 1 658  ? -27.075 -53.116  -22.824 1.00 81.51  ? 662  ASN A OD1   1 
ATOM   5295  N  ND2   . ASN A 1 658  ? -29.087 -52.217  -23.275 1.00 70.44  ? 662  ASN A ND2   1 
ATOM   5296  N  N     . GLN A 1 659  ? -25.489 -51.683  -27.589 1.00 80.95  ? 663  GLN A N     1 
ATOM   5297  C  CA    . GLN A 1 659  ? -25.047 -52.054  -28.931 1.00 81.14  ? 663  GLN A CA    1 
ATOM   5298  C  C     . GLN A 1 659  ? -23.597 -52.531  -28.901 1.00 82.65  ? 663  GLN A C     1 
ATOM   5299  O  O     . GLN A 1 659  ? -23.268 -53.609  -29.414 1.00 84.35  ? 663  GLN A O     1 
ATOM   5300  C  CB    . GLN A 1 659  ? -25.207 -50.882  -29.903 1.00 82.16  ? 663  GLN A CB    1 
ATOM   5301  C  CG    . GLN A 1 659  ? -26.640 -50.405  -30.044 1.00 95.26  ? 663  GLN A CG    1 
ATOM   5302  C  CD    . GLN A 1 659  ? -26.893 -49.654  -31.332 1.00 103.91 ? 663  GLN A CD    1 
ATOM   5303  O  OE1   . GLN A 1 659  ? -25.973 -49.101  -31.931 1.00 109.35 ? 663  GLN A OE1   1 
ATOM   5304  N  NE2   . GLN A 1 659  ? -28.147 -49.640  -31.772 1.00 111.21 ? 663  GLN A NE2   1 
ATOM   5305  N  N     . VAL A 1 660  ? -22.736 -51.728  -28.283 1.00 78.90  ? 664  VAL A N     1 
ATOM   5306  C  CA    . VAL A 1 660  ? -21.322 -52.058  -28.179 1.00 78.94  ? 664  VAL A CA    1 
ATOM   5307  C  C     . VAL A 1 660  ? -21.137 -53.320  -27.342 1.00 78.78  ? 664  VAL A C     1 
ATOM   5308  O  O     . VAL A 1 660  ? -20.363 -54.210  -27.702 1.00 73.22  ? 664  VAL A O     1 
ATOM   5309  C  CB    . VAL A 1 660  ? -20.519 -50.895  -27.560 1.00 63.93  ? 664  VAL A CB    1 
ATOM   5310  C  CG1   . VAL A 1 660  ? -19.029 -51.104  -27.777 1.00 64.70  ? 664  VAL A CG1   1 
ATOM   5311  C  CG2   . VAL A 1 660  ? -20.961 -49.577  -28.157 1.00 60.02  ? 664  VAL A CG2   1 
ATOM   5312  N  N     . TRP A 1 661  ? -21.858 -53.383  -26.226 1.00 79.41  ? 665  TRP A N     1 
ATOM   5313  C  CA    . TRP A 1 661  ? -21.812 -54.538  -25.338 1.00 75.70  ? 665  TRP A CA    1 
ATOM   5314  C  C     . TRP A 1 661  ? -22.153 -55.813  -26.093 1.00 78.07  ? 665  TRP A C     1 
ATOM   5315  O  O     . TRP A 1 661  ? -21.446 -56.811  -25.996 1.00 74.01  ? 665  TRP A O     1 
ATOM   5316  C  CB    . TRP A 1 661  ? -22.773 -54.347  -24.159 1.00 73.22  ? 665  TRP A CB    1 
ATOM   5317  C  CG    . TRP A 1 661  ? -22.942 -55.575  -23.315 1.00 70.37  ? 665  TRP A CG    1 
ATOM   5318  C  CD1   . TRP A 1 661  ? -23.898 -56.531  -23.451 1.00 75.16  ? 665  TRP A CD1   1 
ATOM   5319  C  CD2   . TRP A 1 661  ? -22.131 -55.972  -22.205 1.00 74.87  ? 665  TRP A CD2   1 
ATOM   5320  N  NE1   . TRP A 1 661  ? -23.735 -57.508  -22.496 1.00 81.43  ? 665  TRP A NE1   1 
ATOM   5321  C  CE2   . TRP A 1 661  ? -22.654 -57.187  -21.718 1.00 78.72  ? 665  TRP A CE2   1 
ATOM   5322  C  CE3   . TRP A 1 661  ? -21.013 -55.419  -21.573 1.00 75.92  ? 665  TRP A CE3   1 
ATOM   5323  C  CZ2   . TRP A 1 661  ? -22.100 -57.861  -20.632 1.00 83.17  ? 665  TRP A CZ2   1 
ATOM   5324  C  CZ3   . TRP A 1 661  ? -20.459 -56.092  -20.491 1.00 83.06  ? 665  TRP A CZ3   1 
ATOM   5325  C  CH2   . TRP A 1 661  ? -21.005 -57.301  -20.035 1.00 84.20  ? 665  TRP A CH2   1 
ATOM   5326  N  N     . ASP A 1 662  ? -23.236 -55.761  -26.859 1.00 80.85  ? 666  ASP A N     1 
ATOM   5327  C  CA    . ASP A 1 662  ? -23.676 -56.895  -27.662 1.00 77.00  ? 666  ASP A CA    1 
ATOM   5328  C  C     . ASP A 1 662  ? -22.631 -57.284  -28.699 1.00 79.06  ? 666  ASP A C     1 
ATOM   5329  O  O     . ASP A 1 662  ? -22.340 -58.468  -28.867 1.00 76.49  ? 666  ASP A O     1 
ATOM   5330  C  CB    . ASP A 1 662  ? -25.006 -56.584  -28.347 1.00 68.14  ? 666  ASP A CB    1 
ATOM   5331  C  CG    . ASP A 1 662  ? -26.170 -56.588  -27.384 1.00 82.94  ? 666  ASP A CG    1 
ATOM   5332  O  OD1   . ASP A 1 662  ? -26.046 -57.199  -26.303 1.00 95.88  ? 666  ASP A OD1   1 
ATOM   5333  O  OD2   . ASP A 1 662  ? -27.209 -55.982  -27.710 1.00 88.66  ? 666  ASP A OD2   1 
ATOM   5334  N  N     . SER A 1 663  ? -22.071 -56.288  -29.384 1.00 70.97  ? 667  SER A N     1 
ATOM   5335  C  CA    . SER A 1 663  ? -21.012 -56.534  -30.358 1.00 73.70  ? 667  SER A CA    1 
ATOM   5336  C  C     . SER A 1 663  ? -19.847 -57.299  -29.739 1.00 78.83  ? 667  SER A C     1 
ATOM   5337  O  O     . SER A 1 663  ? -19.395 -58.319  -30.277 1.00 69.40  ? 667  SER A O     1 
ATOM   5338  C  CB    . SER A 1 663  ? -20.510 -55.218  -30.949 1.00 81.31  ? 667  SER A CB    1 
ATOM   5339  O  OG    . SER A 1 663  ? -19.337 -55.427  -31.718 1.00 84.43  ? 667  SER A OG    1 
ATOM   5340  N  N     . ILE A 1 664  ? -19.376 -56.806  -28.598 1.00 78.54  ? 668  ILE A N     1 
ATOM   5341  C  CA    . ILE A 1 664  ? -18.257 -57.429  -27.893 1.00 79.14  ? 668  ILE A CA    1 
ATOM   5342  C  C     . ILE A 1 664  ? -18.580 -58.846  -27.416 1.00 77.21  ? 668  ILE A C     1 
ATOM   5343  O  O     . ILE A 1 664  ? -17.760 -59.753  -27.544 1.00 73.76  ? 668  ILE A O     1 
ATOM   5344  C  CB    . ILE A 1 664  ? -17.825 -56.578  -26.691 1.00 78.18  ? 668  ILE A CB    1 
ATOM   5345  C  CG1   . ILE A 1 664  ? -17.213 -55.265  -27.173 1.00 69.81  ? 668  ILE A CG1   1 
ATOM   5346  C  CG2   . ILE A 1 664  ? -16.833 -57.333  -25.827 1.00 75.18  ? 668  ILE A CG2   1 
ATOM   5347  C  CD1   . ILE A 1 664  ? -16.717 -54.385  -26.061 1.00 65.80  ? 668  ILE A CD1   1 
ATOM   5348  N  N     . ILE A 1 665  ? -19.783 -59.035  -26.882 1.00 76.25  ? 669  ILE A N     1 
ATOM   5349  C  CA    . ILE A 1 665  ? -20.214 -60.352  -26.412 1.00 73.55  ? 669  ILE A CA    1 
ATOM   5350  C  C     . ILE A 1 665  ? -20.274 -61.335  -27.578 1.00 82.45  ? 669  ILE A C     1 
ATOM   5351  O  O     . ILE A 1 665  ? -19.924 -62.510  -27.436 1.00 83.68  ? 669  ILE A O     1 
ATOM   5352  C  CB    . ILE A 1 665  ? -21.590 -60.282  -25.708 1.00 67.98  ? 669  ILE A CB    1 
ATOM   5353  C  CG1   . ILE A 1 665  ? -21.491 -59.457  -24.419 1.00 68.83  ? 669  ILE A CG1   1 
ATOM   5354  C  CG2   . ILE A 1 665  ? -22.100 -61.651  -25.373 1.00 65.61  ? 669  ILE A CG2   1 
ATOM   5355  C  CD1   . ILE A 1 665  ? -20.511 -60.001  -23.408 1.00 74.37  ? 669  ILE A CD1   1 
ATOM   5356  N  N     . GLN A 1 666  ? -20.707 -60.845  -28.736 1.00 89.63  ? 670  GLN A N     1 
ATOM   5357  C  CA    . GLN A 1 666  ? -20.757 -61.647  -29.960 1.00 85.27  ? 670  GLN A CA    1 
ATOM   5358  C  C     . GLN A 1 666  ? -19.352 -62.065  -30.389 1.00 86.36  ? 670  GLN A C     1 
ATOM   5359  O  O     . GLN A 1 666  ? -19.088 -63.243  -30.673 1.00 84.99  ? 670  GLN A O     1 
ATOM   5360  C  CB    . GLN A 1 666  ? -21.448 -60.857  -31.072 1.00 80.22  ? 670  GLN A CB    1 
ATOM   5361  C  CG    . GLN A 1 666  ? -21.507 -61.547  -32.413 1.00 114.60 ? 670  GLN A CG    1 
ATOM   5362  C  CD    . GLN A 1 666  ? -22.322 -60.763  -33.424 1.00 135.27 ? 670  GLN A CD    1 
ATOM   5363  O  OE1   . GLN A 1 666  ? -23.291 -60.091  -33.067 1.00 144.27 ? 670  GLN A OE1   1 
ATOM   5364  N  NE2   . GLN A 1 666  ? -21.927 -60.835  -34.692 1.00 137.89 ? 670  GLN A NE2   1 
ATOM   5365  N  N     . GLN A 1 667  ? -18.448 -61.090  -30.420 1.00 83.93  ? 671  GLN A N     1 
ATOM   5366  C  CA    . GLN A 1 667  ? -17.050 -61.346  -30.746 1.00 80.31  ? 671  GLN A CA    1 
ATOM   5367  C  C     . GLN A 1 667  ? -16.436 -62.374  -29.811 1.00 79.63  ? 671  GLN A C     1 
ATOM   5368  O  O     . GLN A 1 667  ? -15.641 -63.208  -30.240 1.00 77.18  ? 671  GLN A O     1 
ATOM   5369  C  CB    . GLN A 1 667  ? -16.239 -60.048  -30.691 1.00 72.70  ? 671  GLN A CB    1 
ATOM   5370  C  CG    . GLN A 1 667  ? -16.710 -58.972  -31.639 1.00 77.12  ? 671  GLN A CG    1 
ATOM   5371  C  CD    . GLN A 1 667  ? -15.934 -57.689  -31.476 1.00 91.32  ? 671  GLN A CD    1 
ATOM   5372  O  OE1   . GLN A 1 667  ? -14.801 -57.698  -31.000 1.00 106.83 ? 671  GLN A OE1   1 
ATOM   5373  N  NE2   . GLN A 1 667  ? -16.545 -56.573  -31.856 1.00 95.21  ? 671  GLN A NE2   1 
ATOM   5374  N  N     . ALA A 1 668  ? -16.818 -62.306  -28.536 1.00 85.83  ? 672  ALA A N     1 
ATOM   5375  C  CA    . ALA A 1 668  ? -16.317 -63.223  -27.512 1.00 85.02  ? 672  ALA A CA    1 
ATOM   5376  C  C     . ALA A 1 668  ? -16.891 -64.628  -27.695 1.00 85.48  ? 672  ALA A C     1 
ATOM   5377  O  O     . ALA A 1 668  ? -16.192 -65.627  -27.504 1.00 93.01  ? 672  ALA A O     1 
ATOM   5378  C  CB    . ALA A 1 668  ? -16.640 -62.697  -26.131 1.00 67.34  ? 672  ALA A CB    1 
ATOM   5379  N  N     . THR A 1 669  ? -18.170 -64.693  -28.057 1.00 79.95  ? 673  THR A N     1 
ATOM   5380  C  CA    . THR A 1 669  ? -18.818 -65.953  -28.404 1.00 76.81  ? 673  THR A CA    1 
ATOM   5381  C  C     . THR A 1 669  ? -18.070 -66.634  -29.537 1.00 85.93  ? 673  THR A C     1 
ATOM   5382  O  O     . THR A 1 669  ? -17.815 -67.832  -29.486 1.00 105.19 ? 673  THR A O     1 
ATOM   5383  C  CB    . THR A 1 669  ? -20.290 -65.739  -28.809 1.00 80.63  ? 673  THR A CB    1 
ATOM   5384  O  OG1   . THR A 1 669  ? -21.076 -65.487  -27.635 1.00 88.35  ? 673  THR A OG1   1 
ATOM   5385  C  CG2   . THR A 1 669  ? -20.832 -66.938  -29.536 1.00 78.34  ? 673  THR A CG2   1 
ATOM   5386  N  N     . LYS A 1 670  ? -17.695 -65.861  -30.550 1.00 92.50  ? 674  LYS A N     1 
ATOM   5387  C  CA    . LYS A 1 670  ? -16.921 -66.416  -31.658 1.00 97.07  ? 674  LYS A CA    1 
ATOM   5388  C  C     . LYS A 1 670  ? -15.478 -66.723  -31.260 1.00 87.20  ? 674  LYS A C     1 
ATOM   5389  O  O     . LYS A 1 670  ? -14.895 -67.686  -31.726 1.00 93.44  ? 674  LYS A O     1 
ATOM   5390  C  CB    . LYS A 1 670  ? -16.949 -65.467  -32.859 1.00 99.30  ? 674  LYS A CB    1 
ATOM   5391  C  CG    . LYS A 1 670  ? -18.312 -65.368  -33.522 1.00 111.19 ? 674  LYS A CG    1 
ATOM   5392  C  CD    . LYS A 1 670  ? -18.215 -64.734  -34.895 1.00 128.23 ? 674  LYS A CD    1 
ATOM   5393  C  CE    . LYS A 1 670  ? -19.560 -64.760  -35.607 1.00 139.15 ? 674  LYS A CE    1 
ATOM   5394  N  NZ    . LYS A 1 670  ? -20.610 -64.055  -34.816 1.00 138.69 ? 674  LYS A NZ    1 
ATOM   5395  N  N     . ASN A 1 671  ? -14.904 -65.901  -30.394 1.00 85.38  ? 675  ASN A N     1 
ATOM   5396  C  CA    . ASN A 1 671  ? -13.537 -66.112  -29.922 1.00 93.43  ? 675  ASN A CA    1 
ATOM   5397  C  C     . ASN A 1 671  ? -13.269 -65.404  -28.586 1.00 97.35  ? 675  ASN A C     1 
ATOM   5398  O  O     . ASN A 1 671  ? -13.445 -64.188  -28.471 1.00 103.01 ? 675  ASN A O     1 
ATOM   5399  C  CB    . ASN A 1 671  ? -12.538 -65.631  -30.970 1.00 92.68  ? 675  ASN A CB    1 
ATOM   5400  C  CG    . ASN A 1 671  ? -11.101 -65.904  -30.572 1.00 100.05 ? 675  ASN A CG    1 
ATOM   5401  O  OD1   . ASN A 1 671  ? -10.824 -66.793  -29.771 1.00 101.12 ? 675  ASN A OD1   1 
ATOM   5402  N  ND2   . ASN A 1 671  ? -10.177 -65.136  -31.134 1.00 110.87 ? 675  ASN A ND2   1 
ATOM   5403  N  N     . VAL A 1 672  ? -12.827 -66.162  -27.587 1.00 84.94  ? 676  VAL A N     1 
ATOM   5404  C  CA    . VAL A 1 672  ? -12.638 -65.621  -26.247 1.00 95.29  ? 676  VAL A CA    1 
ATOM   5405  C  C     . VAL A 1 672  ? -11.445 -64.676  -26.136 1.00 109.16 ? 676  VAL A C     1 
ATOM   5406  O  O     . VAL A 1 672  ? -11.401 -63.827  -25.236 1.00 126.84 ? 676  VAL A O     1 
ATOM   5407  C  CB    . VAL A 1 672  ? -12.454 -66.742  -25.216 1.00 101.03 ? 676  VAL A CB    1 
ATOM   5408  C  CG1   . VAL A 1 672  ? -13.619 -67.695  -25.278 1.00 119.95 ? 676  VAL A CG1   1 
ATOM   5409  C  CG2   . VAL A 1 672  ? -11.151 -67.488  -25.469 1.00 105.97 ? 676  VAL A CG2   1 
ATOM   5410  N  N     . ASP A 1 673  ? -10.490 -64.807  -27.050 1.00 100.32 ? 677  ASP A N     1 
ATOM   5411  C  CA    . ASP A 1 673  ? -9.213  -64.120  -26.901 1.00 101.06 ? 677  ASP A CA    1 
ATOM   5412  C  C     . ASP A 1 673  ? -9.282  -62.607  -27.130 1.00 96.14  ? 677  ASP A C     1 
ATOM   5413  O  O     . ASP A 1 673  ? -8.304  -61.900  -26.868 1.00 99.81  ? 677  ASP A O     1 
ATOM   5414  C  CB    . ASP A 1 673  ? -8.182  -64.744  -27.834 1.00 104.16 ? 677  ASP A CB    1 
ATOM   5415  C  CG    . ASP A 1 673  ? -7.759  -66.128  -27.387 1.00 110.57 ? 677  ASP A CG    1 
ATOM   5416  O  OD1   . ASP A 1 673  ? -7.766  -66.385  -26.167 1.00 106.44 ? 677  ASP A OD1   1 
ATOM   5417  O  OD2   . ASP A 1 673  ? -7.420  -66.962  -28.255 1.00 132.76 ? 677  ASP A OD2   1 
ATOM   5418  N  N     . ILE A 1 674  ? -10.425 -62.102  -27.593 1.00 83.63  ? 678  ILE A N     1 
ATOM   5419  C  CA    . ILE A 1 674  ? -10.602 -60.656  -27.667 1.00 88.99  ? 678  ILE A CA    1 
ATOM   5420  C  C     . ILE A 1 674  ? -10.768 -60.069  -26.273 1.00 80.74  ? 678  ILE A C     1 
ATOM   5421  O  O     . ILE A 1 674  ? -10.699 -58.851  -26.095 1.00 76.44  ? 678  ILE A O     1 
ATOM   5422  C  CB    . ILE A 1 674  ? -11.812 -60.243  -28.527 1.00 94.37  ? 678  ILE A CB    1 
ATOM   5423  C  CG1   . ILE A 1 674  ? -13.028 -61.097  -28.180 1.00 96.01  ? 678  ILE A CG1   1 
ATOM   5424  C  CG2   . ILE A 1 674  ? -11.475 -60.319  -30.000 1.00 98.56  ? 678  ILE A CG2   1 
ATOM   5425  C  CD1   . ILE A 1 674  ? -14.192 -60.281  -27.669 1.00 111.77 ? 678  ILE A CD1   1 
ATOM   5426  N  N     . LEU A 1 675  ? -10.982 -60.937  -25.285 1.00 83.88  ? 679  LEU A N     1 
ATOM   5427  C  CA    . LEU A 1 675  ? -10.994 -60.502  -23.895 1.00 86.34  ? 679  LEU A CA    1 
ATOM   5428  C  C     . LEU A 1 675  ? -9.558  -60.343  -23.402 1.00 88.08  ? 679  LEU A C     1 
ATOM   5429  O  O     . LEU A 1 675  ? -9.321  -60.081  -22.216 1.00 96.30  ? 679  LEU A O     1 
ATOM   5430  C  CB    . LEU A 1 675  ? -11.769 -61.486  -23.018 1.00 80.91  ? 679  LEU A CB    1 
ATOM   5431  C  CG    . LEU A 1 675  ? -13.241 -61.668  -23.400 1.00 72.21  ? 679  LEU A CG    1 
ATOM   5432  C  CD1   . LEU A 1 675  ? -13.961 -62.524  -22.376 1.00 70.86  ? 679  LEU A CD1   1 
ATOM   5433  C  CD2   . LEU A 1 675  ? -13.927 -60.335  -23.557 1.00 71.30  ? 679  LEU A CD2   1 
ATOM   5434  N  N     . LYS A 1 676  ? -8.607  -60.515  -24.319 1.00 77.62  ? 680  LYS A N     1 
ATOM   5435  C  CA    . LYS A 1 676  ? -7.214  -60.202  -24.041 1.00 80.26  ? 680  LYS A CA    1 
ATOM   5436  C  C     . LYS A 1 676  ? -6.773  -59.000  -24.860 1.00 84.73  ? 680  LYS A C     1 
ATOM   5437  O  O     . LYS A 1 676  ? -5.625  -58.562  -24.788 1.00 86.18  ? 680  LYS A O     1 
ATOM   5438  C  CB    . LYS A 1 676  ? -6.327  -61.399  -24.332 1.00 77.12  ? 680  LYS A CB    1 
ATOM   5439  C  CG    . LYS A 1 676  ? -6.477  -62.494  -23.317 1.00 80.67  ? 680  LYS A CG    1 
ATOM   5440  C  CD    . LYS A 1 676  ? -5.689  -63.720  -23.703 1.00 97.12  ? 680  LYS A CD    1 
ATOM   5441  C  CE    . LYS A 1 676  ? -5.826  -64.773  -22.631 1.00 108.54 ? 680  LYS A CE    1 
ATOM   5442  N  NZ    . LYS A 1 676  ? -5.490  -66.125  -23.167 1.00 109.02 ? 680  LYS A NZ    1 
ATOM   5443  N  N     . ASP A 1 677  ? -7.702  -58.475  -25.648 1.00 78.73  ? 681  ASP A N     1 
ATOM   5444  C  CA    . ASP A 1 677  ? -7.452  -57.274  -26.423 1.00 85.41  ? 681  ASP A CA    1 
ATOM   5445  C  C     . ASP A 1 677  ? -7.644  -56.049  -25.543 1.00 92.81  ? 681  ASP A C     1 
ATOM   5446  O  O     . ASP A 1 677  ? -8.741  -55.822  -25.034 1.00 98.30  ? 681  ASP A O     1 
ATOM   5447  C  CB    . ASP A 1 677  ? -8.381  -57.209  -27.634 1.00 88.04  ? 681  ASP A CB    1 
ATOM   5448  C  CG    . ASP A 1 677  ? -8.033  -56.076  -28.574 1.00 104.05 ? 681  ASP A CG    1 
ATOM   5449  O  OD1   . ASP A 1 677  ? -6.829  -55.857  -28.821 1.00 115.05 ? 681  ASP A OD1   1 
ATOM   5450  O  OD2   . ASP A 1 677  ? -8.961  -55.402  -29.062 1.00 112.05 ? 681  ASP A OD2   1 
ATOM   5451  N  N     . PRO A 1 678  ? -6.575  -55.257  -25.362 1.00 92.33  ? 682  PRO A N     1 
ATOM   5452  C  CA    . PRO A 1 678  ? -6.561  -54.063  -24.509 1.00 92.58  ? 682  PRO A CA    1 
ATOM   5453  C  C     . PRO A 1 678  ? -7.758  -53.139  -24.730 1.00 97.78  ? 682  PRO A C     1 
ATOM   5454  O  O     . PRO A 1 678  ? -8.488  -52.845  -23.777 1.00 115.99 ? 682  PRO A O     1 
ATOM   5455  C  CB    . PRO A 1 678  ? -5.250  -53.365  -24.905 1.00 82.80  ? 682  PRO A CB    1 
ATOM   5456  C  CG    . PRO A 1 678  ? -4.792  -54.039  -26.156 1.00 94.10  ? 682  PRO A CG    1 
ATOM   5457  C  CD    . PRO A 1 678  ? -5.289  -55.437  -26.046 1.00 93.57  ? 682  PRO A CD    1 
ATOM   5458  N  N     . GLU A 1 679  ? -7.964  -52.709  -25.971 1.00 89.89  ? 683  GLU A N     1 
ATOM   5459  C  CA    . GLU A 1 679  ? -9.018  -51.749  -26.282 1.00 99.68  ? 683  GLU A CA    1 
ATOM   5460  C  C     . GLU A 1 679  ? -10.408 -52.326  -26.035 1.00 95.74  ? 683  GLU A C     1 
ATOM   5461  O  O     . GLU A 1 679  ? -11.341 -51.606  -25.663 1.00 102.46 ? 683  GLU A O     1 
ATOM   5462  C  CB    . GLU A 1 679  ? -8.889  -51.276  -27.731 1.00 102.24 ? 683  GLU A CB    1 
ATOM   5463  C  CG    . GLU A 1 679  ? -7.474  -50.850  -28.105 1.00 112.84 ? 683  GLU A CG    1 
ATOM   5464  C  CD    . GLU A 1 679  ? -6.885  -49.831  -27.137 1.00 122.61 ? 683  GLU A CD    1 
ATOM   5465  O  OE1   . GLU A 1 679  ? -7.591  -48.865  -26.779 1.00 117.48 ? 683  GLU A OE1   1 
ATOM   5466  O  OE2   . GLU A 1 679  ? -5.716  -50.003  -26.731 1.00 130.68 ? 683  GLU A OE2   1 
ATOM   5467  N  N     . THR A 1 680  ? -10.538 -53.632  -26.231 1.00 80.29  ? 684  THR A N     1 
ATOM   5468  C  CA    . THR A 1 680  ? -11.792 -54.322  -25.956 1.00 80.99  ? 684  THR A CA    1 
ATOM   5469  C  C     . THR A 1 680  ? -12.128 -54.271  -24.473 1.00 78.93  ? 684  THR A C     1 
ATOM   5470  O  O     . THR A 1 680  ? -13.244 -53.916  -24.092 1.00 90.73  ? 684  THR A O     1 
ATOM   5471  C  CB    . THR A 1 680  ? -11.740 -55.793  -26.415 1.00 84.31  ? 684  THR A CB    1 
ATOM   5472  O  OG1   . THR A 1 680  ? -11.593 -55.846  -27.841 1.00 95.71  ? 684  THR A OG1   1 
ATOM   5473  C  CG2   . THR A 1 680  ? -13.013 -56.520  -26.013 1.00 73.71  ? 684  THR A CG2   1 
ATOM   5474  N  N     . VAL A 1 681  ? -11.150 -54.620  -23.642 1.00 66.41  ? 685  VAL A N     1 
ATOM   5475  C  CA    . VAL A 1 681  ? -11.321 -54.573  -22.194 1.00 77.04  ? 685  VAL A CA    1 
ATOM   5476  C  C     . VAL A 1 681  ? -11.629 -53.146  -21.733 1.00 76.55  ? 685  VAL A C     1 
ATOM   5477  O  O     . VAL A 1 681  ? -12.473 -52.938  -20.866 1.00 80.05  ? 685  VAL A O     1 
ATOM   5478  C  CB    . VAL A 1 681  ? -10.073 -55.099  -21.457 1.00 70.61  ? 685  VAL A CB    1 
ATOM   5479  C  CG1   . VAL A 1 681  ? -10.348 -55.210  -19.970 1.00 71.48  ? 685  VAL A CG1   1 
ATOM   5480  C  CG2   . VAL A 1 681  ? -9.659  -56.442  -22.018 1.00 64.63  ? 685  VAL A CG2   1 
ATOM   5481  N  N     . LYS A 1 682  ? -10.949 -52.169  -22.326 1.00 73.35  ? 686  LYS A N     1 
ATOM   5482  C  CA    . LYS A 1 682  ? -11.248 -50.765  -22.071 1.00 71.24  ? 686  LYS A CA    1 
ATOM   5483  C  C     . LYS A 1 682  ? -12.721 -50.469  -22.349 1.00 71.37  ? 686  LYS A C     1 
ATOM   5484  O  O     . LYS A 1 682  ? -13.406 -49.860  -21.528 1.00 86.74  ? 686  LYS A O     1 
ATOM   5485  C  CB    . LYS A 1 682  ? -10.362 -49.849  -22.925 1.00 83.12  ? 686  LYS A CB    1 
ATOM   5486  C  CG    . LYS A 1 682  ? -8.876  -49.882  -22.613 1.00 91.28  ? 686  LYS A CG    1 
ATOM   5487  C  CD    . LYS A 1 682  ? -8.131  -48.916  -23.523 1.00 94.42  ? 686  LYS A CD    1 
ATOM   5488  C  CE    . LYS A 1 682  ? -6.622  -49.026  -23.376 1.00 97.15  ? 686  LYS A CE    1 
ATOM   5489  N  NZ    . LYS A 1 682  ? -5.911  -48.198  -24.405 1.00 98.70  ? 686  LYS A NZ    1 
ATOM   5490  N  N     . GLN A 1 683  ? -13.198 -50.892  -23.517 1.00 72.07  ? 687  GLN A N     1 
ATOM   5491  C  CA    . GLN A 1 683  ? -14.590 -50.672  -23.906 1.00 73.90  ? 687  GLN A CA    1 
ATOM   5492  C  C     . GLN A 1 683  ? -15.546 -51.292  -22.893 1.00 72.36  ? 687  GLN A C     1 
ATOM   5493  O  O     . GLN A 1 683  ? -16.542 -50.679  -22.507 1.00 81.00  ? 687  GLN A O     1 
ATOM   5494  C  CB    . GLN A 1 683  ? -14.864 -51.241  -25.306 1.00 71.45  ? 687  GLN A CB    1 
ATOM   5495  C  CG    . GLN A 1 683  ? -14.318 -50.400  -26.436 1.00 83.59  ? 687  GLN A CG    1 
ATOM   5496  C  CD    . GLN A 1 683  ? -14.870 -50.808  -27.798 1.00 89.18  ? 687  GLN A CD    1 
ATOM   5497  O  OE1   . GLN A 1 683  ? -14.828 -51.979  -28.173 1.00 91.78  ? 687  GLN A OE1   1 
ATOM   5498  N  NE2   . GLN A 1 683  ? -15.403 -49.839  -28.536 1.00 78.60  ? 687  GLN A NE2   1 
ATOM   5499  N  N     . LEU A 1 684  ? -15.234 -52.512  -22.469 1.00 66.93  ? 688  LEU A N     1 
ATOM   5500  C  CA    . LEU A 1 684  ? -16.041 -53.207  -21.472 1.00 67.70  ? 688  LEU A CA    1 
ATOM   5501  C  C     . LEU A 1 684  ? -16.120 -52.406  -20.180 1.00 76.74  ? 688  LEU A C     1 
ATOM   5502  O  O     . LEU A 1 684  ? -17.205 -52.170  -19.652 1.00 78.63  ? 688  LEU A O     1 
ATOM   5503  C  CB    . LEU A 1 684  ? -15.470 -54.598  -21.191 1.00 65.00  ? 688  LEU A CB    1 
ATOM   5504  C  CG    . LEU A 1 684  ? -15.768 -55.642  -22.265 1.00 67.49  ? 688  LEU A CG    1 
ATOM   5505  C  CD1   . LEU A 1 684  ? -15.023 -56.932  -21.989 1.00 62.84  ? 688  LEU A CD1   1 
ATOM   5506  C  CD2   . LEU A 1 684  ? -17.260 -55.878  -22.349 1.00 65.42  ? 688  LEU A CD2   1 
ATOM   5507  N  N     . GLY A 1 685  ? -14.958 -51.988  -19.684 1.00 75.61  ? 689  GLY A N     1 
ATOM   5508  C  CA    . GLY A 1 685  ? -14.873 -51.168  -18.489 1.00 64.45  ? 689  GLY A CA    1 
ATOM   5509  C  C     . GLY A 1 685  ? -15.732 -49.917  -18.584 1.00 72.67  ? 689  GLY A C     1 
ATOM   5510  O  O     . GLY A 1 685  ? -16.488 -49.602  -17.647 1.00 62.67  ? 689  GLY A O     1 
ATOM   5511  N  N     . SER A 1 686  ? -15.630 -49.213  -19.714 1.00 71.15  ? 690  SER A N     1 
ATOM   5512  C  CA    . SER A 1 686  ? -16.409 -47.997  -19.932 1.00 63.31  ? 690  SER A CA    1 
ATOM   5513  C  C     . SER A 1 686  ? -17.918 -48.251  -19.905 1.00 64.64  ? 690  SER A C     1 
ATOM   5514  O  O     . SER A 1 686  ? -18.673 -47.551  -19.212 1.00 55.85  ? 690  SER A O     1 
ATOM   5515  C  CB    . SER A 1 686  ? -16.017 -47.362  -21.255 1.00 60.88  ? 690  SER A CB    1 
ATOM   5516  O  OG    . SER A 1 686  ? -16.825 -46.234  -21.529 1.00 82.93  ? 690  SER A OG    1 
ATOM   5517  N  N     . ILE A 1 687  ? -18.349 -49.255  -20.666 1.00 67.68  ? 691  ILE A N     1 
ATOM   5518  C  CA    . ILE A 1 687  ? -19.756 -49.656  -20.711 1.00 68.21  ? 691  ILE A CA    1 
ATOM   5519  C  C     . ILE A 1 687  ? -20.289 -49.997  -19.320 1.00 71.14  ? 691  ILE A C     1 
ATOM   5520  O  O     . ILE A 1 687  ? -21.377 -49.565  -18.929 1.00 86.80  ? 691  ILE A O     1 
ATOM   5521  C  CB    . ILE A 1 687  ? -19.964 -50.871  -21.629 1.00 68.46  ? 691  ILE A CB    1 
ATOM   5522  C  CG1   . ILE A 1 687  ? -19.642 -50.508  -23.075 1.00 84.46  ? 691  ILE A CG1   1 
ATOM   5523  C  CG2   . ILE A 1 687  ? -21.386 -51.387  -21.515 1.00 70.94  ? 691  ILE A CG2   1 
ATOM   5524  C  CD1   . ILE A 1 687  ? -19.678 -51.681  -24.026 1.00 100.04 ? 691  ILE A CD1   1 
ATOM   5525  N  N     . LEU A 1 688  ? -19.508 -50.763  -18.566 1.00 61.38  ? 692  LEU A N     1 
ATOM   5526  C  CA    . LEU A 1 688  ? -19.912 -51.135  -17.221 1.00 63.97  ? 692  LEU A CA    1 
ATOM   5527  C  C     . LEU A 1 688  ? -20.001 -49.909  -16.317 1.00 66.91  ? 692  LEU A C     1 
ATOM   5528  O  O     . LEU A 1 688  ? -20.923 -49.807  -15.519 1.00 75.15  ? 692  LEU A O     1 
ATOM   5529  C  CB    . LEU A 1 688  ? -18.956 -52.183  -16.639 1.00 65.31  ? 692  LEU A CB    1 
ATOM   5530  C  CG    . LEU A 1 688  ? -19.206 -53.614  -17.143 1.00 65.80  ? 692  LEU A CG    1 
ATOM   5531  C  CD1   . LEU A 1 688  ? -18.142 -54.568  -16.652 1.00 65.99  ? 692  LEU A CD1   1 
ATOM   5532  C  CD2   . LEU A 1 688  ? -20.591 -54.087  -16.750 1.00 60.89  ? 692  LEU A CD2   1 
ATOM   5533  N  N     . LYS A 1 689  ? -19.059 -48.975  -16.438 1.00 55.76  ? 693  LYS A N     1 
ATOM   5534  C  CA    . LYS A 1 689  ? -19.141 -47.731  -15.654 1.00 60.39  ? 693  LYS A CA    1 
ATOM   5535  C  C     . LYS A 1 689  ? -20.441 -46.994  -15.949 1.00 65.94  ? 693  LYS A C     1 
ATOM   5536  O  O     . LYS A 1 689  ? -21.102 -46.472  -15.047 1.00 72.57  ? 693  LYS A O     1 
ATOM   5537  C  CB    . LYS A 1 689  ? -17.960 -46.794  -15.932 1.00 54.70  ? 693  LYS A CB    1 
ATOM   5538  C  CG    . LYS A 1 689  ? -16.620 -47.274  -15.409 1.00 67.65  ? 693  LYS A CG    1 
ATOM   5539  C  CD    . LYS A 1 689  ? -15.562 -46.213  -15.585 1.00 75.06  ? 693  LYS A CD    1 
ATOM   5540  C  CE    . LYS A 1 689  ? -14.169 -46.772  -15.398 1.00 89.99  ? 693  LYS A CE    1 
ATOM   5541  N  NZ    . LYS A 1 689  ? -14.012 -47.427  -14.076 1.00 105.95 ? 693  LYS A NZ    1 
ATOM   5542  N  N     . THR A 1 690  ? -20.810 -46.964  -17.224 1.00 74.94  ? 694  THR A N     1 
ATOM   5543  C  CA    . THR A 1 690  ? -22.071 -46.357  -17.624 1.00 63.77  ? 694  THR A CA    1 
ATOM   5544  C  C     . THR A 1 690  ? -23.241 -47.063  -16.946 1.00 75.29  ? 694  THR A C     1 
ATOM   5545  O  O     . THR A 1 690  ? -24.152 -46.400  -16.412 1.00 73.87  ? 694  THR A O     1 
ATOM   5546  C  CB    . THR A 1 690  ? -22.261 -46.402  -19.134 1.00 56.36  ? 694  THR A CB    1 
ATOM   5547  O  OG1   . THR A 1 690  ? -21.125 -45.799  -19.759 1.00 75.50  ? 694  THR A OG1   1 
ATOM   5548  C  CG2   . THR A 1 690  ? -23.527 -45.651  -19.529 1.00 53.96  ? 694  THR A CG2   1 
ATOM   5549  N  N     . ASN A 1 691  ? -23.210 -48.397  -16.954 1.00 77.90  ? 695  ASN A N     1 
ATOM   5550  C  CA    . ASN A 1 691  ? -24.273 -49.180  -16.324 1.00 78.59  ? 695  ASN A CA    1 
ATOM   5551  C  C     . ASN A 1 691  ? -24.388 -48.913  -14.819 1.00 80.13  ? 695  ASN A C     1 
ATOM   5552  O  O     . ASN A 1 691  ? -25.487 -48.782  -14.289 1.00 76.66  ? 695  ASN A O     1 
ATOM   5553  C  CB    . ASN A 1 691  ? -24.060 -50.668  -16.576 1.00 83.70  ? 695  ASN A CB    1 
ATOM   5554  C  CG    . ASN A 1 691  ? -24.697 -51.134  -17.866 1.00 85.08  ? 695  ASN A CG    1 
ATOM   5555  O  OD1   . ASN A 1 691  ? -25.881 -51.496  -17.900 1.00 74.44  ? 695  ASN A OD1   1 
ATOM   5556  N  ND2   . ASN A 1 691  ? -23.914 -51.129  -18.942 1.00 85.91  ? 695  ASN A ND2   1 
ATOM   5557  N  N     . VAL A 1 692  ? -23.247 -48.828  -14.142 1.00 70.35  ? 696  VAL A N     1 
ATOM   5558  C  CA    . VAL A 1 692  ? -23.210 -48.507  -12.724 1.00 64.34  ? 696  VAL A CA    1 
ATOM   5559  C  C     . VAL A 1 692  ? -23.833 -47.144  -12.431 1.00 70.50  ? 696  VAL A C     1 
ATOM   5560  O  O     . VAL A 1 692  ? -24.739 -47.037  -11.604 1.00 73.75  ? 696  VAL A O     1 
ATOM   5561  C  CB    . VAL A 1 692  ? -21.766 -48.521  -12.184 1.00 66.07  ? 696  VAL A CB    1 
ATOM   5562  C  CG1   . VAL A 1 692  ? -21.742 -48.081  -10.734 1.00 54.79  ? 696  VAL A CG1   1 
ATOM   5563  C  CG2   . VAL A 1 692  ? -21.165 -49.911  -12.334 1.00 78.30  ? 696  VAL A CG2   1 
ATOM   5564  N  N     . ARG A 1 693  ? -23.348 -46.105  -13.109 1.00 76.60  ? 697  ARG A N     1 
ATOM   5565  C  CA    . ARG A 1 693  ? -23.879 -44.748  -12.907 1.00 74.79  ? 697  ARG A CA    1 
ATOM   5566  C  C     . ARG A 1 693  ? -25.402 -44.685  -13.137 1.00 81.55  ? 697  ARG A C     1 
ATOM   5567  O  O     . ARG A 1 693  ? -26.187 -44.164  -12.304 1.00 84.65  ? 697  ARG A O     1 
ATOM   5568  C  CB    . ARG A 1 693  ? -23.161 -43.769  -13.833 1.00 59.66  ? 697  ARG A CB    1 
ATOM   5569  C  CG    . ARG A 1 693  ? -21.682 -43.558  -13.509 1.00 68.84  ? 697  ARG A CG    1 
ATOM   5570  C  CD    . ARG A 1 693  ? -21.513 -42.750  -12.241 1.00 85.14  ? 697  ARG A CD    1 
ATOM   5571  N  NE    . ARG A 1 693  ? -20.237 -42.040  -12.192 1.00 103.33 ? 697  ARG A NE    1 
ATOM   5572  C  CZ    . ARG A 1 693  ? -20.051 -40.791  -12.609 1.00 109.75 ? 697  ARG A CZ    1 
ATOM   5573  N  NH1   . ARG A 1 693  ? -18.853 -40.229  -12.520 1.00 115.82 ? 697  ARG A NH1   1 
ATOM   5574  N  NH2   . ARG A 1 693  ? -21.059 -40.104  -13.114 1.00 108.02 ? 697  ARG A NH2   1 
ATOM   5575  N  N     . ALA A 1 694  ? -25.813 -45.251  -14.268 1.00 81.80  ? 698  ALA A N     1 
ATOM   5576  C  CA    . ALA A 1 694  ? -27.224 -45.352  -14.614 1.00 85.85  ? 698  ALA A CA    1 
ATOM   5577  C  C     . ALA A 1 694  ? -28.014 -46.038  -13.502 1.00 86.31  ? 698  ALA A C     1 
ATOM   5578  O  O     . ALA A 1 694  ? -29.098 -45.592  -13.126 1.00 91.54  ? 698  ALA A O     1 
ATOM   5579  C  CB    . ALA A 1 694  ? -27.393 -46.110  -15.926 1.00 74.92  ? 698  ALA A CB    1 
ATOM   5580  N  N     . CYS A 1 695  ? -27.455 -47.125  -12.977 1.00 75.58  ? 699  CYS A N     1 
ATOM   5581  C  CA    . CYS A 1 695  ? -28.134 -47.915  -11.961 1.00 78.24  ? 699  CYS A CA    1 
ATOM   5582  C  C     . CYS A 1 695  ? -28.291 -47.133  -10.668 1.00 82.96  ? 699  CYS A C     1 
ATOM   5583  O  O     . CYS A 1 695  ? -29.311 -47.253  -9.976  1.00 83.85  ? 699  CYS A O     1 
ATOM   5584  C  CB    . CYS A 1 695  ? -27.378 -49.208  -11.677 1.00 64.10  ? 699  CYS A CB    1 
ATOM   5585  S  SG    . CYS A 1 695  ? -28.198 -50.213  -10.462 1.00 73.65  ? 699  CYS A SG    1 
ATOM   5586  N  N     . LYS A 1 696  ? -27.266 -46.355  -10.333 1.00 83.35  ? 700  LYS A N     1 
ATOM   5587  C  CA    . LYS A 1 696  ? -27.324 -45.494  -9.163  1.00 78.71  ? 700  LYS A CA    1 
ATOM   5588  C  C     . LYS A 1 696  ? -28.502 -44.547  -9.281  1.00 81.97  ? 700  LYS A C     1 
ATOM   5589  O  O     . LYS A 1 696  ? -29.226 -44.323  -8.307  1.00 82.37  ? 700  LYS A O     1 
ATOM   5590  C  CB    . LYS A 1 696  ? -26.038 -44.697  -9.002  1.00 85.74  ? 700  LYS A CB    1 
ATOM   5591  C  CG    . LYS A 1 696  ? -26.102 -43.645  -7.910  1.00 93.31  ? 700  LYS A CG    1 
ATOM   5592  C  CD    . LYS A 1 696  ? -25.109 -42.532  -8.167  1.00 98.38  ? 700  LYS A CD    1 
ATOM   5593  C  CE    . LYS A 1 696  ? -24.101 -42.407  -7.051  1.00 95.73  ? 700  LYS A CE    1 
ATOM   5594  N  NZ    . LYS A 1 696  ? -22.921 -41.619  -7.492  1.00 97.41  ? 700  LYS A NZ    1 
ATOM   5595  N  N     . ALA A 1 697  ? -28.710 -44.002  -10.479 1.00 89.17  ? 701  ALA A N     1 
ATOM   5596  C  CA    . ALA A 1 697  ? -29.813 -43.049  -10.644 1.00 75.63  ? 701  ALA A CA    1 
ATOM   5597  C  C     . ALA A 1 697  ? -31.207 -43.689  -10.723 1.00 69.81  ? 701  ALA A C     1 
ATOM   5598  O  O     . ALA A 1 697  ? -32.133 -43.250  -10.042 1.00 68.16  ? 701  ALA A O     1 
ATOM   5599  C  CB    . ALA A 1 697  ? -29.571 -42.204  -11.862 1.00 77.57  ? 701  ALA A CB    1 
ATOM   5600  N  N     . VAL A 1 698  ? -31.358 -44.716  -11.553 1.00 70.41  ? 702  VAL A N     1 
ATOM   5601  C  CA    . VAL A 1 698  ? -32.664 -45.334  -11.781 1.00 67.16  ? 702  VAL A CA    1 
ATOM   5602  C  C     . VAL A 1 698  ? -33.168 -46.087  -10.554 1.00 67.61  ? 702  VAL A C     1 
ATOM   5603  O  O     . VAL A 1 698  ? -34.335 -45.980  -10.172 1.00 78.84  ? 702  VAL A O     1 
ATOM   5604  C  CB    . VAL A 1 698  ? -32.625 -46.301  -12.990 1.00 72.38  ? 702  VAL A CB    1 
ATOM   5605  C  CG1   . VAL A 1 698  ? -33.866 -47.174  -13.018 1.00 67.06  ? 702  VAL A CG1   1 
ATOM   5606  C  CG2   . VAL A 1 698  ? -32.494 -45.514  -14.295 1.00 77.18  ? 702  VAL A CG2   1 
ATOM   5607  N  N     . GLY A 1 699  ? -32.276 -46.844  -9.930  1.00 73.21  ? 703  GLY A N     1 
ATOM   5608  C  CA    . GLY A 1 699  ? -32.637 -47.631  -8.767  1.00 83.13  ? 703  GLY A CA    1 
ATOM   5609  C  C     . GLY A 1 699  ? -33.104 -49.026  -9.139  1.00 91.23  ? 703  GLY A C     1 
ATOM   5610  O  O     . GLY A 1 699  ? -32.580 -49.634  -10.067 1.00 104.86 ? 703  GLY A O     1 
ATOM   5611  N  N     . HIS A 1 700  ? -34.100 -49.525  -8.417  1.00 85.61  ? 704  HIS A N     1 
ATOM   5612  C  CA    . HIS A 1 700  ? -34.621 -50.867  -8.633  1.00 77.16  ? 704  HIS A CA    1 
ATOM   5613  C  C     . HIS A 1 700  ? -35.078 -51.150  -10.071 1.00 90.54  ? 704  HIS A C     1 
ATOM   5614  O  O     . HIS A 1 700  ? -34.684 -52.179  -10.638 1.00 94.27  ? 704  HIS A O     1 
ATOM   5615  C  CB    . HIS A 1 700  ? -35.782 -51.159  -7.684  1.00 72.20  ? 704  HIS A CB    1 
ATOM   5616  C  CG    . HIS A 1 700  ? -36.327 -52.548  -7.817  1.00 92.53  ? 704  HIS A CG    1 
ATOM   5617  N  ND1   . HIS A 1 700  ? -36.068 -53.537  -6.894  1.00 106.94 ? 704  HIS A ND1   1 
ATOM   5618  C  CD2   . HIS A 1 700  ? -37.108 -53.117  -8.768  1.00 89.78  ? 704  HIS A CD2   1 
ATOM   5619  C  CE1   . HIS A 1 700  ? -36.672 -54.652  -7.263  1.00 100.73 ? 704  HIS A CE1   1 
ATOM   5620  N  NE2   . HIS A 1 700  ? -37.307 -54.426  -8.399  1.00 92.02  ? 704  HIS A NE2   1 
ATOM   5621  N  N     . PRO A 1 701  ? -35.918 -50.272  -10.667 1.00 89.87  ? 705  PRO A N     1 
ATOM   5622  C  CA    . PRO A 1 701  ? -36.428 -50.626  -12.002 1.00 96.45  ? 705  PRO A CA    1 
ATOM   5623  C  C     . PRO A 1 701  ? -35.340 -50.818  -13.070 1.00 84.54  ? 705  PRO A C     1 
ATOM   5624  O  O     . PRO A 1 701  ? -35.668 -51.234  -14.184 1.00 77.93  ? 705  PRO A O     1 
ATOM   5625  C  CB    . PRO A 1 701  ? -37.334 -49.440  -12.363 1.00 98.88  ? 705  PRO A CB    1 
ATOM   5626  C  CG    . PRO A 1 701  ? -36.907 -48.336  -11.457 1.00 101.03 ? 705  PRO A CG    1 
ATOM   5627  C  CD    . PRO A 1 701  ? -36.486 -48.998  -10.194 1.00 88.58  ? 705  PRO A CD    1 
ATOM   5628  N  N     . PHE A 1 702  ? -34.081 -50.547  -12.722 1.00 77.87  ? 706  PHE A N     1 
ATOM   5629  C  CA    . PHE A 1 702  ? -32.949 -50.804  -13.606 1.00 76.29  ? 706  PHE A CA    1 
ATOM   5630  C  C     . PHE A 1 702  ? -32.732 -52.304  -13.832 1.00 79.85  ? 706  PHE A C     1 
ATOM   5631  O  O     . PHE A 1 702  ? -31.941 -52.708  -14.684 1.00 93.32  ? 706  PHE A O     1 
ATOM   5632  C  CB    . PHE A 1 702  ? -31.691 -50.184  -13.024 1.00 74.40  ? 706  PHE A CB    1 
ATOM   5633  C  CG    . PHE A 1 702  ? -30.495 -50.248  -13.935 1.00 75.86  ? 706  PHE A CG    1 
ATOM   5634  C  CD1   . PHE A 1 702  ? -30.350 -49.347  -14.976 1.00 69.14  ? 706  PHE A CD1   1 
ATOM   5635  C  CD2   . PHE A 1 702  ? -29.496 -51.185  -13.721 1.00 74.84  ? 706  PHE A CD2   1 
ATOM   5636  C  CE1   . PHE A 1 702  ? -29.244 -49.387  -15.793 1.00 69.11  ? 706  PHE A CE1   1 
ATOM   5637  C  CE2   . PHE A 1 702  ? -28.386 -51.232  -14.536 1.00 74.93  ? 706  PHE A CE2   1 
ATOM   5638  C  CZ    . PHE A 1 702  ? -28.259 -50.330  -15.572 1.00 74.96  ? 706  PHE A CZ    1 
ATOM   5639  N  N     . VAL A 1 703  ? -33.442 -53.121  -13.061 1.00 74.16  ? 707  VAL A N     1 
ATOM   5640  C  CA    . VAL A 1 703  ? -33.312 -54.570  -13.119 1.00 86.84  ? 707  VAL A CA    1 
ATOM   5641  C  C     . VAL A 1 703  ? -33.481 -55.079  -14.553 1.00 84.30  ? 707  VAL A C     1 
ATOM   5642  O  O     . VAL A 1 703  ? -32.735 -55.955  -15.002 1.00 80.38  ? 707  VAL A O     1 
ATOM   5643  C  CB    . VAL A 1 703  ? -34.338 -55.258  -12.179 1.00 78.39  ? 707  VAL A CB    1 
ATOM   5644  C  CG1   . VAL A 1 703  ? -35.746 -54.730  -12.422 1.00 82.31  ? 707  VAL A CG1   1 
ATOM   5645  C  CG2   . VAL A 1 703  ? -34.279 -56.756  -12.320 1.00 79.56  ? 707  VAL A CG2   1 
ATOM   5646  N  N     . ILE A 1 704  ? -34.435 -54.496  -15.276 1.00 82.53  ? 708  ILE A N     1 
ATOM   5647  C  CA    . ILE A 1 704  ? -34.708 -54.870  -16.663 1.00 85.56  ? 708  ILE A CA    1 
ATOM   5648  C  C     . ILE A 1 704  ? -33.438 -54.812  -17.512 1.00 90.12  ? 708  ILE A C     1 
ATOM   5649  O  O     . ILE A 1 704  ? -33.196 -55.693  -18.336 1.00 106.91 ? 708  ILE A O     1 
ATOM   5650  C  CB    . ILE A 1 704  ? -35.799 -53.966  -17.283 1.00 83.32  ? 708  ILE A CB    1 
ATOM   5651  C  CG1   . ILE A 1 704  ? -35.959 -54.254  -18.765 1.00 90.41  ? 708  ILE A CG1   1 
ATOM   5652  C  CG2   . ILE A 1 704  ? -35.476 -52.494  -17.074 1.00 90.45  ? 708  ILE A CG2   1 
ATOM   5653  C  CD1   . ILE A 1 704  ? -36.960 -53.346  -19.442 1.00 108.15 ? 708  ILE A CD1   1 
ATOM   5654  N  N     . GLN A 1 705  ? -32.617 -53.791  -17.288 1.00 80.87  ? 709  GLN A N     1 
ATOM   5655  C  CA    . GLN A 1 705  ? -31.329 -53.701  -17.959 1.00 74.64  ? 709  GLN A CA    1 
ATOM   5656  C  C     . GLN A 1 705  ? -30.349 -54.697  -17.358 1.00 89.15  ? 709  GLN A C     1 
ATOM   5657  O  O     . GLN A 1 705  ? -29.670 -55.426  -18.093 1.00 97.64  ? 709  GLN A O     1 
ATOM   5658  C  CB    . GLN A 1 705  ? -30.754 -52.291  -17.865 1.00 64.35  ? 709  GLN A CB    1 
ATOM   5659  C  CG    . GLN A 1 705  ? -29.284 -52.192  -18.273 1.00 65.68  ? 709  GLN A CG    1 
ATOM   5660  C  CD    . GLN A 1 705  ? -29.050 -52.528  -19.741 1.00 75.63  ? 709  GLN A CD    1 
ATOM   5661  O  OE1   . GLN A 1 705  ? -29.955 -52.421  -20.578 1.00 74.32  ? 709  GLN A OE1   1 
ATOM   5662  N  NE2   . GLN A 1 705  ? -27.828 -52.941  -20.057 1.00 82.66  ? 709  GLN A NE2   1 
ATOM   5663  N  N     . LEU A 1 706  ? -30.283 -54.731  -16.027 1.00 85.97  ? 710  LEU A N     1 
ATOM   5664  C  CA    . LEU A 1 706  ? -29.349 -55.618  -15.340 1.00 81.85  ? 710  LEU A CA    1 
ATOM   5665  C  C     . LEU A 1 706  ? -29.562 -57.056  -15.794 1.00 80.07  ? 710  LEU A C     1 
ATOM   5666  O  O     . LEU A 1 706  ? -28.649 -57.705  -16.304 1.00 88.97  ? 710  LEU A O     1 
ATOM   5667  C  CB    . LEU A 1 706  ? -29.506 -55.506  -13.827 1.00 84.37  ? 710  LEU A CB    1 
ATOM   5668  C  CG    . LEU A 1 706  ? -28.594 -56.411  -13.000 1.00 82.73  ? 710  LEU A CG    1 
ATOM   5669  C  CD1   . LEU A 1 706  ? -27.134 -56.114  -13.300 1.00 79.87  ? 710  LEU A CD1   1 
ATOM   5670  C  CD2   . LEU A 1 706  ? -28.881 -56.254  -11.522 1.00 79.15  ? 710  LEU A CD2   1 
ATOM   5671  N  N     . GLY A 1 707  ? -30.794 -57.524  -15.657 1.00 74.62  ? 711  GLY A N     1 
ATOM   5672  C  CA    . GLY A 1 707  ? -31.157 -58.863  -16.072 1.00 79.85  ? 711  GLY A CA    1 
ATOM   5673  C  C     . GLY A 1 707  ? -30.835 -59.147  -17.522 1.00 84.07  ? 711  GLY A C     1 
ATOM   5674  O  O     . GLY A 1 707  ? -30.575 -60.288  -17.900 1.00 87.05  ? 711  GLY A O     1 
ATOM   5675  N  N     . ARG A 1 708  ? -30.834 -58.100  -18.337 1.00 91.21  ? 712  ARG A N     1 
ATOM   5676  C  CA    . ARG A 1 708  ? -30.550 -58.248  -19.758 1.00 79.96  ? 712  ARG A CA    1 
ATOM   5677  C  C     . ARG A 1 708  ? -29.091 -58.619  -20.018 1.00 85.58  ? 712  ARG A C     1 
ATOM   5678  O  O     . ARG A 1 708  ? -28.800 -59.390  -20.925 1.00 110.77 ? 712  ARG A O     1 
ATOM   5679  C  CB    . ARG A 1 708  ? -30.904 -56.963  -20.507 1.00 78.11  ? 712  ARG A CB    1 
ATOM   5680  C  CG    . ARG A 1 708  ? -30.705 -57.036  -22.012 1.00 74.19  ? 712  ARG A CG    1 
ATOM   5681  C  CD    . ARG A 1 708  ? -30.719 -55.651  -22.629 1.00 80.15  ? 712  ARG A CD    1 
ATOM   5682  N  NE    . ARG A 1 708  ? -30.576 -55.688  -24.078 1.00 81.62  ? 712  ARG A NE    1 
ATOM   5683  C  CZ    . ARG A 1 708  ? -29.441 -55.972  -24.709 1.00 89.42  ? 712  ARG A CZ    1 
ATOM   5684  N  NH1   . ARG A 1 708  ? -28.345 -56.263  -24.018 1.00 95.53  ? 712  ARG A NH1   1 
ATOM   5685  N  NH2   . ARG A 1 708  ? -29.402 -55.982  -26.036 1.00 86.49  ? 712  ARG A NH2   1 
ATOM   5686  N  N     . ILE A 1 709  ? -28.170 -58.082  -19.224 1.00 71.99  ? 713  ILE A N     1 
ATOM   5687  C  CA    . ILE A 1 709  ? -26.752 -58.314  -19.494 1.00 76.50  ? 713  ILE A CA    1 
ATOM   5688  C  C     . ILE A 1 709  ? -26.129 -59.268  -18.488 1.00 79.58  ? 713  ILE A C     1 
ATOM   5689  O  O     . ILE A 1 709  ? -25.068 -59.854  -18.735 1.00 93.10  ? 713  ILE A O     1 
ATOM   5690  C  CB    . ILE A 1 709  ? -25.950 -57.002  -19.486 1.00 69.37  ? 713  ILE A CB    1 
ATOM   5691  C  CG1   . ILE A 1 709  ? -26.084 -56.291  -18.141 1.00 61.42  ? 713  ILE A CG1   1 
ATOM   5692  C  CG2   . ILE A 1 709  ? -26.399 -56.092  -20.624 1.00 71.30  ? 713  ILE A CG2   1 
ATOM   5693  C  CD1   . ILE A 1 709  ? -25.297 -55.003  -18.054 1.00 67.37  ? 713  ILE A CD1   1 
ATOM   5694  N  N     . TYR A 1 710  ? -26.835 -59.435  -17.377 1.00 71.58  ? 714  TYR A N     1 
ATOM   5695  C  CA    . TYR A 1 710  ? -26.348 -60.122  -16.190 1.00 74.14  ? 714  TYR A CA    1 
ATOM   5696  C  C     . TYR A 1 710  ? -25.468 -61.340  -16.460 1.00 72.32  ? 714  TYR A C     1 
ATOM   5697  O  O     . TYR A 1 710  ? -24.265 -61.327  -16.198 1.00 67.95  ? 714  TYR A O     1 
ATOM   5698  C  CB    . TYR A 1 710  ? -27.541 -60.537  -15.330 1.00 83.00  ? 714  TYR A CB    1 
ATOM   5699  C  CG    . TYR A 1 710  ? -27.155 -60.918  -13.926 1.00 79.06  ? 714  TYR A CG    1 
ATOM   5700  C  CD1   . TYR A 1 710  ? -26.520 -60.007  -13.098 1.00 80.51  ? 714  TYR A CD1   1 
ATOM   5701  C  CD2   . TYR A 1 710  ? -27.425 -62.186  -13.428 1.00 74.42  ? 714  TYR A CD2   1 
ATOM   5702  C  CE1   . TYR A 1 710  ? -26.160 -60.344  -11.815 1.00 91.64  ? 714  TYR A CE1   1 
ATOM   5703  C  CE2   . TYR A 1 710  ? -27.065 -62.536  -12.144 1.00 80.07  ? 714  TYR A CE2   1 
ATOM   5704  C  CZ    . TYR A 1 710  ? -26.432 -61.609  -11.340 1.00 84.88  ? 714  TYR A CZ    1 
ATOM   5705  O  OH    . TYR A 1 710  ? -26.072 -61.934  -10.052 1.00 84.06  ? 714  TYR A OH    1 
ATOM   5706  N  N     . LEU A 1 711  ? -26.066 -62.384  -17.011 1.00 70.53  ? 715  LEU A N     1 
ATOM   5707  C  CA    . LEU A 1 711  ? -25.337 -63.626  -17.228 1.00 83.80  ? 715  LEU A CA    1 
ATOM   5708  C  C     . LEU A 1 711  ? -24.137 -63.423  -18.150 1.00 84.06  ? 715  LEU A C     1 
ATOM   5709  O  O     . LEU A 1 711  ? -23.028 -63.880  -17.833 1.00 94.19  ? 715  LEU A O     1 
ATOM   5710  C  CB    . LEU A 1 711  ? -26.279 -64.702  -17.763 1.00 77.58  ? 715  LEU A CB    1 
ATOM   5711  C  CG    . LEU A 1 711  ? -27.204 -65.082  -16.606 1.00 81.63  ? 715  LEU A CG    1 
ATOM   5712  C  CD1   . LEU A 1 711  ? -28.331 -65.967  -17.048 1.00 84.63  ? 715  LEU A CD1   1 
ATOM   5713  C  CD2   . LEU A 1 711  ? -26.399 -65.731  -15.494 1.00 80.64  ? 715  LEU A CD2   1 
ATOM   5714  N  N     . ASP A 1 712  ? -24.340 -62.684  -19.241 1.00 68.54  ? 716  ASP A N     1 
ATOM   5715  C  CA    . ASP A 1 712  ? -23.231 -62.322  -20.114 1.00 68.15  ? 716  ASP A CA    1 
ATOM   5716  C  C     . ASP A 1 712  ? -22.132 -61.672  -19.297 1.00 68.38  ? 716  ASP A C     1 
ATOM   5717  O  O     . ASP A 1 712  ? -20.967 -62.099  -19.347 1.00 68.67  ? 716  ASP A O     1 
ATOM   5718  C  CB    . ASP A 1 712  ? -23.687 -61.375  -21.215 1.00 82.94  ? 716  ASP A CB    1 
ATOM   5719  C  CG    . ASP A 1 712  ? -24.574 -62.053  -22.235 1.00 108.55 ? 716  ASP A CG    1 
ATOM   5720  O  OD1   . ASP A 1 712  ? -24.275 -63.212  -22.623 1.00 108.02 ? 716  ASP A OD1   1 
ATOM   5721  O  OD2   . ASP A 1 712  ? -25.574 -61.424  -22.648 1.00 127.37 ? 716  ASP A OD2   1 
ATOM   5722  N  N     . MET A 1 713  ? -22.529 -60.674  -18.509 1.00 66.97  ? 717  MET A N     1 
ATOM   5723  C  CA    . MET A 1 713  ? -21.595 -59.962  -17.655 1.00 70.94  ? 717  MET A CA    1 
ATOM   5724  C  C     . MET A 1 713  ? -20.846 -60.947  -16.769 1.00 76.78  ? 717  MET A C     1 
ATOM   5725  O  O     . MET A 1 713  ? -19.611 -60.924  -16.705 1.00 76.73  ? 717  MET A O     1 
ATOM   5726  C  CB    . MET A 1 713  ? -22.326 -58.924  -16.810 1.00 72.91  ? 717  MET A CB    1 
ATOM   5727  C  CG    . MET A 1 713  ? -21.440 -58.122  -15.889 1.00 68.92  ? 717  MET A CG    1 
ATOM   5728  S  SD    . MET A 1 713  ? -22.418 -57.020  -14.861 1.00 83.91  ? 717  MET A SD    1 
ATOM   5729  C  CE    . MET A 1 713  ? -23.468 -58.180  -14.018 1.00 66.27  ? 717  MET A CE    1 
ATOM   5730  N  N     . LEU A 1 714  ? -21.585 -61.852  -16.133 1.00 81.97  ? 718  LEU A N     1 
ATOM   5731  C  CA    . LEU A 1 714  ? -20.946 -62.784  -15.225 1.00 83.36  ? 718  LEU A CA    1 
ATOM   5732  C  C     . LEU A 1 714  ? -19.884 -63.548  -15.987 1.00 84.59  ? 718  LEU A C     1 
ATOM   5733  O  O     . LEU A 1 714  ? -18.727 -63.638  -15.544 1.00 83.72  ? 718  LEU A O     1 
ATOM   5734  C  CB    . LEU A 1 714  ? -21.969 -63.723  -14.587 1.00 89.55  ? 718  LEU A CB    1 
ATOM   5735  C  CG    . LEU A 1 714  ? -22.785 -63.049  -13.475 1.00 92.10  ? 718  LEU A CG    1 
ATOM   5736  C  CD1   . LEU A 1 714  ? -23.753 -64.029  -12.863 1.00 94.51  ? 718  LEU A CD1   1 
ATOM   5737  C  CD2   . LEU A 1 714  ? -21.870 -62.447  -12.415 1.00 71.62  ? 718  LEU A CD2   1 
ATOM   5738  N  N     . ASN A 1 715  ? -20.259 -64.012  -17.179 1.00 84.32  ? 719  ASN A N     1 
ATOM   5739  C  CA    . ASN A 1 715  ? -19.329 -64.760  -18.002 1.00 80.46  ? 719  ASN A CA    1 
ATOM   5740  C  C     . ASN A 1 715  ? -18.051 -63.980  -18.252 1.00 77.53  ? 719  ASN A C     1 
ATOM   5741  O  O     . ASN A 1 715  ? -16.960 -64.488  -17.973 1.00 82.95  ? 719  ASN A O     1 
ATOM   5742  C  CB    . ASN A 1 715  ? -19.980 -65.163  -19.318 1.00 73.46  ? 719  ASN A CB    1 
ATOM   5743  C  CG    . ASN A 1 715  ? -20.476 -66.602  -19.302 1.00 92.46  ? 719  ASN A CG    1 
ATOM   5744  O  OD1   . ASN A 1 715  ? -20.308 -67.320  -18.318 1.00 101.26 ? 719  ASN A OD1   1 
ATOM   5745  N  ND2   . ASN A 1 715  ? -21.103 -67.024  -20.391 1.00 105.92 ? 719  ASN A ND2   1 
ATOM   5746  N  N     . VAL A 1 716  ? -18.169 -62.728  -18.686 1.00 71.23  ? 720  VAL A N     1 
ATOM   5747  C  CA    . VAL A 1 716  ? -16.948 -62.011  -19.029 1.00 77.03  ? 720  VAL A CA    1 
ATOM   5748  C  C     . VAL A 1 716  ? -16.110 -61.863  -17.760 1.00 78.61  ? 720  VAL A C     1 
ATOM   5749  O  O     . VAL A 1 716  ? -14.888 -62.081  -17.794 1.00 83.36  ? 720  VAL A O     1 
ATOM   5750  C  CB    . VAL A 1 716  ? -17.204 -60.628  -19.705 1.00 96.00  ? 720  VAL A CB    1 
ATOM   5751  C  CG1   . VAL A 1 716  ? -17.990 -59.700  -18.829 1.00 111.79 ? 720  VAL A CG1   1 
ATOM   5752  C  CG2   . VAL A 1 716  ? -15.880 -59.978  -20.074 1.00 97.85  ? 720  VAL A CG2   1 
ATOM   5753  N  N     . TYR A 1 717  ? -16.783 -61.604  -16.635 1.00 75.92  ? 721  TYR A N     1 
ATOM   5754  C  CA    . TYR A 1 717  ? -16.098 -61.496  -15.357 1.00 83.27  ? 721  TYR A CA    1 
ATOM   5755  C  C     . TYR A 1 717  ? -15.238 -62.730  -15.173 1.00 80.49  ? 721  TYR A C     1 
ATOM   5756  O  O     . TYR A 1 717  ? -13.999 -62.636  -15.071 1.00 78.56  ? 721  TYR A O     1 
ATOM   5757  C  CB    . TYR A 1 717  ? -17.099 -61.344  -14.205 1.00 88.69  ? 721  TYR A CB    1 
ATOM   5758  C  CG    . TYR A 1 717  ? -16.480 -61.364  -12.830 1.00 90.72  ? 721  TYR A CG    1 
ATOM   5759  C  CD1   . TYR A 1 717  ? -16.029 -60.191  -12.232 1.00 103.05 ? 721  TYR A CD1   1 
ATOM   5760  C  CD2   . TYR A 1 717  ? -16.359 -62.552  -12.118 1.00 86.29  ? 721  TYR A CD2   1 
ATOM   5761  C  CE1   . TYR A 1 717  ? -15.463 -60.203  -10.950 1.00 92.29  ? 721  TYR A CE1   1 
ATOM   5762  C  CE2   . TYR A 1 717  ? -15.794 -62.575  -10.845 1.00 82.97  ? 721  TYR A CE2   1 
ATOM   5763  C  CZ    . TYR A 1 717  ? -15.351 -61.398  -10.276 1.00 83.39  ? 721  TYR A CZ    1 
ATOM   5764  O  OH    . TYR A 1 717  ? -14.791 -61.420  -9.037  1.00 94.11  ? 721  TYR A OH    1 
ATOM   5765  N  N     . LYS A 1 718  ? -15.905 -63.882  -15.218 1.00 71.65  ? 722  LYS A N     1 
ATOM   5766  C  CA    . LYS A 1 718  ? -15.244 -65.166  -15.058 1.00 82.99  ? 722  LYS A CA    1 
ATOM   5767  C  C     . LYS A 1 718  ? -13.998 -65.220  -15.927 1.00 86.58  ? 722  LYS A C     1 
ATOM   5768  O  O     . LYS A 1 718  ? -12.883 -65.398  -15.424 1.00 102.81 ? 722  LYS A O     1 
ATOM   5769  C  CB    . LYS A 1 718  ? -16.196 -66.307  -15.410 1.00 82.64  ? 722  LYS A CB    1 
ATOM   5770  C  CG    . LYS A 1 718  ? -15.694 -67.684  -15.020 1.00 95.34  ? 722  LYS A CG    1 
ATOM   5771  C  CD    . LYS A 1 718  ? -16.575 -68.777  -15.623 1.00 117.22 ? 722  LYS A CD    1 
ATOM   5772  C  CE    . LYS A 1 718  ? -17.951 -68.815  -14.972 1.00 118.53 ? 722  LYS A CE    1 
ATOM   5773  N  NZ    . LYS A 1 718  ? -18.033 -69.846  -13.899 1.00 124.63 ? 722  LYS A NZ    1 
ATOM   5774  N  N     . CYS A 1 719  ? -14.186 -64.961  -17.216 1.00 79.66  ? 723  CYS A N     1 
ATOM   5775  C  CA    . CYS A 1 719  ? -13.092 -65.061  -18.165 1.00 84.03  ? 723  CYS A CA    1 
ATOM   5776  C  C     . CYS A 1 719  ? -11.939 -64.203  -17.715 1.00 80.16  ? 723  CYS A C     1 
ATOM   5777  O  O     . CYS A 1 719  ? -10.834 -64.703  -17.485 1.00 82.55  ? 723  CYS A O     1 
ATOM   5778  C  CB    . CYS A 1 719  ? -13.551 -64.657  -19.567 1.00 85.86  ? 723  CYS A CB    1 
ATOM   5779  S  SG    . CYS A 1 719  ? -14.778 -65.773  -20.275 1.00 100.03 ? 723  CYS A SG    1 
ATOM   5780  N  N     . LEU A 1 720  ? -12.226 -62.921  -17.517 1.00 77.36  ? 724  LEU A N     1 
ATOM   5781  C  CA    . LEU A 1 720  ? -11.180 -61.977  -17.163 1.00 84.31  ? 724  LEU A CA    1 
ATOM   5782  C  C     . LEU A 1 720  ? -10.500 -62.423  -15.877 1.00 82.54  ? 724  LEU A C     1 
ATOM   5783  O  O     . LEU A 1 720  ? -9.265  -62.428  -15.795 1.00 92.00  ? 724  LEU A O     1 
ATOM   5784  C  CB    . LEU A 1 720  ? -11.745 -60.562  -17.034 1.00 77.33  ? 724  LEU A CB    1 
ATOM   5785  C  CG    . LEU A 1 720  ? -12.205 -59.991  -18.379 1.00 76.92  ? 724  LEU A CG    1 
ATOM   5786  C  CD1   . LEU A 1 720  ? -12.660 -58.564  -18.234 1.00 71.00  ? 724  LEU A CD1   1 
ATOM   5787  C  CD2   . LEU A 1 720  ? -11.091 -60.093  -19.407 1.00 79.22  ? 724  LEU A CD2   1 
ATOM   5788  N  N     . SER A 1 721  ? -11.305 -62.872  -14.916 1.00 75.45  ? 725  SER A N     1 
ATOM   5789  C  CA    . SER A 1 721  ? -10.758 -63.367  -13.668 1.00 85.90  ? 725  SER A CA    1 
ATOM   5790  C  C     . SER A 1 721  ? -9.714  -64.425  -13.974 1.00 84.84  ? 725  SER A C     1 
ATOM   5791  O  O     . SER A 1 721  ? -8.533  -64.265  -13.648 1.00 97.65  ? 725  SER A O     1 
ATOM   5792  C  CB    . SER A 1 721  ? -11.856 -63.937  -12.772 1.00 88.11  ? 725  SER A CB    1 
ATOM   5793  O  OG    . SER A 1 721  ? -11.310 -64.420  -11.548 1.00 84.74  ? 725  SER A OG    1 
ATOM   5794  N  N     . GLU A 1 722  ? -10.154 -65.467  -14.671 1.00 78.02  ? 726  GLU A N     1 
ATOM   5795  C  CA    . GLU A 1 722  ? -9.277  -66.565  -15.044 1.00 90.63  ? 726  GLU A CA    1 
ATOM   5796  C  C     . GLU A 1 722  ? -8.032  -66.028  -15.727 1.00 92.46  ? 726  GLU A C     1 
ATOM   5797  O  O     . GLU A 1 722  ? -6.908  -66.393  -15.354 1.00 94.83  ? 726  GLU A O     1 
ATOM   5798  C  CB    . GLU A 1 722  ? -10.007 -67.559  -15.947 1.00 101.61 ? 726  GLU A CB    1 
ATOM   5799  C  CG    . GLU A 1 722  ? -10.641 -68.713  -15.183 1.00 117.76 ? 726  GLU A CG    1 
ATOM   5800  C  CD    . GLU A 1 722  ? -12.041 -69.046  -15.652 1.00 130.08 ? 726  GLU A CD    1 
ATOM   5801  O  OE1   . GLU A 1 722  ? -12.275 -69.065  -16.875 1.00 131.81 ? 726  GLU A OE1   1 
ATOM   5802  O  OE2   . GLU A 1 722  ? -12.912 -69.285  -14.792 1.00 146.25 ? 726  GLU A OE2   1 
ATOM   5803  N  N     . ASN A 1 723  ? -8.236  -65.113  -16.676 1.00 91.50  ? 727  ASN A N     1 
ATOM   5804  C  CA    . ASN A 1 723  ? -7.123  -64.520  -17.400 1.00 88.65  ? 727  ASN A CA    1 
ATOM   5805  C  C     . ASN A 1 723  ? -6.117  -63.988  -16.408 1.00 94.79  ? 727  ASN A C     1 
ATOM   5806  O  O     . ASN A 1 723  ? -4.968  -64.457  -16.357 1.00 96.92  ? 727  ASN A O     1 
ATOM   5807  C  CB    . ASN A 1 723  ? -7.600  -63.410  -18.334 1.00 85.00  ? 727  ASN A CB    1 
ATOM   5808  C  CG    . ASN A 1 723  ? -8.129  -63.949  -19.662 1.00 92.46  ? 727  ASN A CG    1 
ATOM   5809  O  OD1   . ASN A 1 723  ? -8.353  -65.154  -19.820 1.00 82.57  ? 727  ASN A OD1   1 
ATOM   5810  N  ND2   . ASN A 1 723  ? -8.324  -63.053  -20.626 1.00 104.73 ? 727  ASN A ND2   1 
ATOM   5811  N  N     . ILE A 1 724  ? -6.592  -63.070  -15.567 1.00 97.87  ? 728  ILE A N     1 
ATOM   5812  C  CA    . ILE A 1 724  ? -5.755  -62.421  -14.569 1.00 85.28  ? 728  ILE A CA    1 
ATOM   5813  C  C     . ILE A 1 724  ? -5.015  -63.465  -13.761 1.00 87.49  ? 728  ILE A C     1 
ATOM   5814  O  O     . ILE A 1 724  ? -3.799  -63.372  -13.581 1.00 97.53  ? 728  ILE A O     1 
ATOM   5815  C  CB    . ILE A 1 724  ? -6.583  -61.528  -13.628 1.00 77.49  ? 728  ILE A CB    1 
ATOM   5816  C  CG1   . ILE A 1 724  ? -7.123  -60.317  -14.388 1.00 68.47  ? 728  ILE A CG1   1 
ATOM   5817  C  CG2   . ILE A 1 724  ? -5.755  -61.090  -12.438 1.00 65.46  ? 728  ILE A CG2   1 
ATOM   5818  C  CD1   . ILE A 1 724  ? -7.896  -59.357  -13.525 1.00 64.02  ? 728  ILE A CD1   1 
ATOM   5819  N  N     . SER A 1 725  ? -5.750  -64.488  -13.330 1.00 82.86  ? 729  SER A N     1 
ATOM   5820  C  CA    . SER A 1 725  ? -5.187  -65.488  -12.440 1.00 80.00  ? 729  SER A CA    1 
ATOM   5821  C  C     . SER A 1 725  ? -3.971  -66.113  -13.104 1.00 102.09 ? 729  SER A C     1 
ATOM   5822  O  O     . SER A 1 725  ? -2.892  -66.175  -12.500 1.00 102.56 ? 729  SER A O     1 
ATOM   5823  C  CB    . SER A 1 725  ? -6.227  -66.550  -12.089 1.00 86.35  ? 729  SER A CB    1 
ATOM   5824  O  OG    . SER A 1 725  ? -5.773  -67.375  -11.039 1.00 96.45  ? 729  SER A OG    1 
ATOM   5825  N  N     . ALA A 1 726  ? -4.128  -66.516  -14.364 1.00 99.46  ? 730  ALA A N     1 
ATOM   5826  C  CA    . ALA A 1 726  ? -3.039  -67.176  -15.062 1.00 99.56  ? 730  ALA A CA    1 
ATOM   5827  C  C     . ALA A 1 726  ? -1.864  -66.226  -15.222 1.00 96.48  ? 730  ALA A C     1 
ATOM   5828  O  O     . ALA A 1 726  ? -0.707  -66.626  -15.068 1.00 97.36  ? 730  ALA A O     1 
ATOM   5829  C  CB    . ALA A 1 726  ? -3.501  -67.691  -16.404 1.00 90.00  ? 730  ALA A CB    1 
ATOM   5830  N  N     . ALA A 1 727  ? -2.170  -64.962  -15.499 1.00 88.96  ? 731  ALA A N     1 
ATOM   5831  C  CA    . ALA A 1 727  ? -1.134  -63.946  -15.648 1.00 97.65  ? 731  ALA A CA    1 
ATOM   5832  C  C     . ALA A 1 727  ? -0.257  -63.885  -14.405 1.00 120.08 ? 731  ALA A C     1 
ATOM   5833  O  O     . ALA A 1 727  ? 0.939   -63.603  -14.499 1.00 122.93 ? 731  ALA A O     1 
ATOM   5834  C  CB    . ALA A 1 727  ? -1.749  -62.589  -15.923 1.00 94.59  ? 731  ALA A CB    1 
ATOM   5835  N  N     . ILE A 1 728  ? -0.852  -64.162  -13.245 1.00 136.00 ? 732  ILE A N     1 
ATOM   5836  C  CA    . ILE A 1 728  ? -0.081  -64.250  -12.015 1.00 133.88 ? 732  ILE A CA    1 
ATOM   5837  C  C     . ILE A 1 728  ? 0.787   -65.497  -12.080 1.00 125.60 ? 732  ILE A C     1 
ATOM   5838  O  O     . ILE A 1 728  ? 2.017   -65.412  -12.007 1.00 129.73 ? 732  ILE A O     1 
ATOM   5839  C  CB    . ILE A 1 728  ? -0.982  -64.300  -10.763 1.00 141.50 ? 732  ILE A CB    1 
ATOM   5840  C  CG1   . ILE A 1 728  ? -1.882  -63.061  -10.690 1.00 134.02 ? 732  ILE A CG1   1 
ATOM   5841  C  CG2   . ILE A 1 728  ? -0.140  -64.419  -9.503  1.00 142.19 ? 732  ILE A CG2   1 
ATOM   5842  C  CD1   . ILE A 1 728  ? -1.138  -61.773  -10.436 1.00 122.96 ? 732  ILE A CD1   1 
ATOM   5843  N  N     . GLN A 1 729  ? 0.132   -66.644  -12.255 1.00 118.94 ? 733  GLN A N     1 
ATOM   5844  C  CA    . GLN A 1 729  ? 0.795   -67.944  -12.312 1.00 122.94 ? 733  GLN A CA    1 
ATOM   5845  C  C     . GLN A 1 729  ? 2.005   -67.951  -13.233 1.00 134.63 ? 733  GLN A C     1 
ATOM   5846  O  O     . GLN A 1 729  ? 3.015   -68.590  -12.940 1.00 134.79 ? 733  GLN A O     1 
ATOM   5847  C  CB    . GLN A 1 729  ? -0.190  -69.019  -12.771 1.00 125.07 ? 733  GLN A CB    1 
ATOM   5848  C  CG    . GLN A 1 729  ? -1.054  -69.594  -11.675 1.00 128.57 ? 733  GLN A CG    1 
ATOM   5849  C  CD    . GLN A 1 729  ? -2.098  -70.556  -12.201 1.00 142.62 ? 733  GLN A CD    1 
ATOM   5850  O  OE1   . GLN A 1 729  ? -2.570  -70.421  -13.329 1.00 155.13 ? 733  GLN A OE1   1 
ATOM   5851  N  NE2   . GLN A 1 729  ? -2.460  -71.542  -11.387 1.00 144.03 ? 733  GLN A NE2   1 
ATOM   5852  N  N     . ALA A 1 730  ? 1.896   -67.231  -14.344 1.00 144.02 ? 734  ALA A N     1 
ATOM   5853  C  CA    . ALA A 1 730  ? 2.966   -67.186  -15.326 1.00 145.88 ? 734  ALA A CA    1 
ATOM   5854  C  C     . ALA A 1 730  ? 4.066   -66.206  -14.929 1.00 144.62 ? 734  ALA A C     1 
ATOM   5855  O  O     . ALA A 1 730  ? 5.249   -66.503  -15.084 1.00 157.23 ? 734  ALA A O     1 
ATOM   5856  C  CB    . ALA A 1 730  ? 2.408   -66.826  -16.692 1.00 155.30 ? 734  ALA A CB    1 
ATOM   5857  N  N     . ASN A 1 731  ? 3.682   -65.041  -14.414 1.00 134.79 ? 735  ASN A N     1 
ATOM   5858  C  CA    . ASN A 1 731  ? 4.659   -63.978  -14.179 1.00 135.88 ? 735  ASN A CA    1 
ATOM   5859  C  C     . ASN A 1 731  ? 4.699   -63.449  -12.747 1.00 134.28 ? 735  ASN A C     1 
ATOM   5860  O  O     . ASN A 1 731  ? 5.226   -62.365  -12.500 1.00 133.80 ? 735  ASN A O     1 
ATOM   5861  C  CB    . ASN A 1 731  ? 4.401   -62.806  -15.131 1.00 142.27 ? 735  ASN A CB    1 
ATOM   5862  C  CG    . ASN A 1 731  ? 4.680   -63.155  -16.585 1.00 150.84 ? 735  ASN A CG    1 
ATOM   5863  O  OD1   . ASN A 1 731  ? 4.235   -64.187  -17.088 1.00 155.88 ? 735  ASN A OD1   1 
ATOM   5864  N  ND2   . ASN A 1 731  ? 5.425   -62.290  -17.267 1.00 149.27 ? 735  ASN A ND2   1 
ATOM   5865  N  N     . GLY A 1 732  ? 4.145   -64.208  -11.807 1.00 134.67 ? 736  GLY A N     1 
ATOM   5866  C  CA    . GLY A 1 732  ? 4.205   -63.837  -10.403 1.00 136.80 ? 736  GLY A CA    1 
ATOM   5867  C  C     . GLY A 1 732  ? 3.410   -62.593  -10.049 1.00 133.95 ? 736  GLY A C     1 
ATOM   5868  O  O     . GLY A 1 732  ? 2.361   -62.322  -10.633 1.00 132.32 ? 736  GLY A O     1 
ATOM   5869  N  N     . GLU A 1 733  ? 3.918   -61.834  -9.085  1.00 143.48 ? 737  GLU A N     1 
ATOM   5870  C  CA    . GLU A 1 733  ? 3.220   -60.658  -8.575  1.00 139.77 ? 737  GLU A CA    1 
ATOM   5871  C  C     . GLU A 1 733  ? 3.350   -59.459  -9.509  1.00 124.62 ? 737  GLU A C     1 
ATOM   5872  O  O     . GLU A 1 733  ? 2.349   -58.830  -9.852  1.00 108.51 ? 737  GLU A O     1 
ATOM   5873  C  CB    . GLU A 1 733  ? 3.751   -60.293  -7.184  1.00 151.32 ? 737  GLU A CB    1 
ATOM   5874  C  CG    . GLU A 1 733  ? 3.083   -59.081  -6.542  1.00 157.79 ? 737  GLU A CG    1 
ATOM   5875  C  CD    . GLU A 1 733  ? 1.773   -59.421  -5.851  1.00 166.87 ? 737  GLU A CD    1 
ATOM   5876  O  OE1   . GLU A 1 733  ? 0.950   -60.152  -6.443  1.00 174.99 ? 737  GLU A OE1   1 
ATOM   5877  O  OE2   . GLU A 1 733  ? 1.569   -58.957  -4.709  1.00 171.43 ? 737  GLU A OE2   1 
ATOM   5878  N  N     . MET A 1 734  ? 4.585   -59.160  -9.911  1.00 134.52 ? 738  MET A N     1 
ATOM   5879  C  CA    . MET A 1 734  ? 4.926   -57.990  -10.730 1.00 139.47 ? 738  MET A CA    1 
ATOM   5880  C  C     . MET A 1 734  ? 3.925   -57.708  -11.852 1.00 136.09 ? 738  MET A C     1 
ATOM   5881  O  O     . MET A 1 734  ? 3.553   -56.558  -12.108 1.00 133.56 ? 738  MET A O     1 
ATOM   5882  C  CB    . MET A 1 734  ? 6.324   -58.177  -11.331 1.00 146.15 ? 738  MET A CB    1 
ATOM   5883  C  CG    . MET A 1 734  ? 6.946   -56.905  -11.883 1.00 149.71 ? 738  MET A CG    1 
ATOM   5884  S  SD    . MET A 1 734  ? 7.555   -55.797  -10.588 1.00 216.30 ? 738  MET A SD    1 
ATOM   5885  C  CE    . MET A 1 734  ? 9.305   -56.188  -10.601 1.00 141.19 ? 738  MET A CE    1 
ATOM   5886  N  N     . VAL A 1 735  ? 3.471   -58.783  -12.491 1.00 135.82 ? 739  VAL A N     1 
ATOM   5887  C  CA    . VAL A 1 735  ? 2.578   -58.723  -13.648 1.00 126.27 ? 739  VAL A CA    1 
ATOM   5888  C  C     . VAL A 1 735  ? 1.302   -57.909  -13.407 1.00 120.33 ? 739  VAL A C     1 
ATOM   5889  O  O     . VAL A 1 735  ? 0.596   -57.559  -14.355 1.00 127.61 ? 739  VAL A O     1 
ATOM   5890  C  CB    . VAL A 1 735  ? 2.175   -60.144  -14.091 1.00 128.72 ? 739  VAL A CB    1 
ATOM   5891  C  CG1   . VAL A 1 735  ? 1.063   -60.682  -13.204 1.00 130.13 ? 739  VAL A CG1   1 
ATOM   5892  C  CG2   . VAL A 1 735  ? 1.758   -60.160  -15.551 1.00 132.59 ? 739  VAL A CG2   1 
ATOM   5893  N  N     . THR A 1 736  ? 1.013   -57.596  -12.149 1.00 116.46 ? 740  THR A N     1 
ATOM   5894  C  CA    . THR A 1 736  ? -0.204  -56.872  -11.820 1.00 109.11 ? 740  THR A CA    1 
ATOM   5895  C  C     . THR A 1 736  ? -0.002  -55.358  -11.896 1.00 112.12 ? 740  THR A C     1 
ATOM   5896  O  O     . THR A 1 736  ? -0.853  -54.593  -11.453 1.00 104.90 ? 740  THR A O     1 
ATOM   5897  C  CB    . THR A 1 736  ? -0.715  -57.256  -10.417 1.00 105.86 ? 740  THR A CB    1 
ATOM   5898  O  OG1   . THR A 1 736  ? -2.036  -56.736  -10.230 1.00 116.01 ? 740  THR A OG1   1 
ATOM   5899  C  CG2   . THR A 1 736  ? 0.206   -56.703  -9.340  1.00 113.30 ? 740  THR A CG2   1 
ATOM   5900  N  N     . LYS A 1 737  ? 1.118   -54.925  -12.474 1.00 132.62 ? 741  LYS A N     1 
ATOM   5901  C  CA    . LYS A 1 737  ? 1.425   -53.493  -12.519 1.00 136.52 ? 741  LYS A CA    1 
ATOM   5902  C  C     . LYS A 1 737  ? 1.252   -52.846  -13.902 1.00 133.16 ? 741  LYS A C     1 
ATOM   5903  O  O     . LYS A 1 737  ? 1.118   -51.624  -14.004 1.00 130.21 ? 741  LYS A O     1 
ATOM   5904  C  CB    . LYS A 1 737  ? 2.852   -53.252  -12.017 1.00 147.55 ? 741  LYS A CB    1 
ATOM   5905  C  CG    . LYS A 1 737  ? 3.054   -53.613  -10.554 1.00 153.76 ? 741  LYS A CG    1 
ATOM   5906  C  CD    . LYS A 1 737  ? 4.452   -53.256  -10.078 1.00 159.64 ? 741  LYS A CD    1 
ATOM   5907  C  CE    . LYS A 1 737  ? 4.709   -51.763  -10.198 1.00 165.64 ? 741  LYS A CE    1 
ATOM   5908  N  NZ    . LYS A 1 737  ? 6.055   -51.389  -9.680  1.00 169.78 ? 741  LYS A NZ    1 
ATOM   5909  N  N     . GLN A 1 738  ? 1.244   -53.657  -14.956 1.00 129.74 ? 742  GLN A N     1 
ATOM   5910  C  CA    . GLN A 1 738  ? 1.145   -53.146  -16.325 1.00 125.35 ? 742  GLN A CA    1 
ATOM   5911  C  C     . GLN A 1 738  ? -0.312  -52.951  -16.783 1.00 108.58 ? 742  GLN A C     1 
ATOM   5912  O  O     . GLN A 1 738  ? -1.206  -53.640  -16.295 1.00 101.00 ? 742  GLN A O     1 
ATOM   5913  C  CB    . GLN A 1 738  ? 1.888   -54.086  -17.276 1.00 136.14 ? 742  GLN A CB    1 
ATOM   5914  C  CG    . GLN A 1 738  ? 3.400   -54.018  -17.134 1.00 147.15 ? 742  GLN A CG    1 
ATOM   5915  C  CD    . GLN A 1 738  ? 4.107   -54.958  -18.079 1.00 157.37 ? 742  GLN A CD    1 
ATOM   5916  O  OE1   . GLN A 1 738  ? 3.516   -55.921  -18.565 1.00 166.82 ? 742  GLN A OE1   1 
ATOM   5917  N  NE2   . GLN A 1 738  ? 5.378   -54.683  -18.352 1.00 163.15 ? 742  GLN A NE2   1 
ATOM   5918  N  N     . PRO A 1 739  ? -0.546  -52.008  -17.723 1.00 96.67  ? 743  PRO A N     1 
ATOM   5919  C  CA    . PRO A 1 739  ? -1.866  -51.557  -18.188 1.00 98.37  ? 743  PRO A CA    1 
ATOM   5920  C  C     . PRO A 1 739  ? -2.971  -52.613  -18.354 1.00 109.23 ? 743  PRO A C     1 
ATOM   5921  O  O     . PRO A 1 739  ? -4.102  -52.352  -17.930 1.00 115.17 ? 743  PRO A O     1 
ATOM   5922  C  CB    . PRO A 1 739  ? -1.536  -50.944  -19.546 1.00 103.28 ? 743  PRO A CB    1 
ATOM   5923  C  CG    . PRO A 1 739  ? -0.203  -50.333  -19.338 1.00 106.36 ? 743  PRO A CG    1 
ATOM   5924  C  CD    . PRO A 1 739  ? 0.529   -51.222  -18.361 1.00 99.17  ? 743  PRO A CD    1 
ATOM   5925  N  N     . LEU A 1 740  ? -2.670  -53.758  -18.964 1.00 108.16 ? 744  LEU A N     1 
ATOM   5926  C  CA    . LEU A 1 740  ? -3.718  -54.703  -19.373 1.00 92.86  ? 744  LEU A CA    1 
ATOM   5927  C  C     . LEU A 1 740  ? -4.462  -55.351  -18.199 1.00 100.17 ? 744  LEU A C     1 
ATOM   5928  O  O     . LEU A 1 740  ? -5.687  -55.207  -18.065 1.00 100.98 ? 744  LEU A O     1 
ATOM   5929  C  CB    . LEU A 1 740  ? -3.127  -55.793  -20.258 1.00 86.04  ? 744  LEU A CB    1 
ATOM   5930  C  CG    . LEU A 1 740  ? -4.162  -56.743  -20.860 1.00 83.37  ? 744  LEU A CG    1 
ATOM   5931  C  CD1   . LEU A 1 740  ? -5.196  -55.967  -21.659 1.00 79.29  ? 744  LEU A CD1   1 
ATOM   5932  C  CD2   . LEU A 1 740  ? -3.500  -57.804  -21.719 1.00 100.92 ? 744  LEU A CD2   1 
ATOM   5933  N  N     . ILE A 1 741  ? -3.718  -56.070  -17.359 1.00 97.30  ? 745  ILE A N     1 
ATOM   5934  C  CA    . ILE A 1 741  ? -4.266  -56.682  -16.149 1.00 93.62  ? 745  ILE A CA    1 
ATOM   5935  C  C     . ILE A 1 741  ? -4.998  -55.643  -15.312 1.00 85.42  ? 745  ILE A C     1 
ATOM   5936  O  O     . ILE A 1 741  ? -6.042  -55.907  -14.717 1.00 85.62  ? 745  ILE A O     1 
ATOM   5937  C  CB    . ILE A 1 741  ? -3.156  -57.334  -15.306 1.00 91.03  ? 745  ILE A CB    1 
ATOM   5938  C  CG1   . ILE A 1 741  ? -2.502  -58.468  -16.098 1.00 88.89  ? 745  ILE A CG1   1 
ATOM   5939  C  CG2   . ILE A 1 741  ? -3.708  -57.855  -13.992 1.00 82.62  ? 745  ILE A CG2   1 
ATOM   5940  C  CD1   . ILE A 1 741  ? -3.477  -59.526  -16.535 1.00 91.77  ? 745  ILE A CD1   1 
ATOM   5941  N  N     . ARG A 1 742  ? -4.432  -54.448  -15.297 1.00 84.62  ? 746  ARG A N     1 
ATOM   5942  C  CA    . ARG A 1 742  ? -5.034  -53.289  -14.664 1.00 100.23 ? 746  ARG A CA    1 
ATOM   5943  C  C     . ARG A 1 742  ? -6.456  -53.014  -15.179 1.00 101.55 ? 746  ARG A C     1 
ATOM   5944  O  O     . ARG A 1 742  ? -7.412  -52.987  -14.389 1.00 104.04 ? 746  ARG A O     1 
ATOM   5945  C  CB    . ARG A 1 742  ? -4.103  -52.096  -14.887 1.00 115.74 ? 746  ARG A CB    1 
ATOM   5946  C  CG    . ARG A 1 742  ? -4.665  -50.731  -14.639 1.00 129.27 ? 746  ARG A CG    1 
ATOM   5947  C  CD    . ARG A 1 742  ? -3.517  -49.742  -14.549 1.00 132.25 ? 746  ARG A CD    1 
ATOM   5948  N  NE    . ARG A 1 742  ? -2.667  -50.015  -13.394 1.00 133.47 ? 746  ARG A NE    1 
ATOM   5949  C  CZ    . ARG A 1 742  ? -1.523  -49.391  -13.141 1.00 134.93 ? 746  ARG A CZ    1 
ATOM   5950  N  NH1   . ARG A 1 742  ? -1.079  -48.456  -13.969 1.00 138.85 ? 746  ARG A NH1   1 
ATOM   5951  N  NH2   . ARG A 1 742  ? -0.819  -49.705  -12.062 1.00 134.06 ? 746  ARG A NH2   1 
ATOM   5952  N  N     . SER A 1 743  ? -6.604  -52.850  -16.495 1.00 100.19 ? 747  SER A N     1 
ATOM   5953  C  CA    . SER A 1 743  ? -7.919  -52.565  -17.088 1.00 93.38  ? 747  SER A CA    1 
ATOM   5954  C  C     . SER A 1 743  ? -8.909  -53.731  -16.921 1.00 89.81  ? 747  SER A C     1 
ATOM   5955  O  O     . SER A 1 743  ? -10.139 -53.532  -16.824 1.00 92.40  ? 747  SER A O     1 
ATOM   5956  C  CB    . SER A 1 743  ? -7.770  -52.201  -18.568 1.00 99.04  ? 747  SER A CB    1 
ATOM   5957  O  OG    . SER A 1 743  ? -7.168  -53.245  -19.304 1.00 109.94 ? 747  SER A OG    1 
ATOM   5958  N  N     . MET A 1 744  ? -8.373  -54.949  -16.865 1.00 89.50  ? 748  MET A N     1 
ATOM   5959  C  CA    . MET A 1 744  ? -9.202  -56.126  -16.597 1.00 85.97  ? 748  MET A CA    1 
ATOM   5960  C  C     . MET A 1 744  ? -9.778  -56.097  -15.189 1.00 84.96  ? 748  MET A C     1 
ATOM   5961  O  O     . MET A 1 744  ? -10.990 -56.276  -14.983 1.00 95.14  ? 748  MET A O     1 
ATOM   5962  C  CB    . MET A 1 744  ? -8.399  -57.408  -16.787 1.00 88.59  ? 748  MET A CB    1 
ATOM   5963  C  CG    . MET A 1 744  ? -7.933  -57.653  -18.222 1.00 93.84  ? 748  MET A CG    1 
ATOM   5964  S  SD    . MET A 1 744  ? -7.341  -59.334  -18.431 1.00 87.70  ? 748  MET A SD    1 
ATOM   5965  C  CE    . MET A 1 744  ? -6.827  -59.315  -20.149 1.00 121.19 ? 748  MET A CE    1 
ATOM   5966  N  N     . ARG A 1 745  ? -8.894  -55.865  -14.222 1.00 86.32  ? 749  ARG A N     1 
ATOM   5967  C  CA    . ARG A 1 745  ? -9.283  -55.765  -12.822 1.00 79.54  ? 749  ARG A CA    1 
ATOM   5968  C  C     . ARG A 1 745  ? -10.323 -54.670  -12.680 1.00 70.52  ? 749  ARG A C     1 
ATOM   5969  O  O     . ARG A 1 745  ? -11.277 -54.808  -11.916 1.00 64.63  ? 749  ARG A O     1 
ATOM   5970  C  CB    . ARG A 1 745  ? -8.064  -55.492  -11.945 1.00 91.21  ? 749  ARG A CB    1 
ATOM   5971  C  CG    . ARG A 1 745  ? -8.318  -55.643  -10.455 1.00 118.86 ? 749  ARG A CG    1 
ATOM   5972  C  CD    . ARG A 1 745  ? -7.063  -55.358  -9.635  1.00 130.81 ? 749  ARG A CD    1 
ATOM   5973  N  NE    . ARG A 1 745  ? -5.991  -56.312  -9.911  1.00 142.93 ? 749  ARG A NE    1 
ATOM   5974  C  CZ    . ARG A 1 745  ? -5.857  -57.485  -9.297  1.00 147.06 ? 749  ARG A CZ    1 
ATOM   5975  N  NH1   . ARG A 1 745  ? -6.732  -57.861  -8.373  1.00 146.99 ? 749  ARG A NH1   1 
ATOM   5976  N  NH2   . ARG A 1 745  ? -4.848  -58.287  -9.608  1.00 149.43 ? 749  ARG A NH2   1 
ATOM   5977  N  N     . THR A 1 746  ? -10.144 -53.598  -13.453 1.00 74.50  ? 750  THR A N     1 
ATOM   5978  C  CA    . THR A 1 746  ? -11.155 -52.542  -13.555 1.00 75.15  ? 750  THR A CA    1 
ATOM   5979  C  C     . THR A 1 746  ? -12.515 -53.113  -13.939 1.00 73.68  ? 750  THR A C     1 
ATOM   5980  O  O     . THR A 1 746  ? -13.519 -52.828  -13.285 1.00 76.62  ? 750  THR A O     1 
ATOM   5981  C  CB    . THR A 1 746  ? -10.769 -51.465  -14.591 1.00 73.32  ? 750  THR A CB    1 
ATOM   5982  O  OG1   . THR A 1 746  ? -9.592  -50.774  -14.161 1.00 83.39  ? 750  THR A OG1   1 
ATOM   5983  C  CG2   . THR A 1 746  ? -11.901 -50.473  -14.784 1.00 67.28  ? 750  THR A CG2   1 
ATOM   5984  N  N     . VAL A 1 747  ? -12.553 -53.924  -14.996 1.00 76.45  ? 751  VAL A N     1 
ATOM   5985  C  CA    . VAL A 1 747  ? -13.826 -54.541  -15.401 1.00 75.00  ? 751  VAL A CA    1 
ATOM   5986  C  C     . VAL A 1 747  ? -14.452 -55.402  -14.289 1.00 73.27  ? 751  VAL A C     1 
ATOM   5987  O  O     . VAL A 1 747  ? -15.662 -55.313  -14.025 1.00 71.06  ? 751  VAL A O     1 
ATOM   5988  C  CB    . VAL A 1 747  ? -13.667 -55.407  -16.662 1.00 68.39  ? 751  VAL A CB    1 
ATOM   5989  C  CG1   . VAL A 1 747  ? -14.931 -56.200  -16.914 1.00 59.32  ? 751  VAL A CG1   1 
ATOM   5990  C  CG2   . VAL A 1 747  ? -13.341 -54.533  -17.850 1.00 78.08  ? 751  VAL A CG2   1 
ATOM   5991  N  N     . LYS A 1 748  ? -13.634 -56.227  -13.638 1.00 71.33  ? 752  LYS A N     1 
ATOM   5992  C  CA    . LYS A 1 748  ? -14.110 -57.018  -12.497 1.00 74.54  ? 752  LYS A CA    1 
ATOM   5993  C  C     . LYS A 1 748  ? -14.762 -56.133  -11.421 1.00 76.65  ? 752  LYS A C     1 
ATOM   5994  O  O     . LYS A 1 748  ? -15.897 -56.377  -10.977 1.00 76.38  ? 752  LYS A O     1 
ATOM   5995  C  CB    . LYS A 1 748  ? -12.959 -57.816  -11.883 1.00 71.21  ? 752  LYS A CB    1 
ATOM   5996  C  CG    . LYS A 1 748  ? -12.514 -59.019  -12.710 1.00 72.85  ? 752  LYS A CG    1 
ATOM   5997  C  CD    . LYS A 1 748  ? -11.237 -59.644  -12.159 1.00 87.76  ? 752  LYS A CD    1 
ATOM   5998  C  CE    . LYS A 1 748  ? -11.413 -60.171  -10.727 1.00 83.46  ? 752  LYS A CE    1 
ATOM   5999  N  NZ    . LYS A 1 748  ? -12.256 -61.394  -10.663 1.00 71.12  ? 752  LYS A NZ    1 
ATOM   6000  N  N     . ARG A 1 749  ? -14.041 -55.086  -11.029 1.00 72.37  ? 753  ARG A N     1 
ATOM   6001  C  CA    . ARG A 1 749  ? -14.503 -54.180  -9.984  1.00 77.56  ? 753  ARG A CA    1 
ATOM   6002  C  C     . ARG A 1 749  ? -15.790 -53.449  -10.343 1.00 80.34  ? 753  ARG A C     1 
ATOM   6003  O  O     . ARG A 1 749  ? -16.660 -53.276  -9.490  1.00 79.76  ? 753  ARG A O     1 
ATOM   6004  C  CB    . ARG A 1 749  ? -13.408 -53.168  -9.644  1.00 71.11  ? 753  ARG A CB    1 
ATOM   6005  C  CG    . ARG A 1 749  ? -12.207 -53.797  -8.974  1.00 72.56  ? 753  ARG A CG    1 
ATOM   6006  C  CD    . ARG A 1 749  ? -11.211 -52.772  -8.504  1.00 89.91  ? 753  ARG A CD    1 
ATOM   6007  N  NE    . ARG A 1 749  ? -10.251 -53.368  -7.579  1.00 117.22 ? 753  ARG A NE    1 
ATOM   6008  C  CZ    . ARG A 1 749  ? -9.409  -52.673  -6.820  1.00 132.24 ? 753  ARG A CZ    1 
ATOM   6009  N  NH1   . ARG A 1 749  ? -9.404  -51.345  -6.879  1.00 132.76 ? 753  ARG A NH1   1 
ATOM   6010  N  NH2   . ARG A 1 749  ? -8.575  -53.304  -5.998  1.00 133.66 ? 753  ARG A NH2   1 
ATOM   6011  N  N     . GLU A 1 750  ? -15.916 -53.016  -11.594 1.00 74.14  ? 754  GLU A N     1 
ATOM   6012  C  CA    . GLU A 1 750  ? -17.142 -52.353  -12.022 1.00 72.78  ? 754  GLU A CA    1 
ATOM   6013  C  C     . GLU A 1 750  ? -18.301 -53.347  -12.060 1.00 74.50  ? 754  GLU A C     1 
ATOM   6014  O  O     . GLU A 1 750  ? -19.450 -52.980  -11.828 1.00 71.82  ? 754  GLU A O     1 
ATOM   6015  C  CB    . GLU A 1 750  ? -16.959 -51.694  -13.389 1.00 74.28  ? 754  GLU A CB    1 
ATOM   6016  C  CG    . GLU A 1 750  ? -15.869 -50.642  -13.433 1.00 87.30  ? 754  GLU A CG    1 
ATOM   6017  C  CD    . GLU A 1 750  ? -16.087 -49.524  -12.427 1.00 99.32  ? 754  GLU A CD    1 
ATOM   6018  O  OE1   . GLU A 1 750  ? -17.215 -48.980  -12.373 1.00 105.99 ? 754  GLU A OE1   1 
ATOM   6019  O  OE2   . GLU A 1 750  ? -15.129 -49.192  -11.686 1.00 93.75  ? 754  GLU A OE2   1 
ATOM   6020  N  N     . THR A 1 751  ? -17.996 -54.608  -12.359 1.00 77.90  ? 755  THR A N     1 
ATOM   6021  C  CA    . THR A 1 751  ? -19.019 -55.649  -12.329 1.00 81.21  ? 755  THR A CA    1 
ATOM   6022  C  C     . THR A 1 751  ? -19.570 -55.786  -10.915 1.00 78.95  ? 755  THR A C     1 
ATOM   6023  O  O     . THR A 1 751  ? -20.791 -55.735  -10.694 1.00 83.37  ? 755  THR A O     1 
ATOM   6024  C  CB    . THR A 1 751  ? -18.472 -57.015  -12.796 1.00 74.12  ? 755  THR A CB    1 
ATOM   6025  O  OG1   . THR A 1 751  ? -17.950 -56.886  -14.118 1.00 78.35  ? 755  THR A OG1   1 
ATOM   6026  C  CG2   . THR A 1 751  ? -19.565 -58.063  -12.783 1.00 62.10  ? 755  THR A CG2   1 
ATOM   6027  N  N     . LEU A 1 752  ? -18.660 -55.961  -9.961  1.00 77.86  ? 756  LEU A N     1 
ATOM   6028  C  CA    . LEU A 1 752  ? -19.043 -56.080  -8.557  1.00 71.97  ? 756  LEU A CA    1 
ATOM   6029  C  C     . LEU A 1 752  ? -19.829 -54.849  -8.079  1.00 76.91  ? 756  LEU A C     1 
ATOM   6030  O  O     . LEU A 1 752  ? -20.889 -54.978  -7.443  1.00 74.88  ? 756  LEU A O     1 
ATOM   6031  C  CB    . LEU A 1 752  ? -17.803 -56.290  -7.697  1.00 62.11  ? 756  LEU A CB    1 
ATOM   6032  C  CG    . LEU A 1 752  ? -17.064 -57.595  -7.975  1.00 67.02  ? 756  LEU A CG    1 
ATOM   6033  C  CD1   . LEU A 1 752  ? -15.817 -57.725  -7.135  1.00 70.50  ? 756  LEU A CD1   1 
ATOM   6034  C  CD2   . LEU A 1 752  ? -17.988 -58.779  -7.768  1.00 60.10  ? 756  LEU A CD2   1 
ATOM   6035  N  N     . LYS A 1 753  ? -19.313 -53.664  -8.403  1.00 54.80  ? 757  LYS A N     1 
ATOM   6036  C  CA    . LYS A 1 753  ? -19.975 -52.415  -8.055  1.00 64.11  ? 757  LYS A CA    1 
ATOM   6037  C  C     . LYS A 1 753  ? -21.385 -52.325  -8.634  1.00 62.64  ? 757  LYS A C     1 
ATOM   6038  O  O     . LYS A 1 753  ? -22.288 -51.824  -7.984  1.00 90.53  ? 757  LYS A O     1 
ATOM   6039  C  CB    . LYS A 1 753  ? -19.143 -51.218  -8.524  1.00 73.90  ? 757  LYS A CB    1 
ATOM   6040  C  CG    . LYS A 1 753  ? -17.905 -50.947  -7.690  1.00 87.31  ? 757  LYS A CG    1 
ATOM   6041  C  CD    . LYS A 1 753  ? -17.010 -49.902  -8.351  1.00 87.20  ? 757  LYS A CD    1 
ATOM   6042  C  CE    . LYS A 1 753  ? -17.755 -48.605  -8.592  1.00 96.16  ? 757  LYS A CE    1 
ATOM   6043  N  NZ    . LYS A 1 753  ? -16.894 -47.587  -9.259  1.00 110.53 ? 757  LYS A NZ    1 
ATOM   6044  N  N     . LEU A 1 754  ? -21.570 -52.787  -9.862  1.00 65.89  ? 758  LEU A N     1 
ATOM   6045  C  CA    . LEU A 1 754  ? -22.887 -52.770  -10.473 1.00 71.04  ? 758  LEU A CA    1 
ATOM   6046  C  C     . LEU A 1 754  ? -23.817 -53.693  -9.700  1.00 72.99  ? 758  LEU A C     1 
ATOM   6047  O  O     . LEU A 1 754  ? -24.931 -53.302  -9.343  1.00 69.14  ? 758  LEU A O     1 
ATOM   6048  C  CB    . LEU A 1 754  ? -22.823 -53.191  -11.946 1.00 69.78  ? 758  LEU A CB    1 
ATOM   6049  C  CG    . LEU A 1 754  ? -24.197 -53.327  -12.618 1.00 70.67  ? 758  LEU A CG    1 
ATOM   6050  C  CD1   . LEU A 1 754  ? -24.934 -51.993  -12.579 1.00 67.35  ? 758  LEU A CD1   1 
ATOM   6051  C  CD2   . LEU A 1 754  ? -24.066 -53.832  -14.043 1.00 82.32  ? 758  LEU A CD2   1 
ATOM   6052  N  N     . ILE A 1 755  ? -23.354 -54.918  -9.455  1.00 75.35  ? 759  ILE A N     1 
ATOM   6053  C  CA    . ILE A 1 755  ? -24.148 -55.914  -8.742  1.00 68.30  ? 759  ILE A CA    1 
ATOM   6054  C  C     . ILE A 1 755  ? -24.612 -55.414  -7.369  1.00 81.80  ? 759  ILE A C     1 
ATOM   6055  O  O     . ILE A 1 755  ? -25.821 -55.293  -7.116  1.00 79.08  ? 759  ILE A O     1 
ATOM   6056  C  CB    . ILE A 1 755  ? -23.364 -57.212  -8.563  1.00 73.57  ? 759  ILE A CB    1 
ATOM   6057  C  CG1   . ILE A 1 755  ? -23.079 -57.840  -9.930  1.00 87.85  ? 759  ILE A CG1   1 
ATOM   6058  C  CG2   . ILE A 1 755  ? -24.134 -58.185  -7.664  1.00 70.50  ? 759  ILE A CG2   1 
ATOM   6059  C  CD1   . ILE A 1 755  ? -22.198 -59.065  -9.877  1.00 96.35  ? 759  ILE A CD1   1 
ATOM   6060  N  N     . SER A 1 756  ? -23.655 -55.113  -6.490  1.00 77.63  ? 760  SER A N     1 
ATOM   6061  C  CA    . SER A 1 756  ? -23.996 -54.648  -5.148  1.00 78.18  ? 760  SER A CA    1 
ATOM   6062  C  C     . SER A 1 756  ? -24.770 -53.331  -5.202  1.00 79.69  ? 760  SER A C     1 
ATOM   6063  O  O     . SER A 1 756  ? -25.647 -53.086  -4.384  1.00 77.95  ? 760  SER A O     1 
ATOM   6064  C  CB    . SER A 1 756  ? -22.739 -54.501  -4.288  1.00 74.41  ? 760  SER A CB    1 
ATOM   6065  O  OG    . SER A 1 756  ? -21.735 -53.755  -4.941  1.00 73.69  ? 760  SER A OG    1 
ATOM   6066  N  N     . GLY A 1 757  ? -24.447 -52.504  -6.190  1.00 81.45  ? 761  GLY A N     1 
ATOM   6067  C  CA    . GLY A 1 757  ? -25.117 -51.238  -6.400  1.00 73.37  ? 761  GLY A CA    1 
ATOM   6068  C  C     . GLY A 1 757  ? -26.603 -51.406  -6.633  1.00 79.74  ? 761  GLY A C     1 
ATOM   6069  O  O     . GLY A 1 757  ? -27.415 -50.723  -6.018  1.00 99.86  ? 761  GLY A O     1 
ATOM   6070  N  N     . TRP A 1 758  ? -26.970 -52.314  -7.530  1.00 75.69  ? 762  TRP A N     1 
ATOM   6071  C  CA    . TRP A 1 758  ? -28.380 -52.574  -7.785  1.00 75.73  ? 762  TRP A CA    1 
ATOM   6072  C  C     . TRP A 1 758  ? -29.040 -53.278  -6.606  1.00 91.80  ? 762  TRP A C     1 
ATOM   6073  O  O     . TRP A 1 758  ? -30.180 -52.963  -6.253  1.00 97.36  ? 762  TRP A O     1 
ATOM   6074  C  CB    . TRP A 1 758  ? -28.577 -53.417  -9.041  1.00 62.05  ? 762  TRP A CB    1 
ATOM   6075  C  CG    . TRP A 1 758  ? -30.009 -53.816  -9.216  1.00 63.72  ? 762  TRP A CG    1 
ATOM   6076  C  CD1   . TRP A 1 758  ? -31.003 -53.067  -9.770  1.00 73.62  ? 762  TRP A CD1   1 
ATOM   6077  C  CD2   . TRP A 1 758  ? -30.613 -55.049  -8.817  1.00 62.92  ? 762  TRP A CD2   1 
ATOM   6078  N  NE1   . TRP A 1 758  ? -32.193 -53.763  -9.754  1.00 70.05  ? 762  TRP A NE1   1 
ATOM   6079  C  CE2   . TRP A 1 758  ? -31.977 -54.983  -9.173  1.00 68.51  ? 762  TRP A CE2   1 
ATOM   6080  C  CE3   . TRP A 1 758  ? -30.133 -56.208  -8.206  1.00 70.36  ? 762  TRP A CE3   1 
ATOM   6081  C  CZ2   . TRP A 1 758  ? -32.862 -56.031  -8.936  1.00 71.93  ? 762  TRP A CZ2   1 
ATOM   6082  C  CZ3   . TRP A 1 758  ? -31.020 -57.256  -7.974  1.00 77.67  ? 762  TRP A CZ3   1 
ATOM   6083  C  CH2   . TRP A 1 758  ? -32.364 -57.156  -8.338  1.00 76.29  ? 762  TRP A CH2   1 
ATOM   6084  N  N     . VAL A 1 759  ? -28.337 -54.243  -6.013  1.00 92.11  ? 763  VAL A N     1 
ATOM   6085  C  CA    . VAL A 1 759  ? -28.906 -55.001  -4.900  1.00 93.49  ? 763  VAL A CA    1 
ATOM   6086  C  C     . VAL A 1 759  ? -29.277 -54.066  -3.747  1.00 86.71  ? 763  VAL A C     1 
ATOM   6087  O  O     . VAL A 1 759  ? -30.348 -54.196  -3.160  1.00 78.43  ? 763  VAL A O     1 
ATOM   6088  C  CB    . VAL A 1 759  ? -27.940 -56.094  -4.398  1.00 85.72  ? 763  VAL A CB    1 
ATOM   6089  C  CG1   . VAL A 1 759  ? -28.458 -56.715  -3.112  1.00 91.67  ? 763  VAL A CG1   1 
ATOM   6090  C  CG2   . VAL A 1 759  ? -27.752 -57.162  -5.461  1.00 69.56  ? 763  VAL A CG2   1 
ATOM   6091  N  N     . SER A 1 760  ? -28.403 -53.105  -3.459  1.00 86.28  ? 764  SER A N     1 
ATOM   6092  C  CA    . SER A 1 760  ? -28.624 -52.128  -2.388  1.00 76.47  ? 764  SER A CA    1 
ATOM   6093  C  C     . SER A 1 760  ? -29.926 -51.352  -2.549  1.00 85.20  ? 764  SER A C     1 
ATOM   6094  O  O     . SER A 1 760  ? -30.562 -51.000  -1.559  1.00 94.32  ? 764  SER A O     1 
ATOM   6095  C  CB    . SER A 1 760  ? -27.464 -51.139  -2.324  1.00 75.04  ? 764  SER A CB    1 
ATOM   6096  O  OG    . SER A 1 760  ? -26.254 -51.796  -2.011  1.00 95.28  ? 764  SER A OG    1 
ATOM   6097  N  N     . ARG A 1 761  ? -30.318 -51.083  -3.792  1.00 81.32  ? 765  ARG A N     1 
ATOM   6098  C  CA    . ARG A 1 761  ? -31.513 -50.288  -4.052  1.00 81.79  ? 765  ARG A CA    1 
ATOM   6099  C  C     . ARG A 1 761  ? -32.656 -51.141  -4.576  1.00 85.85  ? 765  ARG A C     1 
ATOM   6100  O  O     . ARG A 1 761  ? -33.561 -50.636  -5.240  1.00 101.14 ? 765  ARG A O     1 
ATOM   6101  C  CB    . ARG A 1 761  ? -31.193 -49.156  -5.033  1.00 85.15  ? 765  ARG A CB    1 
ATOM   6102  C  CG    . ARG A 1 761  ? -30.196 -48.150  -4.485  1.00 88.19  ? 765  ARG A CG    1 
ATOM   6103  C  CD    . ARG A 1 761  ? -30.053 -46.916  -5.380  1.00 107.82 ? 765  ARG A CD    1 
ATOM   6104  N  NE    . ARG A 1 761  ? -31.347 -46.422  -5.858  1.00 126.13 ? 765  ARG A NE    1 
ATOM   6105  C  CZ    . ARG A 1 761  ? -32.265 -45.826  -5.100  1.00 130.93 ? 765  ARG A CZ    1 
ATOM   6106  N  NH1   . ARG A 1 761  ? -32.055 -45.644  -3.804  1.00 136.04 ? 765  ARG A NH1   1 
ATOM   6107  N  NH2   . ARG A 1 761  ? -33.404 -45.413  -5.641  1.00 136.19 ? 765  ARG A NH2   1 
ATOM   6108  N  N     . SER A 1 762  ? -32.616 -52.433  -4.265  1.00 89.56  ? 766  SER A N     1 
ATOM   6109  C  CA    . SER A 1 762  ? -33.640 -53.366  -4.730  1.00 102.80 ? 766  SER A CA    1 
ATOM   6110  C  C     . SER A 1 762  ? -34.714 -53.598  -3.672  1.00 121.84 ? 766  SER A C     1 
ATOM   6111  O  O     . SER A 1 762  ? -34.418 -54.078  -2.580  1.00 126.82 ? 766  SER A O     1 
ATOM   6112  C  CB    . SER A 1 762  ? -33.003 -54.700  -5.123  1.00 102.20 ? 766  SER A CB    1 
ATOM   6113  O  OG    . SER A 1 762  ? -32.364 -55.305  -4.005  1.00 99.53  ? 766  SER A OG    1 
ATOM   6114  N  N     . ASN A 1 763  ? -35.959 -53.261  -3.995  1.00 141.68 ? 767  ASN A N     1 
ATOM   6115  C  CA    . ASN A 1 763  ? -37.054 -53.415  -3.044  1.00 146.84 ? 767  ASN A CA    1 
ATOM   6116  C  C     . ASN A 1 763  ? -37.842 -54.708  -3.255  1.00 142.04 ? 767  ASN A C     1 
ATOM   6117  O  O     . ASN A 1 763  ? -39.076 -54.693  -3.323  1.00 150.92 ? 767  ASN A O     1 
ATOM   6118  C  CB    . ASN A 1 763  ? -37.994 -52.204  -3.109  1.00 158.67 ? 767  ASN A CB    1 
ATOM   6119  C  CG    . ASN A 1 763  ? -38.627 -52.023  -4.474  1.00 167.92 ? 767  ASN A CG    1 
ATOM   6120  O  OD1   . ASN A 1 763  ? -37.978 -51.576  -5.415  1.00 175.08 ? 767  ASN A OD1   1 
ATOM   6121  N  ND2   . ASN A 1 763  ? -39.908 -52.359  -4.582  1.00 169.90 ? 767  ASN A ND2   1 
ATOM   6122  N  N     . ASP A 1 764  ? -37.121 -55.823  -3.346  1.00 127.91 ? 768  ASP A N     1 
ATOM   6123  C  CA    . ASP A 1 764  ? -37.739 -57.147  -3.428  1.00 116.83 ? 768  ASP A CA    1 
ATOM   6124  C  C     . ASP A 1 764  ? -36.704 -58.242  -3.182  1.00 112.16 ? 768  ASP A C     1 
ATOM   6125  O  O     . ASP A 1 764  ? -36.126 -58.778  -4.128  1.00 105.35 ? 768  ASP A O     1 
ATOM   6126  C  CB    . ASP A 1 764  ? -38.412 -57.359  -4.786  1.00 116.09 ? 768  ASP A CB    1 
ATOM   6127  C  CG    . ASP A 1 764  ? -39.107 -58.701  -4.886  1.00 117.59 ? 768  ASP A CG    1 
ATOM   6128  O  OD1   . ASP A 1 764  ? -39.320 -59.349  -3.840  1.00 123.07 ? 768  ASP A OD1   1 
ATOM   6129  O  OD2   . ASP A 1 764  ? -39.450 -59.103  -6.015  1.00 121.13 ? 768  ASP A OD2   1 
ATOM   6130  N  N     . PRO A 1 765  ? -36.487 -58.595  -1.904  1.00 113.19 ? 769  PRO A N     1 
ATOM   6131  C  CA    . PRO A 1 765  ? -35.463 -59.573  -1.520  1.00 101.58 ? 769  PRO A CA    1 
ATOM   6132  C  C     . PRO A 1 765  ? -35.738 -60.960  -2.090  1.00 97.38  ? 769  PRO A C     1 
ATOM   6133  O  O     . PRO A 1 765  ? -34.788 -61.702  -2.354  1.00 102.35 ? 769  PRO A O     1 
ATOM   6134  C  CB    . PRO A 1 765  ? -35.545 -59.581  0.007   1.00 93.17  ? 769  PRO A CB    1 
ATOM   6135  C  CG    . PRO A 1 765  ? -36.937 -59.147  0.305   1.00 106.10 ? 769  PRO A CG    1 
ATOM   6136  C  CD    . PRO A 1 765  ? -37.269 -58.133  -0.744  1.00 106.21 ? 769  PRO A CD    1 
ATOM   6137  N  N     . GLN A 1 766  ? -37.013 -61.296  -2.273  1.00 99.20  ? 770  GLN A N     1 
ATOM   6138  C  CA    . GLN A 1 766  ? -37.400 -62.601  -2.811  1.00 117.94 ? 770  GLN A CA    1 
ATOM   6139  C  C     . GLN A 1 766  ? -36.789 -62.849  -4.193  1.00 113.39 ? 770  GLN A C     1 
ATOM   6140  O  O     . GLN A 1 766  ? -35.981 -63.773  -4.373  1.00 102.36 ? 770  GLN A O     1 
ATOM   6141  C  CB    . GLN A 1 766  ? -38.921 -62.710  -2.898  1.00 131.99 ? 770  GLN A CB    1 
ATOM   6142  C  CG    . GLN A 1 766  ? -39.426 -64.049  -3.406  1.00 140.21 ? 770  GLN A CG    1 
ATOM   6143  C  CD    . GLN A 1 766  ? -39.572 -65.072  -2.296  1.00 146.60 ? 770  GLN A CD    1 
ATOM   6144  O  OE1   . GLN A 1 766  ? -39.984 -64.743  -1.184  1.00 151.01 ? 770  GLN A OE1   1 
ATOM   6145  N  NE2   . GLN A 1 766  ? -39.233 -66.322  -2.594  1.00 150.78 ? 770  GLN A NE2   1 
ATOM   6146  N  N     . MET A 1 767  ? -37.180 -62.009  -5.153  1.00 110.17 ? 771  MET A N     1 
ATOM   6147  C  CA    . MET A 1 767  ? -36.695 -62.099  -6.528  1.00 104.83 ? 771  MET A CA    1 
ATOM   6148  C  C     . MET A 1 767  ? -35.178 -62.093  -6.606  1.00 108.14 ? 771  MET A C     1 
ATOM   6149  O  O     . MET A 1 767  ? -34.592 -62.869  -7.346  1.00 114.28 ? 771  MET A O     1 
ATOM   6150  C  CB    . MET A 1 767  ? -37.244 -60.952  -7.370  1.00 93.34  ? 771  MET A CB    1 
ATOM   6151  C  CG    . MET A 1 767  ? -36.459 -60.701  -8.644  1.00 86.07  ? 771  MET A CG    1 
ATOM   6152  S  SD    . MET A 1 767  ? -36.708 -59.044  -9.311  1.00 143.72 ? 771  MET A SD    1 
ATOM   6153  C  CE    . MET A 1 767  ? -36.185 -58.057  -7.921  1.00 142.99 ? 771  MET A CE    1 
ATOM   6154  N  N     . VAL A 1 768  ? -34.548 -61.207  -5.843  1.00 100.41 ? 772  VAL A N     1 
ATOM   6155  C  CA    . VAL A 1 768  ? -33.094 -61.130  -5.815  1.00 101.30 ? 772  VAL A CA    1 
ATOM   6156  C  C     . VAL A 1 768  ? -32.512 -62.470  -5.388  1.00 96.91  ? 772  VAL A C     1 
ATOM   6157  O  O     . VAL A 1 768  ? -31.607 -63.008  -6.040  1.00 93.79  ? 772  VAL A O     1 
ATOM   6158  C  CB    . VAL A 1 768  ? -32.604 -60.027  -4.860  1.00 102.85 ? 772  VAL A CB    1 
ATOM   6159  C  CG1   . VAL A 1 768  ? -31.088 -60.017  -4.799  1.00 108.57 ? 772  VAL A CG1   1 
ATOM   6160  C  CG2   . VAL A 1 768  ? -33.130 -58.669  -5.306  1.00 103.79 ? 772  VAL A CG2   1 
ATOM   6161  N  N     . ALA A 1 769  ? -33.071 -63.013  -4.309  1.00 93.05  ? 773  ALA A N     1 
ATOM   6162  C  CA    . ALA A 1 769  ? -32.602 -64.262  -3.728  1.00 84.52  ? 773  ALA A CA    1 
ATOM   6163  C  C     . ALA A 1 769  ? -32.721 -65.427  -4.698  1.00 95.25  ? 773  ALA A C     1 
ATOM   6164  O  O     . ALA A 1 769  ? -31.785 -66.219  -4.832  1.00 103.76 ? 773  ALA A O     1 
ATOM   6165  C  CB    . ALA A 1 769  ? -33.366 -64.564  -2.456  1.00 82.52  ? 773  ALA A CB    1 
ATOM   6166  N  N     . GLU A 1 770  ? -33.864 -65.536  -5.372  1.00 99.62  ? 774  GLU A N     1 
ATOM   6167  C  CA    . GLU A 1 770  ? -34.099 -66.681  -6.249  1.00 110.11 ? 774  GLU A CA    1 
ATOM   6168  C  C     . GLU A 1 770  ? -33.402 -66.545  -7.608  1.00 105.65 ? 774  GLU A C     1 
ATOM   6169  O  O     . GLU A 1 770  ? -32.830 -67.509  -8.118  1.00 109.23 ? 774  GLU A O     1 
ATOM   6170  C  CB    . GLU A 1 770  ? -35.603 -66.900  -6.443  1.00 130.39 ? 774  GLU A CB    1 
ATOM   6171  C  CG    . GLU A 1 770  ? -36.382 -65.654  -6.820  1.00 143.13 ? 774  GLU A CG    1 
ATOM   6172  C  CD    . GLU A 1 770  ? -37.867 -65.917  -7.001  1.00 159.80 ? 774  GLU A CD    1 
ATOM   6173  O  OE1   . GLU A 1 770  ? -38.442 -66.680  -6.194  1.00 165.20 ? 774  GLU A OE1   1 
ATOM   6174  O  OE2   . GLU A 1 770  ? -38.457 -65.362  -7.955  1.00 162.43 ? 774  GLU A OE2   1 
ATOM   6175  N  N     . ASN A 1 771  ? -33.444 -65.350  -8.187  1.00 97.11  ? 775  ASN A N     1 
ATOM   6176  C  CA    . ASN A 1 771  ? -32.883 -65.111  -9.510  1.00 87.60  ? 775  ASN A CA    1 
ATOM   6177  C  C     . ASN A 1 771  ? -31.402 -64.736  -9.512  1.00 88.83  ? 775  ASN A C     1 
ATOM   6178  O  O     . ASN A 1 771  ? -30.578 -65.454  -10.064 1.00 101.97 ? 775  ASN A O     1 
ATOM   6179  C  CB    . ASN A 1 771  ? -33.668 -64.007  -10.221 1.00 104.86 ? 775  ASN A CB    1 
ATOM   6180  C  CG    . ASN A 1 771  ? -35.084 -64.419  -10.564 1.00 118.98 ? 775  ASN A CG    1 
ATOM   6181  O  OD1   . ASN A 1 771  ? -35.736 -65.132  -9.806  1.00 113.59 ? 775  ASN A OD1   1 
ATOM   6182  N  ND2   . ASN A 1 771  ? -35.567 -63.971  -11.719 1.00 131.24 ? 775  ASN A ND2   1 
ATOM   6183  N  N     . PHE A 1 772  ? -31.063 -63.610  -8.891  1.00 87.33  ? 776  PHE A N     1 
ATOM   6184  C  CA    . PHE A 1 772  ? -29.753 -62.998  -9.114  1.00 83.17  ? 776  PHE A CA    1 
ATOM   6185  C  C     . PHE A 1 772  ? -28.630 -63.558  -8.243  1.00 77.01  ? 776  PHE A C     1 
ATOM   6186  O  O     . PHE A 1 772  ? -27.453 -63.359  -8.535  1.00 82.05  ? 776  PHE A O     1 
ATOM   6187  C  CB    . PHE A 1 772  ? -29.838 -61.481  -8.906  1.00 74.81  ? 776  PHE A CB    1 
ATOM   6188  C  CG    . PHE A 1 772  ? -30.631 -60.765  -9.961  1.00 81.52  ? 776  PHE A CG    1 
ATOM   6189  C  CD1   . PHE A 1 772  ? -30.043 -60.407  -11.157 1.00 86.39  ? 776  PHE A CD1   1 
ATOM   6190  C  CD2   . PHE A 1 772  ? -31.962 -60.447  -9.754  1.00 89.95  ? 776  PHE A CD2   1 
ATOM   6191  C  CE1   . PHE A 1 772  ? -30.770 -59.748  -12.139 1.00 94.98  ? 776  PHE A CE1   1 
ATOM   6192  C  CE2   . PHE A 1 772  ? -32.692 -59.787  -10.725 1.00 91.44  ? 776  PHE A CE2   1 
ATOM   6193  C  CZ    . PHE A 1 772  ? -32.093 -59.440  -11.922 1.00 93.37  ? 776  PHE A CZ    1 
ATOM   6194  N  N     . VAL A 1 773  ? -28.981 -64.260  -7.177  1.00 75.83  ? 777  VAL A N     1 
ATOM   6195  C  CA    . VAL A 1 773  ? -27.964 -64.756  -6.255  1.00 82.68  ? 777  VAL A CA    1 
ATOM   6196  C  C     . VAL A 1 773  ? -27.297 -66.070  -6.695  1.00 87.56  ? 777  VAL A C     1 
ATOM   6197  O  O     . VAL A 1 773  ? -26.070 -66.156  -6.676  1.00 89.09  ? 777  VAL A O     1 
ATOM   6198  C  CB    . VAL A 1 773  ? -28.546 -64.924  -4.823  1.00 98.05  ? 777  VAL A CB    1 
ATOM   6199  C  CG1   . VAL A 1 773  ? -27.533 -65.599  -3.910  1.00 99.68  ? 777  VAL A CG1   1 
ATOM   6200  C  CG2   . VAL A 1 773  ? -28.948 -63.564  -4.255  1.00 85.58  ? 777  VAL A CG2   1 
ATOM   6201  N  N     . PRO A 1 774  ? -28.086 -67.089  -7.105  1.00 86.86  ? 778  PRO A N     1 
ATOM   6202  C  CA    . PRO A 1 774  ? -27.450 -68.357  -7.498  1.00 80.49  ? 778  PRO A CA    1 
ATOM   6203  C  C     . PRO A 1 774  ? -26.352 -68.301  -8.578  1.00 80.01  ? 778  PRO A C     1 
ATOM   6204  O  O     . PRO A 1 774  ? -25.384 -69.049  -8.444  1.00 84.07  ? 778  PRO A O     1 
ATOM   6205  C  CB    . PRO A 1 774  ? -28.634 -69.182  -8.003  1.00 77.04  ? 778  PRO A CB    1 
ATOM   6206  C  CG    . PRO A 1 774  ? -29.789 -68.667  -7.248  1.00 77.00  ? 778  PRO A CG    1 
ATOM   6207  C  CD    . PRO A 1 774  ? -29.559 -67.204  -7.142  1.00 88.72  ? 778  PRO A CD    1 
ATOM   6208  N  N     . PRO A 1 775  ? -26.482 -67.453  -9.620  1.00 93.41  ? 779  PRO A N     1 
ATOM   6209  C  CA    . PRO A 1 775  ? -25.385 -67.461  -10.596 1.00 97.24  ? 779  PRO A CA    1 
ATOM   6210  C  C     . PRO A 1 775  ? -24.058 -66.970  -10.021 1.00 103.51 ? 779  PRO A C     1 
ATOM   6211  O  O     . PRO A 1 775  ? -22.995 -67.430  -10.450 1.00 115.87 ? 779  PRO A O     1 
ATOM   6212  C  CB    . PRO A 1 775  ? -25.884 -66.511  -11.687 1.00 87.64  ? 779  PRO A CB    1 
ATOM   6213  C  CG    . PRO A 1 775  ? -27.360 -66.523  -11.556 1.00 90.59  ? 779  PRO A CG    1 
ATOM   6214  C  CD    . PRO A 1 775  ? -27.605 -66.621  -10.088 1.00 96.12  ? 779  PRO A CD    1 
ATOM   6215  N  N     . LEU A 1 776  ? -24.130 -66.059  -9.053  1.00 99.92  ? 780  LEU A N     1 
ATOM   6216  C  CA    . LEU A 1 776  ? -22.940 -65.558  -8.366  1.00 89.75  ? 780  LEU A CA    1 
ATOM   6217  C  C     . LEU A 1 776  ? -22.120 -66.690  -7.761  1.00 89.88  ? 780  LEU A C     1 
ATOM   6218  O  O     . LEU A 1 776  ? -20.889 -66.603  -7.702  1.00 90.39  ? 780  LEU A O     1 
ATOM   6219  C  CB    . LEU A 1 776  ? -23.323 -64.578  -7.263  1.00 80.98  ? 780  LEU A CB    1 
ATOM   6220  C  CG    . LEU A 1 776  ? -23.784 -63.189  -7.663  1.00 90.05  ? 780  LEU A CG    1 
ATOM   6221  C  CD1   . LEU A 1 776  ? -24.110 -62.392  -6.409  1.00 93.30  ? 780  LEU A CD1   1 
ATOM   6222  C  CD2   . LEU A 1 776  ? -22.707 -62.485  -8.474  1.00 95.66  ? 780  LEU A CD2   1 
ATOM   6223  N  N     . LEU A 1 777  ? -22.806 -67.745  -7.321  1.00 80.69  ? 781  LEU A N     1 
ATOM   6224  C  CA    . LEU A 1 777  ? -22.165 -68.816  -6.578  1.00 93.65  ? 781  LEU A CA    1 
ATOM   6225  C  C     . LEU A 1 777  ? -21.027 -69.435  -7.373  1.00 103.37 ? 781  LEU A C     1 
ATOM   6226  O  O     . LEU A 1 777  ? -19.941 -69.635  -6.838  1.00 110.76 ? 781  LEU A O     1 
ATOM   6227  C  CB    . LEU A 1 777  ? -23.185 -69.883  -6.179  1.00 105.68 ? 781  LEU A CB    1 
ATOM   6228  C  CG    . LEU A 1 777  ? -22.650 -71.092  -5.400  1.00 113.85 ? 781  LEU A CG    1 
ATOM   6229  C  CD1   . LEU A 1 777  ? -21.751 -70.654  -4.247  1.00 110.91 ? 781  LEU A CD1   1 
ATOM   6230  C  CD2   . LEU A 1 777  ? -23.794 -71.956  -4.880  1.00 118.41 ? 781  LEU A CD2   1 
ATOM   6231  N  N     . ASP A 1 778  ? -21.260 -69.720  -8.650  1.00 113.53 ? 782  ASP A N     1 
ATOM   6232  C  CA    . ASP A 1 778  ? -20.214 -70.319  -9.472  1.00 116.86 ? 782  ASP A CA    1 
ATOM   6233  C  C     . ASP A 1 778  ? -19.468 -69.266  -10.297 1.00 108.72 ? 782  ASP A C     1 
ATOM   6234  O  O     . ASP A 1 778  ? -18.271 -69.407  -10.556 1.00 98.54  ? 782  ASP A O     1 
ATOM   6235  C  CB    . ASP A 1 778  ? -20.805 -71.392  -10.387 1.00 131.19 ? 782  ASP A CB    1 
ATOM   6236  C  CG    . ASP A 1 778  ? -19.807 -72.490  -10.718 1.00 148.46 ? 782  ASP A CG    1 
ATOM   6237  O  OD1   . ASP A 1 778  ? -18.660 -72.165  -11.092 1.00 155.38 ? 782  ASP A OD1   1 
ATOM   6238  O  OD2   . ASP A 1 778  ? -20.167 -73.681  -10.592 1.00 157.32 ? 782  ASP A OD2   1 
ATOM   6239  N  N     . ALA A 1 779  ? -20.168 -68.207  -10.694 1.00 104.70 ? 783  ALA A N     1 
ATOM   6240  C  CA    . ALA A 1 779  ? -19.564 -67.189  -11.550 1.00 98.73  ? 783  ALA A CA    1 
ATOM   6241  C  C     . ALA A 1 779  ? -18.482 -66.374  -10.834 1.00 105.29 ? 783  ALA A C     1 
ATOM   6242  O  O     . ALA A 1 779  ? -17.439 -66.077  -11.421 1.00 105.44 ? 783  ALA A O     1 
ATOM   6243  C  CB    . ALA A 1 779  ? -20.634 -66.259  -12.099 1.00 98.25  ? 783  ALA A CB    1 
ATOM   6244  N  N     . VAL A 1 780  ? -18.726 -66.012  -9.575  1.00 99.21  ? 784  VAL A N     1 
ATOM   6245  C  CA    . VAL A 1 780  ? -17.836 -65.097  -8.862  1.00 97.26  ? 784  VAL A CA    1 
ATOM   6246  C  C     . VAL A 1 780  ? -17.193 -65.711  -7.609  1.00 98.42  ? 784  VAL A C     1 
ATOM   6247  O  O     . VAL A 1 780  ? -16.000 -65.511  -7.342  1.00 81.06  ? 784  VAL A O     1 
ATOM   6248  C  CB    . VAL A 1 780  ? -18.584 -63.819  -8.445  1.00 90.34  ? 784  VAL A CB    1 
ATOM   6249  C  CG1   . VAL A 1 780  ? -17.638 -62.848  -7.753  1.00 80.49  ? 784  VAL A CG1   1 
ATOM   6250  C  CG2   . VAL A 1 780  ? -19.230 -63.164  -9.648  1.00 91.74  ? 784  VAL A CG2   1 
ATOM   6251  N  N     . LEU A 1 781  ? -17.984 -66.453  -6.841  1.00 101.10 ? 785  LEU A N     1 
ATOM   6252  C  CA    . LEU A 1 781  ? -17.514 -67.011  -5.579  1.00 93.56  ? 785  LEU A CA    1 
ATOM   6253  C  C     . LEU A 1 781  ? -16.607 -68.226  -5.766  1.00 95.96  ? 785  LEU A C     1 
ATOM   6254  O  O     . LEU A 1 781  ? -15.497 -68.264  -5.237  1.00 102.27 ? 785  LEU A O     1 
ATOM   6255  C  CB    . LEU A 1 781  ? -18.704 -67.383  -4.697  1.00 102.69 ? 785  LEU A CB    1 
ATOM   6256  C  CG    . LEU A 1 781  ? -19.556 -66.197  -4.244  1.00 97.86  ? 785  LEU A CG    1 
ATOM   6257  C  CD1   . LEU A 1 781  ? -20.700 -66.668  -3.365  1.00 106.96 ? 785  LEU A CD1   1 
ATOM   6258  C  CD2   . LEU A 1 781  ? -18.700 -65.174  -3.514  1.00 93.22  ? 785  LEU A CD2   1 
ATOM   6259  N  N     . ILE A 1 782  ? -17.075 -69.222  -6.512  1.00 97.04  ? 786  ILE A N     1 
ATOM   6260  C  CA    . ILE A 1 782  ? -16.257 -70.404  -6.770  1.00 98.05  ? 786  ILE A CA    1 
ATOM   6261  C  C     . ILE A 1 782  ? -15.063 -70.000  -7.632  1.00 92.43  ? 786  ILE A C     1 
ATOM   6262  O  O     . ILE A 1 782  ? -14.000 -70.604  -7.555  1.00 93.52  ? 786  ILE A O     1 
ATOM   6263  C  CB    . ILE A 1 782  ? -17.071 -71.535  -7.439  1.00 103.24 ? 786  ILE A CB    1 
ATOM   6264  C  CG1   . ILE A 1 782  ? -18.146 -72.047  -6.481  1.00 119.77 ? 786  ILE A CG1   1 
ATOM   6265  C  CG2   . ILE A 1 782  ? -16.178 -72.700  -7.814  1.00 106.08 ? 786  ILE A CG2   1 
ATOM   6266  C  CD1   . ILE A 1 782  ? -19.074 -73.072  -7.089  1.00 129.24 ? 786  ILE A CD1   1 
ATOM   6267  N  N     . ASP A 1 783  ? -15.241 -68.956  -8.434  1.00 85.32  ? 787  ASP A N     1 
ATOM   6268  C  CA    . ASP A 1 783  ? -14.143 -68.368  -9.185  1.00 83.75  ? 787  ASP A CA    1 
ATOM   6269  C  C     . ASP A 1 783  ? -13.106 -67.771  -8.232  1.00 94.68  ? 787  ASP A C     1 
ATOM   6270  O  O     . ASP A 1 783  ? -11.899 -67.923  -8.449  1.00 106.86 ? 787  ASP A O     1 
ATOM   6271  C  CB    . ASP A 1 783  ? -14.665 -67.301  -10.150 1.00 96.79  ? 787  ASP A CB    1 
ATOM   6272  C  CG    . ASP A 1 783  ? -13.556 -66.464  -10.746 1.00 106.95 ? 787  ASP A CG    1 
ATOM   6273  O  OD1   . ASP A 1 783  ? -12.873 -66.950  -11.671 1.00 121.43 ? 787  ASP A OD1   1 
ATOM   6274  O  OD2   . ASP A 1 783  ? -13.368 -65.320  -10.291 1.00 111.16 ? 787  ASP A OD2   1 
ATOM   6275  N  N     . TYR A 1 784  ? -13.587 -67.090  -7.191  1.00 88.36  ? 788  TYR A N     1 
ATOM   6276  C  CA    . TYR A 1 784  ? -12.736 -66.530  -6.151  1.00 85.39  ? 788  TYR A CA    1 
ATOM   6277  C  C     . TYR A 1 784  ? -11.939 -67.634  -5.456  1.00 88.53  ? 788  TYR A C     1 
ATOM   6278  O  O     . TYR A 1 784  ? -10.734 -67.513  -5.230  1.00 91.28  ? 788  TYR A O     1 
ATOM   6279  C  CB    . TYR A 1 784  ? -13.592 -65.767  -5.138  1.00 83.50  ? 788  TYR A CB    1 
ATOM   6280  C  CG    . TYR A 1 784  ? -12.849 -65.219  -3.933  1.00 81.17  ? 788  TYR A CG    1 
ATOM   6281  C  CD1   . TYR A 1 784  ? -12.318 -63.940  -3.949  1.00 80.06  ? 788  TYR A CD1   1 
ATOM   6282  C  CD2   . TYR A 1 784  ? -12.711 -65.974  -2.768  1.00 87.82  ? 788  TYR A CD2   1 
ATOM   6283  C  CE1   . TYR A 1 784  ? -11.655 -63.430  -2.849  1.00 95.49  ? 788  TYR A CE1   1 
ATOM   6284  C  CE2   . TYR A 1 784  ? -12.047 -65.481  -1.667  1.00 85.27  ? 788  TYR A CE2   1 
ATOM   6285  C  CZ    . TYR A 1 784  ? -11.524 -64.201  -1.706  1.00 90.19  ? 788  TYR A CZ    1 
ATOM   6286  O  OH    . TYR A 1 784  ? -10.858 -63.680  -0.619  1.00 75.36  ? 788  TYR A OH    1 
ATOM   6287  N  N     . GLN A 1 785  ? -12.633 -68.711  -5.115  1.00 86.21  ? 789  GLN A N     1 
ATOM   6288  C  CA    . GLN A 1 785  ? -12.014 -69.877  -4.508  1.00 94.51  ? 789  GLN A CA    1 
ATOM   6289  C  C     . GLN A 1 785  ? -10.970 -70.484  -5.439  1.00 103.43 ? 789  GLN A C     1 
ATOM   6290  O  O     . GLN A 1 785  ? -9.934  -70.988  -4.995  1.00 101.86 ? 789  GLN A O     1 
ATOM   6291  C  CB    . GLN A 1 785  ? -13.086 -70.916  -4.165  1.00 92.45  ? 789  GLN A CB    1 
ATOM   6292  C  CG    . GLN A 1 785  ? -12.578 -72.145  -3.438  1.00 100.31 ? 789  GLN A CG    1 
ATOM   6293  C  CD    . GLN A 1 785  ? -13.694 -73.121  -3.127  1.00 126.64 ? 789  GLN A CD    1 
ATOM   6294  O  OE1   . GLN A 1 785  ? -14.699 -73.180  -3.837  1.00 133.84 ? 789  GLN A OE1   1 
ATOM   6295  N  NE2   . GLN A 1 785  ? -13.528 -73.886  -2.054  1.00 141.63 ? 789  GLN A NE2   1 
ATOM   6296  N  N     . ARG A 1 786  ? -11.257 -70.420  -6.735  1.00 109.49 ? 790  ARG A N     1 
ATOM   6297  C  CA    . ARG A 1 786  ? -10.435 -71.048  -7.761  1.00 112.09 ? 790  ARG A CA    1 
ATOM   6298  C  C     . ARG A 1 786  ? -9.163  -70.244  -8.025  1.00 97.02  ? 790  ARG A C     1 
ATOM   6299  O  O     . ARG A 1 786  ? -8.115  -70.798  -8.322  1.00 99.62  ? 790  ARG A O     1 
ATOM   6300  C  CB    . ARG A 1 786  ? -11.249 -71.201  -9.047  1.00 127.23 ? 790  ARG A CB    1 
ATOM   6301  C  CG    . ARG A 1 786  ? -10.931 -72.426  -9.876  1.00 132.98 ? 790  ARG A CG    1 
ATOM   6302  C  CD    . ARG A 1 786  ? -12.208 -73.083  -10.389 1.00 148.36 ? 790  ARG A CD    1 
ATOM   6303  N  NE    . ARG A 1 786  ? -12.766 -74.021  -9.415  1.00 157.74 ? 790  ARG A NE    1 
ATOM   6304  C  CZ    . ARG A 1 786  ? -13.835 -74.784  -9.633  1.00 157.01 ? 790  ARG A CZ    1 
ATOM   6305  N  NH1   . ARG A 1 786  ? -14.266 -75.613  -8.690  1.00 150.36 ? 790  ARG A NH1   1 
ATOM   6306  N  NH2   . ARG A 1 786  ? -14.475 -74.719  -10.794 1.00 161.49 ? 790  ARG A NH2   1 
ATOM   6307  N  N     . ASN A 1 787  ? -9.268  -68.930  -7.902  1.00 92.15  ? 791  ASN A N     1 
ATOM   6308  C  CA    . ASN A 1 787  ? -8.162  -68.034  -8.210  1.00 104.50 ? 791  ASN A CA    1 
ATOM   6309  C  C     . ASN A 1 787  ? -6.915  -68.254  -7.361  1.00 110.33 ? 791  ASN A C     1 
ATOM   6310  O  O     . ASN A 1 787  ? -6.975  -68.787  -6.256  1.00 117.90 ? 791  ASN A O     1 
ATOM   6311  C  CB    . ASN A 1 787  ? -8.613  -66.573  -8.065  1.00 109.39 ? 791  ASN A CB    1 
ATOM   6312  C  CG    . ASN A 1 787  ? -9.117  -65.989  -9.367  1.00 123.71 ? 791  ASN A CG    1 
ATOM   6313  O  OD1   . ASN A 1 787  ? -9.472  -66.720  -10.296 1.00 139.05 ? 791  ASN A OD1   1 
ATOM   6314  N  ND2   . ASN A 1 787  ? -9.144  -64.663  -9.446  1.00 125.30 ? 791  ASN A ND2   1 
ATOM   6315  N  N     . VAL A 1 788  ? -5.784  -67.834  -7.913  1.00 105.94 ? 792  VAL A N     1 
ATOM   6316  C  CA    . VAL A 1 788  ? -4.530  -67.715  -7.182  1.00 108.61 ? 792  VAL A CA    1 
ATOM   6317  C  C     . VAL A 1 788  ? -4.690  -66.624  -6.126  1.00 105.45 ? 792  VAL A C     1 
ATOM   6318  O  O     . VAL A 1 788  ? -5.363  -65.626  -6.385  1.00 96.75  ? 792  VAL A O     1 
ATOM   6319  C  CB    . VAL A 1 788  ? -3.365  -67.380  -8.154  1.00 112.54 ? 792  VAL A CB    1 
ATOM   6320  C  CG1   . VAL A 1 788  ? -2.055  -67.142  -7.418  1.00 122.94 ? 792  VAL A CG1   1 
ATOM   6321  C  CG2   . VAL A 1 788  ? -3.213  -68.483  -9.165  1.00 121.14 ? 792  VAL A CG2   1 
ATOM   6322  N  N     . PRO A 1 789  ? -4.109  -66.828  -4.927  1.00 106.98 ? 793  PRO A N     1 
ATOM   6323  C  CA    . PRO A 1 789  ? -4.117  -65.860  -3.823  1.00 102.36 ? 793  PRO A CA    1 
ATOM   6324  C  C     . PRO A 1 789  ? -4.033  -64.397  -4.252  1.00 94.53  ? 793  PRO A C     1 
ATOM   6325  O  O     . PRO A 1 789  ? -4.887  -63.603  -3.858  1.00 98.29  ? 793  PRO A O     1 
ATOM   6326  C  CB    . PRO A 1 789  ? -2.878  -66.258  -3.031  1.00 98.03  ? 793  PRO A CB    1 
ATOM   6327  C  CG    . PRO A 1 789  ? -2.856  -67.749  -3.163  1.00 106.36 ? 793  PRO A CG    1 
ATOM   6328  C  CD    . PRO A 1 789  ? -3.489  -68.098  -4.507  1.00 105.12 ? 793  PRO A CD    1 
ATOM   6329  N  N     . ALA A 1 790  ? -3.033  -64.051  -5.059  1.00 87.79  ? 794  ALA A N     1 
ATOM   6330  C  CA    . ALA A 1 790  ? -2.849  -62.664  -5.487  1.00 85.69  ? 794  ALA A CA    1 
ATOM   6331  C  C     . ALA A 1 790  ? -3.896  -62.225  -6.512  1.00 87.88  ? 794  ALA A C     1 
ATOM   6332  O  O     . ALA A 1 790  ? -4.086  -61.040  -6.747  1.00 97.91  ? 794  ALA A O     1 
ATOM   6333  C  CB    . ALA A 1 790  ? -1.453  -62.471  -6.050  1.00 87.52  ? 794  ALA A CB    1 
ATOM   6334  N  N     . ALA A 1 791  ? -4.579  -63.184  -7.121  1.00 88.08  ? 795  ALA A N     1 
ATOM   6335  C  CA    . ALA A 1 791  ? -5.570  -62.878  -8.145  1.00 95.81  ? 795  ALA A CA    1 
ATOM   6336  C  C     . ALA A 1 791  ? -6.931  -62.570  -7.536  1.00 96.26  ? 795  ALA A C     1 
ATOM   6337  O  O     . ALA A 1 791  ? -7.751  -61.893  -8.150  1.00 103.18 ? 795  ALA A O     1 
ATOM   6338  C  CB    . ALA A 1 791  ? -5.690  -64.033  -9.129  1.00 110.02 ? 795  ALA A CB    1 
ATOM   6339  N  N     . ARG A 1 792  ? -7.164  -63.072  -6.327  1.00 93.52  ? 796  ARG A N     1 
ATOM   6340  C  CA    . ARG A 1 792  ? -8.447  -62.896  -5.651  1.00 81.45  ? 796  ARG A CA    1 
ATOM   6341  C  C     . ARG A 1 792  ? -8.795  -61.426  -5.447  1.00 82.05  ? 796  ARG A C     1 
ATOM   6342  O  O     . ARG A 1 792  ? -8.033  -60.666  -4.852  1.00 79.88  ? 796  ARG A O     1 
ATOM   6343  C  CB    . ARG A 1 792  ? -8.448  -63.612  -4.300  1.00 74.99  ? 796  ARG A CB    1 
ATOM   6344  C  CG    . ARG A 1 792  ? -8.514  -65.129  -4.373  1.00 78.35  ? 796  ARG A CG    1 
ATOM   6345  C  CD    . ARG A 1 792  ? -8.673  -65.735  -2.998  1.00 92.05  ? 796  ARG A CD    1 
ATOM   6346  N  NE    . ARG A 1 792  ? -8.840  -67.186  -3.037  1.00 113.31 ? 796  ARG A NE    1 
ATOM   6347  C  CZ    . ARG A 1 792  ? -7.864  -68.061  -2.819  1.00 107.70 ? 796  ARG A CZ    1 
ATOM   6348  N  NH1   . ARG A 1 792  ? -6.639  -67.640  -2.544  1.00 105.07 ? 796  ARG A NH1   1 
ATOM   6349  N  NH2   . ARG A 1 792  ? -8.115  -69.359  -2.879  1.00 113.91 ? 796  ARG A NH2   1 
ATOM   6350  N  N     . GLU A 1 793  ? -9.948  -61.028  -5.969  1.00 89.21  ? 797  GLU A N     1 
ATOM   6351  C  CA    . GLU A 1 793  ? -10.444 -59.675  -5.780  1.00 88.92  ? 797  GLU A CA    1 
ATOM   6352  C  C     . GLU A 1 793  ? -11.149 -59.583  -4.432  1.00 90.69  ? 797  GLU A C     1 
ATOM   6353  O  O     . GLU A 1 793  ? -12.179 -60.225  -4.221  1.00 89.69  ? 797  GLU A O     1 
ATOM   6354  C  CB    . GLU A 1 793  ? -11.395 -59.276  -6.915  1.00 88.46  ? 797  GLU A CB    1 
ATOM   6355  C  CG    . GLU A 1 793  ? -12.010 -57.900  -6.756  1.00 99.68  ? 797  GLU A CG    1 
ATOM   6356  C  CD    . GLU A 1 793  ? -10.978 -56.790  -6.807  1.00 116.45 ? 797  GLU A CD    1 
ATOM   6357  O  OE1   . GLU A 1 793  ? -10.155 -56.789  -7.748  1.00 123.82 ? 797  GLU A OE1   1 
ATOM   6358  O  OE2   . GLU A 1 793  ? -10.984 -55.922  -5.905  1.00 119.46 ? 797  GLU A OE2   1 
ATOM   6359  N  N     . PRO A 1 794  ? -10.594 -58.782  -3.511  1.00 87.20  ? 798  PRO A N     1 
ATOM   6360  C  CA    . PRO A 1 794  ? -11.173 -58.625  -2.174  1.00 88.17  ? 798  PRO A CA    1 
ATOM   6361  C  C     . PRO A 1 794  ? -12.581 -58.051  -2.245  1.00 81.98  ? 798  PRO A C     1 
ATOM   6362  O  O     . PRO A 1 794  ? -13.441 -58.384  -1.414  1.00 81.27  ? 798  PRO A O     1 
ATOM   6363  C  CB    . PRO A 1 794  ? -10.214 -57.649  -1.482  1.00 76.08  ? 798  PRO A CB    1 
ATOM   6364  C  CG    . PRO A 1 794  ? -9.536  -56.931  -2.588  1.00 73.92  ? 798  PRO A CG    1 
ATOM   6365  C  CD    . PRO A 1 794  ? -9.411  -57.927  -3.702  1.00 80.45  ? 798  PRO A CD    1 
ATOM   6366  N  N     . GLU A 1 795  ? -12.818 -57.230  -3.265  1.00 67.24  ? 799  GLU A N     1 
ATOM   6367  C  CA    . GLU A 1 795  ? -14.096 -56.552  -3.432  1.00 67.32  ? 799  GLU A CA    1 
ATOM   6368  C  C     . GLU A 1 795  ? -15.248 -57.533  -3.637  1.00 66.11  ? 799  GLU A C     1 
ATOM   6369  O  O     . GLU A 1 795  ? -16.414 -57.148  -3.624  1.00 64.55  ? 799  GLU A O     1 
ATOM   6370  C  CB    . GLU A 1 795  ? -14.015 -55.571  -4.596  1.00 76.43  ? 799  GLU A CB    1 
ATOM   6371  C  CG    . GLU A 1 795  ? -15.049 -54.455  -4.538  1.00 118.12 ? 799  GLU A CG    1 
ATOM   6372  C  CD    . GLU A 1 795  ? -14.758 -53.337  -5.526  1.00 141.79 ? 799  GLU A CD    1 
ATOM   6373  O  OE1   . GLU A 1 795  ? -13.638 -52.781  -5.479  1.00 148.70 ? 799  GLU A OE1   1 
ATOM   6374  O  OE2   . GLU A 1 795  ? -15.646 -53.018  -6.349  1.00 141.25 ? 799  GLU A OE2   1 
ATOM   6375  N  N     . VAL A 1 796  ? -14.913 -58.806  -3.828  1.00 73.98  ? 800  VAL A N     1 
ATOM   6376  C  CA    . VAL A 1 796  ? -15.914 -59.868  -3.825  1.00 82.36  ? 800  VAL A CA    1 
ATOM   6377  C  C     . VAL A 1 796  ? -16.573 -59.961  -2.453  1.00 81.79  ? 800  VAL A C     1 
ATOM   6378  O  O     . VAL A 1 796  ? -17.789 -59.778  -2.314  1.00 81.77  ? 800  VAL A O     1 
ATOM   6379  C  CB    . VAL A 1 796  ? -15.302 -61.230  -4.191  1.00 81.24  ? 800  VAL A CB    1 
ATOM   6380  C  CG1   . VAL A 1 796  ? -16.268 -62.359  -3.871  1.00 69.20  ? 800  VAL A CG1   1 
ATOM   6381  C  CG2   . VAL A 1 796  ? -14.910 -61.250  -5.665  1.00 95.31  ? 800  VAL A CG2   1 
ATOM   6382  N  N     . LEU A 1 797  ? -15.745 -60.213  -1.439  1.00 85.03  ? 801  LEU A N     1 
ATOM   6383  C  CA    . LEU A 1 797  ? -16.203 -60.329  -0.052  1.00 91.79  ? 801  LEU A CA    1 
ATOM   6384  C  C     . LEU A 1 797  ? -17.146 -59.195  0.341   1.00 86.21  ? 801  LEU A C     1 
ATOM   6385  O  O     . LEU A 1 797  ? -18.306 -59.427  0.720   1.00 79.51  ? 801  LEU A O     1 
ATOM   6386  C  CB    . LEU A 1 797  ? -15.005 -60.354  0.904   1.00 80.44  ? 801  LEU A CB    1 
ATOM   6387  C  CG    . LEU A 1 797  ? -13.988 -61.479  0.688   1.00 79.25  ? 801  LEU A CG    1 
ATOM   6388  C  CD1   . LEU A 1 797  ? -12.777 -61.292  1.585   1.00 73.28  ? 801  LEU A CD1   1 
ATOM   6389  C  CD2   . LEU A 1 797  ? -14.625 -62.842  0.910   1.00 73.20  ? 801  LEU A CD2   1 
ATOM   6390  N  N     . SER A 1 798  ? -16.648 -57.970  0.201   1.00 77.71  ? 802  SER A N     1 
ATOM   6391  C  CA    . SER A 1 798  ? -17.423 -56.777  0.517   1.00 81.26  ? 802  SER A CA    1 
ATOM   6392  C  C     . SER A 1 798  ? -18.784 -56.801  -0.158  1.00 79.91  ? 802  SER A C     1 
ATOM   6393  O  O     . SER A 1 798  ? -19.810 -56.583  0.499   1.00 82.97  ? 802  SER A O     1 
ATOM   6394  C  CB    . SER A 1 798  ? -16.658 -55.514  0.119   1.00 72.59  ? 802  SER A CB    1 
ATOM   6395  O  OG    . SER A 1 798  ? -16.568 -55.398  -1.283  1.00 93.16  ? 802  SER A OG    1 
ATOM   6396  N  N     . THR A 1 799  ? -18.802 -57.110  -1.454  1.00 72.61  ? 803  THR A N     1 
ATOM   6397  C  CA    . THR A 1 799  ? -20.065 -57.094  -2.190  1.00 79.63  ? 803  THR A CA    1 
ATOM   6398  C  C     . THR A 1 799  ? -21.031 -58.093  -1.569  1.00 75.20  ? 803  THR A C     1 
ATOM   6399  O  O     . THR A 1 799  ? -22.197 -57.769  -1.316  1.00 81.82  ? 803  THR A O     1 
ATOM   6400  C  CB    . THR A 1 799  ? -19.881 -57.400  -3.697  1.00 79.00  ? 803  THR A CB    1 
ATOM   6401  O  OG1   . THR A 1 799  ? -18.921 -58.446  -3.857  1.00 92.48  ? 803  THR A OG1   1 
ATOM   6402  C  CG2   . THR A 1 799  ? -19.391 -56.169  -4.432  1.00 85.82  ? 803  THR A CG2   1 
ATOM   6403  N  N     . MET A 1 800  ? -20.526 -59.291  -1.276  1.00 70.03  ? 804  MET A N     1 
ATOM   6404  C  CA    . MET A 1 800  ? -21.349 -60.309  -0.642  1.00 85.53  ? 804  MET A CA    1 
ATOM   6405  C  C     . MET A 1 800  ? -21.970 -59.758  0.634   1.00 96.01  ? 804  MET A C     1 
ATOM   6406  O  O     . MET A 1 800  ? -23.180 -59.919  0.865   1.00 90.48  ? 804  MET A O     1 
ATOM   6407  C  CB    . MET A 1 800  ? -20.533 -61.565  -0.334  1.00 86.26  ? 804  MET A CB    1 
ATOM   6408  C  CG    . MET A 1 800  ? -20.235 -62.435  -1.552  1.00 96.09  ? 804  MET A CG    1 
ATOM   6409  S  SD    . MET A 1 800  ? -21.721 -62.929  -2.446  1.00 90.59  ? 804  MET A SD    1 
ATOM   6410  C  CE    . MET A 1 800  ? -22.727 -63.615  -1.157  1.00 81.81  ? 804  MET A CE    1 
ATOM   6411  N  N     . ALA A 1 801  ? -21.146 -59.069  1.429   1.00 89.66  ? 805  ALA A N     1 
ATOM   6412  C  CA    . ALA A 1 801  ? -21.611 -58.474  2.678   1.00 81.72  ? 805  ALA A CA    1 
ATOM   6413  C  C     . ALA A 1 801  ? -22.836 -57.618  2.414   1.00 76.43  ? 805  ALA A C     1 
ATOM   6414  O  O     . ALA A 1 801  ? -23.885 -57.806  3.048   1.00 80.42  ? 805  ALA A O     1 
ATOM   6415  C  CB    . ALA A 1 801  ? -20.516 -57.653  3.334   1.00 68.10  ? 805  ALA A CB    1 
ATOM   6416  N  N     . ILE A 1 802  ? -22.712 -56.722  1.435   1.00 65.34  ? 806  ILE A N     1 
ATOM   6417  C  CA    . ILE A 1 802  ? -23.815 -55.848  1.067   1.00 64.98  ? 806  ILE A CA    1 
ATOM   6418  C  C     . ILE A 1 802  ? -25.064 -56.668  0.802   1.00 69.99  ? 806  ILE A C     1 
ATOM   6419  O  O     . ILE A 1 802  ? -26.119 -56.415  1.397   1.00 81.61  ? 806  ILE A O     1 
ATOM   6420  C  CB    . ILE A 1 802  ? -23.493 -55.005  -0.177  1.00 66.49  ? 806  ILE A CB    1 
ATOM   6421  C  CG1   . ILE A 1 802  ? -22.353 -54.033  0.111   1.00 63.41  ? 806  ILE A CG1   1 
ATOM   6422  C  CG2   . ILE A 1 802  ? -24.724 -54.249  -0.637  1.00 63.45  ? 806  ILE A CG2   1 
ATOM   6423  C  CD1   . ILE A 1 802  ? -22.122 -53.023  -0.984  1.00 57.68  ? 806  ILE A CD1   1 
ATOM   6424  N  N     . ILE A 1 803  ? -24.915 -57.687  -0.042  1.00 71.23  ? 807  ILE A N     1 
ATOM   6425  C  CA    . ILE A 1 803  ? -26.031 -58.542  -0.410  1.00 72.65  ? 807  ILE A CA    1 
ATOM   6426  C  C     . ILE A 1 803  ? -26.662 -59.149  0.831   1.00 74.24  ? 807  ILE A C     1 
ATOM   6427  O  O     . ILE A 1 803  ? -27.883 -59.093  1.005   1.00 86.00  ? 807  ILE A O     1 
ATOM   6428  C  CB    . ILE A 1 803  ? -25.587 -59.656  -1.394  1.00 85.11  ? 807  ILE A CB    1 
ATOM   6429  C  CG1   . ILE A 1 803  ? -25.276 -59.053  -2.761  1.00 70.33  ? 807  ILE A CG1   1 
ATOM   6430  C  CG2   . ILE A 1 803  ? -26.663 -60.726  -1.543  1.00 65.72  ? 807  ILE A CG2   1 
ATOM   6431  C  CD1   . ILE A 1 803  ? -24.882 -60.064  -3.785  1.00 82.99  ? 807  ILE A CD1   1 
ATOM   6432  N  N     . VAL A 1 804  ? -25.827 -59.677  1.720   1.00 83.30  ? 808  VAL A N     1 
ATOM   6433  C  CA    . VAL A 1 804  ? -26.350 -60.250  2.959   1.00 92.96  ? 808  VAL A CA    1 
ATOM   6434  C  C     . VAL A 1 804  ? -27.120 -59.182  3.734   1.00 90.78  ? 808  VAL A C     1 
ATOM   6435  O  O     . VAL A 1 804  ? -28.272 -59.399  4.127   1.00 99.38  ? 808  VAL A O     1 
ATOM   6436  C  CB    . VAL A 1 804  ? -25.235 -60.834  3.848   1.00 91.86  ? 808  VAL A CB    1 
ATOM   6437  C  CG1   . VAL A 1 804  ? -25.782 -61.191  5.215   1.00 88.10  ? 808  VAL A CG1   1 
ATOM   6438  C  CG2   . VAL A 1 804  ? -24.612 -62.054  3.175   1.00 88.43  ? 808  VAL A CG2   1 
ATOM   6439  N  N     . ASN A 1 805  ? -26.501 -58.012  3.887   1.00 73.02  ? 809  ASN A N     1 
ATOM   6440  C  CA    . ASN A 1 805  ? -27.124 -56.912  4.601   1.00 82.19  ? 809  ASN A CA    1 
ATOM   6441  C  C     . ASN A 1 805  ? -28.473 -56.534  4.005   1.00 91.06  ? 809  ASN A C     1 
ATOM   6442  O  O     . ASN A 1 805  ? -29.345 -56.025  4.706   1.00 101.89 ? 809  ASN A O     1 
ATOM   6443  C  CB    . ASN A 1 805  ? -26.202 -55.688  4.612   1.00 89.89  ? 809  ASN A CB    1 
ATOM   6444  C  CG    . ASN A 1 805  ? -25.000 -55.870  5.513   1.00 100.87 ? 809  ASN A CG    1 
ATOM   6445  O  OD1   . ASN A 1 805  ? -25.080 -56.546  6.540   1.00 108.34 ? 809  ASN A OD1   1 
ATOM   6446  N  ND2   . ASN A 1 805  ? -23.876 -55.259  5.139   1.00 98.76  ? 809  ASN A ND2   1 
ATOM   6447  N  N     . LYS A 1 806  ? -28.648 -56.797  2.714   1.00 87.85  ? 810  LYS A N     1 
ATOM   6448  C  CA    . LYS A 1 806  ? -29.879 -56.419  2.042   1.00 92.37  ? 810  LYS A CA    1 
ATOM   6449  C  C     . LYS A 1 806  ? -30.901 -57.548  2.080   1.00 95.19  ? 810  LYS A C     1 
ATOM   6450  O  O     . LYS A 1 806  ? -32.105 -57.303  2.038   1.00 97.43  ? 810  LYS A O     1 
ATOM   6451  C  CB    . LYS A 1 806  ? -29.594 -56.006  0.594   1.00 95.92  ? 810  LYS A CB    1 
ATOM   6452  C  CG    . LYS A 1 806  ? -30.775 -55.349  -0.098  1.00 96.96  ? 810  LYS A CG    1 
ATOM   6453  C  CD    . LYS A 1 806  ? -31.181 -54.068  0.612   1.00 95.57  ? 810  LYS A CD    1 
ATOM   6454  C  CE    . LYS A 1 806  ? -32.538 -53.568  0.138   1.00 104.28 ? 810  LYS A CE    1 
ATOM   6455  N  NZ    . LYS A 1 806  ? -32.540 -53.193  -1.302  1.00 111.07 ? 810  LYS A NZ    1 
ATOM   6456  N  N     . LEU A 1 807  ? -30.422 -58.785  2.170   1.00 100.80 ? 811  LEU A N     1 
ATOM   6457  C  CA    . LEU A 1 807  ? -31.319 -59.930  2.074   1.00 104.71 ? 811  LEU A CA    1 
ATOM   6458  C  C     . LEU A 1 807  ? -31.652 -60.521  3.438   1.00 121.47 ? 811  LEU A C     1 
ATOM   6459  O  O     . LEU A 1 807  ? -32.819 -60.578  3.831   1.00 127.17 ? 811  LEU A O     1 
ATOM   6460  C  CB    . LEU A 1 807  ? -30.712 -61.008  1.172   1.00 112.67 ? 811  LEU A CB    1 
ATOM   6461  C  CG    . LEU A 1 807  ? -30.511 -60.620  -0.296  1.00 106.43 ? 811  LEU A CG    1 
ATOM   6462  C  CD1   . LEU A 1 807  ? -30.098 -61.833  -1.112  1.00 106.14 ? 811  LEU A CD1   1 
ATOM   6463  C  CD2   . LEU A 1 807  ? -31.768 -59.980  -0.872  1.00 91.29  ? 811  LEU A CD2   1 
ATOM   6464  N  N     . GLY A 1 808  ? -30.622 -60.967  4.151   1.00 125.44 ? 812  GLY A N     1 
ATOM   6465  C  CA    . GLY A 1 808  ? -30.800 -61.556  5.464   1.00 123.07 ? 812  GLY A CA    1 
ATOM   6466  C  C     . GLY A 1 808  ? -31.583 -62.853  5.423   1.00 123.94 ? 812  GLY A C     1 
ATOM   6467  O  O     . GLY A 1 808  ? -31.071 -63.883  4.989   1.00 132.89 ? 812  GLY A O     1 
ATOM   6468  N  N     . GLY A 1 809  ? -32.833 -62.794  5.871   1.00 117.24 ? 813  GLY A N     1 
ATOM   6469  C  CA    . GLY A 1 809  ? -33.678 -63.971  5.959   1.00 114.43 ? 813  GLY A CA    1 
ATOM   6470  C  C     . GLY A 1 809  ? -33.904 -64.681  4.637   1.00 123.56 ? 813  GLY A C     1 
ATOM   6471  O  O     . GLY A 1 809  ? -34.148 -65.886  4.610   1.00 126.86 ? 813  GLY A O     1 
ATOM   6472  N  N     . HIS A 1 810  ? -33.814 -63.937  3.539   1.00 120.32 ? 814  HIS A N     1 
ATOM   6473  C  CA    . HIS A 1 810  ? -34.040 -64.508  2.218   1.00 114.44 ? 814  HIS A CA    1 
ATOM   6474  C  C     . HIS A 1 810  ? -32.795 -65.197  1.663   1.00 115.72 ? 814  HIS A C     1 
ATOM   6475  O  O     . HIS A 1 810  ? -32.842 -65.787  0.581   1.00 117.21 ? 814  HIS A O     1 
ATOM   6476  C  CB    . HIS A 1 810  ? -34.503 -63.428  1.240   1.00 115.48 ? 814  HIS A CB    1 
ATOM   6477  C  CG    . HIS A 1 810  ? -35.844 -62.852  1.564   1.00 123.15 ? 814  HIS A CG    1 
ATOM   6478  N  ND1   . HIS A 1 810  ? -36.099 -62.177  2.739   1.00 128.33 ? 814  HIS A ND1   1 
ATOM   6479  C  CD2   . HIS A 1 810  ? -37.003 -62.840  0.864   1.00 126.99 ? 814  HIS A CD2   1 
ATOM   6480  C  CE1   . HIS A 1 810  ? -37.359 -61.781  2.751   1.00 138.24 ? 814  HIS A CE1   1 
ATOM   6481  N  NE2   . HIS A 1 810  ? -37.930 -62.170  1.625   1.00 134.78 ? 814  HIS A NE2   1 
ATOM   6482  N  N     . ILE A 1 811  ? -31.685 -65.125  2.395   1.00 109.07 ? 815  ILE A N     1 
ATOM   6483  C  CA    . ILE A 1 811  ? -30.435 -65.695  1.901   1.00 109.33 ? 815  ILE A CA    1 
ATOM   6484  C  C     . ILE A 1 811  ? -29.716 -66.539  2.951   1.00 109.61 ? 815  ILE A C     1 
ATOM   6485  O  O     . ILE A 1 811  ? -28.644 -67.089  2.686   1.00 105.84 ? 815  ILE A O     1 
ATOM   6486  C  CB    . ILE A 1 811  ? -29.483 -64.590  1.407   1.00 107.34 ? 815  ILE A CB    1 
ATOM   6487  C  CG1   . ILE A 1 811  ? -28.496 -65.148  0.371   1.00 110.84 ? 815  ILE A CG1   1 
ATOM   6488  C  CG2   . ILE A 1 811  ? -28.775 -63.927  2.578   1.00 101.02 ? 815  ILE A CG2   1 
ATOM   6489  C  CD1   . ILE A 1 811  ? -27.400 -64.186  -0.011  1.00 119.73 ? 815  ILE A CD1   1 
ATOM   6490  N  N     . THR A 1 812  ? -30.312 -66.644  4.135   1.00 118.63 ? 816  THR A N     1 
ATOM   6491  C  CA    . THR A 1 812  ? -29.736 -67.430  5.224   1.00 116.17 ? 816  THR A CA    1 
ATOM   6492  C  C     . THR A 1 812  ? -29.409 -68.844  4.760   1.00 104.47 ? 816  THR A C     1 
ATOM   6493  O  O     . THR A 1 812  ? -28.313 -69.354  5.000   1.00 109.78 ? 816  THR A O     1 
ATOM   6494  C  CB    . THR A 1 812  ? -30.689 -67.502  6.433   1.00 126.37 ? 816  THR A CB    1 
ATOM   6495  O  OG1   . THR A 1 812  ? -31.079 -66.178  6.815   1.00 130.35 ? 816  THR A OG1   1 
ATOM   6496  C  CG2   . THR A 1 812  ? -30.013 -68.191  7.610   1.00 129.71 ? 816  THR A CG2   1 
ATOM   6497  N  N     . ALA A 1 813  ? -30.360 -69.457  4.065   1.00 98.01  ? 817  ALA A N     1 
ATOM   6498  C  CA    . ALA A 1 813  ? -30.207 -70.826  3.579   1.00 104.64 ? 817  ALA A CA    1 
ATOM   6499  C  C     . ALA A 1 813  ? -28.981 -70.990  2.683   1.00 106.18 ? 817  ALA A C     1 
ATOM   6500  O  O     . ALA A 1 813  ? -28.415 -72.069  2.582   1.00 100.52 ? 817  ALA A O     1 
ATOM   6501  C  CB    . ALA A 1 813  ? -31.461 -71.256  2.834   1.00 112.43 ? 817  ALA A CB    1 
ATOM   6502  N  N     . GLU A 1 814  ? -28.563 -69.909  2.042   1.00 113.82 ? 818  GLU A N     1 
ATOM   6503  C  CA    . GLU A 1 814  ? -27.456 -69.985  1.096   1.00 120.81 ? 818  GLU A CA    1 
ATOM   6504  C  C     . GLU A 1 814  ? -26.117 -69.651  1.732   1.00 120.63 ? 818  GLU A C     1 
ATOM   6505  O  O     . GLU A 1 814  ? -25.074 -69.828  1.113   1.00 118.26 ? 818  GLU A O     1 
ATOM   6506  C  CB    . GLU A 1 814  ? -27.703 -69.055  -0.099  1.00 129.89 ? 818  GLU A CB    1 
ATOM   6507  C  CG    . GLU A 1 814  ? -29.166 -68.908  -0.502  1.00 147.41 ? 818  GLU A CG    1 
ATOM   6508  C  CD    . GLU A 1 814  ? -29.833 -70.214  -0.917  1.00 167.76 ? 818  GLU A CD    1 
ATOM   6509  O  OE1   . GLU A 1 814  ? -29.173 -71.274  -0.938  1.00 178.85 ? 818  GLU A OE1   1 
ATOM   6510  O  OE2   . GLU A 1 814  ? -31.039 -70.177  -1.231  1.00 176.78 ? 818  GLU A OE2   1 
ATOM   6511  N  N     . ILE A 1 815  ? -26.144 -69.162  2.966   1.00 122.85 ? 819  ILE A N     1 
ATOM   6512  C  CA    . ILE A 1 815  ? -24.908 -68.811  3.667   1.00 119.10 ? 819  ILE A CA    1 
ATOM   6513  C  C     . ILE A 1 815  ? -23.880 -69.965  3.717   1.00 108.93 ? 819  ILE A C     1 
ATOM   6514  O  O     . ILE A 1 815  ? -22.677 -69.731  3.502   1.00 103.48 ? 819  ILE A O     1 
ATOM   6515  C  CB    . ILE A 1 815  ? -25.205 -68.315  5.105   1.00 105.59 ? 819  ILE A CB    1 
ATOM   6516  C  CG1   . ILE A 1 815  ? -26.032 -67.031  5.048   1.00 98.03  ? 819  ILE A CG1   1 
ATOM   6517  C  CG2   . ILE A 1 815  ? -23.920 -68.079  5.866   1.00 106.78 ? 819  ILE A CG2   1 
ATOM   6518  C  CD1   . ILE A 1 815  ? -25.374 -65.931  4.264   1.00 79.26  ? 819  ILE A CD1   1 
ATOM   6519  N  N     . PRO A 1 816  ? -24.336 -71.210  3.979   1.00 103.53 ? 820  PRO A N     1 
ATOM   6520  C  CA    . PRO A 1 816  ? -23.366 -72.311  3.970   1.00 101.93 ? 820  PRO A CA    1 
ATOM   6521  C  C     . PRO A 1 816  ? -22.497 -72.405  2.700   1.00 107.19 ? 820  PRO A C     1 
ATOM   6522  O  O     . PRO A 1 816  ? -21.271 -72.266  2.796   1.00 110.01 ? 820  PRO A O     1 
ATOM   6523  C  CB    . PRO A 1 816  ? -24.261 -73.534  4.106   1.00 94.51  ? 820  PRO A CB    1 
ATOM   6524  C  CG    . PRO A 1 816  ? -25.356 -73.072  4.978   1.00 93.25  ? 820  PRO A CG    1 
ATOM   6525  C  CD    . PRO A 1 816  ? -25.647 -71.672  4.485   1.00 98.74  ? 820  PRO A CD    1 
ATOM   6526  N  N     . GLN A 1 817  ? -23.109 -72.609  1.536   1.00 109.59 ? 821  GLN A N     1 
ATOM   6527  C  CA    . GLN A 1 817  ? -22.346 -72.787  0.293   1.00 122.26 ? 821  GLN A CA    1 
ATOM   6528  C  C     . GLN A 1 817  ? -21.416 -71.589  -0.029  1.00 100.34 ? 821  GLN A C     1 
ATOM   6529  O  O     . GLN A 1 817  ? -20.266 -71.740  -0.508  1.00 81.28  ? 821  GLN A O     1 
ATOM   6530  C  CB    . GLN A 1 817  ? -23.315 -73.066  -0.867  1.00 134.85 ? 821  GLN A CB    1 
ATOM   6531  C  CG    . GLN A 1 817  ? -24.623 -72.291  -0.813  1.00 142.93 ? 821  GLN A CG    1 
ATOM   6532  C  CD    . GLN A 1 817  ? -25.765 -73.022  -1.495  1.00 146.93 ? 821  GLN A CD    1 
ATOM   6533  O  OE1   . GLN A 1 817  ? -26.140 -72.702  -2.626  1.00 145.32 ? 821  GLN A OE1   1 
ATOM   6534  N  NE2   . GLN A 1 817  ? -26.330 -74.010  -0.805  1.00 143.14 ? 821  GLN A NE2   1 
ATOM   6535  N  N     . ILE A 1 818  ? -21.899 -70.392  0.274   1.00 100.92 ? 822  ILE A N     1 
ATOM   6536  C  CA    . ILE A 1 818  ? -21.076 -69.194  0.146   1.00 95.69  ? 822  ILE A CA    1 
ATOM   6537  C  C     . ILE A 1 818  ? -19.794 -69.352  0.966   1.00 94.34  ? 822  ILE A C     1 
ATOM   6538  O  O     . ILE A 1 818  ? -18.663 -69.158  0.467   1.00 101.85 ? 822  ILE A O     1 
ATOM   6539  C  CB    . ILE A 1 818  ? -21.826 -67.937  0.610   1.00 84.47  ? 822  ILE A CB    1 
ATOM   6540  C  CG1   . ILE A 1 818  ? -23.113 -67.748  -0.203  1.00 83.42  ? 822  ILE A CG1   1 
ATOM   6541  C  CG2   . ILE A 1 818  ? -20.922 -66.724  0.466   1.00 75.57  ? 822  ILE A CG2   1 
ATOM   6542  C  CD1   . ILE A 1 818  ? -24.025 -66.656  0.324   1.00 86.24  ? 822  ILE A CD1   1 
ATOM   6543  N  N     . PHE A 1 819  ? -19.974 -69.751  2.219   1.00 87.81  ? 823  PHE A N     1 
ATOM   6544  C  CA    . PHE A 1 819  ? -18.836 -70.005  3.099   1.00 100.58 ? 823  PHE A CA    1 
ATOM   6545  C  C     . PHE A 1 819  ? -17.913 -71.108  2.571   1.00 102.42 ? 823  PHE A C     1 
ATOM   6546  O  O     . PHE A 1 819  ? -16.704 -71.099  2.861   1.00 102.25 ? 823  PHE A O     1 
ATOM   6547  C  CB    . PHE A 1 819  ? -19.327 -70.347  4.512   1.00 109.39 ? 823  PHE A CB    1 
ATOM   6548  C  CG    . PHE A 1 819  ? -19.538 -69.143  5.384   1.00 110.41 ? 823  PHE A CG    1 
ATOM   6549  C  CD1   . PHE A 1 819  ? -20.252 -68.045  4.913   1.00 113.40 ? 823  PHE A CD1   1 
ATOM   6550  C  CD2   . PHE A 1 819  ? -19.021 -69.098  6.665   1.00 105.02 ? 823  PHE A CD2   1 
ATOM   6551  C  CE1   . PHE A 1 819  ? -20.450 -66.924  5.709   1.00 101.94 ? 823  PHE A CE1   1 
ATOM   6552  C  CE2   . PHE A 1 819  ? -19.218 -67.976  7.466   1.00 105.34 ? 823  PHE A CE2   1 
ATOM   6553  C  CZ    . PHE A 1 819  ? -19.933 -66.892  6.989   1.00 93.13  ? 823  PHE A CZ    1 
ATOM   6554  N  N     . ASP A 1 820  ? -18.472 -72.031  1.777   1.00 104.19 ? 824  ASP A N     1 
ATOM   6555  C  CA    . ASP A 1 820  ? -17.667 -73.071  1.129   1.00 114.80 ? 824  ASP A CA    1 
ATOM   6556  C  C     . ASP A 1 820  ? -16.666 -72.448  0.188   1.00 123.51 ? 824  ASP A C     1 
ATOM   6557  O  O     . ASP A 1 820  ? -15.510 -72.875  0.131   1.00 110.86 ? 824  ASP A O     1 
ATOM   6558  C  CB    . ASP A 1 820  ? -18.524 -74.059  0.332   1.00 129.70 ? 824  ASP A CB    1 
ATOM   6559  C  CG    . ASP A 1 820  ? -19.637 -74.656  1.142   1.00 148.66 ? 824  ASP A CG    1 
ATOM   6560  O  OD1   . ASP A 1 820  ? -19.711 -74.352  2.341   1.00 145.51 ? 824  ASP A OD1   1 
ATOM   6561  O  OD2   . ASP A 1 820  ? -20.441 -75.431  0.578   1.00 165.48 ? 824  ASP A OD2   1 
ATOM   6562  N  N     . ALA A 1 821  ? -17.111 -71.442  -0.560  1.00 78.97  ? 825  ALA A N     1 
ATOM   6563  C  CA    . ALA A 1 821  ? -16.207 -70.836  -1.536  1.00 99.62  ? 825  ALA A CA    1 
ATOM   6564  C  C     . ALA A 1 821  ? -15.182 -69.871  -0.937  1.00 104.07 ? 825  ALA A C     1 
ATOM   6565  O  O     . ALA A 1 821  ? -14.001 -69.909  -1.296  1.00 106.83 ? 825  ALA A O     1 
ATOM   6566  C  CB    . ALA A 1 821  ? -17.013 -70.126  -2.612  1.00 76.34  ? 825  ALA A CB    1 
ATOM   6567  N  N     . VAL A 1 822  ? -15.630 -68.998  -0.042  1.00 102.60 ? 826  VAL A N     1 
ATOM   6568  C  CA    . VAL A 1 822  ? -14.767 -67.885  0.352   1.00 103.26 ? 826  VAL A CA    1 
ATOM   6569  C  C     . VAL A 1 822  ? -14.080 -68.037  1.721   1.00 116.19 ? 826  VAL A C     1 
ATOM   6570  O  O     . VAL A 1 822  ? -12.918 -67.625  1.874   1.00 120.50 ? 826  VAL A O     1 
ATOM   6571  C  CB    . VAL A 1 822  ? -15.559 -66.571  0.329   1.00 95.48  ? 826  VAL A CB    1 
ATOM   6572  C  CG1   . VAL A 1 822  ? -15.904 -66.209  -1.119  1.00 95.65  ? 826  VAL A CG1   1 
ATOM   6573  C  CG2   . VAL A 1 822  ? -16.818 -66.682  1.155   1.00 84.40  ? 826  VAL A CG2   1 
ATOM   6574  N  N     . PHE A 1 823  ? -14.762 -68.648  2.692   1.00 111.48 ? 827  PHE A N     1 
ATOM   6575  C  CA    . PHE A 1 823  ? -14.291 -68.573  4.084   1.00 89.89  ? 827  PHE A CA    1 
ATOM   6576  C  C     . PHE A 1 823  ? -12.920 -69.228  4.280   1.00 92.31  ? 827  PHE A C     1 
ATOM   6577  O  O     . PHE A 1 823  ? -11.908 -68.560  4.535   1.00 97.67  ? 827  PHE A O     1 
ATOM   6578  C  CB    . PHE A 1 823  ? -15.317 -69.217  5.014   1.00 84.10  ? 827  PHE A CB    1 
ATOM   6579  C  CG    . PHE A 1 823  ? -15.165 -68.841  6.460   1.00 102.97 ? 827  PHE A CG    1 
ATOM   6580  C  CD1   . PHE A 1 823  ? -15.852 -67.757  6.988   1.00 107.90 ? 827  PHE A CD1   1 
ATOM   6581  C  CD2   . PHE A 1 823  ? -14.351 -69.580  7.298   1.00 109.06 ? 827  PHE A CD2   1 
ATOM   6582  C  CE1   . PHE A 1 823  ? -15.726 -67.419  8.318   1.00 101.59 ? 827  PHE A CE1   1 
ATOM   6583  C  CE2   . PHE A 1 823  ? -14.221 -69.241  8.636   1.00 102.29 ? 827  PHE A CE2   1 
ATOM   6584  C  CZ    . PHE A 1 823  ? -14.907 -68.162  9.141   1.00 96.45  ? 827  PHE A CZ    1 
ATOM   6585  N  N     . GLU A 1 824  ? -12.918 -70.549  4.146   1.00 109.45 ? 828  GLU A N     1 
ATOM   6586  C  CA    . GLU A 1 824  ? -11.739 -71.389  4.319   1.00 112.29 ? 828  GLU A CA    1 
ATOM   6587  C  C     . GLU A 1 824  ? -10.491 -70.854  3.620   1.00 101.08 ? 828  GLU A C     1 
ATOM   6588  O  O     . GLU A 1 824  ? -9.432  -70.744  4.234   1.00 90.76  ? 828  GLU A O     1 
ATOM   6589  C  CB    . GLU A 1 824  ? -12.042 -72.804  3.808   1.00 129.90 ? 828  GLU A CB    1 
ATOM   6590  C  CG    . GLU A 1 824  ? -12.998 -73.594  4.680   1.00 141.40 ? 828  GLU A CG    1 
ATOM   6591  C  CD    . GLU A 1 824  ? -12.278 -74.601  5.557   1.00 152.63 ? 828  GLU A CD    1 
ATOM   6592  O  OE1   . GLU A 1 824  ? -11.204 -75.091  5.146   1.00 159.19 ? 828  GLU A OE1   1 
ATOM   6593  O  OE2   . GLU A 1 824  ? -12.784 -74.904  6.656   1.00 157.04 ? 828  GLU A OE2   1 
ATOM   6594  N  N     . CYS A 1 825  ? -10.616 -70.531  2.336   1.00 106.59 ? 829  CYS A N     1 
ATOM   6595  C  CA    . CYS A 1 825  ? -9.456  -70.148  1.542   1.00 110.22 ? 829  CYS A CA    1 
ATOM   6596  C  C     . CYS A 1 825  ? -9.004  -68.723  1.851   1.00 110.90 ? 829  CYS A C     1 
ATOM   6597  O  O     . CYS A 1 825  ? -7.824  -68.401  1.699   1.00 115.67 ? 829  CYS A O     1 
ATOM   6598  C  CB    . CYS A 1 825  ? -9.756  -70.293  0.051   1.00 105.83 ? 829  CYS A CB    1 
ATOM   6599  S  SG    . CYS A 1 825  ? -10.964 -69.119  -0.592  1.00 135.10 ? 829  CYS A SG    1 
ATOM   6600  N  N     . THR A 1 826  ? -9.937  -67.870  2.271   1.00 101.52 ? 830  THR A N     1 
ATOM   6601  C  CA    . THR A 1 826  ? -9.585  -66.502  2.650   1.00 93.41  ? 830  THR A CA    1 
ATOM   6602  C  C     . THR A 1 826  ? -8.804  -66.481  3.967   1.00 96.03  ? 830  THR A C     1 
ATOM   6603  O  O     . THR A 1 826  ? -7.827  -65.732  4.101   1.00 88.74  ? 830  THR A O     1 
ATOM   6604  C  CB    . THR A 1 826  ? -10.820 -65.620  2.798   1.00 85.62  ? 830  THR A CB    1 
ATOM   6605  O  OG1   . THR A 1 826  ? -11.470 -65.501  1.533   1.00 70.50  ? 830  THR A OG1   1 
ATOM   6606  C  CG2   . THR A 1 826  ? -10.450 -64.227  3.312   1.00 91.21  ? 830  THR A CG2   1 
ATOM   6607  N  N     . LEU A 1 827  ? -9.241  -67.294  4.932   1.00 91.51  ? 831  LEU A N     1 
ATOM   6608  C  CA    . LEU A 1 827  ? -8.540  -67.407  6.208   1.00 87.94  ? 831  LEU A CA    1 
ATOM   6609  C  C     . LEU A 1 827  ? -7.048  -67.651  6.027   1.00 91.70  ? 831  LEU A C     1 
ATOM   6610  O  O     . LEU A 1 827  ? -6.229  -66.937  6.607   1.00 99.80  ? 831  LEU A O     1 
ATOM   6611  C  CB    . LEU A 1 827  ? -9.137  -68.528  7.055   1.00 97.94  ? 831  LEU A CB    1 
ATOM   6612  C  CG    . LEU A 1 827  ? -10.063 -68.103  8.194   1.00 95.53  ? 831  LEU A CG    1 
ATOM   6613  C  CD1   . LEU A 1 827  ? -11.357 -67.606  7.616   1.00 101.67 ? 831  LEU A CD1   1 
ATOM   6614  C  CD2   . LEU A 1 827  ? -10.313 -69.240  9.168   1.00 87.08  ? 831  LEU A CD2   1 
ATOM   6615  N  N     . ASN A 1 828  ? -6.704  -68.650  5.217   1.00 88.79  ? 832  ASN A N     1 
ATOM   6616  C  CA    . ASN A 1 828  ? -5.313  -69.051  5.020   1.00 93.29  ? 832  ASN A CA    1 
ATOM   6617  C  C     . ASN A 1 828  ? -4.427  -67.926  4.501   1.00 92.51  ? 832  ASN A C     1 
ATOM   6618  O  O     . ASN A 1 828  ? -3.206  -67.969  4.651   1.00 104.30 ? 832  ASN A O     1 
ATOM   6619  C  CB    . ASN A 1 828  ? -5.240  -70.239  4.065   1.00 105.30 ? 832  ASN A CB    1 
ATOM   6620  C  CG    . ASN A 1 828  ? -5.923  -71.468  4.618   1.00 126.96 ? 832  ASN A CG    1 
ATOM   6621  O  OD1   . ASN A 1 828  ? -5.298  -72.291  5.289   1.00 137.72 ? 832  ASN A OD1   1 
ATOM   6622  N  ND2   . ASN A 1 828  ? -7.216  -71.599  4.345   1.00 130.92 ? 832  ASN A ND2   1 
ATOM   6623  N  N     . MET A 1 829  ? -5.044  -66.921  3.890   1.00 78.86  ? 833  MET A N     1 
ATOM   6624  C  CA    . MET A 1 829  ? -4.318  -65.749  3.428   1.00 81.66  ? 833  MET A CA    1 
ATOM   6625  C  C     . MET A 1 829  ? -3.997  -64.821  4.590   1.00 96.49  ? 833  MET A C     1 
ATOM   6626  O  O     . MET A 1 829  ? -2.965  -64.150  4.587   1.00 106.29 ? 833  MET A O     1 
ATOM   6627  C  CB    . MET A 1 829  ? -5.131  -64.990  2.380   1.00 84.80  ? 833  MET A CB    1 
ATOM   6628  C  CG    . MET A 1 829  ? -5.662  -65.847  1.240   1.00 80.69  ? 833  MET A CG    1 
ATOM   6629  S  SD    . MET A 1 829  ? -6.716  -64.901  0.121   1.00 92.25  ? 833  MET A SD    1 
ATOM   6630  C  CE    . MET A 1 829  ? -5.541  -63.737  -0.546  1.00 71.92  ? 833  MET A CE    1 
ATOM   6631  N  N     . ILE A 1 830  ? -4.881  -64.802  5.586   1.00 98.88  ? 834  ILE A N     1 
ATOM   6632  C  CA    . ILE A 1 830  ? -4.815  -63.813  6.658   1.00 96.28  ? 834  ILE A CA    1 
ATOM   6633  C  C     . ILE A 1 830  ? -4.709  -64.407  8.062   1.00 107.08 ? 834  ILE A C     1 
ATOM   6634  O  O     . ILE A 1 830  ? -5.259  -63.849  9.009   1.00 113.32 ? 834  ILE A O     1 
ATOM   6635  C  CB    . ILE A 1 830  ? -6.049  -62.895  6.628   1.00 85.93  ? 834  ILE A CB    1 
ATOM   6636  C  CG1   . ILE A 1 830  ? -7.334  -63.724  6.712   1.00 74.81  ? 834  ILE A CG1   1 
ATOM   6637  C  CG2   . ILE A 1 830  ? -6.042  -62.037  5.376   1.00 81.72  ? 834  ILE A CG2   1 
ATOM   6638  C  CD1   . ILE A 1 830  ? -8.589  -62.903  6.925   1.00 70.97  ? 834  ILE A CD1   1 
ATOM   6639  N  N     . ASN A 1 831  ? -4.004  -65.525  8.206   1.00 115.93 ? 835  ASN A N     1 
ATOM   6640  C  CA    . ASN A 1 831  ? -3.815  -66.110  9.533   1.00 112.31 ? 835  ASN A CA    1 
ATOM   6641  C  C     . ASN A 1 831  ? -2.370  -66.498  9.814   1.00 110.39 ? 835  ASN A C     1 
ATOM   6642  O  O     . ASN A 1 831  ? -2.095  -67.284  10.711  1.00 125.55 ? 835  ASN A O     1 
ATOM   6643  C  CB    . ASN A 1 831  ? -4.731  -67.324  9.720   1.00 111.57 ? 835  ASN A CB    1 
ATOM   6644  C  CG    . ASN A 1 831  ? -4.556  -68.371  8.632   1.00 124.48 ? 835  ASN A CG    1 
ATOM   6645  O  OD1   . ASN A 1 831  ? -3.523  -68.436  7.965   1.00 131.03 ? 835  ASN A OD1   1 
ATOM   6646  N  ND2   . ASN A 1 831  ? -5.575  -69.202  8.452   1.00 126.27 ? 835  ASN A ND2   1 
ATOM   6647  N  N     . LYS A 1 832  ? -1.451  -65.936  9.038   1.00 116.63 ? 836  LYS A N     1 
ATOM   6648  C  CA    . LYS A 1 832  ? -0.029  -66.186  9.228   1.00 109.30 ? 836  LYS A CA    1 
ATOM   6649  C  C     . LYS A 1 832  ? 0.652   -64.937  9.797   1.00 103.54 ? 836  LYS A C     1 
ATOM   6650  O  O     . LYS A 1 832  ? 1.789   -64.983  10.262  1.00 108.78 ? 836  LYS A O     1 
ATOM   6651  C  CB    . LYS A 1 832  ? 0.617   -66.609  7.908   1.00 113.78 ? 836  LYS A CB    1 
ATOM   6652  C  CG    . LYS A 1 832  ? -0.030  -67.836  7.284   1.00 115.80 ? 836  LYS A CG    1 
ATOM   6653  C  CD    . LYS A 1 832  ? 0.429   -68.051  5.850   1.00 118.70 ? 836  LYS A CD    1 
ATOM   6654  C  CE    . LYS A 1 832  ? -0.298  -69.218  5.210   1.00 122.36 ? 836  LYS A CE    1 
ATOM   6655  N  NZ    . LYS A 1 832  ? 0.016   -69.333  3.755   1.00 126.25 ? 836  LYS A NZ    1 
ATOM   6656  N  N     . ASP A 1 833  ? -0.067  -63.823  9.756   1.00 84.68  ? 837  ASP A N     1 
ATOM   6657  C  CA    . ASP A 1 833  ? 0.391   -62.572  10.327  1.00 82.23  ? 837  ASP A CA    1 
ATOM   6658  C  C     . ASP A 1 833  ? -0.791  -61.620  10.441  1.00 93.25  ? 837  ASP A C     1 
ATOM   6659  O  O     . ASP A 1 833  ? -1.940  -62.037  10.298  1.00 97.38  ? 837  ASP A O     1 
ATOM   6660  C  CB    . ASP A 1 833  ? 1.504   -61.947  9.486   1.00 99.22  ? 837  ASP A CB    1 
ATOM   6661  C  CG    . ASP A 1 833  ? 1.106   -61.752  8.035   1.00 119.19 ? 837  ASP A CG    1 
ATOM   6662  O  OD1   . ASP A 1 833  ? 0.259   -60.870  7.759   1.00 110.57 ? 837  ASP A OD1   1 
ATOM   6663  O  OD2   . ASP A 1 833  ? 1.648   -62.480  7.168   1.00 132.06 ? 837  ASP A OD2   1 
ATOM   6664  N  N     . PHE A 1 834  ? -0.510  -60.346  10.698  1.00 98.31  ? 838  PHE A N     1 
ATOM   6665  C  CA    . PHE A 1 834  ? -1.563  -59.344  10.819  1.00 90.30  ? 838  PHE A CA    1 
ATOM   6666  C  C     . PHE A 1 834  ? -1.469  -58.272  9.741   1.00 81.75  ? 838  PHE A C     1 
ATOM   6667  O  O     . PHE A 1 834  ? -2.249  -57.328  9.739   1.00 97.79  ? 838  PHE A O     1 
ATOM   6668  C  CB    . PHE A 1 834  ? -1.507  -58.683  12.193  1.00 91.89  ? 838  PHE A CB    1 
ATOM   6669  C  CG    . PHE A 1 834  ? -2.049  -59.533  13.297  1.00 95.26  ? 838  PHE A CG    1 
ATOM   6670  C  CD1   . PHE A 1 834  ? -3.412  -59.595  13.532  1.00 90.38  ? 838  PHE A CD1   1 
ATOM   6671  C  CD2   . PHE A 1 834  ? -1.195  -60.258  14.113  1.00 106.47 ? 838  PHE A CD2   1 
ATOM   6672  C  CE1   . PHE A 1 834  ? -3.914  -60.378  14.552  1.00 103.82 ? 838  PHE A CE1   1 
ATOM   6673  C  CE2   . PHE A 1 834  ? -1.692  -61.042  15.138  1.00 100.25 ? 838  PHE A CE2   1 
ATOM   6674  C  CZ    . PHE A 1 834  ? -3.053  -61.101  15.358  1.00 100.36 ? 838  PHE A CZ    1 
ATOM   6675  N  N     . GLU A 1 835  ? -0.522  -58.428  8.823   1.00 84.53  ? 839  GLU A N     1 
ATOM   6676  C  CA    . GLU A 1 835  ? -0.189  -57.364  7.882   1.00 91.82  ? 839  GLU A CA    1 
ATOM   6677  C  C     . GLU A 1 835  ? -0.599  -57.663  6.440   1.00 100.79 ? 839  GLU A C     1 
ATOM   6678  O  O     . GLU A 1 835  ? -1.201  -56.821  5.778   1.00 104.47 ? 839  GLU A O     1 
ATOM   6679  C  CB    . GLU A 1 835  ? 1.313   -57.081  7.948   1.00 92.87  ? 839  GLU A CB    1 
ATOM   6680  C  CG    . GLU A 1 835  ? 1.847   -57.012  9.370   1.00 106.35 ? 839  GLU A CG    1 
ATOM   6681  C  CD    . GLU A 1 835  ? 3.298   -56.581  9.439   1.00 119.19 ? 839  GLU A CD    1 
ATOM   6682  O  OE1   . GLU A 1 835  ? 4.075   -56.943  8.531   1.00 119.89 ? 839  GLU A OE1   1 
ATOM   6683  O  OE2   . GLU A 1 835  ? 3.660   -55.874  10.404  1.00 130.50 ? 839  GLU A OE2   1 
ATOM   6684  N  N     . GLU A 1 836  ? -0.272  -58.860  5.962   1.00 111.66 ? 840  GLU A N     1 
ATOM   6685  C  CA    . GLU A 1 836  ? -0.481  -59.233  4.562   1.00 98.51  ? 840  GLU A CA    1 
ATOM   6686  C  C     . GLU A 1 836  ? -1.962  -59.270  4.180   1.00 97.27  ? 840  GLU A C     1 
ATOM   6687  O  O     . GLU A 1 836  ? -2.804  -59.680  4.975   1.00 113.78 ? 840  GLU A O     1 
ATOM   6688  C  CB    . GLU A 1 836  ? 0.163   -60.590  4.284   1.00 111.84 ? 840  GLU A CB    1 
ATOM   6689  C  CG    . GLU A 1 836  ? 0.279   -60.944  2.811   1.00 123.70 ? 840  GLU A CG    1 
ATOM   6690  C  CD    . GLU A 1 836  ? 0.930   -62.305  2.581   1.00 124.38 ? 840  GLU A CD    1 
ATOM   6691  O  OE1   . GLU A 1 836  ? 0.975   -63.120  3.529   1.00 124.72 ? 840  GLU A OE1   1 
ATOM   6692  O  OE2   . GLU A 1 836  ? 1.400   -62.555  1.451   1.00 123.39 ? 840  GLU A OE2   1 
ATOM   6693  N  N     . TYR A 1 837  ? -2.264  -58.824  2.962   1.00 89.80  ? 841  TYR A N     1 
ATOM   6694  C  CA    . TYR A 1 837  ? -3.623  -58.833  2.416   1.00 81.38  ? 841  TYR A CA    1 
ATOM   6695  C  C     . TYR A 1 837  ? -4.649  -58.062  3.242   1.00 77.80  ? 841  TYR A C     1 
ATOM   6696  O  O     . TYR A 1 837  ? -5.665  -58.633  3.625   1.00 82.90  ? 841  TYR A O     1 
ATOM   6697  C  CB    . TYR A 1 837  ? -4.109  -60.280  2.252   1.00 85.38  ? 841  TYR A CB    1 
ATOM   6698  C  CG    . TYR A 1 837  ? -3.408  -61.047  1.149   1.00 96.55  ? 841  TYR A CG    1 
ATOM   6699  C  CD1   . TYR A 1 837  ? -3.357  -60.550  -0.146  1.00 92.89  ? 841  TYR A CD1   1 
ATOM   6700  C  CD2   . TYR A 1 837  ? -2.793  -62.263  1.406   1.00 96.55  ? 841  TYR A CD2   1 
ATOM   6701  C  CE1   . TYR A 1 837  ? -2.720  -61.243  -1.154  1.00 90.48  ? 841  TYR A CE1   1 
ATOM   6702  C  CE2   . TYR A 1 837  ? -2.154  -62.962  0.401   1.00 103.66 ? 841  TYR A CE2   1 
ATOM   6703  C  CZ    . TYR A 1 837  ? -2.121  -62.443  -0.878  1.00 100.73 ? 841  TYR A CZ    1 
ATOM   6704  O  OH    . TYR A 1 837  ? -1.484  -63.133  -1.882  1.00 107.46 ? 841  TYR A OH    1 
ATOM   6705  N  N     . PRO A 1 838  ? -4.405  -56.761  3.492   1.00 71.01  ? 842  PRO A N     1 
ATOM   6706  C  CA    . PRO A 1 838  ? -5.255  -55.968  4.389   1.00 65.31  ? 842  PRO A CA    1 
ATOM   6707  C  C     . PRO A 1 838  ? -6.708  -55.834  3.939   1.00 86.46  ? 842  PRO A C     1 
ATOM   6708  O  O     . PRO A 1 838  ? -7.622  -55.999  4.762   1.00 95.86  ? 842  PRO A O     1 
ATOM   6709  C  CB    . PRO A 1 838  ? -4.577  -54.601  4.385   1.00 60.22  ? 842  PRO A CB    1 
ATOM   6710  C  CG    . PRO A 1 838  ? -3.832  -54.530  3.125   1.00 59.81  ? 842  PRO A CG    1 
ATOM   6711  C  CD    . PRO A 1 838  ? -3.365  -55.931  2.861   1.00 71.54  ? 842  PRO A CD    1 
ATOM   6712  N  N     . GLU A 1 839  ? -6.916  -55.551  2.652   1.00 84.63  ? 843  GLU A N     1 
ATOM   6713  C  CA    . GLU A 1 839  ? -8.261  -55.378  2.106   1.00 76.30  ? 843  GLU A CA    1 
ATOM   6714  C  C     . GLU A 1 839  ? -9.097  -56.633  2.298   1.00 78.88  ? 843  GLU A C     1 
ATOM   6715  O  O     . GLU A 1 839  ? -10.322 -56.568  2.460   1.00 75.95  ? 843  GLU A O     1 
ATOM   6716  C  CB    . GLU A 1 839  ? -8.201  -55.015  0.628   1.00 78.98  ? 843  GLU A CB    1 
ATOM   6717  C  CG    . GLU A 1 839  ? -7.554  -53.676  0.347   1.00 85.08  ? 843  GLU A CG    1 
ATOM   6718  C  CD    . GLU A 1 839  ? -7.628  -53.291  -1.115  1.00 101.60 ? 843  GLU A CD    1 
ATOM   6719  O  OE1   . GLU A 1 839  ? -7.790  -54.195  -1.957  1.00 108.63 ? 843  GLU A OE1   1 
ATOM   6720  O  OE2   . GLU A 1 839  ? -7.526  -52.085  -1.423  1.00 112.66 ? 843  GLU A OE2   1 
ATOM   6721  N  N     . HIS A 1 840  ? -8.424  -57.777  2.298   1.00 78.73  ? 844  HIS A N     1 
ATOM   6722  C  CA    . HIS A 1 840  ? -9.104  -59.037  2.541   1.00 79.04  ? 844  HIS A CA    1 
ATOM   6723  C  C     . HIS A 1 840  ? -9.502  -59.176  4.003   1.00 80.95  ? 844  HIS A C     1 
ATOM   6724  O  O     . HIS A 1 840  ? -10.609 -59.581  4.290   1.00 81.74  ? 844  HIS A O     1 
ATOM   6725  C  CB    . HIS A 1 840  ? -8.235  -60.214  2.112   1.00 84.63  ? 844  HIS A CB    1 
ATOM   6726  C  CG    . HIS A 1 840  ? -7.973  -60.252  0.643   1.00 94.29  ? 844  HIS A CG    1 
ATOM   6727  N  ND1   . HIS A 1 840  ? -7.078  -59.404  0.029   1.00 98.12  ? 844  HIS A ND1   1 
ATOM   6728  C  CD2   . HIS A 1 840  ? -8.501  -61.020  -0.337  1.00 96.20  ? 844  HIS A CD2   1 
ATOM   6729  C  CE1   . HIS A 1 840  ? -7.061  -59.654  -1.268  1.00 89.21  ? 844  HIS A CE1   1 
ATOM   6730  N  NE2   . HIS A 1 840  ? -7.912  -60.632  -1.516  1.00 86.87  ? 844  HIS A NE2   1 
ATOM   6731  N  N     . ARG A 1 841  ? -8.609  -58.845  4.928   1.00 77.52  ? 845  ARG A N     1 
ATOM   6732  C  CA    . ARG A 1 841  ? -8.963  -58.878  6.347   1.00 83.63  ? 845  ARG A CA    1 
ATOM   6733  C  C     . ARG A 1 841  ? -10.199 -58.010  6.590   1.00 81.83  ? 845  ARG A C     1 
ATOM   6734  O  O     . ARG A 1 841  ? -11.222 -58.472  7.133   1.00 78.94  ? 845  ARG A O     1 
ATOM   6735  C  CB    . ARG A 1 841  ? -7.791  -58.404  7.207   1.00 73.39  ? 845  ARG A CB    1 
ATOM   6736  C  CG    . ARG A 1 841  ? -6.441  -58.733  6.621   1.00 72.71  ? 845  ARG A CG    1 
ATOM   6737  C  CD    . ARG A 1 841  ? -5.296  -58.405  7.527   1.00 68.65  ? 845  ARG A CD    1 
ATOM   6738  N  NE    . ARG A 1 841  ? -5.011  -59.502  8.437   1.00 79.24  ? 845  ARG A NE    1 
ATOM   6739  C  CZ    . ARG A 1 841  ? -4.113  -60.451  8.212   1.00 91.15  ? 845  ARG A CZ    1 
ATOM   6740  N  NH1   . ARG A 1 841  ? -3.417  -60.438  7.094   1.00 87.67  ? 845  ARG A NH1   1 
ATOM   6741  N  NH2   . ARG A 1 841  ? -3.921  -61.417  9.101   1.00 107.15 ? 845  ARG A NH2   1 
ATOM   6742  N  N     . THR A 1 842  ? -10.106 -56.766  6.133   1.00 59.30  ? 846  THR A N     1 
ATOM   6743  C  CA    . THR A 1 842  ? -11.213 -55.827  6.227   1.00 63.99  ? 846  THR A CA    1 
ATOM   6744  C  C     . THR A 1 842  ? -12.523 -56.378  5.670   1.00 72.83  ? 846  THR A C     1 
ATOM   6745  O  O     . THR A 1 842  ? -13.495 -56.563  6.412   1.00 84.16  ? 846  THR A O     1 
ATOM   6746  C  CB    . THR A 1 842  ? -10.899 -54.520  5.484   1.00 63.32  ? 846  THR A CB    1 
ATOM   6747  O  OG1   . THR A 1 842  ? -9.692  -53.942  5.994   1.00 68.40  ? 846  THR A OG1   1 
ATOM   6748  C  CG2   . THR A 1 842  ? -12.037 -53.534  5.640   1.00 55.48  ? 846  THR A CG2   1 
ATOM   6749  N  N     . ASN A 1 843  ? -12.537 -56.654  4.369   1.00 75.40  ? 847  ASN A N     1 
ATOM   6750  C  CA    . ASN A 1 843  ? -13.754 -57.087  3.690   1.00 66.95  ? 847  ASN A CA    1 
ATOM   6751  C  C     . ASN A 1 843  ? -14.298 -58.416  4.222   1.00 73.44  ? 847  ASN A C     1 
ATOM   6752  O  O     . ASN A 1 843  ? -15.510 -58.615  4.296   1.00 82.12  ? 847  ASN A O     1 
ATOM   6753  C  CB    . ASN A 1 843  ? -13.502 -57.196  2.192   1.00 66.97  ? 847  ASN A CB    1 
ATOM   6754  C  CG    . ASN A 1 843  ? -13.138 -55.867  1.561   1.00 74.01  ? 847  ASN A CG    1 
ATOM   6755  O  OD1   . ASN A 1 843  ? -13.334 -54.810  2.152   1.00 73.78  ? 847  ASN A OD1   1 
ATOM   6756  N  ND2   . ASN A 1 843  ? -12.610 -55.918  0.345   1.00 94.46  ? 847  ASN A ND2   1 
ATOM   6757  N  N     . PHE A 1 844  ? -13.396 -59.315  4.596   1.00 62.02  ? 848  PHE A N     1 
ATOM   6758  C  CA    . PHE A 1 844  ? -13.782 -60.611  5.128   1.00 71.63  ? 848  PHE A CA    1 
ATOM   6759  C  C     . PHE A 1 844  ? -14.530 -60.450  6.433   1.00 84.11  ? 848  PHE A C     1 
ATOM   6760  O  O     . PHE A 1 844  ? -15.607 -61.016  6.610   1.00 89.67  ? 848  PHE A O     1 
ATOM   6761  C  CB    . PHE A 1 844  ? -12.571 -61.512  5.355   1.00 79.71  ? 848  PHE A CB    1 
ATOM   6762  C  CG    . PHE A 1 844  ? -12.895 -62.761  6.117   1.00 100.67 ? 848  PHE A CG    1 
ATOM   6763  C  CD1   . PHE A 1 844  ? -13.542 -63.823  5.493   1.00 107.38 ? 848  PHE A CD1   1 
ATOM   6764  C  CD2   . PHE A 1 844  ? -12.563 -62.879  7.458   1.00 99.11  ? 848  PHE A CD2   1 
ATOM   6765  C  CE1   . PHE A 1 844  ? -13.849 -64.972  6.195   1.00 103.35 ? 848  PHE A CE1   1 
ATOM   6766  C  CE2   . PHE A 1 844  ? -12.868 -64.032  8.157   1.00 98.74  ? 848  PHE A CE2   1 
ATOM   6767  C  CZ    . PHE A 1 844  ? -13.516 -65.069  7.528   1.00 95.14  ? 848  PHE A CZ    1 
ATOM   6768  N  N     . PHE A 1 845  ? -13.967 -59.676  7.355   1.00 84.60  ? 849  PHE A N     1 
ATOM   6769  C  CA    . PHE A 1 845  ? -14.638 -59.531  8.632   1.00 79.32  ? 849  PHE A CA    1 
ATOM   6770  C  C     . PHE A 1 845  ? -15.881 -58.668  8.490   1.00 75.15  ? 849  PHE A C     1 
ATOM   6771  O  O     . PHE A 1 845  ? -16.812 -58.793  9.298   1.00 70.39  ? 849  PHE A O     1 
ATOM   6772  C  CB    . PHE A 1 845  ? -13.669 -59.000  9.682   1.00 69.37  ? 849  PHE A CB    1 
ATOM   6773  C  CG    . PHE A 1 845  ? -12.678 -60.033  10.118  1.00 79.87  ? 849  PHE A CG    1 
ATOM   6774  C  CD1   . PHE A 1 845  ? -13.109 -61.177  10.769  1.00 74.21  ? 849  PHE A CD1   1 
ATOM   6775  C  CD2   . PHE A 1 845  ? -11.332 -59.896  9.834   1.00 85.21  ? 849  PHE A CD2   1 
ATOM   6776  C  CE1   . PHE A 1 845  ? -12.217 -62.151  11.145  1.00 73.86  ? 849  PHE A CE1   1 
ATOM   6777  C  CE2   . PHE A 1 845  ? -10.428 -60.869  10.222  1.00 82.95  ? 849  PHE A CE2   1 
ATOM   6778  C  CZ    . PHE A 1 845  ? -10.873 -61.997  10.879  1.00 79.90  ? 849  PHE A CZ    1 
ATOM   6779  N  N     . LEU A 1 846  ? -15.912 -57.830  7.450   1.00 70.27  ? 850  LEU A N     1 
ATOM   6780  C  CA    . LEU A 1 846  ? -17.138 -57.123  7.087   1.00 66.28  ? 850  LEU A CA    1 
ATOM   6781  C  C     . LEU A 1 846  ? -18.250 -58.114  6.737   1.00 79.42  ? 850  LEU A C     1 
ATOM   6782  O  O     . LEU A 1 846  ? -19.374 -58.020  7.242   1.00 96.96  ? 850  LEU A O     1 
ATOM   6783  C  CB    . LEU A 1 846  ? -16.889 -56.193  5.915   1.00 69.68  ? 850  LEU A CB    1 
ATOM   6784  C  CG    . LEU A 1 846  ? -16.353 -54.808  6.223   1.00 65.59  ? 850  LEU A CG    1 
ATOM   6785  C  CD1   . LEU A 1 846  ? -15.778 -54.179  4.976   1.00 68.02  ? 850  LEU A CD1   1 
ATOM   6786  C  CD2   . LEU A 1 846  ? -17.478 -53.966  6.771   1.00 75.17  ? 850  LEU A CD2   1 
ATOM   6787  N  N     . LEU A 1 847  ? -17.919 -59.070  5.873   1.00 80.15  ? 851  LEU A N     1 
ATOM   6788  C  CA    . LEU A 1 847  ? -18.860 -60.103  5.467   1.00 82.22  ? 851  LEU A CA    1 
ATOM   6789  C  C     . LEU A 1 847  ? -19.316 -60.940  6.659   1.00 92.78  ? 851  LEU A C     1 
ATOM   6790  O  O     . LEU A 1 847  ? -20.508 -61.184  6.844   1.00 91.11  ? 851  LEU A O     1 
ATOM   6791  C  CB    . LEU A 1 847  ? -18.234 -61.007  4.404   1.00 83.45  ? 851  LEU A CB    1 
ATOM   6792  C  CG    . LEU A 1 847  ? -18.973 -62.312  4.089   1.00 77.56  ? 851  LEU A CG    1 
ATOM   6793  C  CD1   . LEU A 1 847  ? -20.351 -62.037  3.510   1.00 73.39  ? 851  LEU A CD1   1 
ATOM   6794  C  CD2   . LEU A 1 847  ? -18.141 -63.164  3.162   1.00 74.55  ? 851  LEU A CD2   1 
ATOM   6795  N  N     . LEU A 1 848  ? -18.354 -61.382  7.462   1.00 94.06  ? 852  LEU A N     1 
ATOM   6796  C  CA    . LEU A 1 848  ? -18.648 -62.172  8.654   1.00 99.64  ? 852  LEU A CA    1 
ATOM   6797  C  C     . LEU A 1 848  ? -19.583 -61.413  9.594   1.00 93.10  ? 852  LEU A C     1 
ATOM   6798  O  O     . LEU A 1 848  ? -20.523 -61.997  10.158  1.00 88.20  ? 852  LEU A O     1 
ATOM   6799  C  CB    . LEU A 1 848  ? -17.358 -62.542  9.383   1.00 91.26  ? 852  LEU A CB    1 
ATOM   6800  C  CG    . LEU A 1 848  ? -17.531 -63.426  10.608  1.00 84.70  ? 852  LEU A CG    1 
ATOM   6801  C  CD1   . LEU A 1 848  ? -18.339 -64.658  10.254  1.00 83.77  ? 852  LEU A CD1   1 
ATOM   6802  C  CD2   . LEU A 1 848  ? -16.173 -63.817  11.173  1.00 88.98  ? 852  LEU A CD2   1 
ATOM   6803  N  N     . GLN A 1 849  ? -19.328 -60.115  9.750   1.00 77.43  ? 853  GLN A N     1 
ATOM   6804  C  CA    . GLN A 1 849  ? -20.210 -59.260  10.532  1.00 77.20  ? 853  GLN A CA    1 
ATOM   6805  C  C     . GLN A 1 849  ? -21.623 -59.263  9.975   1.00 86.57  ? 853  GLN A C     1 
ATOM   6806  O  O     . GLN A 1 849  ? -22.595 -59.410  10.721  1.00 88.53  ? 853  GLN A O     1 
ATOM   6807  C  CB    . GLN A 1 849  ? -19.684 -57.829  10.577  1.00 76.24  ? 853  GLN A CB    1 
ATOM   6808  C  CG    . GLN A 1 849  ? -20.704 -56.840  11.092  1.00 78.64  ? 853  GLN A CG    1 
ATOM   6809  C  CD    . GLN A 1 849  ? -20.081 -55.566  11.585  1.00 85.07  ? 853  GLN A CD    1 
ATOM   6810  O  OE1   . GLN A 1 849  ? -19.031 -55.149  11.097  1.00 99.74  ? 853  GLN A OE1   1 
ATOM   6811  N  NE2   . GLN A 1 849  ? -20.720 -54.936  12.569  1.00 92.71  ? 853  GLN A NE2   1 
ATOM   6812  N  N     . ALA A 1 850  ? -21.726 -59.099  8.657   1.00 96.29  ? 854  ALA A N     1 
ATOM   6813  C  CA    . ALA A 1 850  ? -23.021 -59.087  7.978   1.00 84.38  ? 854  ALA A CA    1 
ATOM   6814  C  C     . ALA A 1 850  ? -23.793 -60.377  8.224   1.00 87.00  ? 854  ALA A C     1 
ATOM   6815  O  O     . ALA A 1 850  ? -24.993 -60.351  8.527   1.00 86.51  ? 854  ALA A O     1 
ATOM   6816  C  CB    . ALA A 1 850  ? -22.833 -58.866  6.494   1.00 79.26  ? 854  ALA A CB    1 
ATOM   6817  N  N     . VAL A 1 851  ? -23.093 -61.500  8.105   1.00 88.95  ? 855  VAL A N     1 
ATOM   6818  C  CA    . VAL A 1 851  ? -23.705 -62.808  8.284   1.00 101.07 ? 855  VAL A CA    1 
ATOM   6819  C  C     . VAL A 1 851  ? -24.177 -63.008  9.719   1.00 105.85 ? 855  VAL A C     1 
ATOM   6820  O  O     . VAL A 1 851  ? -25.305 -63.460  9.957   1.00 94.95  ? 855  VAL A O     1 
ATOM   6821  C  CB    . VAL A 1 851  ? -22.733 -63.945  7.907   1.00 103.66 ? 855  VAL A CB    1 
ATOM   6822  C  CG1   . VAL A 1 851  ? -23.336 -65.310  8.241   1.00 94.08  ? 855  VAL A CG1   1 
ATOM   6823  C  CG2   . VAL A 1 851  ? -22.370 -63.858  6.433   1.00 100.72 ? 855  VAL A CG2   1 
ATOM   6824  N  N     . ASN A 1 852  ? -23.315 -62.673  10.677  1.00 113.51 ? 856  ASN A N     1 
ATOM   6825  C  CA    . ASN A 1 852  ? -23.673 -62.830  12.083  1.00 107.40 ? 856  ASN A CA    1 
ATOM   6826  C  C     . ASN A 1 852  ? -24.843 -61.935  12.468  1.00 92.31  ? 856  ASN A C     1 
ATOM   6827  O  O     . ASN A 1 852  ? -25.681 -62.316  13.277  1.00 91.54  ? 856  ASN A O     1 
ATOM   6828  C  CB    . ASN A 1 852  ? -22.471 -62.537  12.979  1.00 114.55 ? 856  ASN A CB    1 
ATOM   6829  C  CG    . ASN A 1 852  ? -22.790 -62.695  14.455  1.00 125.24 ? 856  ASN A CG    1 
ATOM   6830  O  OD1   . ASN A 1 852  ? -22.820 -63.807  14.981  1.00 135.48 ? 856  ASN A OD1   1 
ATOM   6831  N  ND2   . ASN A 1 852  ? -23.029 -61.577  15.131  1.00 126.28 ? 856  ASN A ND2   1 
ATOM   6832  N  N     . SER A 1 853  ? -24.914 -60.757  11.861  1.00 89.81  ? 857  SER A N     1 
ATOM   6833  C  CA    . SER A 1 853  ? -25.941 -59.786  12.216  1.00 95.87  ? 857  SER A CA    1 
ATOM   6834  C  C     . SER A 1 853  ? -27.292 -60.065  11.556  1.00 109.95 ? 857  SER A C     1 
ATOM   6835  O  O     . SER A 1 853  ? -28.335 -59.819  12.158  1.00 113.12 ? 857  SER A O     1 
ATOM   6836  C  CB    . SER A 1 853  ? -25.481 -58.376  11.856  1.00 100.24 ? 857  SER A CB    1 
ATOM   6837  O  OG    . SER A 1 853  ? -26.398 -57.411  12.337  1.00 112.54 ? 857  SER A OG    1 
ATOM   6838  N  N     . HIS A 1 854  ? -27.282 -60.578  10.328  1.00 114.03 ? 858  HIS A N     1 
ATOM   6839  C  CA    . HIS A 1 854  ? -28.534 -60.766  9.591   1.00 97.07  ? 858  HIS A CA    1 
ATOM   6840  C  C     . HIS A 1 854  ? -28.910 -62.227  9.358   1.00 95.65  ? 858  HIS A C     1 
ATOM   6841  O  O     . HIS A 1 854  ? -30.072 -62.527  9.074   1.00 103.85 ? 858  HIS A O     1 
ATOM   6842  C  CB    . HIS A 1 854  ? -28.463 -60.038  8.255   1.00 80.03  ? 858  HIS A CB    1 
ATOM   6843  C  CG    . HIS A 1 854  ? -28.428 -58.549  8.386   1.00 89.85  ? 858  HIS A CG    1 
ATOM   6844  N  ND1   . HIS A 1 854  ? -29.569 -57.785  8.502   1.00 97.47  ? 858  HIS A ND1   1 
ATOM   6845  C  CD2   . HIS A 1 854  ? -27.390 -57.679  8.411   1.00 100.78 ? 858  HIS A CD2   1 
ATOM   6846  C  CE1   . HIS A 1 854  ? -29.237 -56.510  8.593   1.00 109.52 ? 858  HIS A CE1   1 
ATOM   6847  N  NE2   . HIS A 1 854  ? -27.920 -56.418  8.540   1.00 107.51 ? 858  HIS A NE2   1 
ATOM   6848  N  N     . CYS A 1 855  ? -27.944 -63.133  9.492   1.00 87.04  ? 859  CYS A N     1 
ATOM   6849  C  CA    . CYS A 1 855  ? -28.191 -64.547  9.217   1.00 97.46  ? 859  CYS A CA    1 
ATOM   6850  C  C     . CYS A 1 855  ? -27.589 -65.459  10.282  1.00 116.25 ? 859  CYS A C     1 
ATOM   6851  O  O     . CYS A 1 855  ? -26.905 -66.425  9.959   1.00 130.45 ? 859  CYS A O     1 
ATOM   6852  C  CB    . CYS A 1 855  ? -27.631 -64.933  7.839   1.00 109.36 ? 859  CYS A CB    1 
ATOM   6853  S  SG    . CYS A 1 855  ? -28.221 -63.930  6.448   1.00 126.82 ? 859  CYS A SG    1 
ATOM   6854  N  N     . PHE A 1 856  ? -27.844 -65.160  11.551  1.00 115.57 ? 860  PHE A N     1 
ATOM   6855  C  CA    . PHE A 1 856  ? -27.333 -65.976  12.660  1.00 106.17 ? 860  PHE A CA    1 
ATOM   6856  C  C     . PHE A 1 856  ? -27.790 -67.460  12.668  1.00 108.68 ? 860  PHE A C     1 
ATOM   6857  O  O     . PHE A 1 856  ? -27.011 -68.378  13.067  1.00 118.51 ? 860  PHE A O     1 
ATOM   6858  C  CB    . PHE A 1 856  ? -27.718 -65.304  13.987  1.00 109.04 ? 860  PHE A CB    1 
ATOM   6859  C  CG    . PHE A 1 856  ? -27.306 -66.082  15.194  1.00 116.06 ? 860  PHE A CG    1 
ATOM   6860  C  CD1   . PHE A 1 856  ? -25.965 -66.288  15.467  1.00 118.10 ? 860  PHE A CD1   1 
ATOM   6861  C  CD2   . PHE A 1 856  ? -28.255 -66.623  16.048  1.00 126.72 ? 860  PHE A CD2   1 
ATOM   6862  C  CE1   . PHE A 1 856  ? -25.573 -67.017  16.573  1.00 119.26 ? 860  PHE A CE1   1 
ATOM   6863  C  CE2   . PHE A 1 856  ? -27.869 -67.348  17.156  1.00 128.00 ? 860  PHE A CE2   1 
ATOM   6864  C  CZ    . PHE A 1 856  ? -26.525 -67.546  17.418  1.00 123.64 ? 860  PHE A CZ    1 
ATOM   6865  N  N     . PRO A 1 857  ? -29.050 -67.721  12.259  1.00 107.20 ? 861  PRO A N     1 
ATOM   6866  C  CA    . PRO A 1 857  ? -29.443 -69.134  12.232  1.00 100.56 ? 861  PRO A CA    1 
ATOM   6867  C  C     . PRO A 1 857  ? -28.494 -70.021  11.431  1.00 114.36 ? 861  PRO A C     1 
ATOM   6868  O  O     . PRO A 1 857  ? -28.401 -71.197  11.721  1.00 87.98  ? 861  PRO A O     1 
ATOM   6869  C  CB    . PRO A 1 857  ? -30.824 -69.092  11.582  1.00 97.90  ? 861  PRO A CB    1 
ATOM   6870  C  CG    . PRO A 1 857  ? -31.380 -67.792  12.015  1.00 101.50 ? 861  PRO A CG    1 
ATOM   6871  C  CD    . PRO A 1 857  ? -30.216 -66.838  12.041  1.00 91.69  ? 861  PRO A CD    1 
ATOM   6872  N  N     . ALA A 1 858  ? -27.788 -69.455  10.458  1.00 109.05 ? 862  ALA A N     1 
ATOM   6873  C  CA    . ALA A 1 858  ? -26.816 -70.207  9.670   1.00 107.28 ? 862  ALA A CA    1 
ATOM   6874  C  C     . ALA A 1 858  ? -25.726 -70.775  10.565  1.00 109.62 ? 862  ALA A C     1 
ATOM   6875  O  O     . ALA A 1 858  ? -25.269 -71.900  10.364  1.00 102.49 ? 862  ALA A O     1 
ATOM   6876  C  CB    . ALA A 1 858  ? -26.210 -69.331  8.592   1.00 108.48 ? 862  ALA A CB    1 
ATOM   6877  N  N     . PHE A 1 859  ? -25.317 -69.986  11.554  1.00 113.64 ? 863  PHE A N     1 
ATOM   6878  C  CA    . PHE A 1 859  ? -24.367 -70.446  12.558  1.00 104.08 ? 863  PHE A CA    1 
ATOM   6879  C  C     . PHE A 1 859  ? -24.996 -71.548  13.376  1.00 109.92 ? 863  PHE A C     1 
ATOM   6880  O  O     . PHE A 1 859  ? -24.324 -72.506  13.764  1.00 113.27 ? 863  PHE A O     1 
ATOM   6881  C  CB    . PHE A 1 859  ? -23.931 -69.304  13.464  1.00 100.70 ? 863  PHE A CB    1 
ATOM   6882  C  CG    . PHE A 1 859  ? -23.001 -68.341  12.808  1.00 112.00 ? 863  PHE A CG    1 
ATOM   6883  C  CD1   . PHE A 1 859  ? -21.884 -68.793  12.124  1.00 112.53 ? 863  PHE A CD1   1 
ATOM   6884  C  CD2   . PHE A 1 859  ? -23.244 -66.980  12.864  1.00 115.23 ? 863  PHE A CD2   1 
ATOM   6885  C  CE1   . PHE A 1 859  ? -21.022 -67.903  11.515  1.00 115.54 ? 863  PHE A CE1   1 
ATOM   6886  C  CE2   . PHE A 1 859  ? -22.387 -66.086  12.251  1.00 118.30 ? 863  PHE A CE2   1 
ATOM   6887  C  CZ    . PHE A 1 859  ? -21.276 -66.549  11.576  1.00 118.06 ? 863  PHE A CZ    1 
ATOM   6888  N  N     . LEU A 1 860  ? -26.295 -71.418  13.639  1.00 120.52 ? 864  LEU A N     1 
ATOM   6889  C  CA    . LEU A 1 860  ? -26.987 -72.518  14.335  1.00 122.61 ? 864  LEU A CA    1 
ATOM   6890  C  C     . LEU A 1 860  ? -27.155 -73.773  13.467  1.00 132.07 ? 864  LEU A C     1 
ATOM   6891  O  O     . LEU A 1 860  ? -27.526 -74.837  13.964  1.00 141.77 ? 864  LEU A O     1 
ATOM   6892  C  CB    . LEU A 1 860  ? -28.364 -72.076  14.825  1.00 119.57 ? 864  LEU A CB    1 
ATOM   6893  C  CG    . LEU A 1 860  ? -28.442 -71.026  15.927  1.00 126.35 ? 864  LEU A CG    1 
ATOM   6894  C  CD1   . LEU A 1 860  ? -29.880 -70.574  16.072  1.00 130.44 ? 864  LEU A CD1   1 
ATOM   6895  C  CD2   . LEU A 1 860  ? -27.906 -71.565  17.243  1.00 118.87 ? 864  LEU A CD2   1 
ATOM   6896  N  N     . ALA A 1 861  ? -26.883 -73.641  12.172  1.00 135.07 ? 865  ALA A N     1 
ATOM   6897  C  CA    . ALA A 1 861  ? -27.144 -74.712  11.214  1.00 135.61 ? 865  ALA A CA    1 
ATOM   6898  C  C     . ALA A 1 861  ? -25.865 -75.318  10.629  1.00 132.17 ? 865  ALA A C     1 
ATOM   6899  O  O     . ALA A 1 861  ? -25.924 -76.145  9.725   1.00 141.11 ? 865  ALA A O     1 
ATOM   6900  C  CB    . ALA A 1 861  ? -28.039 -74.197  10.095  1.00 139.34 ? 865  ALA A CB    1 
ATOM   6901  N  N     . ILE A 1 862  ? -24.712 -74.922  11.159  1.00 127.75 ? 866  ILE A N     1 
ATOM   6902  C  CA    . ILE A 1 862  ? -23.429 -75.438  10.686  1.00 120.95 ? 866  ILE A CA    1 
ATOM   6903  C  C     . ILE A 1 862  ? -22.725 -76.248  11.770  1.00 126.07 ? 866  ILE A C     1 
ATOM   6904  O  O     . ILE A 1 862  ? -22.935 -76.006  12.962  1.00 130.50 ? 866  ILE A O     1 
ATOM   6905  C  CB    . ILE A 1 862  ? -22.489 -74.296  10.228  1.00 113.12 ? 866  ILE A CB    1 
ATOM   6906  C  CG1   . ILE A 1 862  ? -22.310 -73.260  11.353  1.00 103.46 ? 866  ILE A CG1   1 
ATOM   6907  C  CG2   . ILE A 1 862  ? -23.014 -73.651  8.951   1.00 87.90  ? 866  ILE A CG2   1 
ATOM   6908  C  CD1   . ILE A 1 862  ? -21.152 -72.311  11.146  1.00 90.52  ? 866  ILE A CD1   1 
ATOM   6909  N  N     . PRO A 1 863  ? -21.887 -77.217  11.361  1.00 119.55 ? 867  PRO A N     1 
ATOM   6910  C  CA    . PRO A 1 863  ? -21.122 -78.071  12.284  1.00 125.28 ? 867  PRO A CA    1 
ATOM   6911  C  C     . PRO A 1 863  ? -20.369 -77.290  13.365  1.00 140.50 ? 867  PRO A C     1 
ATOM   6912  O  O     . PRO A 1 863  ? -19.914 -76.170  13.111  1.00 155.38 ? 867  PRO A O     1 
ATOM   6913  C  CB    . PRO A 1 863  ? -20.134 -78.783  11.359  1.00 121.23 ? 867  PRO A CB    1 
ATOM   6914  C  CG    . PRO A 1 863  ? -20.871 -78.889  10.077  1.00 125.55 ? 867  PRO A CG    1 
ATOM   6915  C  CD    . PRO A 1 863  ? -21.695 -77.624  9.958   1.00 117.55 ? 867  PRO A CD    1 
ATOM   6916  N  N     . PRO A 1 864  ? -20.241 -77.878  14.562  1.00 129.89 ? 868  PRO A N     1 
ATOM   6917  C  CA    . PRO A 1 864  ? -19.560 -77.269  15.709  1.00 112.71 ? 868  PRO A CA    1 
ATOM   6918  C  C     . PRO A 1 864  ? -18.084 -77.016  15.436  1.00 113.44 ? 868  PRO A C     1 
ATOM   6919  O  O     . PRO A 1 864  ? -17.571 -75.943  15.762  1.00 122.86 ? 868  PRO A O     1 
ATOM   6920  C  CB    . PRO A 1 864  ? -19.730 -78.314  16.812  1.00 112.85 ? 868  PRO A CB    1 
ATOM   6921  C  CG    . PRO A 1 864  ? -20.864 -79.159  16.372  1.00 117.07 ? 868  PRO A CG    1 
ATOM   6922  C  CD    . PRO A 1 864  ? -20.789 -79.203  14.891  1.00 126.69 ? 868  PRO A CD    1 
ATOM   6923  N  N     . THR A 1 865  ? -17.417 -78.005  14.847  1.00 111.09 ? 869  THR A N     1 
ATOM   6924  C  CA    . THR A 1 865  ? -16.000 -77.914  14.505  1.00 116.42 ? 869  THR A CA    1 
ATOM   6925  C  C     . THR A 1 865  ? -15.711 -76.689  13.632  1.00 123.47 ? 869  THR A C     1 
ATOM   6926  O  O     . THR A 1 865  ? -14.652 -76.068  13.739  1.00 131.60 ? 869  THR A O     1 
ATOM   6927  C  CB    . THR A 1 865  ? -15.529 -79.196  13.785  1.00 117.95 ? 869  THR A CB    1 
ATOM   6928  O  OG1   . THR A 1 865  ? -15.574 -80.298  14.698  1.00 121.48 ? 869  THR A OG1   1 
ATOM   6929  C  CG2   . THR A 1 865  ? -14.106 -79.050  13.262  1.00 115.63 ? 869  THR A CG2   1 
ATOM   6930  N  N     . GLN A 1 866  ? -16.671 -76.328  12.789  1.00 121.30 ? 870  GLN A N     1 
ATOM   6931  C  CA    . GLN A 1 866  ? -16.540 -75.157  11.930  1.00 121.64 ? 870  GLN A CA    1 
ATOM   6932  C  C     . GLN A 1 866  ? -16.850 -73.870  12.683  1.00 115.58 ? 870  GLN A C     1 
ATOM   6933  O  O     . GLN A 1 866  ? -16.235 -72.822  12.431  1.00 117.87 ? 870  GLN A O     1 
ATOM   6934  C  CB    . GLN A 1 866  ? -17.460 -75.289  10.711  1.00 124.16 ? 870  GLN A CB    1 
ATOM   6935  C  CG    . GLN A 1 866  ? -17.264 -76.571  9.919   1.00 118.21 ? 870  GLN A CG    1 
ATOM   6936  C  CD    . GLN A 1 866  ? -15.923 -76.626  9.215   1.00 127.15 ? 870  GLN A CD    1 
ATOM   6937  O  OE1   . GLN A 1 866  ? -15.226 -75.620  9.098   1.00 121.68 ? 870  GLN A OE1   1 
ATOM   6938  N  NE2   . GLN A 1 866  ? -15.557 -77.807  8.735   1.00 149.36 ? 870  GLN A NE2   1 
ATOM   6939  N  N     . PHE A 1 867  ? -17.810 -73.951  13.601  1.00 120.46 ? 871  PHE A N     1 
ATOM   6940  C  CA    . PHE A 1 867  ? -18.183 -72.803  14.426  1.00 123.90 ? 871  PHE A CA    1 
ATOM   6941  C  C     . PHE A 1 867  ? -17.010 -72.368  15.296  1.00 115.06 ? 871  PHE A C     1 
ATOM   6942  O  O     . PHE A 1 867  ? -16.825 -71.182  15.571  1.00 113.51 ? 871  PHE A O     1 
ATOM   6943  C  CB    . PHE A 1 867  ? -19.400 -73.130  15.290  1.00 129.61 ? 871  PHE A CB    1 
ATOM   6944  C  CG    . PHE A 1 867  ? -19.986 -71.938  15.988  1.00 133.19 ? 871  PHE A CG    1 
ATOM   6945  C  CD1   . PHE A 1 867  ? -20.884 -71.108  15.337  1.00 134.73 ? 871  PHE A CD1   1 
ATOM   6946  C  CD2   . PHE A 1 867  ? -19.645 -71.649  17.298  1.00 134.41 ? 871  PHE A CD2   1 
ATOM   6947  C  CE1   . PHE A 1 867  ? -21.427 -70.008  15.976  1.00 133.28 ? 871  PHE A CE1   1 
ATOM   6948  C  CE2   . PHE A 1 867  ? -20.184 -70.551  17.946  1.00 140.04 ? 871  PHE A CE2   1 
ATOM   6949  C  CZ    . PHE A 1 867  ? -21.077 -69.727  17.282  1.00 139.42 ? 871  PHE A CZ    1 
ATOM   6950  N  N     . LYS A 1 868  ? -16.221 -73.348  15.720  1.00 119.47 ? 872  LYS A N     1 
ATOM   6951  C  CA    . LYS A 1 868  ? -14.960 -73.084  16.400  1.00 129.66 ? 872  LYS A CA    1 
ATOM   6952  C  C     . LYS A 1 868  ? -14.064 -72.204  15.531  1.00 130.36 ? 872  LYS A C     1 
ATOM   6953  O  O     . LYS A 1 868  ? -13.446 -71.253  16.014  1.00 140.68 ? 872  LYS A O     1 
ATOM   6954  C  CB    . LYS A 1 868  ? -14.262 -74.404  16.750  1.00 130.79 ? 872  LYS A CB    1 
ATOM   6955  C  CG    . LYS A 1 868  ? -12.748 -74.333  16.862  1.00 131.17 ? 872  LYS A CG    1 
ATOM   6956  C  CD    . LYS A 1 868  ? -12.288 -73.614  18.116  1.00 124.12 ? 872  LYS A CD    1 
ATOM   6957  C  CE    . LYS A 1 868  ? -10.816 -73.886  18.365  1.00 132.64 ? 872  LYS A CE    1 
ATOM   6958  N  NZ    . LYS A 1 868  ? -10.028 -73.765  17.107  1.00 150.31 ? 872  LYS A NZ    1 
ATOM   6959  N  N     . LEU A 1 869  ? -14.018 -72.517  14.240  1.00 124.93 ? 873  LEU A N     1 
ATOM   6960  C  CA    . LEU A 1 869  ? -13.207 -71.763  13.288  1.00 120.95 ? 873  LEU A CA    1 
ATOM   6961  C  C     . LEU A 1 869  ? -13.732 -70.343  13.104  1.00 112.15 ? 873  LEU A C     1 
ATOM   6962  O  O     . LEU A 1 869  ? -12.951 -69.397  12.996  1.00 116.10 ? 873  LEU A O     1 
ATOM   6963  C  CB    . LEU A 1 869  ? -13.161 -72.481  11.939  1.00 114.88 ? 873  LEU A CB    1 
ATOM   6964  C  CG    . LEU A 1 869  ? -11.944 -72.202  11.060  1.00 107.74 ? 873  LEU A CG    1 
ATOM   6965  C  CD1   . LEU A 1 869  ? -10.679 -72.656  11.762  1.00 111.44 ? 873  LEU A CD1   1 
ATOM   6966  C  CD2   . LEU A 1 869  ? -12.094 -72.901  9.720   1.00 115.89 ? 873  LEU A CD2   1 
ATOM   6967  N  N     . VAL A 1 870  ? -15.056 -70.195  13.073  1.00 106.97 ? 874  VAL A N     1 
ATOM   6968  C  CA    . VAL A 1 870  ? -15.671 -68.865  12.999  1.00 105.50 ? 874  VAL A CA    1 
ATOM   6969  C  C     . VAL A 1 870  ? -15.307 -68.007  14.211  1.00 108.39 ? 874  VAL A C     1 
ATOM   6970  O  O     . VAL A 1 870  ? -14.831 -66.876  14.071  1.00 111.49 ? 874  VAL A O     1 
ATOM   6971  C  CB    . VAL A 1 870  ? -17.210 -68.957  12.895  1.00 107.03 ? 874  VAL A CB    1 
ATOM   6972  C  CG1   . VAL A 1 870  ? -17.852 -67.613  13.189  1.00 77.73  ? 874  VAL A CG1   1 
ATOM   6973  C  CG2   . VAL A 1 870  ? -17.620 -69.470  11.528  1.00 96.87  ? 874  VAL A CG2   1 
ATOM   6974  N  N     . LEU A 1 871  ? -15.536 -68.564  15.398  1.00 112.68 ? 875  LEU A N     1 
ATOM   6975  C  CA    . LEU A 1 871  ? -15.223 -67.901  16.662  1.00 109.05 ? 875  LEU A CA    1 
ATOM   6976  C  C     . LEU A 1 871  ? -13.753 -67.483  16.697  1.00 103.85 ? 875  LEU A C     1 
ATOM   6977  O  O     . LEU A 1 871  ? -13.415 -66.347  17.055  1.00 106.20 ? 875  LEU A O     1 
ATOM   6978  C  CB    . LEU A 1 871  ? -15.553 -68.835  17.831  1.00 120.21 ? 875  LEU A CB    1 
ATOM   6979  C  CG    . LEU A 1 871  ? -15.901 -68.273  19.211  1.00 120.95 ? 875  LEU A CG    1 
ATOM   6980  C  CD1   . LEU A 1 871  ? -14.657 -67.826  19.956  1.00 132.48 ? 875  LEU A CD1   1 
ATOM   6981  C  CD2   . LEU A 1 871  ? -16.901 -67.126  19.095  1.00 109.65 ? 875  LEU A CD2   1 
ATOM   6982  N  N     . ASP A 1 872  ? -12.884 -68.408  16.299  1.00 98.83  ? 876  ASP A N     1 
ATOM   6983  C  CA    . ASP A 1 872  ? -11.458 -68.125  16.218  1.00 107.47 ? 876  ASP A CA    1 
ATOM   6984  C  C     . ASP A 1 872  ? -11.175 -66.988  15.254  1.00 112.64 ? 876  ASP A C     1 
ATOM   6985  O  O     . ASP A 1 872  ? -10.297 -66.166  15.518  1.00 110.86 ? 876  ASP A O     1 
ATOM   6986  C  CB    . ASP A 1 872  ? -10.680 -69.367  15.794  1.00 122.64 ? 876  ASP A CB    1 
ATOM   6987  C  CG    . ASP A 1 872  ? -10.531 -70.373  16.919  1.00 133.29 ? 876  ASP A CG    1 
ATOM   6988  O  OD1   . ASP A 1 872  ? -11.018 -70.099  18.036  1.00 136.28 ? 876  ASP A OD1   1 
ATOM   6989  O  OD2   . ASP A 1 872  ? -9.912  -71.430  16.687  1.00 137.66 ? 876  ASP A OD2   1 
ATOM   6990  N  N     . SER A 1 873  ? -11.913 -66.943  14.144  1.00 110.76 ? 877  SER A N     1 
ATOM   6991  C  CA    . SER A 1 873  ? -11.756 -65.858  13.184  1.00 103.45 ? 877  SER A CA    1 
ATOM   6992  C  C     . SER A 1 873  ? -12.102 -64.523  13.847  1.00 95.87  ? 877  SER A C     1 
ATOM   6993  O  O     . SER A 1 873  ? -11.398 -63.533  13.650  1.00 89.81  ? 877  SER A O     1 
ATOM   6994  C  CB    . SER A 1 873  ? -12.617 -66.090  11.940  1.00 109.39 ? 877  SER A CB    1 
ATOM   6995  O  OG    . SER A 1 873  ? -13.998 -65.986  12.235  1.00 122.75 ? 877  SER A OG    1 
ATOM   6996  N  N     . ILE A 1 874  ? -13.163 -64.507  14.653  1.00 89.37  ? 878  ILE A N     1 
ATOM   6997  C  CA    . ILE A 1 874  ? -13.549 -63.294  15.381  1.00 87.60  ? 878  ILE A CA    1 
ATOM   6998  C  C     . ILE A 1 874  ? -12.461 -62.820  16.351  1.00 86.42  ? 878  ILE A C     1 
ATOM   6999  O  O     . ILE A 1 874  ? -12.051 -61.646  16.341  1.00 89.61  ? 878  ILE A O     1 
ATOM   7000  C  CB    . ILE A 1 874  ? -14.849 -63.504  16.175  1.00 83.02  ? 878  ILE A CB    1 
ATOM   7001  C  CG1   . ILE A 1 874  ? -15.994 -63.877  15.237  1.00 83.95  ? 878  ILE A CG1   1 
ATOM   7002  C  CG2   . ILE A 1 874  ? -15.198 -62.254  16.964  1.00 88.94  ? 878  ILE A CG2   1 
ATOM   7003  C  CD1   . ILE A 1 874  ? -17.272 -64.234  15.961  1.00 89.62  ? 878  ILE A CD1   1 
ATOM   7004  N  N     . ILE A 1 875  ? -12.009 -63.740  17.199  1.00 78.81  ? 879  ILE A N     1 
ATOM   7005  C  CA    . ILE A 1 875  ? -10.926 -63.447  18.138  1.00 77.07  ? 879  ILE A CA    1 
ATOM   7006  C  C     . ILE A 1 875  ? -9.731  -62.877  17.403  1.00 83.58  ? 879  ILE A C     1 
ATOM   7007  O  O     . ILE A 1 875  ? -9.228  -61.808  17.743  1.00 94.33  ? 879  ILE A O     1 
ATOM   7008  C  CB    . ILE A 1 875  ? -10.474 -64.704  18.905  1.00 87.12  ? 879  ILE A CB    1 
ATOM   7009  C  CG1   . ILE A 1 875  ? -11.615 -65.246  19.755  1.00 84.56  ? 879  ILE A CG1   1 
ATOM   7010  C  CG2   . ILE A 1 875  ? -9.252  -64.407  19.748  1.00 74.57  ? 879  ILE A CG2   1 
ATOM   7011  C  CD1   . ILE A 1 875  ? -11.287 -66.550  20.420  1.00 91.99  ? 879  ILE A CD1   1 
ATOM   7012  N  N     . TRP A 1 876  ? -9.305  -63.608  16.380  1.00 82.78  ? 880  TRP A N     1 
ATOM   7013  C  CA    . TRP A 1 876  ? -8.228  -63.202  15.489  1.00 74.46  ? 880  TRP A CA    1 
ATOM   7014  C  C     . TRP A 1 876  ? -8.437  -61.777  14.985  1.00 80.06  ? 880  TRP A C     1 
ATOM   7015  O  O     . TRP A 1 876  ? -7.490  -60.991  14.904  1.00 89.27  ? 880  TRP A O     1 
ATOM   7016  C  CB    . TRP A 1 876  ? -8.140  -64.177  14.316  1.00 74.98  ? 880  TRP A CB    1 
ATOM   7017  C  CG    . TRP A 1 876  ? -7.027  -63.905  13.366  1.00 86.31  ? 880  TRP A CG    1 
ATOM   7018  C  CD1   . TRP A 1 876  ? -7.138  -63.484  12.079  1.00 82.69  ? 880  TRP A CD1   1 
ATOM   7019  C  CD2   . TRP A 1 876  ? -5.626  -64.029  13.633  1.00 89.72  ? 880  TRP A CD2   1 
ATOM   7020  N  NE1   . TRP A 1 876  ? -5.893  -63.339  11.524  1.00 85.77  ? 880  TRP A NE1   1 
ATOM   7021  C  CE2   . TRP A 1 876  ? -4.946  -63.669  12.455  1.00 84.03  ? 880  TRP A CE2   1 
ATOM   7022  C  CE3   . TRP A 1 876  ? -4.882  -64.403  14.756  1.00 92.07  ? 880  TRP A CE3   1 
ATOM   7023  C  CZ2   . TRP A 1 876  ? -3.559  -63.675  12.361  1.00 92.91  ? 880  TRP A CZ2   1 
ATOM   7024  C  CZ3   . TRP A 1 876  ? -3.502  -64.413  14.663  1.00 98.91  ? 880  TRP A CZ3   1 
ATOM   7025  C  CH2   . TRP A 1 876  ? -2.854  -64.049  13.471  1.00 102.28 ? 880  TRP A CH2   1 
ATOM   7026  N  N     . ALA A 1 877  ? -9.687  -61.443  14.669  1.00 77.71  ? 881  ALA A N     1 
ATOM   7027  C  CA    . ALA A 1 877  ? -10.023 -60.104  14.203  1.00 73.14  ? 881  ALA A CA    1 
ATOM   7028  C  C     . ALA A 1 877  ? -9.734  -59.066  15.269  1.00 86.55  ? 881  ALA A C     1 
ATOM   7029  O  O     . ALA A 1 877  ? -9.065  -58.079  14.978  1.00 93.63  ? 881  ALA A O     1 
ATOM   7030  C  CB    . ALA A 1 877  ? -11.474 -60.027  13.780  1.00 69.83  ? 881  ALA A CB    1 
ATOM   7031  N  N     . PHE A 1 878  ? -10.212 -59.266  16.500  1.00 97.06  ? 882  PHE A N     1 
ATOM   7032  C  CA    . PHE A 1 878  ? -9.969  -58.217  17.498  1.00 83.91  ? 882  PHE A CA    1 
ATOM   7033  C  C     . PHE A 1 878  ? -8.540  -58.258  18.051  1.00 83.36  ? 882  PHE A C     1 
ATOM   7034  O  O     . PHE A 1 878  ? -8.179  -57.444  18.905  1.00 105.73 ? 882  PHE A O     1 
ATOM   7035  C  CB    . PHE A 1 878  ? -11.009 -58.246  18.649  1.00 85.15  ? 882  PHE A CB    1 
ATOM   7036  C  CG    . PHE A 1 878  ? -10.969 -59.470  19.548  1.00 85.59  ? 882  PHE A CG    1 
ATOM   7037  C  CD1   . PHE A 1 878  ? -9.841  -59.803  20.285  1.00 88.60  ? 882  PHE A CD1   1 
ATOM   7038  C  CD2   . PHE A 1 878  ? -12.116 -60.231  19.726  1.00 84.86  ? 882  PHE A CD2   1 
ATOM   7039  C  CE1   . PHE A 1 878  ? -9.837  -60.907  21.122  1.00 90.76  ? 882  PHE A CE1   1 
ATOM   7040  C  CE2   . PHE A 1 878  ? -12.121 -61.326  20.569  1.00 87.55  ? 882  PHE A CE2   1 
ATOM   7041  C  CZ    . PHE A 1 878  ? -10.978 -61.664  21.265  1.00 87.77  ? 882  PHE A CZ    1 
ATOM   7042  N  N     . LYS A 1 879  ? -7.728  -59.195  17.568  1.00 75.16  ? 883  LYS A N     1 
ATOM   7043  C  CA    . LYS A 1 879  ? -6.317  -59.231  17.941  1.00 81.38  ? 883  LYS A CA    1 
ATOM   7044  C  C     . LYS A 1 879  ? -5.472  -58.312  17.047  1.00 86.44  ? 883  LYS A C     1 
ATOM   7045  O  O     . LYS A 1 879  ? -4.268  -58.164  17.259  1.00 80.33  ? 883  LYS A O     1 
ATOM   7046  C  CB    . LYS A 1 879  ? -5.777  -60.658  17.867  1.00 81.76  ? 883  LYS A CB    1 
ATOM   7047  C  CG    . LYS A 1 879  ? -6.324  -61.602  18.920  1.00 91.12  ? 883  LYS A CG    1 
ATOM   7048  C  CD    . LYS A 1 879  ? -5.438  -61.656  20.138  1.00 99.77  ? 883  LYS A CD    1 
ATOM   7049  C  CE    . LYS A 1 879  ? -5.900  -62.740  21.108  1.00 104.92 ? 883  LYS A CE    1 
ATOM   7050  N  NZ    . LYS A 1 879  ? -4.989  -62.855  22.288  1.00 99.37  ? 883  LYS A NZ    1 
ATOM   7051  N  N     . HIS A 1 880  ? -6.107  -57.696  16.053  1.00 92.56  ? 884  HIS A N     1 
ATOM   7052  C  CA    . HIS A 1 880  ? -5.397  -56.909  15.039  1.00 95.76  ? 884  HIS A CA    1 
ATOM   7053  C  C     . HIS A 1 880  ? -4.925  -55.539  15.517  1.00 94.39  ? 884  HIS A C     1 
ATOM   7054  O  O     . HIS A 1 880  ? -5.574  -54.900  16.346  1.00 104.54 ? 884  HIS A O     1 
ATOM   7055  C  CB    . HIS A 1 880  ? -6.284  -56.716  13.803  1.00 97.08  ? 884  HIS A CB    1 
ATOM   7056  C  CG    . HIS A 1 880  ? -6.290  -57.888  12.869  1.00 98.58  ? 884  HIS A CG    1 
ATOM   7057  N  ND1   . HIS A 1 880  ? -6.695  -59.148  13.257  1.00 92.81  ? 884  HIS A ND1   1 
ATOM   7058  C  CD2   . HIS A 1 880  ? -5.949  -57.987  11.562  1.00 81.04  ? 884  HIS A CD2   1 
ATOM   7059  C  CE1   . HIS A 1 880  ? -6.598  -59.972  12.229  1.00 89.84  ? 884  HIS A CE1   1 
ATOM   7060  N  NE2   . HIS A 1 880  ? -6.144  -59.293  11.190  1.00 81.15  ? 884  HIS A NE2   1 
ATOM   7061  N  N     . THR A 1 881  ? -3.801  -55.086  14.970  1.00 97.75  ? 885  THR A N     1 
ATOM   7062  C  CA    . THR A 1 881  ? -3.336  -53.720  15.193  1.00 95.91  ? 885  THR A CA    1 
ATOM   7063  C  C     . THR A 1 881  ? -4.021  -52.757  14.231  1.00 102.15 ? 885  THR A C     1 
ATOM   7064  O  O     . THR A 1 881  ? -4.089  -51.562  14.481  1.00 120.88 ? 885  THR A O     1 
ATOM   7065  C  CB    . THR A 1 881  ? -1.808  -53.599  15.036  1.00 95.33  ? 885  THR A CB    1 
ATOM   7066  O  OG1   . THR A 1 881  ? -1.342  -54.558  14.079  1.00 103.53 ? 885  THR A OG1   1 
ATOM   7067  C  CG2   . THR A 1 881  ? -1.113  -53.850  16.364  1.00 98.43  ? 885  THR A CG2   1 
ATOM   7068  N  N     . MET A 1 882  ? -4.524  -53.285  13.121  1.00 101.01 ? 886  MET A N     1 
ATOM   7069  C  CA    . MET A 1 882  ? -5.362  -52.498  12.218  1.00 91.91  ? 886  MET A CA    1 
ATOM   7070  C  C     . MET A 1 882  ? -6.645  -52.149  12.959  1.00 74.78  ? 886  MET A C     1 
ATOM   7071  O  O     . MET A 1 882  ? -7.375  -53.033  13.401  1.00 87.07  ? 886  MET A O     1 
ATOM   7072  C  CB    . MET A 1 882  ? -5.669  -53.260  10.916  1.00 85.38  ? 886  MET A CB    1 
ATOM   7073  C  CG    . MET A 1 882  ? -4.470  -53.470  10.006  1.00 76.14  ? 886  MET A CG    1 
ATOM   7074  S  SD    . MET A 1 882  ? -4.853  -54.512  8.543   1.00 87.15  ? 886  MET A SD    1 
ATOM   7075  C  CE    . MET A 1 882  ? -6.143  -53.552  7.773   1.00 71.56  ? 886  MET A CE    1 
ATOM   7076  N  N     . ARG A 1 883  ? -6.911  -50.855  13.092  1.00 60.13  ? 887  ARG A N     1 
ATOM   7077  C  CA    . ARG A 1 883  ? -8.001  -50.372  13.930  1.00 59.73  ? 887  ARG A CA    1 
ATOM   7078  C  C     . ARG A 1 883  ? -9.382  -50.898  13.524  1.00 65.07  ? 887  ARG A C     1 
ATOM   7079  O  O     . ARG A 1 883  ? -10.123 -51.419  14.357  1.00 70.83  ? 887  ARG A O     1 
ATOM   7080  C  CB    . ARG A 1 883  ? -8.008  -48.838  13.934  1.00 61.65  ? 887  ARG A CB    1 
ATOM   7081  C  CG    . ARG A 1 883  ? -9.030  -48.216  14.859  1.00 73.49  ? 887  ARG A CG    1 
ATOM   7082  C  CD    . ARG A 1 883  ? -8.854  -48.758  16.270  1.00 101.59 ? 887  ARG A CD    1 
ATOM   7083  N  NE    . ARG A 1 883  ? -10.052 -49.430  16.765  1.00 102.61 ? 887  ARG A NE    1 
ATOM   7084  C  CZ    . ARG A 1 883  ? -10.042 -50.413  17.657  1.00 103.24 ? 887  ARG A CZ    1 
ATOM   7085  N  NH1   . ARG A 1 883  ? -8.892  -50.848  18.150  1.00 107.40 ? 887  ARG A NH1   1 
ATOM   7086  N  NH2   . ARG A 1 883  ? -11.181 -50.965  18.048  1.00 103.70 ? 887  ARG A NH2   1 
ATOM   7087  N  N     . ASN A 1 884  ? -9.722  -50.764  12.246  1.00 73.32  ? 888  ASN A N     1 
ATOM   7088  C  CA    . ASN A 1 884  ? -11.062 -51.097  11.765  1.00 60.53  ? 888  ASN A CA    1 
ATOM   7089  C  C     . ASN A 1 884  ? -11.370 -52.585  11.878  1.00 60.40  ? 888  ASN A C     1 
ATOM   7090  O  O     . ASN A 1 884  ? -12.508 -52.986  12.133  1.00 59.64  ? 888  ASN A O     1 
ATOM   7091  C  CB    . ASN A 1 884  ? -11.226 -50.635  10.313  1.00 67.01  ? 888  ASN A CB    1 
ATOM   7092  C  CG    . ASN A 1 884  ? -10.315 -51.387  9.353   1.00 76.88  ? 888  ASN A CG    1 
ATOM   7093  O  OD1   . ASN A 1 884  ? -9.129  -51.599  9.629   1.00 85.40  ? 888  ASN A OD1   1 
ATOM   7094  N  ND2   . ASN A 1 884  ? -10.873 -51.811  8.229   1.00 73.05  ? 888  ASN A ND2   1 
ATOM   7095  N  N     . VAL A 1 885  ? -10.346 -53.405  11.691  1.00 59.86  ? 889  VAL A N     1 
ATOM   7096  C  CA    . VAL A 1 885  ? -10.527 -54.843  11.755  1.00 73.83  ? 889  VAL A CA    1 
ATOM   7097  C  C     . VAL A 1 885  ? -10.857 -55.251  13.182  1.00 78.29  ? 889  VAL A C     1 
ATOM   7098  O  O     . VAL A 1 885  ? -11.838 -55.948  13.424  1.00 91.31  ? 889  VAL A O     1 
ATOM   7099  C  CB    . VAL A 1 885  ? -9.268  -55.605  11.253  1.00 85.66  ? 889  VAL A CB    1 
ATOM   7100  C  CG1   . VAL A 1 885  ? -9.484  -57.111  11.323  1.00 76.84  ? 889  VAL A CG1   1 
ATOM   7101  C  CG2   . VAL A 1 885  ? -8.927  -55.188  9.826   1.00 77.98  ? 889  VAL A CG2   1 
ATOM   7102  N  N     . ALA A 1 886  ? -10.043 -54.789  14.126  1.00 77.14  ? 890  ALA A N     1 
ATOM   7103  C  CA    . ALA A 1 886  ? -10.267 -55.064  15.548  1.00 76.82  ? 890  ALA A CA    1 
ATOM   7104  C  C     . ALA A 1 886  ? -11.623 -54.540  16.014  1.00 72.50  ? 890  ALA A C     1 
ATOM   7105  O  O     . ALA A 1 886  ? -12.341 -55.216  16.780  1.00 73.63  ? 890  ALA A O     1 
ATOM   7106  C  CB    . ALA A 1 886  ? -9.152  -54.465  16.384  1.00 66.18  ? 890  ALA A CB    1 
ATOM   7107  N  N     . ASP A 1 887  ? -11.966 -53.342  15.540  1.00 62.40  ? 891  ASP A N     1 
ATOM   7108  C  CA    . ASP A 1 887  ? -13.253 -52.729  15.845  1.00 75.54  ? 891  ASP A CA    1 
ATOM   7109  C  C     . ASP A 1 887  ? -14.401 -53.644  15.434  1.00 88.97  ? 891  ASP A C     1 
ATOM   7110  O  O     . ASP A 1 887  ? -15.255 -54.024  16.256  1.00 98.27  ? 891  ASP A O     1 
ATOM   7111  C  CB    . ASP A 1 887  ? -13.364 -51.379  15.145  1.00 89.78  ? 891  ASP A CB    1 
ATOM   7112  C  CG    . ASP A 1 887  ? -14.687 -50.689  15.404  1.00 119.19 ? 891  ASP A CG    1 
ATOM   7113  O  OD1   . ASP A 1 887  ? -15.061 -49.806  14.602  1.00 132.14 ? 891  ASP A OD1   1 
ATOM   7114  O  OD2   . ASP A 1 887  ? -15.350 -51.014  16.409  1.00 132.05 ? 891  ASP A OD2   1 
ATOM   7115  N  N     . THR A 1 888  ? -14.398 -54.019  14.159  1.00 87.85  ? 892  THR A N     1 
ATOM   7116  C  CA    . THR A 1 888  ? -15.431 -54.893  13.627  1.00 82.94  ? 892  THR A CA    1 
ATOM   7117  C  C     . THR A 1 888  ? -15.465 -56.212  14.395  1.00 81.31  ? 892  THR A C     1 
ATOM   7118  O  O     . THR A 1 888  ? -16.538 -56.732  14.696  1.00 82.12  ? 892  THR A O     1 
ATOM   7119  C  CB    . THR A 1 888  ? -15.217 -55.161  12.136  1.00 80.04  ? 892  THR A CB    1 
ATOM   7120  O  OG1   . THR A 1 888  ? -13.858 -55.555  11.922  1.00 90.16  ? 892  THR A OG1   1 
ATOM   7121  C  CG2   . THR A 1 888  ? -15.501 -53.905  11.334  1.00 70.58  ? 892  THR A CG2   1 
ATOM   7122  N  N     . GLY A 1 889  ? -14.290 -56.736  14.728  1.00 78.27  ? 893  GLY A N     1 
ATOM   7123  C  CA    . GLY A 1 889  ? -14.192 -57.964  15.494  1.00 78.46  ? 893  GLY A CA    1 
ATOM   7124  C  C     . GLY A 1 889  ? -14.943 -57.883  16.809  1.00 86.35  ? 893  GLY A C     1 
ATOM   7125  O  O     . GLY A 1 889  ? -15.784 -58.743  17.103  1.00 93.71  ? 893  GLY A O     1 
ATOM   7126  N  N     . LEU A 1 890  ? -14.652 -56.843  17.592  1.00 88.95  ? 894  LEU A N     1 
ATOM   7127  C  CA    . LEU A 1 890  ? -15.335 -56.634  18.867  1.00 85.70  ? 894  LEU A CA    1 
ATOM   7128  C  C     . LEU A 1 890  ? -16.847 -56.488  18.682  1.00 85.28  ? 894  LEU A C     1 
ATOM   7129  O  O     . LEU A 1 890  ? -17.630 -57.100  19.417  1.00 90.26  ? 894  LEU A O     1 
ATOM   7130  C  CB    . LEU A 1 890  ? -14.766 -55.410  19.584  1.00 75.44  ? 894  LEU A CB    1 
ATOM   7131  C  CG    . LEU A 1 890  ? -13.323 -55.546  20.083  1.00 68.56  ? 894  LEU A CG    1 
ATOM   7132  C  CD1   . LEU A 1 890  ? -12.824 -54.241  20.682  1.00 61.36  ? 894  LEU A CD1   1 
ATOM   7133  C  CD2   . LEU A 1 890  ? -13.212 -56.669  21.075  1.00 64.62  ? 894  LEU A CD2   1 
ATOM   7134  N  N     . GLN A 1 891  ? -17.252 -55.695  17.690  1.00 88.28  ? 895  GLN A N     1 
ATOM   7135  C  CA    . GLN A 1 891  ? -18.673 -55.554  17.368  1.00 90.36  ? 895  GLN A CA    1 
ATOM   7136  C  C     . GLN A 1 891  ? -19.341 -56.914  17.119  1.00 99.13  ? 895  GLN A C     1 
ATOM   7137  O  O     . GLN A 1 891  ? -20.397 -57.220  17.709  1.00 113.52 ? 895  GLN A O     1 
ATOM   7138  C  CB    . GLN A 1 891  ? -18.861 -54.667  16.144  1.00 92.29  ? 895  GLN A CB    1 
ATOM   7139  C  CG    . GLN A 1 891  ? -18.635 -53.195  16.391  1.00 103.23 ? 895  GLN A CG    1 
ATOM   7140  C  CD    . GLN A 1 891  ? -18.789 -52.364  15.127  1.00 123.04 ? 895  GLN A CD    1 
ATOM   7141  O  OE1   . GLN A 1 891  ? -18.101 -52.591  14.134  1.00 135.98 ? 895  GLN A OE1   1 
ATOM   7142  N  NE2   . GLN A 1 891  ? -19.703 -51.405  15.156  1.00 136.93 ? 895  GLN A NE2   1 
ATOM   7143  N  N     . ILE A 1 892  ? -18.722 -57.720  16.253  1.00 77.17  ? 896  ILE A N     1 
ATOM   7144  C  CA    . ILE A 1 892  ? -19.221 -59.053  15.950  1.00 86.80  ? 896  ILE A CA    1 
ATOM   7145  C  C     . ILE A 1 892  ? -19.346 -59.895  17.210  1.00 90.93  ? 896  ILE A C     1 
ATOM   7146  O  O     . ILE A 1 892  ? -20.352 -60.564  17.408  1.00 97.05  ? 896  ILE A O     1 
ATOM   7147  C  CB    . ILE A 1 892  ? -18.313 -59.803  14.946  1.00 87.94  ? 896  ILE A CB    1 
ATOM   7148  C  CG1   . ILE A 1 892  ? -18.248 -59.067  13.607  1.00 88.42  ? 896  ILE A CG1   1 
ATOM   7149  C  CG2   . ILE A 1 892  ? -18.828 -61.207  14.708  1.00 72.57  ? 896  ILE A CG2   1 
ATOM   7150  C  CD1   . ILE A 1 892  ? -17.240 -59.658  12.648  1.00 78.57  ? 896  ILE A CD1   1 
ATOM   7151  N  N     . LEU A 1 893  ? -18.323 -59.862  18.058  1.00 94.76  ? 897  LEU A N     1 
ATOM   7152  C  CA    . LEU A 1 893  ? -18.344 -60.658  19.280  1.00 102.18 ? 897  LEU A CA    1 
ATOM   7153  C  C     . LEU A 1 893  ? -19.531 -60.273  20.160  1.00 100.03 ? 897  LEU A C     1 
ATOM   7154  O  O     . LEU A 1 893  ? -20.251 -61.141  20.675  1.00 105.61 ? 897  LEU A O     1 
ATOM   7155  C  CB    . LEU A 1 893  ? -17.040 -60.497  20.060  1.00 98.67  ? 897  LEU A CB    1 
ATOM   7156  C  CG    . LEU A 1 893  ? -16.896 -61.453  21.249  1.00 94.58  ? 897  LEU A CG    1 
ATOM   7157  C  CD1   . LEU A 1 893  ? -16.842 -62.882  20.764  1.00 105.35 ? 897  LEU A CD1   1 
ATOM   7158  C  CD2   . LEU A 1 893  ? -15.664 -61.117  22.067  1.00 96.79  ? 897  LEU A CD2   1 
ATOM   7159  N  N     . PHE A 1 894  ? -19.735 -58.967  20.311  1.00 87.18  ? 898  PHE A N     1 
ATOM   7160  C  CA    . PHE A 1 894  ? -20.846 -58.444  21.100  1.00 86.89  ? 898  PHE A CA    1 
ATOM   7161  C  C     . PHE A 1 894  ? -22.201 -58.909  20.570  1.00 92.29  ? 898  PHE A C     1 
ATOM   7162  O  O     . PHE A 1 894  ? -22.996 -59.537  21.283  1.00 106.13 ? 898  PHE A O     1 
ATOM   7163  C  CB    . PHE A 1 894  ? -20.784 -56.916  21.115  1.00 102.54 ? 898  PHE A CB    1 
ATOM   7164  C  CG    . PHE A 1 894  ? -21.753 -56.275  22.064  1.00 113.33 ? 898  PHE A CG    1 
ATOM   7165  C  CD1   . PHE A 1 894  ? -21.589 -56.406  23.432  1.00 113.99 ? 898  PHE A CD1   1 
ATOM   7166  C  CD2   . PHE A 1 894  ? -22.819 -55.527  21.588  1.00 116.81 ? 898  PHE A CD2   1 
ATOM   7167  C  CE1   . PHE A 1 894  ? -22.476 -55.819  24.307  1.00 107.79 ? 898  PHE A CE1   1 
ATOM   7168  C  CE2   . PHE A 1 894  ? -23.709 -54.934  22.460  1.00 111.18 ? 898  PHE A CE2   1 
ATOM   7169  C  CZ    . PHE A 1 894  ? -23.536 -55.082  23.823  1.00 108.19 ? 898  PHE A CZ    1 
ATOM   7170  N  N     . THR A 1 895  ? -22.450 -58.621  19.299  1.00 104.86 ? 899  THR A N     1 
ATOM   7171  C  CA    . THR A 1 895  ? -23.721 -58.972  18.678  1.00 103.56 ? 899  THR A CA    1 
ATOM   7172  C  C     . THR A 1 895  ? -23.919 -60.481  18.649  1.00 104.24 ? 899  THR A C     1 
ATOM   7173  O  O     . THR A 1 895  ? -25.052 -60.958  18.622  1.00 124.42 ? 899  THR A O     1 
ATOM   7174  C  CB    . THR A 1 895  ? -23.825 -58.413  17.248  1.00 101.67 ? 899  THR A CB    1 
ATOM   7175  O  OG1   . THR A 1 895  ? -22.742 -58.918  16.460  1.00 116.43 ? 899  THR A OG1   1 
ATOM   7176  C  CG2   . THR A 1 895  ? -23.764 -56.890  17.271  1.00 94.11  ? 899  THR A CG2   1 
ATOM   7177  N  N     . LEU A 1 896  ? -22.819 -61.227  18.672  1.00 91.97  ? 900  LEU A N     1 
ATOM   7178  C  CA    . LEU A 1 896  ? -22.879 -62.683  18.706  1.00 90.58  ? 900  LEU A CA    1 
ATOM   7179  C  C     . LEU A 1 896  ? -23.328 -63.165  20.071  1.00 100.92 ? 900  LEU A C     1 
ATOM   7180  O  O     . LEU A 1 896  ? -24.136 -64.089  20.177  1.00 105.67 ? 900  LEU A O     1 
ATOM   7181  C  CB    . LEU A 1 896  ? -21.523 -63.301  18.359  1.00 90.81  ? 900  LEU A CB    1 
ATOM   7182  C  CG    . LEU A 1 896  ? -21.401 -64.809  18.625  1.00 93.54  ? 900  LEU A CG    1 
ATOM   7183  C  CD1   . LEU A 1 896  ? -22.335 -65.606  17.718  1.00 95.16  ? 900  LEU A CD1   1 
ATOM   7184  C  CD2   . LEU A 1 896  ? -19.961 -65.278  18.471  1.00 89.43  ? 900  LEU A CD2   1 
ATOM   7185  N  N     . LEU A 1 897  ? -22.786 -62.551  21.119  1.00 106.73 ? 901  LEU A N     1 
ATOM   7186  C  CA    . LEU A 1 897  ? -23.209 -62.882  22.472  1.00 105.82 ? 901  LEU A CA    1 
ATOM   7187  C  C     . LEU A 1 897  ? -24.701 -62.612  22.614  1.00 105.11 ? 901  LEU A C     1 
ATOM   7188  O  O     . LEU A 1 897  ? -25.439 -63.430  23.173  1.00 108.91 ? 901  LEU A O     1 
ATOM   7189  C  CB    . LEU A 1 897  ? -22.413 -62.086  23.506  1.00 102.10 ? 901  LEU A CB    1 
ATOM   7190  C  CG    . LEU A 1 897  ? -20.910 -62.370  23.546  1.00 95.68  ? 901  LEU A CG    1 
ATOM   7191  C  CD1   . LEU A 1 897  ? -20.265 -61.701  24.737  1.00 101.52 ? 901  LEU A CD1   1 
ATOM   7192  C  CD2   . LEU A 1 897  ? -20.634 -63.869  23.545  1.00 87.38  ? 901  LEU A CD2   1 
ATOM   7193  N  N     . GLN A 1 898  ? -25.143 -61.474  22.086  1.00 104.85 ? 902  GLN A N     1 
ATOM   7194  C  CA    . GLN A 1 898  ? -26.569 -61.154  22.104  1.00 110.49 ? 902  GLN A CA    1 
ATOM   7195  C  C     . GLN A 1 898  ? -27.393 -62.192  21.333  1.00 117.03 ? 902  GLN A C     1 
ATOM   7196  O  O     . GLN A 1 898  ? -28.422 -62.675  21.824  1.00 128.66 ? 902  GLN A O     1 
ATOM   7197  C  CB    . GLN A 1 898  ? -26.808 -59.759  21.536  1.00 122.00 ? 902  GLN A CB    1 
ATOM   7198  C  CG    . GLN A 1 898  ? -26.228 -58.640  22.393  1.00 130.74 ? 902  GLN A CG    1 
ATOM   7199  C  CD    . GLN A 1 898  ? -26.480 -57.263  21.807  1.00 140.76 ? 902  GLN A CD    1 
ATOM   7200  O  OE1   . GLN A 1 898  ? -26.354 -57.055  20.599  1.00 142.42 ? 902  GLN A OE1   1 
ATOM   7201  N  NE2   . GLN A 1 898  ? -26.845 -56.315  22.662  1.00 144.31 ? 902  GLN A NE2   1 
ATOM   7202  N  N     . ASN A 1 899  ? -26.926 -62.541  20.135  1.00 109.62 ? 903  ASN A N     1 
ATOM   7203  C  CA    . ASN A 1 899  ? -27.582 -63.545  19.297  1.00 111.18 ? 903  ASN A CA    1 
ATOM   7204  C  C     . ASN A 1 899  ? -27.742 -64.882  20.001  1.00 110.10 ? 903  ASN A C     1 
ATOM   7205  O  O     . ASN A 1 899  ? -28.780 -65.533  19.882  1.00 124.93 ? 903  ASN A O     1 
ATOM   7206  C  CB    . ASN A 1 899  ? -26.802 -63.763  17.995  1.00 123.97 ? 903  ASN A CB    1 
ATOM   7207  C  CG    . ASN A 1 899  ? -26.943 -62.612  17.021  1.00 116.45 ? 903  ASN A CG    1 
ATOM   7208  O  OD1   . ASN A 1 899  ? -27.888 -61.829  17.093  1.00 128.24 ? 903  ASN A OD1   1 
ATOM   7209  N  ND2   . ASN A 1 899  ? -26.000 -62.509  16.098  1.00 112.66 ? 903  ASN A ND2   1 
ATOM   7210  N  N     . VAL A 1 900  ? -26.699 -65.292  20.717  1.00 113.20 ? 904  VAL A N     1 
ATOM   7211  C  CA    . VAL A 1 900  ? -26.728 -66.533  21.479  1.00 118.29 ? 904  VAL A CA    1 
ATOM   7212  C  C     . VAL A 1 900  ? -27.724 -66.418  22.626  1.00 122.35 ? 904  VAL A C     1 
ATOM   7213  O  O     . VAL A 1 900  ? -28.484 -67.347  22.899  1.00 124.98 ? 904  VAL A O     1 
ATOM   7214  C  CB    . VAL A 1 900  ? -25.339 -66.890  22.033  1.00 113.12 ? 904  VAL A CB    1 
ATOM   7215  C  CG1   . VAL A 1 900  ? -25.433 -68.063  22.990  1.00 121.92 ? 904  VAL A CG1   1 
ATOM   7216  C  CG2   . VAL A 1 900  ? -24.381 -67.203  20.899  1.00 100.56 ? 904  VAL A CG2   1 
ATOM   7217  N  N     . ALA A 1 901  ? -27.725 -65.261  23.282  1.00 129.34 ? 905  ALA A N     1 
ATOM   7218  C  CA    . ALA A 1 901  ? -28.676 -64.993  24.357  1.00 130.64 ? 905  ALA A CA    1 
ATOM   7219  C  C     . ALA A 1 901  ? -30.113 -65.078  23.846  1.00 136.12 ? 905  ALA A C     1 
ATOM   7220  O  O     . ALA A 1 901  ? -31.033 -65.375  24.607  1.00 146.09 ? 905  ALA A O     1 
ATOM   7221  C  CB    . ALA A 1 901  ? -28.410 -63.627  24.978  1.00 125.66 ? 905  ALA A CB    1 
ATOM   7222  N  N     . GLN A 1 902  ? -30.298 -64.821  22.555  1.00 134.34 ? 906  GLN A N     1 
ATOM   7223  C  CA    . GLN A 1 902  ? -31.619 -64.921  21.939  1.00 135.98 ? 906  GLN A CA    1 
ATOM   7224  C  C     . GLN A 1 902  ? -32.086 -66.376  21.811  1.00 143.58 ? 906  GLN A C     1 
ATOM   7225  O  O     . GLN A 1 902  ? -33.238 -66.692  22.110  1.00 151.04 ? 906  GLN A O     1 
ATOM   7226  C  CB    . GLN A 1 902  ? -31.613 -64.254  20.564  1.00 142.27 ? 906  GLN A CB    1 
ATOM   7227  C  CG    . GLN A 1 902  ? -32.987 -63.844  20.059  1.00 150.15 ? 906  GLN A CG    1 
ATOM   7228  C  CD    . GLN A 1 902  ? -33.482 -62.559  20.693  1.00 149.53 ? 906  GLN A CD    1 
ATOM   7229  O  OE1   . GLN A 1 902  ? -33.562 -62.444  21.919  1.00 150.27 ? 906  GLN A OE1   1 
ATOM   7230  N  NE2   . GLN A 1 902  ? -33.809 -61.578  19.856  1.00 146.20 ? 906  GLN A NE2   1 
ATOM   7231  N  N     . GLU A 1 903  ? -31.191 -67.253  21.365  1.00 142.01 ? 907  GLU A N     1 
ATOM   7232  C  CA    . GLU A 1 903  ? -31.524 -68.661  21.164  1.00 145.74 ? 907  GLU A CA    1 
ATOM   7233  C  C     . GLU A 1 903  ? -31.219 -69.473  22.417  1.00 152.99 ? 907  GLU A C     1 
ATOM   7234  O  O     . GLU A 1 903  ? -30.078 -69.878  22.640  1.00 152.38 ? 907  GLU A O     1 
ATOM   7235  C  CB    . GLU A 1 903  ? -30.758 -69.225  19.966  1.00 153.42 ? 907  GLU A CB    1 
ATOM   7236  C  CG    . GLU A 1 903  ? -30.923 -68.407  18.686  1.00 157.16 ? 907  GLU A CG    1 
ATOM   7237  C  CD    . GLU A 1 903  ? -32.252 -68.658  17.991  1.00 158.53 ? 907  GLU A CD    1 
ATOM   7238  O  OE1   . GLU A 1 903  ? -32.689 -69.834  17.940  1.00 157.80 ? 907  GLU A OE1   1 
ATOM   7239  O  OE2   . GLU A 1 903  ? -32.857 -67.677  17.497  1.00 150.99 ? 907  GLU A OE2   1 
ATOM   7240  N  N     . GLU A 1 904  ? -32.248 -69.718  23.223  1.00 162.00 ? 908  GLU A N     1 
ATOM   7241  C  CA    . GLU A 1 904  ? -32.074 -70.311  24.549  1.00 171.83 ? 908  GLU A CA    1 
ATOM   7242  C  C     . GLU A 1 904  ? -31.592 -71.761  24.524  1.00 173.34 ? 908  GLU A C     1 
ATOM   7243  O  O     . GLU A 1 904  ? -31.047 -72.252  25.515  1.00 175.15 ? 908  GLU A O     1 
ATOM   7244  C  CB    . GLU A 1 904  ? -33.385 -70.224  25.336  1.00 185.62 ? 908  GLU A CB    1 
ATOM   7245  C  CG    . GLU A 1 904  ? -34.580 -70.839  24.625  1.00 197.63 ? 908  GLU A CG    1 
ATOM   7246  C  CD    . GLU A 1 904  ? -35.846 -70.776  25.459  1.00 206.68 ? 908  GLU A CD    1 
ATOM   7247  O  OE1   . GLU A 1 904  ? -35.758 -70.951  26.694  1.00 210.57 ? 908  GLU A OE1   1 
ATOM   7248  O  OE2   . GLU A 1 904  ? -36.930 -70.546  24.880  1.00 208.70 ? 908  GLU A OE2   1 
ATOM   7249  N  N     . ALA A 1 905  ? -31.797 -72.443  23.401  1.00 169.86 ? 909  ALA A N     1 
ATOM   7250  C  CA    . ALA A 1 905  ? -31.377 -73.834  23.276  1.00 160.80 ? 909  ALA A CA    1 
ATOM   7251  C  C     . ALA A 1 905  ? -29.856 -73.942  23.251  1.00 154.99 ? 909  ALA A C     1 
ATOM   7252  O  O     . ALA A 1 905  ? -29.264 -74.731  23.993  1.00 161.33 ? 909  ALA A O     1 
ATOM   7253  C  CB    . ALA A 1 905  ? -31.974 -74.461  22.028  1.00 156.59 ? 909  ALA A CB    1 
ATOM   7254  N  N     . ALA A 1 906  ? -29.229 -73.137  22.398  1.00 142.62 ? 910  ALA A N     1 
ATOM   7255  C  CA    . ALA A 1 906  ? -27.784 -73.183  22.221  1.00 130.79 ? 910  ALA A CA    1 
ATOM   7256  C  C     . ALA A 1 906  ? -27.048 -72.431  23.322  1.00 130.53 ? 910  ALA A C     1 
ATOM   7257  O  O     . ALA A 1 906  ? -25.883 -72.710  23.588  1.00 135.75 ? 910  ALA A O     1 
ATOM   7258  C  CB    . ALA A 1 906  ? -27.404 -72.618  20.860  1.00 128.01 ? 910  ALA A CB    1 
ATOM   7259  N  N     . ALA A 1 907  ? -27.740 -71.488  23.956  1.00 121.40 ? 911  ALA A N     1 
ATOM   7260  C  CA    . ALA A 1 907  ? -27.131 -70.558  24.908  1.00 125.85 ? 911  ALA A CA    1 
ATOM   7261  C  C     . ALA A 1 907  ? -26.231 -71.234  25.942  1.00 130.55 ? 911  ALA A C     1 
ATOM   7262  O  O     . ALA A 1 907  ? -25.044 -70.904  26.055  1.00 133.80 ? 911  ALA A O     1 
ATOM   7263  C  CB    . ALA A 1 907  ? -28.218 -69.757  25.610  1.00 124.50 ? 911  ALA A CB    1 
ATOM   7264  N  N     . GLN A 1 908  ? -26.794 -72.181  26.687  1.00 120.14 ? 912  GLN A N     1 
ATOM   7265  C  CA    . GLN A 1 908  ? -26.071 -72.825  27.778  1.00 130.68 ? 912  GLN A CA    1 
ATOM   7266  C  C     . GLN A 1 908  ? -24.855 -73.599  27.276  1.00 138.44 ? 912  GLN A C     1 
ATOM   7267  O  O     . GLN A 1 908  ? -23.772 -73.521  27.861  1.00 138.21 ? 912  GLN A O     1 
ATOM   7268  C  CB    . GLN A 1 908  ? -27.002 -73.751  28.556  1.00 132.58 ? 912  GLN A CB    1 
ATOM   7269  C  CG    . GLN A 1 908  ? -28.358 -73.134  28.867  1.00 142.63 ? 912  GLN A CG    1 
ATOM   7270  C  CD    . GLN A 1 908  ? -28.249 -71.786  29.563  1.00 150.01 ? 912  GLN A CD    1 
ATOM   7271  O  OE1   . GLN A 1 908  ? -27.367 -71.569  30.398  1.00 154.30 ? 912  GLN A OE1   1 
ATOM   7272  N  NE2   . GLN A 1 908  ? -29.148 -70.868  29.218  1.00 143.09 ? 912  GLN A NE2   1 
ATOM   7273  N  N     . SER A 1 909  ? -25.038 -74.337  26.185  1.00 139.22 ? 913  SER A N     1 
ATOM   7274  C  CA    . SER A 1 909  ? -23.947 -75.095  25.579  1.00 142.02 ? 913  SER A CA    1 
ATOM   7275  C  C     . SER A 1 909  ? -22.815 -74.166  25.132  1.00 140.32 ? 913  SER A C     1 
ATOM   7276  O  O     . SER A 1 909  ? -21.634 -74.467  25.325  1.00 143.63 ? 913  SER A O     1 
ATOM   7277  C  CB    . SER A 1 909  ? -24.461 -75.914  24.392  1.00 144.65 ? 913  SER A CB    1 
ATOM   7278  O  OG    . SER A 1 909  ? -25.145 -75.090  23.462  1.00 147.56 ? 913  SER A OG    1 
ATOM   7279  N  N     . PHE A 1 910  ? -23.189 -73.033  24.547  1.00 133.67 ? 914  PHE A N     1 
ATOM   7280  C  CA    . PHE A 1 910  ? -22.227 -72.052  24.062  1.00 125.69 ? 914  PHE A CA    1 
ATOM   7281  C  C     . PHE A 1 910  ? -21.423 -71.465  25.210  1.00 130.41 ? 914  PHE A C     1 
ATOM   7282  O  O     . PHE A 1 910  ? -20.193 -71.391  25.142  1.00 133.57 ? 914  PHE A O     1 
ATOM   7283  C  CB    . PHE A 1 910  ? -22.939 -70.935  23.290  1.00 113.73 ? 914  PHE A CB    1 
ATOM   7284  C  CG    . PHE A 1 910  ? -22.018 -69.864  22.783  1.00 105.24 ? 914  PHE A CG    1 
ATOM   7285  C  CD1   . PHE A 1 910  ? -21.139 -70.122  21.744  1.00 101.91 ? 914  PHE A CD1   1 
ATOM   7286  C  CD2   . PHE A 1 910  ? -22.036 -68.595  23.340  1.00 115.40 ? 914  PHE A CD2   1 
ATOM   7287  C  CE1   . PHE A 1 910  ? -20.293 -69.133  21.270  1.00 108.70 ? 914  PHE A CE1   1 
ATOM   7288  C  CE2   . PHE A 1 910  ? -21.194 -67.605  22.873  1.00 116.76 ? 914  PHE A CE2   1 
ATOM   7289  C  CZ    . PHE A 1 910  ? -20.320 -67.876  21.834  1.00 117.01 ? 914  PHE A CZ    1 
ATOM   7290  N  N     . TYR A 1 911  ? -22.130 -71.041  26.257  1.00 123.86 ? 915  TYR A N     1 
ATOM   7291  C  CA    . TYR A 1 911  ? -21.487 -70.508  27.451  1.00 115.87 ? 915  TYR A CA    1 
ATOM   7292  C  C     . TYR A 1 911  ? -20.484 -71.516  27.996  1.00 116.88 ? 915  TYR A C     1 
ATOM   7293  O  O     . TYR A 1 911  ? -19.286 -71.218  28.132  1.00 122.75 ? 915  TYR A O     1 
ATOM   7294  C  CB    . TYR A 1 911  ? -22.526 -70.169  28.519  1.00 115.36 ? 915  TYR A CB    1 
ATOM   7295  C  CG    . TYR A 1 911  ? -23.498 -69.078  28.121  1.00 118.79 ? 915  TYR A CG    1 
ATOM   7296  C  CD1   . TYR A 1 911  ? -23.152 -68.115  27.182  1.00 111.15 ? 915  TYR A CD1   1 
ATOM   7297  C  CD2   . TYR A 1 911  ? -24.763 -69.011  28.692  1.00 118.73 ? 915  TYR A CD2   1 
ATOM   7298  C  CE1   . TYR A 1 911  ? -24.040 -67.122  26.822  1.00 109.27 ? 915  TYR A CE1   1 
ATOM   7299  C  CE2   . TYR A 1 911  ? -25.657 -68.017  28.337  1.00 113.48 ? 915  TYR A CE2   1 
ATOM   7300  C  CZ    . TYR A 1 911  ? -25.291 -67.078  27.403  1.00 113.85 ? 915  TYR A CZ    1 
ATOM   7301  O  OH    . TYR A 1 911  ? -26.175 -66.086  27.043  1.00 125.67 ? 915  TYR A OH    1 
ATOM   7302  N  N     . GLN A 1 912  ? -20.990 -72.717  28.277  1.00 120.78 ? 916  GLN A N     1 
ATOM   7303  C  CA    . GLN A 1 912  ? -20.186 -73.826  28.783  1.00 123.64 ? 916  GLN A CA    1 
ATOM   7304  C  C     . GLN A 1 912  ? -18.968 -74.113  27.919  1.00 120.64 ? 916  GLN A C     1 
ATOM   7305  O  O     . GLN A 1 912  ? -17.937 -74.564  28.406  1.00 119.11 ? 916  GLN A O     1 
ATOM   7306  C  CB    . GLN A 1 912  ? -21.038 -75.095  28.885  1.00 123.80 ? 916  GLN A CB    1 
ATOM   7307  C  CG    . GLN A 1 912  ? -22.117 -75.045  29.946  1.00 133.88 ? 916  GLN A CG    1 
ATOM   7308  C  CD    . GLN A 1 912  ? -21.561 -74.769  31.325  1.00 139.94 ? 916  GLN A CD    1 
ATOM   7309  O  OE1   . GLN A 1 912  ? -21.870 -73.745  31.937  1.00 142.03 ? 916  GLN A OE1   1 
ATOM   7310  N  NE2   . GLN A 1 912  ? -20.737 -75.682  31.824  1.00 139.23 ? 916  GLN A NE2   1 
ATOM   7311  N  N     . THR A 1 913  ? -19.094 -73.848  26.626  1.00 130.66 ? 917  THR A N     1 
ATOM   7312  C  CA    . THR A 1 913  ? -18.034 -74.179  25.686  1.00 132.37 ? 917  THR A CA    1 
ATOM   7313  C  C     . THR A 1 913  ? -16.941 -73.115  25.594  1.00 125.15 ? 917  THR A C     1 
ATOM   7314  O  O     . THR A 1 913  ? -15.758 -73.426  25.728  1.00 139.67 ? 917  THR A O     1 
ATOM   7315  C  CB    . THR A 1 913  ? -18.600 -74.411  24.278  1.00 131.39 ? 917  THR A CB    1 
ATOM   7316  O  OG1   . THR A 1 913  ? -19.596 -75.439  24.330  1.00 135.67 ? 917  THR A OG1   1 
ATOM   7317  C  CG2   . THR A 1 913  ? -17.492 -74.827  23.331  1.00 132.92 ? 917  THR A CG2   1 
ATOM   7318  N  N     . TYR A 1 914  ? -17.332 -71.866  25.373  1.00 103.99 ? 918  TYR A N     1 
ATOM   7319  C  CA    . TYR A 1 914  ? -16.355 -70.844  25.021  1.00 113.87 ? 918  TYR A CA    1 
ATOM   7320  C  C     . TYR A 1 914  ? -16.156 -69.706  26.032  1.00 121.40 ? 918  TYR A C     1 
ATOM   7321  O  O     . TYR A 1 914  ? -15.226 -68.911  25.859  1.00 123.08 ? 918  TYR A O     1 
ATOM   7322  C  CB    . TYR A 1 914  ? -16.729 -70.218  23.668  1.00 115.06 ? 918  TYR A CB    1 
ATOM   7323  C  CG    . TYR A 1 914  ? -16.724 -71.164  22.489  1.00 111.59 ? 918  TYR A CG    1 
ATOM   7324  C  CD1   . TYR A 1 914  ? -15.533 -71.642  21.958  1.00 107.29 ? 918  TYR A CD1   1 
ATOM   7325  C  CD2   . TYR A 1 914  ? -17.912 -71.557  21.891  1.00 109.14 ? 918  TYR A CD2   1 
ATOM   7326  C  CE1   . TYR A 1 914  ? -15.530 -72.502  20.873  1.00 108.55 ? 918  TYR A CE1   1 
ATOM   7327  C  CE2   . TYR A 1 914  ? -17.920 -72.413  20.806  1.00 106.25 ? 918  TYR A CE2   1 
ATOM   7328  C  CZ    . TYR A 1 914  ? -16.727 -72.884  20.301  1.00 106.33 ? 918  TYR A CZ    1 
ATOM   7329  O  OH    . TYR A 1 914  ? -16.733 -73.738  19.219  1.00 109.06 ? 918  TYR A OH    1 
ATOM   7330  N  N     . PHE A 1 915  ? -17.007 -69.612  27.056  1.00 114.63 ? 919  PHE A N     1 
ATOM   7331  C  CA    . PHE A 1 915  ? -17.007 -68.431  27.934  1.00 115.88 ? 919  PHE A CA    1 
ATOM   7332  C  C     . PHE A 1 915  ? -15.616 -68.025  28.447  1.00 108.82 ? 919  PHE A C     1 
ATOM   7333  O  O     . PHE A 1 915  ? -15.204 -66.862  28.331  1.00 99.37  ? 919  PHE A O     1 
ATOM   7334  C  CB    . PHE A 1 915  ? -17.930 -68.662  29.127  1.00 129.12 ? 919  PHE A CB    1 
ATOM   7335  C  CG    . PHE A 1 915  ? -18.447 -67.396  29.753  1.00 132.68 ? 919  PHE A CG    1 
ATOM   7336  C  CD1   . PHE A 1 915  ? -19.654 -66.850  29.346  1.00 126.66 ? 919  PHE A CD1   1 
ATOM   7337  C  CD2   . PHE A 1 915  ? -17.734 -66.760  30.755  1.00 136.61 ? 919  PHE A CD2   1 
ATOM   7338  C  CE1   . PHE A 1 915  ? -20.139 -65.692  29.923  1.00 122.79 ? 919  PHE A CE1   1 
ATOM   7339  C  CE2   . PHE A 1 915  ? -18.212 -65.596  31.336  1.00 131.47 ? 919  PHE A CE2   1 
ATOM   7340  C  CZ    . PHE A 1 915  ? -19.416 -65.063  30.917  1.00 123.89 ? 919  PHE A CZ    1 
ATOM   7341  N  N     . CYS A 1 916  ? -14.891 -68.995  28.992  1.00 113.29 ? 920  CYS A N     1 
ATOM   7342  C  CA    . CYS A 1 916  ? -13.584 -68.731  29.582  1.00 118.63 ? 920  CYS A CA    1 
ATOM   7343  C  C     . CYS A 1 916  ? -12.521 -68.403  28.536  1.00 121.48 ? 920  CYS A C     1 
ATOM   7344  O  O     . CYS A 1 916  ? -11.666 -67.552  28.772  1.00 123.12 ? 920  CYS A O     1 
ATOM   7345  C  CB    . CYS A 1 916  ? -13.140 -69.924  30.428  1.00 122.78 ? 920  CYS A CB    1 
ATOM   7346  S  SG    . CYS A 1 916  ? -14.183 -70.214  31.876  1.00 149.79 ? 920  CYS A SG    1 
ATOM   7347  N  N     . ASP A 1 917  ? -12.579 -69.077  27.389  1.00 128.51 ? 921  ASP A N     1 
ATOM   7348  C  CA    . ASP A 1 917  ? -11.649 -68.819  26.289  1.00 124.93 ? 921  ASP A CA    1 
ATOM   7349  C  C     . ASP A 1 917  ? -11.811 -67.379  25.796  1.00 109.55 ? 921  ASP A C     1 
ATOM   7350  O  O     . ASP A 1 917  ? -10.827 -66.643  25.621  1.00 104.73 ? 921  ASP A O     1 
ATOM   7351  C  CB    . ASP A 1 917  ? -11.884 -69.813  25.145  1.00 130.27 ? 921  ASP A CB    1 
ATOM   7352  C  CG    . ASP A 1 917  ? -10.728 -69.860  24.155  1.00 129.78 ? 921  ASP A CG    1 
ATOM   7353  O  OD1   . ASP A 1 917  ? -9.562  -69.922  24.603  1.00 131.43 ? 921  ASP A OD1   1 
ATOM   7354  O  OD2   . ASP A 1 917  ? -10.987 -69.840  22.927  1.00 126.14 ? 921  ASP A OD2   1 
ATOM   7355  N  N     . ILE A 1 918  ? -13.064 -66.986  25.587  1.00 105.19 ? 922  ILE A N     1 
ATOM   7356  C  CA    . ILE A 1 918  ? -13.385 -65.622  25.198  1.00 100.87 ? 922  ILE A CA    1 
ATOM   7357  C  C     . ILE A 1 918  ? -12.838 -64.640  26.223  1.00 102.34 ? 922  ILE A C     1 
ATOM   7358  O  O     . ILE A 1 918  ? -12.124 -63.693  25.871  1.00 103.78 ? 922  ILE A O     1 
ATOM   7359  C  CB    . ILE A 1 918  ? -14.906 -65.410  25.050  1.00 103.62 ? 922  ILE A CB    1 
ATOM   7360  C  CG1   . ILE A 1 918  ? -15.447 -66.202  23.855  1.00 107.79 ? 922  ILE A CG1   1 
ATOM   7361  C  CG2   . ILE A 1 918  ? -15.229 -63.931  24.884  1.00 96.89  ? 922  ILE A CG2   1 
ATOM   7362  C  CD1   . ILE A 1 918  ? -16.914 -65.956  23.575  1.00 103.14 ? 922  ILE A CD1   1 
ATOM   7363  N  N     . LEU A 1 919  ? -13.172 -64.873  27.490  1.00 101.21 ? 923  LEU A N     1 
ATOM   7364  C  CA    . LEU A 1 919  ? -12.713 -64.004  28.565  1.00 93.88  ? 923  LEU A CA    1 
ATOM   7365  C  C     . LEU A 1 919  ? -11.201 -63.829  28.580  1.00 94.04  ? 923  LEU A C     1 
ATOM   7366  O  O     . LEU A 1 919  ? -10.710 -62.711  28.673  1.00 97.07  ? 923  LEU A O     1 
ATOM   7367  C  CB    . LEU A 1 919  ? -13.175 -64.538  29.924  1.00 115.22 ? 923  LEU A CB    1 
ATOM   7368  C  CG    . LEU A 1 919  ? -14.557 -64.073  30.389  1.00 117.80 ? 923  LEU A CG    1 
ATOM   7369  C  CD1   . LEU A 1 919  ? -14.736 -64.346  31.860  1.00 122.31 ? 923  LEU A CD1   1 
ATOM   7370  C  CD2   . LEU A 1 919  ? -14.751 -62.604  30.086  1.00 111.49 ? 923  LEU A CD2   1 
ATOM   7371  N  N     . GLN A 1 920  ? -10.461 -64.929  28.487  1.00 96.62  ? 924  GLN A N     1 
ATOM   7372  C  CA    . GLN A 1 920  ? -9.009  -64.846  28.596  1.00 100.48 ? 924  GLN A CA    1 
ATOM   7373  C  C     . GLN A 1 920  ? -8.391  -64.160  27.373  1.00 97.36  ? 924  GLN A C     1 
ATOM   7374  O  O     . GLN A 1 920  ? -7.449  -63.376  27.513  1.00 101.04 ? 924  GLN A O     1 
ATOM   7375  C  CB    . GLN A 1 920  ? -8.395  -66.237  28.818  1.00 105.04 ? 924  GLN A CB    1 
ATOM   7376  C  CG    . GLN A 1 920  ? -8.755  -67.268  27.772  1.00 123.79 ? 924  GLN A CG    1 
ATOM   7377  C  CD    . GLN A 1 920  ? -8.026  -68.576  27.962  1.00 132.64 ? 924  GLN A CD    1 
ATOM   7378  O  OE1   . GLN A 1 920  ? -7.355  -68.784  28.973  1.00 132.32 ? 924  GLN A OE1   1 
ATOM   7379  N  NE2   . GLN A 1 920  ? -8.147  -69.468  26.983  1.00 137.84 ? 924  GLN A NE2   1 
ATOM   7380  N  N     . HIS A 1 921  ? -8.921  -64.433  26.183  1.00 97.82  ? 925  HIS A N     1 
ATOM   7381  C  CA    . HIS A 1 921  ? -8.430  -63.743  24.980  1.00 99.66  ? 925  HIS A CA    1 
ATOM   7382  C  C     . HIS A 1 921  ? -8.663  -62.230  25.071  1.00 98.12  ? 925  HIS A C     1 
ATOM   7383  O  O     . HIS A 1 921  ? -7.749  -61.416  24.837  1.00 83.16  ? 925  HIS A O     1 
ATOM   7384  C  CB    . HIS A 1 921  ? -9.100  -64.298  23.719  1.00 98.38  ? 925  HIS A CB    1 
ATOM   7385  C  CG    . HIS A 1 921  ? -8.427  -65.513  23.164  1.00 102.72 ? 925  HIS A CG    1 
ATOM   7386  N  ND1   . HIS A 1 921  ? -7.141  -65.489  22.672  1.00 109.37 ? 925  HIS A ND1   1 
ATOM   7387  C  CD2   . HIS A 1 921  ? -8.862  -66.788  23.015  1.00 101.97 ? 925  HIS A CD2   1 
ATOM   7388  C  CE1   . HIS A 1 921  ? -6.809  -66.695  22.248  1.00 113.11 ? 925  HIS A CE1   1 
ATOM   7389  N  NE2   . HIS A 1 921  ? -7.836  -67.502  22.446  1.00 110.71 ? 925  HIS A NE2   1 
ATOM   7390  N  N     . ILE A 1 922  ? -9.893  -61.866  25.422  1.00 102.12 ? 926  ILE A N     1 
ATOM   7391  C  CA    . ILE A 1 922  ? -10.248 -60.466  25.624  1.00 102.11 ? 926  ILE A CA    1 
ATOM   7392  C  C     . ILE A 1 922  ? -9.340  -59.802  26.654  1.00 105.19 ? 926  ILE A C     1 
ATOM   7393  O  O     . ILE A 1 922  ? -8.824  -58.719  26.412  1.00 100.40 ? 926  ILE A O     1 
ATOM   7394  C  CB    . ILE A 1 922  ? -11.709 -60.306  26.076  1.00 94.28  ? 926  ILE A CB    1 
ATOM   7395  C  CG1   . ILE A 1 922  ? -12.652 -60.600  24.915  1.00 101.72 ? 926  ILE A CG1   1 
ATOM   7396  C  CG2   . ILE A 1 922  ? -11.960 -58.902  26.600  1.00 78.11  ? 926  ILE A CG2   1 
ATOM   7397  C  CD1   . ILE A 1 922  ? -14.086 -60.266  25.217  1.00 111.03 ? 926  ILE A CD1   1 
ATOM   7398  N  N     . PHE A 1 923  ? -9.136  -60.458  27.792  1.00 98.16  ? 927  PHE A N     1 
ATOM   7399  C  CA    . PHE A 1 923  ? -8.253  -59.926  28.824  1.00 99.36  ? 927  PHE A CA    1 
ATOM   7400  C  C     . PHE A 1 923  ? -6.836  -59.758  28.289  1.00 99.54  ? 927  PHE A C     1 
ATOM   7401  O  O     . PHE A 1 923  ? -6.129  -58.822  28.676  1.00 99.37  ? 927  PHE A O     1 
ATOM   7402  C  CB    . PHE A 1 923  ? -8.247  -60.830  30.065  1.00 100.12 ? 927  PHE A CB    1 
ATOM   7403  C  CG    . PHE A 1 923  ? -9.382  -60.567  31.013  1.00 97.68  ? 927  PHE A CG    1 
ATOM   7404  C  CD1   . PHE A 1 923  ? -9.793  -59.277  31.276  1.00 102.05 ? 927  PHE A CD1   1 
ATOM   7405  C  CD2   . PHE A 1 923  ? -10.046 -61.611  31.628  1.00 113.31 ? 927  PHE A CD2   1 
ATOM   7406  C  CE1   . PHE A 1 923  ? -10.838 -59.028  32.143  1.00 110.77 ? 927  PHE A CE1   1 
ATOM   7407  C  CE2   . PHE A 1 923  ? -11.093 -61.369  32.500  1.00 124.14 ? 927  PHE A CE2   1 
ATOM   7408  C  CZ    . PHE A 1 923  ? -11.489 -60.071  32.756  1.00 117.60 ? 927  PHE A CZ    1 
ATOM   7409  N  N     . SER A 1 924  ? -6.423  -60.658  27.399  1.00 88.93  ? 928  SER A N     1 
ATOM   7410  C  CA    . SER A 1 924  ? -5.102  -60.550  26.792  1.00 82.73  ? 928  SER A CA    1 
ATOM   7411  C  C     . SER A 1 924  ? -5.027  -59.326  25.900  1.00 83.87  ? 928  SER A C     1 
ATOM   7412  O  O     . SER A 1 924  ? -3.954  -58.761  25.701  1.00 93.12  ? 928  SER A O     1 
ATOM   7413  C  CB    . SER A 1 924  ? -4.763  -61.801  25.990  1.00 78.38  ? 928  SER A CB    1 
ATOM   7414  O  OG    . SER A 1 924  ? -5.524  -61.850  24.792  1.00 95.16  ? 928  SER A OG    1 
ATOM   7415  N  N     . VAL A 1 925  ? -6.172  -58.921  25.358  1.00 83.51  ? 929  VAL A N     1 
ATOM   7416  C  CA    . VAL A 1 925  ? -6.216  -57.722  24.514  1.00 87.83  ? 929  VAL A CA    1 
ATOM   7417  C  C     . VAL A 1 925  ? -6.295  -56.424  25.351  1.00 83.05  ? 929  VAL A C     1 
ATOM   7418  O  O     . VAL A 1 925  ? -5.617  -55.442  25.072  1.00 87.58  ? 929  VAL A O     1 
ATOM   7419  C  CB    . VAL A 1 925  ? -7.407  -57.791  23.522  1.00 77.94  ? 929  VAL A CB    1 
ATOM   7420  C  CG1   . VAL A 1 925  ? -7.642  -56.467  22.859  1.00 89.55  ? 929  VAL A CG1   1 
ATOM   7421  C  CG2   . VAL A 1 925  ? -7.155  -58.858  22.482  1.00 85.26  ? 929  VAL A CG2   1 
ATOM   7422  N  N     . VAL A 1 926  ? -7.118  -56.440  26.391  1.00 85.10  ? 930  VAL A N     1 
ATOM   7423  C  CA    . VAL A 1 926  ? -7.343  -55.287  27.259  1.00 86.53  ? 930  VAL A CA    1 
ATOM   7424  C  C     . VAL A 1 926  ? -6.078  -54.849  27.991  1.00 80.78  ? 930  VAL A C     1 
ATOM   7425  O  O     . VAL A 1 926  ? -5.812  -53.653  28.149  1.00 80.65  ? 930  VAL A O     1 
ATOM   7426  C  CB    . VAL A 1 926  ? -8.446  -55.595  28.302  1.00 93.61  ? 930  VAL A CB    1 
ATOM   7427  C  CG1   . VAL A 1 926  ? -8.473  -54.542  29.384  1.00 107.49 ? 930  VAL A CG1   1 
ATOM   7428  C  CG2   . VAL A 1 926  ? -9.796  -55.691  27.619  1.00 101.59 ? 930  VAL A CG2   1 
ATOM   7429  N  N     . THR A 1 927  ? -5.295  -55.821  28.443  1.00 79.97  ? 931  THR A N     1 
ATOM   7430  C  CA    . THR A 1 927  ? -4.062  -55.529  29.161  1.00 80.81  ? 931  THR A CA    1 
ATOM   7431  C  C     . THR A 1 927  ? -2.946  -55.124  28.206  1.00 92.41  ? 931  THR A C     1 
ATOM   7432  O  O     . THR A 1 927  ? -1.822  -54.863  28.639  1.00 97.30  ? 931  THR A O     1 
ATOM   7433  C  CB    . THR A 1 927  ? -3.601  -56.737  29.985  1.00 84.67  ? 931  THR A CB    1 
ATOM   7434  O  OG1   . THR A 1 927  ? -3.350  -57.854  29.114  1.00 93.33  ? 931  THR A OG1   1 
ATOM   7435  C  CG2   . THR A 1 927  ? -4.671  -57.121  30.988  1.00 87.60  ? 931  THR A CG2   1 
ATOM   7436  N  N     . ASP A 1 928  ? -3.259  -55.083  26.912  1.00 95.15  ? 932  ASP A N     1 
ATOM   7437  C  CA    . ASP A 1 928  ? -2.296  -54.660  25.897  1.00 111.02 ? 932  ASP A CA    1 
ATOM   7438  C  C     . ASP A 1 928  ? -2.462  -53.178  25.555  1.00 110.21 ? 932  ASP A C     1 
ATOM   7439  O  O     . ASP A 1 928  ? -3.581  -52.691  25.359  1.00 92.67  ? 932  ASP A O     1 
ATOM   7440  C  CB    . ASP A 1 928  ? -2.443  -55.509  24.635  1.00 120.45 ? 932  ASP A CB    1 
ATOM   7441  C  CG    . ASP A 1 928  ? -1.380  -55.204  23.601  1.00 132.53 ? 932  ASP A CG    1 
ATOM   7442  O  OD1   . ASP A 1 928  ? -0.264  -54.810  23.992  1.00 142.71 ? 932  ASP A OD1   1 
ATOM   7443  O  OD2   . ASP A 1 928  ? -1.659  -55.358  22.395  1.00 138.06 ? 932  ASP A OD2   1 
ATOM   7444  N  N     . THR A 1 929  ? -1.339  -52.469  25.480  1.00 109.22 ? 933  THR A N     1 
ATOM   7445  C  CA    . THR A 1 929  ? -1.349  -51.033  25.225  1.00 97.91  ? 933  THR A CA    1 
ATOM   7446  C  C     . THR A 1 929  ? -1.768  -50.702  23.798  1.00 97.40  ? 933  THR A C     1 
ATOM   7447  O  O     . THR A 1 929  ? -2.258  -49.605  23.525  1.00 109.72 ? 933  THR A O     1 
ATOM   7448  C  CB    . THR A 1 929  ? 0.036   -50.404  25.485  1.00 82.66  ? 933  THR A CB    1 
ATOM   7449  O  OG1   . THR A 1 929  ? 0.999   -50.995  24.607  1.00 95.76  ? 933  THR A OG1   1 
ATOM   7450  C  CG2   . THR A 1 929  ? 0.464   -50.632  26.911  1.00 83.09  ? 933  THR A CG2   1 
ATOM   7451  N  N     . SER A 1 930  ? -1.579  -51.652  22.890  1.00 106.76 ? 934  SER A N     1 
ATOM   7452  C  CA    . SER A 1 930  ? -1.828  -51.413  21.470  1.00 93.73  ? 934  SER A CA    1 
ATOM   7453  C  C     . SER A 1 930  ? -3.290  -51.581  21.075  1.00 100.02 ? 934  SER A C     1 
ATOM   7454  O  O     . SER A 1 930  ? -3.622  -51.507  19.901  1.00 119.16 ? 934  SER A O     1 
ATOM   7455  C  CB    . SER A 1 930  ? -0.964  -52.345  20.624  1.00 91.77  ? 934  SER A CB    1 
ATOM   7456  O  OG    . SER A 1 930  ? 0.414   -52.089  20.826  1.00 106.34 ? 934  SER A OG    1 
ATOM   7457  N  N     . HIS A 1 931  ? -4.163  -51.794  22.051  1.00 87.59  ? 935  HIS A N     1 
ATOM   7458  C  CA    . HIS A 1 931  ? -5.570  -52.037  21.756  1.00 80.29  ? 935  HIS A CA    1 
ATOM   7459  C  C     . HIS A 1 931  ? -6.508  -51.116  22.515  1.00 78.21  ? 935  HIS A C     1 
ATOM   7460  O  O     . HIS A 1 931  ? -7.726  -51.295  22.478  1.00 64.62  ? 935  HIS A O     1 
ATOM   7461  C  CB    . HIS A 1 931  ? -5.924  -53.491  22.059  1.00 87.30  ? 935  HIS A CB    1 
ATOM   7462  C  CG    . HIS A 1 931  ? -5.272  -54.476  21.136  1.00 92.44  ? 935  HIS A CG    1 
ATOM   7463  N  ND1   . HIS A 1 931  ? -4.412  -55.457  21.581  1.00 100.07 ? 935  HIS A ND1   1 
ATOM   7464  C  CD2   . HIS A 1 931  ? -5.353  -54.629  19.793  1.00 79.58  ? 935  HIS A CD2   1 
ATOM   7465  C  CE1   . HIS A 1 931  ? -3.992  -56.171  20.553  1.00 100.53 ? 935  HIS A CE1   1 
ATOM   7466  N  NE2   . HIS A 1 931  ? -4.546  -55.688  19.455  1.00 78.31  ? 935  HIS A NE2   1 
ATOM   7467  N  N     . THR A 1 932  ? -5.933  -50.121  23.185  1.00 101.77 ? 936  THR A N     1 
ATOM   7468  C  CA    . THR A 1 932  ? -6.688  -49.186  24.019  1.00 95.18  ? 936  THR A CA    1 
ATOM   7469  C  C     . THR A 1 932  ? -7.841  -48.534  23.263  1.00 92.05  ? 936  THR A C     1 
ATOM   7470  O  O     . THR A 1 932  ? -8.855  -48.162  23.863  1.00 93.95  ? 936  THR A O     1 
ATOM   7471  C  CB    . THR A 1 932  ? -5.778  -48.089  24.581  1.00 88.81  ? 936  THR A CB    1 
ATOM   7472  O  OG1   . THR A 1 932  ? -4.931  -47.599  23.538  1.00 107.28 ? 936  THR A OG1   1 
ATOM   7473  C  CG2   . THR A 1 932  ? -4.913  -48.639  25.692  1.00 79.95  ? 936  THR A CG2   1 
ATOM   7474  N  N     . ALA A 1 933  ? -7.686  -48.423  21.945  1.00 85.33  ? 937  ALA A N     1 
ATOM   7475  C  CA    . ALA A 1 933  ? -8.702  -47.819  21.089  1.00 83.89  ? 937  ALA A CA    1 
ATOM   7476  C  C     . ALA A 1 933  ? -10.058 -48.517  21.208  1.00 77.67  ? 937  ALA A C     1 
ATOM   7477  O  O     . ALA A 1 933  ? -11.103 -47.882  21.062  1.00 85.91  ? 937  ALA A O     1 
ATOM   7478  C  CB    . ALA A 1 933  ? -8.236  -47.823  19.655  1.00 88.16  ? 937  ALA A CB    1 
ATOM   7479  N  N     . GLY A 1 934  ? -10.043 -49.817  21.487  1.00 60.82  ? 938  GLY A N     1 
ATOM   7480  C  CA    . GLY A 1 934  ? -11.281 -50.566  21.600  1.00 71.40  ? 938  GLY A CA    1 
ATOM   7481  C  C     . GLY A 1 934  ? -11.801 -50.689  23.030  1.00 77.73  ? 938  GLY A C     1 
ATOM   7482  O  O     . GLY A 1 934  ? -12.698 -51.511  23.324  1.00 67.45  ? 938  GLY A O     1 
ATOM   7483  N  N     . LEU A 1 935  ? -11.249 -49.859  23.917  1.00 80.13  ? 939  LEU A N     1 
ATOM   7484  C  CA    . LEU A 1 935  ? -11.602 -49.874  25.333  1.00 79.57  ? 939  LEU A CA    1 
ATOM   7485  C  C     . LEU A 1 935  ? -13.114 -49.850  25.569  1.00 77.09  ? 939  LEU A C     1 
ATOM   7486  O  O     . LEU A 1 935  ? -13.654 -50.738  26.241  1.00 88.98  ? 939  LEU A O     1 
ATOM   7487  C  CB    . LEU A 1 935  ? -10.947 -48.693  26.033  1.00 83.68  ? 939  LEU A CB    1 
ATOM   7488  C  CG    . LEU A 1 935  ? -10.911 -48.675  27.560  1.00 79.72  ? 939  LEU A CG    1 
ATOM   7489  C  CD1   . LEU A 1 935  ? -10.368 -49.975  28.133  1.00 66.34  ? 939  LEU A CD1   1 
ATOM   7490  C  CD2   . LEU A 1 935  ? -10.081 -47.481  28.025  1.00 74.91  ? 939  LEU A CD2   1 
ATOM   7491  N  N     . THR A 1 936  ? -13.787 -48.850  24.996  1.00 67.95  ? 940  THR A N     1 
ATOM   7492  C  CA    . THR A 1 936  ? -15.239 -48.714  25.117  1.00 65.65  ? 940  THR A CA    1 
ATOM   7493  C  C     . THR A 1 936  ? -15.955 -50.021  24.790  1.00 83.98  ? 940  THR A C     1 
ATOM   7494  O  O     . THR A 1 936  ? -16.901 -50.413  25.500  1.00 82.54  ? 940  THR A O     1 
ATOM   7495  C  CB    . THR A 1 936  ? -15.787 -47.613  24.205  1.00 75.01  ? 940  THR A CB    1 
ATOM   7496  O  OG1   . THR A 1 936  ? -15.265 -46.340  24.608  1.00 76.27  ? 940  THR A OG1   1 
ATOM   7497  C  CG2   . THR A 1 936  ? -17.304 -47.569  24.271  1.00 79.71  ? 940  THR A CG2   1 
ATOM   7498  N  N     . MET A 1 937  ? -15.489 -50.712  23.748  1.00 84.74  ? 941  MET A N     1 
ATOM   7499  C  CA    . MET A 1 937  ? -16.097 -51.984  23.387  1.00 84.88  ? 941  MET A CA    1 
ATOM   7500  C  C     . MET A 1 937  ? -15.755 -53.056  24.415  1.00 94.05  ? 941  MET A C     1 
ATOM   7501  O  O     . MET A 1 937  ? -16.645 -53.763  24.893  1.00 107.72 ? 941  MET A O     1 
ATOM   7502  C  CB    . MET A 1 937  ? -15.665 -52.422  21.994  1.00 88.88  ? 941  MET A CB    1 
ATOM   7503  C  CG    . MET A 1 937  ? -16.464 -51.778  20.877  1.00 100.42 ? 941  MET A CG    1 
ATOM   7504  S  SD    . MET A 1 937  ? -18.242 -52.010  21.085  1.00 93.78  ? 941  MET A SD    1 
ATOM   7505  C  CE    . MET A 1 937  ? -18.380 -53.773  20.964  1.00 80.23  ? 941  MET A CE    1 
ATOM   7506  N  N     . HIS A 1 938  ? -14.469 -53.159  24.755  1.00 90.88  ? 942  HIS A N     1 
ATOM   7507  C  CA    . HIS A 1 938  ? -13.996 -54.158  25.719  1.00 90.36  ? 942  HIS A CA    1 
ATOM   7508  C  C     . HIS A 1 938  ? -14.880 -54.173  26.953  1.00 91.14  ? 942  HIS A C     1 
ATOM   7509  O  O     . HIS A 1 938  ? -15.511 -55.193  27.263  1.00 100.15 ? 942  HIS A O     1 
ATOM   7510  C  CB    . HIS A 1 938  ? -12.550 -53.884  26.129  1.00 91.41  ? 942  HIS A CB    1 
ATOM   7511  C  CG    . HIS A 1 938  ? -11.564 -54.062  25.021  1.00 90.59  ? 942  HIS A CG    1 
ATOM   7512  N  ND1   . HIS A 1 938  ? -10.315 -53.478  25.034  1.00 95.07  ? 942  HIS A ND1   1 
ATOM   7513  C  CD2   . HIS A 1 938  ? -11.636 -54.767  23.871  1.00 88.79  ? 942  HIS A CD2   1 
ATOM   7514  C  CE1   . HIS A 1 938  ? -9.664  -53.808  23.935  1.00 78.25  ? 942  HIS A CE1   1 
ATOM   7515  N  NE2   . HIS A 1 938  ? -10.442 -54.594  23.213  1.00 86.68  ? 942  HIS A NE2   1 
ATOM   7516  N  N     . ALA A 1 939  ? -14.934 -53.026  27.631  1.00 84.38  ? 943  ALA A N     1 
ATOM   7517  C  CA    . ALA A 1 939  ? -15.808 -52.834  28.782  1.00 93.68  ? 943  ALA A CA    1 
ATOM   7518  C  C     . ALA A 1 939  ? -17.204 -53.360  28.480  1.00 99.90  ? 943  ALA A C     1 
ATOM   7519  O  O     . ALA A 1 939  ? -17.687 -54.278  29.165  1.00 118.66 ? 943  ALA A O     1 
ATOM   7520  C  CB    . ALA A 1 939  ? -15.866 -51.367  29.168  1.00 89.63  ? 943  ALA A CB    1 
ATOM   7521  N  N     . SER A 1 940  ? -17.814 -52.815  27.423  1.00 85.39  ? 944  SER A N     1 
ATOM   7522  C  CA    . SER A 1 940  ? -19.179 -53.172  27.038  1.00 87.21  ? 944  SER A CA    1 
ATOM   7523  C  C     . SER A 1 940  ? -19.369 -54.685  26.961  1.00 99.90  ? 944  SER A C     1 
ATOM   7524  O  O     . SER A 1 940  ? -20.420 -55.207  27.350  1.00 105.28 ? 944  SER A O     1 
ATOM   7525  C  CB    . SER A 1 940  ? -19.542 -52.537  25.696  1.00 77.19  ? 944  SER A CB    1 
ATOM   7526  O  OG    . SER A 1 940  ? -19.580 -51.128  25.788  1.00 86.16  ? 944  SER A OG    1 
ATOM   7527  N  N     . ILE A 1 941  ? -18.348 -55.389  26.479  1.00 95.91  ? 945  ILE A N     1 
ATOM   7528  C  CA    . ILE A 1 941  ? -18.429 -56.834  26.421  1.00 97.05  ? 945  ILE A CA    1 
ATOM   7529  C  C     . ILE A 1 941  ? -18.371 -57.403  27.831  1.00 106.11 ? 945  ILE A C     1 
ATOM   7530  O  O     . ILE A 1 941  ? -19.329 -58.042  28.281  1.00 109.94 ? 945  ILE A O     1 
ATOM   7531  C  CB    . ILE A 1 941  ? -17.307 -57.443  25.563  1.00 98.44  ? 945  ILE A CB    1 
ATOM   7532  C  CG1   . ILE A 1 941  ? -17.433 -56.977  24.110  1.00 92.45  ? 945  ILE A CG1   1 
ATOM   7533  C  CG2   . ILE A 1 941  ? -17.365 -58.953  25.618  1.00 104.63 ? 945  ILE A CG2   1 
ATOM   7534  C  CD1   . ILE A 1 941  ? -16.383 -57.557  23.190  1.00 95.95  ? 945  ILE A CD1   1 
ATOM   7535  N  N     . LEU A 1 942  ? -17.269 -57.135  28.531  1.00 106.35 ? 946  LEU A N     1 
ATOM   7536  C  CA    . LEU A 1 942  ? -17.018 -57.754  29.831  1.00 111.01 ? 946  LEU A CA    1 
ATOM   7537  C  C     . LEU A 1 942  ? -18.170 -57.485  30.785  1.00 109.38 ? 946  LEU A C     1 
ATOM   7538  O  O     . LEU A 1 942  ? -18.724 -58.427  31.378  1.00 111.73 ? 946  LEU A O     1 
ATOM   7539  C  CB    . LEU A 1 942  ? -15.704 -57.252  30.424  1.00 100.44 ? 946  LEU A CB    1 
ATOM   7540  C  CG    . LEU A 1 942  ? -14.444 -57.630  29.647  1.00 80.19  ? 946  LEU A CG    1 
ATOM   7541  C  CD1   . LEU A 1 942  ? -13.203 -57.066  30.300  1.00 72.90  ? 946  LEU A CD1   1 
ATOM   7542  C  CD2   . LEU A 1 942  ? -14.337 -59.142  29.517  1.00 82.34  ? 946  LEU A CD2   1 
ATOM   7543  N  N     . ALA A 1 943  ? -18.536 -56.206  30.898  1.00 91.85  ? 947  ALA A N     1 
ATOM   7544  C  CA    . ALA A 1 943  ? -19.719 -55.798  31.642  1.00 92.50  ? 947  ALA A CA    1 
ATOM   7545  C  C     . ALA A 1 943  ? -20.860 -56.755  31.352  1.00 100.55 ? 947  ALA A C     1 
ATOM   7546  O  O     . ALA A 1 943  ? -21.287 -57.510  32.249  1.00 94.66  ? 947  ALA A O     1 
ATOM   7547  C  CB    . ALA A 1 943  ? -20.111 -54.378  31.288  1.00 102.21 ? 947  ALA A CB    1 
ATOM   7548  N  N     . TYR A 1 944  ? -21.290 -56.765  30.087  1.00 101.79 ? 948  TYR A N     1 
ATOM   7549  C  CA    . TYR A 1 944  ? -22.365 -57.643  29.634  1.00 94.28  ? 948  TYR A CA    1 
ATOM   7550  C  C     . TYR A 1 944  ? -22.134 -59.063  30.135  1.00 90.30  ? 948  TYR A C     1 
ATOM   7551  O  O     . TYR A 1 944  ? -22.986 -59.635  30.807  1.00 79.59  ? 948  TYR A O     1 
ATOM   7552  C  CB    . TYR A 1 944  ? -22.477 -57.631  28.097  1.00 100.53 ? 948  TYR A CB    1 
ATOM   7553  C  CG    . TYR A 1 944  ? -23.474 -58.631  27.546  1.00 99.23  ? 948  TYR A CG    1 
ATOM   7554  C  CD1   . TYR A 1 944  ? -24.816 -58.302  27.413  1.00 104.97 ? 948  TYR A CD1   1 
ATOM   7555  C  CD2   . TYR A 1 944  ? -23.074 -59.909  27.173  1.00 103.33 ? 948  TYR A CD2   1 
ATOM   7556  C  CE1   . TYR A 1 944  ? -25.732 -59.216  26.922  1.00 116.29 ? 948  TYR A CE1   1 
ATOM   7557  C  CE2   . TYR A 1 944  ? -23.983 -60.832  26.685  1.00 115.45 ? 948  TYR A CE2   1 
ATOM   7558  C  CZ    . TYR A 1 944  ? -25.311 -60.480  26.561  1.00 119.07 ? 948  TYR A CZ    1 
ATOM   7559  O  OH    . TYR A 1 944  ? -26.222 -61.395  26.076  1.00 108.73 ? 948  TYR A OH    1 
ATOM   7560  N  N     . MET A 1 945  ? -20.960 -59.603  29.829  1.00 89.18  ? 949  MET A N     1 
ATOM   7561  C  CA    . MET A 1 945  ? -20.653 -60.986  30.148  1.00 95.29  ? 949  MET A CA    1 
ATOM   7562  C  C     . MET A 1 945  ? -20.790 -61.190  31.639  1.00 112.84 ? 949  MET A C     1 
ATOM   7563  O  O     . MET A 1 945  ? -21.464 -62.121  32.089  1.00 111.70 ? 949  MET A O     1 
ATOM   7564  C  CB    . MET A 1 945  ? -19.245 -61.367  29.680  1.00 104.52 ? 949  MET A CB    1 
ATOM   7565  C  CG    . MET A 1 945  ? -19.058 -61.346  28.149  1.00 91.36  ? 949  MET A CG    1 
ATOM   7566  S  SD    . MET A 1 945  ? -17.449 -61.960  27.608  1.00 109.69 ? 949  MET A SD    1 
ATOM   7567  C  CE    . MET A 1 945  ? -17.593 -63.698  27.965  1.00 80.33  ? 949  MET A CE    1 
ATOM   7568  N  N     . PHE A 1 946  ? -20.197 -60.282  32.408  1.00 120.99 ? 950  PHE A N     1 
ATOM   7569  C  CA    . PHE A 1 946  ? -20.202 -60.438  33.852  1.00 112.64 ? 950  PHE A CA    1 
ATOM   7570  C  C     . PHE A 1 946  ? -21.621 -60.296  34.372  1.00 113.51 ? 950  PHE A C     1 
ATOM   7571  O  O     . PHE A 1 946  ? -22.012 -61.003  35.307  1.00 121.83 ? 950  PHE A O     1 
ATOM   7572  C  CB    . PHE A 1 946  ? -19.258 -59.435  34.509  1.00 108.65 ? 950  PHE A CB    1 
ATOM   7573  C  CG    . PHE A 1 946  ? -17.835 -59.916  34.587  1.00 107.83 ? 950  PHE A CG    1 
ATOM   7574  C  CD1   . PHE A 1 946  ? -17.353 -60.505  35.743  1.00 117.06 ? 950  PHE A CD1   1 
ATOM   7575  C  CD2   . PHE A 1 946  ? -16.984 -59.789  33.503  1.00 104.90 ? 950  PHE A CD2   1 
ATOM   7576  C  CE1   . PHE A 1 946  ? -16.046 -60.954  35.818  1.00 116.80 ? 950  PHE A CE1   1 
ATOM   7577  C  CE2   . PHE A 1 946  ? -15.679 -60.239  33.572  1.00 105.42 ? 950  PHE A CE2   1 
ATOM   7578  C  CZ    . PHE A 1 946  ? -15.212 -60.832  34.726  1.00 110.67 ? 950  PHE A CZ    1 
ATOM   7579  N  N     . ASN A 1 947  ? -22.406 -59.425  33.737  1.00 94.30  ? 951  ASN A N     1 
ATOM   7580  C  CA    . ASN A 1 947  ? -23.792 -59.262  34.143  1.00 102.60 ? 951  ASN A CA    1 
ATOM   7581  C  C     . ASN A 1 947  ? -24.520 -60.583  33.960  1.00 116.49 ? 951  ASN A C     1 
ATOM   7582  O  O     . ASN A 1 947  ? -25.314 -60.997  34.811  1.00 137.32 ? 951  ASN A O     1 
ATOM   7583  C  CB    . ASN A 1 947  ? -24.474 -58.155  33.348  1.00 109.11 ? 951  ASN A CB    1 
ATOM   7584  C  CG    . ASN A 1 947  ? -25.869 -57.846  33.859  1.00 126.04 ? 951  ASN A CG    1 
ATOM   7585  O  OD1   . ASN A 1 947  ? -26.816 -58.583  33.598  1.00 135.03 ? 951  ASN A OD1   1 
ATOM   7586  N  ND2   . ASN A 1 947  ? -26.002 -56.745  34.587  1.00 132.66 ? 951  ASN A ND2   1 
ATOM   7587  N  N     . LEU A 1 948  ? -24.195 -61.267  32.866  1.00 119.95 ? 952  LEU A N     1 
ATOM   7588  C  CA    . LEU A 1 948  ? -24.815 -62.542  32.540  1.00 118.66 ? 952  LEU A CA    1 
ATOM   7589  C  C     . LEU A 1 948  ? -24.549 -63.554  33.636  1.00 120.49 ? 952  LEU A C     1 
ATOM   7590  O  O     . LEU A 1 948  ? -25.353 -64.450  33.880  1.00 136.26 ? 952  LEU A O     1 
ATOM   7591  C  CB    . LEU A 1 948  ? -24.290 -63.069  31.203  1.00 123.74 ? 952  LEU A CB    1 
ATOM   7592  C  CG    . LEU A 1 948  ? -25.305 -63.453  30.132  1.00 123.42 ? 952  LEU A CG    1 
ATOM   7593  C  CD1   . LEU A 1 948  ? -26.133 -62.245  29.730  1.00 127.86 ? 952  LEU A CD1   1 
ATOM   7594  C  CD2   . LEU A 1 948  ? -24.578 -64.032  28.939  1.00 129.04 ? 952  LEU A CD2   1 
ATOM   7595  N  N     . VAL A 1 949  ? -23.413 -63.402  34.303  1.00 110.73 ? 953  VAL A N     1 
ATOM   7596  C  CA    . VAL A 1 949  ? -23.012 -64.371  35.302  1.00 121.18 ? 953  VAL A CA    1 
ATOM   7597  C  C     . VAL A 1 949  ? -23.772 -64.131  36.597  1.00 126.07 ? 953  VAL A C     1 
ATOM   7598  O  O     . VAL A 1 949  ? -23.961 -65.058  37.393  1.00 121.85 ? 953  VAL A O     1 
ATOM   7599  C  CB    . VAL A 1 949  ? -21.496 -64.325  35.527  1.00 119.58 ? 953  VAL A CB    1 
ATOM   7600  C  CG1   . VAL A 1 949  ? -21.080 -65.229  36.676  1.00 124.37 ? 953  VAL A CG1   1 
ATOM   7601  C  CG2   . VAL A 1 949  ? -20.805 -64.743  34.242  1.00 112.32 ? 953  VAL A CG2   1 
ATOM   7602  N  N     . GLU A 1 950  ? -24.256 -62.908  36.797  1.00 124.20 ? 954  GLU A N     1 
ATOM   7603  C  CA    . GLU A 1 950  ? -24.986 -62.648  38.028  1.00 128.73 ? 954  GLU A CA    1 
ATOM   7604  C  C     . GLU A 1 950  ? -26.295 -63.462  38.089  1.00 149.04 ? 954  GLU A C     1 
ATOM   7605  O  O     . GLU A 1 950  ? -26.618 -64.005  39.145  1.00 173.49 ? 954  GLU A O     1 
ATOM   7606  C  CB    . GLU A 1 950  ? -25.263 -61.154  38.202  1.00 124.62 ? 954  GLU A CB    1 
ATOM   7607  C  CG    . GLU A 1 950  ? -24.073 -60.320  38.643  1.00 139.49 ? 954  GLU A CG    1 
ATOM   7608  C  CD    . GLU A 1 950  ? -24.480 -58.910  39.039  1.00 148.22 ? 954  GLU A CD    1 
ATOM   7609  O  OE1   . GLU A 1 950  ? -25.651 -58.539  38.805  1.00 152.33 ? 954  GLU A OE1   1 
ATOM   7610  O  OE2   . GLU A 1 950  ? -23.634 -58.175  39.590  1.00 151.31 ? 954  GLU A OE2   1 
ATOM   7611  N  N     . GLU A 1 951  ? -27.033 -63.586  36.981  1.00 146.69 ? 955  GLU A N     1 
ATOM   7612  C  CA    . GLU A 1 951  ? -28.320 -64.298  37.053  1.00 146.40 ? 955  GLU A CA    1 
ATOM   7613  C  C     . GLU A 1 951  ? -28.793 -65.098  35.820  1.00 148.59 ? 955  GLU A C     1 
ATOM   7614  O  O     . GLU A 1 951  ? -29.778 -65.834  35.922  1.00 136.63 ? 955  GLU A O     1 
ATOM   7615  C  CB    . GLU A 1 951  ? -29.428 -63.297  37.438  1.00 147.05 ? 955  GLU A CB    1 
ATOM   7616  C  CG    . GLU A 1 951  ? -29.806 -62.243  36.385  1.00 144.87 ? 955  GLU A CG    1 
ATOM   7617  C  CD    . GLU A 1 951  ? -28.791 -61.118  36.259  1.00 151.16 ? 955  GLU A CD    1 
ATOM   7618  O  OE1   . GLU A 1 951  ? -27.623 -61.341  36.597  1.00 152.30 ? 955  GLU A OE1   1 
ATOM   7619  O  OE2   . GLU A 1 951  ? -29.153 -60.008  35.816  1.00 151.74 ? 955  GLU A OE2   1 
ATOM   7620  N  N     . GLY A 1 952  ? -28.111 -64.986  34.680  1.00 150.95 ? 956  GLY A N     1 
ATOM   7621  C  CA    . GLY A 1 952  ? -28.613 -65.574  33.440  1.00 139.32 ? 956  GLY A CA    1 
ATOM   7622  C  C     . GLY A 1 952  ? -27.965 -66.842  32.900  1.00 132.31 ? 956  GLY A C     1 
ATOM   7623  O  O     . GLY A 1 952  ? -28.282 -67.274  31.797  1.00 133.09 ? 956  GLY A O     1 
ATOM   7624  N  N     . LYS A 1 953  ? -27.071 -67.453  33.669  1.00 140.92 ? 957  LYS A N     1 
ATOM   7625  C  CA    . LYS A 1 953  ? -26.369 -68.655  33.219  1.00 147.22 ? 957  LYS A CA    1 
ATOM   7626  C  C     . LYS A 1 953  ? -26.626 -69.827  34.168  1.00 162.59 ? 957  LYS A C     1 
ATOM   7627  O  O     . LYS A 1 953  ? -26.032 -69.903  35.243  1.00 164.27 ? 957  LYS A O     1 
ATOM   7628  C  CB    . LYS A 1 953  ? -24.869 -68.376  33.103  1.00 141.64 ? 957  LYS A CB    1 
ATOM   7629  C  CG    . LYS A 1 953  ? -24.044 -69.535  32.577  1.00 145.58 ? 957  LYS A CG    1 
ATOM   7630  C  CD    . LYS A 1 953  ? -22.556 -69.254  32.726  1.00 151.38 ? 957  LYS A CD    1 
ATOM   7631  C  CE    . LYS A 1 953  ? -21.725 -70.480  32.375  1.00 163.38 ? 957  LYS A CE    1 
ATOM   7632  N  NZ    . LYS A 1 953  ? -20.290 -70.311  32.743  1.00 165.84 ? 957  LYS A NZ    1 
ATOM   7633  N  N     . ILE A 1 954  ? -27.501 -70.746  33.762  1.00 168.72 ? 958  ILE A N     1 
ATOM   7634  C  CA    . ILE A 1 954  ? -27.994 -71.791  34.663  1.00 173.80 ? 958  ILE A CA    1 
ATOM   7635  C  C     . ILE A 1 954  ? -26.986 -72.914  34.937  1.00 171.87 ? 958  ILE A C     1 
ATOM   7636  O  O     . ILE A 1 954  ? -26.843 -73.353  36.077  1.00 169.31 ? 958  ILE A O     1 
ATOM   7637  C  CB    . ILE A 1 954  ? -29.308 -72.421  34.126  1.00 161.58 ? 958  ILE A CB    1 
ATOM   7638  C  CG1   . ILE A 1 954  ? -29.127 -72.955  32.702  1.00 159.24 ? 958  ILE A CG1   1 
ATOM   7639  C  CG2   . ILE A 1 954  ? -30.436 -71.404  34.161  1.00 165.71 ? 958  ILE A CG2   1 
ATOM   7640  C  CD1   . ILE A 1 954  ? -30.353 -73.653  32.143  1.00 162.89 ? 958  ILE A CD1   1 
ATOM   7641  N  N     . SER A 1 955  ? -26.290 -73.376  33.905  1.00 170.80 ? 959  SER A N     1 
ATOM   7642  C  CA    . SER A 1 955  ? -25.329 -74.461  34.067  1.00 167.98 ? 959  SER A CA    1 
ATOM   7643  C  C     . SER A 1 955  ? -24.076 -73.971  34.787  1.00 161.90 ? 959  SER A C     1 
ATOM   7644  O  O     . SER A 1 955  ? -23.791 -72.771  34.819  1.00 159.32 ? 959  SER A O     1 
ATOM   7645  C  CB    . SER A 1 955  ? -24.962 -75.062  32.708  1.00 171.91 ? 959  SER A CB    1 
ATOM   7646  O  OG    . SER A 1 955  ? -24.551 -74.050  31.798  1.00 171.59 ? 959  SER A OG    1 
ATOM   7647  N  N     . THR A 1 956  ? -23.331 -74.906  35.365  1.00 157.30 ? 960  THR A N     1 
ATOM   7648  C  CA    . THR A 1 956  ? -22.139 -74.569  36.135  1.00 159.64 ? 960  THR A CA    1 
ATOM   7649  C  C     . THR A 1 956  ? -20.877 -75.053  35.420  1.00 159.06 ? 960  THR A C     1 
ATOM   7650  O  O     . THR A 1 956  ? -20.880 -76.124  34.804  1.00 169.05 ? 960  THR A O     1 
ATOM   7651  C  CB    . THR A 1 956  ? -22.204 -75.172  37.552  1.00 167.17 ? 960  THR A CB    1 
ATOM   7652  O  OG1   . THR A 1 956  ? -23.441 -74.802  38.174  1.00 174.73 ? 960  THR A OG1   1 
ATOM   7653  C  CG2   . THR A 1 956  ? -21.056 -74.668  38.397  1.00 164.41 ? 960  THR A CG2   1 
ATOM   7654  N  N     . SER A 1 957  ? -19.807 -74.266  35.510  1.00 145.77 ? 961  SER A N     1 
ATOM   7655  C  CA    . SER A 1 957  ? -18.600 -74.503  34.725  1.00 137.97 ? 961  SER A CA    1 
ATOM   7656  C  C     . SER A 1 957  ? -17.816 -75.767  35.094  1.00 169.58 ? 961  SER A C     1 
ATOM   7657  O  O     . SER A 1 957  ? -17.407 -76.520  34.207  1.00 180.19 ? 961  SER A O     1 
ATOM   7658  C  CB    . SER A 1 957  ? -17.684 -73.293  34.832  1.00 129.03 ? 961  SER A CB    1 
ATOM   7659  O  OG    . SER A 1 957  ? -18.306 -72.132  34.284  1.00 132.37 ? 961  SER A OG    1 
ATOM   7660  N  N     . LEU A 1 958  ? -17.597 -76.007  36.383  1.00 171.71 ? 962  LEU A N     1 
ATOM   7661  C  CA    . LEU A 1 958  ? -16.801 -77.162  36.792  1.00 180.02 ? 962  LEU A CA    1 
ATOM   7662  C  C     . LEU A 1 958  ? -17.655 -78.274  37.398  1.00 203.43 ? 962  LEU A C     1 
ATOM   7663  O  O     . LEU A 1 958  ? -18.778 -78.029  37.845  1.00 208.96 ? 962  LEU A O     1 
ATOM   7664  C  CB    . LEU A 1 958  ? -15.715 -76.734  37.783  1.00 173.83 ? 962  LEU A CB    1 
ATOM   7665  C  CG    . LEU A 1 958  ? -14.271 -76.834  37.281  1.00 165.28 ? 962  LEU A CG    1 
ATOM   7666  C  CD1   . LEU A 1 958  ? -13.291 -76.417  38.374  1.00 155.42 ? 962  LEU A CD1   1 
ATOM   7667  C  CD2   . LEU A 1 958  ? -13.965 -78.250  36.784  1.00 167.97 ? 962  LEU A CD2   1 
ATOM   7668  N  N     . ASN A 1 959  ? -17.111 -79.491  37.407  1.00 216.29 ? 963  ASN A N     1 
ATOM   7669  C  CA    . ASN A 1 959  ? -17.798 -80.653  37.969  1.00 225.75 ? 963  ASN A CA    1 
ATOM   7670  C  C     . ASN A 1 959  ? -18.275 -80.431  39.409  1.00 228.38 ? 963  ASN A C     1 
ATOM   7671  O  O     . ASN A 1 959  ? -19.427 -80.728  39.726  1.00 238.53 ? 963  ASN A O     1 
ATOM   7672  C  CB    . ASN A 1 959  ? -16.897 -81.892  37.908  1.00 233.54 ? 963  ASN A CB    1 
ATOM   7673  C  CG    . ASN A 1 959  ? -16.156 -82.012  36.593  1.00 235.71 ? 963  ASN A CG    1 
ATOM   7674  O  OD1   . ASN A 1 959  ? -15.195 -81.285  36.343  1.00 233.79 ? 963  ASN A OD1   1 
ATOM   7675  N  ND2   . ASN A 1 959  ? -16.592 -82.941  35.749  1.00 241.40 ? 963  ASN A ND2   1 
ATOM   7676  N  N     . PRO A 1 960  ? -17.401 -79.910  40.293  1.00 221.81 ? 964  PRO A N     1 
ATOM   7677  C  CA    . PRO A 1 960  ? -17.957 -79.615  41.616  1.00 216.97 ? 964  PRO A CA    1 
ATOM   7678  C  C     . PRO A 1 960  ? -18.825 -78.362  41.568  1.00 208.90 ? 964  PRO A C     1 
ATOM   7679  O  O     . PRO A 1 960  ? -18.400 -77.319  42.052  1.00 208.04 ? 964  PRO A O     1 
ATOM   7680  C  CB    . PRO A 1 960  ? -16.712 -79.388  42.488  1.00 219.16 ? 964  PRO A CB    1 
ATOM   7681  C  CG    . PRO A 1 960  ? -15.549 -79.880  41.670  1.00 221.36 ? 964  PRO A CG    1 
ATOM   7682  C  CD    . PRO A 1 960  ? -15.950 -79.655  40.253  1.00 220.05 ? 964  PRO A CD    1 
ATOM   7683  N  N     . GLY A 1 961  ? -20.018 -78.467  40.989  1.00 202.85 ? 965  GLY A N     1 
ATOM   7684  C  CA    . GLY A 1 961  ? -20.892 -77.321  40.821  1.00 188.50 ? 965  GLY A CA    1 
ATOM   7685  C  C     . GLY A 1 961  ? -21.262 -76.622  42.117  1.00 193.12 ? 965  GLY A C     1 
ATOM   7686  O  O     . GLY A 1 961  ? -21.388 -75.396  42.153  1.00 180.27 ? 965  GLY A O     1 
ATOM   7687  N  N     . ASN A 1 962  ? -21.430 -77.403  43.183  1.00 214.45 ? 966  ASN A N     1 
ATOM   7688  C  CA    . ASN A 1 962  ? -21.825 -76.866  44.485  1.00 220.92 ? 966  ASN A CA    1 
ATOM   7689  C  C     . ASN A 1 962  ? -20.730 -76.034  45.172  1.00 249.17 ? 966  ASN A C     1 
ATOM   7690  O  O     . ASN A 1 962  ? -21.003 -74.916  45.615  1.00 243.08 ? 966  ASN A O     1 
ATOM   7691  C  CB    . ASN A 1 962  ? -22.283 -78.000  45.414  1.00 202.44 ? 966  ASN A CB    1 
ATOM   7692  C  CG    . ASN A 1 962  ? -23.791 -78.080  45.538  1.00 189.67 ? 966  ASN A CG    1 
ATOM   7693  O  OD1   . ASN A 1 962  ? -24.523 -77.413  44.811  1.00 189.22 ? 966  ASN A OD1   1 
ATOM   7694  N  ND2   . ASN A 1 962  ? -24.262 -78.902  46.462  1.00 186.54 ? 966  ASN A ND2   1 
ATOM   7695  N  N     . PRO A 1 963  ? -19.492 -76.561  45.274  1.00 263.64 ? 967  PRO A N     1 
ATOM   7696  C  CA    . PRO A 1 963  ? -18.475 -75.672  45.852  1.00 257.43 ? 967  PRO A CA    1 
ATOM   7697  C  C     . PRO A 1 963  ? -18.056 -74.567  44.883  1.00 250.37 ? 967  PRO A C     1 
ATOM   7698  O  O     . PRO A 1 963  ? -17.348 -73.636  45.268  1.00 256.70 ? 967  PRO A O     1 
ATOM   7699  C  CB    . PRO A 1 963  ? -17.297 -76.616  46.135  1.00 259.53 ? 967  PRO A CB    1 
ATOM   7700  C  CG    . PRO A 1 963  ? -17.869 -77.998  46.080  1.00 263.92 ? 967  PRO A CG    1 
ATOM   7701  C  CD    . PRO A 1 963  ? -18.965 -77.923  45.074  1.00 263.71 ? 967  PRO A CD    1 
ATOM   7702  N  N     . VAL A 1 964  ? -18.500 -74.677  43.635  1.00 226.13 ? 968  VAL A N     1 
ATOM   7703  C  CA    . VAL A 1 964  ? -18.059 -73.783  42.580  1.00 186.45 ? 968  VAL A CA    1 
ATOM   7704  C  C     . VAL A 1 964  ? -19.262 -73.082  41.939  1.00 161.26 ? 968  VAL A C     1 
ATOM   7705  O  O     . VAL A 1 964  ? -19.717 -73.456  40.859  1.00 163.26 ? 968  VAL A O     1 
ATOM   7706  C  CB    . VAL A 1 964  ? -17.233 -74.569  41.524  1.00 184.43 ? 968  VAL A CB    1 
ATOM   7707  C  CG1   . VAL A 1 964  ? -16.723 -73.674  40.428  1.00 178.87 ? 968  VAL A CG1   1 
ATOM   7708  C  CG2   . VAL A 1 964  ? -16.058 -75.276  42.194  1.00 182.03 ? 968  VAL A CG2   1 
ATOM   7709  N  N     . ASN A 1 965  ? -19.792 -72.078  42.631  1.00 155.04 ? 969  ASN A N     1 
ATOM   7710  C  CA    . ASN A 1 965  ? -20.861 -71.244  42.084  1.00 153.54 ? 969  ASN A CA    1 
ATOM   7711  C  C     . ASN A 1 965  ? -20.315 -70.356  40.969  1.00 154.72 ? 969  ASN A C     1 
ATOM   7712  O  O     . ASN A 1 965  ? -19.118 -70.074  40.938  1.00 155.25 ? 969  ASN A O     1 
ATOM   7713  C  CB    . ASN A 1 965  ? -21.496 -70.389  43.185  1.00 149.74 ? 969  ASN A CB    1 
ATOM   7714  C  CG    . ASN A 1 965  ? -22.596 -69.477  42.664  1.00 144.27 ? 969  ASN A CG    1 
ATOM   7715  O  OD1   . ASN A 1 965  ? -23.240 -69.777  41.662  1.00 153.71 ? 969  ASN A OD1   1 
ATOM   7716  N  ND2   . ASN A 1 965  ? -22.809 -68.356  43.341  1.00 139.31 ? 969  ASN A ND2   1 
ATOM   7717  N  N     . ASN A 1 966  ? -21.190 -69.923  40.062  1.00 153.84 ? 970  ASN A N     1 
ATOM   7718  C  CA    . ASN A 1 966  ? -20.782 -69.125  38.904  1.00 146.57 ? 970  ASN A CA    1 
ATOM   7719  C  C     . ASN A 1 966  ? -19.910 -67.916  39.249  1.00 141.42 ? 970  ASN A C     1 
ATOM   7720  O  O     . ASN A 1 966  ? -18.778 -67.803  38.769  1.00 140.80 ? 970  ASN A O     1 
ATOM   7721  C  CB    . ASN A 1 966  ? -22.017 -68.657  38.129  1.00 145.49 ? 970  ASN A CB    1 
ATOM   7722  C  CG    . ASN A 1 966  ? -22.559 -69.722  37.192  1.00 141.75 ? 970  ASN A CG    1 
ATOM   7723  O  OD1   . ASN A 1 966  ? -21.871 -70.691  36.868  1.00 136.61 ? 970  ASN A OD1   1 
ATOM   7724  N  ND2   . ASN A 1 966  ? -23.793 -69.539  36.739  1.00 141.64 ? 970  ASN A ND2   1 
ATOM   7725  N  N     . GLN A 1 967  ? -20.428 -67.022  40.087  1.00 145.16 ? 971  GLN A N     1 
ATOM   7726  C  CA    . GLN A 1 967  ? -19.704 -65.803  40.437  1.00 133.77 ? 971  GLN A CA    1 
ATOM   7727  C  C     . GLN A 1 967  ? -18.396 -66.098  41.171  1.00 136.68 ? 971  GLN A C     1 
ATOM   7728  O  O     . GLN A 1 967  ? -17.352 -65.527  40.839  1.00 131.42 ? 971  GLN A O     1 
ATOM   7729  C  CB    . GLN A 1 967  ? -20.580 -64.877  41.283  1.00 115.67 ? 971  GLN A CB    1 
ATOM   7730  C  CG    . GLN A 1 967  ? -19.844 -63.647  41.783  1.00 124.65 ? 971  GLN A CG    1 
ATOM   7731  C  CD    . GLN A 1 967  ? -20.776 -62.508  42.143  1.00 134.16 ? 971  GLN A CD    1 
ATOM   7732  O  OE1   . GLN A 1 967  ? -21.972 -62.557  41.855  1.00 144.60 ? 971  GLN A OE1   1 
ATOM   7733  N  NE2   . GLN A 1 967  ? -20.230 -61.468  42.770  1.00 121.56 ? 971  GLN A NE2   1 
ATOM   7734  N  N     . ILE A 1 968  ? -18.457 -66.988  42.160  1.00 129.46 ? 972  ILE A N     1 
ATOM   7735  C  CA    . ILE A 1 968  ? -17.273 -67.382  42.918  1.00 135.12 ? 972  ILE A CA    1 
ATOM   7736  C  C     . ILE A 1 968  ? -16.187 -67.916  41.995  1.00 125.90 ? 972  ILE A C     1 
ATOM   7737  O  O     . ILE A 1 968  ? -15.027 -67.471  42.029  1.00 129.47 ? 972  ILE A O     1 
ATOM   7738  C  CB    . ILE A 1 968  ? -17.606 -68.460  43.970  1.00 147.00 ? 972  ILE A CB    1 
ATOM   7739  C  CG1   . ILE A 1 968  ? -18.599 -67.918  45.001  1.00 152.84 ? 972  ILE A CG1   1 
ATOM   7740  C  CG2   . ILE A 1 968  ? -16.338 -68.950  44.656  1.00 144.03 ? 972  ILE A CG2   1 
ATOM   7741  C  CD1   . ILE A 1 968  ? -18.995 -68.932  46.055  1.00 160.51 ? 972  ILE A CD1   1 
ATOM   7742  N  N     . PHE A 1 969  ? -16.583 -68.872  41.162  1.00 122.26 ? 973  PHE A N     1 
ATOM   7743  C  CA    . PHE A 1 969  ? -15.668 -69.482  40.207  1.00 132.27 ? 973  PHE A CA    1 
ATOM   7744  C  C     . PHE A 1 969  ? -15.038 -68.466  39.288  1.00 138.14 ? 973  PHE A C     1 
ATOM   7745  O  O     . PHE A 1 969  ? -13.842 -68.528  39.025  1.00 139.38 ? 973  PHE A O     1 
ATOM   7746  C  CB    . PHE A 1 969  ? -16.365 -70.523  39.347  1.00 123.96 ? 973  PHE A CB    1 
ATOM   7747  C  CG    . PHE A 1 969  ? -15.474 -71.106  38.294  1.00 131.78 ? 973  PHE A CG    1 
ATOM   7748  C  CD1   . PHE A 1 969  ? -14.328 -71.797  38.648  1.00 143.88 ? 973  PHE A CD1   1 
ATOM   7749  C  CD2   . PHE A 1 969  ? -15.769 -70.949  36.953  1.00 147.02 ? 973  PHE A CD2   1 
ATOM   7750  C  CE1   . PHE A 1 969  ? -13.498 -72.330  37.685  1.00 150.42 ? 973  PHE A CE1   1 
ATOM   7751  C  CE2   . PHE A 1 969  ? -14.941 -71.478  35.981  1.00 154.04 ? 973  PHE A CE2   1 
ATOM   7752  C  CZ    . PHE A 1 969  ? -13.804 -72.172  36.349  1.00 152.41 ? 973  PHE A CZ    1 
ATOM   7753  N  N     . LEU A 1 970  ? -15.851 -67.550  38.776  1.00 134.45 ? 974  LEU A N     1 
ATOM   7754  C  CA    . LEU A 1 970  ? -15.312 -66.492  37.943  1.00 136.10 ? 974  LEU A CA    1 
ATOM   7755  C  C     . LEU A 1 970  ? -14.245 -65.745  38.697  1.00 143.87 ? 974  LEU A C     1 
ATOM   7756  O  O     . LEU A 1 970  ? -13.107 -65.697  38.251  1.00 149.91 ? 974  LEU A O     1 
ATOM   7757  C  CB    . LEU A 1 970  ? -16.394 -65.525  37.499  1.00 137.67 ? 974  LEU A CB    1 
ATOM   7758  C  CG    . LEU A 1 970  ? -17.056 -65.896  36.185  1.00 140.52 ? 974  LEU A CG    1 
ATOM   7759  C  CD1   . LEU A 1 970  ? -17.750 -64.673  35.697  1.00 139.04 ? 974  LEU A CD1   1 
ATOM   7760  C  CD2   . LEU A 1 970  ? -16.028 -66.372  35.174  1.00 139.64 ? 974  LEU A CD2   1 
ATOM   7761  N  N     . GLN A 1 971  ? -14.619 -65.187  39.845  1.00 141.14 ? 975  GLN A N     1 
ATOM   7762  C  CA    . GLN A 1 971  ? -13.700 -64.391  40.644  1.00 126.69 ? 975  GLN A CA    1 
ATOM   7763  C  C     . GLN A 1 971  ? -12.355 -65.086  40.830  1.00 122.54 ? 975  GLN A C     1 
ATOM   7764  O  O     . GLN A 1 971  ? -11.314 -64.512  40.509  1.00 125.82 ? 975  GLN A O     1 
ATOM   7765  C  CB    . GLN A 1 971  ? -14.325 -64.064  41.996  1.00 129.25 ? 975  GLN A CB    1 
ATOM   7766  C  CG    . GLN A 1 971  ? -15.504 -63.117  41.895  1.00 128.93 ? 975  GLN A CG    1 
ATOM   7767  C  CD    . GLN A 1 971  ? -15.946 -62.589  43.239  1.00 139.55 ? 975  GLN A CD    1 
ATOM   7768  O  OE1   . GLN A 1 971  ? -16.052 -63.339  44.213  1.00 155.02 ? 975  GLN A OE1   1 
ATOM   7769  N  NE2   . GLN A 1 971  ? -16.201 -61.284  43.304  1.00 137.44 ? 975  GLN A NE2   1 
ATOM   7770  N  N     . GLU A 1 972  ? -12.371 -66.332  41.300  1.00 125.36 ? 976  GLU A N     1 
ATOM   7771  C  CA    . GLU A 1 972  ? -11.107 -67.031  41.531  1.00 131.27 ? 976  GLU A CA    1 
ATOM   7772  C  C     . GLU A 1 972  ? -10.369 -67.345  40.220  1.00 122.28 ? 976  GLU A C     1 
ATOM   7773  O  O     . GLU A 1 972  ? -9.137  -67.361  40.184  1.00 113.40 ? 976  GLU A O     1 
ATOM   7774  C  CB    . GLU A 1 972  ? -11.335 -68.317  42.334  1.00 128.14 ? 976  GLU A CB    1 
ATOM   7775  C  CG    . GLU A 1 972  ? -10.043 -68.979  42.795  1.00 137.61 ? 976  GLU A CG    1 
ATOM   7776  C  CD    . GLU A 1 972  ? -10.172 -69.640  44.156  1.00 159.00 ? 976  GLU A CD    1 
ATOM   7777  O  OE1   . GLU A 1 972  ? -9.982  -68.943  45.178  1.00 170.11 ? 976  GLU A OE1   1 
ATOM   7778  O  OE2   . GLU A 1 972  ? -10.459 -70.856  44.203  1.00 161.23 ? 976  GLU A OE2   1 
ATOM   7779  N  N     . TYR A 1 973  ? -11.121 -67.581  39.148  1.00 121.66 ? 977  TYR A N     1 
ATOM   7780  C  CA    . TYR A 1 973  ? -10.530 -67.913  37.852  1.00 126.88 ? 977  TYR A CA    1 
ATOM   7781  C  C     . TYR A 1 973  ? -9.816  -66.726  37.225  1.00 117.91 ? 977  TYR A C     1 
ATOM   7782  O  O     . TYR A 1 973  ? -8.655  -66.830  36.840  1.00 122.79 ? 977  TYR A O     1 
ATOM   7783  C  CB    . TYR A 1 973  ? -11.595 -68.432  36.887  1.00 137.04 ? 977  TYR A CB    1 
ATOM   7784  C  CG    . TYR A 1 973  ? -11.085 -68.683  35.483  1.00 139.80 ? 977  TYR A CG    1 
ATOM   7785  C  CD1   . TYR A 1 973  ? -9.884  -69.352  35.263  1.00 139.50 ? 977  TYR A CD1   1 
ATOM   7786  C  CD2   . TYR A 1 973  ? -11.813 -68.260  34.377  1.00 145.02 ? 977  TYR A CD2   1 
ATOM   7787  C  CE1   . TYR A 1 973  ? -9.418  -69.580  33.986  1.00 140.32 ? 977  TYR A CE1   1 
ATOM   7788  C  CE2   . TYR A 1 973  ? -11.354 -68.481  33.090  1.00 142.00 ? 977  TYR A CE2   1 
ATOM   7789  C  CZ    . TYR A 1 973  ? -10.157 -69.142  32.901  1.00 144.56 ? 977  TYR A CZ    1 
ATOM   7790  O  OH    . TYR A 1 973  ? -9.696  -69.366  31.626  1.00 143.61 ? 977  TYR A OH    1 
ATOM   7791  N  N     . VAL A 1 974  ? -10.527 -65.611  37.108  1.00 106.70 ? 978  VAL A N     1 
ATOM   7792  C  CA    . VAL A 1 974  ? -9.966  -64.363  36.619  1.00 92.12  ? 978  VAL A CA    1 
ATOM   7793  C  C     . VAL A 1 974  ? -8.798  -63.927  37.495  1.00 101.21 ? 978  VAL A C     1 
ATOM   7794  O  O     . VAL A 1 974  ? -7.767  -63.478  36.981  1.00 108.36 ? 978  VAL A O     1 
ATOM   7795  C  CB    . VAL A 1 974  ? -11.025 -63.253  36.587  1.00 94.82  ? 978  VAL A CB    1 
ATOM   7796  C  CG1   . VAL A 1 974  ? -10.425 -61.938  36.080  1.00 90.47  ? 978  VAL A CG1   1 
ATOM   7797  C  CG2   . VAL A 1 974  ? -12.200 -63.666  35.708  1.00 102.74 ? 978  VAL A CG2   1 
ATOM   7798  N  N     . ALA A 1 975  ? -8.955  -64.075  38.811  1.00 104.57 ? 979  ALA A N     1 
ATOM   7799  C  CA    . ALA A 1 975  ? -7.888  -63.724  39.744  1.00 102.40 ? 979  ALA A CA    1 
ATOM   7800  C  C     . ALA A 1 975  ? -6.627  -64.543  39.478  1.00 101.60 ? 979  ALA A C     1 
ATOM   7801  O  O     . ALA A 1 975  ? -5.536  -63.993  39.368  1.00 101.94 ? 979  ALA A O     1 
ATOM   7802  C  CB    . ALA A 1 975  ? -8.346  -63.911  41.177  1.00 110.96 ? 979  ALA A CB    1 
ATOM   7803  N  N     . ASN A 1 976  ? -6.782  -65.857  39.367  1.00 107.34 ? 980  ASN A N     1 
ATOM   7804  C  CA    . ASN A 1 976  ? -5.639  -66.733  39.136  1.00 126.72 ? 980  ASN A CA    1 
ATOM   7805  C  C     . ASN A 1 976  ? -5.001  -66.480  37.778  1.00 120.38 ? 980  ASN A C     1 
ATOM   7806  O  O     . ASN A 1 976  ? -3.779  -66.513  37.635  1.00 121.16 ? 980  ASN A O     1 
ATOM   7807  C  CB    . ASN A 1 976  ? -6.056  -68.201  39.251  1.00 140.55 ? 980  ASN A CB    1 
ATOM   7808  C  CG    . ASN A 1 976  ? -4.886  -69.150  39.099  1.00 148.52 ? 980  ASN A CG    1 
ATOM   7809  O  OD1   . ASN A 1 976  ? -3.831  -68.951  39.703  1.00 147.86 ? 980  ASN A OD1   1 
ATOM   7810  N  ND2   . ASN A 1 976  ? -5.059  -70.182  38.276  1.00 153.52 ? 980  ASN A ND2   1 
ATOM   7811  N  N     . LEU A 1 977  ? -5.847  -66.223  36.787  1.00 128.63 ? 981  LEU A N     1 
ATOM   7812  C  CA    . LEU A 1 977  ? -5.415  -65.944  35.421  1.00 128.68 ? 981  LEU A CA    1 
ATOM   7813  C  C     . LEU A 1 977  ? -4.558  -64.687  35.341  1.00 122.83 ? 981  LEU A C     1 
ATOM   7814  O  O     . LEU A 1 977  ? -3.491  -64.693  34.728  1.00 116.40 ? 981  LEU A O     1 
ATOM   7815  C  CB    . LEU A 1 977  ? -6.631  -65.801  34.505  1.00 130.85 ? 981  LEU A CB    1 
ATOM   7816  C  CG    . LEU A 1 977  ? -6.392  -65.295  33.082  1.00 132.45 ? 981  LEU A CG    1 
ATOM   7817  C  CD1   . LEU A 1 977  ? -5.523  -66.264  32.291  1.00 133.12 ? 981  LEU A CD1   1 
ATOM   7818  C  CD2   . LEU A 1 977  ? -7.717  -65.055  32.375  1.00 136.87 ? 981  LEU A CD2   1 
ATOM   7819  N  N     . LEU A 1 978  ? -5.030  -63.612  35.967  1.00 123.48 ? 982  LEU A N     1 
ATOM   7820  C  CA    . LEU A 1 978  ? -4.293  -62.355  35.986  1.00 104.96 ? 982  LEU A CA    1 
ATOM   7821  C  C     . LEU A 1 978  ? -3.049  -62.435  36.869  1.00 103.99 ? 982  LEU A C     1 
ATOM   7822  O  O     . LEU A 1 978  ? -2.039  -61.787  36.584  1.00 105.42 ? 982  LEU A O     1 
ATOM   7823  C  CB    . LEU A 1 978  ? -5.196  -61.222  36.459  1.00 100.29 ? 982  LEU A CB    1 
ATOM   7824  C  CG    . LEU A 1 978  ? -6.433  -60.971  35.599  1.00 94.32  ? 982  LEU A CG    1 
ATOM   7825  C  CD1   . LEU A 1 978  ? -7.338  -59.948  36.271  1.00 96.27  ? 982  LEU A CD1   1 
ATOM   7826  C  CD2   . LEU A 1 978  ? -6.033  -60.509  34.215  1.00 85.50  ? 982  LEU A CD2   1 
ATOM   7827  N  N     . LYS A 1 979  ? -3.123  -63.228  37.936  1.00 102.55 ? 983  LYS A N     1 
ATOM   7828  C  CA    . LYS A 1 979  ? -1.978  -63.425  38.818  1.00 115.36 ? 983  LYS A CA    1 
ATOM   7829  C  C     . LYS A 1 979  ? -0.850  -64.159  38.099  1.00 101.18 ? 983  LYS A C     1 
ATOM   7830  O  O     . LYS A 1 979  ? 0.316   -63.806  38.225  1.00 96.22  ? 983  LYS A O     1 
ATOM   7831  C  CB    . LYS A 1 979  ? -2.387  -64.194  40.083  1.00 128.63 ? 983  LYS A CB    1 
ATOM   7832  C  CG    . LYS A 1 979  ? -3.020  -63.335  41.178  1.00 128.23 ? 983  LYS A CG    1 
ATOM   7833  C  CD    . LYS A 1 979  ? -3.340  -64.174  42.415  1.00 138.13 ? 983  LYS A CD    1 
ATOM   7834  C  CE    . LYS A 1 979  ? -3.895  -63.324  43.554  1.00 134.40 ? 983  LYS A CE    1 
ATOM   7835  N  NZ    . LYS A 1 979  ? -5.265  -62.806  43.281  1.00 131.91 ? 983  LYS A NZ    1 
ATOM   7836  N  N     . SER A 1 980  ? -1.208  -65.184  37.338  1.00 116.30 ? 984  SER A N     1 
ATOM   7837  C  CA    . SER A 1 980  ? -0.222  -65.957  36.587  1.00 122.31 ? 984  SER A CA    1 
ATOM   7838  C  C     . SER A 1 980  ? 0.276   -65.201  35.353  1.00 110.04 ? 984  SER A C     1 
ATOM   7839  O  O     . SER A 1 980  ? 1.435   -65.332  34.959  1.00 110.67 ? 984  SER A O     1 
ATOM   7840  C  CB    . SER A 1 980  ? -0.809  -67.309  36.181  1.00 135.03 ? 984  SER A CB    1 
ATOM   7841  O  OG    . SER A 1 980  ? -2.204  -67.207  35.963  1.00 142.75 ? 984  SER A OG    1 
ATOM   7842  N  N     . ALA A 1 981  ? -0.602  -64.405  34.752  1.00 94.20  ? 985  ALA A N     1 
ATOM   7843  C  CA    . ALA A 1 981  ? -0.222  -63.567  33.623  1.00 89.48  ? 985  ALA A CA    1 
ATOM   7844  C  C     . ALA A 1 981  ? 0.706   -62.446  34.065  1.00 103.64 ? 985  ALA A C     1 
ATOM   7845  O  O     . ALA A 1 981  ? 1.728   -62.181  33.434  1.00 111.52 ? 985  ALA A O     1 
ATOM   7846  C  CB    . ALA A 1 981  ? -1.457  -62.988  32.950  1.00 91.31  ? 985  ALA A CB    1 
ATOM   7847  N  N     . PHE A 1 982  ? 0.337   -61.784  35.156  1.00 115.88 ? 986  PHE A N     1 
ATOM   7848  C  CA    . PHE A 1 982  ? 1.146   -60.706  35.715  1.00 113.55 ? 986  PHE A CA    1 
ATOM   7849  C  C     . PHE A 1 982  ? 1.517   -61.023  37.151  1.00 113.98 ? 986  PHE A C     1 
ATOM   7850  O  O     . PHE A 1 982  ? 0.815   -60.618  38.075  1.00 113.78 ? 986  PHE A O     1 
ATOM   7851  C  CB    . PHE A 1 982  ? 0.394   -59.383  35.641  1.00 100.71 ? 986  PHE A CB    1 
ATOM   7852  C  CG    . PHE A 1 982  ? -0.271  -59.144  34.317  1.00 101.25 ? 986  PHE A CG    1 
ATOM   7853  C  CD1   . PHE A 1 982  ? 0.469   -58.756  33.211  1.00 101.95 ? 986  PHE A CD1   1 
ATOM   7854  C  CD2   . PHE A 1 982  ? -1.639  -59.304  34.178  1.00 106.61 ? 986  PHE A CD2   1 
ATOM   7855  C  CE1   . PHE A 1 982  ? -0.142  -58.534  31.996  1.00 99.67  ? 986  PHE A CE1   1 
ATOM   7856  C  CE2   . PHE A 1 982  ? -2.256  -59.078  32.956  1.00 101.48 ? 986  PHE A CE2   1 
ATOM   7857  C  CZ    . PHE A 1 982  ? -1.506  -58.696  31.870  1.00 97.21  ? 986  PHE A CZ    1 
ATOM   7858  N  N     . PRO A 1 983  ? 2.631   -61.748  37.341  1.00 120.01 ? 987  PRO A N     1 
ATOM   7859  C  CA    . PRO A 1 983  ? 3.069   -62.230  38.654  1.00 122.18 ? 987  PRO A CA    1 
ATOM   7860  C  C     . PRO A 1 983  ? 3.504   -61.109  39.592  1.00 112.65 ? 987  PRO A C     1 
ATOM   7861  O  O     . PRO A 1 983  ? 3.510   -61.305  40.807  1.00 121.54 ? 987  PRO A O     1 
ATOM   7862  C  CB    . PRO A 1 983  ? 4.251   -63.141  38.312  1.00 116.32 ? 987  PRO A CB    1 
ATOM   7863  C  CG    . PRO A 1 983  ? 4.794   -62.583  37.057  1.00 111.87 ? 987  PRO A CG    1 
ATOM   7864  C  CD    . PRO A 1 983  ? 3.599   -62.090  36.284  1.00 120.34 ? 987  PRO A CD    1 
ATOM   7865  N  N     . HIS A 1 984  ? 3.854   -59.954  39.033  1.00 103.54 ? 988  HIS A N     1 
ATOM   7866  C  CA    . HIS A 1 984  ? 4.346   -58.842  39.838  1.00 106.36 ? 988  HIS A CA    1 
ATOM   7867  C  C     . HIS A 1 984  ? 3.216   -58.055  40.488  1.00 101.91 ? 988  HIS A C     1 
ATOM   7868  O  O     . HIS A 1 984  ? 3.459   -57.126  41.256  1.00 105.74 ? 988  HIS A O     1 
ATOM   7869  C  CB    . HIS A 1 984  ? 5.210   -57.909  38.990  1.00 108.23 ? 988  HIS A CB    1 
ATOM   7870  C  CG    . HIS A 1 984  ? 4.492   -57.303  37.825  1.00 112.90 ? 988  HIS A CG    1 
ATOM   7871  N  ND1   . HIS A 1 984  ? 3.557   -56.300  37.967  1.00 108.66 ? 988  HIS A ND1   1 
ATOM   7872  C  CD2   . HIS A 1 984  ? 4.575   -57.554  36.497  1.00 114.70 ? 988  HIS A CD2   1 
ATOM   7873  C  CE1   . HIS A 1 984  ? 3.092   -55.963  36.777  1.00 111.50 ? 988  HIS A CE1   1 
ATOM   7874  N  NE2   . HIS A 1 984  ? 3.695   -56.708  35.868  1.00 109.16 ? 988  HIS A NE2   1 
ATOM   7875  N  N     . LEU A 1 985  ? 1.983   -58.426  40.169  1.00 101.05 ? 989  LEU A N     1 
ATOM   7876  C  CA    . LEU A 1 985  ? 0.823   -57.800  40.782  1.00 100.67 ? 989  LEU A CA    1 
ATOM   7877  C  C     . LEU A 1 985  ? 0.650   -58.276  42.219  1.00 104.48 ? 989  LEU A C     1 
ATOM   7878  O  O     . LEU A 1 985  ? 1.177   -59.320  42.603  1.00 118.58 ? 989  LEU A O     1 
ATOM   7879  C  CB    . LEU A 1 985  ? -0.437  -58.098  39.971  1.00 99.37  ? 989  LEU A CB    1 
ATOM   7880  C  CG    . LEU A 1 985  ? -1.063  -56.908  39.243  1.00 107.21 ? 989  LEU A CG    1 
ATOM   7881  C  CD1   . LEU A 1 985  ? -0.010  -56.111  38.482  1.00 107.22 ? 989  LEU A CD1   1 
ATOM   7882  C  CD2   . LEU A 1 985  ? -2.140  -57.399  38.291  1.00 108.96 ? 989  LEU A CD2   1 
ATOM   7883  N  N     . GLN A 1 986  ? -0.077  -57.498  43.014  1.00 108.46 ? 990  GLN A N     1 
ATOM   7884  C  CA    . GLN A 1 986  ? -0.371  -57.874  44.389  1.00 113.81 ? 990  GLN A CA    1 
ATOM   7885  C  C     . GLN A 1 986  ? -1.742  -58.536  44.455  1.00 117.13 ? 990  GLN A C     1 
ATOM   7886  O  O     . GLN A 1 986  ? -2.589  -58.289  43.583  1.00 111.13 ? 990  GLN A O     1 
ATOM   7887  C  CB    . GLN A 1 986  ? -0.317  -56.650  45.297  1.00 107.60 ? 990  GLN A CB    1 
ATOM   7888  C  CG    . GLN A 1 986  ? 1.023   -55.939  45.270  1.00 108.30 ? 990  GLN A CG    1 
ATOM   7889  C  CD    . GLN A 1 986  ? 1.056   -54.708  46.153  1.00 120.39 ? 990  GLN A CD    1 
ATOM   7890  O  OE1   . GLN A 1 986  ? 0.028   -54.080  46.404  1.00 130.44 ? 990  GLN A OE1   1 
ATOM   7891  N  NE2   . GLN A 1 986  ? 2.242   -54.357  46.634  1.00 120.05 ? 990  GLN A NE2   1 
ATOM   7892  N  N     . ASP A 1 987  ? -1.957  -59.382  45.465  1.00 112.19 ? 991  ASP A N     1 
ATOM   7893  C  CA    . ASP A 1 987  ? -3.244  -60.056  45.615  1.00 111.42 ? 991  ASP A CA    1 
ATOM   7894  C  C     . ASP A 1 987  ? -4.371  -59.032  45.744  1.00 106.37 ? 991  ASP A C     1 
ATOM   7895  O  O     . ASP A 1 987  ? -5.410  -59.149  45.102  1.00 108.81 ? 991  ASP A O     1 
ATOM   7896  C  CB    . ASP A 1 987  ? -3.237  -60.992  46.823  1.00 128.70 ? 991  ASP A CB    1 
ATOM   7897  C  CG    . ASP A 1 987  ? -2.573  -62.325  46.531  1.00 137.90 ? 991  ASP A CG    1 
ATOM   7898  O  OD1   . ASP A 1 987  ? -1.473  -62.330  45.942  1.00 145.75 ? 991  ASP A OD1   1 
ATOM   7899  O  OD2   . ASP A 1 987  ? -3.153  -63.373  46.889  1.00 147.61 ? 991  ASP A OD2   1 
ATOM   7900  N  N     . ALA A 1 988  ? -4.146  -58.014  46.566  1.00 98.66  ? 992  ALA A N     1 
ATOM   7901  C  CA    . ALA A 1 988  ? -5.145  -56.979  46.807  1.00 101.08 ? 992  ALA A CA    1 
ATOM   7902  C  C     . ALA A 1 988  ? -5.540  -56.278  45.510  1.00 112.69 ? 992  ALA A C     1 
ATOM   7903  O  O     . ALA A 1 988  ? -6.732  -56.099  45.241  1.00 130.19 ? 992  ALA A O     1 
ATOM   7904  C  CB    . ALA A 1 988  ? -4.632  -55.974  47.815  1.00 99.45  ? 992  ALA A CB    1 
ATOM   7905  N  N     . GLN A 1 989  ? -4.541  -55.890  44.717  1.00 103.57 ? 993  GLN A N     1 
ATOM   7906  C  CA    . GLN A 1 989  ? -4.769  -55.293  43.401  1.00 99.35  ? 993  GLN A CA    1 
ATOM   7907  C  C     . GLN A 1 989  ? -5.745  -56.109  42.559  1.00 103.37 ? 993  GLN A C     1 
ATOM   7908  O  O     . GLN A 1 989  ? -6.724  -55.572  42.007  1.00 106.24 ? 993  GLN A O     1 
ATOM   7909  C  CB    . GLN A 1 989  ? -3.448  -55.159  42.637  1.00 94.78  ? 993  GLN A CB    1 
ATOM   7910  C  CG    . GLN A 1 989  ? -2.670  -53.915  42.958  1.00 87.49  ? 993  GLN A CG    1 
ATOM   7911  C  CD    . GLN A 1 989  ? -1.310  -53.856  42.309  1.00 86.08  ? 993  GLN A CD    1 
ATOM   7912  O  OE1   . GLN A 1 989  ? -0.477  -54.750  42.488  1.00 89.06  ? 993  GLN A OE1   1 
ATOM   7913  N  NE2   . GLN A 1 989  ? -1.074  -52.791  41.542  1.00 89.72  ? 993  GLN A NE2   1 
ATOM   7914  N  N     . VAL A 1 990  ? -5.466  -57.407  42.468  1.00 92.67  ? 994  VAL A N     1 
ATOM   7915  C  CA    . VAL A 1 990  ? -6.221  -58.280  41.595  1.00 91.66  ? 994  VAL A CA    1 
ATOM   7916  C  C     . VAL A 1 990  ? -7.629  -58.505  42.111  1.00 91.77  ? 994  VAL A C     1 
ATOM   7917  O  O     . VAL A 1 990  ? -8.588  -58.419  41.350  1.00 98.46  ? 994  VAL A O     1 
ATOM   7918  C  CB    . VAL A 1 990  ? -5.518  -59.622  41.422  1.00 97.54  ? 994  VAL A CB    1 
ATOM   7919  C  CG1   . VAL A 1 990  ? -6.255  -60.477  40.393  1.00 93.13  ? 994  VAL A CG1   1 
ATOM   7920  C  CG2   . VAL A 1 990  ? -4.078  -59.400  40.981  1.00 108.99 ? 994  VAL A CG2   1 
ATOM   7921  N  N     . LYS A 1 991  ? -7.754  -58.784  43.405  1.00 103.21 ? 995  LYS A N     1 
ATOM   7922  C  CA    . LYS A 1 991  ? -9.072  -59.009  43.998  1.00 113.58 ? 995  LYS A CA    1 
ATOM   7923  C  C     . LYS A 1 991  ? -9.941  -57.771  43.805  1.00 103.26 ? 995  LYS A C     1 
ATOM   7924  O  O     . LYS A 1 991  ? -11.124 -57.862  43.486  1.00 110.12 ? 995  LYS A O     1 
ATOM   7925  C  CB    . LYS A 1 991  ? -8.966  -59.353  45.490  1.00 122.50 ? 995  LYS A CB    1 
ATOM   7926  C  CG    . LYS A 1 991  ? -8.037  -60.525  45.815  1.00 127.91 ? 995  LYS A CG    1 
ATOM   7927  C  CD    . LYS A 1 991  ? -8.280  -61.735  44.921  1.00 124.71 ? 995  LYS A CD    1 
ATOM   7928  C  CE    . LYS A 1 991  ? -9.582  -62.435  45.272  1.00 132.86 ? 995  LYS A CE    1 
ATOM   7929  N  NZ    . LYS A 1 991  ? -9.782  -63.674  44.461  1.00 133.18 ? 995  LYS A NZ    1 
ATOM   7930  N  N     . LEU A 1 992  ? -9.323  -56.610  43.968  1.00 103.71 ? 996  LEU A N     1 
ATOM   7931  C  CA    . LEU A 1 992  ? -10.018 -55.336  43.854  1.00 106.14 ? 996  LEU A CA    1 
ATOM   7932  C  C     . LEU A 1 992  ? -10.476 -55.094  42.426  1.00 118.58 ? 996  LEU A C     1 
ATOM   7933  O  O     . LEU A 1 992  ? -11.590 -54.617  42.185  1.00 130.99 ? 996  LEU A O     1 
ATOM   7934  C  CB    . LEU A 1 992  ? -9.104  -54.203  44.324  1.00 112.42 ? 996  LEU A CB    1 
ATOM   7935  C  CG    . LEU A 1 992  ? -9.740  -52.863  44.672  1.00 122.25 ? 996  LEU A CG    1 
ATOM   7936  C  CD1   . LEU A 1 992  ? -11.027 -53.068  45.447  1.00 128.96 ? 996  LEU A CD1   1 
ATOM   7937  C  CD2   . LEU A 1 992  ? -8.749  -52.054  45.485  1.00 131.93 ? 996  LEU A CD2   1 
ATOM   7938  N  N     . PHE A 1 993  ? -9.605  -55.420  41.479  1.00 119.53 ? 997  PHE A N     1 
ATOM   7939  C  CA    . PHE A 1 993  ? -9.937  -55.315  40.061  1.00 112.50 ? 997  PHE A CA    1 
ATOM   7940  C  C     . PHE A 1 993  ? -11.112 -56.225  39.692  1.00 105.25 ? 997  PHE A C     1 
ATOM   7941  O  O     . PHE A 1 993  ? -12.058 -55.807  39.010  1.00 105.99 ? 997  PHE A O     1 
ATOM   7942  C  CB    . PHE A 1 993  ? -8.712  -55.656  39.214  1.00 107.48 ? 997  PHE A CB    1 
ATOM   7943  C  CG    . PHE A 1 993  ? -8.982  -55.693  37.742  1.00 105.50 ? 997  PHE A CG    1 
ATOM   7944  C  CD1   . PHE A 1 993  ? -9.382  -54.555  37.068  1.00 108.78 ? 997  PHE A CD1   1 
ATOM   7945  C  CD2   . PHE A 1 993  ? -8.813  -56.865  37.026  1.00 114.58 ? 997  PHE A CD2   1 
ATOM   7946  C  CE1   . PHE A 1 993  ? -9.630  -54.586  35.713  1.00 109.03 ? 997  PHE A CE1   1 
ATOM   7947  C  CE2   . PHE A 1 993  ? -9.055  -56.904  35.667  1.00 117.35 ? 997  PHE A CE2   1 
ATOM   7948  C  CZ    . PHE A 1 993  ? -9.463  -55.760  35.010  1.00 115.61 ? 997  PHE A CZ    1 
ATOM   7949  N  N     . VAL A 1 994  ? -11.054 -57.464  40.175  1.00 96.66  ? 998  VAL A N     1 
ATOM   7950  C  CA    . VAL A 1 994  ? -12.048 -58.469  39.833  1.00 100.22 ? 998  VAL A CA    1 
ATOM   7951  C  C     . VAL A 1 994  ? -13.411 -58.166  40.456  1.00 113.42 ? 998  VAL A C     1 
ATOM   7952  O  O     . VAL A 1 994  ? -14.442 -58.370  39.818  1.00 119.37 ? 998  VAL A O     1 
ATOM   7953  C  CB    . VAL A 1 994  ? -11.579 -59.873  40.255  1.00 100.94 ? 998  VAL A CB    1 
ATOM   7954  C  CG1   . VAL A 1 994  ? -12.671 -60.902  40.015  1.00 113.71 ? 998  VAL A CG1   1 
ATOM   7955  C  CG2   . VAL A 1 994  ? -10.323 -60.253  39.494  1.00 101.63 ? 998  VAL A CG2   1 
ATOM   7956  N  N     . THR A 1 995  ? -13.434 -57.673  41.690  1.00 116.79 ? 999  THR A N     1 
ATOM   7957  C  CA    . THR A 1 995  ? -14.713 -57.259  42.257  1.00 119.65 ? 999  THR A CA    1 
ATOM   7958  C  C     . THR A 1 995  ? -15.194 -56.008  41.529  1.00 113.14 ? 999  THR A C     1 
ATOM   7959  O  O     . THR A 1 995  ? -16.392 -55.780  41.391  1.00 110.40 ? 999  THR A O     1 
ATOM   7960  C  CB    . THR A 1 995  ? -14.643 -56.988  43.777  1.00 125.64 ? 999  THR A CB    1 
ATOM   7961  O  OG1   . THR A 1 995  ? -15.902 -56.465  44.218  1.00 140.46 ? 999  THR A OG1   1 
ATOM   7962  C  CG2   . THR A 1 995  ? -13.561 -55.988  44.103  1.00 105.50 ? 999  THR A CG2   1 
ATOM   7963  N  N     . GLY A 1 996  ? -14.247 -55.206  41.053  1.00 116.36 ? 1000 GLY A N     1 
ATOM   7964  C  CA    . GLY A 1 996  ? -14.577 -54.039  40.255  1.00 115.33 ? 1000 GLY A CA    1 
ATOM   7965  C  C     . GLY A 1 996  ? -15.279 -54.439  38.966  1.00 111.51 ? 1000 GLY A C     1 
ATOM   7966  O  O     . GLY A 1 996  ? -16.091 -53.677  38.426  1.00 98.38  ? 1000 GLY A O     1 
ATOM   7967  N  N     . LEU A 1 997  ? -14.967 -55.640  38.476  1.00 113.67 ? 1001 LEU A N     1 
ATOM   7968  C  CA    . LEU A 1 997  ? -15.610 -56.172  37.274  1.00 106.75 ? 1001 LEU A CA    1 
ATOM   7969  C  C     . LEU A 1 997  ? -17.104 -56.440  37.473  1.00 109.19 ? 1001 LEU A C     1 
ATOM   7970  O  O     . LEU A 1 997  ? -17.902 -56.232  36.559  1.00 101.87 ? 1001 LEU A O     1 
ATOM   7971  C  CB    . LEU A 1 997  ? -14.915 -57.458  36.827  1.00 102.55 ? 1001 LEU A CB    1 
ATOM   7972  C  CG    . LEU A 1 997  ? -13.426 -57.338  36.501  1.00 87.66  ? 1001 LEU A CG    1 
ATOM   7973  C  CD1   . LEU A 1 997  ? -12.831 -58.692  36.152  1.00 92.91  ? 1001 LEU A CD1   1 
ATOM   7974  C  CD2   . LEU A 1 997  ? -13.209 -56.341  35.386  1.00 76.76  ? 1001 LEU A CD2   1 
ATOM   7975  N  N     . PHE A 1 998  ? -17.479 -56.911  38.660  1.00 112.43 ? 1002 PHE A N     1 
ATOM   7976  C  CA    . PHE A 1 998  ? -18.882 -57.206  38.955  1.00 111.51 ? 1002 PHE A CA    1 
ATOM   7977  C  C     . PHE A 1 998  ? -19.638 -55.968  39.432  1.00 111.32 ? 1002 PHE A C     1 
ATOM   7978  O  O     . PHE A 1 998  ? -20.810 -55.772  39.107  1.00 109.68 ? 1002 PHE A O     1 
ATOM   7979  C  CB    . PHE A 1 998  ? -18.995 -58.305  40.012  1.00 109.04 ? 1002 PHE A CB    1 
ATOM   7980  C  CG    . PHE A 1 998  ? -18.678 -59.677  39.504  1.00 112.41 ? 1002 PHE A CG    1 
ATOM   7981  C  CD1   . PHE A 1 998  ? -19.657 -60.449  38.898  1.00 122.43 ? 1002 PHE A CD1   1 
ATOM   7982  C  CD2   . PHE A 1 998  ? -17.408 -60.209  39.652  1.00 117.16 ? 1002 PHE A CD2   1 
ATOM   7983  C  CE1   . PHE A 1 998  ? -19.369 -61.723  38.435  1.00 123.35 ? 1002 PHE A CE1   1 
ATOM   7984  C  CE2   . PHE A 1 998  ? -17.115 -61.481  39.194  1.00 121.45 ? 1002 PHE A CE2   1 
ATOM   7985  C  CZ    . PHE A 1 998  ? -18.097 -62.238  38.584  1.00 121.94 ? 1002 PHE A CZ    1 
ATOM   7986  N  N     . SER A 1 999  ? -18.962 -55.139  40.215  1.00 103.23 ? 1003 SER A N     1 
ATOM   7987  C  CA    . SER A 1 999  ? -19.586 -53.968  40.810  1.00 109.03 ? 1003 SER A CA    1 
ATOM   7988  C  C     . SER A 1 999  ? -19.967 -52.932  39.760  1.00 106.06 ? 1003 SER A C     1 
ATOM   7989  O  O     . SER A 1 999  ? -20.947 -52.203  39.924  1.00 109.01 ? 1003 SER A O     1 
ATOM   7990  C  CB    . SER A 1 999  ? -18.650 -53.344  41.842  1.00 120.12 ? 1003 SER A CB    1 
ATOM   7991  O  OG    . SER A 1 999  ? -18.253 -54.300  42.816  1.00 133.70 ? 1003 SER A OG    1 
ATOM   7992  N  N     . LEU A 1 1000 ? -19.194 -52.879  38.681  1.00 97.89  ? 1004 LEU A N     1 
ATOM   7993  C  CA    . LEU A 1 1000 ? -19.370 -51.852  37.674  1.00 96.01  ? 1004 LEU A CA    1 
ATOM   7994  C  C     . LEU A 1 1000 ? -19.926 -52.392  36.362  1.00 102.56 ? 1004 LEU A C     1 
ATOM   7995  O  O     . LEU A 1 1000 ? -19.788 -51.753  35.320  1.00 97.69  ? 1004 LEU A O     1 
ATOM   7996  C  CB    . LEU A 1 1000 ? -18.034 -51.157  37.410  1.00 103.04 ? 1004 LEU A CB    1 
ATOM   7997  C  CG    . LEU A 1 1000 ? -17.352 -50.434  38.572  1.00 100.43 ? 1004 LEU A CG    1 
ATOM   7998  C  CD1   . LEU A 1 1000 ? -15.911 -50.097  38.229  1.00 90.60  ? 1004 LEU A CD1   1 
ATOM   7999  C  CD2   . LEU A 1 1000 ? -18.120 -49.176  38.925  1.00 108.53 ? 1004 LEU A CD2   1 
ATOM   8000  N  N     . ASN A 1 1001 ? -20.564 -53.557  36.401  1.00 117.99 ? 1005 ASN A N     1 
ATOM   8001  C  CA    . ASN A 1 1001 ? -21.034 -54.185  35.167  1.00 116.32 ? 1005 ASN A CA    1 
ATOM   8002  C  C     . ASN A 1 1001 ? -22.314 -53.554  34.626  1.00 124.34 ? 1005 ASN A C     1 
ATOM   8003  O  O     . ASN A 1 1001 ? -22.930 -54.078  33.705  1.00 139.54 ? 1005 ASN A O     1 
ATOM   8004  C  CB    . ASN A 1 1001 ? -21.230 -55.697  35.370  1.00 119.46 ? 1005 ASN A CB    1 
ATOM   8005  C  CG    . ASN A 1 1001 ? -22.258 -56.030  36.431  1.00 124.41 ? 1005 ASN A CG    1 
ATOM   8006  O  OD1   . ASN A 1 1001 ? -23.335 -55.439  36.487  1.00 130.53 ? 1005 ASN A OD1   1 
ATOM   8007  N  ND2   . ASN A 1 1001 ? -21.928 -56.998  37.279  1.00 139.13 ? 1005 ASN A ND2   1 
ATOM   8008  N  N     . GLN A 1 1002 ? -22.711 -52.430  35.207  1.00 109.42 ? 1006 GLN A N     1 
ATOM   8009  C  CA    . GLN A 1 1002 ? -23.875 -51.689  34.739  1.00 94.20  ? 1006 GLN A CA    1 
ATOM   8010  C  C     . GLN A 1 1002 ? -23.541 -50.205  34.636  1.00 92.62  ? 1006 GLN A C     1 
ATOM   8011  O  O     . GLN A 1 1002 ? -24.424 -49.369  34.464  1.00 99.76  ? 1006 GLN A O     1 
ATOM   8012  C  CB    . GLN A 1 1002 ? -25.068 -51.911  35.670  1.00 105.39 ? 1006 GLN A CB    1 
ATOM   8013  C  CG    . GLN A 1 1002 ? -25.493 -53.365  35.779  1.00 103.14 ? 1006 GLN A CG    1 
ATOM   8014  C  CD    . GLN A 1 1002 ? -26.722 -53.564  36.639  1.00 117.62 ? 1006 GLN A CD    1 
ATOM   8015  O  OE1   . GLN A 1 1002 ? -27.444 -52.614  36.940  1.00 126.11 ? 1006 GLN A OE1   1 
ATOM   8016  N  NE2   . GLN A 1 1002 ? -26.967 -54.807  37.040  1.00 120.85 ? 1006 GLN A NE2   1 
ATOM   8017  N  N     . ASP A 1 1003 ? -22.251 -49.896  34.742  1.00 93.78  ? 1007 ASP A N     1 
ATOM   8018  C  CA    . ASP A 1 1003 ? -21.750 -48.535  34.605  1.00 102.20 ? 1007 ASP A CA    1 
ATOM   8019  C  C     . ASP A 1 1003 ? -20.546 -48.542  33.666  1.00 106.41 ? 1007 ASP A C     1 
ATOM   8020  O  O     . ASP A 1 1003 ? -19.406 -48.673  34.106  1.00 117.61 ? 1007 ASP A O     1 
ATOM   8021  C  CB    . ASP A 1 1003 ? -21.374 -47.961  35.974  1.00 115.10 ? 1007 ASP A CB    1 
ATOM   8022  C  CG    . ASP A 1 1003 ? -21.242 -46.445  35.964  1.00 124.94 ? 1007 ASP A CG    1 
ATOM   8023  O  OD1   . ASP A 1 1003 ? -20.701 -45.889  34.984  1.00 121.73 ? 1007 ASP A OD1   1 
ATOM   8024  O  OD2   . ASP A 1 1003 ? -21.680 -45.809  36.947  1.00 131.38 ? 1007 ASP A OD2   1 
ATOM   8025  N  N     . ILE A 1 1004 ? -20.810 -48.400  32.370  1.00 101.73 ? 1008 ILE A N     1 
ATOM   8026  C  CA    . ILE A 1 1004 ? -19.784 -48.573  31.342  1.00 113.16 ? 1008 ILE A CA    1 
ATOM   8027  C  C     . ILE A 1 1004 ? -18.619 -47.572  31.406  1.00 114.65 ? 1008 ILE A C     1 
ATOM   8028  O  O     . ILE A 1 1004 ? -17.468 -47.986  31.292  1.00 119.84 ? 1008 ILE A O     1 
ATOM   8029  C  CB    . ILE A 1 1004 ? -20.418 -48.531  29.923  1.00 140.13 ? 1008 ILE A CB    1 
ATOM   8030  C  CG1   . ILE A 1 1004 ? -21.040 -49.887  29.587  1.00 137.05 ? 1008 ILE A CG1   1 
ATOM   8031  C  CG2   . ILE A 1 1004 ? -19.387 -48.162  28.867  1.00 140.47 ? 1008 ILE A CG2   1 
ATOM   8032  C  CD1   . ILE A 1 1004 ? -21.557 -49.992  28.172  1.00 139.27 ? 1008 ILE A CD1   1 
ATOM   8033  N  N     . PRO A 1 1005 ? -18.897 -46.262  31.579  1.00 110.13 ? 1009 PRO A N     1 
ATOM   8034  C  CA    . PRO A 1 1005 ? -17.733 -45.369  31.672  1.00 105.33 ? 1009 PRO A CA    1 
ATOM   8035  C  C     . PRO A 1 1005 ? -16.866 -45.673  32.893  1.00 111.12 ? 1009 PRO A C     1 
ATOM   8036  O  O     . PRO A 1 1005 ? -15.636 -45.617  32.807  1.00 123.86 ? 1009 PRO A O     1 
ATOM   8037  C  CB    . PRO A 1 1005 ? -18.362 -43.976  31.774  1.00 102.73 ? 1009 PRO A CB    1 
ATOM   8038  C  CG    . PRO A 1 1005 ? -19.761 -44.214  32.226  1.00 105.76 ? 1009 PRO A CG    1 
ATOM   8039  C  CD    . PRO A 1 1005 ? -20.163 -45.509  31.607  1.00 105.86 ? 1009 PRO A CD    1 
ATOM   8040  N  N     . ALA A 1 1006 ? -17.504 -46.005  34.009  1.00 98.07  ? 1010 ALA A N     1 
ATOM   8041  C  CA    . ALA A 1 1006 ? -16.787 -46.376  35.213  1.00 95.20  ? 1010 ALA A CA    1 
ATOM   8042  C  C     . ALA A 1 1006 ? -15.950 -47.622  34.967  1.00 108.84 ? 1010 ALA A C     1 
ATOM   8043  O  O     . ALA A 1 1006 ? -14.799 -47.687  35.374  1.00 113.18 ? 1010 ALA A O     1 
ATOM   8044  C  CB    . ALA A 1 1006 ? -17.759 -46.602  36.359  1.00 102.21 ? 1010 ALA A CB    1 
ATOM   8045  N  N     . PHE A 1 1007 ? -16.545 -48.607  34.300  1.00 106.27 ? 1011 PHE A N     1 
ATOM   8046  C  CA    . PHE A 1 1007 ? -15.865 -49.855  33.939  1.00 88.78  ? 1011 PHE A CA    1 
ATOM   8047  C  C     . PHE A 1 1007 ? -14.634 -49.557  33.079  1.00 79.04  ? 1011 PHE A C     1 
ATOM   8048  O  O     . PHE A 1 1007 ? -13.563 -50.144  33.241  1.00 74.13  ? 1011 PHE A O     1 
ATOM   8049  C  CB    . PHE A 1 1007 ? -16.825 -50.779  33.184  1.00 75.67  ? 1011 PHE A CB    1 
ATOM   8050  C  CG    . PHE A 1 1007 ? -16.482 -52.236  33.280  1.00 77.29  ? 1011 PHE A CG    1 
ATOM   8051  C  CD1   . PHE A 1 1007 ? -17.328 -53.116  33.945  1.00 80.74  ? 1011 PHE A CD1   1 
ATOM   8052  C  CD2   . PHE A 1 1007 ? -15.328 -52.737  32.695  1.00 82.49  ? 1011 PHE A CD2   1 
ATOM   8053  C  CE1   . PHE A 1 1007 ? -17.028 -54.468  34.026  1.00 76.64  ? 1011 PHE A CE1   1 
ATOM   8054  C  CE2   . PHE A 1 1007 ? -15.024 -54.092  32.775  1.00 85.57  ? 1011 PHE A CE2   1 
ATOM   8055  C  CZ    . PHE A 1 1007 ? -15.877 -54.954  33.443  1.00 81.28  ? 1011 PHE A CZ    1 
ATOM   8056  N  N     . LYS A 1 1008 ? -14.812 -48.628  32.153  1.00 70.37  ? 1012 LYS A N     1 
ATOM   8057  C  CA    . LYS A 1 1008 ? -13.755 -48.209  31.259  1.00 82.39  ? 1012 LYS A CA    1 
ATOM   8058  C  C     . LYS A 1 1008 ? -12.602 -47.629  32.058  1.00 97.34  ? 1012 LYS A C     1 
ATOM   8059  O  O     . LYS A 1 1008 ? -11.426 -47.954  31.825  1.00 93.72  ? 1012 LYS A O     1 
ATOM   8060  C  CB    . LYS A 1 1008 ? -14.292 -47.180  30.266  1.00 86.70  ? 1012 LYS A CB    1 
ATOM   8061  C  CG    . LYS A 1 1008 ? -13.398 -46.952  29.073  1.00 90.44  ? 1012 LYS A CG    1 
ATOM   8062  C  CD    . LYS A 1 1008 ? -13.888 -45.825  28.208  1.00 91.80  ? 1012 LYS A CD    1 
ATOM   8063  C  CE    . LYS A 1 1008 ? -15.363 -45.975  27.909  1.00 97.47  ? 1012 LYS A CE    1 
ATOM   8064  N  NZ    . LYS A 1 1008 ? -15.856 -44.805  27.124  1.00 104.15 ? 1012 LYS A NZ    1 
ATOM   8065  N  N     . GLU A 1 1009 ? -12.953 -46.774  33.017  1.00 109.54 ? 1013 GLU A N     1 
ATOM   8066  C  CA    . GLU A 1 1009 ? -11.952 -46.129  33.854  1.00 87.04  ? 1013 GLU A CA    1 
ATOM   8067  C  C     . GLU A 1 1009 ? -11.238 -47.161  34.711  1.00 68.06  ? 1013 GLU A C     1 
ATOM   8068  O  O     . GLU A 1 1009 ? -10.033 -47.091  34.912  1.00 72.07  ? 1013 GLU A O     1 
ATOM   8069  C  CB    . GLU A 1 1009 ? -12.592 -45.046  34.714  1.00 90.51  ? 1013 GLU A CB    1 
ATOM   8070  C  CG    . GLU A 1 1009 ? -13.181 -43.893  33.922  1.00 112.13 ? 1013 GLU A CG    1 
ATOM   8071  C  CD    . GLU A 1 1009 ? -12.198 -43.279  32.931  1.00 125.39 ? 1013 GLU A CD    1 
ATOM   8072  O  OE1   . GLU A 1 1009 ? -10.971 -43.402  33.136  1.00 133.87 ? 1013 GLU A OE1   1 
ATOM   8073  O  OE2   . GLU A 1 1009 ? -12.656 -42.670  31.938  1.00 127.55 ? 1013 GLU A OE2   1 
ATOM   8074  N  N     . HIS A 1 1010 ? -11.998 -48.133  35.190  1.00 66.28  ? 1014 HIS A N     1 
ATOM   8075  C  CA    . HIS A 1 1010 ? -11.460 -49.226  35.988  1.00 73.50  ? 1014 HIS A CA    1 
ATOM   8076  C  C     . HIS A 1 1010 ? -10.407 -49.985  35.182  1.00 89.75  ? 1014 HIS A C     1 
ATOM   8077  O  O     . HIS A 1 1010 ? -9.323  -50.337  35.695  1.00 83.15  ? 1014 HIS A O     1 
ATOM   8078  C  CB    . HIS A 1 1010 ? -12.582 -50.170  36.417  1.00 73.22  ? 1014 HIS A CB    1 
ATOM   8079  C  CG    . HIS A 1 1010 ? -12.148 -51.226  37.380  1.00 79.14  ? 1014 HIS A CG    1 
ATOM   8080  N  ND1   . HIS A 1 1010 ? -11.678 -50.940  38.645  1.00 85.78  ? 1014 HIS A ND1   1 
ATOM   8081  C  CD2   . HIS A 1 1010 ? -12.130 -52.574  37.265  1.00 87.73  ? 1014 HIS A CD2   1 
ATOM   8082  C  CE1   . HIS A 1 1010 ? -11.381 -52.071  39.261  1.00 102.78 ? 1014 HIS A CE1   1 
ATOM   8083  N  NE2   . HIS A 1 1010 ? -11.654 -53.075  38.449  1.00 96.26  ? 1014 HIS A NE2   1 
ATOM   8084  N  N     . LEU A 1 1011 ? -10.732 -50.218  33.911  1.00 94.91  ? 1015 LEU A N     1 
ATOM   8085  C  CA    . LEU A 1 1011 ? -9.830  -50.917  33.013  1.00 87.70  ? 1015 LEU A CA    1 
ATOM   8086  C  C     . LEU A 1 1011 ? -8.566  -50.102  32.773  1.00 86.10  ? 1015 LEU A C     1 
ATOM   8087  O  O     . LEU A 1 1011 ? -7.465  -50.652  32.729  1.00 98.54  ? 1015 LEU A O     1 
ATOM   8088  C  CB    . LEU A 1 1011 ? -10.521 -51.222  31.691  1.00 90.73  ? 1015 LEU A CB    1 
ATOM   8089  C  CG    . LEU A 1 1011 ? -11.641 -52.268  31.738  1.00 80.13  ? 1015 LEU A CG    1 
ATOM   8090  C  CD1   . LEU A 1 1011 ? -12.279 -52.433  30.355  1.00 72.06  ? 1015 LEU A CD1   1 
ATOM   8091  C  CD2   . LEU A 1 1011 ? -11.119 -53.591  32.245  1.00 72.39  ? 1015 LEU A CD2   1 
ATOM   8092  N  N     . ARG A 1 1012 ? -8.723  -48.791  32.622  1.00 74.10  ? 1016 ARG A N     1 
ATOM   8093  C  CA    . ARG A 1 1012 ? -7.568  -47.916  32.435  1.00 62.34  ? 1016 ARG A CA    1 
ATOM   8094  C  C     . ARG A 1 1012 ? -6.665  -47.968  33.673  1.00 80.66  ? 1016 ARG A C     1 
ATOM   8095  O  O     . ARG A 1 1012 ? -5.427  -48.020  33.544  1.00 89.87  ? 1016 ARG A O     1 
ATOM   8096  C  CB    . ARG A 1 1012 ? -8.019  -46.491  32.154  1.00 66.40  ? 1016 ARG A CB    1 
ATOM   8097  C  CG    . ARG A 1 1012 ? -6.953  -45.613  31.544  1.00 85.98  ? 1016 ARG A CG    1 
ATOM   8098  C  CD    . ARG A 1 1012 ? -7.419  -44.156  31.446  1.00 99.42  ? 1016 ARG A CD    1 
ATOM   8099  N  NE    . ARG A 1 1012 ? -8.761  -44.045  30.884  1.00 104.89 ? 1016 ARG A NE    1 
ATOM   8100  C  CZ    . ARG A 1 1012 ? -9.025  -44.059  29.583  1.00 116.13 ? 1016 ARG A CZ    1 
ATOM   8101  N  NH1   . ARG A 1 1012 ? -8.037  -44.185  28.704  1.00 121.03 ? 1016 ARG A NH1   1 
ATOM   8102  N  NH2   . ARG A 1 1012 ? -10.277 -43.953  29.160  1.00 117.90 ? 1016 ARG A NH2   1 
ATOM   8103  N  N     . ASP A 1 1013 ? -7.291  -47.974  34.857  1.00 71.10  ? 1017 ASP A N     1 
ATOM   8104  C  CA    . ASP A 1 1013 ? -6.581  -48.108  36.126  1.00 82.90  ? 1017 ASP A CA    1 
ATOM   8105  C  C     . ASP A 1 1013 ? -5.735  -49.369  36.139  1.00 81.47  ? 1017 ASP A C     1 
ATOM   8106  O  O     . ASP A 1 1013 ? -4.534  -49.315  36.421  1.00 76.69  ? 1017 ASP A O     1 
ATOM   8107  C  CB    . ASP A 1 1013 ? -7.562  -48.139  37.303  1.00 95.86  ? 1017 ASP A CB    1 
ATOM   8108  C  CG    . ASP A 1 1013 ? -8.157  -46.783  37.610  1.00 97.71  ? 1017 ASP A CG    1 
ATOM   8109  O  OD1   . ASP A 1 1013 ? -8.029  -45.866  36.780  1.00 94.29  ? 1017 ASP A OD1   1 
ATOM   8110  O  OD2   . ASP A 1 1013 ? -8.766  -46.641  38.684  1.00 120.08 ? 1017 ASP A OD2   1 
ATOM   8111  N  N     . PHE A 1 1014 ? -6.367  -50.499  35.836  1.00 82.00  ? 1018 PHE A N     1 
ATOM   8112  C  CA    . PHE A 1 1014 ? -5.661  -51.776  35.835  1.00 91.02  ? 1018 PHE A CA    1 
ATOM   8113  C  C     . PHE A 1 1014 ? -4.515  -51.748  34.836  1.00 80.73  ? 1018 PHE A C     1 
ATOM   8114  O  O     . PHE A 1 1014 ? -3.432  -52.275  35.088  1.00 76.23  ? 1018 PHE A O     1 
ATOM   8115  C  CB    . PHE A 1 1014 ? -6.620  -52.924  35.519  1.00 91.71  ? 1018 PHE A CB    1 
ATOM   8116  C  CG    . PHE A 1 1014 ? -6.096  -54.280  35.915  1.00 93.13  ? 1018 PHE A CG    1 
ATOM   8117  C  CD1   . PHE A 1 1014 ? -5.874  -54.591  37.245  1.00 91.09  ? 1018 PHE A CD1   1 
ATOM   8118  C  CD2   . PHE A 1 1014 ? -5.831  -55.245  34.952  1.00 90.94  ? 1018 PHE A CD2   1 
ATOM   8119  C  CE1   . PHE A 1 1014 ? -5.394  -55.825  37.605  1.00 85.72  ? 1018 PHE A CE1   1 
ATOM   8120  C  CE2   . PHE A 1 1014 ? -5.349  -56.486  35.310  1.00 86.56  ? 1018 PHE A CE2   1 
ATOM   8121  C  CZ    . PHE A 1 1014 ? -5.133  -56.774  36.642  1.00 93.14  ? 1018 PHE A CZ    1 
ATOM   8122  N  N     . LEU A 1 1015 ? -4.762  -51.099  33.709  1.00 88.90  ? 1019 LEU A N     1 
ATOM   8123  C  CA    . LEU A 1 1015 ? -3.769  -50.987  32.654  1.00 93.23  ? 1019 LEU A CA    1 
ATOM   8124  C  C     . LEU A 1 1015 ? -2.541  -50.226  33.142  1.00 101.02 ? 1019 LEU A C     1 
ATOM   8125  O  O     . LEU A 1 1015 ? -1.417  -50.550  32.774  1.00 104.92 ? 1019 LEU A O     1 
ATOM   8126  C  CB    . LEU A 1 1015 ? -4.379  -50.305  31.425  1.00 92.28  ? 1019 LEU A CB    1 
ATOM   8127  C  CG    . LEU A 1 1015 ? -3.568  -50.300  30.126  1.00 76.48  ? 1019 LEU A CG    1 
ATOM   8128  C  CD1   . LEU A 1 1015 ? -2.879  -51.637  29.907  1.00 72.63  ? 1019 LEU A CD1   1 
ATOM   8129  C  CD2   . LEU A 1 1015 ? -4.485  -49.974  28.978  1.00 74.99  ? 1019 LEU A CD2   1 
ATOM   8130  N  N     . VAL A 1 1016 ? -2.759  -49.221  33.983  1.00 101.80 ? 1020 VAL A N     1 
ATOM   8131  C  CA    . VAL A 1 1016 ? -1.642  -48.494  34.587  1.00 94.92  ? 1020 VAL A CA    1 
ATOM   8132  C  C     . VAL A 1 1016 ? -0.937  -49.327  35.660  1.00 91.70  ? 1020 VAL A C     1 
ATOM   8133  O  O     . VAL A 1 1016 ? 0.294   -49.325  35.752  1.00 94.83  ? 1020 VAL A O     1 
ATOM   8134  C  CB    . VAL A 1 1016 ? -2.096  -47.174  35.219  1.00 93.01  ? 1020 VAL A CB    1 
ATOM   8135  C  CG1   . VAL A 1 1016 ? -0.900  -46.431  35.793  1.00 92.11  ? 1020 VAL A CG1   1 
ATOM   8136  C  CG2   . VAL A 1 1016 ? -2.813  -46.318  34.192  1.00 99.27  ? 1020 VAL A CG2   1 
ATOM   8137  N  N     . GLN A 1 1017 ? -1.718  -50.040  36.467  1.00 82.97  ? 1021 GLN A N     1 
ATOM   8138  C  CA    . GLN A 1 1017 ? -1.163  -50.851  37.547  1.00 74.41  ? 1021 GLN A CA    1 
ATOM   8139  C  C     . GLN A 1 1017 ? -0.266  -51.966  37.045  1.00 83.66  ? 1021 GLN A C     1 
ATOM   8140  O  O     . GLN A 1 1017 ? 0.755   -52.248  37.660  1.00 103.58 ? 1021 GLN A O     1 
ATOM   8141  C  CB    . GLN A 1 1017 ? -2.288  -51.440  38.409  1.00 73.80  ? 1021 GLN A CB    1 
ATOM   8142  C  CG    . GLN A 1 1017 ? -3.047  -50.401  39.229  1.00 74.51  ? 1021 GLN A CG    1 
ATOM   8143  C  CD    . GLN A 1 1017 ? -4.286  -50.975  39.868  1.00 94.78  ? 1021 GLN A CD    1 
ATOM   8144  O  OE1   . GLN A 1 1017 ? -4.207  -51.854  40.737  1.00 97.63  ? 1021 GLN A OE1   1 
ATOM   8145  N  NE2   . GLN A 1 1017 ? -5.449  -50.484  39.441  1.00 101.88 ? 1021 GLN A NE2   1 
ATOM   8146  N  N     . ILE A 1 1018 ? -0.643  -52.602  35.937  1.00 90.41  ? 1022 ILE A N     1 
ATOM   8147  C  CA    . ILE A 1 1018 ? 0.120   -53.747  35.430  1.00 93.11  ? 1022 ILE A CA    1 
ATOM   8148  C  C     . ILE A 1 1018 ? 1.429   -53.341  34.760  1.00 93.30  ? 1022 ILE A C     1 
ATOM   8149  O  O     . ILE A 1 1018 ? 2.218   -54.196  34.373  1.00 106.66 ? 1022 ILE A O     1 
ATOM   8150  C  CB    . ILE A 1 1018 ? -0.700  -54.589  34.416  1.00 94.08  ? 1022 ILE A CB    1 
ATOM   8151  C  CG1   . ILE A 1 1018 ? -1.038  -53.769  33.181  1.00 88.16  ? 1022 ILE A CG1   1 
ATOM   8152  C  CG2   . ILE A 1 1018 ? -1.960  -55.143  35.061  1.00 105.34 ? 1022 ILE A CG2   1 
ATOM   8153  C  CD1   . ILE A 1 1018 ? -0.507  -54.366  31.898  1.00 97.57  ? 1022 ILE A CD1   1 
ATOM   8154  N  N     . LYS A 1 1019 ? 1.655   -52.040  34.619  1.00 85.60  ? 1023 LYS A N     1 
ATOM   8155  C  CA    . LYS A 1 1019 ? 2.844   -51.539  33.937  1.00 89.12  ? 1023 LYS A CA    1 
ATOM   8156  C  C     . LYS A 1 1019 ? 3.948   -51.116  34.906  1.00 96.44  ? 1023 LYS A C     1 
ATOM   8157  O  O     . LYS A 1 1019 ? 5.055   -50.784  34.482  1.00 105.96 ? 1023 LYS A O     1 
ATOM   8158  C  CB    . LYS A 1 1019 ? 2.472   -50.365  33.024  1.00 94.98  ? 1023 LYS A CB    1 
ATOM   8159  C  CG    . LYS A 1 1019 ? 1.762   -50.780  31.748  1.00 112.54 ? 1023 LYS A CG    1 
ATOM   8160  C  CD    . LYS A 1 1019 ? 1.076   -49.602  31.070  1.00 113.96 ? 1023 LYS A CD    1 
ATOM   8161  C  CE    . LYS A 1 1019 ? 2.044   -48.471  30.784  1.00 112.69 ? 1023 LYS A CE    1 
ATOM   8162  N  NZ    . LYS A 1 1019 ? 1.356   -47.339  30.102  1.00 118.10 ? 1023 LYS A NZ    1 
ATOM   8163  N  N     . GLU A 1 1020 ? 3.647   -51.124  36.203  1.00 100.77 ? 1024 GLU A N     1 
ATOM   8164  C  CA    . GLU A 1 1020 ? 4.637   -50.744  37.214  1.00 96.90  ? 1024 GLU A CA    1 
ATOM   8165  C  C     . GLU A 1 1020 ? 4.704   -51.734  38.385  1.00 92.18  ? 1024 GLU A C     1 
ATOM   8166  O  O     . GLU A 1 1020 ? 3.689   -52.299  38.817  1.00 82.77  ? 1024 GLU A O     1 
ATOM   8167  C  CB    . GLU A 1 1020 ? 4.354   -49.342  37.742  1.00 97.52  ? 1024 GLU A CB    1 
ATOM   8168  C  CG    . GLU A 1 1020 ? 2.904   -49.082  38.111  1.00 119.81 ? 1024 GLU A CG    1 
ATOM   8169  C  CD    . GLU A 1 1020 ? 2.667   -47.645  38.557  1.00 137.10 ? 1024 GLU A CD    1 
ATOM   8170  O  OE1   . GLU A 1 1020 ? 2.908   -47.347  39.747  1.00 136.30 ? 1024 GLU A OE1   1 
ATOM   8171  O  OE2   . GLU A 1 1020 ? 2.245   -46.817  37.717  1.00 147.39 ? 1024 GLU A OE2   1 
ATOM   8172  N  N     . PHE A 1 1021 ? 5.916   -51.947  38.887  1.00 78.81  ? 1025 PHE A N     1 
ATOM   8173  C  CA    . PHE A 1 1021 ? 6.155   -52.903  39.960  1.00 83.33  ? 1025 PHE A CA    1 
ATOM   8174  C  C     . PHE A 1 1021 ? 5.995   -52.264  41.336  1.00 91.25  ? 1025 PHE A C     1 
ATOM   8175  O  O     . PHE A 1 1021 ? 6.936   -51.668  41.861  1.00 96.99  ? 1025 PHE A O     1 
ATOM   8176  C  CB    . PHE A 1 1021 ? 7.556   -53.495  39.839  1.00 85.14  ? 1025 PHE A CB    1 
ATOM   8177  C  CG    . PHE A 1 1021 ? 7.757   -54.334  38.615  1.00 101.58 ? 1025 PHE A CG    1 
ATOM   8178  C  CD1   . PHE A 1 1021 ? 7.841   -55.715  38.711  1.00 102.74 ? 1025 PHE A CD1   1 
ATOM   8179  C  CD2   . PHE A 1 1021 ? 7.869   -53.747  37.360  1.00 107.09 ? 1025 PHE A CD2   1 
ATOM   8180  C  CE1   . PHE A 1 1021 ? 8.024   -56.489  37.577  1.00 100.47 ? 1025 PHE A CE1   1 
ATOM   8181  C  CE2   . PHE A 1 1021 ? 8.052   -54.522  36.225  1.00 98.66  ? 1025 PHE A CE2   1 
ATOM   8182  C  CZ    . PHE A 1 1021 ? 8.128   -55.892  36.337  1.00 96.00  ? 1025 PHE A CZ    1 
ATOM   8183  N  N     . ALA A 1 1022 ? 4.802   -52.370  41.911  1.00 101.05 ? 1026 ALA A N     1 
ATOM   8184  C  CA    . ALA A 1 1022 ? 4.594   -51.924  43.284  1.00 109.34 ? 1026 ALA A CA    1 
ATOM   8185  C  C     . ALA A 1 1022 ? 5.437   -52.799  44.193  1.00 128.13 ? 1026 ALA A C     1 
ATOM   8186  O  O     . ALA A 1 1022 ? 6.206   -52.317  45.019  1.00 119.39 ? 1026 ALA A O     1 
ATOM   8187  C  CB    . ALA A 1 1022 ? 3.127   -52.001  43.670  1.00 105.19 ? 1026 ALA A CB    1 
ATOM   8188  N  N     . GLY A 1 1023 ? 5.304   -54.103  44.004  1.00 142.31 ? 1027 GLY A N     1 
ATOM   8189  C  CA    . GLY A 1 1023 ? 6.069   -55.061  44.768  1.00 147.98 ? 1027 GLY A CA    1 
ATOM   8190  C  C     . GLY A 1 1023 ? 5.299   -55.556  45.967  1.00 149.57 ? 1027 GLY A C     1 
ATOM   8191  O  O     . GLY A 1 1023 ? 4.141   -55.954  45.853  1.00 159.20 ? 1027 GLY A O     1 
ATOM   8192  N  N     . GLU A 1 1024 ? 5.943   -55.516  47.126  1.00 151.50 ? 1028 GLU A N     1 
ATOM   8193  C  CA    . GLU A 1 1024 ? 5.378   -56.122  48.321  1.00 162.76 ? 1028 GLU A CA    1 
ATOM   8194  C  C     . GLU A 1 1024 ? 4.828   -55.101  49.307  1.00 181.02 ? 1028 GLU A C     1 
ATOM   8195  O  O     . GLU A 1 1024 ? 5.473   -54.094  49.602  1.00 148.38 ? 1028 GLU A O     1 
ATOM   8196  C  CB    . GLU A 1 1024 ? 6.429   -57.000  49.011  1.00 154.74 ? 1028 GLU A CB    1 
ATOM   8197  C  CG    . GLU A 1 1024 ? 5.947   -57.692  50.273  1.00 153.44 ? 1028 GLU A CG    1 
ATOM   8198  C  CD    . GLU A 1 1024 ? 4.977   -58.832  50.004  1.00 167.46 ? 1028 GLU A CD    1 
ATOM   8199  O  OE1   . GLU A 1 1024 ? 4.566   -59.496  50.981  1.00 180.26 ? 1028 GLU A OE1   1 
ATOM   8200  O  OE2   . GLU A 1 1024 ? 4.629   -59.073  48.827  1.00 168.40 ? 1028 GLU A OE2   1 
ATOM   8201  N  N     . ASP A 1 1025 ? 3.615   -55.375  49.785  1.00 212.53 ? 1029 ASP A N     1 
ATOM   8202  C  CA    . ASP A 1 1025 ? 2.974   -54.644  50.881  1.00 229.02 ? 1029 ASP A CA    1 
ATOM   8203  C  C     . ASP A 1 1025 ? 3.042   -53.118  50.803  1.00 227.65 ? 1029 ASP A C     1 
ATOM   8204  O  O     . ASP A 1 1025 ? 2.876   -52.442  51.825  1.00 239.05 ? 1029 ASP A O     1 
ATOM   8205  C  CB    . ASP A 1 1025 ? 3.566   -55.097  52.221  1.00 239.28 ? 1029 ASP A CB    1 
ATOM   8206  C  CG    . ASP A 1 1025 ? 3.034   -56.447  52.666  1.00 246.75 ? 1029 ASP A CG    1 
ATOM   8207  O  OD1   . ASP A 1 1025 ? 2.817   -56.629  53.883  1.00 245.84 ? 1029 ASP A OD1   1 
ATOM   8208  O  OD2   . ASP A 1 1025 ? 2.830   -57.326  51.800  1.00 254.42 ? 1029 ASP A OD2   1 
ATOM   8209  N  N     . THR A 1 1026 ? 3.279   -52.569  49.614  1.00 207.34 ? 1030 THR A N     1 
ATOM   8210  C  CA    . THR A 1 1026 ? 3.229   -51.122  49.473  1.00 166.52 ? 1030 THR A CA    1 
ATOM   8211  C  C     . THR A 1 1026 ? 1.821   -50.745  49.008  1.00 144.68 ? 1030 THR A C     1 
ATOM   8212  O  O     . THR A 1 1026 ? 1.411   -51.019  47.884  1.00 148.30 ? 1030 THR A O     1 
ATOM   8213  C  CB    . THR A 1 1026 ? 4.340   -50.579  48.521  1.00 107.53 ? 1030 THR A CB    1 
ATOM   8214  O  OG1   . THR A 1 1026 ? 4.322   -49.140  48.514  1.00 78.51  ? 1030 THR A OG1   1 
ATOM   8215  C  CG2   . THR A 1 1026 ? 4.210   -51.129  47.108  1.00 117.67 ? 1030 THR A CG2   1 
ATOM   8216  N  N     . SER A 1 1027 ? 1.058   -50.143  49.910  1.00 136.58 ? 1031 SER A N     1 
ATOM   8217  C  CA    . SER A 1 1027 ? -0.346  -49.910  49.636  1.00 126.57 ? 1031 SER A CA    1 
ATOM   8218  C  C     . SER A 1 1027 ? -0.706  -48.439  49.442  1.00 124.10 ? 1031 SER A C     1 
ATOM   8219  O  O     . SER A 1 1027 ? -1.082  -47.736  50.368  1.00 138.10 ? 1031 SER A O     1 
ATOM   8220  C  CB    . SER A 1 1027 ? -1.208  -50.516  50.742  1.00 149.66 ? 1031 SER A CB    1 
ATOM   8221  O  OG    . SER A 1 1027 ? -1.258  -51.926  50.614  1.00 152.02 ? 1031 SER A OG    1 
ATOM   8222  N  N     . ASP A 1 1028 ? -0.599  -47.986  48.203  1.00 140.51 ? 1032 ASP A N     1 
ATOM   8223  C  CA    . ASP A 1 1028 ? -1.066  -46.662  47.806  1.00 130.01 ? 1032 ASP A CA    1 
ATOM   8224  C  C     . ASP A 1 1028 ? -2.057  -46.840  46.656  1.00 102.88 ? 1032 ASP A C     1 
ATOM   8225  O  O     . ASP A 1 1028 ? -1.994  -46.169  45.632  1.00 79.11  ? 1032 ASP A O     1 
ATOM   8226  C  CB    . ASP A 1 1028 ? 0.113   -45.779  47.420  1.00 130.42 ? 1032 ASP A CB    1 
ATOM   8227  C  CG    . ASP A 1 1028 ? 1.146   -45.689  48.531  1.00 120.57 ? 1032 ASP A CG    1 
ATOM   8228  O  OD1   . ASP A 1 1028 ? 2.018   -46.582  48.623  1.00 100.57 ? 1032 ASP A OD1   1 
ATOM   8229  O  OD2   . ASP A 1 1028 ? 1.075   -44.734  49.330  1.00 134.61 ? 1032 ASP A OD2   1 
ATOM   8230  N  N     . LEU A 1 1029 ? -2.970  -47.778  46.874  1.00 95.00  ? 1033 LEU A N     1 
ATOM   8231  C  CA    . LEU A 1 1029 ? -4.017  -48.145  45.948  1.00 98.11  ? 1033 LEU A CA    1 
ATOM   8232  C  C     . LEU A 1 1029 ? -5.326  -47.600  46.472  1.00 102.57 ? 1033 LEU A C     1 
ATOM   8233  O  O     . LEU A 1 1029 ? -6.368  -47.745  45.834  1.00 112.49 ? 1033 LEU A O     1 
ATOM   8234  C  CB    . LEU A 1 1029 ? -4.111  -49.664  45.796  1.00 113.37 ? 1033 LEU A CB    1 
ATOM   8235  C  CG    . LEU A 1 1029 ? -2.864  -50.541  45.918  1.00 120.90 ? 1033 LEU A CG    1 
ATOM   8236  C  CD1   . LEU A 1 1029 ? -2.487  -50.711  47.330  1.00 121.53 ? 1033 LEU A CD1   1 
ATOM   8237  C  CD2   . LEU A 1 1029 ? -3.190  -51.883  45.429  1.00 129.85 ? 1033 LEU A CD2   1 
ATOM   8238  N  N     . PHE A 1 1030 ? -5.248  -46.980  47.647  1.00 102.88 ? 1034 PHE A N     1 
ATOM   8239  C  CA    . PHE A 1 1030 ? -6.383  -46.337  48.298  1.00 97.32  ? 1034 PHE A CA    1 
ATOM   8240  C  C     . PHE A 1 1030 ? -7.613  -47.221  48.292  1.00 90.07  ? 1034 PHE A C     1 
ATOM   8241  O  O     . PHE A 1 1030 ? -8.604  -46.912  47.624  1.00 87.13  ? 1034 PHE A O     1 
ATOM   8242  C  CB    . PHE A 1 1030 ? -6.700  -45.002  47.629  1.00 105.14 ? 1034 PHE A CB    1 
ATOM   8243  C  CG    . PHE A 1 1030 ? -5.602  -43.995  47.753  1.00 106.05 ? 1034 PHE A CG    1 
ATOM   8244  C  CD1   . PHE A 1 1030 ? -5.577  -43.105  48.814  1.00 122.60 ? 1034 PHE A CD1   1 
ATOM   8245  C  CD2   . PHE A 1 1030 ? -4.594  -43.936  46.811  1.00 100.76 ? 1034 PHE A CD2   1 
ATOM   8246  C  CE1   . PHE A 1 1030 ? -4.564  -42.175  48.933  1.00 123.81 ? 1034 PHE A CE1   1 
ATOM   8247  C  CE2   . PHE A 1 1030 ? -3.579  -43.008  46.918  1.00 106.18 ? 1034 PHE A CE2   1 
ATOM   8248  C  CZ    . PHE A 1 1030 ? -3.562  -42.126  47.983  1.00 110.85 ? 1034 PHE A CZ    1 
ATOM   8249  N  N     . LEU A 1 1031 ? -7.539  -48.314  49.041  1.00 88.29  ? 1035 LEU A N     1 
ATOM   8250  C  CA    . LEU A 1 1031 ? -8.594  -49.306  49.043  1.00 103.82 ? 1035 LEU A CA    1 
ATOM   8251  C  C     . LEU A 1 1031 ? -9.893  -48.720  49.574  1.00 118.39 ? 1035 LEU A C     1 
ATOM   8252  O  O     . LEU A 1 1031 ? -10.958 -49.109  49.134  1.00 122.26 ? 1035 LEU A O     1 
ATOM   8253  C  CB    . LEU A 1 1031 ? -8.189  -50.527  49.869  1.00 119.49 ? 1035 LEU A CB    1 
ATOM   8254  C  CG    . LEU A 1 1031 ? -6.967  -51.348  49.439  1.00 121.17 ? 1035 LEU A CG    1 
ATOM   8255  C  CD1   . LEU A 1 1031 ? -5.654  -50.595  49.664  1.00 125.41 ? 1035 LEU A CD1   1 
ATOM   8256  C  CD2   . LEU A 1 1031 ? -6.932  -52.664  50.200  1.00 108.59 ? 1035 LEU A CD2   1 
ATOM   8257  N  N     . GLU A 1 1032 ? -9.815  -47.780  50.511  1.00 133.46 ? 1036 GLU A N     1 
ATOM   8258  C  CA    . GLU A 1 1032 ? -11.039 -47.236  51.093  1.00 141.21 ? 1036 GLU A CA    1 
ATOM   8259  C  C     . GLU A 1 1032 ? -11.853 -46.475  50.057  1.00 137.57 ? 1036 GLU A C     1 
ATOM   8260  O  O     . GLU A 1 1032 ? -12.994 -46.836  49.805  1.00 132.30 ? 1036 GLU A O     1 
ATOM   8261  C  CB    . GLU A 1 1032 ? -10.747 -46.333  52.297  1.00 148.04 ? 1036 GLU A CB    1 
ATOM   8262  C  CG    . GLU A 1 1032 ? -9.315  -45.878  52.440  1.00 151.52 ? 1036 GLU A CG    1 
ATOM   8263  C  CD    . GLU A 1 1032 ? -8.414  -46.962  52.991  1.00 156.73 ? 1036 GLU A CD    1 
ATOM   8264  O  OE1   . GLU A 1 1032 ? -8.793  -47.615  53.988  1.00 164.07 ? 1036 GLU A OE1   1 
ATOM   8265  O  OE2   . GLU A 1 1032 ? -7.329  -47.165  52.411  1.00 158.65 ? 1036 GLU A OE2   1 
ATOM   8266  N  N     . GLU A 1 1033 ? -11.277 -45.439  49.450  1.00 139.95 ? 1037 GLU A N     1 
ATOM   8267  C  CA    . GLU A 1 1033 ? -11.987 -44.693  48.405  1.00 132.95 ? 1037 GLU A CA    1 
ATOM   8268  C  C     . GLU A 1 1033 ? -12.466 -45.623  47.292  1.00 117.98 ? 1037 GLU A C     1 
ATOM   8269  O  O     . GLU A 1 1033 ? -13.603 -45.519  46.833  1.00 121.87 ? 1037 GLU A O     1 
ATOM   8270  C  CB    . GLU A 1 1033 ? -11.107 -43.587  47.814  1.00 132.13 ? 1037 GLU A CB    1 
ATOM   8271  C  CG    . GLU A 1 1033 ? -10.993 -42.339  48.681  1.00 136.60 ? 1037 GLU A CG    1 
ATOM   8272  C  CD    . GLU A 1 1033 ? -9.833  -42.399  49.653  1.00 142.78 ? 1037 GLU A CD    1 
ATOM   8273  O  OE1   . GLU A 1 1033 ? -9.192  -43.463  49.749  1.00 147.38 ? 1037 GLU A OE1   1 
ATOM   8274  O  OE2   . GLU A 1 1033 ? -9.556  -41.377  50.316  1.00 142.36 ? 1037 GLU A OE2   1 
ATOM   8275  N  N     . ARG A 1 1034 ? -11.599 -46.546  46.889  1.00 108.24 ? 1038 ARG A N     1 
ATOM   8276  C  CA    . ARG A 1 1034 ? -11.901 -47.490  45.815  1.00 114.96 ? 1038 ARG A CA    1 
ATOM   8277  C  C     . ARG A 1 1034 ? -13.104 -48.387  46.120  1.00 119.77 ? 1038 ARG A C     1 
ATOM   8278  O  O     . ARG A 1 1034 ? -14.093 -48.386  45.385  1.00 131.98 ? 1038 ARG A O     1 
ATOM   8279  C  CB    . ARG A 1 1034 ? -10.675 -48.357  45.525  1.00 116.52 ? 1038 ARG A CB    1 
ATOM   8280  C  CG    . ARG A 1 1034 ? -10.939 -49.485  44.551  1.00 133.89 ? 1038 ARG A CG    1 
ATOM   8281  C  CD    . ARG A 1 1034 ? -11.345 -48.959  43.193  1.00 142.61 ? 1038 ARG A CD    1 
ATOM   8282  N  NE    . ARG A 1 1034 ? -10.352 -48.036  42.661  1.00 143.63 ? 1038 ARG A NE    1 
ATOM   8283  C  CZ    . ARG A 1 1034 ? -10.637 -47.034  41.838  1.00 154.98 ? 1038 ARG A CZ    1 
ATOM   8284  N  NH1   . ARG A 1 1034 ? -11.892 -46.829  41.460  1.00 160.43 ? 1038 ARG A NH1   1 
ATOM   8285  N  NH2   . ARG A 1 1034 ? -9.672  -46.235  41.399  1.00 157.16 ? 1038 ARG A NH2   1 
ATOM   8286  N  N     . GLU A 1 1035 ? -13.005 -49.153  47.200  1.00 113.32 ? 1039 GLU A N     1 
ATOM   8287  C  CA    . GLU A 1 1035 ? -14.053 -50.073  47.627  1.00 115.61 ? 1039 GLU A CA    1 
ATOM   8288  C  C     . GLU A 1 1035 ? -15.337 -49.323  47.979  1.00 117.47 ? 1039 GLU A C     1 
ATOM   8289  O  O     . GLU A 1 1035 ? -16.436 -49.868  47.860  1.00 123.02 ? 1039 GLU A O     1 
ATOM   8290  C  CB    . GLU A 1 1035 ? -13.577 -50.908  48.819  1.00 120.08 ? 1039 GLU A CB    1 
ATOM   8291  C  CG    . GLU A 1 1035 ? -14.276 -52.243  48.973  1.00 129.95 ? 1039 GLU A CG    1 
ATOM   8292  C  CD    . GLU A 1 1035 ? -13.891 -52.963  50.263  1.00 152.04 ? 1039 GLU A CD    1 
ATOM   8293  O  OE1   . GLU A 1 1035 ? -13.141 -52.377  51.073  1.00 164.78 ? 1039 GLU A OE1   1 
ATOM   8294  O  OE2   . GLU A 1 1035 ? -14.339 -54.112  50.468  1.00 156.25 ? 1039 GLU A OE2   1 
ATOM   8295  N  N     . ILE A 1 1036 ? -15.195 -48.071  48.407  1.00 124.74 ? 1040 ILE A N     1 
ATOM   8296  C  CA    . ILE A 1 1036 ? -16.353 -47.212  48.634  1.00 133.45 ? 1040 ILE A CA    1 
ATOM   8297  C  C     . ILE A 1 1036 ? -17.062 -46.925  47.320  1.00 130.05 ? 1040 ILE A C     1 
ATOM   8298  O  O     . ILE A 1 1036 ? -18.277 -47.072  47.222  1.00 134.35 ? 1040 ILE A O     1 
ATOM   8299  C  CB    . ILE A 1 1036 ? -15.973 -45.871  49.300  1.00 138.27 ? 1040 ILE A CB    1 
ATOM   8300  C  CG1   . ILE A 1 1036 ? -15.792 -46.045  50.810  1.00 142.93 ? 1040 ILE A CG1   1 
ATOM   8301  C  CG2   . ILE A 1 1036 ? -17.052 -44.827  49.055  1.00 135.32 ? 1040 ILE A CG2   1 
ATOM   8302  C  CD1   . ILE A 1 1036 ? -15.750 -44.729  51.566  1.00 146.14 ? 1040 ILE A CD1   1 
ATOM   8303  N  N     . ALA A 1 1037 ? -16.296 -46.516  46.312  1.00 132.05 ? 1041 ALA A N     1 
ATOM   8304  C  CA    . ALA A 1 1037 ? -16.858 -46.215  44.995  1.00 120.61 ? 1041 ALA A CA    1 
ATOM   8305  C  C     . ALA A 1 1037 ? -17.525 -47.445  44.390  1.00 116.04 ? 1041 ALA A C     1 
ATOM   8306  O  O     . ALA A 1 1037 ? -18.638 -47.365  43.860  1.00 113.50 ? 1041 ALA A O     1 
ATOM   8307  C  CB    . ALA A 1 1037 ? -15.779 -45.686  44.066  1.00 112.44 ? 1041 ALA A CB    1 
ATOM   8308  N  N     . LEU A 1 1038 ? -16.838 -48.580  44.481  1.00 110.02 ? 1042 LEU A N     1 
ATOM   8309  C  CA    . LEU A 1 1038 ? -17.380 -49.849  44.018  1.00 107.73 ? 1042 LEU A CA    1 
ATOM   8310  C  C     . LEU A 1 1038 ? -18.677 -50.164  44.739  1.00 124.65 ? 1042 LEU A C     1 
ATOM   8311  O  O     . LEU A 1 1038 ? -19.621 -50.690  44.153  1.00 141.72 ? 1042 LEU A O     1 
ATOM   8312  C  CB    . LEU A 1 1038 ? -16.370 -50.977  44.230  1.00 103.42 ? 1042 LEU A CB    1 
ATOM   8313  C  CG    . LEU A 1 1038 ? -15.045 -50.853  43.468  1.00 111.12 ? 1042 LEU A CG    1 
ATOM   8314  C  CD1   . LEU A 1 1038 ? -14.172 -52.073  43.735  1.00 121.33 ? 1042 LEU A CD1   1 
ATOM   8315  C  CD2   . LEU A 1 1038 ? -15.295 -50.678  41.975  1.00 72.53  ? 1042 LEU A CD2   1 
ATOM   8316  N  N     . ARG A 1 1039 ? -18.717 -49.824  46.021  1.00 135.18 ? 1043 ARG A N     1 
ATOM   8317  C  CA    . ARG A 1 1039 ? -19.903 -50.046  46.835  1.00 133.00 ? 1043 ARG A CA    1 
ATOM   8318  C  C     . ARG A 1 1039 ? -21.084 -49.191  46.378  1.00 133.80 ? 1043 ARG A C     1 
ATOM   8319  O  O     . ARG A 1 1039 ? -22.202 -49.687  46.240  1.00 137.16 ? 1043 ARG A O     1 
ATOM   8320  C  CB    . ARG A 1 1039 ? -19.597 -49.757  48.302  1.00 137.10 ? 1043 ARG A CB    1 
ATOM   8321  C  CG    . ARG A 1 1039 ? -20.780 -49.976  49.193  1.00 142.65 ? 1043 ARG A CG    1 
ATOM   8322  C  CD    . ARG A 1 1039 ? -21.023 -51.458  49.410  1.00 146.83 ? 1043 ARG A CD    1 
ATOM   8323  N  NE    . ARG A 1 1039 ? -20.373 -51.925  50.629  1.00 154.58 ? 1043 ARG A NE    1 
ATOM   8324  C  CZ    . ARG A 1 1039 ? -20.764 -51.585  51.853  1.00 159.95 ? 1043 ARG A CZ    1 
ATOM   8325  N  NH1   . ARG A 1 1039 ? -21.799 -50.773  52.021  1.00 160.00 ? 1043 ARG A NH1   1 
ATOM   8326  N  NH2   . ARG A 1 1039 ? -20.119 -52.054  52.912  1.00 167.63 ? 1043 ARG A NH2   1 
ATOM   8327  N  N     . GLN A 1 1040 ? -20.830 -47.905  46.156  1.00 133.61 ? 1044 GLN A N     1 
ATOM   8328  C  CA    . GLN A 1 1040 ? -21.871 -46.974  45.735  1.00 131.03 ? 1044 GLN A CA    1 
ATOM   8329  C  C     . GLN A 1 1040 ? -22.417 -47.358  44.366  1.00 140.05 ? 1044 GLN A C     1 
ATOM   8330  O  O     . GLN A 1 1040 ? -23.628 -47.317  44.135  1.00 142.40 ? 1044 GLN A O     1 
ATOM   8331  C  CB    . GLN A 1 1040 ? -21.340 -45.542  45.702  1.00 128.95 ? 1044 GLN A CB    1 
ATOM   8332  C  CG    . GLN A 1 1040 ? -20.818 -45.034  47.031  1.00 138.66 ? 1044 GLN A CG    1 
ATOM   8333  C  CD    . GLN A 1 1040 ? -20.573 -43.537  47.019  1.00 148.61 ? 1044 GLN A CD    1 
ATOM   8334  O  OE1   . GLN A 1 1040 ? -21.242 -42.792  46.299  1.00 146.47 ? 1044 GLN A OE1   1 
ATOM   8335  N  NE2   . GLN A 1 1040 ? -19.607 -43.087  47.813  1.00 152.56 ? 1044 GLN A NE2   1 
ATOM   8336  N  N     . ALA A 1 1041 ? -21.516 -47.724  43.459  1.00 135.65 ? 1045 ALA A N     1 
ATOM   8337  C  CA    . ALA A 1 1041 ? -21.922 -48.186  42.141  1.00 126.47 ? 1045 ALA A CA    1 
ATOM   8338  C  C     . ALA A 1 1041 ? -22.729 -49.473  42.260  1.00 124.34 ? 1045 ALA A C     1 
ATOM   8339  O  O     . ALA A 1 1041 ? -23.668 -49.705  41.496  1.00 128.21 ? 1045 ALA A O     1 
ATOM   8340  C  CB    . ALA A 1 1041 ? -20.708 -48.397  41.253  1.00 133.96 ? 1045 ALA A CB    1 
ATOM   8341  N  N     . ASP A 1 1042 ? -22.359 -50.304  43.226  1.00 132.41 ? 1046 ASP A N     1 
ATOM   8342  C  CA    . ASP A 1 1042 ? -23.054 -51.563  43.459  1.00 131.27 ? 1046 ASP A CA    1 
ATOM   8343  C  C     . ASP A 1 1042 ? -24.468 -51.311  43.972  1.00 144.22 ? 1046 ASP A C     1 
ATOM   8344  O  O     . ASP A 1 1042 ? -25.391 -52.067  43.672  1.00 152.07 ? 1046 ASP A O     1 
ATOM   8345  C  CB    . ASP A 1 1042 ? -22.271 -52.429  44.446  1.00 122.85 ? 1046 ASP A CB    1 
ATOM   8346  C  CG    . ASP A 1 1042 ? -22.551 -53.904  44.277  1.00 140.59 ? 1046 ASP A CG    1 
ATOM   8347  O  OD1   . ASP A 1 1042 ? -23.208 -54.275  43.283  1.00 136.39 ? 1046 ASP A OD1   1 
ATOM   8348  O  OD2   . ASP A 1 1042 ? -22.105 -54.696  45.133  1.00 160.40 ? 1046 ASP A OD2   1 
ATOM   8349  N  N     . GLU A 1 1043 ? -24.633 -50.237  44.741  1.00 148.11 ? 1047 GLU A N     1 
ATOM   8350  C  CA    . GLU A 1 1043 ? -25.939 -49.872  45.279  1.00 152.69 ? 1047 GLU A CA    1 
ATOM   8351  C  C     . GLU A 1 1043 ? -26.907 -49.488  44.165  1.00 143.89 ? 1047 GLU A C     1 
ATOM   8352  O  O     . GLU A 1 1043 ? -28.069 -49.888  44.175  1.00 142.65 ? 1047 GLU A O     1 
ATOM   8353  C  CB    . GLU A 1 1043 ? -25.804 -48.722  46.281  1.00 166.27 ? 1047 GLU A CB    1 
ATOM   8354  C  CG    . GLU A 1 1043 ? -27.118 -48.306  46.931  1.00 183.40 ? 1047 GLU A CG    1 
ATOM   8355  C  CD    . GLU A 1 1043 ? -26.937 -47.224  47.980  1.00 195.98 ? 1047 GLU A CD    1 
ATOM   8356  O  OE1   . GLU A 1 1043 ? -25.785 -46.790  48.197  1.00 201.37 ? 1047 GLU A OE1   1 
ATOM   8357  O  OE2   . GLU A 1 1043 ? -27.946 -46.808  48.588  1.00 199.98 ? 1047 GLU A OE2   1 
ATOM   8358  N  N     . GLU A 1 1044 ? -26.420 -48.711  43.204  1.00 131.81 ? 1048 GLU A N     1 
ATOM   8359  C  CA    . GLU A 1 1044 ? -27.227 -48.341  42.044  1.00 134.79 ? 1048 GLU A CA    1 
ATOM   8360  C  C     . GLU A 1 1044 ? -27.171 -49.415  40.959  1.00 122.38 ? 1048 GLU A C     1 
ATOM   8361  O  O     . GLU A 1 1044 ? -27.502 -50.582  41.196  1.00 117.43 ? 1048 GLU A O     1 
ATOM   8362  C  CB    . GLU A 1 1044 ? -26.772 -46.997  41.469  1.00 142.25 ? 1048 GLU A CB    1 
ATOM   8363  C  CG    . GLU A 1 1044 ? -27.014 -45.812  42.393  1.00 147.54 ? 1048 GLU A CG    1 
ATOM   8364  C  CD    . GLU A 1 1044 ? -27.150 -44.509  41.632  1.00 148.89 ? 1048 GLU A CD    1 
ATOM   8365  O  OE1   . GLU A 1 1044 ? -26.875 -44.500  40.413  1.00 150.74 ? 1048 GLU A OE1   1 
ATOM   8366  O  OE2   . GLU A 1 1044 ? -27.541 -43.496  42.247  1.00 154.88 ? 1048 GLU A OE2   1 
ATOM   8367  N  N     . GLN B 2 1    ? 23.828  -28.139  3.434   1.00 200.28 ? 8    GLN B N     1 
ATOM   8368  C  CA    . GLN B 2 1    ? 23.019  -28.709  2.362   1.00 197.06 ? 8    GLN B CA    1 
ATOM   8369  C  C     . GLN B 2 1    ? 21.599  -28.157  2.395   1.00 180.92 ? 8    GLN B C     1 
ATOM   8370  O  O     . GLN B 2 1    ? 20.682  -28.769  1.844   1.00 182.33 ? 8    GLN B O     1 
ATOM   8371  C  CB    . GLN B 2 1    ? 22.987  -30.236  2.467   1.00 205.30 ? 8    GLN B CB    1 
ATOM   8372  C  CG    . GLN B 2 1    ? 23.557  -30.954  1.257   1.00 216.00 ? 8    GLN B CG    1 
ATOM   8373  C  CD    . GLN B 2 1    ? 23.310  -32.449  1.301   1.00 217.95 ? 8    GLN B CD    1 
ATOM   8374  O  OE1   . GLN B 2 1    ? 23.500  -33.093  2.334   1.00 217.01 ? 8    GLN B OE1   1 
ATOM   8375  N  NE2   . GLN B 2 1    ? 22.872  -33.009  0.178   1.00 220.10 ? 8    GLN B NE2   1 
ATOM   8376  N  N     . VAL B 2 2    ? 21.446  -26.994  3.031   1.00 167.45 ? 9    VAL B N     1 
ATOM   8377  C  CA    . VAL B 2 2    ? 20.155  -26.348  3.299   1.00 139.18 ? 9    VAL B CA    1 
ATOM   8378  C  C     . VAL B 2 2    ? 19.075  -27.394  3.622   1.00 122.72 ? 9    VAL B C     1 
ATOM   8379  O  O     . VAL B 2 2    ? 17.982  -27.416  3.044   1.00 121.44 ? 9    VAL B O     1 
ATOM   8380  C  CB    . VAL B 2 2    ? 19.732  -25.398  2.118   1.00 139.61 ? 9    VAL B CB    1 
ATOM   8381  C  CG1   . VAL B 2 2    ? 19.478  -26.146  0.804   1.00 146.94 ? 9    VAL B CG1   1 
ATOM   8382  C  CG2   . VAL B 2 2    ? 18.542  -24.514  2.510   1.00 137.09 ? 9    VAL B CG2   1 
ATOM   8383  N  N     . GLN B 2 3    ? 19.403  -28.270  4.568   1.00 116.96 ? 10   GLN B N     1 
ATOM   8384  C  CA    . GLN B 2 3    ? 18.468  -29.301  5.009   1.00 98.38  ? 10   GLN B CA    1 
ATOM   8385  C  C     . GLN B 2 3    ? 17.974  -29.038  6.425   1.00 89.11  ? 10   GLN B C     1 
ATOM   8386  O  O     . GLN B 2 3    ? 18.640  -28.381  7.215   1.00 101.78 ? 10   GLN B O     1 
ATOM   8387  C  CB    . GLN B 2 3    ? 19.110  -30.686  4.921   1.00 100.19 ? 10   GLN B CB    1 
ATOM   8388  C  CG    . GLN B 2 3    ? 20.515  -30.771  5.492   1.00 106.72 ? 10   GLN B CG    1 
ATOM   8389  C  CD    . GLN B 2 3    ? 21.040  -32.192  5.504   1.00 113.03 ? 10   GLN B CD    1 
ATOM   8390  O  OE1   . GLN B 2 3    ? 21.684  -32.642  4.552   1.00 124.39 ? 10   GLN B OE1   1 
ATOM   8391  N  NE2   . GLN B 2 3    ? 20.764  -32.912  6.585   1.00 111.70 ? 10   GLN B NE2   1 
ATOM   8392  N  N     . PHE B 2 4    ? 16.795  -29.556  6.738   1.00 82.96  ? 11   PHE B N     1 
ATOM   8393  C  CA    . PHE B 2 4    ? 16.185  -29.347  8.040   1.00 73.53  ? 11   PHE B CA    1 
ATOM   8394  C  C     . PHE B 2 4    ? 15.765  -30.668  8.684   1.00 90.10  ? 11   PHE B C     1 
ATOM   8395  O  O     . PHE B 2 4    ? 15.449  -31.640  7.987   1.00 91.76  ? 11   PHE B O     1 
ATOM   8396  C  CB    . PHE B 2 4    ? 14.965  -28.437  7.915   1.00 71.38  ? 11   PHE B CB    1 
ATOM   8397  C  CG    . PHE B 2 4    ? 15.280  -27.061  7.400   1.00 85.62  ? 11   PHE B CG    1 
ATOM   8398  C  CD1   . PHE B 2 4    ? 15.767  -26.082  8.246   1.00 95.46  ? 11   PHE B CD1   1 
ATOM   8399  C  CD2   . PHE B 2 4    ? 15.074  -26.744  6.071   1.00 94.80  ? 11   PHE B CD2   1 
ATOM   8400  C  CE1   . PHE B 2 4    ? 16.054  -24.818  7.775   1.00 98.34  ? 11   PHE B CE1   1 
ATOM   8401  C  CE2   . PHE B 2 4    ? 15.365  -25.482  5.593   1.00 99.39  ? 11   PHE B CE2   1 
ATOM   8402  C  CZ    . PHE B 2 4    ? 15.853  -24.517  6.449   1.00 101.92 ? 11   PHE B CZ    1 
ATOM   8403  N  N     . LYS B 2 5    ? 15.756  -30.704  10.015  1.00 94.28  ? 12   LYS B N     1 
ATOM   8404  C  CA    . LYS B 2 5    ? 15.253  -31.875  10.719  1.00 85.60  ? 12   LYS B CA    1 
ATOM   8405  C  C     . LYS B 2 5    ? 13.771  -31.735  11.041  1.00 80.53  ? 12   LYS B C     1 
ATOM   8406  O  O     . LYS B 2 5    ? 13.339  -30.821  11.763  1.00 90.25  ? 12   LYS B O     1 
ATOM   8407  C  CB    . LYS B 2 5    ? 16.035  -32.132  12.000  1.00 93.96  ? 12   LYS B CB    1 
ATOM   8408  C  CG    . LYS B 2 5    ? 15.521  -33.350  12.754  1.00 94.99  ? 12   LYS B CG    1 
ATOM   8409  C  CD    . LYS B 2 5    ? 16.377  -33.686  13.966  1.00 89.47  ? 12   LYS B CD    1 
ATOM   8410  C  CE    . LYS B 2 5    ? 15.767  -34.824  14.751  1.00 78.93  ? 12   LYS B CE    1 
ATOM   8411  N  NZ    . LYS B 2 5    ? 16.667  -35.269  15.850  1.00 84.45  ? 12   LYS B NZ    1 
ATOM   8412  N  N     . LEU B 2 6    ? 12.997  -32.654  10.482  1.00 74.74  ? 13   LEU B N     1 
ATOM   8413  C  CA    . LEU B 2 6    ? 11.562  -32.707  10.702  1.00 71.08  ? 13   LEU B CA    1 
ATOM   8414  C  C     . LEU B 2 6    ? 11.237  -33.953  11.498  1.00 70.75  ? 13   LEU B C     1 
ATOM   8415  O  O     . LEU B 2 6    ? 11.664  -35.053  11.138  1.00 75.58  ? 13   LEU B O     1 
ATOM   8416  C  CB    . LEU B 2 6    ? 10.806  -32.712  9.371   1.00 70.50  ? 13   LEU B CB    1 
ATOM   8417  C  CG    . LEU B 2 6    ? 9.283   -32.566  9.373   1.00 68.41  ? 13   LEU B CG    1 
ATOM   8418  C  CD1   . LEU B 2 6    ? 8.834   -31.961  8.051   1.00 75.06  ? 13   LEU B CD1   1 
ATOM   8419  C  CD2   . LEU B 2 6    ? 8.579   -33.888  9.613   1.00 63.86  ? 13   LEU B CD2   1 
ATOM   8420  N  N     . VAL B 2 7    ? 10.487  -33.792  12.581  1.00 74.60  ? 14   VAL B N     1 
ATOM   8421  C  CA    . VAL B 2 7    ? 10.077  -34.951  13.363  1.00 65.06  ? 14   VAL B CA    1 
ATOM   8422  C  C     . VAL B 2 7    ? 8.585   -35.192  13.171  1.00 61.53  ? 14   VAL B C     1 
ATOM   8423  O  O     . VAL B 2 7    ? 7.754   -34.293  13.302  1.00 65.36  ? 14   VAL B O     1 
ATOM   8424  C  CB    . VAL B 2 7    ? 10.419  -34.790  14.858  1.00 67.42  ? 14   VAL B CB    1 
ATOM   8425  C  CG1   . VAL B 2 7    ? 9.974   -33.419  15.376  1.00 79.21  ? 14   VAL B CG1   1 
ATOM   8426  C  CG2   . VAL B 2 7    ? 9.795   -35.897  15.668  1.00 71.93  ? 14   VAL B CG2   1 
ATOM   8427  N  N     . LEU B 2 8    ? 8.255   -36.427  12.827  1.00 67.12  ? 15   LEU B N     1 
ATOM   8428  C  CA    . LEU B 2 8    ? 6.880   -36.792  12.508  1.00 70.45  ? 15   LEU B CA    1 
ATOM   8429  C  C     . LEU B 2 8    ? 6.298   -37.672  13.614  1.00 66.78  ? 15   LEU B C     1 
ATOM   8430  O  O     . LEU B 2 8    ? 6.731   -38.810  13.802  1.00 68.71  ? 15   LEU B O     1 
ATOM   8431  C  CB    . LEU B 2 8    ? 6.827   -37.502  11.143  1.00 60.46  ? 15   LEU B CB    1 
ATOM   8432  C  CG    . LEU B 2 8    ? 5.503   -38.073  10.650  1.00 59.47  ? 15   LEU B CG    1 
ATOM   8433  C  CD1   . LEU B 2 8    ? 4.429   -37.022  10.596  1.00 59.45  ? 15   LEU B CD1   1 
ATOM   8434  C  CD2   . LEU B 2 8    ? 5.721   -38.685  9.285   1.00 74.11  ? 15   LEU B CD2   1 
ATOM   8435  N  N     . VAL B 2 9    ? 5.324   -37.140  14.342  1.00 60.34  ? 16   VAL B N     1 
ATOM   8436  C  CA    . VAL B 2 9    ? 4.757   -37.878  15.450  1.00 61.36  ? 16   VAL B CA    1 
ATOM   8437  C  C     . VAL B 2 9    ? 3.253   -38.060  15.303  1.00 69.80  ? 16   VAL B C     1 
ATOM   8438  O  O     . VAL B 2 9    ? 2.617   -37.393  14.481  1.00 61.30  ? 16   VAL B O     1 
ATOM   8439  C  CB    . VAL B 2 9    ? 5.052   -37.180  16.810  1.00 71.50  ? 16   VAL B CB    1 
ATOM   8440  C  CG1   . VAL B 2 9    ? 6.542   -36.999  16.998  1.00 58.50  ? 16   VAL B CG1   1 
ATOM   8441  C  CG2   . VAL B 2 9    ? 4.330   -35.836  16.887  1.00 67.62  ? 16   VAL B CG2   1 
ATOM   8442  N  N     . GLY B 2 10   ? 2.695   -38.953  16.122  1.00 77.56  ? 17   GLY B N     1 
ATOM   8443  C  CA    . GLY B 2 10   ? 1.268   -39.230  16.100  1.00 71.03  ? 17   GLY B CA    1 
ATOM   8444  C  C     . GLY B 2 10   ? 1.008   -40.647  16.523  1.00 67.77  ? 17   GLY B C     1 
ATOM   8445  O  O     . GLY B 2 10   ? 1.948   -41.408  16.704  1.00 65.19  ? 17   GLY B O     1 
ATOM   8446  N  N     . ASP B 2 11   ? -0.263  -40.996  16.680  1.00 60.41  ? 18   ASP B N     1 
ATOM   8447  C  CA    . ASP B 2 11   ? -0.628  -42.341  17.105  1.00 57.90  ? 18   ASP B CA    1 
ATOM   8448  C  C     . ASP B 2 11   ? -0.336  -43.366  16.020  1.00 78.03  ? 18   ASP B C     1 
ATOM   8449  O  O     . ASP B 2 11   ? -0.051  -43.010  14.874  1.00 83.56  ? 18   ASP B O     1 
ATOM   8450  C  CB    . ASP B 2 11   ? -2.105  -42.402  17.497  1.00 67.18  ? 18   ASP B CB    1 
ATOM   8451  C  CG    . ASP B 2 11   ? -2.336  -42.050  18.956  1.00 80.93  ? 18   ASP B CG    1 
ATOM   8452  O  OD1   . ASP B 2 11   ? -1.415  -41.500  19.598  1.00 95.24  ? 18   ASP B OD1   1 
ATOM   8453  O  OD2   . ASP B 2 11   ? -3.447  -42.311  19.452  1.00 84.29  ? 18   ASP B OD2   1 
ATOM   8454  N  N     . GLY B 2 12   ? -0.399  -44.642  16.382  1.00 78.88  ? 19   GLY B N     1 
ATOM   8455  C  CA    . GLY B 2 12   ? -0.209  -45.706  15.417  1.00 61.40  ? 19   GLY B CA    1 
ATOM   8456  C  C     . GLY B 2 12   ? -1.366  -45.780  14.440  1.00 72.14  ? 19   GLY B C     1 
ATOM   8457  O  O     . GLY B 2 12   ? -2.489  -45.362  14.762  1.00 60.12  ? 19   GLY B O     1 
ATOM   8458  N  N     . GLY B 2 13   ? -1.089  -46.303  13.247  1.00 79.34  ? 20   GLY B N     1 
ATOM   8459  C  CA    . GLY B 2 13   ? -2.110  -46.472  12.231  1.00 83.95  ? 20   GLY B CA    1 
ATOM   8460  C  C     . GLY B 2 13   ? -2.721  -45.158  11.821  1.00 73.63  ? 20   GLY B C     1 
ATOM   8461  O  O     . GLY B 2 13   ? -3.905  -45.067  11.514  1.00 86.87  ? 20   GLY B O     1 
ATOM   8462  N  N     . THR B 2 14   ? -1.893  -44.127  11.813  1.00 72.27  ? 21   THR B N     1 
ATOM   8463  C  CA    . THR B 2 14   ? -2.361  -42.766  11.548  1.00 76.86  ? 21   THR B CA    1 
ATOM   8464  C  C     . THR B 2 14   ? -2.084  -42.373  10.101  1.00 66.73  ? 21   THR B C     1 
ATOM   8465  O  O     . THR B 2 14   ? -2.911  -41.767  9.437   1.00 73.40  ? 21   THR B O     1 
ATOM   8466  C  CB    . THR B 2 14   ? -1.693  -41.752  12.507  1.00 58.72  ? 21   THR B CB    1 
ATOM   8467  O  OG1   . THR B 2 14   ? -2.296  -41.874  13.786  1.00 65.05  ? 21   THR B OG1   1 
ATOM   8468  C  CG2   . THR B 2 14   ? -1.885  -40.348  12.039  1.00 82.12  ? 21   THR B CG2   1 
ATOM   8469  N  N     . GLY B 2 15   ? -0.906  -42.733  9.614   1.00 73.44  ? 22   GLY B N     1 
ATOM   8470  C  CA    . GLY B 2 15   ? -0.578  -42.529  8.218   1.00 74.04  ? 22   GLY B CA    1 
ATOM   8471  C  C     . GLY B 2 15   ? 0.781   -41.913  8.004   1.00 65.37  ? 22   GLY B C     1 
ATOM   8472  O  O     . GLY B 2 15   ? 1.127   -41.564  6.879   1.00 79.73  ? 22   GLY B O     1 
ATOM   8473  N  N     . LYS B 2 16   ? 1.543   -41.779  9.082   1.00 65.69  ? 23   LYS B N     1 
ATOM   8474  C  CA    . LYS B 2 16   ? 2.868   -41.171  9.016   1.00 69.27  ? 23   LYS B CA    1 
ATOM   8475  C  C     . LYS B 2 16   ? 3.776   -41.825  7.953   1.00 67.28  ? 23   LYS B C     1 
ATOM   8476  O  O     . LYS B 2 16   ? 4.222   -41.167  6.998   1.00 76.08  ? 23   LYS B O     1 
ATOM   8477  C  CB    . LYS B 2 16   ? 3.528   -41.235  10.389  1.00 46.31  ? 23   LYS B CB    1 
ATOM   8478  C  CG    . LYS B 2 16   ? 2.829   -40.357  11.429  1.00 69.49  ? 23   LYS B CG    1 
ATOM   8479  C  CD    . LYS B 2 16   ? 3.338   -40.657  12.869  1.00 65.93  ? 23   LYS B CD    1 
ATOM   8480  C  CE    . LYS B 2 16   ? 2.709   -41.924  13.415  1.00 66.50  ? 23   LYS B CE    1 
ATOM   8481  N  NZ    . LYS B 2 16   ? 3.679   -42.711  14.196  1.00 84.46  ? 23   LYS B NZ    1 
ATOM   8482  N  N     . THR B 2 17   ? 4.020   -43.121  8.115   1.00 55.22  ? 24   THR B N     1 
ATOM   8483  C  CA    . THR B 2 17   ? 4.943   -43.846  7.269   1.00 64.69  ? 24   THR B CA    1 
ATOM   8484  C  C     . THR B 2 17   ? 4.445   -43.879  5.819   1.00 81.74  ? 24   THR B C     1 
ATOM   8485  O  O     . THR B 2 17   ? 5.224   -43.678  4.891   1.00 62.02  ? 24   THR B O     1 
ATOM   8486  C  CB    . THR B 2 17   ? 5.138   -45.271  7.758   1.00 68.17  ? 24   THR B CB    1 
ATOM   8487  O  OG1   . THR B 2 17   ? 5.449   -45.257  9.149   1.00 74.41  ? 24   THR B OG1   1 
ATOM   8488  C  CG2   . THR B 2 17   ? 6.281   -45.945  7.011   1.00 85.75  ? 24   THR B CG2   1 
ATOM   8489  N  N     . THR B 2 18   ? 3.151   -44.132  5.635   1.00 75.69  ? 25   THR B N     1 
ATOM   8490  C  CA    . THR B 2 18   ? 2.551   -44.173  4.318   1.00 66.22  ? 25   THR B CA    1 
ATOM   8491  C  C     . THR B 2 18   ? 2.699   -42.825  3.626   1.00 86.85  ? 25   THR B C     1 
ATOM   8492  O  O     . THR B 2 18   ? 2.988   -42.749  2.416   1.00 103.38 ? 25   THR B O     1 
ATOM   8493  C  CB    . THR B 2 18   ? 1.066   -44.541  4.388   1.00 70.31  ? 25   THR B CB    1 
ATOM   8494  O  OG1   . THR B 2 18   ? 0.887   -45.674  5.242   1.00 74.26  ? 25   THR B OG1   1 
ATOM   8495  C  CG2   . THR B 2 18   ? 0.562   -44.915  2.997   1.00 110.02 ? 25   THR B CG2   1 
ATOM   8496  N  N     . PHE B 2 19   ? 2.493   -41.767  4.409   1.00 85.79  ? 26   PHE B N     1 
ATOM   8497  C  CA    . PHE B 2 19   ? 2.626   -40.388  3.941   1.00 71.06  ? 26   PHE B CA    1 
ATOM   8498  C  C     . PHE B 2 19   ? 4.042   -40.121  3.417   1.00 81.98  ? 26   PHE B C     1 
ATOM   8499  O  O     . PHE B 2 19   ? 4.236   -39.679  2.274   1.00 88.25  ? 26   PHE B O     1 
ATOM   8500  C  CB    . PHE B 2 19   ? 2.284   -39.450  5.088   1.00 70.95  ? 26   PHE B CB    1 
ATOM   8501  C  CG    . PHE B 2 19   ? 2.297   -37.993  4.734   1.00 68.54  ? 26   PHE B CG    1 
ATOM   8502  C  CD1   . PHE B 2 19   ? 1.351   -37.466  3.889   1.00 79.12  ? 26   PHE B CD1   1 
ATOM   8503  C  CD2   . PHE B 2 19   ? 3.227   -37.140  5.303   1.00 75.90  ? 26   PHE B CD2   1 
ATOM   8504  C  CE1   . PHE B 2 19   ? 1.360   -36.121  3.574   1.00 90.94  ? 26   PHE B CE1   1 
ATOM   8505  C  CE2   . PHE B 2 19   ? 3.236   -35.802  5.010   1.00 77.22  ? 26   PHE B CE2   1 
ATOM   8506  C  CZ    . PHE B 2 19   ? 2.304   -35.285  4.144   1.00 86.24  ? 26   PHE B CZ    1 
ATOM   8507  N  N     . VAL B 2 20   ? 5.036   -40.422  4.250   1.00 80.18  ? 27   VAL B N     1 
ATOM   8508  C  CA    . VAL B 2 20   ? 6.433   -40.234  3.857   1.00 80.18  ? 27   VAL B CA    1 
ATOM   8509  C  C     . VAL B 2 20   ? 6.809   -41.068  2.634   1.00 81.45  ? 27   VAL B C     1 
ATOM   8510  O  O     . VAL B 2 20   ? 7.435   -40.566  1.716   1.00 89.59  ? 27   VAL B O     1 
ATOM   8511  C  CB    . VAL B 2 20   ? 7.391   -40.579  5.019   1.00 81.49  ? 27   VAL B CB    1 
ATOM   8512  C  CG1   . VAL B 2 20   ? 8.836   -40.550  4.553   1.00 77.61  ? 27   VAL B CG1   1 
ATOM   8513  C  CG2   . VAL B 2 20   ? 7.182   -39.613  6.164   1.00 84.32  ? 27   VAL B CG2   1 
ATOM   8514  N  N     . LYS B 2 21   ? 6.423   -42.341  2.636   1.00 86.52  ? 28   LYS B N     1 
ATOM   8515  C  CA    . LYS B 2 21   ? 6.741   -43.256  1.543   1.00 91.66  ? 28   LYS B CA    1 
ATOM   8516  C  C     . LYS B 2 21   ? 6.153   -42.750  0.230   1.00 100.10 ? 28   LYS B C     1 
ATOM   8517  O  O     . LYS B 2 21   ? 6.823   -42.765  -0.802  1.00 104.36 ? 28   LYS B O     1 
ATOM   8518  C  CB    . LYS B 2 21   ? 6.220   -44.667  1.826   1.00 86.19  ? 28   LYS B CB    1 
ATOM   8519  C  CG    . LYS B 2 21   ? 6.921   -45.376  2.970   1.00 114.34 ? 28   LYS B CG    1 
ATOM   8520  C  CD    . LYS B 2 21   ? 8.377   -45.664  2.661   1.00 126.43 ? 28   LYS B CD    1 
ATOM   8521  C  CE    . LYS B 2 21   ? 9.065   -46.320  3.853   1.00 116.70 ? 28   LYS B CE    1 
ATOM   8522  N  NZ    . LYS B 2 21   ? 8.362   -47.556  4.294   1.00 109.88 ? 28   LYS B NZ    1 
ATOM   8523  N  N     . ARG B 2 22   ? 4.903   -42.296  0.279   1.00 84.63  ? 29   ARG B N     1 
ATOM   8524  C  CA    . ARG B 2 22   ? 4.270   -41.738  -0.901  1.00 84.64  ? 29   ARG B CA    1 
ATOM   8525  C  C     . ARG B 2 22   ? 5.022   -40.502  -1.373  1.00 94.07  ? 29   ARG B C     1 
ATOM   8526  O  O     . ARG B 2 22   ? 5.191   -40.295  -2.577  1.00 99.39  ? 29   ARG B O     1 
ATOM   8527  C  CB    . ARG B 2 22   ? 2.807   -41.392  -0.641  1.00 75.12  ? 29   ARG B CB    1 
ATOM   8528  C  CG    . ARG B 2 22   ? 2.136   -40.829  -1.868  1.00 95.90  ? 29   ARG B CG    1 
ATOM   8529  C  CD    . ARG B 2 22   ? 0.656   -41.102  -1.902  1.00 92.39  ? 29   ARG B CD    1 
ATOM   8530  N  NE    . ARG B 2 22   ? 0.208   -41.447  -3.251  1.00 89.38  ? 29   ARG B NE    1 
ATOM   8531  C  CZ    . ARG B 2 22   ? -1.058  -41.674  -3.576  1.00 87.48  ? 29   ARG B CZ    1 
ATOM   8532  N  NH1   . ARG B 2 22   ? -1.382  -41.983  -4.817  1.00 101.02 ? 29   ARG B NH1   1 
ATOM   8533  N  NH2   . ARG B 2 22   ? -2.002  -41.588  -2.656  1.00 90.86  ? 29   ARG B NH2   1 
ATOM   8534  N  N     . HIS B 2 23   ? 5.478   -39.681  -0.433  1.00 80.92  ? 30   HIS B N     1 
ATOM   8535  C  CA    . HIS B 2 23   ? 6.308   -38.539  -0.798  1.00 87.99  ? 30   HIS B CA    1 
ATOM   8536  C  C     . HIS B 2 23   ? 7.650   -38.963  -1.397  1.00 101.05 ? 30   HIS B C     1 
ATOM   8537  O  O     . HIS B 2 23   ? 8.278   -38.191  -2.122  1.00 112.23 ? 30   HIS B O     1 
ATOM   8538  C  CB    . HIS B 2 23   ? 6.545   -37.637  0.411   1.00 94.59  ? 30   HIS B CB    1 
ATOM   8539  C  CG    . HIS B 2 23   ? 5.611   -36.470  0.483   1.00 93.97  ? 30   HIS B CG    1 
ATOM   8540  N  ND1   . HIS B 2 23   ? 4.554   -36.411  1.365   1.00 90.02  ? 30   HIS B ND1   1 
ATOM   8541  C  CD2   . HIS B 2 23   ? 5.571   -35.320  -0.229  1.00 101.07 ? 30   HIS B CD2   1 
ATOM   8542  C  CE1   . HIS B 2 23   ? 3.905   -35.273  1.196   1.00 90.19  ? 30   HIS B CE1   1 
ATOM   8543  N  NE2   . HIS B 2 23   ? 4.504   -34.592  0.236   1.00 99.98  ? 30   HIS B NE2   1 
ATOM   8544  N  N     . LEU B 2 24   ? 8.082   -40.187  -1.102  1.00 97.85  ? 31   LEU B N     1 
ATOM   8545  C  CA    . LEU B 2 24   ? 9.341   -40.700  -1.638  1.00 99.66  ? 31   LEU B CA    1 
ATOM   8546  C  C     . LEU B 2 24   ? 9.147   -41.409  -2.983  1.00 106.16 ? 31   LEU B C     1 
ATOM   8547  O  O     . LEU B 2 24   ? 9.450   -40.861  -4.034  1.00 116.82 ? 31   LEU B O     1 
ATOM   8548  C  CB    . LEU B 2 24   ? 9.996   -41.661  -0.647  1.00 98.41  ? 31   LEU B CB    1 
ATOM   8549  C  CG    . LEU B 2 24   ? 10.663  -41.065  0.588   1.00 106.75 ? 31   LEU B CG    1 
ATOM   8550  C  CD1   . LEU B 2 24   ? 11.230  -42.170  1.471   1.00 110.61 ? 31   LEU B CD1   1 
ATOM   8551  C  CD2   . LEU B 2 24   ? 11.751  -40.081  0.194   1.00 107.18 ? 31   LEU B CD2   1 
ATOM   8552  N  N     . THR B 2 25   ? 8.652   -42.640  -2.925  1.00 107.62 ? 32   THR B N     1 
ATOM   8553  C  CA    . THR B 2 25   ? 8.422   -43.458  -4.097  1.00 99.16  ? 32   THR B CA    1 
ATOM   8554  C  C     . THR B 2 25   ? 7.337   -42.862  -4.977  1.00 107.42 ? 32   THR B C     1 
ATOM   8555  O  O     . THR B 2 25   ? 7.566   -42.564  -6.152  1.00 124.46 ? 32   THR B O     1 
ATOM   8556  C  CB    . THR B 2 25   ? 8.009   -44.885  -3.706  1.00 102.58 ? 32   THR B CB    1 
ATOM   8557  O  OG1   . THR B 2 25   ? 6.611   -44.918  -3.396  1.00 100.78 ? 32   THR B OG1   1 
ATOM   8558  C  CG2   . THR B 2 25   ? 8.814   -45.386  -2.531  1.00 102.41 ? 32   THR B CG2   1 
ATOM   8559  N  N     . GLY B 2 26   ? 6.151   -42.702  -4.403  1.00 102.80 ? 33   GLY B N     1 
ATOM   8560  C  CA    . GLY B 2 26   ? 5.001   -42.223  -5.140  1.00 102.86 ? 33   GLY B CA    1 
ATOM   8561  C  C     . GLY B 2 26   ? 3.848   -43.186  -4.986  1.00 99.51  ? 33   GLY B C     1 
ATOM   8562  O  O     . GLY B 2 26   ? 2.717   -42.885  -5.356  1.00 99.22  ? 33   GLY B O     1 
ATOM   8563  N  N     . GLU B 2 27   ? 4.142   -44.354  -4.429  1.00 98.51  ? 34   GLU B N     1 
ATOM   8564  C  CA    . GLU B 2 27   ? 3.129   -45.381  -4.232  1.00 101.00 ? 34   GLU B CA    1 
ATOM   8565  C  C     . GLU B 2 27   ? 2.347   -45.142  -2.949  1.00 99.75  ? 34   GLU B C     1 
ATOM   8566  O  O     . GLU B 2 27   ? 2.656   -44.239  -2.177  1.00 94.41  ? 34   GLU B O     1 
ATOM   8567  C  CB    . GLU B 2 27   ? 3.765   -46.773  -4.205  1.00 111.14 ? 34   GLU B CB    1 
ATOM   8568  C  CG    . GLU B 2 27   ? 4.436   -47.173  -5.517  1.00 131.73 ? 34   GLU B CG    1 
ATOM   8569  C  CD    . GLU B 2 27   ? 3.482   -47.144  -6.694  1.00 143.94 ? 34   GLU B CD    1 
ATOM   8570  O  OE1   . GLU B 2 27   ? 2.309   -47.532  -6.519  1.00 150.81 ? 34   GLU B OE1   1 
ATOM   8571  O  OE2   . GLU B 2 27   ? 3.904   -46.725  -7.791  1.00 149.60 ? 34   GLU B OE2   1 
ATOM   8572  N  N     . PHE B 2 28   ? 1.327   -45.960  -2.728  1.00 102.66 ? 35   PHE B N     1 
ATOM   8573  C  CA    . PHE B 2 28   ? 0.523   -45.867  -1.518  1.00 85.71  ? 35   PHE B CA    1 
ATOM   8574  C  C     . PHE B 2 28   ? 0.429   -47.235  -0.858  1.00 98.29  ? 35   PHE B C     1 
ATOM   8575  O  O     . PHE B 2 28   ? -0.150  -48.162  -1.417  1.00 97.78  ? 35   PHE B O     1 
ATOM   8576  C  CB    . PHE B 2 28   ? -0.870  -45.325  -1.827  1.00 71.76  ? 35   PHE B CB    1 
ATOM   8577  C  CG    . PHE B 2 28   ? -1.812  -45.389  -0.669  1.00 76.10  ? 35   PHE B CG    1 
ATOM   8578  C  CD1   . PHE B 2 28   ? -1.684  -44.507  0.386   1.00 78.82  ? 35   PHE B CD1   1 
ATOM   8579  C  CD2   . PHE B 2 28   ? -2.834  -46.325  -0.635  1.00 86.67  ? 35   PHE B CD2   1 
ATOM   8580  C  CE1   . PHE B 2 28   ? -2.557  -44.551  1.461   1.00 74.11  ? 35   PHE B CE1   1 
ATOM   8581  C  CE2   . PHE B 2 28   ? -3.707  -46.375  0.437   1.00 90.75  ? 35   PHE B CE2   1 
ATOM   8582  C  CZ    . PHE B 2 28   ? -3.564  -45.484  1.490   1.00 78.78  ? 35   PHE B CZ    1 
ATOM   8583  N  N     . GLU B 2 29   ? 0.998   -47.349  0.338   1.00 107.58 ? 36   GLU B N     1 
ATOM   8584  C  CA    . GLU B 2 29   ? 1.012   -48.620  1.054   1.00 96.22  ? 36   GLU B CA    1 
ATOM   8585  C  C     . GLU B 2 29   ? -0.356  -48.942  1.643   1.00 88.30  ? 36   GLU B C     1 
ATOM   8586  O  O     . GLU B 2 29   ? -0.959  -48.116  2.321   1.00 90.77  ? 36   GLU B O     1 
ATOM   8587  C  CB    . GLU B 2 29   ? 2.065   -48.603  2.158   1.00 94.02  ? 36   GLU B CB    1 
ATOM   8588  C  CG    . GLU B 2 29   ? 2.165   -49.911  2.914   1.00 104.91 ? 36   GLU B CG    1 
ATOM   8589  C  CD    . GLU B 2 29   ? 2.406   -51.094  2.007   1.00 121.03 ? 36   GLU B CD    1 
ATOM   8590  O  OE1   . GLU B 2 29   ? 3.451   -51.120  1.327   1.00 135.22 ? 36   GLU B OE1   1 
ATOM   8591  O  OE2   . GLU B 2 29   ? 1.545   -51.997  1.964   1.00 127.49 ? 36   GLU B OE2   1 
ATOM   8592  N  N     . LYS B 2 30   ? -0.840  -50.147  1.368   1.00 89.68  ? 37   LYS B N     1 
ATOM   8593  C  CA    . LYS B 2 30   ? -2.126  -50.605  1.873   1.00 90.13  ? 37   LYS B CA    1 
ATOM   8594  C  C     . LYS B 2 30   ? -1.988  -51.252  3.249   1.00 84.57  ? 37   LYS B C     1 
ATOM   8595  O  O     . LYS B 2 30   ? -2.937  -51.256  4.032   1.00 74.84  ? 37   LYS B O     1 
ATOM   8596  C  CB    . LYS B 2 30   ? -2.760  -51.600  0.895   1.00 100.89 ? 37   LYS B CB    1 
ATOM   8597  C  CG    . LYS B 2 30   ? -3.053  -51.051  -0.482  1.00 104.12 ? 37   LYS B CG    1 
ATOM   8598  C  CD    . LYS B 2 30   ? -4.237  -50.099  -0.455  1.00 109.93 ? 37   LYS B CD    1 
ATOM   8599  C  CE    . LYS B 2 30   ? -4.747  -49.833  -1.879  1.00 111.31 ? 37   LYS B CE    1 
ATOM   8600  N  NZ    . LYS B 2 30   ? -5.163  -51.090  -2.535  1.00 106.64 ? 37   LYS B NZ    1 
ATOM   8601  N  N     . LYS B 2 31   ? -0.806  -51.794  3.534   1.00 91.26  ? 38   LYS B N     1 
ATOM   8602  C  CA    . LYS B 2 31   ? -0.580  -52.548  4.763   1.00 103.83 ? 38   LYS B CA    1 
ATOM   8603  C  C     . LYS B 2 31   ? -0.196  -51.665  5.941   1.00 107.25 ? 38   LYS B C     1 
ATOM   8604  O  O     . LYS B 2 31   ? 0.359   -50.578  5.766   1.00 99.55  ? 38   LYS B O     1 
ATOM   8605  C  CB    . LYS B 2 31   ? 0.510   -53.600  4.558   1.00 100.08 ? 38   LYS B CB    1 
ATOM   8606  C  CG    . LYS B 2 31   ? 0.225   -54.609  3.438   1.00 82.69  ? 38   LYS B CG    1 
ATOM   8607  C  CD    . LYS B 2 31   ? 1.173   -55.791  3.518   1.00 98.91  ? 38   LYS B CD    1 
ATOM   8608  C  CE    . LYS B 2 31   ? 2.627   -55.358  3.512   1.00 104.81 ? 38   LYS B CE    1 
ATOM   8609  N  NZ    . LYS B 2 31   ? 2.976   -54.567  2.309   1.00 104.84 ? 38   LYS B NZ    1 
ATOM   8610  N  N     . TYR B 2 32   ? -0.499  -52.141  7.145   1.00 109.46 ? 39   TYR B N     1 
ATOM   8611  C  CA    . TYR B 2 32   ? -0.038  -51.482  8.366   1.00 82.65  ? 39   TYR B CA    1 
ATOM   8612  C  C     . TYR B 2 32   ? 1.082   -52.283  9.007   1.00 81.46  ? 39   TYR B C     1 
ATOM   8613  O  O     . TYR B 2 32   ? 0.834   -53.184  9.803   1.00 93.46  ? 39   TYR B O     1 
ATOM   8614  C  CB    . TYR B 2 32   ? -1.178  -51.300  9.359   1.00 67.48  ? 39   TYR B CB    1 
ATOM   8615  C  CG    . TYR B 2 32   ? -0.732  -50.633  10.650  1.00 80.28  ? 39   TYR B CG    1 
ATOM   8616  C  CD1   . TYR B 2 32   ? 0.052   -49.495  10.628  1.00 84.43  ? 39   TYR B CD1   1 
ATOM   8617  C  CD2   . TYR B 2 32   ? -1.098  -51.143  11.886  1.00 86.56  ? 39   TYR B CD2   1 
ATOM   8618  C  CE1   . TYR B 2 32   ? 0.459   -48.891  11.793  1.00 91.61  ? 39   TYR B CE1   1 
ATOM   8619  C  CE2   . TYR B 2 32   ? -0.694  -50.544  13.056  1.00 79.09  ? 39   TYR B CE2   1 
ATOM   8620  C  CZ    . TYR B 2 32   ? 0.082   -49.417  13.009  1.00 83.96  ? 39   TYR B CZ    1 
ATOM   8621  O  OH    . TYR B 2 32   ? 0.485   -48.819  14.186  1.00 83.21  ? 39   TYR B OH    1 
ATOM   8622  N  N     . VAL B 2 33   ? 2.314   -51.968  8.628   1.00 82.08  ? 40   VAL B N     1 
ATOM   8623  C  CA    . VAL B 2 33   ? 3.490   -52.556  9.254   1.00 86.51  ? 40   VAL B CA    1 
ATOM   8624  C  C     . VAL B 2 33   ? 4.122   -51.473  10.141  1.00 93.02  ? 40   VAL B C     1 
ATOM   8625  O  O     . VAL B 2 33   ? 4.806   -50.565  9.661   1.00 84.85  ? 40   VAL B O     1 
ATOM   8626  C  CB    . VAL B 2 33   ? 4.486   -53.112  8.209   1.00 87.85  ? 40   VAL B CB    1 
ATOM   8627  C  CG1   . VAL B 2 33   ? 4.633   -52.163  7.027   1.00 121.26 ? 40   VAL B CG1   1 
ATOM   8628  C  CG2   . VAL B 2 33   ? 5.834   -53.423  8.844   1.00 87.68  ? 40   VAL B CG2   1 
ATOM   8629  N  N     . ALA B 2 34   ? 3.858   -51.577  11.445  1.00 87.66  ? 41   ALA B N     1 
ATOM   8630  C  CA    . ALA B 2 34   ? 4.167   -50.514  12.403  1.00 69.93  ? 41   ALA B CA    1 
ATOM   8631  C  C     . ALA B 2 34   ? 5.655   -50.168  12.445  1.00 71.32  ? 41   ALA B C     1 
ATOM   8632  O  O     . ALA B 2 34   ? 6.524   -51.059  12.427  1.00 69.80  ? 41   ALA B O     1 
ATOM   8633  C  CB    . ALA B 2 34   ? 3.694   -50.899  13.787  1.00 62.02  ? 41   ALA B CB    1 
ATOM   8634  N  N     . THR B 2 35   ? 5.935   -48.868  12.481  1.00 67.50  ? 42   THR B N     1 
ATOM   8635  C  CA    . THR B 2 35   ? 7.297   -48.377  12.584  1.00 72.25  ? 42   THR B CA    1 
ATOM   8636  C  C     . THR B 2 35   ? 7.866   -48.791  13.931  1.00 78.61  ? 42   THR B C     1 
ATOM   8637  O  O     . THR B 2 35   ? 7.142   -48.839  14.922  1.00 95.38  ? 42   THR B O     1 
ATOM   8638  C  CB    . THR B 2 35   ? 7.356   -46.848  12.425  1.00 77.52  ? 42   THR B CB    1 
ATOM   8639  O  OG1   . THR B 2 35   ? 6.892   -46.490  11.120  1.00 92.59  ? 42   THR B OG1   1 
ATOM   8640  C  CG2   . THR B 2 35   ? 8.778   -46.336  12.601  1.00 82.32  ? 42   THR B CG2   1 
ATOM   8641  N  N     . LEU B 2 36   ? 9.153   -49.119  13.961  1.00 83.46  ? 43   LEU B N     1 
ATOM   8642  C  CA    . LEU B 2 36   ? 9.836   -49.444  15.208  1.00 79.54  ? 43   LEU B CA    1 
ATOM   8643  C  C     . LEU B 2 36   ? 10.829  -48.354  15.566  1.00 88.57  ? 43   LEU B C     1 
ATOM   8644  O  O     . LEU B 2 36   ? 11.750  -48.072  14.800  1.00 100.75 ? 43   LEU B O     1 
ATOM   8645  C  CB    . LEU B 2 36   ? 10.558  -50.778  15.100  1.00 87.05  ? 43   LEU B CB    1 
ATOM   8646  C  CG    . LEU B 2 36   ? 9.688   -51.988  14.781  1.00 101.86 ? 43   LEU B CG    1 
ATOM   8647  C  CD1   . LEU B 2 36   ? 10.549  -53.212  14.546  1.00 129.12 ? 43   LEU B CD1   1 
ATOM   8648  C  CD2   . LEU B 2 36   ? 8.729   -52.231  15.901  1.00 93.72  ? 43   LEU B CD2   1 
ATOM   8649  N  N     . GLY B 2 37   ? 10.641  -47.744  16.731  1.00 83.36  ? 44   GLY B N     1 
ATOM   8650  C  CA    . GLY B 2 37   ? 11.484  -46.643  17.163  1.00 78.61  ? 44   GLY B CA    1 
ATOM   8651  C  C     . GLY B 2 37   ? 11.395  -45.498  16.172  1.00 82.42  ? 44   GLY B C     1 
ATOM   8652  O  O     . GLY B 2 37   ? 10.455  -44.708  16.198  1.00 79.55  ? 44   GLY B O     1 
ATOM   8653  N  N     . VAL B 2 38   ? 12.364  -45.424  15.268  1.00 89.56  ? 45   VAL B N     1 
ATOM   8654  C  CA    . VAL B 2 38   ? 12.376  -44.368  14.271  1.00 80.74  ? 45   VAL B CA    1 
ATOM   8655  C  C     . VAL B 2 38   ? 12.962  -44.836  12.939  1.00 88.06  ? 45   VAL B C     1 
ATOM   8656  O  O     . VAL B 2 38   ? 13.892  -45.647  12.900  1.00 94.69  ? 45   VAL B O     1 
ATOM   8657  C  CB    . VAL B 2 38   ? 13.163  -43.137  14.785  1.00 76.02  ? 45   VAL B CB    1 
ATOM   8658  C  CG1   . VAL B 2 38   ? 14.647  -43.446  14.906  1.00 80.97  ? 45   VAL B CG1   1 
ATOM   8659  C  CG2   . VAL B 2 38   ? 12.933  -41.934  13.884  1.00 71.29  ? 45   VAL B CG2   1 
ATOM   8660  N  N     . GLU B 2 39   ? 12.377  -44.343  11.851  1.00 86.93  ? 46   GLU B N     1 
ATOM   8661  C  CA    . GLU B 2 39   ? 12.962  -44.467  10.520  1.00 93.12  ? 46   GLU B CA    1 
ATOM   8662  C  C     . GLU B 2 39   ? 13.189  -43.077  9.964   1.00 83.48  ? 46   GLU B C     1 
ATOM   8663  O  O     . GLU B 2 39   ? 12.242  -42.297  9.856   1.00 81.34  ? 46   GLU B O     1 
ATOM   8664  C  CB    . GLU B 2 39   ? 12.055  -45.254  9.573   1.00 111.42 ? 46   GLU B CB    1 
ATOM   8665  C  CG    . GLU B 2 39   ? 11.828  -46.706  9.934   1.00 121.01 ? 46   GLU B CG    1 
ATOM   8666  C  CD    . GLU B 2 39   ? 10.785  -47.340  9.042   1.00 125.90 ? 46   GLU B CD    1 
ATOM   8667  O  OE1   . GLU B 2 39   ? 10.300  -46.648  8.121   1.00 127.15 ? 46   GLU B OE1   1 
ATOM   8668  O  OE2   . GLU B 2 39   ? 10.445  -48.518  9.266   1.00 133.27 ? 46   GLU B OE2   1 
ATOM   8669  N  N     . VAL B 2 40   ? 14.426  -42.755  9.611   1.00 81.89  ? 47   VAL B N     1 
ATOM   8670  C  CA    . VAL B 2 40   ? 14.688  -41.441  9.045   1.00 95.38  ? 47   VAL B CA    1 
ATOM   8671  C  C     . VAL B 2 40   ? 14.843  -41.531  7.531   1.00 98.03  ? 47   VAL B C     1 
ATOM   8672  O  O     . VAL B 2 40   ? 15.655  -42.303  7.017   1.00 103.85 ? 47   VAL B O     1 
ATOM   8673  C  CB    . VAL B 2 40   ? 15.936  -40.784  9.673   1.00 102.34 ? 47   VAL B CB    1 
ATOM   8674  C  CG1   . VAL B 2 40   ? 17.134  -41.708  9.575   1.00 105.22 ? 47   VAL B CG1   1 
ATOM   8675  C  CG2   . VAL B 2 40   ? 16.216  -39.436  9.019   1.00 97.60  ? 47   VAL B CG2   1 
ATOM   8676  N  N     . HIS B 2 41   ? 14.037  -40.756  6.816   1.00 101.12 ? 48   HIS B N     1 
ATOM   8677  C  CA    . HIS B 2 41   ? 14.126  -40.715  5.367   1.00 101.83 ? 48   HIS B CA    1 
ATOM   8678  C  C     . HIS B 2 41   ? 14.411  -39.297  4.890   1.00 103.19 ? 48   HIS B C     1 
ATOM   8679  O  O     . HIS B 2 41   ? 13.673  -38.364  5.219   1.00 106.42 ? 48   HIS B O     1 
ATOM   8680  C  CB    . HIS B 2 41   ? 12.836  -41.231  4.724   1.00 98.77  ? 48   HIS B CB    1 
ATOM   8681  C  CG    . HIS B 2 41   ? 12.387  -42.561  5.242   1.00 96.53  ? 48   HIS B CG    1 
ATOM   8682  N  ND1   . HIS B 2 41   ? 11.278  -42.705  6.046   1.00 79.35  ? 48   HIS B ND1   1 
ATOM   8683  C  CD2   . HIS B 2 41   ? 12.884  -43.806  5.059   1.00 100.17 ? 48   HIS B CD2   1 
ATOM   8684  C  CE1   . HIS B 2 41   ? 11.120  -43.980  6.350   1.00 88.38  ? 48   HIS B CE1   1 
ATOM   8685  N  NE2   . HIS B 2 41   ? 12.082  -44.670  5.764   1.00 101.00 ? 48   HIS B NE2   1 
ATOM   8686  N  N     . PRO B 2 42   ? 15.504  -39.125  4.134   1.00 106.27 ? 49   PRO B N     1 
ATOM   8687  C  CA    . PRO B 2 42   ? 15.760  -37.871  3.422   1.00 102.93 ? 49   PRO B CA    1 
ATOM   8688  C  C     . PRO B 2 42   ? 14.723  -37.655  2.325   1.00 98.15  ? 49   PRO B C     1 
ATOM   8689  O  O     . PRO B 2 42   ? 14.411  -38.589  1.584   1.00 109.87 ? 49   PRO B O     1 
ATOM   8690  C  CB    . PRO B 2 42   ? 17.162  -38.074  2.839   1.00 107.06 ? 49   PRO B CB    1 
ATOM   8691  C  CG    . PRO B 2 42   ? 17.784  -39.122  3.697   1.00 113.95 ? 49   PRO B CG    1 
ATOM   8692  C  CD    . PRO B 2 42   ? 16.656  -40.038  4.064   1.00 115.40 ? 49   PRO B CD    1 
ATOM   8693  N  N     . LEU B 2 43   ? 14.197  -36.438  2.231   1.00 97.05  ? 50   LEU B N     1 
ATOM   8694  C  CA    . LEU B 2 43   ? 13.101  -36.132  1.320   1.00 88.75  ? 50   LEU B CA    1 
ATOM   8695  C  C     . LEU B 2 43   ? 13.290  -34.736  0.727   1.00 102.47 ? 50   LEU B C     1 
ATOM   8696  O  O     . LEU B 2 43   ? 13.218  -33.747  1.462   1.00 103.07 ? 50   LEU B O     1 
ATOM   8697  C  CB    . LEU B 2 43   ? 11.769  -36.224  2.062   1.00 74.72  ? 50   LEU B CB    1 
ATOM   8698  C  CG    . LEU B 2 43   ? 10.411  -36.361  1.367   1.00 87.77  ? 50   LEU B CG    1 
ATOM   8699  C  CD1   . LEU B 2 43   ? 9.317   -36.418  2.436   1.00 89.98  ? 50   LEU B CD1   1 
ATOM   8700  C  CD2   . LEU B 2 43   ? 10.117  -35.230  0.402   1.00 96.86  ? 50   LEU B CD2   1 
ATOM   8701  N  N     . VAL B 2 44   ? 13.516  -34.642  -0.585  1.00 92.29  ? 51   VAL B N     1 
ATOM   8702  C  CA    . VAL B 2 44   ? 13.806  -33.334  -1.173  1.00 91.10  ? 51   VAL B CA    1 
ATOM   8703  C  C     . VAL B 2 44   ? 12.631  -32.709  -1.925  1.00 97.55  ? 51   VAL B C     1 
ATOM   8704  O  O     . VAL B 2 44   ? 11.812  -33.403  -2.528  1.00 99.39  ? 51   VAL B O     1 
ATOM   8705  C  CB    . VAL B 2 44   ? 15.003  -33.399  -2.124  1.00 98.26  ? 51   VAL B CB    1 
ATOM   8706  C  CG1   . VAL B 2 44   ? 16.266  -33.749  -1.351  1.00 99.04  ? 51   VAL B CG1   1 
ATOM   8707  C  CG2   . VAL B 2 44   ? 14.751  -34.408  -3.240  1.00 124.07 ? 51   VAL B CG2   1 
ATOM   8708  N  N     . PHE B 2 45   ? 12.556  -31.382  -1.855  1.00 105.51 ? 52   PHE B N     1 
ATOM   8709  C  CA    . PHE B 2 45   ? 11.631  -30.603  -2.664  1.00 92.25  ? 52   PHE B CA    1 
ATOM   8710  C  C     . PHE B 2 45   ? 12.420  -29.551  -3.431  1.00 104.17 ? 52   PHE B C     1 
ATOM   8711  O  O     . PHE B 2 45   ? 13.433  -29.051  -2.945  1.00 109.93 ? 52   PHE B O     1 
ATOM   8712  C  CB    . PHE B 2 45   ? 10.561  -29.930  -1.803  1.00 79.06  ? 52   PHE B CB    1 
ATOM   8713  C  CG    . PHE B 2 45   ? 9.565   -30.876  -1.218  1.00 76.51  ? 52   PHE B CG    1 
ATOM   8714  C  CD1   . PHE B 2 45   ? 8.585   -31.448  -2.011  1.00 74.49  ? 52   PHE B CD1   1 
ATOM   8715  C  CD2   . PHE B 2 45   ? 9.592   -31.176  0.137   1.00 77.12  ? 52   PHE B CD2   1 
ATOM   8716  C  CE1   . PHE B 2 45   ? 7.656   -32.314  -1.468  1.00 82.64  ? 52   PHE B CE1   1 
ATOM   8717  C  CE2   . PHE B 2 45   ? 8.665   -32.044  0.691   1.00 69.30  ? 52   PHE B CE2   1 
ATOM   8718  C  CZ    . PHE B 2 45   ? 7.695   -32.612  -0.105  1.00 82.85  ? 52   PHE B CZ    1 
ATOM   8719  N  N     . HIS B 2 46   ? 11.955  -29.212  -4.628  1.00 107.73 ? 53   HIS B N     1 
ATOM   8720  C  CA    . HIS B 2 46   ? 12.598  -28.161  -5.400  1.00 107.33 ? 53   HIS B CA    1 
ATOM   8721  C  C     . HIS B 2 46   ? 11.774  -26.884  -5.325  1.00 115.26 ? 53   HIS B C     1 
ATOM   8722  O  O     . HIS B 2 46   ? 10.629  -26.846  -5.770  1.00 127.15 ? 53   HIS B O     1 
ATOM   8723  C  CB    . HIS B 2 46   ? 12.793  -28.601  -6.849  1.00 117.16 ? 53   HIS B CB    1 
ATOM   8724  C  CG    . HIS B 2 46   ? 13.604  -29.850  -6.990  1.00 129.24 ? 53   HIS B CG    1 
ATOM   8725  N  ND1   . HIS B 2 46   ? 13.033  -31.087  -7.194  1.00 135.25 ? 53   HIS B ND1   1 
ATOM   8726  C  CD2   . HIS B 2 46   ? 14.942  -30.056  -6.944  1.00 136.11 ? 53   HIS B CD2   1 
ATOM   8727  C  CE1   . HIS B 2 46   ? 13.984  -32.000  -7.274  1.00 143.36 ? 53   HIS B CE1   1 
ATOM   8728  N  NE2   . HIS B 2 46   ? 15.151  -31.400  -7.126  1.00 143.05 ? 53   HIS B NE2   1 
ATOM   8729  N  N     . THR B 2 47   ? 12.360  -25.843  -4.743  1.00 115.00 ? 54   THR B N     1 
ATOM   8730  C  CA    . THR B 2 47   ? 11.673  -24.566  -4.585  1.00 118.41 ? 54   THR B CA    1 
ATOM   8731  C  C     . THR B 2 47   ? 12.171  -23.546  -5.607  1.00 123.10 ? 54   THR B C     1 
ATOM   8732  O  O     . THR B 2 47   ? 13.227  -23.728  -6.214  1.00 119.66 ? 54   THR B O     1 
ATOM   8733  C  CB    . THR B 2 47   ? 11.864  -23.990  -3.170  1.00 119.48 ? 54   THR B CB    1 
ATOM   8734  O  OG1   . THR B 2 47   ? 13.161  -23.387  -3.065  1.00 133.01 ? 54   THR B OG1   1 
ATOM   8735  C  CG2   . THR B 2 47   ? 11.731  -25.086  -2.129  1.00 110.04 ? 54   THR B CG2   1 
ATOM   8736  N  N     . ASN B 2 48   ? 11.410  -22.468  -5.776  1.00 125.54 ? 55   ASN B N     1 
ATOM   8737  C  CA    . ASN B 2 48   ? 11.775  -21.404  -6.696  1.00 137.29 ? 55   ASN B CA    1 
ATOM   8738  C  C     . ASN B 2 48   ? 13.089  -20.733  -6.306  1.00 145.59 ? 55   ASN B C     1 
ATOM   8739  O  O     . ASN B 2 48   ? 13.715  -20.043  -7.126  1.00 161.13 ? 55   ASN B O     1 
ATOM   8740  C  CB    . ASN B 2 48   ? 10.658  -20.360  -6.777  1.00 143.41 ? 55   ASN B CB    1 
ATOM   8741  C  CG    . ASN B 2 48   ? 10.355  -19.717  -5.438  1.00 147.04 ? 55   ASN B CG    1 
ATOM   8742  O  OD1   . ASN B 2 48   ? 10.981  -20.030  -4.428  1.00 153.08 ? 55   ASN B OD1   1 
ATOM   8743  N  ND2   . ASN B 2 48   ? 9.393   -18.801  -5.428  1.00 148.17 ? 55   ASN B ND2   1 
ATOM   8744  N  N     . ARG B 2 49   ? 13.499  -20.938  -5.055  1.00 137.27 ? 56   ARG B N     1 
ATOM   8745  C  CA    . ARG B 2 49   ? 14.756  -20.398  -4.557  1.00 143.77 ? 56   ARG B CA    1 
ATOM   8746  C  C     . ARG B 2 49   ? 15.815  -21.481  -4.382  1.00 139.16 ? 56   ARG B C     1 
ATOM   8747  O  O     . ARG B 2 49   ? 16.750  -21.321  -3.601  1.00 151.49 ? 56   ARG B O     1 
ATOM   8748  C  CB    . ARG B 2 49   ? 14.533  -19.670  -3.233  1.00 146.08 ? 56   ARG B CB    1 
ATOM   8749  C  CG    . ARG B 2 49   ? 13.861  -18.319  -3.380  1.00 154.85 ? 56   ARG B CG    1 
ATOM   8750  C  CD    . ARG B 2 49   ? 13.660  -17.642  -2.037  1.00 158.43 ? 56   ARG B CD    1 
ATOM   8751  N  NE    . ARG B 2 49   ? 14.901  -17.487  -1.285  1.00 166.15 ? 56   ARG B NE    1 
ATOM   8752  C  CZ    . ARG B 2 49   ? 15.021  -16.735  -0.193  1.00 166.01 ? 56   ARG B CZ    1 
ATOM   8753  N  NH1   . ARG B 2 49   ? 13.976  -16.060  0.269   1.00 159.68 ? 56   ARG B NH1   1 
ATOM   8754  N  NH2   . ARG B 2 49   ? 16.187  -16.653  0.433   1.00 170.67 ? 56   ARG B NH2   1 
ATOM   8755  N  N     . GLY B 2 50   ? 15.667  -22.583  -5.110  1.00 131.41 ? 57   GLY B N     1 
ATOM   8756  C  CA    . GLY B 2 50   ? 16.624  -23.672  -5.038  1.00 122.57 ? 57   GLY B CA    1 
ATOM   8757  C  C     . GLY B 2 50   ? 16.068  -24.871  -4.295  1.00 118.11 ? 57   GLY B C     1 
ATOM   8758  O  O     . GLY B 2 50   ? 14.922  -24.852  -3.860  1.00 105.89 ? 57   GLY B O     1 
ATOM   8759  N  N     . PRO B 2 51   ? 16.882  -25.924  -4.137  1.00 122.34 ? 58   PRO B N     1 
ATOM   8760  C  CA    . PRO B 2 51   ? 16.426  -27.163  -3.500  1.00 119.48 ? 58   PRO B CA    1 
ATOM   8761  C  C     . PRO B 2 51   ? 16.347  -27.056  -1.981  1.00 119.69 ? 58   PRO B C     1 
ATOM   8762  O  O     . PRO B 2 51   ? 16.960  -26.170  -1.390  1.00 130.46 ? 58   PRO B O     1 
ATOM   8763  C  CB    . PRO B 2 51   ? 17.496  -28.170  -3.909  1.00 125.07 ? 58   PRO B CB    1 
ATOM   8764  C  CG    . PRO B 2 51   ? 18.733  -27.350  -4.006  1.00 139.55 ? 58   PRO B CG    1 
ATOM   8765  C  CD    . PRO B 2 51   ? 18.296  -26.006  -4.543  1.00 140.59 ? 58   PRO B CD    1 
ATOM   8766  N  N     . ILE B 2 52   ? 15.593  -27.957  -1.362  1.00 113.32 ? 59   ILE B N     1 
ATOM   8767  C  CA    . ILE B 2 52   ? 15.507  -28.017  0.095   1.00 115.78 ? 59   ILE B CA    1 
ATOM   8768  C  C     . ILE B 2 52   ? 15.290  -29.465  0.556   1.00 107.31 ? 59   ILE B C     1 
ATOM   8769  O  O     . ILE B 2 52   ? 14.499  -30.210  -0.031  1.00 119.40 ? 59   ILE B O     1 
ATOM   8770  C  CB    . ILE B 2 52   ? 14.379  -27.107  0.639   1.00 115.58 ? 59   ILE B CB    1 
ATOM   8771  C  CG1   . ILE B 2 52   ? 14.391  -27.089  2.164   1.00 121.87 ? 59   ILE B CG1   1 
ATOM   8772  C  CG2   . ILE B 2 52   ? 13.015  -27.554  0.135   1.00 114.67 ? 59   ILE B CG2   1 
ATOM   8773  C  CD1   . ILE B 2 52   ? 13.302  -26.228  2.759   1.00 125.67 ? 59   ILE B CD1   1 
ATOM   8774  N  N     . LYS B 2 53   ? 16.011  -29.870  1.595   1.00 99.23  ? 60   LYS B N     1 
ATOM   8775  C  CA    . LYS B 2 53   ? 15.940  -31.247  2.063   1.00 94.51  ? 60   LYS B CA    1 
ATOM   8776  C  C     . LYS B 2 53   ? 15.335  -31.340  3.454   1.00 93.23  ? 60   LYS B C     1 
ATOM   8777  O  O     . LYS B 2 53   ? 15.754  -30.645  4.375   1.00 87.48  ? 60   LYS B O     1 
ATOM   8778  C  CB    . LYS B 2 53   ? 17.329  -31.883  2.059   1.00 99.82  ? 60   LYS B CB    1 
ATOM   8779  C  CG    . LYS B 2 53   ? 17.323  -33.390  2.270   1.00 103.36 ? 60   LYS B CG    1 
ATOM   8780  C  CD    . LYS B 2 53   ? 18.738  -33.956  2.250   1.00 120.59 ? 60   LYS B CD    1 
ATOM   8781  C  CE    . LYS B 2 53   ? 18.806  -35.241  1.441   1.00 140.78 ? 60   LYS B CE    1 
ATOM   8782  N  NZ    . LYS B 2 53   ? 20.160  -35.863  1.475   1.00 156.47 ? 60   LYS B NZ    1 
ATOM   8783  N  N     . PHE B 2 54   ? 14.330  -32.195  3.588   1.00 92.04  ? 61   PHE B N     1 
ATOM   8784  C  CA    . PHE B 2 54   ? 13.733  -32.521  4.878   1.00 76.05  ? 61   PHE B CA    1 
ATOM   8785  C  C     . PHE B 2 54   ? 14.193  -33.898  5.323   1.00 91.80  ? 61   PHE B C     1 
ATOM   8786  O  O     . PHE B 2 54   ? 13.911  -34.893  4.657   1.00 100.03 ? 61   PHE B O     1 
ATOM   8787  C  CB    . PHE B 2 54   ? 12.212  -32.503  4.805   1.00 65.85  ? 61   PHE B CB    1 
ATOM   8788  C  CG    . PHE B 2 54   ? 11.615  -31.135  4.881   1.00 83.02  ? 61   PHE B CG    1 
ATOM   8789  C  CD1   . PHE B 2 54   ? 11.494  -30.483  6.107   1.00 80.91  ? 61   PHE B CD1   1 
ATOM   8790  C  CD2   . PHE B 2 54   ? 11.142  -30.504  3.738   1.00 78.52  ? 61   PHE B CD2   1 
ATOM   8791  C  CE1   . PHE B 2 54   ? 10.934  -29.221  6.184   1.00 76.57  ? 61   PHE B CE1   1 
ATOM   8792  C  CE2   . PHE B 2 54   ? 10.577  -29.242  3.814   1.00 85.46  ? 61   PHE B CE2   1 
ATOM   8793  C  CZ    . PHE B 2 54   ? 10.478  -28.601  5.033   1.00 90.54  ? 61   PHE B CZ    1 
ATOM   8794  N  N     . ASN B 2 55   ? 14.905  -33.971  6.440   1.00 99.49  ? 62   ASN B N     1 
ATOM   8795  C  CA    . ASN B 2 55   ? 15.224  -35.271  7.019   1.00 93.86  ? 62   ASN B CA    1 
ATOM   8796  C  C     . ASN B 2 55   ? 14.105  -35.705  7.952   1.00 87.45  ? 62   ASN B C     1 
ATOM   8797  O  O     . ASN B 2 55   ? 14.061  -35.299  9.116   1.00 80.61  ? 62   ASN B O     1 
ATOM   8798  C  CB    . ASN B 2 55   ? 16.554  -35.227  7.750   1.00 84.80  ? 62   ASN B CB    1 
ATOM   8799  C  CG    . ASN B 2 55   ? 17.727  -35.261  6.804   1.00 87.90  ? 62   ASN B CG    1 
ATOM   8800  O  OD1   . ASN B 2 55   ? 18.314  -34.227  6.485   1.00 91.52  ? 62   ASN B OD1   1 
ATOM   8801  N  ND2   . ASN B 2 55   ? 18.074  -36.457  6.339   1.00 96.64  ? 62   ASN B ND2   1 
ATOM   8802  N  N     . VAL B 2 56   ? 13.188  -36.514  7.426   1.00 86.75  ? 63   VAL B N     1 
ATOM   8803  C  CA    . VAL B 2 56   ? 11.980  -36.865  8.165   1.00 78.06  ? 63   VAL B CA    1 
ATOM   8804  C  C     . VAL B 2 56   ? 12.222  -38.012  9.129   1.00 83.78  ? 63   VAL B C     1 
ATOM   8805  O  O     . VAL B 2 56   ? 12.559  -39.127  8.703   1.00 78.28  ? 63   VAL B O     1 
ATOM   8806  C  CB    . VAL B 2 56   ? 10.833  -37.255  7.228   1.00 79.06  ? 63   VAL B CB    1 
ATOM   8807  C  CG1   . VAL B 2 56   ? 9.583   -37.568  8.035   1.00 58.21  ? 63   VAL B CG1   1 
ATOM   8808  C  CG2   . VAL B 2 56   ? 10.562  -36.138  6.224   1.00 88.96  ? 63   VAL B CG2   1 
ATOM   8809  N  N     . TRP B 2 57   ? 12.050  -37.726  10.419  1.00 84.77  ? 64   TRP B N     1 
ATOM   8810  C  CA    . TRP B 2 57   ? 12.147  -38.740  11.453  1.00 69.20  ? 64   TRP B CA    1 
ATOM   8811  C  C     . TRP B 2 57   ? 10.769  -39.347  11.705  1.00 76.73  ? 64   TRP B C     1 
ATOM   8812  O  O     . TRP B 2 57   ? 10.035  -38.932  12.605  1.00 71.17  ? 64   TRP B O     1 
ATOM   8813  C  CB    . TRP B 2 57   ? 12.726  -38.146  12.732  1.00 64.46  ? 64   TRP B CB    1 
ATOM   8814  C  CG    . TRP B 2 57   ? 14.184  -37.797  12.625  1.00 70.14  ? 64   TRP B CG    1 
ATOM   8815  C  CD1   . TRP B 2 57   ? 14.753  -36.923  11.750  1.00 68.40  ? 64   TRP B CD1   1 
ATOM   8816  C  CD2   . TRP B 2 57   ? 15.254  -38.296  13.444  1.00 80.38  ? 64   TRP B CD2   1 
ATOM   8817  N  NE1   . TRP B 2 57   ? 16.113  -36.859  11.956  1.00 74.46  ? 64   TRP B NE1   1 
ATOM   8818  C  CE2   . TRP B 2 57   ? 16.444  -37.695  12.989  1.00 81.94  ? 64   TRP B CE2   1 
ATOM   8819  C  CE3   . TRP B 2 57   ? 15.322  -39.199  14.510  1.00 78.27  ? 64   TRP B CE3   1 
ATOM   8820  C  CZ2   . TRP B 2 57   ? 17.685  -37.965  13.564  1.00 91.11  ? 64   TRP B CZ2   1 
ATOM   8821  C  CZ3   . TRP B 2 57   ? 16.556  -39.470  15.075  1.00 80.61  ? 64   TRP B CZ3   1 
ATOM   8822  C  CH2   . TRP B 2 57   ? 17.719  -38.854  14.603  1.00 90.72  ? 64   TRP B CH2   1 
ATOM   8823  N  N     . ASP B 2 58   ? 10.416  -40.317  10.870  1.00 92.07  ? 65   ASP B N     1 
ATOM   8824  C  CA    . ASP B 2 58   ? 9.185   -41.086  11.008  1.00 93.00  ? 65   ASP B CA    1 
ATOM   8825  C  C     . ASP B 2 58   ? 9.249   -41.930  12.287  1.00 91.24  ? 65   ASP B C     1 
ATOM   8826  O  O     . ASP B 2 58   ? 9.843   -43.012  12.300  1.00 92.89  ? 65   ASP B O     1 
ATOM   8827  C  CB    . ASP B 2 58   ? 8.981   -41.967  9.763   1.00 90.81  ? 65   ASP B CB    1 
ATOM   8828  C  CG    . ASP B 2 58   ? 7.745   -42.842  9.847   1.00 103.36 ? 65   ASP B CG    1 
ATOM   8829  O  OD1   . ASP B 2 58   ? 6.811   -42.498  10.609  1.00 118.92 ? 65   ASP B OD1   1 
ATOM   8830  O  OD2   . ASP B 2 58   ? 7.708   -43.874  9.135   1.00 93.68  ? 65   ASP B OD2   1 
ATOM   8831  N  N     . THR B 2 59   ? 8.648   -41.425  13.361  1.00 75.41  ? 66   THR B N     1 
ATOM   8832  C  CA    . THR B 2 59   ? 8.684   -42.099  14.657  1.00 67.79  ? 66   THR B CA    1 
ATOM   8833  C  C     . THR B 2 59   ? 7.526   -43.068  14.834  1.00 64.28  ? 66   THR B C     1 
ATOM   8834  O  O     . THR B 2 59   ? 6.497   -42.952  14.175  1.00 72.95  ? 66   THR B O     1 
ATOM   8835  C  CB    . THR B 2 59   ? 8.648   -41.089  15.835  1.00 64.87  ? 66   THR B CB    1 
ATOM   8836  O  OG1   . THR B 2 59   ? 7.403   -40.375  15.828  1.00 72.18  ? 66   THR B OG1   1 
ATOM   8837  C  CG2   . THR B 2 59   ? 9.807   -40.105  15.756  1.00 62.77  ? 66   THR B CG2   1 
ATOM   8838  N  N     . ALA B 2 60   ? 7.702   -44.020  15.741  1.00 64.43  ? 67   ALA B N     1 
ATOM   8839  C  CA    . ALA B 2 60   ? 6.662   -44.993  16.058  1.00 68.67  ? 67   ALA B CA    1 
ATOM   8840  C  C     . ALA B 2 60   ? 5.632   -44.424  17.028  1.00 70.29  ? 67   ALA B C     1 
ATOM   8841  O  O     . ALA B 2 60   ? 5.985   -43.814  18.031  1.00 79.18  ? 67   ALA B O     1 
ATOM   8842  C  CB    . ALA B 2 60   ? 7.283   -46.260  16.632  1.00 66.78  ? 67   ALA B CB    1 
ATOM   8843  N  N     . GLY B 2 61   ? 4.358   -44.638  16.721  1.00 77.13  ? 68   GLY B N     1 
ATOM   8844  C  CA    . GLY B 2 61   ? 3.267   -44.113  17.519  1.00 71.43  ? 68   GLY B CA    1 
ATOM   8845  C  C     . GLY B 2 61   ? 2.650   -45.138  18.464  1.00 78.42  ? 68   GLY B C     1 
ATOM   8846  O  O     . GLY B 2 61   ? 1.719   -44.819  19.210  1.00 82.25  ? 68   GLY B O     1 
ATOM   8847  N  N     . LEU B 2 62   ? 3.138   -46.375  18.421  1.00 78.63  ? 69   LEU B N     1 
ATOM   8848  C  CA    . LEU B 2 62   ? 2.697   -47.392  19.360  1.00 82.90  ? 69   LEU B CA    1 
ATOM   8849  C  C     . LEU B 2 62   ? 3.581   -47.345  20.600  1.00 88.12  ? 69   LEU B C     1 
ATOM   8850  O  O     . LEU B 2 62   ? 4.814   -47.371  20.493  1.00 98.82  ? 69   LEU B O     1 
ATOM   8851  C  CB    . LEU B 2 62   ? 2.749   -48.780  18.730  1.00 94.45  ? 69   LEU B CB    1 
ATOM   8852  C  CG    . LEU B 2 62   ? 1.632   -49.180  17.774  1.00 82.29  ? 69   LEU B CG    1 
ATOM   8853  C  CD1   . LEU B 2 62   ? 1.990   -50.499  17.105  1.00 91.01  ? 69   LEU B CD1   1 
ATOM   8854  C  CD2   . LEU B 2 62   ? 0.311   -49.307  18.496  1.00 77.74  ? 69   LEU B CD2   1 
ATOM   8855  N  N     . GLU B 2 63   ? 2.954   -47.295  21.774  1.00 78.45  ? 70   GLU B N     1 
ATOM   8856  C  CA    . GLU B 2 63   ? 3.690   -47.172  23.025  1.00 76.36  ? 70   GLU B CA    1 
ATOM   8857  C  C     . GLU B 2 63   ? 4.664   -48.321  23.137  1.00 78.49  ? 70   GLU B C     1 
ATOM   8858  O  O     . GLU B 2 63   ? 5.798   -48.148  23.567  1.00 88.74  ? 70   GLU B O     1 
ATOM   8859  C  CB    . GLU B 2 63   ? 2.722   -47.138  24.214  1.00 91.90  ? 70   GLU B CB    1 
ATOM   8860  C  CG    . GLU B 2 63   ? 3.371   -46.915  25.563  1.00 114.28 ? 70   GLU B CG    1 
ATOM   8861  C  CD    . GLU B 2 63   ? 2.358   -46.831  26.686  1.00 131.12 ? 70   GLU B CD    1 
ATOM   8862  O  OE1   . GLU B 2 63   ? 1.237   -46.345  26.437  1.00 132.49 ? 70   GLU B OE1   1 
ATOM   8863  O  OE2   . GLU B 2 63   ? 2.675   -47.258  27.816  1.00 143.12 ? 70   GLU B OE2   1 
ATOM   8864  N  N     . LYS B 2 64   ? 4.206   -49.492  22.715  1.00 75.45  ? 71   LYS B N     1 
ATOM   8865  C  CA    . LYS B 2 64   ? 5.010   -50.713  22.727  1.00 92.70  ? 71   LYS B CA    1 
ATOM   8866  C  C     . LYS B 2 64   ? 6.322   -50.552  21.954  1.00 96.27  ? 71   LYS B C     1 
ATOM   8867  O  O     . LYS B 2 64   ? 7.359   -51.073  22.358  1.00 95.46  ? 71   LYS B O     1 
ATOM   8868  C  CB    . LYS B 2 64   ? 4.194   -51.870  22.140  1.00 106.46 ? 71   LYS B CB    1 
ATOM   8869  C  CG    . LYS B 2 64   ? 4.910   -53.183  22.055  1.00 115.23 ? 71   LYS B CG    1 
ATOM   8870  C  CD    . LYS B 2 64   ? 3.915   -54.311  21.851  1.00 131.77 ? 71   LYS B CD    1 
ATOM   8871  C  CE    . LYS B 2 64   ? 2.883   -54.329  22.965  1.00 144.59 ? 71   LYS B CE    1 
ATOM   8872  N  NZ    . LYS B 2 64   ? 1.933   -55.468  22.844  1.00 159.70 ? 71   LYS B NZ    1 
ATOM   8873  N  N     . PHE B 2 65   ? 6.264   -49.822  20.842  1.00 102.51 ? 72   PHE B N     1 
ATOM   8874  C  CA    . PHE B 2 65   ? 7.428   -49.640  19.984  1.00 94.87  ? 72   PHE B CA    1 
ATOM   8875  C  C     . PHE B 2 65   ? 7.955   -48.217  20.031  1.00 92.99  ? 72   PHE B C     1 
ATOM   8876  O  O     . PHE B 2 65   ? 8.658   -47.788  19.120  1.00 100.58 ? 72   PHE B O     1 
ATOM   8877  C  CB    . PHE B 2 65   ? 7.085   -50.002  18.541  1.00 83.52  ? 72   PHE B CB    1 
ATOM   8878  C  CG    . PHE B 2 65   ? 6.661   -51.428  18.356  1.00 81.18  ? 72   PHE B CG    1 
ATOM   8879  C  CD1   . PHE B 2 65   ? 7.343   -52.459  18.980  1.00 84.55  ? 72   PHE B CD1   1 
ATOM   8880  C  CD2   . PHE B 2 65   ? 5.577   -51.737  17.556  1.00 77.26  ? 72   PHE B CD2   1 
ATOM   8881  C  CE1   . PHE B 2 65   ? 6.955   -53.764  18.802  1.00 91.49  ? 72   PHE B CE1   1 
ATOM   8882  C  CE2   . PHE B 2 65   ? 5.183   -53.047  17.383  1.00 82.74  ? 72   PHE B CE2   1 
ATOM   8883  C  CZ    . PHE B 2 65   ? 5.872   -54.057  18.006  1.00 93.18  ? 72   PHE B CZ    1 
ATOM   8884  N  N     . GLY B 2 66   ? 7.610   -47.494  21.091  1.00 90.08  ? 73   GLY B N     1 
ATOM   8885  C  CA    . GLY B 2 66   ? 7.965   -46.092  21.218  1.00 91.83  ? 73   GLY B CA    1 
ATOM   8886  C  C     . GLY B 2 66   ? 9.433   -45.795  20.997  1.00 82.75  ? 73   GLY B C     1 
ATOM   8887  O  O     . GLY B 2 66   ? 9.789   -44.800  20.376  1.00 92.91  ? 73   GLY B O     1 
ATOM   8888  N  N     . GLY B 2 67   ? 10.289  -46.670  21.503  1.00 75.58  ? 74   GLY B N     1 
ATOM   8889  C  CA    . GLY B 2 67   ? 11.719  -46.510  21.349  1.00 84.77  ? 74   GLY B CA    1 
ATOM   8890  C  C     . GLY B 2 67   ? 12.314  -45.476  22.281  1.00 90.72  ? 74   GLY B C     1 
ATOM   8891  O  O     . GLY B 2 67   ? 12.123  -45.535  23.497  1.00 100.95 ? 74   GLY B O     1 
ATOM   8892  N  N     . LEU B 2 68   ? 13.036  -44.521  21.706  1.00 90.41  ? 75   LEU B N     1 
ATOM   8893  C  CA    . LEU B 2 68   ? 13.686  -43.474  22.483  1.00 85.82  ? 75   LEU B CA    1 
ATOM   8894  C  C     . LEU B 2 68   ? 12.745  -42.329  22.783  1.00 76.70  ? 75   LEU B C     1 
ATOM   8895  O  O     . LEU B 2 68   ? 13.066  -41.429  23.556  1.00 78.97  ? 75   LEU B O     1 
ATOM   8896  C  CB    . LEU B 2 68   ? 14.901  -42.943  21.747  1.00 76.82  ? 75   LEU B CB    1 
ATOM   8897  C  CG    . LEU B 2 68   ? 15.948  -44.016  21.528  1.00 83.06  ? 75   LEU B CG    1 
ATOM   8898  C  CD1   . LEU B 2 68   ? 17.009  -43.435  20.699  1.00 86.55  ? 75   LEU B CD1   1 
ATOM   8899  C  CD2   . LEU B 2 68   ? 16.514  -44.470  22.851  1.00 77.10  ? 75   LEU B CD2   1 
ATOM   8900  N  N     . ARG B 2 69   ? 11.581  -42.370  22.150  1.00 68.24  ? 76   ARG B N     1 
ATOM   8901  C  CA    . ARG B 2 69   ? 10.567  -41.348  22.338  1.00 73.37  ? 76   ARG B CA    1 
ATOM   8902  C  C     . ARG B 2 69   ? 11.107  -39.942  22.083  1.00 82.07  ? 76   ARG B C     1 
ATOM   8903  O  O     . ARG B 2 69   ? 11.579  -39.629  20.982  1.00 91.25  ? 76   ARG B O     1 
ATOM   8904  C  CB    . ARG B 2 69   ? 9.975   -41.463  23.732  1.00 82.05  ? 76   ARG B CB    1 
ATOM   8905  C  CG    . ARG B 2 69   ? 8.765   -42.367  23.762  1.00 82.95  ? 76   ARG B CG    1 
ATOM   8906  C  CD    . ARG B 2 69   ? 8.860   -43.433  24.840  1.00 109.53 ? 76   ARG B CD    1 
ATOM   8907  N  NE    . ARG B 2 69   ? 7.946   -44.527  24.532  1.00 113.80 ? 76   ARG B NE    1 
ATOM   8908  C  CZ    . ARG B 2 69   ? 8.062   -45.756  25.017  1.00 122.33 ? 76   ARG B CZ    1 
ATOM   8909  N  NH1   . ARG B 2 69   ? 9.055   -46.055  25.844  1.00 130.93 ? 76   ARG B NH1   1 
ATOM   8910  N  NH2   . ARG B 2 69   ? 7.185   -46.684  24.671  1.00 132.68 ? 76   ARG B NH2   1 
ATOM   8911  N  N     . ASP B 2 70   ? 11.046  -39.092  23.105  1.00 86.64  ? 77   ASP B N     1 
ATOM   8912  C  CA    . ASP B 2 70   ? 11.484  -37.714  22.940  1.00 88.55  ? 77   ASP B CA    1 
ATOM   8913  C  C     . ASP B 2 70   ? 12.936  -37.638  22.561  1.00 91.79  ? 77   ASP B C     1 
ATOM   8914  O  O     . ASP B 2 70   ? 13.328  -36.660  21.970  1.00 106.23 ? 77   ASP B O     1 
ATOM   8915  C  CB    . ASP B 2 70   ? 11.277  -36.888  24.206  1.00 90.31  ? 77   ASP B CB    1 
ATOM   8916  C  CG    . ASP B 2 70   ? 11.520  -37.688  25.463  1.00 103.85 ? 77   ASP B CG    1 
ATOM   8917  O  OD1   . ASP B 2 70   ? 11.051  -38.844  25.511  1.00 111.97 ? 77   ASP B OD1   1 
ATOM   8918  O  OD2   . ASP B 2 70   ? 12.182  -37.181  26.395  1.00 91.27  ? 77   ASP B OD2   1 
ATOM   8919  N  N     . GLY B 2 71   ? 13.737  -38.641  22.914  1.00 80.92  ? 78   GLY B N     1 
ATOM   8920  C  CA    . GLY B 2 71   ? 15.127  -38.671  22.482  1.00 95.80  ? 78   GLY B CA    1 
ATOM   8921  C  C     . GLY B 2 71   ? 15.286  -38.314  21.006  1.00 88.38  ? 78   GLY B C     1 
ATOM   8922  O  O     . GLY B 2 71   ? 16.256  -37.655  20.626  1.00 86.97  ? 78   GLY B O     1 
ATOM   8923  N  N     . TYR B 2 72   ? 14.310  -38.714  20.192  1.00 75.35  ? 79   TYR B N     1 
ATOM   8924  C  CA    . TYR B 2 72   ? 14.319  -38.425  18.755  1.00 86.31  ? 79   TYR B CA    1 
ATOM   8925  C  C     . TYR B 2 72   ? 14.118  -36.940  18.402  1.00 90.34  ? 79   TYR B C     1 
ATOM   8926  O  O     . TYR B 2 72   ? 14.434  -36.504  17.294  1.00 105.79 ? 79   TYR B O     1 
ATOM   8927  C  CB    . TYR B 2 72   ? 13.234  -39.248  18.054  1.00 79.50  ? 79   TYR B CB    1 
ATOM   8928  C  CG    . TYR B 2 72   ? 13.355  -40.750  18.227  1.00 75.92  ? 79   TYR B CG    1 
ATOM   8929  C  CD1   . TYR B 2 72   ? 14.589  -41.379  18.173  1.00 74.22  ? 79   TYR B CD1   1 
ATOM   8930  C  CD2   . TYR B 2 72   ? 12.228  -41.537  18.439  1.00 68.00  ? 79   TYR B CD2   1 
ATOM   8931  C  CE1   . TYR B 2 72   ? 14.696  -42.747  18.316  1.00 82.28  ? 79   TYR B CE1   1 
ATOM   8932  C  CE2   . TYR B 2 72   ? 12.324  -42.899  18.593  1.00 69.20  ? 79   TYR B CE2   1 
ATOM   8933  C  CZ    . TYR B 2 72   ? 13.562  -43.508  18.534  1.00 78.32  ? 79   TYR B CZ    1 
ATOM   8934  O  OH    . TYR B 2 72   ? 13.671  -44.880  18.690  1.00 71.16  ? 79   TYR B OH    1 
ATOM   8935  N  N     . TYR B 2 73   ? 13.580  -36.180  19.351  1.00 75.36  ? 80   TYR B N     1 
ATOM   8936  C  CA    . TYR B 2 73   ? 13.180  -34.786  19.169  1.00 80.20  ? 80   TYR B CA    1 
ATOM   8937  C  C     . TYR B 2 73   ? 14.347  -33.812  19.316  1.00 75.89  ? 80   TYR B C     1 
ATOM   8938  O  O     . TYR B 2 73   ? 14.225  -32.645  18.966  1.00 76.55  ? 80   TYR B O     1 
ATOM   8939  C  CB    . TYR B 2 73   ? 12.083  -34.399  20.178  1.00 82.90  ? 80   TYR B CB    1 
ATOM   8940  C  CG    . TYR B 2 73   ? 10.830  -35.260  20.143  1.00 82.80  ? 80   TYR B CG    1 
ATOM   8941  C  CD1   . TYR B 2 73   ? 10.601  -36.162  19.107  1.00 68.51  ? 80   TYR B CD1   1 
ATOM   8942  C  CD2   . TYR B 2 73   ? 9.865   -35.158  21.146  1.00 78.72  ? 80   TYR B CD2   1 
ATOM   8943  C  CE1   . TYR B 2 73   ? 9.464   -36.936  19.078  1.00 73.17  ? 80   TYR B CE1   1 
ATOM   8944  C  CE2   . TYR B 2 73   ? 8.715   -35.937  21.116  1.00 72.53  ? 80   TYR B CE2   1 
ATOM   8945  C  CZ    . TYR B 2 73   ? 8.524   -36.820  20.083  1.00 72.00  ? 80   TYR B CZ    1 
ATOM   8946  O  OH    . TYR B 2 73   ? 7.391   -37.600  20.048  1.00 86.92  ? 80   TYR B OH    1 
ATOM   8947  N  N     . ILE B 2 74   ? 15.469  -34.281  19.847  1.00 72.68  ? 81   ILE B N     1 
ATOM   8948  C  CA    . ILE B 2 74   ? 16.612  -33.403  20.072  1.00 82.36  ? 81   ILE B CA    1 
ATOM   8949  C  C     . ILE B 2 74   ? 17.139  -32.815  18.766  1.00 95.07  ? 81   ILE B C     1 
ATOM   8950  O  O     . ILE B 2 74   ? 17.375  -33.539  17.808  1.00 96.82  ? 81   ILE B O     1 
ATOM   8951  C  CB    . ILE B 2 74   ? 17.749  -34.140  20.806  1.00 89.65  ? 81   ILE B CB    1 
ATOM   8952  C  CG1   . ILE B 2 74   ? 17.374  -34.368  22.280  1.00 80.60  ? 81   ILE B CG1   1 
ATOM   8953  C  CG2   . ILE B 2 74   ? 19.051  -33.349  20.723  1.00 100.69 ? 81   ILE B CG2   1 
ATOM   8954  C  CD1   . ILE B 2 74   ? 18.408  -35.139  23.058  1.00 73.69  ? 81   ILE B CD1   1 
ATOM   8955  N  N     . GLN B 2 75   ? 17.291  -31.490  18.751  1.00 96.27  ? 82   GLN B N     1 
ATOM   8956  C  CA    . GLN B 2 75   ? 17.787  -30.721  17.602  1.00 80.07  ? 82   GLN B CA    1 
ATOM   8957  C  C     . GLN B 2 75   ? 16.844  -30.766  16.395  1.00 75.58  ? 82   GLN B C     1 
ATOM   8958  O  O     . GLN B 2 75   ? 17.264  -30.531  15.266  1.00 74.72  ? 82   GLN B O     1 
ATOM   8959  C  CB    . GLN B 2 75   ? 19.186  -31.197  17.188  1.00 82.14  ? 82   GLN B CB    1 
ATOM   8960  C  CG    . GLN B 2 75   ? 20.287  -30.774  18.141  1.00 104.53 ? 82   GLN B CG    1 
ATOM   8961  C  CD    . GLN B 2 75   ? 21.671  -31.161  17.645  1.00 122.98 ? 82   GLN B CD    1 
ATOM   8962  O  OE1   . GLN B 2 75   ? 22.008  -32.345  17.559  1.00 122.55 ? 82   GLN B OE1   1 
ATOM   8963  N  NE2   . GLN B 2 75   ? 22.481  -30.158  17.313  1.00 129.49 ? 82   GLN B NE2   1 
ATOM   8964  N  N     . ALA B 2 76   ? 15.571  -31.058  16.637  1.00 65.00  ? 83   ALA B N     1 
ATOM   8965  C  CA    . ALA B 2 76   ? 14.569  -30.989  15.584  1.00 60.91  ? 83   ALA B CA    1 
ATOM   8966  C  C     . ALA B 2 76   ? 14.319  -29.542  15.216  1.00 75.13  ? 83   ALA B C     1 
ATOM   8967  O  O     . ALA B 2 76   ? 14.381  -28.660  16.070  1.00 87.00  ? 83   ALA B O     1 
ATOM   8968  C  CB    . ALA B 2 76   ? 13.274  -31.657  16.021  1.00 52.88  ? 83   ALA B CB    1 
ATOM   8969  N  N     . GLN B 2 77   ? 14.029  -29.293  13.943  1.00 70.80  ? 84   GLN B N     1 
ATOM   8970  C  CA    . GLN B 2 77   ? 13.827  -27.921  13.482  1.00 73.37  ? 84   GLN B CA    1 
ATOM   8971  C  C     . GLN B 2 77   ? 12.379  -27.648  13.117  1.00 69.76  ? 84   GLN B C     1 
ATOM   8972  O  O     . GLN B 2 77   ? 11.956  -26.498  13.020  1.00 75.94  ? 84   GLN B O     1 
ATOM   8973  C  CB    . GLN B 2 77   ? 14.744  -27.623  12.299  1.00 70.40  ? 84   GLN B CB    1 
ATOM   8974  C  CG    . GLN B 2 77   ? 16.208  -27.610  12.690  1.00 78.94  ? 84   GLN B CG    1 
ATOM   8975  C  CD    . GLN B 2 77   ? 17.133  -27.568  11.505  1.00 89.37  ? 84   GLN B CD    1 
ATOM   8976  O  OE1   . GLN B 2 77   ? 17.569  -28.606  11.008  1.00 94.22  ? 84   GLN B OE1   1 
ATOM   8977  N  NE2   . GLN B 2 77   ? 17.450  -26.364  11.045  1.00 97.01  ? 84   GLN B NE2   1 
ATOM   8978  N  N     . CYS B 2 78   ? 11.613  -28.714  12.931  1.00 70.03  ? 85   CYS B N     1 
ATOM   8979  C  CA    . CYS B 2 78   ? 10.182  -28.573  12.665  1.00 80.11  ? 85   CYS B CA    1 
ATOM   8980  C  C     . CYS B 2 78   ? 9.461   -29.889  12.931  1.00 67.29  ? 85   CYS B C     1 
ATOM   8981  O  O     . CYS B 2 78   ? 10.100  -30.933  13.074  1.00 63.66  ? 85   CYS B O     1 
ATOM   8982  C  CB    . CYS B 2 78   ? 9.939   -28.123  11.219  1.00 91.78  ? 85   CYS B CB    1 
ATOM   8983  S  SG    . CYS B 2 78   ? 10.552  -29.297  10.025  1.00 87.89  ? 85   CYS B SG    1 
ATOM   8984  N  N     . ALA B 2 79   ? 8.134   -29.857  12.961  1.00 57.96  ? 86   ALA B N     1 
ATOM   8985  C  CA    . ALA B 2 79   ? 7.420   -31.070  13.301  1.00 56.17  ? 86   ALA B CA    1 
ATOM   8986  C  C     . ALA B 2 79   ? 6.040   -31.207  12.674  1.00 59.46  ? 86   ALA B C     1 
ATOM   8987  O  O     . ALA B 2 79   ? 5.359   -30.214  12.399  1.00 53.45  ? 86   ALA B O     1 
ATOM   8988  C  CB    . ALA B 2 79   ? 7.302   -31.170  14.823  1.00 67.60  ? 86   ALA B CB    1 
ATOM   8989  N  N     . ILE B 2 80   ? 5.626   -32.457  12.489  1.00 57.05  ? 87   ILE B N     1 
ATOM   8990  C  CA    . ILE B 2 80   ? 4.273   -32.756  12.042  1.00 57.68  ? 87   ILE B CA    1 
ATOM   8991  C  C     . ILE B 2 80   ? 3.596   -33.705  13.011  1.00 59.79  ? 87   ILE B C     1 
ATOM   8992  O  O     . ILE B 2 80   ? 3.949   -34.884  13.092  1.00 74.35  ? 87   ILE B O     1 
ATOM   8993  C  CB    . ILE B 2 80   ? 4.249   -33.387  10.618  1.00 63.57  ? 87   ILE B CB    1 
ATOM   8994  C  CG1   . ILE B 2 80   ? 4.894   -32.444  9.604   1.00 71.04  ? 87   ILE B CG1   1 
ATOM   8995  C  CG2   . ILE B 2 80   ? 2.825   -33.719  10.196  1.00 45.63  ? 87   ILE B CG2   1 
ATOM   8996  C  CD1   . ILE B 2 80   ? 4.855   -32.981  8.185   1.00 73.43  ? 87   ILE B CD1   1 
ATOM   8997  N  N     . ILE B 2 81   ? 2.635   -33.192  13.765  1.00 56.86  ? 88   ILE B N     1 
ATOM   8998  C  CA    . ILE B 2 81   ? 1.787   -34.054  14.575  1.00 64.05  ? 88   ILE B CA    1 
ATOM   8999  C  C     . ILE B 2 81   ? 0.658   -34.513  13.678  1.00 69.27  ? 88   ILE B C     1 
ATOM   9000  O  O     . ILE B 2 81   ? 0.107   -33.716  12.926  1.00 70.66  ? 88   ILE B O     1 
ATOM   9001  C  CB    . ILE B 2 81   ? 1.229   -33.338  15.811  1.00 65.74  ? 88   ILE B CB    1 
ATOM   9002  C  CG1   . ILE B 2 81   ? 2.358   -32.652  16.609  1.00 51.98  ? 88   ILE B CG1   1 
ATOM   9003  C  CG2   . ILE B 2 81   ? 0.471   -34.325  16.695  1.00 65.40  ? 88   ILE B CG2   1 
ATOM   9004  C  CD1   . ILE B 2 81   ? 1.863   -31.859  17.800  1.00 47.53  ? 88   ILE B CD1   1 
ATOM   9005  N  N     . MET B 2 82   ? 0.325   -35.796  13.728  1.00 69.79  ? 89   MET B N     1 
ATOM   9006  C  CA    . MET B 2 82   ? -0.692  -36.332  12.835  1.00 67.49  ? 89   MET B CA    1 
ATOM   9007  C  C     . MET B 2 82   ? -1.733  -37.168  13.577  1.00 66.25  ? 89   MET B C     1 
ATOM   9008  O  O     . MET B 2 82   ? -1.419  -37.841  14.546  1.00 78.80  ? 89   MET B O     1 
ATOM   9009  C  CB    . MET B 2 82   ? -0.031  -37.174  11.761  1.00 79.16  ? 89   MET B CB    1 
ATOM   9010  C  CG    . MET B 2 82   ? -0.816  -37.266  10.461  1.00 90.09  ? 89   MET B CG    1 
ATOM   9011  S  SD    . MET B 2 82   ? -0.159  -38.570  9.430   1.00 87.42  ? 89   MET B SD    1 
ATOM   9012  C  CE    . MET B 2 82   ? -0.230  -37.849  7.862   1.00 69.09  ? 89   MET B CE    1 
ATOM   9013  N  N     . PHE B 2 83   ? -2.979  -37.107  13.125  1.00 76.47  ? 90   PHE B N     1 
ATOM   9014  C  CA    . PHE B 2 83   ? -4.019  -37.973  13.659  1.00 64.31  ? 90   PHE B CA    1 
ATOM   9015  C  C     . PHE B 2 83   ? -4.937  -38.503  12.542  1.00 67.92  ? 90   PHE B C     1 
ATOM   9016  O  O     . PHE B 2 83   ? -4.792  -38.156  11.372  1.00 49.49  ? 90   PHE B O     1 
ATOM   9017  C  CB    . PHE B 2 83   ? -4.830  -37.248  14.732  1.00 38.29  ? 90   PHE B CB    1 
ATOM   9018  C  CG    . PHE B 2 83   ? -5.632  -36.089  14.226  1.00 53.24  ? 90   PHE B CG    1 
ATOM   9019  C  CD1   . PHE B 2 83   ? -6.994  -36.221  13.986  1.00 57.02  ? 90   PHE B CD1   1 
ATOM   9020  C  CD2   . PHE B 2 83   ? -5.038  -34.856  14.023  1.00 53.34  ? 90   PHE B CD2   1 
ATOM   9021  C  CE1   . PHE B 2 83   ? -7.739  -35.146  13.532  1.00 51.44  ? 90   PHE B CE1   1 
ATOM   9022  C  CE2   . PHE B 2 83   ? -5.777  -33.781  13.562  1.00 56.39  ? 90   PHE B CE2   1 
ATOM   9023  C  CZ    . PHE B 2 83   ? -7.125  -33.925  13.317  1.00 53.64  ? 90   PHE B CZ    1 
ATOM   9024  N  N     . ASP B 2 84   ? -5.874  -39.362  12.918  1.00 76.24  ? 91   ASP B N     1 
ATOM   9025  C  CA    . ASP B 2 84   ? -6.782  -39.982  11.962  1.00 62.58  ? 91   ASP B CA    1 
ATOM   9026  C  C     . ASP B 2 84   ? -8.199  -39.474  12.173  1.00 57.17  ? 91   ASP B C     1 
ATOM   9027  O  O     . ASP B 2 84   ? -8.777  -39.647  13.233  1.00 72.64  ? 91   ASP B O     1 
ATOM   9028  C  CB    . ASP B 2 84   ? -6.731  -41.512  12.107  1.00 71.20  ? 91   ASP B CB    1 
ATOM   9029  C  CG    . ASP B 2 84   ? -7.550  -42.239  11.055  1.00 78.88  ? 91   ASP B CG    1 
ATOM   9030  O  OD1   . ASP B 2 84   ? -8.256  -41.583  10.267  1.00 82.62  ? 91   ASP B OD1   1 
ATOM   9031  O  OD2   . ASP B 2 84   ? -7.497  -43.485  11.024  1.00 88.30  ? 91   ASP B OD2   1 
ATOM   9032  N  N     . VAL B 2 85   ? -8.778  -38.876  11.144  1.00 57.04  ? 92   VAL B N     1 
ATOM   9033  C  CA    . VAL B 2 85   ? -10.131 -38.342  11.255  1.00 59.88  ? 92   VAL B CA    1 
ATOM   9034  C  C     . VAL B 2 85   ? -11.191 -39.440  11.306  1.00 63.70  ? 92   VAL B C     1 
ATOM   9035  O  O     . VAL B 2 85   ? -12.390 -39.156  11.374  1.00 67.69  ? 92   VAL B O     1 
ATOM   9036  C  CB    . VAL B 2 85   ? -10.459 -37.387  10.080  1.00 67.13  ? 92   VAL B CB    1 
ATOM   9037  C  CG1   . VAL B 2 85   ? -9.423  -36.281  10.006  1.00 58.10  ? 92   VAL B CG1   1 
ATOM   9038  C  CG2   . VAL B 2 85   ? -10.521 -38.164  8.772   1.00 68.04  ? 92   VAL B CG2   1 
ATOM   9039  N  N     . THR B 2 86   ? -10.755 -40.693  11.263  1.00 64.22  ? 93   THR B N     1 
ATOM   9040  C  CA    . THR B 2 86   ? -11.678 -41.812  11.407  1.00 81.69  ? 93   THR B CA    1 
ATOM   9041  C  C     . THR B 2 86   ? -11.573 -42.431  12.810  1.00 93.60  ? 93   THR B C     1 
ATOM   9042  O  O     . THR B 2 86   ? -12.321 -43.343  13.158  1.00 119.38 ? 93   THR B O     1 
ATOM   9043  C  CB    . THR B 2 86   ? -11.421 -42.901  10.340  1.00 74.10  ? 93   THR B CB    1 
ATOM   9044  O  OG1   . THR B 2 86   ? -10.182 -43.569  10.615  1.00 68.61  ? 93   THR B OG1   1 
ATOM   9045  C  CG2   . THR B 2 86   ? -11.361 -42.290  8.963   1.00 77.76  ? 93   THR B CG2   1 
ATOM   9046  N  N     . SER B 2 87   ? -10.633 -41.928  13.606  1.00 81.83  ? 94   SER B N     1 
ATOM   9047  C  CA    . SER B 2 87   ? -10.437 -42.398  14.972  1.00 80.26  ? 94   SER B CA    1 
ATOM   9048  C  C     . SER B 2 87   ? -10.277 -41.234  15.945  1.00 79.67  ? 94   SER B C     1 
ATOM   9049  O  O     . SER B 2 87   ? -9.215  -40.605  16.001  1.00 78.57  ? 94   SER B O     1 
ATOM   9050  C  CB    . SER B 2 87   ? -9.217  -43.312  15.053  1.00 72.92  ? 94   SER B CB    1 
ATOM   9051  O  OG    . SER B 2 87   ? -9.019  -43.776  16.375  1.00 78.54  ? 94   SER B OG    1 
ATOM   9052  N  N     . ARG B 2 88   ? -11.332 -40.967  16.713  1.00 78.19  ? 95   ARG B N     1 
ATOM   9053  C  CA    . ARG B 2 88   ? -11.359 -39.841  17.643  1.00 69.01  ? 95   ARG B CA    1 
ATOM   9054  C  C     . ARG B 2 88   ? -10.255 -39.927  18.698  1.00 67.78  ? 95   ARG B C     1 
ATOM   9055  O  O     . ARG B 2 88   ? -9.741  -38.916  19.171  1.00 83.08  ? 95   ARG B O     1 
ATOM   9056  C  CB    . ARG B 2 88   ? -12.721 -39.765  18.322  1.00 70.55  ? 95   ARG B CB    1 
ATOM   9057  C  CG    . ARG B 2 88   ? -13.389 -38.407  18.251  1.00 98.86  ? 95   ARG B CG    1 
ATOM   9058  C  CD    . ARG B 2 88   ? -14.756 -38.459  18.907  1.00 120.78 ? 95   ARG B CD    1 
ATOM   9059  N  NE    . ARG B 2 88   ? -15.526 -39.601  18.422  1.00 133.58 ? 95   ARG B NE    1 
ATOM   9060  C  CZ    . ARG B 2 88   ? -16.535 -39.515  17.562  1.00 138.72 ? 95   ARG B CZ    1 
ATOM   9061  N  NH1   . ARG B 2 88   ? -17.178 -40.612  17.178  1.00 142.28 ? 95   ARG B NH1   1 
ATOM   9062  N  NH2   . ARG B 2 88   ? -16.907 -38.333  17.092  1.00 145.68 ? 95   ARG B NH2   1 
ATOM   9063  N  N     . VAL B 2 89   ? -9.891  -41.150  19.051  1.00 73.13  ? 96   VAL B N     1 
ATOM   9064  C  CA    . VAL B 2 89   ? -8.854  -41.394  20.033  1.00 71.57  ? 96   VAL B CA    1 
ATOM   9065  C  C     . VAL B 2 89   ? -7.529  -40.796  19.592  1.00 76.44  ? 96   VAL B C     1 
ATOM   9066  O  O     . VAL B 2 89   ? -6.825  -40.174  20.381  1.00 79.30  ? 96   VAL B O     1 
ATOM   9067  C  CB    . VAL B 2 89   ? -8.668  -42.903  20.289  1.00 64.81  ? 96   VAL B CB    1 
ATOM   9068  C  CG1   . VAL B 2 89   ? -7.740  -43.105  21.478  1.00 64.65  ? 96   VAL B CG1   1 
ATOM   9069  C  CG2   . VAL B 2 89   ? -10.018 -43.558  20.532  1.00 68.30  ? 96   VAL B CG2   1 
ATOM   9070  N  N     . THR B 2 90   ? -7.195  -40.987  18.322  1.00 78.95  ? 97   THR B N     1 
ATOM   9071  C  CA    . THR B 2 90   ? -5.931  -40.502  17.782  1.00 76.10  ? 97   THR B CA    1 
ATOM   9072  C  C     . THR B 2 90   ? -5.845  -38.987  17.877  1.00 65.14  ? 97   THR B C     1 
ATOM   9073  O  O     . THR B 2 90   ? -4.751  -38.423  17.939  1.00 65.70  ? 97   THR B O     1 
ATOM   9074  C  CB    . THR B 2 90   ? -5.739  -40.936  16.302  1.00 68.42  ? 97   THR B CB    1 
ATOM   9075  O  OG1   . THR B 2 90   ? -6.712  -40.279  15.478  1.00 67.20  ? 97   THR B OG1   1 
ATOM   9076  C  CG2   . THR B 2 90   ? -5.888  -42.441  16.162  1.00 49.38  ? 97   THR B CG2   1 
ATOM   9077  N  N     . TYR B 2 91   ? -7.006  -38.338  17.881  1.00 65.38  ? 98   TYR B N     1 
ATOM   9078  C  CA    . TYR B 2 91   ? -7.068  -36.890  18.002  1.00 58.43  ? 98   TYR B CA    1 
ATOM   9079  C  C     . TYR B 2 91   ? -6.961  -36.462  19.453  1.00 70.22  ? 98   TYR B C     1 
ATOM   9080  O  O     . TYR B 2 91   ? -6.247  -35.507  19.782  1.00 70.00  ? 98   TYR B O     1 
ATOM   9081  C  CB    . TYR B 2 91   ? -8.360  -36.336  17.413  1.00 67.73  ? 98   TYR B CB    1 
ATOM   9082  C  CG    . TYR B 2 91   ? -8.489  -34.849  17.611  1.00 64.75  ? 98   TYR B CG    1 
ATOM   9083  C  CD1   . TYR B 2 91   ? -7.638  -33.965  16.956  1.00 62.88  ? 98   TYR B CD1   1 
ATOM   9084  C  CD2   . TYR B 2 91   ? -9.444  -34.329  18.474  1.00 61.90  ? 98   TYR B CD2   1 
ATOM   9085  C  CE1   . TYR B 2 91   ? -7.739  -32.601  17.156  1.00 75.85  ? 98   TYR B CE1   1 
ATOM   9086  C  CE2   . TYR B 2 91   ? -9.555  -32.954  18.681  1.00 63.89  ? 98   TYR B CE2   1 
ATOM   9087  C  CZ    . TYR B 2 91   ? -8.698  -32.100  18.016  1.00 71.48  ? 98   TYR B CZ    1 
ATOM   9088  O  OH    . TYR B 2 91   ? -8.799  -30.744  18.195  1.00 76.77  ? 98   TYR B OH    1 
ATOM   9089  N  N     . LYS B 2 92   ? -7.673  -37.169  20.327  1.00 64.85  ? 99   LYS B N     1 
ATOM   9090  C  CA    . LYS B 2 92   ? -7.601  -36.882  21.750  1.00 60.32  ? 99   LYS B CA    1 
ATOM   9091  C  C     . LYS B 2 92   ? -6.197  -37.104  22.299  1.00 62.96  ? 99   LYS B C     1 
ATOM   9092  O  O     . LYS B 2 92   ? -5.872  -36.635  23.380  1.00 85.31  ? 99   LYS B O     1 
ATOM   9093  C  CB    . LYS B 2 92   ? -8.622  -37.724  22.516  1.00 74.51  ? 99   LYS B CB    1 
ATOM   9094  C  CG    . LYS B 2 92   ? -10.071 -37.347  22.218  1.00 96.43  ? 99   LYS B CG    1 
ATOM   9095  C  CD    . LYS B 2 92   ? -11.031 -37.964  23.226  1.00 115.53 ? 99   LYS B CD    1 
ATOM   9096  C  CE    . LYS B 2 92   ? -12.461 -37.511  22.966  1.00 125.13 ? 99   LYS B CE    1 
ATOM   9097  N  NZ    . LYS B 2 92   ? -13.409 -38.019  24.005  1.00 131.68 ? 99   LYS B NZ    1 
ATOM   9098  N  N     . ASN B 2 93   ? -5.362  -37.801  21.539  1.00 56.04  ? 100  ASN B N     1 
ATOM   9099  C  CA    . ASN B 2 93   ? -3.990  -38.080  21.940  1.00 68.89  ? 100  ASN B CA    1 
ATOM   9100  C  C     . ASN B 2 93   ? -2.996  -37.036  21.458  1.00 67.08  ? 100  ASN B C     1 
ATOM   9101  O  O     . ASN B 2 93   ? -1.836  -37.034  21.870  1.00 72.76  ? 100  ASN B O     1 
ATOM   9102  C  CB    . ASN B 2 93   ? -3.557  -39.456  21.430  1.00 75.28  ? 100  ASN B CB    1 
ATOM   9103  C  CG    . ASN B 2 93   ? -3.991  -40.578  22.354  1.00 80.68  ? 100  ASN B CG    1 
ATOM   9104  O  OD1   . ASN B 2 93   ? -4.148  -40.383  23.559  1.00 85.23  ? 100  ASN B OD1   1 
ATOM   9105  N  ND2   . ASN B 2 93   ? -4.188  -41.757  21.796  1.00 91.11  ? 100  ASN B ND2   1 
ATOM   9106  N  N     . VAL B 2 94   ? -3.446  -36.152  20.577  1.00 70.26  ? 101  VAL B N     1 
ATOM   9107  C  CA    . VAL B 2 94   ? -2.583  -35.099  20.032  1.00 62.31  ? 101  VAL B CA    1 
ATOM   9108  C  C     . VAL B 2 94   ? -1.918  -34.208  21.108  1.00 71.49  ? 101  VAL B C     1 
ATOM   9109  O  O     . VAL B 2 94   ? -0.721  -33.936  21.019  1.00 72.64  ? 101  VAL B O     1 
ATOM   9110  C  CB    . VAL B 2 94   ? -3.364  -34.223  19.060  1.00 70.34  ? 101  VAL B CB    1 
ATOM   9111  C  CG1   . VAL B 2 94   ? -2.560  -32.975  18.659  1.00 73.63  ? 101  VAL B CG1   1 
ATOM   9112  C  CG2   . VAL B 2 94   ? -3.732  -35.030  17.814  1.00 55.44  ? 101  VAL B CG2   1 
ATOM   9113  N  N     . PRO B 2 95   ? -2.672  -33.777  22.148  1.00 76.29  ? 102  PRO B N     1 
ATOM   9114  C  CA    . PRO B 2 95   ? -1.996  -32.952  23.166  1.00 68.49  ? 102  PRO B CA    1 
ATOM   9115  C  C     . PRO B 2 95   ? -0.820  -33.637  23.861  1.00 72.75  ? 102  PRO B C     1 
ATOM   9116  O  O     . PRO B 2 95   ? 0.083   -32.953  24.362  1.00 87.93  ? 102  PRO B O     1 
ATOM   9117  C  CB    . PRO B 2 95   ? -3.108  -32.663  24.177  1.00 56.05  ? 102  PRO B CB    1 
ATOM   9118  C  CG    . PRO B 2 95   ? -4.366  -32.774  23.398  1.00 54.48  ? 102  PRO B CG    1 
ATOM   9119  C  CD    . PRO B 2 95   ? -4.117  -33.891  22.429  1.00 65.74  ? 102  PRO B CD    1 
ATOM   9120  N  N     . ASN B 2 96   ? -0.819  -34.966  23.862  1.00 66.96  ? 103  ASN B N     1 
ATOM   9121  C  CA    . ASN B 2 96   ? 0.269   -35.718  24.474  1.00 77.70  ? 103  ASN B CA    1 
ATOM   9122  C  C     . ASN B 2 96   ? 1.531   -35.627  23.620  1.00 67.02  ? 103  ASN B C     1 
ATOM   9123  O  O     . ASN B 2 96   ? 2.636   -35.327  24.111  1.00 79.57  ? 103  ASN B O     1 
ATOM   9124  C  CB    . ASN B 2 96   ? -0.147  -37.178  24.686  1.00 77.28  ? 103  ASN B CB    1 
ATOM   9125  C  CG    . ASN B 2 96   ? -1.288  -37.326  25.693  1.00 76.30  ? 103  ASN B CG    1 
ATOM   9126  O  OD1   . ASN B 2 96   ? -2.081  -36.410  25.903  1.00 90.75  ? 103  ASN B OD1   1 
ATOM   9127  N  ND2   . ASN B 2 96   ? -1.351  -38.477  26.337  1.00 100.04 ? 103  ASN B ND2   1 
ATOM   9128  N  N     . TRP B 2 97   ? 1.352   -35.871  22.327  1.00 84.70  ? 104  TRP B N     1 
ATOM   9129  C  CA    . TRP B 2 97   ? 2.446   -35.766  21.370  1.00 73.36  ? 104  TRP B CA    1 
ATOM   9130  C  C     . TRP B 2 97   ? 2.987   -34.348  21.379  1.00 69.76  ? 104  TRP B C     1 
ATOM   9131  O  O     . TRP B 2 97   ? 4.204   -34.127  21.364  1.00 71.68  ? 104  TRP B O     1 
ATOM   9132  C  CB    . TRP B 2 97   ? 1.977   -36.155  19.971  1.00 78.43  ? 104  TRP B CB    1 
ATOM   9133  C  CG    . TRP B 2 97   ? 1.565   -37.608  19.872  1.00 64.82  ? 104  TRP B CG    1 
ATOM   9134  C  CD1   . TRP B 2 97   ? 0.304   -38.096  19.716  1.00 64.80  ? 104  TRP B CD1   1 
ATOM   9135  C  CD2   . TRP B 2 97   ? 2.428   -38.749  19.954  1.00 56.32  ? 104  TRP B CD2   1 
ATOM   9136  N  NE1   . TRP B 2 97   ? 0.329   -39.472  19.698  1.00 55.79  ? 104  TRP B NE1   1 
ATOM   9137  C  CE2   . TRP B 2 97   ? 1.622   -39.892  19.848  1.00 51.29  ? 104  TRP B CE2   1 
ATOM   9138  C  CE3   . TRP B 2 97   ? 3.805   -38.910  20.121  1.00 62.63  ? 104  TRP B CE3   1 
ATOM   9139  C  CZ2   . TRP B 2 97   ? 2.145   -41.165  19.892  1.00 65.05  ? 104  TRP B CZ2   1 
ATOM   9140  C  CZ3   . TRP B 2 97   ? 4.323   -40.186  20.170  1.00 57.76  ? 104  TRP B CZ3   1 
ATOM   9141  C  CH2   . TRP B 2 97   ? 3.497   -41.291  20.052  1.00 70.17  ? 104  TRP B CH2   1 
ATOM   9142  N  N     . HIS B 2 98   ? 2.069   -33.389  21.462  1.00 57.47  ? 105  HIS B N     1 
ATOM   9143  C  CA    . HIS B 2 98   ? 2.436   -31.984  21.484  1.00 67.48  ? 105  HIS B CA    1 
ATOM   9144  C  C     . HIS B 2 98   ? 3.248   -31.630  22.730  1.00 78.26  ? 105  HIS B C     1 
ATOM   9145  O  O     . HIS B 2 98   ? 4.253   -30.931  22.604  1.00 74.94  ? 105  HIS B O     1 
ATOM   9146  C  CB    . HIS B 2 98   ? 1.196   -31.102  21.407  1.00 68.37  ? 105  HIS B CB    1 
ATOM   9147  C  CG    . HIS B 2 98   ? 1.498   -29.637  21.460  1.00 71.16  ? 105  HIS B CG    1 
ATOM   9148  N  ND1   . HIS B 2 98   ? 1.509   -28.923  22.638  1.00 80.45  ? 105  HIS B ND1   1 
ATOM   9149  C  CD2   . HIS B 2 98   ? 1.811   -28.755  20.481  1.00 66.20  ? 105  HIS B CD2   1 
ATOM   9150  C  CE1   . HIS B 2 98   ? 1.806   -27.661  22.381  1.00 81.19  ? 105  HIS B CE1   1 
ATOM   9151  N  NE2   . HIS B 2 98   ? 1.998   -27.535  21.080  1.00 59.51  ? 105  HIS B NE2   1 
ATOM   9152  N  N     . ARG B 2 99   ? 2.829   -32.098  23.913  1.00 76.69  ? 106  ARG B N     1 
ATOM   9153  C  CA    . ARG B 2 99   ? 3.540   -31.753  25.142  1.00 79.32  ? 106  ARG B CA    1 
ATOM   9154  C  C     . ARG B 2 99   ? 4.949   -32.346  25.126  1.00 85.63  ? 106  ARG B C     1 
ATOM   9155  O  O     . ARG B 2 99   ? 5.936   -31.647  25.430  1.00 98.08  ? 106  ARG B O     1 
ATOM   9156  C  CB    . ARG B 2 99   ? 2.766   -32.214  26.385  1.00 84.74  ? 106  ARG B CB    1 
ATOM   9157  C  CG    . ARG B 2 99   ? 2.750   -33.716  26.626  1.00 92.56  ? 106  ARG B CG    1 
ATOM   9158  C  CD    . ARG B 2 99   ? 2.550   -34.126  28.066  1.00 89.89  ? 106  ARG B CD    1 
ATOM   9159  N  NE    . ARG B 2 99   ? 2.932   -35.523  28.249  1.00 99.59  ? 106  ARG B NE    1 
ATOM   9160  C  CZ    . ARG B 2 99   ? 2.141   -36.562  27.996  1.00 107.66 ? 106  ARG B CZ    1 
ATOM   9161  N  NH1   . ARG B 2 99   ? 0.912   -36.368  27.551  1.00 98.90  ? 106  ARG B NH1   1 
ATOM   9162  N  NH2   . ARG B 2 99   ? 2.574   -37.799  28.200  1.00 128.40 ? 106  ARG B NH2   1 
ATOM   9163  N  N     . ASP B 2 100  ? 5.046   -33.619  24.737  1.00 75.96  ? 107  ASP B N     1 
ATOM   9164  C  CA    . ASP B 2 100  ? 6.333   -34.299  24.746  1.00 74.48  ? 107  ASP B CA    1 
ATOM   9165  C  C     . ASP B 2 100  ? 7.255   -33.619  23.757  1.00 81.86  ? 107  ASP B C     1 
ATOM   9166  O  O     . ASP B 2 100  ? 8.463   -33.530  23.980  1.00 80.75  ? 107  ASP B O     1 
ATOM   9167  C  CB    . ASP B 2 100  ? 6.186   -35.783  24.400  1.00 76.82  ? 107  ASP B CB    1 
ATOM   9168  C  CG    . ASP B 2 100  ? 5.593   -36.602  25.534  1.00 88.99  ? 107  ASP B CG    1 
ATOM   9169  O  OD1   . ASP B 2 100  ? 5.541   -36.117  26.679  1.00 80.80  ? 107  ASP B OD1   1 
ATOM   9170  O  OD2   . ASP B 2 100  ? 5.184   -37.749  25.274  1.00 118.03 ? 107  ASP B OD2   1 
ATOM   9171  N  N     . LEU B 2 101  ? 6.662   -33.129  22.672  1.00 88.41  ? 108  LEU B N     1 
ATOM   9172  C  CA    . LEU B 2 101  ? 7.412   -32.488  21.602  1.00 79.42  ? 108  LEU B CA    1 
ATOM   9173  C  C     . LEU B 2 101  ? 7.920   -31.097  21.973  1.00 79.15  ? 108  LEU B C     1 
ATOM   9174  O  O     . LEU B 2 101  ? 9.098   -30.794  21.812  1.00 88.26  ? 108  LEU B O     1 
ATOM   9175  C  CB    . LEU B 2 101  ? 6.539   -32.405  20.354  1.00 74.29  ? 108  LEU B CB    1 
ATOM   9176  C  CG    . LEU B 2 101  ? 7.107   -31.774  19.085  1.00 61.62  ? 108  LEU B CG    1 
ATOM   9177  C  CD1   . LEU B 2 101  ? 8.370   -32.496  18.653  1.00 62.20  ? 108  LEU B CD1   1 
ATOM   9178  C  CD2   . LEU B 2 101  ? 6.036   -31.838  18.036  1.00 54.53  ? 108  LEU B CD2   1 
ATOM   9179  N  N     . VAL B 2 102  ? 7.026   -30.252  22.470  1.00 73.12  ? 109  VAL B N     1 
ATOM   9180  C  CA    . VAL B 2 102  ? 7.377   -28.869  22.774  1.00 71.53  ? 109  VAL B CA    1 
ATOM   9181  C  C     . VAL B 2 102  ? 8.201   -28.763  24.038  1.00 75.54  ? 109  VAL B C     1 
ATOM   9182  O  O     . VAL B 2 102  ? 8.755   -27.705  24.316  1.00 78.03  ? 109  VAL B O     1 
ATOM   9183  C  CB    . VAL B 2 102  ? 6.134   -27.961  22.921  1.00 61.44  ? 109  VAL B CB    1 
ATOM   9184  C  CG1   . VAL B 2 102  ? 5.287   -27.992  21.626  1.00 76.66  ? 109  VAL B CG1   1 
ATOM   9185  C  CG2   . VAL B 2 102  ? 5.312   -28.368  24.107  1.00 69.62  ? 109  VAL B CG2   1 
ATOM   9186  N  N     . ARG B 2 103  ? 8.287   -29.843  24.812  1.00 79.62  ? 110  ARG B N     1 
ATOM   9187  C  CA    . ARG B 2 103  ? 9.222   -29.843  25.939  1.00 75.19  ? 110  ARG B CA    1 
ATOM   9188  C  C     . ARG B 2 103  ? 10.674  -29.943  25.469  1.00 83.02  ? 110  ARG B C     1 
ATOM   9189  O  O     . ARG B 2 103  ? 11.565  -29.345  26.071  1.00 97.28  ? 110  ARG B O     1 
ATOM   9190  C  CB    . ARG B 2 103  ? 8.906   -30.976  26.913  1.00 67.84  ? 110  ARG B CB    1 
ATOM   9191  C  CG    . ARG B 2 103  ? 7.856   -30.612  27.930  1.00 71.64  ? 110  ARG B CG    1 
ATOM   9192  C  CD    . ARG B 2 103  ? 7.371   -31.813  28.705  1.00 76.35  ? 110  ARG B CD    1 
ATOM   9193  N  NE    . ARG B 2 103  ? 6.290   -31.459  29.621  1.00 81.40  ? 110  ARG B NE    1 
ATOM   9194  C  CZ    . ARG B 2 103  ? 5.585   -32.346  30.314  1.00 98.21  ? 110  ARG B CZ    1 
ATOM   9195  N  NH1   . ARG B 2 103  ? 5.842   -33.639  30.187  1.00 101.47 ? 110  ARG B NH1   1 
ATOM   9196  N  NH2   . ARG B 2 103  ? 4.623   -31.944  31.134  1.00 113.36 ? 110  ARG B NH2   1 
ATOM   9197  N  N     . VAL B 2 104  ? 10.908  -30.690  24.394  1.00 81.50  ? 111  VAL B N     1 
ATOM   9198  C  CA    . VAL B 2 104  ? 12.253  -30.814  23.834  1.00 81.03  ? 111  VAL B CA    1 
ATOM   9199  C  C     . VAL B 2 104  ? 12.517  -29.688  22.839  1.00 88.37  ? 111  VAL B C     1 
ATOM   9200  O  O     . VAL B 2 104  ? 13.619  -29.143  22.774  1.00 101.86 ? 111  VAL B O     1 
ATOM   9201  C  CB    . VAL B 2 104  ? 12.456  -32.164  23.142  1.00 76.08  ? 111  VAL B CB    1 
ATOM   9202  C  CG1   . VAL B 2 104  ? 13.907  -32.331  22.711  1.00 85.20  ? 111  VAL B CG1   1 
ATOM   9203  C  CG2   . VAL B 2 104  ? 12.043  -33.294  24.065  1.00 78.25  ? 111  VAL B CG2   1 
ATOM   9204  N  N     . CYS B 2 105  ? 11.491  -29.332  22.076  1.00 85.06  ? 112  CYS B N     1 
ATOM   9205  C  CA    . CYS B 2 105  ? 11.608  -28.282  21.075  1.00 92.23  ? 112  CYS B CA    1 
ATOM   9206  C  C     . CYS B 2 105  ? 10.713  -27.102  21.419  1.00 92.69  ? 112  CYS B C     1 
ATOM   9207  O  O     . CYS B 2 105  ? 9.541   -27.056  21.031  1.00 86.27  ? 112  CYS B O     1 
ATOM   9208  C  CB    . CYS B 2 105  ? 11.258  -28.826  19.696  1.00 96.03  ? 112  CYS B CB    1 
ATOM   9209  S  SG    . CYS B 2 105  ? 12.176  -30.298  19.257  1.00 92.28  ? 112  CYS B SG    1 
ATOM   9210  N  N     . GLU B 2 106  ? 11.281  -26.145  22.144  1.00 97.27  ? 113  GLU B N     1 
ATOM   9211  C  CA    . GLU B 2 106  ? 10.527  -25.007  22.653  1.00 99.04  ? 113  GLU B CA    1 
ATOM   9212  C  C     . GLU B 2 106  ? 9.937   -24.139  21.540  1.00 101.68 ? 113  GLU B C     1 
ATOM   9213  O  O     . GLU B 2 106  ? 8.751   -23.807  21.573  1.00 105.59 ? 113  GLU B O     1 
ATOM   9214  C  CB    . GLU B 2 106  ? 11.423  -24.166  23.564  1.00 102.94 ? 113  GLU B CB    1 
ATOM   9215  C  CG    . GLU B 2 106  ? 10.697  -23.102  24.364  1.00 99.91  ? 113  GLU B CG    1 
ATOM   9216  C  CD    . GLU B 2 106  ? 11.396  -22.805  25.666  1.00 128.11 ? 113  GLU B CD    1 
ATOM   9217  O  OE1   . GLU B 2 106  ? 11.647  -23.761  26.431  1.00 135.49 ? 113  GLU B OE1   1 
ATOM   9218  O  OE2   . GLU B 2 106  ? 11.701  -21.622  25.926  1.00 153.44 ? 113  GLU B OE2   1 
ATOM   9219  N  N     . ASN B 2 107  ? 10.756  -23.779  20.554  1.00 99.01  ? 114  ASN B N     1 
ATOM   9220  C  CA    . ASN B 2 107  ? 10.299  -22.879  19.497  1.00 108.82 ? 114  ASN B CA    1 
ATOM   9221  C  C     . ASN B 2 107  ? 10.583  -23.392  18.083  1.00 99.18  ? 114  ASN B C     1 
ATOM   9222  O  O     . ASN B 2 107  ? 11.573  -23.001  17.461  1.00 101.92 ? 114  ASN B O     1 
ATOM   9223  C  CB    . ASN B 2 107  ? 10.934  -21.497  19.683  1.00 126.52 ? 114  ASN B CB    1 
ATOM   9224  C  CG    . ASN B 2 107  ? 10.239  -20.420  18.870  1.00 143.40 ? 114  ASN B CG    1 
ATOM   9225  O  OD1   . ASN B 2 107  ? 9.986   -20.586  17.677  1.00 154.70 ? 114  ASN B OD1   1 
ATOM   9226  N  ND2   . ASN B 2 107  ? 9.924   -19.306  19.519  1.00 151.70 ? 114  ASN B ND2   1 
ATOM   9227  N  N     . ILE B 2 108  ? 9.709   -24.262  17.582  1.00 78.19  ? 115  ILE B N     1 
ATOM   9228  C  CA    . ILE B 2 108  ? 9.810   -24.757  16.212  1.00 70.35  ? 115  ILE B CA    1 
ATOM   9229  C  C     . ILE B 2 108  ? 8.445   -24.715  15.520  1.00 78.28  ? 115  ILE B C     1 
ATOM   9230  O  O     . ILE B 2 108  ? 7.408   -24.795  16.176  1.00 84.38  ? 115  ILE B O     1 
ATOM   9231  C  CB    . ILE B 2 108  ? 10.349  -26.199  16.150  1.00 57.92  ? 115  ILE B CB    1 
ATOM   9232  C  CG1   . ILE B 2 108  ? 9.380   -27.162  16.833  1.00 57.86  ? 115  ILE B CG1   1 
ATOM   9233  C  CG2   . ILE B 2 108  ? 11.737  -26.292  16.742  1.00 59.91  ? 115  ILE B CG2   1 
ATOM   9234  C  CD1   . ILE B 2 108  ? 9.676   -28.610  16.569  1.00 61.34  ? 115  ILE B CD1   1 
ATOM   9235  N  N     . PRO B 2 109  ? 8.436   -24.577  14.186  1.00 76.10  ? 116  PRO B N     1 
ATOM   9236  C  CA    . PRO B 2 109  ? 7.165   -24.637  13.456  1.00 76.00  ? 116  PRO B CA    1 
ATOM   9237  C  C     . PRO B 2 109  ? 6.557   -26.044  13.460  1.00 70.84  ? 116  PRO B C     1 
ATOM   9238  O  O     . PRO B 2 109  ? 7.252   -27.044  13.220  1.00 75.17  ? 116  PRO B O     1 
ATOM   9239  C  CB    . PRO B 2 109  ? 7.551   -24.199  12.036  1.00 67.65  ? 116  PRO B CB    1 
ATOM   9240  C  CG    . PRO B 2 109  ? 9.008   -24.470  11.940  1.00 75.87  ? 116  PRO B CG    1 
ATOM   9241  C  CD    . PRO B 2 109  ? 9.563   -24.224  13.306  1.00 73.26  ? 116  PRO B CD    1 
ATOM   9242  N  N     . ILE B 2 110  ? 5.260   -26.112  13.741  1.00 56.46  ? 117  ILE B N     1 
ATOM   9243  C  CA    . ILE B 2 110  ? 4.583   -27.388  13.845  1.00 57.96  ? 117  ILE B CA    1 
ATOM   9244  C  C     . ILE B 2 110  ? 3.256   -27.375  13.098  1.00 64.89  ? 117  ILE B C     1 
ATOM   9245  O  O     . ILE B 2 110  ? 2.476   -26.401  13.158  1.00 59.43  ? 117  ILE B O     1 
ATOM   9246  C  CB    . ILE B 2 110  ? 4.328   -27.796  15.338  1.00 74.01  ? 117  ILE B CB    1 
ATOM   9247  C  CG1   . ILE B 2 110  ? 5.582   -27.617  16.204  1.00 56.32  ? 117  ILE B CG1   1 
ATOM   9248  C  CG2   . ILE B 2 110  ? 3.843   -29.230  15.431  1.00 73.23  ? 117  ILE B CG2   1 
ATOM   9249  C  CD1   . ILE B 2 110  ? 5.346   -27.876  17.648  1.00 54.54  ? 117  ILE B CD1   1 
ATOM   9250  N  N     . VAL B 2 111  ? 3.011   -28.476  12.391  1.00 69.09  ? 118  VAL B N     1 
ATOM   9251  C  CA    . VAL B 2 111  ? 1.782   -28.652  11.632  1.00 60.71  ? 118  VAL B CA    1 
ATOM   9252  C  C     . VAL B 2 111  ? 1.015   -29.878  12.123  1.00 62.03  ? 118  VAL B C     1 
ATOM   9253  O  O     . VAL B 2 111  ? 1.578   -30.971  12.276  1.00 62.69  ? 118  VAL B O     1 
ATOM   9254  C  CB    . VAL B 2 111  ? 2.057   -28.806  10.130  1.00 65.92  ? 118  VAL B CB    1 
ATOM   9255  C  CG1   . VAL B 2 111  ? 0.760   -28.737  9.349   1.00 65.82  ? 118  VAL B CG1   1 
ATOM   9256  C  CG2   . VAL B 2 111  ? 3.023   -27.735  9.668   1.00 61.98  ? 118  VAL B CG2   1 
ATOM   9257  N  N     . LEU B 2 112  ? -0.272  -29.674  12.373  1.00 61.71  ? 119  LEU B N     1 
ATOM   9258  C  CA    . LEU B 2 112  ? -1.181  -30.730  12.751  1.00 65.84  ? 119  LEU B CA    1 
ATOM   9259  C  C     . LEU B 2 112  ? -1.946  -31.201  11.524  1.00 63.69  ? 119  LEU B C     1 
ATOM   9260  O  O     . LEU B 2 112  ? -2.588  -30.408  10.846  1.00 73.51  ? 119  LEU B O     1 
ATOM   9261  C  CB    . LEU B 2 112  ? -2.137  -30.242  13.850  1.00 63.89  ? 119  LEU B CB    1 
ATOM   9262  C  CG    . LEU B 2 112  ? -3.109  -31.276  14.415  1.00 69.83  ? 119  LEU B CG    1 
ATOM   9263  C  CD1   . LEU B 2 112  ? -2.342  -32.458  14.970  1.00 69.57  ? 119  LEU B CD1   1 
ATOM   9264  C  CD2   . LEU B 2 112  ? -3.993  -30.657  15.456  1.00 74.32  ? 119  LEU B CD2   1 
ATOM   9265  N  N     . CYS B 2 113  ? -1.890  -32.498  11.246  1.00 67.23  ? 120  CYS B N     1 
ATOM   9266  C  CA    . CYS B 2 113  ? -2.535  -33.028  10.048  1.00 71.06  ? 120  CYS B CA    1 
ATOM   9267  C  C     . CYS B 2 113  ? -3.623  -34.038  10.384  1.00 68.83  ? 120  CYS B C     1 
ATOM   9268  O  O     . CYS B 2 113  ? -3.377  -35.045  11.073  1.00 61.93  ? 120  CYS B O     1 
ATOM   9269  C  CB    . CYS B 2 113  ? -1.502  -33.661  9.100   1.00 51.93  ? 120  CYS B CB    1 
ATOM   9270  S  SG    . CYS B 2 113  ? -0.343  -32.493  8.409   1.00 93.19  ? 120  CYS B SG    1 
ATOM   9271  N  N     . GLY B 2 114  ? -4.828  -33.747  9.894   1.00 66.66  ? 121  GLY B N     1 
ATOM   9272  C  CA    . GLY B 2 114  ? -5.927  -34.688  9.969   1.00 65.81  ? 121  GLY B CA    1 
ATOM   9273  C  C     . GLY B 2 114  ? -5.880  -35.562  8.728   1.00 67.56  ? 121  GLY B C     1 
ATOM   9274  O  O     . GLY B 2 114  ? -6.235  -35.134  7.636   1.00 84.15  ? 121  GLY B O     1 
ATOM   9275  N  N     . ASN B 2 115  ? -5.428  -36.794  8.897   1.00 69.23  ? 122  ASN B N     1 
ATOM   9276  C  CA    . ASN B 2 115  ? -5.229  -37.694  7.780   1.00 68.45  ? 122  ASN B CA    1 
ATOM   9277  C  C     . ASN B 2 115  ? -6.452  -38.562  7.506   1.00 69.85  ? 122  ASN B C     1 
ATOM   9278  O  O     . ASN B 2 115  ? -7.358  -38.661  8.349   1.00 65.55  ? 122  ASN B O     1 
ATOM   9279  C  CB    . ASN B 2 115  ? -4.014  -38.579  8.036   1.00 73.65  ? 122  ASN B CB    1 
ATOM   9280  C  CG    . ASN B 2 115  ? -3.500  -39.230  6.772   1.00 80.82  ? 122  ASN B CG    1 
ATOM   9281  O  OD1   . ASN B 2 115  ? -3.557  -38.633  5.694   1.00 75.87  ? 122  ASN B OD1   1 
ATOM   9282  N  ND2   . ASN B 2 115  ? -3.003  -40.462  6.892   1.00 85.97  ? 122  ASN B ND2   1 
ATOM   9283  N  N     . LYS B 2 116  ? -6.465  -39.166  6.314   1.00 66.83  ? 123  LYS B N     1 
ATOM   9284  C  CA    . LYS B 2 116  ? -7.508  -40.097  5.876   1.00 59.13  ? 123  LYS B CA    1 
ATOM   9285  C  C     . LYS B 2 116  ? -8.858  -39.417  5.669   1.00 61.00  ? 123  LYS B C     1 
ATOM   9286  O  O     . LYS B 2 116  ? -9.910  -40.012  5.907   1.00 62.04  ? 123  LYS B O     1 
ATOM   9287  C  CB    . LYS B 2 116  ? -7.650  -41.256  6.871   1.00 58.96  ? 123  LYS B CB    1 
ATOM   9288  C  CG    . LYS B 2 116  ? -6.337  -41.957  7.188   1.00 57.47  ? 123  LYS B CG    1 
ATOM   9289  C  CD    . LYS B 2 116  ? -6.570  -43.260  7.928   1.00 60.07  ? 123  LYS B CD    1 
ATOM   9290  C  CE    . LYS B 2 116  ? -5.253  -43.872  8.384   1.00 61.83  ? 123  LYS B CE    1 
ATOM   9291  N  NZ    . LYS B 2 116  ? -5.448  -45.085  9.215   1.00 60.67  ? 123  LYS B NZ    1 
ATOM   9292  N  N     . VAL B 2 117  ? -8.829  -38.177  5.189   1.00 58.18  ? 124  VAL B N     1 
ATOM   9293  C  CA    . VAL B 2 117  ? -10.068 -37.447  4.921   1.00 67.54  ? 124  VAL B CA    1 
ATOM   9294  C  C     . VAL B 2 117  ? -10.786 -38.003  3.695   1.00 72.85  ? 124  VAL B C     1 
ATOM   9295  O  O     . VAL B 2 117  ? -11.886 -37.569  3.365   1.00 82.63  ? 124  VAL B O     1 
ATOM   9296  C  CB    . VAL B 2 117  ? -9.813  -35.948  4.721   1.00 64.67  ? 124  VAL B CB    1 
ATOM   9297  C  CG1   . VAL B 2 117  ? -9.266  -35.331  5.995   1.00 57.40  ? 124  VAL B CG1   1 
ATOM   9298  C  CG2   . VAL B 2 117  ? -8.847  -35.733  3.578   1.00 83.94  ? 124  VAL B CG2   1 
ATOM   9299  N  N     . ASP B 2 118  ? -10.156 -38.970  3.030   1.00 77.45  ? 125  ASP B N     1 
ATOM   9300  C  CA    . ASP B 2 118  ? -10.745 -39.640  1.876   1.00 74.81  ? 125  ASP B CA    1 
ATOM   9301  C  C     . ASP B 2 118  ? -11.846 -40.603  2.304   1.00 80.15  ? 125  ASP B C     1 
ATOM   9302  O  O     . ASP B 2 118  ? -12.842 -40.765  1.602   1.00 75.30  ? 125  ASP B O     1 
ATOM   9303  C  CB    . ASP B 2 118  ? -9.667  -40.376  1.081   1.00 67.24  ? 125  ASP B CB    1 
ATOM   9304  C  CG    . ASP B 2 118  ? -8.977  -41.456  1.887   1.00 78.08  ? 125  ASP B CG    1 
ATOM   9305  O  OD1   . ASP B 2 118  ? -8.200  -41.113  2.794   1.00 75.07  ? 125  ASP B OD1   1 
ATOM   9306  O  OD2   . ASP B 2 118  ? -9.198  -42.653  1.603   1.00 92.83  ? 125  ASP B OD2   1 
ATOM   9307  N  N     . ILE B 2 119  ? -11.664 -41.231  3.464   1.00 82.13  ? 126  ILE B N     1 
ATOM   9308  C  CA    . ILE B 2 119  ? -12.667 -42.142  4.017   1.00 81.44  ? 126  ILE B CA    1 
ATOM   9309  C  C     . ILE B 2 119  ? -13.943 -41.379  4.350   1.00 91.52  ? 126  ILE B C     1 
ATOM   9310  O  O     . ILE B 2 119  ? -13.890 -40.303  4.949   1.00 108.67 ? 126  ILE B O     1 
ATOM   9311  C  CB    . ILE B 2 119  ? -12.149 -42.857  5.270   1.00 71.64  ? 126  ILE B CB    1 
ATOM   9312  C  CG1   . ILE B 2 119  ? -11.002 -43.794  4.904   1.00 68.04  ? 126  ILE B CG1   1 
ATOM   9313  C  CG2   . ILE B 2 119  ? -13.255 -43.646  5.940   1.00 77.48  ? 126  ILE B CG2   1 
ATOM   9314  C  CD1   . ILE B 2 119  ? -10.392 -44.498  6.087   1.00 78.96  ? 126  ILE B CD1   1 
ATOM   9315  N  N     . LYS B 2 120  ? -15.084 -41.935  3.953   1.00 98.90  ? 127  LYS B N     1 
ATOM   9316  C  CA    . LYS B 2 120  ? -16.353 -41.227  4.069   1.00 115.39 ? 127  LYS B CA    1 
ATOM   9317  C  C     . LYS B 2 120  ? -16.817 -41.034  5.509   1.00 123.41 ? 127  LYS B C     1 
ATOM   9318  O  O     . LYS B 2 120  ? -17.128 -39.915  5.919   1.00 138.60 ? 127  LYS B O     1 
ATOM   9319  C  CB    . LYS B 2 120  ? -17.436 -41.950  3.269   1.00 128.93 ? 127  LYS B CB    1 
ATOM   9320  C  CG    . LYS B 2 120  ? -17.324 -41.730  1.767   1.00 136.96 ? 127  LYS B CG    1 
ATOM   9321  C  CD    . LYS B 2 120  ? -16.845 -40.312  1.453   1.00 134.86 ? 127  LYS B CD    1 
ATOM   9322  C  CE    . LYS B 2 120  ? -17.058 -39.957  -0.012  1.00 138.33 ? 127  LYS B CE    1 
ATOM   9323  N  NZ    . LYS B 2 120  ? -16.565 -41.020  -0.934  1.00 138.28 ? 127  LYS B NZ    1 
ATOM   9324  N  N     . ASP B 2 121  ? -16.870 -42.116  6.275   1.00 114.46 ? 128  ASP B N     1 
ATOM   9325  C  CA    . ASP B 2 121  ? -17.277 -42.023  7.672   1.00 118.97 ? 128  ASP B CA    1 
ATOM   9326  C  C     . ASP B 2 121  ? -16.262 -41.228  8.481   1.00 107.45 ? 128  ASP B C     1 
ATOM   9327  O  O     . ASP B 2 121  ? -15.378 -41.801  9.122   1.00 111.10 ? 128  ASP B O     1 
ATOM   9328  C  CB    . ASP B 2 121  ? -17.458 -43.415  8.285   1.00 142.30 ? 128  ASP B CB    1 
ATOM   9329  C  CG    . ASP B 2 121  ? -18.677 -44.140  7.744   1.00 163.37 ? 128  ASP B CG    1 
ATOM   9330  O  OD1   . ASP B 2 121  ? -19.540 -43.476  7.131   1.00 174.07 ? 128  ASP B OD1   1 
ATOM   9331  O  OD2   . ASP B 2 121  ? -18.775 -45.371  7.939   1.00 171.46 ? 128  ASP B OD2   1 
ATOM   9332  N  N     . ARG B 2 122  ? -16.387 -39.905  8.442   1.00 97.07  ? 129  ARG B N     1 
ATOM   9333  C  CA    . ARG B 2 122  ? -15.511 -39.036  9.221   1.00 86.06  ? 129  ARG B CA    1 
ATOM   9334  C  C     . ARG B 2 122  ? -16.016 -38.931  10.652  1.00 82.58  ? 129  ARG B C     1 
ATOM   9335  O  O     . ARG B 2 122  ? -17.152 -38.501  10.889  1.00 89.52  ? 129  ARG B O     1 
ATOM   9336  C  CB    . ARG B 2 122  ? -15.410 -37.647  8.591   1.00 78.97  ? 129  ARG B CB    1 
ATOM   9337  C  CG    . ARG B 2 122  ? -14.470 -36.713  9.323   1.00 73.26  ? 129  ARG B CG    1 
ATOM   9338  C  CD    . ARG B 2 122  ? -13.966 -35.592  8.423   1.00 68.61  ? 129  ARG B CD    1 
ATOM   9339  N  NE    . ARG B 2 122  ? -12.974 -34.761  9.096   1.00 74.47  ? 129  ARG B NE    1 
ATOM   9340  C  CZ    . ARG B 2 122  ? -12.196 -33.876  8.484   1.00 86.65  ? 129  ARG B CZ    1 
ATOM   9341  N  NH1   . ARG B 2 122  ? -12.284 -33.712  7.175   1.00 101.61 ? 129  ARG B NH1   1 
ATOM   9342  N  NH2   . ARG B 2 122  ? -11.324 -33.159  9.177   1.00 91.78  ? 129  ARG B NH2   1 
ATOM   9343  N  N     . LYS B 2 123  ? -15.175 -39.343  11.596  1.00 75.85  ? 130  LYS B N     1 
ATOM   9344  C  CA    . LYS B 2 123  ? -15.541 -39.349  13.008  1.00 87.85  ? 130  LYS B CA    1 
ATOM   9345  C  C     . LYS B 2 123  ? -15.119 -38.050  13.700  1.00 80.80  ? 130  LYS B C     1 
ATOM   9346  O  O     . LYS B 2 123  ? -15.914 -37.429  14.411  1.00 84.66  ? 130  LYS B O     1 
ATOM   9347  C  CB    . LYS B 2 123  ? -14.913 -40.548  13.703  1.00 88.16  ? 130  LYS B CB    1 
ATOM   9348  C  CG    . LYS B 2 123  ? -15.351 -41.875  13.136  1.00 94.12  ? 130  LYS B CG    1 
ATOM   9349  C  CD    . LYS B 2 123  ? -16.838 -42.103  13.341  1.00 108.71 ? 130  LYS B CD    1 
ATOM   9350  C  CE    . LYS B 2 123  ? -17.268 -43.452  12.792  1.00 124.62 ? 130  LYS B CE    1 
ATOM   9351  N  NZ    . LYS B 2 123  ? -18.664 -43.794  13.179  1.00 138.60 ? 130  LYS B NZ    1 
ATOM   9352  N  N     . VAL B 2 124  ? -13.869 -37.651  13.486  1.00 68.11  ? 131  VAL B N     1 
ATOM   9353  C  CA    . VAL B 2 124  ? -13.386 -36.352  13.932  1.00 58.68  ? 131  VAL B CA    1 
ATOM   9354  C  C     . VAL B 2 124  ? -13.804 -35.273  12.943  1.00 64.11  ? 131  VAL B C     1 
ATOM   9355  O  O     . VAL B 2 124  ? -13.115 -35.041  11.946  1.00 83.08  ? 131  VAL B O     1 
ATOM   9356  C  CB    . VAL B 2 124  ? -11.858 -36.336  14.076  1.00 57.08  ? 131  VAL B CB    1 
ATOM   9357  C  CG1   . VAL B 2 124  ? -11.404 -35.070  14.783  1.00 49.53  ? 131  VAL B CG1   1 
ATOM   9358  C  CG2   . VAL B 2 124  ? -11.388 -37.572  14.813  1.00 59.03  ? 131  VAL B CG2   1 
ATOM   9359  N  N     . LYS B 2 125  ? -14.931 -34.619  13.213  1.00 66.79  ? 132  LYS B N     1 
ATOM   9360  C  CA    . LYS B 2 125  ? -15.432 -33.566  12.334  1.00 68.67  ? 132  LYS B CA    1 
ATOM   9361  C  C     . LYS B 2 125  ? -14.487 -32.362  12.333  1.00 79.98  ? 132  LYS B C     1 
ATOM   9362  O  O     . LYS B 2 125  ? -13.724 -32.165  13.278  1.00 76.46  ? 132  LYS B O     1 
ATOM   9363  C  CB    . LYS B 2 125  ? -16.831 -33.132  12.761  1.00 73.61  ? 132  LYS B CB    1 
ATOM   9364  C  CG    . LYS B 2 125  ? -17.731 -34.269  13.210  1.00 86.30  ? 132  LYS B CG    1 
ATOM   9365  C  CD    . LYS B 2 125  ? -17.987 -35.275  12.099  1.00 100.51 ? 132  LYS B CD    1 
ATOM   9366  C  CE    . LYS B 2 125  ? -19.018 -34.770  11.106  1.00 113.24 ? 132  LYS B CE    1 
ATOM   9367  N  NZ    . LYS B 2 125  ? -19.358 -35.812  10.090  1.00 118.85 ? 132  LYS B NZ    1 
ATOM   9368  N  N     . ALA B 2 126  ? -14.532 -31.566  11.269  1.00 90.72  ? 133  ALA B N     1 
ATOM   9369  C  CA    . ALA B 2 126  ? -13.697 -30.371  11.170  1.00 83.88  ? 133  ALA B CA    1 
ATOM   9370  C  C     . ALA B 2 126  ? -14.074 -29.385  12.263  1.00 77.53  ? 133  ALA B C     1 
ATOM   9371  O  O     . ALA B 2 126  ? -13.244 -28.599  12.724  1.00 75.34  ? 133  ALA B O     1 
ATOM   9372  C  CB    . ALA B 2 126  ? -13.837 -29.733  9.799   1.00 80.76  ? 133  ALA B CB    1 
ATOM   9373  N  N     . LYS B 2 127  ? -15.340 -29.443  12.666  1.00 85.21  ? 134  LYS B N     1 
ATOM   9374  C  CA    . LYS B 2 127  ? -15.870 -28.636  13.762  1.00 90.01  ? 134  LYS B CA    1 
ATOM   9375  C  C     . LYS B 2 127  ? -15.150 -28.897  15.094  1.00 81.36  ? 134  LYS B C     1 
ATOM   9376  O  O     . LYS B 2 127  ? -14.988 -28.000  15.905  1.00 96.43  ? 134  LYS B O     1 
ATOM   9377  C  CB    . LYS B 2 127  ? -17.369 -28.909  13.897  1.00 98.03  ? 134  LYS B CB    1 
ATOM   9378  C  CG    . LYS B 2 127  ? -18.021 -28.446  15.178  1.00 113.66 ? 134  LYS B CG    1 
ATOM   9379  C  CD    . LYS B 2 127  ? -19.531 -28.625  15.094  1.00 129.61 ? 134  LYS B CD    1 
ATOM   9380  C  CE    . LYS B 2 127  ? -19.893 -30.020  14.600  1.00 130.25 ? 134  LYS B CE    1 
ATOM   9381  N  NZ    . LYS B 2 127  ? -21.340 -30.146  14.263  1.00 139.09 ? 134  LYS B NZ    1 
ATOM   9382  N  N     . SER B 2 128  ? -14.696 -30.125  15.296  1.00 75.73  ? 135  SER B N     1 
ATOM   9383  C  CA    . SER B 2 128  ? -14.103 -30.534  16.565  1.00 63.58  ? 135  SER B CA    1 
ATOM   9384  C  C     . SER B 2 128  ? -12.608 -30.253  16.661  1.00 73.02  ? 135  SER B C     1 
ATOM   9385  O  O     . SER B 2 128  ? -12.025 -30.348  17.742  1.00 84.88  ? 135  SER B O     1 
ATOM   9386  C  CB    . SER B 2 128  ? -14.344 -32.028  16.797  1.00 65.13  ? 135  SER B CB    1 
ATOM   9387  O  OG    . SER B 2 128  ? -15.729 -32.332  16.745  1.00 77.30  ? 135  SER B OG    1 
ATOM   9388  N  N     . ILE B 2 129  ? -11.982 -29.909  15.541  1.00 65.68  ? 136  ILE B N     1 
ATOM   9389  C  CA    . ILE B 2 129  ? -10.528 -29.764  15.516  1.00 63.16  ? 136  ILE B CA    1 
ATOM   9390  C  C     . ILE B 2 129  ? -10.119 -28.327  15.843  1.00 79.71  ? 136  ILE B C     1 
ATOM   9391  O  O     . ILE B 2 129  ? -10.240 -27.425  15.013  1.00 92.98  ? 136  ILE B O     1 
ATOM   9392  C  CB    . ILE B 2 129  ? -9.959  -30.180  14.152  1.00 52.46  ? 136  ILE B CB    1 
ATOM   9393  C  CG1   . ILE B 2 129  ? -10.332 -31.632  13.857  1.00 57.48  ? 136  ILE B CG1   1 
ATOM   9394  C  CG2   . ILE B 2 129  ? -8.453  -30.013  14.111  1.00 47.37  ? 136  ILE B CG2   1 
ATOM   9395  C  CD1   . ILE B 2 129  ? -10.048 -32.106  12.467  1.00 45.51  ? 136  ILE B CD1   1 
ATOM   9396  N  N     . VAL B 2 130  ? -9.633  -28.115  17.063  1.00 73.12  ? 137  VAL B N     1 
ATOM   9397  C  CA    . VAL B 2 130  ? -9.308  -26.765  17.529  1.00 76.52  ? 137  VAL B CA    1 
ATOM   9398  C  C     . VAL B 2 130  ? -8.055  -26.681  18.396  1.00 68.99  ? 137  VAL B C     1 
ATOM   9399  O  O     . VAL B 2 130  ? -7.676  -25.602  18.826  1.00 74.07  ? 137  VAL B O     1 
ATOM   9400  C  CB    . VAL B 2 130  ? -10.463 -26.160  18.341  1.00 70.37  ? 137  VAL B CB    1 
ATOM   9401  C  CG1   . VAL B 2 130  ? -11.636 -25.796  17.420  1.00 77.53  ? 137  VAL B CG1   1 
ATOM   9402  C  CG2   . VAL B 2 130  ? -10.893 -27.125  19.440  1.00 63.51  ? 137  VAL B CG2   1 
ATOM   9403  N  N     . PHE B 2 131  ? -7.412  -27.814  18.645  1.00 62.10  ? 138  PHE B N     1 
ATOM   9404  C  CA    . PHE B 2 131  ? -6.260  -27.862  19.540  1.00 65.64  ? 138  PHE B CA    1 
ATOM   9405  C  C     . PHE B 2 131  ? -5.135  -26.928  19.119  1.00 70.50  ? 138  PHE B C     1 
ATOM   9406  O  O     . PHE B 2 131  ? -4.467  -26.321  19.954  1.00 89.66  ? 138  PHE B O     1 
ATOM   9407  C  CB    . PHE B 2 131  ? -5.719  -29.292  19.641  1.00 62.51  ? 138  PHE B CB    1 
ATOM   9408  C  CG    . PHE B 2 131  ? -4.428  -29.390  20.401  1.00 56.53  ? 138  PHE B CG    1 
ATOM   9409  C  CD1   . PHE B 2 131  ? -4.412  -29.300  21.788  1.00 56.02  ? 138  PHE B CD1   1 
ATOM   9410  C  CD2   . PHE B 2 131  ? -3.228  -29.547  19.729  1.00 53.53  ? 138  PHE B CD2   1 
ATOM   9411  C  CE1   . PHE B 2 131  ? -3.231  -29.373  22.483  1.00 57.20  ? 138  PHE B CE1   1 
ATOM   9412  C  CE2   . PHE B 2 131  ? -2.036  -29.624  20.427  1.00 59.60  ? 138  PHE B CE2   1 
ATOM   9413  C  CZ    . PHE B 2 131  ? -2.042  -29.536  21.813  1.00 58.49  ? 138  PHE B CZ    1 
ATOM   9414  N  N     . HIS B 2 132  ? -4.933  -26.815  17.815  1.00 62.93  ? 139  HIS B N     1 
ATOM   9415  C  CA    . HIS B 2 132  ? -3.839  -26.014  17.267  1.00 69.70  ? 139  HIS B CA    1 
ATOM   9416  C  C     . HIS B 2 132  ? -4.003  -24.508  17.528  1.00 58.52  ? 139  HIS B C     1 
ATOM   9417  O  O     . HIS B 2 132  ? -3.018  -23.779  17.606  1.00 65.30  ? 139  HIS B O     1 
ATOM   9418  C  CB    . HIS B 2 132  ? -3.716  -26.269  15.760  1.00 52.62  ? 139  HIS B CB    1 
ATOM   9419  C  CG    . HIS B 2 132  ? -4.975  -25.980  15.008  1.00 57.66  ? 139  HIS B CG    1 
ATOM   9420  N  ND1   . HIS B 2 132  ? -6.092  -26.784  15.089  1.00 62.82  ? 139  HIS B ND1   1 
ATOM   9421  C  CD2   . HIS B 2 132  ? -5.305  -24.957  14.186  1.00 52.72  ? 139  HIS B CD2   1 
ATOM   9422  C  CE1   . HIS B 2 132  ? -7.051  -26.279  14.335  1.00 68.07  ? 139  HIS B CE1   1 
ATOM   9423  N  NE2   . HIS B 2 132  ? -6.600  -25.168  13.779  1.00 65.93  ? 139  HIS B NE2   1 
ATOM   9424  N  N     . ARG B 2 133  ? -5.249  -24.058  17.652  1.00 47.56  ? 140  ARG B N     1 
ATOM   9425  C  CA    . ARG B 2 133  ? -5.553  -22.639  17.808  1.00 60.18  ? 140  ARG B CA    1 
ATOM   9426  C  C     . ARG B 2 133  ? -4.775  -21.964  18.945  1.00 65.54  ? 140  ARG B C     1 
ATOM   9427  O  O     . ARG B 2 133  ? -4.009  -21.032  18.699  1.00 84.59  ? 140  ARG B O     1 
ATOM   9428  C  CB    . ARG B 2 133  ? -7.058  -22.441  18.025  1.00 64.09  ? 140  ARG B CB    1 
ATOM   9429  C  CG    . ARG B 2 133  ? -7.920  -22.679  16.797  1.00 56.18  ? 140  ARG B CG    1 
ATOM   9430  C  CD    . ARG B 2 133  ? -9.390  -22.626  17.149  1.00 55.97  ? 140  ARG B CD    1 
ATOM   9431  N  NE    . ARG B 2 133  ? -10.256 -22.468  15.986  1.00 63.11  ? 140  ARG B NE    1 
ATOM   9432  C  CZ    . ARG B 2 133  ? -11.580 -22.374  16.053  1.00 79.47  ? 140  ARG B CZ    1 
ATOM   9433  N  NH1   . ARG B 2 133  ? -12.299 -22.222  14.953  1.00 85.58  ? 140  ARG B NH1   1 
ATOM   9434  N  NH2   . ARG B 2 133  ? -12.194 -22.433  17.224  1.00 88.43  ? 140  ARG B NH2   1 
ATOM   9435  N  N     . LYS B 2 134  ? -4.968  -22.427  20.177  1.00 58.68  ? 141  LYS B N     1 
ATOM   9436  C  CA    . LYS B 2 134  ? -4.286  -21.831  21.321  1.00 68.05  ? 141  LYS B CA    1 
ATOM   9437  C  C     . LYS B 2 134  ? -2.798  -22.162  21.345  1.00 63.47  ? 141  LYS B C     1 
ATOM   9438  O  O     . LYS B 2 134  ? -2.011  -21.467  22.004  1.00 67.45  ? 141  LYS B O     1 
ATOM   9439  C  CB    . LYS B 2 134  ? -4.932  -22.282  22.629  1.00 78.32  ? 141  LYS B CB    1 
ATOM   9440  C  CG    . LYS B 2 134  ? -6.311  -21.697  22.875  1.00 81.40  ? 141  LYS B CG    1 
ATOM   9441  C  CD    . LYS B 2 134  ? -6.853  -22.108  24.227  1.00 87.22  ? 141  LYS B CD    1 
ATOM   9442  C  CE    . LYS B 2 134  ? -8.198  -21.464  24.489  1.00 107.27 ? 141  LYS B CE    1 
ATOM   9443  N  NZ    . LYS B 2 134  ? -8.680  -21.744  25.869  1.00 132.54 ? 141  LYS B NZ    1 
ATOM   9444  N  N     . LYS B 2 135  ? -2.414  -23.213  20.625  1.00 54.75  ? 142  LYS B N     1 
ATOM   9445  C  CA    . LYS B 2 135  ? -1.018  -23.631  20.571  1.00 66.45  ? 142  LYS B CA    1 
ATOM   9446  C  C     . LYS B 2 135  ? -0.291  -22.986  19.405  1.00 73.89  ? 142  LYS B C     1 
ATOM   9447  O  O     . LYS B 2 135  ? 0.904   -23.237  19.197  1.00 75.06  ? 142  LYS B O     1 
ATOM   9448  C  CB    . LYS B 2 135  ? -0.913  -25.149  20.467  1.00 66.76  ? 142  LYS B CB    1 
ATOM   9449  C  CG    . LYS B 2 135  ? -1.498  -25.875  21.669  1.00 65.89  ? 142  LYS B CG    1 
ATOM   9450  C  CD    . LYS B 2 135  ? -0.825  -25.437  22.954  1.00 60.32  ? 142  LYS B CD    1 
ATOM   9451  C  CE    . LYS B 2 135  ? -1.337  -26.239  24.132  1.00 75.59  ? 142  LYS B CE    1 
ATOM   9452  N  NZ    . LYS B 2 135  ? -0.608  -25.929  25.393  1.00 87.30  ? 142  LYS B NZ    1 
ATOM   9453  N  N     . ASN B 2 136  ? -1.023  -22.172  18.645  1.00 74.30  ? 143  ASN B N     1 
ATOM   9454  C  CA    . ASN B 2 136  ? -0.493  -21.498  17.459  1.00 79.95  ? 143  ASN B CA    1 
ATOM   9455  C  C     . ASN B 2 136  ? 0.118   -22.455  16.429  1.00 76.16  ? 143  ASN B C     1 
ATOM   9456  O  O     . ASN B 2 136  ? 1.029   -22.093  15.707  1.00 88.36  ? 143  ASN B O     1 
ATOM   9457  C  CB    . ASN B 2 136  ? 0.538   -20.452  17.877  1.00 91.06  ? 143  ASN B CB    1 
ATOM   9458  C  CG    . ASN B 2 136  ? -0.041  -19.411  18.832  1.00 104.06 ? 143  ASN B CG    1 
ATOM   9459  O  OD1   . ASN B 2 136  ? 0.488   -19.189  19.919  1.00 118.32 ? 143  ASN B OD1   1 
ATOM   9460  N  ND2   . ASN B 2 136  ? -1.129  -18.770  18.424  1.00 108.54 ? 143  ASN B ND2   1 
ATOM   9461  N  N     . LEU B 2 137  ? -0.383  -23.685  16.380  1.00 69.74  ? 144  LEU B N     1 
ATOM   9462  C  CA    . LEU B 2 137  ? 0.048   -24.662  15.380  1.00 66.01  ? 144  LEU B CA    1 
ATOM   9463  C  C     . LEU B 2 137  ? -0.695  -24.410  14.074  1.00 76.08  ? 144  LEU B C     1 
ATOM   9464  O  O     . LEU B 2 137  ? -1.788  -23.838  14.074  1.00 82.78  ? 144  LEU B O     1 
ATOM   9465  C  CB    . LEU B 2 137  ? -0.227  -26.099  15.834  1.00 64.57  ? 144  LEU B CB    1 
ATOM   9466  C  CG    . LEU B 2 137  ? 0.162   -26.565  17.233  1.00 79.33  ? 144  LEU B CG    1 
ATOM   9467  C  CD1   . LEU B 2 137  ? -0.554  -27.872  17.551  1.00 78.00  ? 144  LEU B CD1   1 
ATOM   9468  C  CD2   . LEU B 2 137  ? 1.658   -26.748  17.353  1.00 81.87  ? 144  LEU B CD2   1 
ATOM   9469  N  N     . GLN B 2 138  ? -0.119  -24.846  12.957  1.00 77.98  ? 145  GLN B N     1 
ATOM   9470  C  CA    . GLN B 2 138  ? -0.828  -24.740  11.681  1.00 81.66  ? 145  GLN B CA    1 
ATOM   9471  C  C     . GLN B 2 138  ? -1.623  -26.021  11.435  1.00 87.48  ? 145  GLN B C     1 
ATOM   9472  O  O     . GLN B 2 138  ? -1.123  -27.095  11.710  1.00 89.64  ? 145  GLN B O     1 
ATOM   9473  C  CB    . GLN B 2 138  ? 0.167   -24.482  10.541  1.00 87.25  ? 145  GLN B CB    1 
ATOM   9474  C  CG    . GLN B 2 138  ? -0.398  -24.687  9.146   1.00 87.83  ? 145  GLN B CG    1 
ATOM   9475  C  CD    . GLN B 2 138  ? -1.417  -23.634  8.769   1.00 85.40  ? 145  GLN B CD    1 
ATOM   9476  O  OE1   . GLN B 2 138  ? -2.615  -23.786  9.024   1.00 87.31  ? 145  GLN B OE1   1 
ATOM   9477  N  NE2   . GLN B 2 138  ? -0.947  -22.561  8.143   1.00 88.97  ? 145  GLN B NE2   1 
ATOM   9478  N  N     . TYR B 2 139  ? -2.852  -25.931  10.932  1.00 76.38  ? 146  TYR B N     1 
ATOM   9479  C  CA    . TYR B 2 139  ? -3.617  -27.156  10.671  1.00 63.33  ? 146  TYR B CA    1 
ATOM   9480  C  C     . TYR B 2 139  ? -3.869  -27.444  9.177   1.00 68.94  ? 146  TYR B C     1 
ATOM   9481  O  O     . TYR B 2 139  ? -4.038  -26.515  8.372   1.00 72.82  ? 146  TYR B O     1 
ATOM   9482  C  CB    . TYR B 2 139  ? -4.967  -27.123  11.386  1.00 52.38  ? 146  TYR B CB    1 
ATOM   9483  C  CG    . TYR B 2 139  ? -5.778  -28.353  11.068  1.00 59.65  ? 146  TYR B CG    1 
ATOM   9484  C  CD1   . TYR B 2 139  ? -5.365  -29.610  11.502  1.00 72.16  ? 146  TYR B CD1   1 
ATOM   9485  C  CD2   . TYR B 2 139  ? -6.924  -28.274  10.304  1.00 60.79  ? 146  TYR B CD2   1 
ATOM   9486  C  CE1   . TYR B 2 139  ? -6.074  -30.746  11.195  1.00 79.23  ? 146  TYR B CE1   1 
ATOM   9487  C  CE2   . TYR B 2 139  ? -7.651  -29.418  9.987   1.00 81.77  ? 146  TYR B CE2   1 
ATOM   9488  C  CZ    . TYR B 2 139  ? -7.218  -30.647  10.437  1.00 85.26  ? 146  TYR B CZ    1 
ATOM   9489  O  OH    . TYR B 2 139  ? -7.928  -31.780  10.121  1.00 88.07  ? 146  TYR B OH    1 
ATOM   9490  N  N     . TYR B 2 140  ? -3.894  -28.733  8.819   1.00 76.17  ? 147  TYR B N     1 
ATOM   9491  C  CA    . TYR B 2 140  ? -4.277  -29.176  7.470   1.00 69.90  ? 147  TYR B CA    1 
ATOM   9492  C  C     . TYR B 2 140  ? -5.046  -30.504  7.455   1.00 66.54  ? 147  TYR B C     1 
ATOM   9493  O  O     . TYR B 2 140  ? -4.642  -31.482  8.084   1.00 71.99  ? 147  TYR B O     1 
ATOM   9494  C  CB    . TYR B 2 140  ? -3.044  -29.328  6.575   1.00 59.57  ? 147  TYR B CB    1 
ATOM   9495  C  CG    . TYR B 2 140  ? -2.481  -28.031  6.047   1.00 58.46  ? 147  TYR B CG    1 
ATOM   9496  C  CD1   . TYR B 2 140  ? -3.301  -27.079  5.454   1.00 47.54  ? 147  TYR B CD1   1 
ATOM   9497  C  CD2   . TYR B 2 140  ? -1.121  -27.756  6.148   1.00 69.98  ? 147  TYR B CD2   1 
ATOM   9498  C  CE1   . TYR B 2 140  ? -2.782  -25.885  4.994   1.00 63.15  ? 147  TYR B CE1   1 
ATOM   9499  C  CE2   . TYR B 2 140  ? -0.595  -26.561  5.683   1.00 78.04  ? 147  TYR B CE2   1 
ATOM   9500  C  CZ    . TYR B 2 140  ? -1.431  -25.636  5.110   1.00 78.06  ? 147  TYR B CZ    1 
ATOM   9501  O  OH    . TYR B 2 140  ? -0.910  -24.457  4.643   1.00 95.87  ? 147  TYR B OH    1 
ATOM   9502  N  N     . ASP B 2 141  ? -6.163  -30.526  6.733   1.00 68.16  ? 148  ASP B N     1 
ATOM   9503  C  CA    . ASP B 2 141  ? -6.797  -31.779  6.321   1.00 58.37  ? 148  ASP B CA    1 
ATOM   9504  C  C     . ASP B 2 141  ? -5.957  -32.394  5.216   1.00 72.65  ? 148  ASP B C     1 
ATOM   9505  O  O     . ASP B 2 141  ? -5.715  -31.743  4.197   1.00 95.66  ? 148  ASP B O     1 
ATOM   9506  C  CB    . ASP B 2 141  ? -8.218  -31.553  5.803   1.00 57.03  ? 148  ASP B CB    1 
ATOM   9507  C  CG    . ASP B 2 141  ? -9.249  -31.602  6.888   1.00 77.30  ? 148  ASP B CG    1 
ATOM   9508  O  OD1   . ASP B 2 141  ? -8.867  -31.725  8.085   1.00 86.85  ? 148  ASP B OD1   1 
ATOM   9509  O  OD2   . ASP B 2 141  ? -10.448 -31.511  6.534   1.00 80.04  ? 148  ASP B OD2   1 
ATOM   9510  N  N     . ILE B 2 142  ? -5.500  -33.629  5.395   1.00 61.06  ? 149  ILE B N     1 
ATOM   9511  C  CA    . ILE B 2 142  ? -4.762  -34.277  4.324   1.00 73.26  ? 149  ILE B CA    1 
ATOM   9512  C  C     . ILE B 2 142  ? -5.223  -35.714  4.079   1.00 78.25  ? 149  ILE B C     1 
ATOM   9513  O  O     . ILE B 2 142  ? -5.948  -36.305  4.882   1.00 72.27  ? 149  ILE B O     1 
ATOM   9514  C  CB    . ILE B 2 142  ? -3.245  -34.283  4.587   1.00 65.84  ? 149  ILE B CB    1 
ATOM   9515  C  CG1   . ILE B 2 142  ? -2.865  -35.373  5.570   1.00 53.19  ? 149  ILE B CG1   1 
ATOM   9516  C  CG2   . ILE B 2 142  ? -2.749  -32.935  5.061   1.00 76.16  ? 149  ILE B CG2   1 
ATOM   9517  C  CD1   . ILE B 2 142  ? -1.386  -35.598  5.613   1.00 62.33  ? 149  ILE B CD1   1 
ATOM   9518  N  N     . SER B 2 143  ? -4.801  -36.260  2.943   1.00 84.36  ? 150  SER B N     1 
ATOM   9519  C  CA    . SER B 2 143  ? -5.068  -37.653  2.604   1.00 74.27  ? 150  SER B CA    1 
ATOM   9520  C  C     . SER B 2 143  ? -3.885  -38.222  1.843   1.00 71.11  ? 150  SER B C     1 
ATOM   9521  O  O     . SER B 2 143  ? -3.561  -37.746  0.753   1.00 83.24  ? 150  SER B O     1 
ATOM   9522  C  CB    . SER B 2 143  ? -6.351  -37.785  1.773   1.00 64.90  ? 150  SER B CB    1 
ATOM   9523  O  OG    . SER B 2 143  ? -6.653  -39.147  1.523   1.00 65.00  ? 150  SER B OG    1 
ATOM   9524  N  N     . ALA B 2 144  ? -3.236  -39.230  2.418   1.00 57.73  ? 151  ALA B N     1 
ATOM   9525  C  CA    . ALA B 2 144  ? -2.096  -39.850  1.755   1.00 70.59  ? 151  ALA B CA    1 
ATOM   9526  C  C     . ALA B 2 144  ? -2.559  -40.829  0.664   1.00 76.21  ? 151  ALA B C     1 
ATOM   9527  O  O     . ALA B 2 144  ? -1.746  -41.424  -0.032  1.00 76.57  ? 151  ALA B O     1 
ATOM   9528  C  CB    . ALA B 2 144  ? -1.213  -40.555  2.772   1.00 63.77  ? 151  ALA B CB    1 
ATOM   9529  N  N     . LYS B 2 145  ? -3.870  -40.987  0.528   1.00 64.48  ? 152  LYS B N     1 
ATOM   9530  C  CA    . LYS B 2 145  ? -4.430  -41.946  -0.403  1.00 79.88  ? 152  LYS B CA    1 
ATOM   9531  C  C     . LYS B 2 145  ? -4.927  -41.243  -1.665  1.00 89.73  ? 152  LYS B C     1 
ATOM   9532  O  O     . LYS B 2 145  ? -4.499  -41.572  -2.769  1.00 111.08 ? 152  LYS B O     1 
ATOM   9533  C  CB    . LYS B 2 145  ? -5.561  -42.736  0.265   1.00 83.94  ? 152  LYS B CB    1 
ATOM   9534  C  CG    . LYS B 2 145  ? -6.108  -43.882  -0.589  1.00 87.53  ? 152  LYS B CG    1 
ATOM   9535  C  CD    . LYS B 2 145  ? -6.951  -44.811  0.269   1.00 91.69  ? 152  LYS B CD    1 
ATOM   9536  C  CE    . LYS B 2 145  ? -7.492  -45.979  -0.548  1.00 88.99  ? 152  LYS B CE    1 
ATOM   9537  N  NZ    . LYS B 2 145  ? -8.534  -45.532  -1.502  1.00 99.99  ? 152  LYS B NZ    1 
ATOM   9538  N  N     . SER B 2 146  ? -5.822  -40.273  -1.497  1.00 84.12  ? 153  SER B N     1 
ATOM   9539  C  CA    . SER B 2 146  ? -6.344  -39.516  -2.626  1.00 81.46  ? 153  SER B CA    1 
ATOM   9540  C  C     . SER B 2 146  ? -5.480  -38.292  -2.911  1.00 80.32  ? 153  SER B C     1 
ATOM   9541  O  O     . SER B 2 146  ? -5.799  -37.487  -3.780  1.00 86.45  ? 153  SER B O     1 
ATOM   9542  C  CB    . SER B 2 146  ? -7.794  -39.096  -2.372  1.00 83.07  ? 153  SER B CB    1 
ATOM   9543  O  OG    . SER B 2 146  ? -7.876  -38.139  -1.338  1.00 81.53  ? 153  SER B OG    1 
ATOM   9544  N  N     . ASN B 2 147  ? -4.390  -38.167  -2.160  1.00 75.30  ? 154  ASN B N     1 
ATOM   9545  C  CA    . ASN B 2 147  ? -3.405  -37.093  -2.326  1.00 89.59  ? 154  ASN B CA    1 
ATOM   9546  C  C     . ASN B 2 147  ? -3.923  -35.677  -2.011  1.00 91.43  ? 154  ASN B C     1 
ATOM   9547  O  O     . ASN B 2 147  ? -3.395  -34.696  -2.515  1.00 104.30 ? 154  ASN B O     1 
ATOM   9548  C  CB    . ASN B 2 147  ? -2.831  -37.116  -3.742  1.00 96.55  ? 154  ASN B CB    1 
ATOM   9549  C  CG    . ASN B 2 147  ? -1.343  -37.382  -3.758  1.00 122.84 ? 154  ASN B CG    1 
ATOM   9550  O  OD1   . ASN B 2 147  ? -0.847  -38.240  -3.031  1.00 135.31 ? 154  ASN B OD1   1 
ATOM   9551  N  ND2   . ASN B 2 147  ? -0.620  -36.642  -4.583  1.00 139.26 ? 154  ASN B ND2   1 
ATOM   9552  N  N     . TYR B 2 148  ? -4.942  -35.575  -1.166  1.00 76.84  ? 155  TYR B N     1 
ATOM   9553  C  CA    . TYR B 2 148  ? -5.550  -34.289  -0.840  1.00 66.44  ? 155  TYR B CA    1 
ATOM   9554  C  C     . TYR B 2 148  ? -4.652  -33.452  0.073   1.00 66.44  ? 155  TYR B C     1 
ATOM   9555  O  O     . TYR B 2 148  ? -4.224  -33.907  1.131   1.00 64.88  ? 155  TYR B O     1 
ATOM   9556  C  CB    . TYR B 2 148  ? -6.915  -34.508  -0.183  1.00 68.40  ? 155  TYR B CB    1 
ATOM   9557  C  CG    . TYR B 2 148  ? -7.610  -33.241  0.233   1.00 75.46  ? 155  TYR B CG    1 
ATOM   9558  C  CD1   . TYR B 2 148  ? -8.223  -32.426  -0.707  1.00 72.60  ? 155  TYR B CD1   1 
ATOM   9559  C  CD2   . TYR B 2 148  ? -7.666  -32.861  1.570   1.00 78.00  ? 155  TYR B CD2   1 
ATOM   9560  C  CE1   . TYR B 2 148  ? -8.865  -31.258  -0.331  1.00 72.88  ? 155  TYR B CE1   1 
ATOM   9561  C  CE2   . TYR B 2 148  ? -8.306  -31.694  1.951   1.00 77.47  ? 155  TYR B CE2   1 
ATOM   9562  C  CZ    . TYR B 2 148  ? -8.901  -30.900  0.995   1.00 81.84  ? 155  TYR B CZ    1 
ATOM   9563  O  OH    . TYR B 2 148  ? -9.540  -29.745  1.372   1.00 100.35 ? 155  TYR B OH    1 
ATOM   9564  N  N     . ASN B 2 149  ? -4.397  -32.212  -0.336  1.00 75.40  ? 156  ASN B N     1 
ATOM   9565  C  CA    . ASN B 2 149  ? -3.497  -31.296  0.382   1.00 79.15  ? 156  ASN B CA    1 
ATOM   9566  C  C     . ASN B 2 149  ? -2.170  -31.946  0.732   1.00 72.03  ? 156  ASN B C     1 
ATOM   9567  O  O     . ASN B 2 149  ? -1.641  -31.755  1.803   1.00 70.82  ? 156  ASN B O     1 
ATOM   9568  C  CB    . ASN B 2 149  ? -4.159  -30.757  1.654   1.00 74.06  ? 156  ASN B CB    1 
ATOM   9569  C  CG    . ASN B 2 149  ? -5.213  -29.714  1.363   1.00 84.65  ? 156  ASN B CG    1 
ATOM   9570  O  OD1   . ASN B 2 149  ? -5.212  -29.083  0.304   1.00 92.75  ? 156  ASN B OD1   1 
ATOM   9571  N  ND2   . ASN B 2 149  ? -6.116  -29.517  2.311   1.00 85.80  ? 156  ASN B ND2   1 
ATOM   9572  N  N     . PHE B 2 150  ? -1.636  -32.706  -0.207  1.00 79.80  ? 157  PHE B N     1 
ATOM   9573  C  CA    . PHE B 2 150  ? -0.502  -33.576  0.033   1.00 87.98  ? 157  PHE B CA    1 
ATOM   9574  C  C     . PHE B 2 150  ? 0.798   -32.862  0.406   1.00 76.73  ? 157  PHE B C     1 
ATOM   9575  O  O     . PHE B 2 150  ? 1.571   -33.381  1.197   1.00 72.25  ? 157  PHE B O     1 
ATOM   9576  C  CB    . PHE B 2 150  ? -0.271  -34.450  -1.209  1.00 108.45 ? 157  PHE B CB    1 
ATOM   9577  C  CG    . PHE B 2 150  ? 0.672   -35.587  -0.975  1.00 120.04 ? 157  PHE B CG    1 
ATOM   9578  C  CD1   . PHE B 2 150  ? 0.465   -36.463  0.080   1.00 121.76 ? 157  PHE B CD1   1 
ATOM   9579  C  CD2   . PHE B 2 150  ? 1.760   -35.786  -1.806  1.00 122.25 ? 157  PHE B CD2   1 
ATOM   9580  C  CE1   . PHE B 2 150  ? 1.328   -37.514  0.304   1.00 123.98 ? 157  PHE B CE1   1 
ATOM   9581  C  CE2   . PHE B 2 150  ? 2.627   -36.836  -1.586  1.00 128.41 ? 157  PHE B CE2   1 
ATOM   9582  C  CZ    . PHE B 2 150  ? 2.410   -37.702  -0.531  1.00 128.24 ? 157  PHE B CZ    1 
ATOM   9583  N  N     . GLU B 2 151  ? 1.052   -31.689  -0.165  1.00 92.66  ? 158  GLU B N     1 
ATOM   9584  C  CA    . GLU B 2 151  ? 2.329   -31.008  0.047   1.00 94.33  ? 158  GLU B CA    1 
ATOM   9585  C  C     . GLU B 2 151  ? 2.215   -29.760  0.917   1.00 104.07 ? 158  GLU B C     1 
ATOM   9586  O  O     . GLU B 2 151  ? 3.222   -29.109  1.204   1.00 109.69 ? 158  GLU B O     1 
ATOM   9587  C  CB    . GLU B 2 151  ? 2.959   -30.630  -1.291  1.00 92.53  ? 158  GLU B CB    1 
ATOM   9588  C  CG    . GLU B 2 151  ? 3.467   -31.822  -2.089  1.00 106.88 ? 158  GLU B CG    1 
ATOM   9589  C  CD    . GLU B 2 151  ? 4.128   -31.419  -3.390  1.00 114.56 ? 158  GLU B CD    1 
ATOM   9590  O  OE1   . GLU B 2 151  ? 4.277   -30.205  -3.636  1.00 123.99 ? 158  GLU B OE1   1 
ATOM   9591  O  OE2   . GLU B 2 151  ? 4.496   -32.322  -4.165  1.00 112.80 ? 158  GLU B OE2   1 
ATOM   9592  N  N     . LYS B 2 152  ? 0.996   -29.439  1.341   1.00 97.40  ? 159  LYS B N     1 
ATOM   9593  C  CA    . LYS B 2 152  ? 0.757   -28.254  2.155   1.00 88.23  ? 159  LYS B CA    1 
ATOM   9594  C  C     . LYS B 2 152  ? 1.595   -28.211  3.443   1.00 81.85  ? 159  LYS B C     1 
ATOM   9595  O  O     . LYS B 2 152  ? 2.151   -27.159  3.763   1.00 87.10  ? 159  LYS B O     1 
ATOM   9596  C  CB    . LYS B 2 152  ? -0.737  -28.138  2.482   1.00 83.60  ? 159  LYS B CB    1 
ATOM   9597  C  CG    . LYS B 2 152  ? -1.643  -28.093  1.255   1.00 93.86  ? 159  LYS B CG    1 
ATOM   9598  C  CD    . LYS B 2 152  ? -2.564  -26.877  1.251   1.00 88.31  ? 159  LYS B CD    1 
ATOM   9599  C  CE    . LYS B 2 152  ? -1.775  -25.582  1.145   1.00 88.92  ? 159  LYS B CE    1 
ATOM   9600  N  NZ    . LYS B 2 152  ? -2.657  -24.382  1.185   1.00 98.04  ? 159  LYS B NZ    1 
ATOM   9601  N  N     . PRO B 2 153  ? 1.696   -29.336  4.186   1.00 86.07  ? 160  PRO B N     1 
ATOM   9602  C  CA    . PRO B 2 153  ? 2.523   -29.284  5.403   1.00 81.19  ? 160  PRO B CA    1 
ATOM   9603  C  C     . PRO B 2 153  ? 3.981   -28.914  5.128   1.00 88.16  ? 160  PRO B C     1 
ATOM   9604  O  O     . PRO B 2 153  ? 4.533   -28.008  5.777   1.00 91.11  ? 160  PRO B O     1 
ATOM   9605  C  CB    . PRO B 2 153  ? 2.439   -30.711  5.943   1.00 68.52  ? 160  PRO B CB    1 
ATOM   9606  C  CG    . PRO B 2 153  ? 1.148   -31.214  5.436   1.00 71.33  ? 160  PRO B CG    1 
ATOM   9607  C  CD    . PRO B 2 153  ? 0.988   -30.626  4.075   1.00 88.09  ? 160  PRO B CD    1 
ATOM   9608  N  N     . PHE B 2 154  ? 4.591   -29.608  4.171   1.00 84.81  ? 161  PHE B N     1 
ATOM   9609  C  CA    . PHE B 2 154  ? 5.991   -29.386  3.850   1.00 75.05  ? 161  PHE B CA    1 
ATOM   9610  C  C     . PHE B 2 154  ? 6.189   -27.997  3.275   1.00 84.49  ? 161  PHE B C     1 
ATOM   9611  O  O     . PHE B 2 154  ? 7.227   -27.367  3.498   1.00 76.33  ? 161  PHE B O     1 
ATOM   9612  C  CB    . PHE B 2 154  ? 6.489   -30.440  2.873   1.00 77.21  ? 161  PHE B CB    1 
ATOM   9613  C  CG    . PHE B 2 154  ? 6.649   -31.807  3.481   1.00 85.69  ? 161  PHE B CG    1 
ATOM   9614  C  CD1   . PHE B 2 154  ? 7.720   -32.086  4.309   1.00 85.09  ? 161  PHE B CD1   1 
ATOM   9615  C  CD2   . PHE B 2 154  ? 5.740   -32.816  3.207   1.00 84.16  ? 161  PHE B CD2   1 
ATOM   9616  C  CE1   . PHE B 2 154  ? 7.874   -33.337  4.861   1.00 84.36  ? 161  PHE B CE1   1 
ATOM   9617  C  CE2   . PHE B 2 154  ? 5.893   -34.068  3.756   1.00 78.22  ? 161  PHE B CE2   1 
ATOM   9618  C  CZ    . PHE B 2 154  ? 6.959   -34.330  4.579   1.00 82.88  ? 161  PHE B CZ    1 
ATOM   9619  N  N     . LEU B 2 155  ? 5.191   -27.522  2.534   1.00 91.87  ? 162  LEU B N     1 
ATOM   9620  C  CA    . LEU B 2 155  ? 5.261   -26.195  1.924   1.00 91.53  ? 162  LEU B CA    1 
ATOM   9621  C  C     . LEU B 2 155  ? 5.243   -25.098  2.994   1.00 90.27  ? 162  LEU B C     1 
ATOM   9622  O  O     . LEU B 2 155  ? 6.069   -24.172  2.978   1.00 86.04  ? 162  LEU B O     1 
ATOM   9623  C  CB    . LEU B 2 155  ? 4.110   -26.001  0.934   1.00 66.37  ? 162  LEU B CB    1 
ATOM   9624  C  CG    . LEU B 2 155  ? 3.964   -24.612  0.320   1.00 66.05  ? 162  LEU B CG    1 
ATOM   9625  C  CD1   . LEU B 2 155  ? 5.243   -24.194  -0.346  1.00 67.67  ? 162  LEU B CD1   1 
ATOM   9626  C  CD2   . LEU B 2 155  ? 2.780   -24.566  -0.631  1.00 70.15  ? 162  LEU B CD2   1 
ATOM   9627  N  N     . TRP B 2 156  ? 4.300   -25.219  3.927   1.00 84.17  ? 163  TRP B N     1 
ATOM   9628  C  CA    . TRP B 2 156  ? 4.170   -24.263  5.028   1.00 76.98  ? 163  TRP B CA    1 
ATOM   9629  C  C     . TRP B 2 156  ? 5.418   -24.263  5.900   1.00 82.10  ? 163  TRP B C     1 
ATOM   9630  O  O     . TRP B 2 156  ? 5.934   -23.205  6.272   1.00 95.83  ? 163  TRP B O     1 
ATOM   9631  C  CB    . TRP B 2 156  ? 2.928   -24.573  5.872   1.00 58.10  ? 163  TRP B CB    1 
ATOM   9632  C  CG    . TRP B 2 156  ? 2.645   -23.550  6.922   1.00 69.14  ? 163  TRP B CG    1 
ATOM   9633  C  CD1   . TRP B 2 156  ? 1.934   -22.399  6.776   1.00 82.10  ? 163  TRP B CD1   1 
ATOM   9634  C  CD2   . TRP B 2 156  ? 3.060   -23.593  8.294   1.00 86.23  ? 163  TRP B CD2   1 
ATOM   9635  N  NE1   . TRP B 2 156  ? 1.890   -21.716  7.967   1.00 87.46  ? 163  TRP B NE1   1 
ATOM   9636  C  CE2   . TRP B 2 156  ? 2.572   -22.433  8.914   1.00 92.74  ? 163  TRP B CE2   1 
ATOM   9637  C  CE3   . TRP B 2 156  ? 3.798   -24.504  9.057   1.00 83.26  ? 163  TRP B CE3   1 
ATOM   9638  C  CZ2   . TRP B 2 156  ? 2.797   -22.161  10.257  1.00 100.01 ? 163  TRP B CZ2   1 
ATOM   9639  C  CZ3   . TRP B 2 156  ? 4.020   -24.232  10.380  1.00 79.97  ? 163  TRP B CZ3   1 
ATOM   9640  C  CH2   . TRP B 2 156  ? 3.522   -23.073  10.971  1.00 86.83  ? 163  TRP B CH2   1 
ATOM   9641  N  N     . LEU B 2 157  ? 5.908   -25.458  6.212   1.00 83.14  ? 164  LEU B N     1 
ATOM   9642  C  CA    . LEU B 2 157  ? 7.125   -25.580  7.000   1.00 75.10  ? 164  LEU B CA    1 
ATOM   9643  C  C     . LEU B 2 157  ? 8.324   -24.959  6.273   1.00 81.83  ? 164  LEU B C     1 
ATOM   9644  O  O     . LEU B 2 157  ? 9.122   -24.239  6.883   1.00 82.50  ? 164  LEU B O     1 
ATOM   9645  C  CB    . LEU B 2 157  ? 7.402   -27.045  7.338   1.00 68.79  ? 164  LEU B CB    1 
ATOM   9646  C  CG    . LEU B 2 157  ? 6.462   -27.637  8.397   1.00 70.40  ? 164  LEU B CG    1 
ATOM   9647  C  CD1   . LEU B 2 157  ? 6.748   -29.108  8.635   1.00 76.09  ? 164  LEU B CD1   1 
ATOM   9648  C  CD2   . LEU B 2 157  ? 6.567   -26.866  9.707   1.00 63.22  ? 164  LEU B CD2   1 
ATOM   9649  N  N     . ALA B 2 158  ? 8.435   -25.220  4.971   1.00 76.57  ? 165  ALA B N     1 
ATOM   9650  C  CA    . ALA B 2 158  ? 9.527   -24.681  4.179   1.00 74.44  ? 165  ALA B CA    1 
ATOM   9651  C  C     . ALA B 2 158  ? 9.499   -23.160  4.212   1.00 83.75  ? 165  ALA B C     1 
ATOM   9652  O  O     . ALA B 2 158  ? 10.538  -22.510  4.407   1.00 97.65  ? 165  ALA B O     1 
ATOM   9653  C  CB    . ALA B 2 158  ? 9.445   -25.179  2.753   1.00 91.92  ? 165  ALA B CB    1 
ATOM   9654  N  N     . ARG B 2 159  ? 8.309   -22.599  4.012   1.00 78.27  ? 166  ARG B N     1 
ATOM   9655  C  CA    . ARG B 2 159  ? 8.131   -21.153  4.080   1.00 81.45  ? 166  ARG B CA    1 
ATOM   9656  C  C     . ARG B 2 159  ? 8.564   -20.597  5.432   1.00 95.81  ? 166  ARG B C     1 
ATOM   9657  O  O     . ARG B 2 159  ? 9.296   -19.607  5.501   1.00 102.58 ? 166  ARG B O     1 
ATOM   9658  C  CB    . ARG B 2 159  ? 6.676   -20.792  3.803   1.00 82.04  ? 166  ARG B CB    1 
ATOM   9659  C  CG    . ARG B 2 159  ? 6.296   -20.931  2.337   1.00 93.21  ? 166  ARG B CG    1 
ATOM   9660  C  CD    . ARG B 2 159  ? 4.809   -20.747  2.097   1.00 83.58  ? 166  ARG B CD    1 
ATOM   9661  N  NE    . ARG B 2 159  ? 4.542   -20.504  0.684   1.00 86.89  ? 166  ARG B NE    1 
ATOM   9662  C  CZ    . ARG B 2 159  ? 3.380   -20.717  0.082   1.00 77.61  ? 166  ARG B CZ    1 
ATOM   9663  N  NH1   . ARG B 2 159  ? 2.355   -21.187  0.752   1.00 67.55  ? 166  ARG B NH1   1 
ATOM   9664  N  NH2   . ARG B 2 159  ? 3.248   -20.460  -1.204  1.00 99.10  ? 166  ARG B NH2   1 
ATOM   9665  N  N     . LYS B 2 160  ? 8.121   -21.253  6.504   1.00 88.23  ? 167  LYS B N     1 
ATOM   9666  C  CA    . LYS B 2 160  ? 8.446   -20.814  7.857   1.00 70.98  ? 167  LYS B CA    1 
ATOM   9667  C  C     . LYS B 2 160  ? 9.952   -20.840  8.136   1.00 75.14  ? 167  LYS B C     1 
ATOM   9668  O  O     . LYS B 2 160  ? 10.501  -19.875  8.680   1.00 72.89  ? 167  LYS B O     1 
ATOM   9669  C  CB    . LYS B 2 160  ? 7.710   -21.677  8.875   1.00 67.75  ? 167  LYS B CB    1 
ATOM   9670  C  CG    . LYS B 2 160  ? 6.267   -21.255  9.101   1.00 74.32  ? 167  LYS B CG    1 
ATOM   9671  C  CD    . LYS B 2 160  ? 6.223   -19.913  9.802   1.00 95.22  ? 167  LYS B CD    1 
ATOM   9672  C  CE    . LYS B 2 160  ? 4.806   -19.377  9.901   1.00 107.43 ? 167  LYS B CE    1 
ATOM   9673  N  NZ    . LYS B 2 160  ? 4.772   -18.074  10.625  1.00 117.18 ? 167  LYS B NZ    1 
ATOM   9674  N  N     . LEU B 2 161  ? 10.615  -21.930  7.754   1.00 74.95  ? 168  LEU B N     1 
ATOM   9675  C  CA    . LEU B 2 161  ? 12.040  -22.112  8.036   1.00 73.59  ? 168  LEU B CA    1 
ATOM   9676  C  C     . LEU B 2 161  ? 12.910  -21.190  7.197   1.00 85.43  ? 168  LEU B C     1 
ATOM   9677  O  O     . LEU B 2 161  ? 13.871  -20.606  7.693   1.00 101.38 ? 168  LEU B O     1 
ATOM   9678  C  CB    . LEU B 2 161  ? 12.452  -23.562  7.788   1.00 77.00  ? 168  LEU B CB    1 
ATOM   9679  C  CG    . LEU B 2 161  ? 11.760  -24.631  8.633   1.00 75.25  ? 168  LEU B CG    1 
ATOM   9680  C  CD1   . LEU B 2 161  ? 12.095  -26.010  8.102   1.00 77.71  ? 168  LEU B CD1   1 
ATOM   9681  C  CD2   . LEU B 2 161  ? 12.164  -24.500  10.077  1.00 84.55  ? 168  LEU B CD2   1 
ATOM   9682  N  N     . ILE B 2 162  ? 12.579  -21.077  5.920   1.00 92.87  ? 169  ILE B N     1 
ATOM   9683  C  CA    . ILE B 2 162  ? 13.366  -20.270  5.001   1.00 98.77  ? 169  ILE B CA    1 
ATOM   9684  C  C     . ILE B 2 162  ? 13.080  -18.782  5.197   1.00 100.57 ? 169  ILE B C     1 
ATOM   9685  O  O     . ILE B 2 162  ? 13.975  -17.949  5.092   1.00 107.97 ? 169  ILE B O     1 
ATOM   9686  C  CB    . ILE B 2 162  ? 13.105  -20.707  3.550   1.00 97.14  ? 169  ILE B CB    1 
ATOM   9687  C  CG1   . ILE B 2 162  ? 13.807  -22.048  3.302   1.00 91.88  ? 169  ILE B CG1   1 
ATOM   9688  C  CG2   . ILE B 2 162  ? 13.572  -19.648  2.558   1.00 105.95 ? 169  ILE B CG2   1 
ATOM   9689  C  CD1   . ILE B 2 162  ? 13.940  -22.435  1.856   1.00 101.37 ? 169  ILE B CD1   1 
ATOM   9690  N  N     . GLY B 2 163  ? 11.834  -18.456  5.519   1.00 104.26 ? 170  GLY B N     1 
ATOM   9691  C  CA    . GLY B 2 163  ? 11.465  -17.080  5.793   1.00 102.70 ? 170  GLY B CA    1 
ATOM   9692  C  C     . GLY B 2 163  ? 10.848  -16.390  4.595   1.00 107.70 ? 170  GLY B C     1 
ATOM   9693  O  O     . GLY B 2 163  ? 10.559  -15.195  4.634   1.00 112.33 ? 170  GLY B O     1 
ATOM   9694  N  N     . ASP B 2 164  ? 10.654  -17.150  3.523   1.00 107.85 ? 171  ASP B N     1 
ATOM   9695  C  CA    . ASP B 2 164  ? 10.017  -16.623  2.325   1.00 122.53 ? 171  ASP B CA    1 
ATOM   9696  C  C     . ASP B 2 164  ? 8.594   -17.156  2.230   1.00 118.55 ? 171  ASP B C     1 
ATOM   9697  O  O     . ASP B 2 164  ? 8.380   -18.293  1.815   1.00 118.38 ? 171  ASP B O     1 
ATOM   9698  C  CB    . ASP B 2 164  ? 10.818  -17.006  1.076   1.00 136.27 ? 171  ASP B CB    1 
ATOM   9699  C  CG    . ASP B 2 164  ? 10.450  -16.170  -0.130  1.00 144.10 ? 171  ASP B CG    1 
ATOM   9700  O  OD1   . ASP B 2 164  ? 9.490   -15.382  -0.044  1.00 148.97 ? 171  ASP B OD1   1 
ATOM   9701  O  OD2   . ASP B 2 164  ? 11.120  -16.306  -1.172  1.00 154.07 ? 171  ASP B OD2   1 
ATOM   9702  N  N     . PRO B 2 165  ? 7.611   -16.334  2.626   1.00 115.29 ? 172  PRO B N     1 
ATOM   9703  C  CA    . PRO B 2 165  ? 6.208   -16.762  2.603   1.00 111.91 ? 172  PRO B CA    1 
ATOM   9704  C  C     . PRO B 2 165  ? 5.666   -16.994  1.189   1.00 120.24 ? 172  PRO B C     1 
ATOM   9705  O  O     . PRO B 2 165  ? 4.620   -17.622  1.038   1.00 113.15 ? 172  PRO B O     1 
ATOM   9706  C  CB    . PRO B 2 165  ? 5.475   -15.598  3.279   1.00 110.42 ? 172  PRO B CB    1 
ATOM   9707  C  CG    . PRO B 2 165  ? 6.373   -14.427  3.110   1.00 110.71 ? 172  PRO B CG    1 
ATOM   9708  C  CD    . PRO B 2 165  ? 7.763   -14.975  3.172   1.00 115.57 ? 172  PRO B CD    1 
ATOM   9709  N  N     . ASN B 2 166  ? 6.367   -16.498  0.175   1.00 87.38  ? 173  ASN B N     1 
ATOM   9710  C  CA    . ASN B 2 166  ? 5.938   -16.692  -1.201  1.00 108.63 ? 173  ASN B CA    1 
ATOM   9711  C  C     . ASN B 2 166  ? 6.741   -17.780  -1.902  1.00 108.55 ? 173  ASN B C     1 
ATOM   9712  O  O     . ASN B 2 166  ? 6.788   -17.841  -3.131  1.00 121.06 ? 173  ASN B O     1 
ATOM   9713  C  CB    . ASN B 2 166  ? 6.041   -15.376  -1.984  1.00 124.60 ? 173  ASN B CB    1 
ATOM   9714  C  CG    . ASN B 2 166  ? 5.087   -14.316  -1.467  1.00 130.34 ? 173  ASN B CG    1 
ATOM   9715  O  OD1   . ASN B 2 166  ? 3.917   -14.596  -1.199  1.00 136.41 ? 173  ASN B OD1   1 
ATOM   9716  N  ND2   . ASN B 2 166  ? 5.585   -13.097  -1.305  1.00 121.39 ? 173  ASN B ND2   1 
ATOM   9717  N  N     . LEU B 2 167  ? 7.373   -18.635  -1.107  1.00 106.35 ? 174  LEU B N     1 
ATOM   9718  C  CA    . LEU B 2 167  ? 8.097   -19.789  -1.625  1.00 118.03 ? 174  LEU B CA    1 
ATOM   9719  C  C     . LEU B 2 167  ? 7.121   -20.793  -2.232  1.00 121.51 ? 174  LEU B C     1 
ATOM   9720  O  O     . LEU B 2 167  ? 6.011   -20.974  -1.728  1.00 108.30 ? 174  LEU B O     1 
ATOM   9721  C  CB    . LEU B 2 167  ? 8.917   -20.443  -0.510  1.00 118.66 ? 174  LEU B CB    1 
ATOM   9722  C  CG    . LEU B 2 167  ? 9.885   -21.582  -0.830  1.00 115.27 ? 174  LEU B CG    1 
ATOM   9723  C  CD1   . LEU B 2 167  ? 11.008  -21.566  0.173   1.00 109.30 ? 174  LEU B CD1   1 
ATOM   9724  C  CD2   . LEU B 2 167  ? 9.178   -22.925  -0.784  1.00 110.71 ? 174  LEU B CD2   1 
ATOM   9725  N  N     . GLU B 2 168  ? 7.538   -21.446  -3.313  1.00 132.73 ? 175  GLU B N     1 
ATOM   9726  C  CA    . GLU B 2 168  ? 6.672   -22.394  -4.010  1.00 130.77 ? 175  GLU B CA    1 
ATOM   9727  C  C     . GLU B 2 168  ? 7.457   -23.603  -4.525  1.00 111.89 ? 175  GLU B C     1 
ATOM   9728  O  O     . GLU B 2 168  ? 8.640   -23.484  -4.861  1.00 115.70 ? 175  GLU B O     1 
ATOM   9729  C  CB    . GLU B 2 168  ? 5.951   -21.695  -5.169  1.00 145.77 ? 175  GLU B CB    1 
ATOM   9730  C  CG    . GLU B 2 168  ? 4.800   -22.496  -5.755  1.00 167.20 ? 175  GLU B CG    1 
ATOM   9731  C  CD    . GLU B 2 168  ? 4.233   -21.865  -7.012  1.00 200.23 ? 175  GLU B CD    1 
ATOM   9732  O  OE1   . GLU B 2 168  ? 4.499   -20.668  -7.254  1.00 215.05 ? 175  GLU B OE1   1 
ATOM   9733  O  OE2   . GLU B 2 168  ? 3.525   -22.569  -7.764  1.00 213.60 ? 175  GLU B OE2   1 
ATOM   9734  N  N     . PHE B 2 169  ? 6.797   -24.759  -4.582  1.00 95.51  ? 176  PHE B N     1 
ATOM   9735  C  CA    . PHE B 2 169  ? 7.434   -25.976  -5.078  1.00 101.42 ? 176  PHE B CA    1 
ATOM   9736  C  C     . PHE B 2 169  ? 7.374   -26.098  -6.606  1.00 112.40 ? 176  PHE B C     1 
ATOM   9737  O  O     . PHE B 2 169  ? 6.402   -25.683  -7.236  1.00 113.01 ? 176  PHE B O     1 
ATOM   9738  C  CB    . PHE B 2 169  ? 6.791   -27.202  -4.435  1.00 96.75  ? 176  PHE B CB    1 
ATOM   9739  C  CG    . PHE B 2 169  ? 7.176   -27.407  -3.001  1.00 90.85  ? 176  PHE B CG    1 
ATOM   9740  C  CD1   . PHE B 2 169  ? 8.303   -26.798  -2.477  1.00 93.62  ? 176  PHE B CD1   1 
ATOM   9741  C  CD2   . PHE B 2 169  ? 6.418   -28.224  -2.179  1.00 87.92  ? 176  PHE B CD2   1 
ATOM   9742  C  CE1   . PHE B 2 169  ? 8.663   -26.994  -1.150  1.00 96.45  ? 176  PHE B CE1   1 
ATOM   9743  C  CE2   . PHE B 2 169  ? 6.769   -28.425  -0.847  1.00 86.76  ? 176  PHE B CE2   1 
ATOM   9744  C  CZ    . PHE B 2 169  ? 7.891   -27.809  -0.328  1.00 85.39  ? 176  PHE B CZ    1 
ATOM   9745  N  N     . VAL B 2 170  ? 8.424   -26.675  -7.186  1.00 123.85 ? 177  VAL B N     1 
ATOM   9746  C  CA    . VAL B 2 170  ? 8.547   -26.828  -8.632  1.00 128.56 ? 177  VAL B CA    1 
ATOM   9747  C  C     . VAL B 2 170  ? 8.804   -28.299  -8.982  1.00 136.08 ? 177  VAL B C     1 
ATOM   9748  O  O     . VAL B 2 170  ? 9.169   -29.093  -8.111  1.00 125.27 ? 177  VAL B O     1 
ATOM   9749  C  CB    . VAL B 2 170  ? 9.681   -25.940  -9.192  1.00 127.77 ? 177  VAL B CB    1 
ATOM   9750  C  CG1   . VAL B 2 170  ? 9.539   -25.750  -10.705 1.00 150.02 ? 177  VAL B CG1   1 
ATOM   9751  C  CG2   . VAL B 2 170  ? 9.699   -24.592  -8.491  1.00 106.64 ? 177  VAL B CG2   1 
ATOM   9752  N  N     . ALA B 2 171  ? 8.611   -28.651  -10.253 1.00 143.01 ? 178  ALA B N     1 
ATOM   9753  C  CA    . ALA B 2 171  ? 8.713   -30.033  -10.724 1.00 152.43 ? 178  ALA B CA    1 
ATOM   9754  C  C     . ALA B 2 171  ? 10.058  -30.698  -10.417 1.00 163.03 ? 178  ALA B C     1 
ATOM   9755  O  O     . ALA B 2 171  ? 10.106  -31.703  -9.702  1.00 167.57 ? 178  ALA B O     1 
ATOM   9756  C  CB    . ALA B 2 171  ? 8.440   -30.087  -12.217 1.00 161.92 ? 178  ALA B CB    1 
ATOM   9757  N  N     . MET B 2 172  ? 11.141  -30.147  -10.959 1.00 168.46 ? 179  MET B N     1 
ATOM   9758  C  CA    . MET B 2 172  ? 12.468  -30.726  -10.752 1.00 167.71 ? 179  MET B CA    1 
ATOM   9759  C  C     . MET B 2 172  ? 13.567  -29.715  -11.070 1.00 172.79 ? 179  MET B C     1 
ATOM   9760  C  CB    . MET B 2 172  ? 12.645  -31.984  -11.611 1.00 177.15 ? 179  MET B CB    1 
ATOM   9761  C  CG    . MET B 2 172  ? 13.684  -32.982  -11.100 1.00 179.59 ? 179  MET B CG    1 
ATOM   9762  S  SD    . MET B 2 172  ? 13.054  -34.064  -9.799  1.00 252.66 ? 179  MET B SD    1 
ATOM   9763  C  CE    . MET B 2 172  ? 14.093  -35.505  -10.030 1.00 161.06 ? 179  MET B CE    1 
ATOM   9764  O  OXT   . MET B 2 172  ? 14.730  -30.069  -11.276 1.00 181.20 ? 179  MET B OXT   1 
ATOM   9765  N  N     . GLY C 3 1    ? -43.495 -11.670  -19.000 1.00 207.42 ? -1   GLY C N     1 
ATOM   9766  C  CA    . GLY C 3 1    ? -42.934 -10.580  -19.776 1.00 203.93 ? -1   GLY C CA    1 
ATOM   9767  C  C     . GLY C 3 1    ? -41.445 -10.429  -19.538 1.00 197.76 ? -1   GLY C C     1 
ATOM   9768  O  O     . GLY C 3 1    ? -40.645 -10.517  -20.470 1.00 202.64 ? -1   GLY C O     1 
ATOM   9769  N  N     . SER C 3 2    ? -41.073 -10.197  -18.284 1.00 185.06 ? 0    SER C N     1 
ATOM   9770  C  CA    . SER C 3 2    ? -39.668 -10.103  -17.910 1.00 160.30 ? 0    SER C CA    1 
ATOM   9771  C  C     . SER C 3 2    ? -39.042 -11.491  -17.947 1.00 143.92 ? 0    SER C C     1 
ATOM   9772  O  O     . SER C 3 2    ? -37.845 -11.640  -18.204 1.00 142.54 ? 0    SER C O     1 
ATOM   9773  C  CB    . SER C 3 2    ? -39.517 -9.476   -16.523 1.00 154.12 ? 0    SER C CB    1 
ATOM   9774  O  OG    . SER C 3 2    ? -38.165 -9.152   -16.253 1.00 146.79 ? 0    SER C OG    1 
ATOM   9775  N  N     . MET C 3 3    ? -39.868 -12.503  -17.700 1.00 142.77 ? 1    MET C N     1 
ATOM   9776  C  CA    . MET C 3 3    ? -39.422 -13.890  -17.743 1.00 133.48 ? 1    MET C CA    1 
ATOM   9777  C  C     . MET C 3 3    ? -39.273 -14.367  -19.186 1.00 127.94 ? 1    MET C C     1 
ATOM   9778  O  O     . MET C 3 3    ? -38.333 -15.092  -19.515 1.00 120.63 ? 1    MET C O     1 
ATOM   9779  C  CB    . MET C 3 3    ? -40.397 -14.793  -16.986 1.00 130.36 ? 1    MET C CB    1 
ATOM   9780  C  CG    . MET C 3 3    ? -39.885 -16.204  -16.761 1.00 138.94 ? 1    MET C CG    1 
ATOM   9781  S  SD    . MET C 3 3    ? -38.494 -16.268  -15.614 1.00 163.27 ? 1    MET C SD    1 
ATOM   9782  C  CE    . MET C 3 3    ? -39.277 -15.689  -14.116 1.00 129.91 ? 1    MET C CE    1 
ATOM   9783  N  N     . GLU C 3 4    ? -40.207 -13.963  -20.042 1.00 129.56 ? 2    GLU C N     1 
ATOM   9784  C  CA    . GLU C 3 4    ? -40.093 -14.249  -21.466 1.00 131.32 ? 2    GLU C CA    1 
ATOM   9785  C  C     . GLU C 3 4    ? -38.878 -13.525  -22.025 1.00 129.93 ? 2    GLU C C     1 
ATOM   9786  O  O     . GLU C 3 4    ? -38.133 -14.079  -22.829 1.00 129.80 ? 2    GLU C O     1 
ATOM   9787  C  CB    . GLU C 3 4    ? -41.363 -13.836  -22.218 1.00 145.40 ? 2    GLU C CB    1 
ATOM   9788  C  CG    . GLU C 3 4    ? -41.188 -13.644  -23.731 1.00 149.44 ? 2    GLU C CG    1 
ATOM   9789  C  CD    . GLU C 3 4    ? -41.075 -14.951  -24.509 1.00 149.39 ? 2    GLU C CD    1 
ATOM   9790  O  OE1   . GLU C 3 4    ? -40.245 -15.811  -24.145 1.00 146.35 ? 2    GLU C OE1   1 
ATOM   9791  O  OE2   . GLU C 3 4    ? -41.819 -15.113  -25.500 1.00 151.64 ? 2    GLU C OE2   1 
ATOM   9792  N  N     . GLU C 3 5    ? -38.681 -12.287  -21.581 1.00 140.06 ? 3    GLU C N     1 
ATOM   9793  C  CA    . GLU C 3 5    ? -37.498 -11.514  -21.939 1.00 143.88 ? 3    GLU C CA    1 
ATOM   9794  C  C     . GLU C 3 5    ? -36.228 -12.256  -21.547 1.00 135.88 ? 3    GLU C C     1 
ATOM   9795  O  O     . GLU C 3 5    ? -35.281 -12.347  -22.327 1.00 128.21 ? 3    GLU C O     1 
ATOM   9796  C  CB    . GLU C 3 5    ? -37.531 -10.140  -21.265 1.00 161.81 ? 3    GLU C CB    1 
ATOM   9797  C  CG    . GLU C 3 5    ? -37.749 -8.983   -22.226 1.00 181.69 ? 3    GLU C CG    1 
ATOM   9798  C  CD    . GLU C 3 5    ? -36.619 -8.843   -23.227 1.00 190.15 ? 3    GLU C CD    1 
ATOM   9799  O  OE1   . GLU C 3 5    ? -35.443 -8.936   -22.814 1.00 193.43 ? 3    GLU C OE1   1 
ATOM   9800  O  OE2   . GLU C 3 5    ? -36.908 -8.647   -24.426 1.00 194.97 ? 3    GLU C OE2   1 
ATOM   9801  N  N     . LEU C 3 6    ? -36.226 -12.797  -20.332 1.00 138.89 ? 4    LEU C N     1 
ATOM   9802  C  CA    . LEU C 3 6    ? -35.061 -13.496  -19.799 1.00 123.47 ? 4    LEU C CA    1 
ATOM   9803  C  C     . LEU C 3 6    ? -34.752 -14.772  -20.570 1.00 114.97 ? 4    LEU C C     1 
ATOM   9804  O  O     . LEU C 3 6    ? -33.620 -14.980  -21.003 1.00 114.95 ? 4    LEU C O     1 
ATOM   9805  C  CB    . LEU C 3 6    ? -35.268 -13.827  -18.322 1.00 111.10 ? 4    LEU C CB    1 
ATOM   9806  C  CG    . LEU C 3 6    ? -34.100 -14.556  -17.661 1.00 109.35 ? 4    LEU C CG    1 
ATOM   9807  C  CD1   . LEU C 3 6    ? -32.836 -13.718  -17.755 1.00 108.59 ? 4    LEU C CD1   1 
ATOM   9808  C  CD2   . LEU C 3 6    ? -34.422 -14.895  -16.216 1.00 111.49 ? 4    LEU C CD2   1 
ATOM   9809  N  N     . SER C 3 7    ? -35.758 -15.623  -20.728 1.00 111.67 ? 5    SER C N     1 
ATOM   9810  C  CA    . SER C 3 7    ? -35.598 -16.883  -21.445 1.00 107.88 ? 5    SER C CA    1 
ATOM   9811  C  C     . SER C 3 7    ? -35.160 -16.639  -22.889 1.00 113.16 ? 5    SER C C     1 
ATOM   9812  O  O     . SER C 3 7    ? -34.259 -17.303  -23.409 1.00 108.24 ? 5    SER C O     1 
ATOM   9813  C  CB    . SER C 3 7    ? -36.905 -17.676  -21.411 1.00 101.10 ? 5    SER C CB    1 
ATOM   9814  O  OG    . SER C 3 7    ? -36.766 -18.910  -22.085 1.00 109.63 ? 5    SER C OG    1 
ATOM   9815  N  N     . GLN C 3 8    ? -35.797 -15.662  -23.522 1.00 120.94 ? 6    GLN C N     1 
ATOM   9816  C  CA    . GLN C 3 8    ? -35.497 -15.310  -24.903 1.00 122.94 ? 6    GLN C CA    1 
ATOM   9817  C  C     . GLN C 3 8    ? -34.067 -14.806  -25.044 1.00 122.53 ? 6    GLN C C     1 
ATOM   9818  O  O     . GLN C 3 8    ? -33.364 -15.178  -25.980 1.00 124.83 ? 6    GLN C O     1 
ATOM   9819  C  CB    . GLN C 3 8    ? -36.480 -14.252  -25.411 1.00 132.61 ? 6    GLN C CB    1 
ATOM   9820  C  CG    . GLN C 3 8    ? -36.643 -14.229  -26.915 1.00 146.20 ? 6    GLN C CG    1 
ATOM   9821  C  CD    . GLN C 3 8    ? -37.223 -15.523  -27.453 1.00 156.24 ? 6    GLN C CD    1 
ATOM   9822  O  OE1   . GLN C 3 8    ? -37.914 -16.254  -26.741 1.00 161.45 ? 6    GLN C OE1   1 
ATOM   9823  N  NE2   . GLN C 3 8    ? -36.940 -15.816  -28.718 1.00 162.38 ? 6    GLN C NE2   1 
ATOM   9824  N  N     . ALA C 3 9    ? -33.644 -13.959  -24.109 1.00 122.24 ? 7    ALA C N     1 
ATOM   9825  C  CA    . ALA C 3 9    ? -32.288 -13.420  -24.122 1.00 117.45 ? 7    ALA C CA    1 
ATOM   9826  C  C     . ALA C 3 9    ? -31.264 -14.524  -23.905 1.00 113.10 ? 7    ALA C C     1 
ATOM   9827  O  O     . ALA C 3 9    ? -30.202 -14.539  -24.525 1.00 110.50 ? 7    ALA C O     1 
ATOM   9828  C  CB    . ALA C 3 9    ? -32.133 -12.344  -23.061 1.00 122.30 ? 7    ALA C CB    1 
ATOM   9829  N  N     . LEU C 3 10   ? -31.602 -15.453  -23.021 1.00 113.39 ? 8    LEU C N     1 
ATOM   9830  C  CA    . LEU C 3 10   ? -30.710 -16.544  -22.664 1.00 101.90 ? 8    LEU C CA    1 
ATOM   9831  C  C     . LEU C 3 10   ? -30.518 -17.487  -23.837 1.00 104.66 ? 8    LEU C C     1 
ATOM   9832  O  O     . LEU C 3 10   ? -29.412 -17.964  -24.080 1.00 102.08 ? 8    LEU C O     1 
ATOM   9833  C  CB    . LEU C 3 10   ? -31.253 -17.302  -21.450 1.00 100.92 ? 8    LEU C CB    1 
ATOM   9834  C  CG    . LEU C 3 10   ? -30.218 -17.987  -20.549 1.00 97.02  ? 8    LEU C CG    1 
ATOM   9835  C  CD1   . LEU C 3 10   ? -30.756 -18.124  -19.139 1.00 103.07 ? 8    LEU C CD1   1 
ATOM   9836  C  CD2   . LEU C 3 10   ? -29.815 -19.341  -21.095 1.00 91.38  ? 8    LEU C CD2   1 
ATOM   9837  N  N     . ALA C 3 11   ? -31.597 -17.759  -24.564 1.00 120.53 ? 9    ALA C N     1 
ATOM   9838  C  CA    . ALA C 3 11   ? -