data_5DK3
# 
_entry.id   5DK3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DK3         
WWPDB D_1000213319 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DK3 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Scapin, G.'   1 
'Prosise, W.'  2 
'Reichert, P.' 3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            22 
_citation.language                  ? 
_citation.page_first                953 
_citation.page_last                 958 
_citation.title                     'Structure of full-length human anti-PD1 therapeutic IgG4 antibody pembrolizumab.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nsmb.3129 
_citation.pdbx_database_id_PubMed   26595420 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Scapin, G.'     1 
primary 'Yang, X.'       2 
primary 'Prosise, W.W.'  3 
primary 'McCoy, M.'      4 
primary 'Reichert, P.'   5 
primary 'Johnston, J.M.' 6 
primary 'Kashi, R.S.'    7 
primary 'Strickland, C.' 8 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5DK3 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     63.830 
_cell.length_a_esd                 ? 
_cell.length_b                     110.830 
_cell.length_b_esd                 ? 
_cell.length_c                     264.960 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5DK3 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Light Chain'          23768.449 2   ? ? ? ? 
2 polymer     man 'Heavy Chain'          49166.047 2   ? ? ? ? 
3 non-polymer syn 'SULFATE ION'          96.063    5   ? ? ? ? 
4 non-polymer man N-ACETYL-D-GLUCOSAMINE 221.208   7   ? ? ? ? 
5 non-polymer man BETA-D-MANNOSE         180.156   2   ? ? ? ? 
6 non-polymer man ALPHA-D-MANNOSE        180.156   4   ? ? ? ? 
7 non-polymer man SUCROSE                342.296   3   ? ? ? ? 
8 non-polymer man ALPHA-L-FUCOSE         164.156   1   ? ? ? ? 
9 water       nat water                  18.015    481 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLESGVPARFSGSGSGTDFTLTIS
SLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQS
GNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
;EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLESGVPARFSGSGSGTDFTLTIS
SLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQS
GNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
;
A,F ? 
2 'polypeptide(L)' no no 
;QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAY
MELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK
CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSRLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
;
;QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAY
MELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYK
CKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSRLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
;
B,G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ILE n 
1 3   VAL n 
1 4   LEU n 
1 5   THR n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   ALA n 
1 10  THR n 
1 11  LEU n 
1 12  SER n 
1 13  LEU n 
1 14  SER n 
1 15  PRO n 
1 16  GLY n 
1 17  GLU n 
1 18  ARG n 
1 19  ALA n 
1 20  THR n 
1 21  LEU n 
1 22  SER n 
1 23  CYS n 
1 24  ARG n 
1 25  ALA n 
1 26  SER n 
1 27  LYS n 
1 28  GLY n 
1 29  VAL n 
1 30  SER n 
1 31  THR n 
1 32  SER n 
1 33  GLY n 
1 34  TYR n 
1 35  SER n 
1 36  TYR n 
1 37  LEU n 
1 38  HIS n 
1 39  TRP n 
1 40  TYR n 
1 41  GLN n 
1 42  GLN n 
1 43  LYS n 
1 44  PRO n 
1 45  GLY n 
1 46  GLN n 
1 47  ALA n 
1 48  PRO n 
1 49  ARG n 
1 50  LEU n 
1 51  LEU n 
1 52  ILE n 
1 53  TYR n 
1 54  LEU n 
1 55  ALA n 
1 56  SER n 
1 57  TYR n 
1 58  LEU n 
1 59  GLU n 
1 60  SER n 
1 61  GLY n 
1 62  VAL n 
1 63  PRO n 
1 64  ALA n 
1 65  ARG n 
1 66  PHE n 
1 67  SER n 
1 68  GLY n 
1 69  SER n 
1 70  GLY n 
1 71  SER n 
1 72  GLY n 
1 73  THR n 
1 74  ASP n 
1 75  PHE n 
1 76  THR n 
1 77  LEU n 
1 78  THR n 
1 79  ILE n 
1 80  SER n 
1 81  SER n 
1 82  LEU n 
1 83  GLU n 
1 84  PRO n 
1 85  GLU n 
1 86  ASP n 
1 87  PHE n 
1 88  ALA n 
1 89  VAL n 
1 90  TYR n 
1 91  TYR n 
1 92  CYS n 
1 93  GLN n 
1 94  HIS n 
1 95  SER n 
1 96  ARG n 
1 97  ASP n 
1 98  LEU n 
1 99  PRO n 
1 100 LEU n 
1 101 THR n 
1 102 PHE n 
1 103 GLY n 
1 104 GLY n 
1 105 GLY n 
1 106 THR n 
1 107 LYS n 
1 108 VAL n 
1 109 GLU n 
1 110 ILE n 
1 111 LYS n 
1 112 ARG n 
1 113 THR n 
1 114 VAL n 
1 115 ALA n 
1 116 ALA n 
1 117 PRO n 
1 118 SER n 
1 119 VAL n 
1 120 PHE n 
1 121 ILE n 
1 122 PHE n 
1 123 PRO n 
1 124 PRO n 
1 125 SER n 
1 126 ASP n 
1 127 GLU n 
1 128 GLN n 
1 129 LEU n 
1 130 LYS n 
1 131 SER n 
1 132 GLY n 
1 133 THR n 
1 134 ALA n 
1 135 SER n 
1 136 VAL n 
1 137 VAL n 
1 138 CYS n 
1 139 LEU n 
1 140 LEU n 
1 141 ASN n 
1 142 ASN n 
1 143 PHE n 
1 144 TYR n 
1 145 PRO n 
1 146 ARG n 
1 147 GLU n 
1 148 ALA n 
1 149 LYS n 
1 150 VAL n 
1 151 GLN n 
1 152 TRP n 
1 153 LYS n 
1 154 VAL n 
1 155 ASP n 
1 156 ASN n 
1 157 ALA n 
1 158 LEU n 
1 159 GLN n 
1 160 SER n 
1 161 GLY n 
1 162 ASN n 
1 163 SER n 
1 164 GLN n 
1 165 GLU n 
1 166 SER n 
1 167 VAL n 
1 168 THR n 
1 169 GLU n 
1 170 GLN n 
1 171 ASP n 
1 172 SER n 
1 173 LYS n 
1 174 ASP n 
1 175 SER n 
1 176 THR n 
1 177 TYR n 
1 178 SER n 
1 179 LEU n 
1 180 SER n 
1 181 SER n 
1 182 THR n 
1 183 LEU n 
1 184 THR n 
1 185 LEU n 
1 186 SER n 
1 187 LYS n 
1 188 ALA n 
1 189 ASP n 
1 190 TYR n 
1 191 GLU n 
1 192 LYS n 
1 193 HIS n 
1 194 LYS n 
1 195 VAL n 
1 196 TYR n 
1 197 ALA n 
1 198 CYS n 
1 199 GLU n 
1 200 VAL n 
1 201 THR n 
1 202 HIS n 
1 203 GLN n 
1 204 GLY n 
1 205 LEU n 
1 206 SER n 
1 207 SER n 
1 208 PRO n 
1 209 VAL n 
1 210 THR n 
1 211 LYS n 
1 212 SER n 
1 213 PHE n 
1 214 ASN n 
1 215 ARG n 
1 216 GLY n 
1 217 GLU n 
1 218 CYS n 
2 1   GLN n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   VAL n 
2 6   GLN n 
2 7   SER n 
2 8   GLY n 
2 9   VAL n 
2 10  GLU n 
2 11  VAL n 
2 12  LYS n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  ALA n 
2 17  SER n 
2 18  VAL n 
2 19  LYS n 
2 20  VAL n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  TYR n 
2 28  THR n 
2 29  PHE n 
2 30  THR n 
2 31  ASN n 
2 32  TYR n 
2 33  TYR n 
2 34  MET n 
2 35  TYR n 
2 36  TRP n 
2 37  VAL n 
2 38  ARG n 
2 39  GLN n 
2 40  ALA n 
2 41  PRO n 
2 42  GLY n 
2 43  GLN n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  MET n 
2 49  GLY n 
2 50  GLY n 
2 51  ILE n 
2 52  ASN n 
2 53  PRO n 
2 54  SER n 
2 55  ASN n 
2 56  GLY n 
2 57  GLY n 
2 58  THR n 
2 59  ASN n 
2 60  PHE n 
2 61  ASN n 
2 62  GLU n 
2 63  LYS n 
2 64  PHE n 
2 65  LYS n 
2 66  ASN n 
2 67  ARG n 
2 68  VAL n 
2 69  THR n 
2 70  LEU n 
2 71  THR n 
2 72  THR n 
2 73  ASP n 
2 74  SER n 
2 75  SER n 
2 76  THR n 
2 77  THR n 
2 78  THR n 
2 79  ALA n 
2 80  TYR n 
2 81  MET n 
2 82  GLU n 
2 83  LEU n 
2 84  LYS n 
2 85  SER n 
2 86  LEU n 
2 87  GLN n 
2 88  PHE n 
2 89  ASP n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  VAL n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  ALA n 
2 98  ARG n 
2 99  ARG n 
2 100 ASP n 
2 101 TYR n 
2 102 ARG n 
2 103 PHE n 
2 104 ASP n 
2 105 MET n 
2 106 GLY n 
2 107 PHE n 
2 108 ASP n 
2 109 TYR n 
2 110 TRP n 
2 111 GLY n 
2 112 GLN n 
2 113 GLY n 
2 114 THR n 
2 115 THR n 
2 116 VAL n 
2 117 THR n 
2 118 VAL n 
2 119 SER n 
2 120 SER n 
2 121 ALA n 
2 122 SER n 
2 123 THR n 
2 124 LYS n 
2 125 GLY n 
2 126 PRO n 
2 127 SER n 
2 128 VAL n 
2 129 PHE n 
2 130 PRO n 
2 131 LEU n 
2 132 ALA n 
2 133 PRO n 
2 134 CYS n 
2 135 SER n 
2 136 ARG n 
2 137 SER n 
2 138 THR n 
2 139 SER n 
2 140 GLU n 
2 141 SER n 
2 142 THR n 
2 143 ALA n 
2 144 ALA n 
2 145 LEU n 
2 146 GLY n 
2 147 CYS n 
2 148 LEU n 
2 149 VAL n 
2 150 LYS n 
2 151 ASP n 
2 152 TYR n 
2 153 PHE n 
2 154 PRO n 
2 155 GLU n 
2 156 PRO n 
2 157 VAL n 
2 158 THR n 
2 159 VAL n 
2 160 SER n 
2 161 TRP n 
2 162 ASN n 
2 163 SER n 
2 164 GLY n 
2 165 ALA n 
2 166 LEU n 
2 167 THR n 
2 168 SER n 
2 169 GLY n 
2 170 VAL n 
2 171 HIS n 
2 172 THR n 
2 173 PHE n 
2 174 PRO n 
2 175 ALA n 
2 176 VAL n 
2 177 LEU n 
2 178 GLN n 
2 179 SER n 
2 180 SER n 
2 181 GLY n 
2 182 LEU n 
2 183 TYR n 
2 184 SER n 
2 185 LEU n 
2 186 SER n 
2 187 SER n 
2 188 VAL n 
2 189 VAL n 
2 190 THR n 
2 191 VAL n 
2 192 PRO n 
2 193 SER n 
2 194 SER n 
2 195 SER n 
2 196 LEU n 
2 197 GLY n 
2 198 THR n 
2 199 LYS n 
2 200 THR n 
2 201 TYR n 
2 202 THR n 
2 203 CYS n 
2 204 ASN n 
2 205 VAL n 
2 206 ASP n 
2 207 HIS n 
2 208 LYS n 
2 209 PRO n 
2 210 SER n 
2 211 ASN n 
2 212 THR n 
2 213 LYS n 
2 214 VAL n 
2 215 ASP n 
2 216 LYS n 
2 217 ARG n 
2 218 VAL n 
2 219 GLU n 
2 220 SER n 
2 221 LYS n 
2 222 TYR n 
2 223 GLY n 
2 224 PRO n 
2 225 PRO n 
2 226 CYS n 
2 227 PRO n 
2 228 PRO n 
2 229 CYS n 
2 230 PRO n 
2 231 ALA n 
2 232 PRO n 
2 233 GLU n 
2 234 PHE n 
2 235 LEU n 
2 236 GLY n 
2 237 GLY n 
2 238 PRO n 
2 239 SER n 
2 240 VAL n 
2 241 PHE n 
2 242 LEU n 
2 243 PHE n 
2 244 PRO n 
2 245 PRO n 
2 246 LYS n 
2 247 PRO n 
2 248 LYS n 
2 249 ASP n 
2 250 THR n 
2 251 LEU n 
2 252 MET n 
2 253 ILE n 
2 254 SER n 
2 255 ARG n 
2 256 THR n 
2 257 PRO n 
2 258 GLU n 
2 259 VAL n 
2 260 THR n 
2 261 CYS n 
2 262 VAL n 
2 263 VAL n 
2 264 VAL n 
2 265 ASP n 
2 266 VAL n 
2 267 SER n 
2 268 GLN n 
2 269 GLU n 
2 270 ASP n 
2 271 PRO n 
2 272 GLU n 
2 273 VAL n 
2 274 GLN n 
2 275 PHE n 
2 276 ASN n 
2 277 TRP n 
2 278 TYR n 
2 279 VAL n 
2 280 ASP n 
2 281 GLY n 
2 282 VAL n 
2 283 GLU n 
2 284 VAL n 
2 285 HIS n 
2 286 ASN n 
2 287 ALA n 
2 288 LYS n 
2 289 THR n 
2 290 LYS n 
2 291 PRO n 
2 292 ARG n 
2 293 GLU n 
2 294 GLU n 
2 295 GLN n 
2 296 PHE n 
2 297 ASN n 
2 298 SER n 
2 299 THR n 
2 300 TYR n 
2 301 ARG n 
2 302 VAL n 
2 303 VAL n 
2 304 SER n 
2 305 VAL n 
2 306 LEU n 
2 307 THR n 
2 308 VAL n 
2 309 LEU n 
2 310 HIS n 
2 311 GLN n 
2 312 ASP n 
2 313 TRP n 
2 314 LEU n 
2 315 ASN n 
2 316 GLY n 
2 317 LYS n 
2 318 GLU n 
2 319 TYR n 
2 320 LYS n 
2 321 CYS n 
2 322 LYS n 
2 323 VAL n 
2 324 SER n 
2 325 ASN n 
2 326 LYS n 
2 327 GLY n 
2 328 LEU n 
2 329 PRO n 
2 330 SER n 
2 331 SER n 
2 332 ILE n 
2 333 GLU n 
2 334 LYS n 
2 335 THR n 
2 336 ILE n 
2 337 SER n 
2 338 LYS n 
2 339 ALA n 
2 340 LYS n 
2 341 GLY n 
2 342 GLN n 
2 343 PRO n 
2 344 ARG n 
2 345 GLU n 
2 346 PRO n 
2 347 GLN n 
2 348 VAL n 
2 349 TYR n 
2 350 THR n 
2 351 LEU n 
2 352 PRO n 
2 353 PRO n 
2 354 SER n 
2 355 GLN n 
2 356 GLU n 
2 357 GLU n 
2 358 MET n 
2 359 THR n 
2 360 LYS n 
2 361 ASN n 
2 362 GLN n 
2 363 VAL n 
2 364 SER n 
2 365 LEU n 
2 366 THR n 
2 367 CYS n 
2 368 LEU n 
2 369 VAL n 
2 370 LYS n 
2 371 GLY n 
2 372 PHE n 
2 373 TYR n 
2 374 PRO n 
2 375 SER n 
2 376 ASP n 
2 377 ILE n 
2 378 ALA n 
2 379 VAL n 
2 380 GLU n 
2 381 TRP n 
2 382 GLU n 
2 383 SER n 
2 384 ASN n 
2 385 GLY n 
2 386 GLN n 
2 387 PRO n 
2 388 GLU n 
2 389 ASN n 
2 390 ASN n 
2 391 TYR n 
2 392 LYS n 
2 393 THR n 
2 394 THR n 
2 395 PRO n 
2 396 PRO n 
2 397 VAL n 
2 398 LEU n 
2 399 ASP n 
2 400 SER n 
2 401 ASP n 
2 402 GLY n 
2 403 SER n 
2 404 PHE n 
2 405 PHE n 
2 406 LEU n 
2 407 TYR n 
2 408 SER n 
2 409 ARG n 
2 410 LEU n 
2 411 THR n 
2 412 VAL n 
2 413 ASP n 
2 414 LYS n 
2 415 SER n 
2 416 ARG n 
2 417 TRP n 
2 418 GLN n 
2 419 GLN n 
2 420 GLY n 
2 421 ASN n 
2 422 VAL n 
2 423 PHE n 
2 424 SER n 
2 425 CYS n 
2 426 SER n 
2 427 VAL n 
2 428 MET n 
2 429 HIS n 
2 430 GLU n 
2 431 ALA n 
2 432 LEU n 
2 433 HIS n 
2 434 ASN n 
2 435 HIS n 
2 436 TYR n 
2 437 THR n 
2 438 GLN n 
2 439 LYS n 
2 440 SER n 
2 441 LEU n 
2 442 SER n 
2 443 LEU n 
2 444 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 218 ? ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? Mammalia 40674 ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 444 ? ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? Mammalia 40674 ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 5DK3 5DK3 ? 1 ? 1 
2 PDB 5DK3 5DK3 ? 2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5DK3 A 1 ? 218 ? 5DK3 1 ? 218 ? 1 218 
2 2 5DK3 B 1 ? 444 ? 5DK3 1 ? 444 ? 1 444 
3 1 5DK3 F 1 ? 218 ? 5DK3 1 ? 218 ? 1 218 
4 2 5DK3 G 1 ? 444 ? 5DK3 1 ? 444 ? 1 444 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ? 'C4 H7 N O4'     133.103 
BMA D-saccharide        . BETA-D-MANNOSE         ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking' y CYSTEINE               ? 'C3 H7 N O2 S'   121.158 
FUC saccharide          . ALPHA-L-FUCOSE         ? 'C6 H12 O5'      164.156 
GLN 'L-peptide linking' y GLUTAMINE              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ? 'C6 H15 N2 O2 1' 147.195 
MAN D-saccharide        . ALPHA-D-MANNOSE        ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking' y METHIONINE             ? 'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking' y PHENYLALANINE          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'          ? 'O4 S -2'        96.063  
SUC saccharide          . SUCROSE                ? 'C12 H22 O11'    342.296 
THR 'L-peptide linking' y THREONINE              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DK3 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.22 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.75 
_exptl_crystal.description                 Rods 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            303 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.8-2.2 M NH4H2PO4, 100 mM TRIS' 
_exptl_crystal_grow.pdbx_pH_range   '8.0 - 8.5' 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-05-21 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9795 1.0 
2 1.00   1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_synchrotron_site       CLSI 
# 
_reflns.B_iso_Wilson_estimate            53.08 
_reflns.entry_id                         5DK3 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.28 
_reflns.d_resolution_low                 110.83 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       654220 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.8 
_reflns.pdbx_Rmerge_I_obs                0.072 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            18.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.280 2.550   ? 3.000  184254 ? ? 24467 ? 100.000 ? ? ? ? 0.723 ? ? ? ? ? ? ? ? 7.500 ? ? ? ? ? 0.282 0 1 1 0.857 ? 
5.090 110.830 ? 46.700 56298  ? ? 8276  ? 100.000 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 6.800 ? ? ? ? ? 0.013 0 2 1 0.999 ? 
# 
_refine.aniso_B[1][1]                            0.2590 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            6.9585 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -7.2175 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               64.17 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.9421 
_refine.correlation_coeff_Fo_to_Fc_free          0.9225 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5DK3 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.28 
_refine.ls_d_res_low                             33.38 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     86694 
_refine.ls_number_reflns_R_free                  4386 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1863 
_refine.ls_R_factor_R_free                       0.2235 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1843 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.179 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.177 
_refine.pdbx_overall_SU_R_Blow_DPI               0.207 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.627 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5DK3 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.308 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        19507 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         268 
_refine_hist.number_atoms_solvent             481 
_refine_hist.number_atoms_total               20256 
_refine_hist.d_res_high                       2.28 
_refine_hist.d_res_low                        33.38 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 20259 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.18  ? 36518 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 4320  ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 221   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 2940  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 20259 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 6     ? t_nbd                     5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 4.08  ? ?     ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 15.77 ? ?     ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 1455  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 21020 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.28 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_all                6245 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             300 
_refine_ls_shell.number_reflns_R_work             5945 
_refine_ls_shell.percent_reflns_obs               99.99 
_refine_ls_shell.percent_reflns_R_free            4.80 
_refine_ls_shell.R_factor_all                     0.2071 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2375 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2055 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5DK3 
_struct.title                        'Crystal Structure of Pembrolizumab, a full length IgG4 antibody' 
_struct.pdbx_descriptor              'Light Chain, Heavy Chain' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DK3 
_struct_keywords.text            'Cancer, Antibody, subclasses, IgG4, melanoma, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 5 ? 
M  N N 6 ? 
N  N N 6 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 7 ? 
R  N N 7 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 5 ? 
V  N N 6 ? 
W  N N 6 ? 
X  N N 4 ? 
Y  N N 8 ? 
Z  N N 7 ? 
AA N N 9 ? 
BA N N 9 ? 
CA N N 9 ? 
DA N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 83  ? PHE A 87  ? GLU A 83  PHE A 87  5 ? 5 
HELX_P HELX_P2  AA2 SER A 125 ? SER A 131 ? SER A 125 SER A 131 1 ? 7 
HELX_P HELX_P3  AA3 LYS A 187 ? LYS A 192 ? LYS A 187 LYS A 192 1 ? 6 
HELX_P HELX_P4  AA4 THR B 28  ? THR B 30  ? THR B 28  THR B 30  5 ? 3 
HELX_P HELX_P5  AA5 GLN B 87  ? THR B 91  ? GLN B 87  THR B 91  5 ? 5 
HELX_P HELX_P6  AA6 SER B 163 ? ALA B 165 ? SER B 163 ALA B 165 5 ? 3 
HELX_P HELX_P7  AA7 SER B 194 ? LEU B 196 ? SER B 194 LEU B 196 5 ? 3 
HELX_P HELX_P8  AA8 LYS B 208 ? ASN B 211 ? LYS B 208 ASN B 211 5 ? 4 
HELX_P HELX_P9  AA9 GLN B 311 ? GLY B 316 ? GLN B 311 GLY B 316 1 ? 6 
HELX_P HELX_P10 AB1 SER B 354 ? LYS B 360 ? SER B 354 LYS B 360 5 ? 7 
HELX_P HELX_P11 AB2 LYS B 414 ? GLN B 419 ? LYS B 414 GLN B 419 1 ? 6 
HELX_P HELX_P12 AB3 LEU B 432 ? TYR B 436 ? LEU B 432 TYR B 436 5 ? 5 
HELX_P HELX_P13 AB4 GLU C 83  ? PHE C 87  ? GLU F 83  PHE F 87  5 ? 5 
HELX_P HELX_P14 AB5 SER C 125 ? LYS C 130 ? SER F 125 LYS F 130 1 ? 6 
HELX_P HELX_P15 AB6 LYS C 187 ? HIS C 193 ? LYS F 187 HIS F 193 1 ? 7 
HELX_P HELX_P16 AB7 THR D 28  ? THR D 30  ? THR G 28  THR G 30  5 ? 3 
HELX_P HELX_P17 AB8 GLN D 87  ? THR D 91  ? GLN G 87  THR G 91  5 ? 5 
HELX_P HELX_P18 AB9 SER D 163 ? ALA D 165 ? SER G 163 ALA G 165 5 ? 3 
HELX_P HELX_P19 AC1 SER D 194 ? LEU D 196 ? SER G 194 LEU G 196 5 ? 3 
HELX_P HELX_P20 AC2 LYS D 208 ? ASN D 211 ? LYS G 208 ASN G 211 5 ? 4 
HELX_P HELX_P21 AC3 LYS D 246 ? MET D 252 ? LYS G 246 MET G 252 1 ? 7 
HELX_P HELX_P22 AC4 LEU D 309 ? ASN D 315 ? LEU G 309 ASN G 315 1 ? 7 
HELX_P HELX_P23 AC5 SER D 354 ? LYS D 360 ? SER G 354 LYS G 360 5 ? 7 
HELX_P HELX_P24 AC6 LYS D 414 ? GLN D 419 ? LYS G 414 GLN G 419 1 ? 6 
HELX_P HELX_P25 AC7 LEU D 432 ? TYR D 436 ? LEU G 432 TYR G 436 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?    ? A CYS 23  SG  ? ? ? 1_555 A CYS 92  SG ? ? A CYS 23  A CYS 92  1_555 ? ? ? ? ? ? ? 2.513 ? 
disulf2  disulf ?    ? A CYS 138 SG  ? ? ? 1_555 A CYS 198 SG ? ? A CYS 138 A CYS 198 1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf3  disulf ?    ? A CYS 218 SG  ? ? ? 1_555 B CYS 134 SG ? ? A CYS 218 B CYS 134 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf4  disulf ?    ? B CYS 22  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 22  B CYS 96  1_555 ? ? ? ? ? ? ? 2.083 ? 
disulf5  disulf ?    ? B CYS 147 SG  ? ? ? 1_555 B CYS 203 SG ? ? B CYS 147 B CYS 203 1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf6  disulf ?    ? B CYS 226 SG  ? ? ? 1_555 D CYS 226 SG ? ? B CYS 226 G CYS 226 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf7  disulf ?    ? B CYS 229 SG  ? ? ? 1_555 D CYS 229 SG ? ? B CYS 229 G CYS 229 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf8  disulf ?    ? B CYS 261 SG  ? ? ? 1_555 B CYS 321 SG ? ? B CYS 261 B CYS 321 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf9  disulf ?    ? B CYS 367 SG  ? ? ? 1_555 B CYS 425 SG ? ? B CYS 367 B CYS 425 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf10 disulf ?    ? C CYS 23  SG  ? ? ? 1_555 C CYS 92  SG ? ? F CYS 23  F CYS 92  1_555 ? ? ? ? ? ? ? 2.550 ? 
disulf11 disulf ?    ? C CYS 138 SG  ? ? ? 1_555 C CYS 198 SG ? ? F CYS 138 F CYS 198 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf12 disulf ?    ? C CYS 218 SG  ? ? ? 1_555 D CYS 134 SG ? ? F CYS 218 G CYS 134 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf13 disulf ?    ? D CYS 22  SG  ? ? ? 1_555 D CYS 96  SG ? ? G CYS 22  G CYS 96  1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf14 disulf ?    ? D CYS 147 SG  ? ? ? 1_555 D CYS 203 SG ? ? G CYS 147 G CYS 203 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf15 disulf ?    ? D CYS 261 SG  ? ? ? 1_555 D CYS 321 SG ? ? G CYS 261 G CYS 321 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf16 disulf ?    ? D CYS 367 SG  ? ? ? 1_555 D CYS 425 SG ? ? G CYS 367 G CYS 425 1_555 ? ? ? ? ? ? ? 2.044 ? 
covale1  covale one  ? D ASN 297 ND2 ? ? ? 1_555 S NAG .   C1 ? ? G ASN 297 G NAG 501 1_555 ? ? ? ? ? ? ? 1.438 ? 
covale2  covale both ? J NAG .   O4  ? ? ? 1_555 K NAG .   C1 ? ? B NAG 505 B NAG 506 1_555 ? ? ? ? ? ? ? 1.424 ? 
covale3  covale both ? K NAG .   O4  ? ? ? 1_555 L BMA .   C1 ? ? B NAG 506 B BMA 507 1_555 ? ? ? ? ? ? ? 1.402 ? 
covale4  covale one  ? L BMA .   O3  ? ? ? 1_555 N MAN .   C1 ? ? B BMA 507 B MAN 509 1_555 ? ? ? ? ? ? ? 1.430 ? 
covale5  covale one  ? L BMA .   O6  ? ? ? 1_555 M MAN .   C1 ? ? B BMA 507 B MAN 508 1_555 ? ? ? ? ? ? ? 1.408 ? 
covale6  covale one  ? M MAN .   O2  ? ? ? 1_555 P NAG .   C1 ? ? B MAN 508 B NAG 511 1_555 ? ? ? ? ? ? ? 1.423 ? 
covale7  covale one  ? N MAN .   O2  ? ? ? 1_555 O NAG .   C1 ? ? B MAN 509 B NAG 510 1_555 ? ? ? ? ? ? ? 1.425 ? 
covale8  covale both ? S NAG .   O4  ? ? ? 1_555 T NAG .   C1 ? ? G NAG 501 G NAG 502 1_555 ? ? ? ? ? ? ? 1.432 ? 
covale9  covale one  ? S NAG .   O6  ? ? ? 1_555 Y FUC .   C1 ? ? G NAG 501 G FUC 507 1_555 ? ? ? ? ? ? ? 1.405 ? 
covale10 covale both ? T NAG .   O4  ? ? ? 1_555 U BMA .   C1 ? ? G NAG 502 G BMA 503 1_555 ? ? ? ? ? ? ? 1.419 ? 
covale11 covale one  ? U BMA .   O3  ? ? ? 1_555 V MAN .   C1 ? ? G BMA 503 G MAN 504 1_555 ? ? ? ? ? ? ? 1.424 ? 
covale12 covale one  ? U BMA .   O6  ? ? ? 1_555 W MAN .   C1 ? ? G BMA 503 G MAN 505 1_555 ? ? ? ? ? ? ? 1.401 ? 
covale13 covale one  ? W MAN .   O2  ? ? ? 1_555 X NAG .   C1 ? ? G MAN 505 G NAG 506 1_555 ? ? ? ? ? ? ? 1.412 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  SER 7   A . ? SER 7   A PRO 8   A ? PRO 8   A 1 -8.51 
2  LEU 98  A . ? LEU 98  A PRO 99  A ? PRO 99  A 1 -4.08 
3  TYR 144 A . ? TYR 144 A PRO 145 A ? PRO 145 A 1 2.87  
4  THR 138 B . ? THR 138 B SER 139 B ? SER 139 B 1 1.78  
5  PHE 153 B . ? PHE 153 B PRO 154 B ? PRO 154 B 1 -4.63 
6  GLU 155 B . ? GLU 155 B PRO 156 B ? PRO 156 B 1 -2.99 
7  TYR 222 B . ? TYR 222 B GLY 223 B ? GLY 223 B 1 20.68 
8  PRO 224 B . ? PRO 224 B PRO 225 B ? PRO 225 B 1 16.98 
9  LYS 246 B . ? LYS 246 B PRO 247 B ? PRO 247 B 1 -7.46 
10 LEU 251 B . ? LEU 251 B MET 252 B ? MET 252 B 1 -0.44 
11 SER 254 B . ? SER 254 B ARG 255 B ? ARG 255 B 1 1.38  
12 GLN 295 B . ? GLN 295 B PHE 296 B ? PHE 296 B 1 0.78  
13 TYR 373 B . ? TYR 373 B PRO 374 B ? PRO 374 B 1 3.31  
14 SER 7   C . ? SER 7   F PRO 8   C ? PRO 8   F 1 -7.73 
15 LEU 98  C . ? LEU 98  F PRO 99  C ? PRO 99  F 1 8.30  
16 TYR 144 C . ? TYR 144 F PRO 145 C ? PRO 145 F 1 -0.64 
17 ALA 121 D . ? ALA 121 G SER 122 D ? SER 122 G 1 12.36 
18 PHE 153 D . ? PHE 153 G PRO 154 D ? PRO 154 G 1 -6.76 
19 GLU 155 D . ? GLU 155 G PRO 156 D ? PRO 156 G 1 3.11  
20 PRO 224 D . ? PRO 224 G PRO 225 D ? PRO 225 G 1 4.35  
21 TYR 373 D . ? TYR 373 G PRO 374 D ? PRO 374 G 1 -7.80 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 6 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
AB3 ? 3 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 4 ? 
AB9 ? 4 ? 
AC1 ? 6 ? 
AC2 ? 4 ? 
AC3 ? 2 ? 
AC4 ? 4 ? 
AC5 ? 4 ? 
AC6 ? 4 ? 
AC7 ? 6 ? 
AC8 ? 4 ? 
AC9 ? 4 ? 
AD1 ? 3 ? 
AD2 ? 4 ? 
AD3 ? 4 ? 
AD4 ? 4 ? 
AD5 ? 4 ? 
AD6 ? 4 ? 
AD7 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? parallel      
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC1 4 5 ? anti-parallel 
AC1 5 6 ? anti-parallel 
AC2 1 2 ? parallel      
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? parallel      
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC7 5 6 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 4   ? SER A 7   ? LEU A 4   SER A 7   
AA1 2 ALA A 19  ? ALA A 25  ? ALA A 19  ALA A 25  
AA1 3 ASP A 74  ? ILE A 79  ? ASP A 74  ILE A 79  
AA1 4 PHE A 66  ? SER A 71  ? PHE A 66  SER A 71  
AA2 1 THR A 10  ? LEU A 13  ? THR A 10  LEU A 13  
AA2 2 THR A 106 ? ILE A 110 ? THR A 106 ILE A 110 
AA2 3 ALA A 88  ? HIS A 94  ? ALA A 88  HIS A 94  
AA2 4 LEU A 37  ? GLN A 42  ? LEU A 37  GLN A 42  
AA2 5 ARG A 49  ? TYR A 53  ? ARG A 49  TYR A 53  
AA2 6 TYR A 57  ? LEU A 58  ? TYR A 57  LEU A 58  
AA3 1 THR A 10  ? LEU A 13  ? THR A 10  LEU A 13  
AA3 2 THR A 106 ? ILE A 110 ? THR A 106 ILE A 110 
AA3 3 ALA A 88  ? HIS A 94  ? ALA A 88  HIS A 94  
AA3 4 THR A 101 ? PHE A 102 ? THR A 101 PHE A 102 
AA4 1 SER A 30  ? THR A 31  ? SER A 30  THR A 31  
AA4 2 TYR A 34  ? SER A 35  ? TYR A 34  SER A 35  
AA5 1 SER A 118 ? PHE A 122 ? SER A 118 PHE A 122 
AA5 2 THR A 133 ? PHE A 143 ? THR A 133 PHE A 143 
AA5 3 TYR A 177 ? SER A 186 ? TYR A 177 SER A 186 
AA5 4 SER A 163 ? VAL A 167 ? SER A 163 VAL A 167 
AA6 1 ALA A 157 ? LEU A 158 ? ALA A 157 LEU A 158 
AA6 2 LYS A 149 ? VAL A 154 ? LYS A 149 VAL A 154 
AA6 3 VAL A 195 ? THR A 201 ? VAL A 195 THR A 201 
AA6 4 VAL A 209 ? ASN A 214 ? VAL A 209 ASN A 214 
AA7 1 GLN B 3   ? GLN B 6   ? GLN B 3   GLN B 6   
AA7 2 VAL B 18  ? SER B 25  ? VAL B 18  SER B 25  
AA7 3 THR B 78  ? LEU B 83  ? THR B 78  LEU B 83  
AA7 4 VAL B 68  ? ASP B 73  ? VAL B 68  ASP B 73  
AA8 1 GLU B 10  ? LYS B 12  ? GLU B 10  LYS B 12  
AA8 2 THR B 114 ? VAL B 118 ? THR B 114 VAL B 118 
AA8 3 ALA B 92  ? ASP B 100 ? ALA B 92  ASP B 100 
AA8 4 TYR B 32  ? GLN B 39  ? TYR B 32  GLN B 39  
AA8 5 LEU B 45  ? ILE B 51  ? LEU B 45  ILE B 51  
AA8 6 THR B 58  ? PHE B 60  ? THR B 58  PHE B 60  
AA9 1 GLU B 10  ? LYS B 12  ? GLU B 10  LYS B 12  
AA9 2 THR B 114 ? VAL B 118 ? THR B 114 VAL B 118 
AA9 3 ALA B 92  ? ASP B 100 ? ALA B 92  ASP B 100 
AA9 4 PHE B 107 ? TRP B 110 ? PHE B 107 TRP B 110 
AB1 1 SER B 127 ? LEU B 131 ? SER B 127 LEU B 131 
AB1 2 THR B 142 ? TYR B 152 ? THR B 142 TYR B 152 
AB1 3 TYR B 183 ? PRO B 192 ? TYR B 183 PRO B 192 
AB1 4 VAL B 170 ? THR B 172 ? VAL B 170 THR B 172 
AB2 1 SER B 127 ? LEU B 131 ? SER B 127 LEU B 131 
AB2 2 THR B 142 ? TYR B 152 ? THR B 142 TYR B 152 
AB2 3 TYR B 183 ? PRO B 192 ? TYR B 183 PRO B 192 
AB2 4 VAL B 176 ? LEU B 177 ? VAL B 176 LEU B 177 
AB3 1 THR B 158 ? TRP B 161 ? THR B 158 TRP B 161 
AB3 2 TYR B 201 ? HIS B 207 ? TYR B 201 HIS B 207 
AB3 3 THR B 212 ? GLU B 219 ? THR B 212 GLU B 219 
AB4 1 SER B 239 ? PHE B 243 ? SER B 239 PHE B 243 
AB4 2 GLU B 258 ? VAL B 266 ? GLU B 258 VAL B 266 
AB4 3 TYR B 300 ? THR B 307 ? TYR B 300 THR B 307 
AB4 4 LYS B 288 ? THR B 289 ? LYS B 288 THR B 289 
AB5 1 VAL B 282 ? VAL B 284 ? VAL B 282 VAL B 284 
AB5 2 VAL B 273 ? VAL B 279 ? VAL B 273 VAL B 279 
AB5 3 TYR B 319 ? ASN B 325 ? TYR B 319 ASN B 325 
AB5 4 ILE B 332 ? ILE B 336 ? ILE B 332 ILE B 336 
AB6 1 GLN B 347 ? LEU B 351 ? GLN B 347 LEU B 351 
AB6 2 GLN B 362 ? PHE B 372 ? GLN B 362 PHE B 372 
AB6 3 PHE B 404 ? ASP B 413 ? PHE B 404 ASP B 413 
AB6 4 TYR B 391 ? THR B 393 ? TYR B 391 THR B 393 
AB7 1 GLN B 347 ? LEU B 351 ? GLN B 347 LEU B 351 
AB7 2 GLN B 362 ? PHE B 372 ? GLN B 362 PHE B 372 
AB7 3 PHE B 404 ? ASP B 413 ? PHE B 404 ASP B 413 
AB7 4 VAL B 397 ? LEU B 398 ? VAL B 397 LEU B 398 
AB8 1 GLN B 386 ? PRO B 387 ? GLN B 386 PRO B 387 
AB8 2 ALA B 378 ? SER B 383 ? ALA B 378 SER B 383 
AB8 3 PHE B 423 ? MET B 428 ? PHE B 423 MET B 428 
AB8 4 THR B 437 ? LEU B 441 ? THR B 437 LEU B 441 
AB9 1 LEU C 4   ? SER C 7   ? LEU F 4   SER F 7   
AB9 2 ALA C 19  ? ALA C 25  ? ALA F 19  ALA F 25  
AB9 3 ASP C 74  ? ILE C 79  ? ASP F 74  ILE F 79  
AB9 4 PHE C 66  ? SER C 71  ? PHE F 66  SER F 71  
AC1 1 THR C 10  ? LEU C 13  ? THR F 10  LEU F 13  
AC1 2 THR C 106 ? ILE C 110 ? THR F 106 ILE F 110 
AC1 3 VAL C 89  ? HIS C 94  ? VAL F 89  HIS F 94  
AC1 4 LEU C 37  ? GLN C 42  ? LEU F 37  GLN F 42  
AC1 5 ARG C 49  ? TYR C 53  ? ARG F 49  TYR F 53  
AC1 6 TYR C 57  ? LEU C 58  ? TYR F 57  LEU F 58  
AC2 1 THR C 10  ? LEU C 13  ? THR F 10  LEU F 13  
AC2 2 THR C 106 ? ILE C 110 ? THR F 106 ILE F 110 
AC2 3 VAL C 89  ? HIS C 94  ? VAL F 89  HIS F 94  
AC2 4 THR C 101 ? PHE C 102 ? THR F 101 PHE F 102 
AC3 1 SER C 30  ? THR C 31  ? SER F 30  THR F 31  
AC3 2 TYR C 34  ? SER C 35  ? TYR F 34  SER F 35  
AC4 1 SER C 118 ? PHE C 122 ? SER F 118 PHE F 122 
AC4 2 THR C 133 ? PHE C 143 ? THR F 133 PHE F 143 
AC4 3 TYR C 177 ? SER C 186 ? TYR F 177 SER F 186 
AC4 4 SER C 163 ? VAL C 167 ? SER F 163 VAL F 167 
AC5 1 ALA C 157 ? LEU C 158 ? ALA F 157 LEU F 158 
AC5 2 LYS C 149 ? VAL C 154 ? LYS F 149 VAL F 154 
AC5 3 VAL C 195 ? THR C 201 ? VAL F 195 THR F 201 
AC5 4 VAL C 209 ? ASN C 214 ? VAL F 209 ASN F 214 
AC6 1 GLN D 3   ? GLN D 6   ? GLN G 3   GLN G 6   
AC6 2 VAL D 18  ? SER D 25  ? VAL G 18  SER G 25  
AC6 3 THR D 78  ? LEU D 83  ? THR G 78  LEU G 83  
AC6 4 VAL D 68  ? ASP D 73  ? VAL G 68  ASP G 73  
AC7 1 GLU D 10  ? LYS D 12  ? GLU G 10  LYS G 12  
AC7 2 THR D 114 ? VAL D 118 ? THR G 114 VAL G 118 
AC7 3 ALA D 92  ? ASP D 100 ? ALA G 92  ASP G 100 
AC7 4 TYR D 32  ? GLN D 39  ? TYR G 32  GLN G 39  
AC7 5 LEU D 45  ? ILE D 51  ? LEU G 45  ILE G 51  
AC7 6 THR D 58  ? PHE D 60  ? THR G 58  PHE G 60  
AC8 1 SER D 127 ? LEU D 131 ? SER G 127 LEU G 131 
AC8 2 THR D 142 ? TYR D 152 ? THR G 142 TYR G 152 
AC8 3 TYR D 183 ? PRO D 192 ? TYR G 183 PRO G 192 
AC8 4 VAL D 170 ? THR D 172 ? VAL G 170 THR G 172 
AC9 1 SER D 127 ? LEU D 131 ? SER G 127 LEU G 131 
AC9 2 THR D 142 ? TYR D 152 ? THR G 142 TYR G 152 
AC9 3 TYR D 183 ? PRO D 192 ? TYR G 183 PRO G 192 
AC9 4 VAL D 176 ? LEU D 177 ? VAL G 176 LEU G 177 
AD1 1 THR D 158 ? TRP D 161 ? THR G 158 TRP G 161 
AD1 2 TYR D 201 ? HIS D 207 ? TYR G 201 HIS G 207 
AD1 3 THR D 212 ? GLU D 219 ? THR G 212 GLU G 219 
AD2 1 SER D 239 ? PHE D 243 ? SER G 239 PHE G 243 
AD2 2 GLU D 258 ? VAL D 266 ? GLU G 258 VAL G 266 
AD2 3 TYR D 300 ? THR D 307 ? TYR G 300 THR G 307 
AD2 4 LYS D 288 ? THR D 289 ? LYS G 288 THR G 289 
AD3 1 SER D 239 ? PHE D 243 ? SER G 239 PHE G 243 
AD3 2 GLU D 258 ? VAL D 266 ? GLU G 258 VAL G 266 
AD3 3 TYR D 300 ? THR D 307 ? TYR G 300 THR G 307 
AD3 4 GLU D 293 ? GLU D 294 ? GLU G 293 GLU G 294 
AD4 1 VAL D 282 ? VAL D 284 ? VAL G 282 VAL G 284 
AD4 2 GLN D 274 ? VAL D 279 ? GLN G 274 VAL G 279 
AD4 3 TYR D 319 ? SER D 324 ? TYR G 319 SER G 324 
AD4 4 ILE D 332 ? ILE D 336 ? ILE G 332 ILE G 336 
AD5 1 GLN D 347 ? LEU D 351 ? GLN G 347 LEU G 351 
AD5 2 GLN D 362 ? PHE D 372 ? GLN G 362 PHE G 372 
AD5 3 PHE D 404 ? ASP D 413 ? PHE G 404 ASP G 413 
AD5 4 TYR D 391 ? THR D 393 ? TYR G 391 THR G 393 
AD6 1 GLN D 347 ? LEU D 351 ? GLN G 347 LEU G 351 
AD6 2 GLN D 362 ? PHE D 372 ? GLN G 362 PHE G 372 
AD6 3 PHE D 404 ? ASP D 413 ? PHE G 404 ASP G 413 
AD6 4 VAL D 397 ? LEU D 398 ? VAL G 397 LEU G 398 
AD7 1 GLN D 386 ? PRO D 387 ? GLN G 386 PRO G 387 
AD7 2 ALA D 378 ? SER D 383 ? ALA G 378 SER G 383 
AD7 3 PHE D 423 ? MET D 428 ? PHE G 423 MET G 428 
AD7 4 THR D 437 ? LEU D 441 ? THR G 437 LEU G 441 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR A 5   ? N THR A 5   O ARG A 24  ? O ARG A 24  
AA1 2 3 N CYS A 23  ? N CYS A 23  O PHE A 75  ? O PHE A 75  
AA1 3 4 O THR A 78  ? O THR A 78  N SER A 67  ? N SER A 67  
AA2 1 2 N LEU A 11  ? N LEU A 11  O GLU A 109 ? O GLU A 109 
AA2 2 3 O VAL A 108 ? O VAL A 108 N ALA A 88  ? N ALA A 88  
AA2 3 4 O VAL A 89  ? O VAL A 89  N GLN A 42  ? N GLN A 42  
AA2 4 5 N TRP A 39  ? N TRP A 39  O LEU A 51  ? O LEU A 51  
AA2 5 6 N TYR A 53  ? N TYR A 53  O TYR A 57  ? O TYR A 57  
AA3 1 2 N LEU A 11  ? N LEU A 11  O GLU A 109 ? O GLU A 109 
AA3 2 3 O VAL A 108 ? O VAL A 108 N ALA A 88  ? N ALA A 88  
AA3 3 4 N HIS A 94  ? N HIS A 94  O THR A 101 ? O THR A 101 
AA4 1 2 N THR A 31  ? N THR A 31  O TYR A 34  ? O TYR A 34  
AA5 1 2 N PHE A 120 ? N PHE A 120 O LEU A 139 ? O LEU A 139 
AA5 2 3 N ALA A 134 ? N ALA A 134 O LEU A 185 ? O LEU A 185 
AA5 3 4 O THR A 182 ? O THR A 182 N GLN A 164 ? N GLN A 164 
AA6 1 2 O ALA A 157 ? O ALA A 157 N VAL A 154 ? N VAL A 154 
AA6 2 3 N GLN A 151 ? N GLN A 151 O GLU A 199 ? O GLU A 199 
AA6 3 4 N CYS A 198 ? N CYS A 198 O LYS A 211 ? O LYS A 211 
AA7 1 2 N VAL B 5   ? N VAL B 5   O LYS B 23  ? O LYS B 23  
AA7 2 3 N VAL B 20  ? N VAL B 20  O MET B 81  ? O MET B 81  
AA7 3 4 O GLU B 82  ? O GLU B 82  N THR B 69  ? N THR B 69  
AA8 1 2 N GLU B 10  ? N GLU B 10  O THR B 117 ? O THR B 117 
AA8 2 3 O THR B 114 ? O THR B 114 N TYR B 94  ? N TYR B 94  
AA8 3 4 O TYR B 95  ? O TYR B 95  N VAL B 37  ? N VAL B 37  
AA8 4 5 N TRP B 36  ? N TRP B 36  O MET B 48  ? O MET B 48  
AA8 5 6 N GLY B 50  ? N GLY B 50  O ASN B 59  ? O ASN B 59  
AA9 1 2 N GLU B 10  ? N GLU B 10  O THR B 117 ? O THR B 117 
AA9 2 3 O THR B 114 ? O THR B 114 N TYR B 94  ? N TYR B 94  
AA9 3 4 N ARG B 98  ? N ARG B 98  O TYR B 109 ? O TYR B 109 
AB1 1 2 N PHE B 129 ? N PHE B 129 O LEU B 148 ? O LEU B 148 
AB1 2 3 N VAL B 149 ? N VAL B 149 O LEU B 185 ? O LEU B 185 
AB1 3 4 O VAL B 188 ? O VAL B 188 N HIS B 171 ? N HIS B 171 
AB2 1 2 N PHE B 129 ? N PHE B 129 O LEU B 148 ? O LEU B 148 
AB2 2 3 N VAL B 149 ? N VAL B 149 O LEU B 185 ? O LEU B 185 
AB2 3 4 O SER B 184 ? O SER B 184 N VAL B 176 ? N VAL B 176 
AB3 1 2 N SER B 160 ? N SER B 160 O ASN B 204 ? O ASN B 204 
AB3 2 3 N VAL B 205 ? N VAL B 205 O VAL B 214 ? O VAL B 214 
AB4 1 2 N PHE B 243 ? N PHE B 243 O THR B 260 ? O THR B 260 
AB4 2 3 N CYS B 261 ? N CYS B 261 O SER B 304 ? O SER B 304 
AB4 3 4 O VAL B 305 ? O VAL B 305 N LYS B 288 ? N LYS B 288 
AB5 1 2 O VAL B 284 ? O VAL B 284 N TRP B 277 ? N TRP B 277 
AB5 2 3 N ASN B 276 ? N ASN B 276 O LYS B 322 ? O LYS B 322 
AB5 3 4 N VAL B 323 ? N VAL B 323 O ILE B 332 ? O ILE B 332 
AB6 1 2 N TYR B 349 ? N TYR B 349 O LEU B 368 ? O LEU B 368 
AB6 2 3 N LEU B 365 ? N LEU B 365 O LEU B 410 ? O LEU B 410 
AB6 3 4 O ARG B 409 ? O ARG B 409 N LYS B 392 ? N LYS B 392 
AB7 1 2 N TYR B 349 ? N TYR B 349 O LEU B 368 ? O LEU B 368 
AB7 2 3 N LEU B 365 ? N LEU B 365 O LEU B 410 ? O LEU B 410 
AB7 3 4 O PHE B 405 ? O PHE B 405 N VAL B 397 ? N VAL B 397 
AB8 1 2 O GLN B 386 ? O GLN B 386 N SER B 383 ? N SER B 383 
AB8 2 3 N GLU B 380 ? N GLU B 380 O SER B 426 ? O SER B 426 
AB8 3 4 N VAL B 427 ? N VAL B 427 O THR B 437 ? O THR B 437 
AB9 1 2 N SER C 7   ? N SER F 7   O SER C 22  ? O SER F 22  
AB9 2 3 N LEU C 21  ? N LEU F 21  O LEU C 77  ? O LEU F 77  
AB9 3 4 O THR C 78  ? O THR F 78  N SER C 67  ? N SER F 67  
AC1 1 2 N LEU C 11  ? N LEU F 11  O GLU C 109 ? O GLU F 109 
AC1 2 3 O THR C 106 ? O THR F 106 N TYR C 90  ? N TYR F 90  
AC1 3 4 O VAL C 89  ? O VAL F 89  N GLN C 42  ? N GLN F 42  
AC1 4 5 N GLN C 41  ? N GLN F 41  O ARG C 49  ? O ARG F 49  
AC1 5 6 N TYR C 53  ? N TYR F 53  O TYR C 57  ? O TYR F 57  
AC2 1 2 N LEU C 11  ? N LEU F 11  O GLU C 109 ? O GLU F 109 
AC2 2 3 O THR C 106 ? O THR F 106 N TYR C 90  ? N TYR F 90  
AC2 3 4 N HIS C 94  ? N HIS F 94  O THR C 101 ? O THR F 101 
AC3 1 2 N THR C 31  ? N THR F 31  O TYR C 34  ? O TYR F 34  
AC4 1 2 N PHE C 120 ? N PHE F 120 O LEU C 139 ? O LEU F 139 
AC4 2 3 N LEU C 140 ? N LEU F 140 O LEU C 179 ? O LEU F 179 
AC4 3 4 O THR C 182 ? O THR F 182 N GLN C 164 ? N GLN F 164 
AC5 1 2 O ALA C 157 ? O ALA F 157 N VAL C 154 ? N VAL F 154 
AC5 2 3 N LYS C 153 ? N LYS F 153 O ALA C 197 ? O ALA F 197 
AC5 3 4 N VAL C 200 ? N VAL F 200 O VAL C 209 ? O VAL F 209 
AC6 1 2 N VAL D 5   ? N VAL G 5   O LYS D 23  ? O LYS G 23  
AC6 2 3 N VAL D 18  ? N VAL G 18  O LEU D 83  ? O LEU G 83  
AC6 3 4 O GLU D 82  ? O GLU G 82  N THR D 69  ? N THR G 69  
AC7 1 2 N LYS D 12  ? N LYS G 12  O THR D 117 ? O THR G 117 
AC7 2 3 O THR D 114 ? O THR G 114 N TYR D 94  ? N TYR G 94  
AC7 3 4 O TYR D 95  ? O TYR G 95  N VAL D 37  ? N VAL G 37  
AC7 4 5 N TRP D 36  ? N TRP G 36  O MET D 48  ? O MET G 48  
AC7 5 6 N GLY D 50  ? N GLY G 50  O ASN D 59  ? O ASN G 59  
AC8 1 2 N PHE D 129 ? N PHE G 129 O LEU D 148 ? O LEU G 148 
AC8 2 3 N VAL D 149 ? N VAL G 149 O LEU D 185 ? O LEU G 185 
AC8 3 4 O VAL D 188 ? O VAL G 188 N HIS D 171 ? N HIS G 171 
AC9 1 2 N PHE D 129 ? N PHE G 129 O LEU D 148 ? O LEU G 148 
AC9 2 3 N VAL D 149 ? N VAL G 149 O LEU D 185 ? O LEU G 185 
AC9 3 4 O SER D 184 ? O SER G 184 N VAL D 176 ? N VAL G 176 
AD1 1 2 N SER D 160 ? N SER G 160 O ASN D 204 ? O ASN G 204 
AD1 2 3 N VAL D 205 ? N VAL G 205 O VAL D 214 ? O VAL G 214 
AD2 1 2 N PHE D 243 ? N PHE G 243 O THR D 260 ? O THR G 260 
AD2 2 3 N CYS D 261 ? N CYS G 261 O SER D 304 ? O SER G 304 
AD2 3 4 O VAL D 305 ? O VAL G 305 N LYS D 288 ? N LYS G 288 
AD3 1 2 N PHE D 243 ? N PHE G 243 O THR D 260 ? O THR G 260 
AD3 2 3 N CYS D 261 ? N CYS G 261 O SER D 304 ? O SER G 304 
AD3 3 4 O ARG D 301 ? O ARG G 301 N GLU D 293 ? N GLU G 293 
AD4 1 2 O VAL D 284 ? O VAL G 284 N TRP D 277 ? N TRP G 277 
AD4 2 3 N ASN D 276 ? N ASN G 276 O LYS D 322 ? O LYS G 322 
AD4 3 4 N VAL D 323 ? N VAL G 323 O ILE D 332 ? O ILE G 332 
AD5 1 2 N GLN D 347 ? N GLN G 347 O LYS D 370 ? O LYS G 370 
AD5 2 3 N VAL D 363 ? N VAL G 363 O VAL D 412 ? O VAL G 412 
AD5 3 4 O ARG D 409 ? O ARG G 409 N LYS D 392 ? N LYS G 392 
AD6 1 2 N GLN D 347 ? N GLN G 347 O LYS D 370 ? O LYS G 370 
AD6 2 3 N VAL D 363 ? N VAL G 363 O VAL D 412 ? O VAL G 412 
AD6 3 4 O PHE D 405 ? O PHE G 405 N VAL D 397 ? N VAL G 397 
AD7 1 2 O GLN D 386 ? O GLN G 386 N SER D 383 ? N SER G 383 
AD7 2 3 N GLU D 380 ? N GLU G 380 O SER D 426 ? O SER G 426 
AD7 3 4 N PHE D 423 ? N PHE G 423 O LEU D 441 ? O LEU G 441 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 301 ? 4  'binding site for residue SO4 A 301'                                                       
AC2 Software B SO4 501 ? 4  'binding site for residue SO4 B 501'                                                       
AC3 Software B SO4 502 ? 4  'binding site for residue SO4 B 502'                                                       
AC4 Software B SO4 503 ? 7  'binding site for residue SO4 B 503'                                                       
AC5 Software B SO4 504 ? 3  'binding site for residue SO4 B 504'                                                       
AC6 Software B SUC 512 ? 15 'binding site for residue SUC B 512'                                                       
AC7 Software B SUC 513 ? 14 'binding site for residue SUC B 513'                                                       
AC8 Software G SUC 508 ? 5  'binding site for residue SUC G 508'                                                       
AC9 Software G ASN 297 ? 13 'binding site for Poly-Saccharide residues NAG G 501 through FUC G 507 bound to ASN G 297' 
AD1 Software B NAG 505 ? 9  'binding site for Poly-Saccharide residues NAG B 505 through NAG B 511'                    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ARG A  49  ? ARG A 49  . ? 1_555 ? 
2  AC1 4  PRO A  63  ? PRO A 63  . ? 1_555 ? 
3  AC1 4  ARG A  65  ? ARG A 65  . ? 1_555 ? 
4  AC1 4  GLU A  85  ? GLU A 85  . ? 1_555 ? 
5  AC2 4  TYR B  27  ? TYR B 27  . ? 1_555 ? 
6  AC2 4  THR B  28  ? THR B 28  . ? 1_555 ? 
7  AC2 4  ASN B  31  ? ASN B 31  . ? 1_555 ? 
8  AC2 4  TYR B  32  ? TYR B 32  . ? 1_555 ? 
9  AC3 4  LYS B  360 ? LYS B 360 . ? 1_555 ? 
10 AC3 4  ASN B  361 ? ASN B 361 . ? 1_555 ? 
11 AC3 4  GLN B  362 ? GLN B 362 . ? 1_555 ? 
12 AC3 4  SUC R  .   ? SUC B 513 . ? 1_555 ? 
13 AC4 7  GLU A  169 ? GLU A 169 . ? 1_555 ? 
14 AC4 7  ASP A  171 ? ASP A 171 . ? 1_555 ? 
15 AC4 7  HOH AA .   ? HOH A 436 . ? 1_555 ? 
16 AC4 7  HIS B  171 ? HIS B 171 . ? 1_555 ? 
17 AC4 7  HOH BA .   ? HOH B 618 . ? 1_555 ? 
18 AC4 7  HOH BA .   ? HOH B 623 . ? 1_555 ? 
19 AC4 7  HOH BA .   ? HOH B 711 . ? 1_555 ? 
20 AC5 3  TRP B  313 ? TRP B 313 . ? 1_555 ? 
21 AC5 3  LYS B  338 ? LYS B 338 . ? 1_555 ? 
22 AC5 3  ALA B  339 ? ALA B 339 . ? 1_555 ? 
23 AC6 15 ARG B  38  ? ARG B 38  . ? 3_544 ? 
24 AC6 15 GLN B  43  ? GLN B 43  . ? 3_544 ? 
25 AC6 15 ASP B  89  ? ASP B 89  . ? 3_544 ? 
26 AC6 15 ILE B  377 ? ILE B 377 . ? 1_555 ? 
27 AC6 15 ALA B  378 ? ALA B 378 . ? 1_555 ? 
28 AC6 15 VAL B  379 ? VAL B 379 . ? 1_555 ? 
29 AC6 15 LYS B  392 ? LYS B 392 . ? 1_555 ? 
30 AC6 15 THR B  393 ? THR B 393 . ? 1_555 ? 
31 AC6 15 PRO B  395 ? PRO B 395 . ? 1_555 ? 
32 AC6 15 PRO B  396 ? PRO B 396 . ? 1_555 ? 
33 AC6 15 HOH BA .   ? HOH B 602 . ? 1_555 ? 
34 AC6 15 HOH BA .   ? HOH B 603 . ? 1_555 ? 
35 AC6 15 HOH BA .   ? HOH B 613 . ? 1_555 ? 
36 AC6 15 HOH BA .   ? HOH B 637 . ? 1_555 ? 
37 AC6 15 HOH BA .   ? HOH B 650 . ? 1_555 ? 
38 AC7 14 LYS B  360 ? LYS B 360 . ? 1_555 ? 
39 AC7 14 GLN B  362 ? GLN B 362 . ? 1_555 ? 
40 AC7 14 ASN B  390 ? ASN B 390 . ? 1_555 ? 
41 AC7 14 ARG B  409 ? ARG B 409 . ? 1_555 ? 
42 AC7 14 THR B  411 ? THR B 411 . ? 1_555 ? 
43 AC7 14 SO4 G  .   ? SO4 B 502 . ? 1_555 ? 
44 AC7 14 HOH BA .   ? HOH B 617 . ? 1_555 ? 
45 AC7 14 HOH BA .   ? HOH B 660 . ? 1_555 ? 
46 AC7 14 ARG D  344 ? ARG G 344 . ? 1_555 ? 
47 AC7 14 GLN D  347 ? GLN G 347 . ? 1_555 ? 
48 AC7 14 LYS D  370 ? LYS G 370 . ? 1_555 ? 
49 AC7 14 ASP D  399 ? ASP G 399 . ? 1_555 ? 
50 AC7 14 SER D  400 ? SER G 400 . ? 1_555 ? 
51 AC7 14 ASP D  401 ? ASP G 401 . ? 1_555 ? 
52 AC8 5  PHE D  88  ? PHE G 88  . ? 1_555 ? 
53 AC8 5  LEU D  177 ? LEU G 177 . ? 1_555 ? 
54 AC8 5  SER D  179 ? SER G 179 . ? 1_555 ? 
55 AC8 5  HOH DA .   ? HOH G 614 . ? 1_555 ? 
56 AC8 5  HOH DA .   ? HOH G 632 . ? 1_555 ? 
57 AC9 13 GLN B  274 ? GLN B 274 . ? 1_555 ? 
58 AC9 13 ASN B  276 ? ASN B 276 . ? 1_555 ? 
59 AC9 13 TYR B  278 ? TYR B 278 . ? 1_555 ? 
60 AC9 13 SER B  324 ? SER B 324 . ? 1_555 ? 
61 AC9 13 PHE D  241 ? PHE G 241 . ? 1_555 ? 
62 AC9 13 PHE D  243 ? PHE G 243 . ? 1_555 ? 
63 AC9 13 THR D  260 ? THR G 260 . ? 1_555 ? 
64 AC9 13 VAL D  264 ? VAL G 264 . ? 1_555 ? 
65 AC9 13 ASP D  265 ? ASP G 265 . ? 1_555 ? 
66 AC9 13 GLN D  295 ? GLN G 295 . ? 1_555 ? 
67 AC9 13 ASN D  297 ? ASN G 297 . ? 1_555 ? 
68 AC9 13 THR D  299 ? THR G 299 . ? 1_555 ? 
69 AC9 13 ARG D  301 ? ARG G 301 . ? 1_555 ? 
70 AD1 9  SER B  141 ? SER B 141 . ? 1_555 ? 
71 AD1 9  PHE B  241 ? PHE B 241 . ? 1_555 ? 
72 AD1 9  PHE B  243 ? PHE B 243 . ? 1_555 ? 
73 AD1 9  PRO B  247 ? PRO B 247 . ? 1_555 ? 
74 AD1 9  VAL B  264 ? VAL B 264 . ? 1_555 ? 
75 AD1 9  ASP B  265 ? ASP B 265 . ? 1_555 ? 
76 AD1 9  ASN B  297 ? ASN B 297 . ? 1_555 ? 
77 AD1 9  THR B  299 ? THR B 299 . ? 1_555 ? 
78 AD1 9  ARG B  301 ? ARG B 301 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5DK3 
_atom_sites.fract_transf_matrix[1][1]   0.015667 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009023 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003774 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . GLU A  1 1   ? 9.227   -4.698  -95.607 1.00 46.98  ? 1   GLU A N     1 
ATOM   2     C CA    . GLU A  1 1   ? 10.294  -4.659  -94.606 1.00 46.14  ? 1   GLU A CA    1 
ATOM   3     C C     . GLU A  1 1   ? 11.184  -5.906  -94.675 1.00 52.57  ? 1   GLU A C     1 
ATOM   4     O O     . GLU A  1 1   ? 10.782  -6.919  -95.254 1.00 52.79  ? 1   GLU A O     1 
ATOM   5     C CB    . GLU A  1 1   ? 9.699   -4.556  -93.188 1.00 46.05  ? 1   GLU A CB    1 
ATOM   6     C CG    . GLU A  1 1   ? 8.758   -5.683  -92.809 1.00 50.46  ? 1   GLU A CG    1 
ATOM   7     C CD    . GLU A  1 1   ? 8.122   -5.620  -91.431 1.00 68.80  ? 1   GLU A CD    1 
ATOM   8     O OE1   . GLU A  1 1   ? 7.614   -6.669  -90.977 1.00 73.07  ? 1   GLU A OE1   1 
ATOM   9     O OE2   . GLU A  1 1   ? 8.111   -4.538  -90.807 1.00 62.48  ? 1   GLU A OE2   1 
ATOM   10    N N     . ILE A  1 2   ? 12.375  -5.860  -94.028 1.00 47.00  ? 2   ILE A N     1 
ATOM   11    C CA    . ILE A  1 2   ? 13.229  -7.042  -94.009 1.00 44.38  ? 2   ILE A CA    1 
ATOM   12    C C     . ILE A  1 2   ? 12.662  -7.978  -92.956 1.00 45.09  ? 2   ILE A C     1 
ATOM   13    O O     . ILE A  1 2   ? 12.320  -7.522  -91.893 1.00 44.68  ? 2   ILE A O     1 
ATOM   14    C CB    . ILE A  1 2   ? 14.692  -6.637  -93.717 1.00 46.77  ? 2   ILE A CB    1 
ATOM   15    C CG1   . ILE A  1 2   ? 15.244  -5.817  -94.919 1.00 46.18  ? 2   ILE A CG1   1 
ATOM   16    C CG2   . ILE A  1 2   ? 15.561  -7.879  -93.359 1.00 45.90  ? 2   ILE A CG2   1 
ATOM   17    C CD1   . ILE A  1 2   ? 16.487  -5.282  -94.758 1.00 41.86  ? 2   ILE A CD1   1 
ATOM   18    N N     . VAL A  1 3   ? 12.535  -9.260  -93.250 1.00 39.54  ? 3   VAL A N     1 
ATOM   19    C CA    . VAL A  1 3   ? 12.059  -10.255 -92.296 1.00 37.07  ? 3   VAL A CA    1 
ATOM   20    C C     . VAL A  1 3   ? 13.283  -11.032 -91.866 1.00 39.63  ? 3   VAL A C     1 
ATOM   21    O O     . VAL A  1 3   ? 14.044  -11.507 -92.692 1.00 40.04  ? 3   VAL A O     1 
ATOM   22    C CB    . VAL A  1 3   ? 10.939  -11.168 -92.858 1.00 40.23  ? 3   VAL A CB    1 
ATOM   23    C CG1   . VAL A  1 3   ? 10.614  -12.326 -91.895 1.00 39.49  ? 3   VAL A CG1   1 
ATOM   24    C CG2   . VAL A  1 3   ? 9.696   -10.359 -93.147 1.00 39.52  ? 3   VAL A CG2   1 
ATOM   25    N N     . LEU A  1 4   ? 13.474  -11.148 -90.576 1.00 37.26  ? 4   LEU A N     1 
ATOM   26    C CA    . LEU A  1 4   ? 14.599  -11.851 -89.988 1.00 36.56  ? 4   LEU A CA    1 
ATOM   27    C C     . LEU A  1 4   ? 14.073  -13.129 -89.406 1.00 38.67  ? 4   LEU A C     1 
ATOM   28    O O     . LEU A  1 4   ? 13.339  -13.103 -88.427 1.00 39.65  ? 4   LEU A O     1 
ATOM   29    C CB    . LEU A  1 4   ? 15.256  -11.023 -88.890 1.00 35.53  ? 4   LEU A CB    1 
ATOM   30    C CG    . LEU A  1 4   ? 15.934  -9.721  -89.260 1.00 38.97  ? 4   LEU A CG    1 
ATOM   31    C CD1   . LEU A  1 4   ? 16.652  -9.135  -88.010 1.00 39.21  ? 4   LEU A CD1   1 
ATOM   32    C CD2   . LEU A  1 4   ? 16.941  -9.903  -90.367 1.00 40.19  ? 4   LEU A CD2   1 
ATOM   33    N N     . THR A  1 5   ? 14.423  -14.248 -90.033 1.00 35.24  ? 5   THR A N     1 
ATOM   34    C CA    . THR A  1 5   ? 13.980  -15.592 -89.642 1.00 33.91  ? 5   THR A CA    1 
ATOM   35    C C     . THR A  1 5   ? 15.006  -16.230 -88.687 1.00 36.83  ? 5   THR A C     1 
ATOM   36    O O     . THR A  1 5   ? 16.114  -16.564 -89.104 1.00 36.96  ? 5   THR A O     1 
ATOM   37    C CB    . THR A  1 5   ? 13.740  -16.419 -90.926 1.00 35.28  ? 5   THR A CB    1 
ATOM   38    O OG1   . THR A  1 5   ? 12.654  -15.836 -91.634 1.00 37.33  ? 5   THR A OG1   1 
ATOM   39    C CG2   . THR A  1 5   ? 13.417  -17.811 -90.664 1.00 29.97  ? 5   THR A CG2   1 
ATOM   40    N N     . GLN A  1 6   ? 14.607  -16.447 -87.436 1.00 32.84  ? 6   GLN A N     1 
ATOM   41    C CA    . GLN A  1 6   ? 15.454  -17.071 -86.417 1.00 32.37  ? 6   GLN A CA    1 
ATOM   42    C C     . GLN A  1 6   ? 15.108  -18.533 -86.276 1.00 39.23  ? 6   GLN A C     1 
ATOM   43    O O     . GLN A  1 6   ? 13.949  -18.921 -86.475 1.00 38.75  ? 6   GLN A O     1 
ATOM   44    C CB    . GLN A  1 6   ? 15.325  -16.372 -85.045 1.00 31.33  ? 6   GLN A CB    1 
ATOM   45    C CG    . GLN A  1 6   ? 16.161  -15.085 -85.041 1.00 27.03  ? 6   GLN A CG    1 
ATOM   46    C CD    . GLN A  1 6   ? 16.224  -14.455 -83.693 1.00 34.44  ? 6   GLN A CD    1 
ATOM   47    O OE1   . GLN A  1 6   ? 15.512  -13.505 -83.422 1.00 35.50  ? 6   GLN A OE1   1 
ATOM   48    N NE2   . GLN A  1 6   ? 17.124  -14.908 -82.844 1.00 24.28  ? 6   GLN A NE2   1 
ATOM   49    N N     . SER A  1 7   ? 16.139  -19.357 -86.018 1.00 36.55  ? 7   SER A N     1 
ATOM   50    C CA    . SER A  1 7   ? 15.961  -20.791 -85.813 1.00 36.83  ? 7   SER A CA    1 
ATOM   51    C C     . SER A  1 7   ? 17.106  -21.344 -85.013 1.00 41.76  ? 7   SER A C     1 
ATOM   52    O O     . SER A  1 7   ? 18.204  -20.817 -85.076 1.00 44.39  ? 7   SER A O     1 
ATOM   53    C CB    . SER A  1 7   ? 15.832  -21.537 -87.133 1.00 38.47  ? 7   SER A CB    1 
ATOM   54    O OG    . SER A  1 7   ? 16.932  -21.262 -87.984 1.00 47.22  ? 7   SER A OG    1 
ATOM   55    N N     . PRO A  1 8   ? 16.885  -22.379 -84.216 1.00 39.00  ? 8   PRO A N     1 
ATOM   56    C CA    . PRO A  1 8   ? 15.586  -22.976 -83.872 1.00 38.30  ? 8   PRO A CA    1 
ATOM   57    C C     . PRO A  1 8   ? 14.791  -22.039 -82.948 1.00 40.35  ? 8   PRO A C     1 
ATOM   58    O O     . PRO A  1 8   ? 15.313  -21.062 -82.441 1.00 41.83  ? 8   PRO A O     1 
ATOM   59    C CB    . PRO A  1 8   ? 16.005  -24.273 -83.173 1.00 40.17  ? 8   PRO A CB    1 
ATOM   60    C CG    . PRO A  1 8   ? 17.231  -23.883 -82.438 1.00 45.80  ? 8   PRO A CG    1 
ATOM   61    C CD    . PRO A  1 8   ? 17.961  -22.927 -83.367 1.00 40.75  ? 8   PRO A CD    1 
ATOM   62    N N     . ALA A  1 9   ? 13.533  -22.304 -82.746 1.00 37.34  ? 9   ALA A N     1 
ATOM   63    C CA    . ALA A  1 9   ? 12.701  -21.518 -81.817 1.00 36.88  ? 9   ALA A CA    1 
ATOM   64    C C     . ALA A  1 9   ? 13.208  -21.694 -80.373 1.00 40.93  ? 9   ALA A C     1 
ATOM   65    O O     . ALA A  1 9   ? 13.102  -20.784 -79.549 1.00 38.19  ? 9   ALA A O     1 
ATOM   66    C CB    . ALA A  1 9   ? 11.262  -22.012 -81.870 1.00 36.58  ? 9   ALA A CB    1 
ATOM   67    N N     . THR A  1 10  ? 13.611  -22.930 -80.061 1.00 38.37  ? 10  THR A N     1 
ATOM   68    C CA    . THR A  1 10  ? 14.053  -23.336 -78.733 1.00 38.92  ? 10  THR A CA    1 
ATOM   69    C C     . THR A  1 10  ? 15.275  -24.198 -78.857 1.00 39.30  ? 10  THR A C     1 
ATOM   70    O O     . THR A  1 10  ? 15.442  -24.922 -79.820 1.00 38.94  ? 10  THR A O     1 
ATOM   71    C CB    . THR A  1 10  ? 12.901  -24.064 -77.940 1.00 45.97  ? 10  THR A CB    1 
ATOM   72    O OG1   . THR A  1 10  ? 11.794  -23.165 -77.859 1.00 52.09  ? 10  THR A OG1   1 
ATOM   73    C CG2   . THR A  1 10  ? 13.296  -24.399 -76.505 1.00 47.82  ? 10  THR A CG2   1 
ATOM   74    N N     . LEU A  1 11  ? 16.121  -24.121 -77.876 1.00 37.10  ? 11  LEU A N     1 
ATOM   75    C CA    . LEU A  1 11  ? 17.352  -24.873 -77.851 1.00 38.60  ? 11  LEU A CA    1 
ATOM   76    C C     . LEU A  1 11  ? 17.602  -25.253 -76.407 1.00 43.02  ? 11  LEU A C     1 
ATOM   77    O O     . LEU A  1 11  ? 17.637  -24.381 -75.553 1.00 42.66  ? 11  LEU A O     1 
ATOM   78    C CB    . LEU A  1 11  ? 18.420  -23.932 -78.422 1.00 39.62  ? 11  LEU A CB    1 
ATOM   79    C CG    . LEU A  1 11  ? 19.770  -24.434 -78.723 1.00 46.57  ? 11  LEU A CG    1 
ATOM   80    C CD1   . LEU A  1 11  ? 19.733  -25.767 -79.572 1.00 46.16  ? 11  LEU A CD1   1 
ATOM   81    C CD2   . LEU A  1 11  ? 20.569  -23.329 -79.452 1.00 48.32  ? 11  LEU A CD2   1 
ATOM   82    N N     . SER A  1 12  ? 17.657  -26.554 -76.122 1.00 41.61  ? 12  SER A N     1 
ATOM   83    C CA    . SER A  1 12  ? 17.850  -27.084 -74.777 1.00 42.16  ? 12  SER A CA    1 
ATOM   84    C C     . SER A  1 12  ? 19.192  -27.786 -74.763 1.00 46.31  ? 12  SER A C     1 
ATOM   85    O O     . SER A  1 12  ? 19.394  -28.730 -75.509 1.00 46.80  ? 12  SER A O     1 
ATOM   86    C CB    . SER A  1 12  ? 16.740  -28.060 -74.402 1.00 44.83  ? 12  SER A CB    1 
ATOM   87    O OG    . SER A  1 12  ? 16.872  -28.391 -73.028 1.00 55.09  ? 12  SER A OG    1 
ATOM   88    N N     . LEU A  1 13  ? 20.129  -27.281 -73.968 1.00 42.42  ? 13  LEU A N     1 
ATOM   89    C CA    . LEU A  1 13  ? 21.486  -27.798 -73.941 1.00 41.77  ? 13  LEU A CA    1 
ATOM   90    C C     . LEU A  1 13  ? 22.050  -27.823 -72.527 1.00 41.24  ? 13  LEU A C     1 
ATOM   91    O O     . LEU A  1 13  ? 21.694  -26.995 -71.677 1.00 38.87  ? 13  LEU A O     1 
ATOM   92    C CB    . LEU A  1 13  ? 22.365  -26.877 -74.821 1.00 42.39  ? 13  LEU A CB    1 
ATOM   93    C CG    . LEU A  1 13  ? 22.175  -26.941 -76.350 1.00 47.02  ? 13  LEU A CG    1 
ATOM   94    C CD1   . LEU A  1 13  ? 22.821  -25.727 -77.025 1.00 47.33  ? 13  LEU A CD1   1 
ATOM   95    C CD2   . LEU A  1 13  ? 22.776  -28.201 -76.917 1.00 47.30  ? 13  LEU A CD2   1 
ATOM   96    N N     . SER A  1 14  ? 23.032  -28.689 -72.327 1.00 38.63  ? 14  SER A N     1 
ATOM   97    C CA    . SER A  1 14  ? 23.744  -28.771 -71.048 1.00 39.56  ? 14  SER A CA    1 
ATOM   98    C C     . SER A  1 14  ? 24.826  -27.711 -70.961 1.00 44.04  ? 14  SER A C     1 
ATOM   99    O O     . SER A  1 14  ? 25.432  -27.330 -71.977 1.00 43.57  ? 14  SER A O     1 
ATOM   100   C CB    . SER A  1 14  ? 24.394  -30.142 -70.859 1.00 40.42  ? 14  SER A CB    1 
ATOM   101   O OG    . SER A  1 14  ? 23.420  -31.094 -70.472 1.00 53.12  ? 14  SER A OG    1 
ATOM   102   N N     . PRO A  1 15  ? 25.180  -27.312 -69.732 1.00 39.78  ? 15  PRO A N     1 
ATOM   103   C CA    . PRO A  1 15  ? 26.301  -26.379 -69.580 1.00 39.57  ? 15  PRO A CA    1 
ATOM   104   C C     . PRO A  1 15  ? 27.617  -26.990 -70.111 1.00 43.51  ? 15  PRO A C     1 
ATOM   105   O O     . PRO A  1 15  ? 27.880  -28.188 -69.956 1.00 43.66  ? 15  PRO A O     1 
ATOM   106   C CB    . PRO A  1 15  ? 26.334  -26.122 -68.059 1.00 40.83  ? 15  PRO A CB    1 
ATOM   107   C CG    . PRO A  1 15  ? 24.976  -26.433 -67.598 1.00 42.76  ? 15  PRO A CG    1 
ATOM   108   C CD    . PRO A  1 15  ? 24.552  -27.599 -68.428 1.00 39.15  ? 15  PRO A CD    1 
ATOM   109   N N     . GLY A  1 16  ? 28.396  -26.170 -70.808 1.00 40.52  ? 16  GLY A N     1 
ATOM   110   C CA    . GLY A  1 16  ? 29.641  -26.590 -71.426 1.00 40.54  ? 16  GLY A CA    1 
ATOM   111   C C     . GLY A  1 16  ? 29.489  -26.910 -72.896 1.00 45.17  ? 16  GLY A C     1 
ATOM   112   O O     . GLY A  1 16  ? 30.496  -27.029 -73.589 1.00 45.15  ? 16  GLY A O     1 
ATOM   113   N N     . GLU A  1 17  ? 28.240  -27.058 -73.392 1.00 42.20  ? 17  GLU A N     1 
ATOM   114   C CA    . GLU A  1 17  ? 27.985  -27.319 -74.803 1.00 42.03  ? 17  GLU A CA    1 
ATOM   115   C C     . GLU A  1 17  ? 28.020  -26.022 -75.609 1.00 46.24  ? 17  GLU A C     1 
ATOM   116   O O     . GLU A  1 17  ? 27.790  -24.930 -75.112 1.00 46.50  ? 17  GLU A O     1 
ATOM   117   C CB    . GLU A  1 17  ? 26.629  -28.019 -75.031 1.00 41.84  ? 17  GLU A CB    1 
ATOM   118   C CG    . GLU A  1 17  ? 26.553  -29.463 -74.539 1.00 54.31  ? 17  GLU A CG    1 
ATOM   119   C CD    . GLU A  1 17  ? 25.313  -30.209 -75.008 1.00 70.84  ? 17  GLU A CD    1 
ATOM   120   O OE1   . GLU A  1 17  ? 25.266  -30.582 -76.203 1.00 83.75  ? 17  GLU A OE1   1 
ATOM   121   O OE2   . GLU A  1 17  ? 24.360  -30.360 -74.211 1.00 64.66  ? 17  GLU A OE2   1 
ATOM   122   N N     . ARG A  1 18  ? 28.295  -26.158 -76.872 1.00 43.97  ? 18  ARG A N     1 
ATOM   123   C CA    . ARG A  1 18  ? 28.261  -25.039 -77.807 1.00 42.42  ? 18  ARG A CA    1 
ATOM   124   C C     . ARG A  1 18  ? 26.810  -24.809 -78.287 1.00 44.81  ? 18  ARG A C     1 
ATOM   125   O O     . ARG A  1 18  ? 26.196  -25.742 -78.786 1.00 46.60  ? 18  ARG A O     1 
ATOM   126   C CB    . ARG A  1 18  ? 29.145  -25.375 -79.000 1.00 40.95  ? 18  ARG A CB    1 
ATOM   127   C CG    . ARG A  1 18  ? 29.144  -24.353 -80.136 1.00 58.66  ? 18  ARG A CG    1 
ATOM   128   C CD    . ARG A  1 18  ? 30.259  -24.665 -81.118 1.00 69.14  ? 18  ARG A CD    1 
ATOM   129   N NE    . ARG A  1 18  ? 31.400  -23.784 -80.856 1.00 87.66  ? 18  ARG A NE    1 
ATOM   130   C CZ    . ARG A  1 18  ? 32.097  -23.100 -81.765 1.00 102.17 ? 18  ARG A CZ    1 
ATOM   131   N NH1   . ARG A  1 18  ? 31.796  -23.192 -83.063 1.00 88.18  ? 18  ARG A NH1   1 
ATOM   132   N NH2   . ARG A  1 18  ? 33.098  -22.317 -81.387 1.00 83.65  ? 18  ARG A NH2   1 
ATOM   133   N N     . ALA A  1 19  ? 26.277  -23.585 -78.190 1.00 39.14  ? 19  ALA A N     1 
ATOM   134   C CA    . ALA A  1 19  ? 24.946  -23.264 -78.741 1.00 37.52  ? 19  ALA A CA    1 
ATOM   135   C C     . ALA A  1 19  ? 25.092  -22.503 -80.055 1.00 42.90  ? 19  ALA A C     1 
ATOM   136   O O     . ALA A  1 19  ? 25.864  -21.555 -80.111 1.00 43.82  ? 19  ALA A O     1 
ATOM   137   C CB    . ALA A  1 19  ? 24.141  -22.456 -77.749 1.00 37.26  ? 19  ALA A CB    1 
ATOM   138   N N     . THR A  1 20  ? 24.353  -22.901 -81.109 1.00 41.00  ? 20  THR A N     1 
ATOM   139   C CA    . THR A  1 20  ? 24.427  -22.270 -82.458 1.00 40.13  ? 20  THR A CA    1 
ATOM   140   C C     . THR A  1 20  ? 23.036  -21.752 -82.856 1.00 40.74  ? 20  THR A C     1 
ATOM   141   O O     . THR A  1 20  ? 22.116  -22.536 -83.106 1.00 39.34  ? 20  THR A O     1 
ATOM   142   C CB    . THR A  1 20  ? 24.955  -23.244 -83.497 1.00 42.70  ? 20  THR A CB    1 
ATOM   143   O OG1   . THR A  1 20  ? 26.256  -23.637 -83.109 1.00 45.35  ? 20  THR A OG1   1 
ATOM   144   C CG2   . THR A  1 20  ? 25.017  -22.621 -84.883 1.00 44.97  ? 20  THR A CG2   1 
ATOM   145   N N     . LEU A  1 21  ? 22.904  -20.435 -82.928 1.00 36.25  ? 21  LEU A N     1 
ATOM   146   C CA    . LEU A  1 21  ? 21.623  -19.756 -83.223 1.00 34.21  ? 21  LEU A CA    1 
ATOM   147   C C     . LEU A  1 21  ? 21.728  -19.138 -84.588 1.00 38.35  ? 21  LEU A C     1 
ATOM   148   O O     . LEU A  1 21  ? 22.745  -18.517 -84.888 1.00 38.24  ? 21  LEU A O     1 
ATOM   149   C CB    . LEU A  1 21  ? 21.386  -18.668 -82.193 1.00 32.53  ? 21  LEU A CB    1 
ATOM   150   C CG    . LEU A  1 21  ? 20.988  -19.127 -80.819 1.00 34.16  ? 21  LEU A CG    1 
ATOM   151   C CD1   . LEU A  1 21  ? 22.147  -19.697 -80.078 1.00 35.83  ? 21  LEU A CD1   1 
ATOM   152   C CD2   . LEU A  1 21  ? 20.435  -18.017 -80.045 1.00 32.26  ? 21  LEU A CD2   1 
ATOM   153   N N     . SER A  1 22  ? 20.719  -19.312 -85.435 1.00 35.23  ? 22  SER A N     1 
ATOM   154   C CA    . SER A  1 22  ? 20.848  -18.779 -86.787 1.00 36.44  ? 22  SER A CA    1 
ATOM   155   C C     . SER A  1 22  ? 19.818  -17.693 -87.063 1.00 40.72  ? 22  SER A C     1 
ATOM   156   O O     . SER A  1 22  ? 18.755  -17.676 -86.468 1.00 38.90  ? 22  SER A O     1 
ATOM   157   C CB    . SER A  1 22  ? 20.848  -19.910 -87.822 1.00 37.74  ? 22  SER A CB    1 
ATOM   158   O OG    . SER A  1 22  ? 19.628  -19.937 -88.536 1.00 58.53  ? 22  SER A OG    1 
ATOM   159   N N     . CYS A  1 23  ? 20.213  -16.715 -87.870 1.00 40.06  ? 23  CYS A N     1 
ATOM   160   C CA    . CYS A  1 23  ? 19.370  -15.602 -88.278 1.00 40.28  ? 23  CYS A CA    1 
ATOM   161   C C     . CYS A  1 23  ? 19.545  -15.449 -89.761 1.00 44.95  ? 23  CYS A C     1 
ATOM   162   O O     . CYS A  1 23  ? 20.654  -15.191 -90.194 1.00 45.26  ? 23  CYS A O     1 
ATOM   163   C CB    . CYS A  1 23  ? 19.758  -14.312 -87.568 1.00 41.40  ? 23  CYS A CB    1 
ATOM   164   S SG    . CYS A  1 23  ? 18.870  -12.856 -88.189 1.00 45.52  ? 23  CYS A SG    1 
ATOM   165   N N     . ARG A  1 24  ? 18.461  -15.539 -90.518 1.00 42.17  ? 24  ARG A N     1 
ATOM   166   C CA    . ARG A  1 24  ? 18.449  -15.385 -91.964 1.00 41.33  ? 24  ARG A CA    1 
ATOM   167   C C     . ARG A  1 24  ? 17.611  -14.163 -92.339 1.00 40.99  ? 24  ARG A C     1 
ATOM   168   O O     . ARG A  1 24  ? 16.428  -14.100 -92.000 1.00 39.81  ? 24  ARG A O     1 
ATOM   169   C CB    . ARG A  1 24  ? 17.861  -16.637 -92.626 1.00 41.18  ? 24  ARG A CB    1 
ATOM   170   C CG    . ARG A  1 24  ? 18.095  -16.643 -94.138 1.00 48.96  ? 24  ARG A CG    1 
ATOM   171   C CD    . ARG A  1 24  ? 17.545  -17.877 -94.824 1.00 49.70  ? 24  ARG A CD    1 
ATOM   172   N NE    . ARG A  1 24  ? 16.066  -17.954 -94.785 1.00 45.56  ? 24  ARG A NE    1 
ATOM   173   C CZ    . ARG A  1 24  ? 15.335  -18.805 -94.073 1.00 51.11  ? 24  ARG A CZ    1 
ATOM   174   N NH1   . ARG A  1 24  ? 15.917  -19.669 -93.247 1.00 53.15  ? 24  ARG A NH1   1 
ATOM   175   N NH2   . ARG A  1 24  ? 14.009  -18.781 -94.158 1.00 53.32  ? 24  ARG A NH2   1 
ATOM   176   N N     . ALA A  1 25  ? 18.214  -13.196 -93.015 1.00 37.20  ? 25  ALA A N     1 
ATOM   177   C CA    . ALA A  1 25  ? 17.505  -11.988 -93.433 1.00 36.76  ? 25  ALA A CA    1 
ATOM   178   C C     . ALA A  1 25  ? 16.847  -12.220 -94.792 1.00 42.43  ? 25  ALA A C     1 
ATOM   179   O O     . ALA A  1 25  ? 17.384  -12.933 -95.619 1.00 44.01  ? 25  ALA A O     1 
ATOM   180   C CB    . ALA A  1 25  ? 18.467  -10.812 -93.497 1.00 36.99  ? 25  ALA A CB    1 
ATOM   181   N N     . SER A  1 26  ? 15.684  -11.637 -95.027 1.00 40.60  ? 26  SER A N     1 
ATOM   182   C CA    . SER A  1 26  ? 15.006  -11.841 -96.298 1.00 41.77  ? 26  SER A CA    1 
ATOM   183   C C     . SER A  1 26  ? 15.696  -11.132 -97.487 1.00 49.16  ? 26  SER A C     1 
ATOM   184   O O     . SER A  1 26  ? 15.508  -11.546 -98.612 1.00 50.38  ? 26  SER A O     1 
ATOM   185   C CB    . SER A  1 26  ? 13.534  -11.462 -96.189 1.00 40.89  ? 26  SER A CB    1 
ATOM   186   O OG    . SER A  1 26  ? 13.380  -10.133 -95.733 1.00 41.36  ? 26  SER A OG    1 
ATOM   187   N N     . LYS A  1 27  ? 16.512  -10.111 -97.212 1.00 46.67  ? 27  LYS A N     1 
ATOM   188   C CA    . LYS A  1 27  ? 17.239  -9.236  -98.150 1.00 46.32  ? 27  LYS A CA    1 
ATOM   189   C C     . LYS A  1 27  ? 18.630  -9.112  -97.523 1.00 47.42  ? 27  LYS A C     1 
ATOM   190   O O     . LYS A  1 27  ? 18.727  -9.177  -96.311 1.00 42.57  ? 27  LYS A O     1 
ATOM   191   C CB    . LYS A  1 27  ? 16.585  -7.813  -98.075 1.00 48.96  ? 27  LYS A CB    1 
ATOM   192   C CG    . LYS A  1 27  ? 16.225  -7.128  -99.350 1.00 60.25  ? 27  LYS A CG    1 
ATOM   193   C CD    . LYS A  1 27  ? 15.821  -5.643  -99.080 1.00 73.48  ? 27  LYS A CD    1 
ATOM   194   C CE    . LYS A  1 27  ? 17.003  -4.682  -99.190 1.00 90.18  ? 27  LYS A CE    1 
ATOM   195   N NZ    . LYS A  1 27  ? 16.613  -3.239  -99.085 1.00 91.77  ? 27  LYS A NZ    1 
ATOM   196   N N     . GLY A  1 28  ? 19.659  -8.844  -98.316 1.00 47.58  ? 28  GLY A N     1 
ATOM   197   C CA    . GLY A  1 28  ? 20.994  -8.618  -97.796 1.00 46.86  ? 28  GLY A CA    1 
ATOM   198   C C     . GLY A  1 28  ? 21.065  -7.401  -96.888 1.00 48.25  ? 28  GLY A C     1 
ATOM   199   O O     . GLY A  1 28  ? 20.387  -6.398  -97.147 1.00 46.03  ? 28  GLY A O     1 
ATOM   200   N N     . VAL A  1 29  ? 21.869  -7.491  -95.796 1.00 42.88  ? 29  VAL A N     1 
ATOM   201   C CA    . VAL A  1 29  ? 22.029  -6.400  -94.817 1.00 40.83  ? 29  VAL A CA    1 
ATOM   202   C C     . VAL A  1 29  ? 23.476  -5.884  -94.770 1.00 45.63  ? 29  VAL A C     1 
ATOM   203   O O     . VAL A  1 29  ? 23.838  -5.150  -93.851 1.00 42.76  ? 29  VAL A O     1 
ATOM   204   C CB    . VAL A  1 29  ? 21.481  -6.739  -93.414 1.00 42.81  ? 29  VAL A CB    1 
ATOM   205   C CG1   . VAL A  1 29  ? 19.964  -6.968  -93.463 1.00 42.74  ? 29  VAL A CG1   1 
ATOM   206   C CG2   . VAL A  1 29  ? 22.201  -7.925  -92.775 1.00 41.87  ? 29  VAL A CG2   1 
ATOM   207   N N     . SER A  1 30  ? 24.271  -6.215  -95.801 1.00 46.16  ? 30  SER A N     1 
ATOM   208   C CA    . SER A  1 30  ? 25.676  -5.808  -95.935 1.00 47.69  ? 30  SER A CA    1 
ATOM   209   C C     . SER A  1 30  ? 25.876  -4.732  -96.969 1.00 54.52  ? 30  SER A C     1 
ATOM   210   O O     . SER A  1 30  ? 25.267  -4.775  -98.021 1.00 55.35  ? 30  SER A O     1 
ATOM   211   C CB    . SER A  1 30  ? 26.560  -6.997  -96.256 1.00 48.79  ? 30  SER A CB    1 
ATOM   212   O OG    . SER A  1 30  ? 26.266  -8.069  -95.375 1.00 57.79  ? 30  SER A OG    1 
ATOM   213   N N     . THR A  1 31  ? 26.702  -3.747  -96.650 1.00 55.44  ? 31  THR A N     1 
ATOM   214   C CA    . THR A  1 31  ? 26.987  -2.624  -97.551 1.00 58.36  ? 31  THR A CA    1 
ATOM   215   C C     . THR A  1 31  ? 28.289  -1.970  -97.190 1.00 62.36  ? 31  THR A C     1 
ATOM   216   O O     . THR A  1 31  ? 28.485  -1.629  -96.016 1.00 59.97  ? 31  THR A O     1 
ATOM   217   C CB    . THR A  1 31  ? 25.889  -1.545  -97.449 1.00 75.79  ? 31  THR A CB    1 
ATOM   218   O OG1   . THR A  1 31  ? 24.605  -2.138  -97.606 1.00 82.47  ? 31  THR A OG1   1 
ATOM   219   C CG2   . THR A  1 31  ? 26.067  -0.450  -98.473 1.00 78.25  ? 31  THR A CG2   1 
ATOM   220   N N     . SER A  1 32  ? 29.163  -1.758  -98.201 1.00 62.14  ? 32  SER A N     1 
ATOM   221   C CA    . SER A  1 32  ? 30.438  -1.050  -98.054 1.00 62.83  ? 32  SER A CA    1 
ATOM   222   C C     . SER A  1 32  ? 31.305  -1.583  -96.892 1.00 64.79  ? 32  SER A C     1 
ATOM   223   O O     . SER A  1 32  ? 31.818  -0.800  -96.091 1.00 65.55  ? 32  SER A O     1 
ATOM   224   C CB    . SER A  1 32  ? 30.176  0.444   -97.865 1.00 67.89  ? 32  SER A CB    1 
ATOM   225   O OG    . SER A  1 32  ? 29.313  0.996   -98.851 1.00 78.12  ? 32  SER A OG    1 
ATOM   226   N N     . GLY A  1 33  ? 31.444  -2.900  -96.813 1.00 58.47  ? 33  GLY A N     1 
ATOM   227   C CA    . GLY A  1 33  ? 32.247  -3.541  -95.780 1.00 57.63  ? 33  GLY A CA    1 
ATOM   228   C C     . GLY A  1 33  ? 31.606  -3.722  -94.413 1.00 61.11  ? 33  GLY A C     1 
ATOM   229   O O     . GLY A  1 33  ? 32.279  -4.171  -93.484 1.00 61.67  ? 33  GLY A O     1 
ATOM   230   N N     . TYR A  1 34  ? 30.310  -3.418  -94.268 1.00 55.54  ? 34  TYR A N     1 
ATOM   231   C CA    . TYR A  1 34  ? 29.618  -3.570  -92.991 1.00 53.65  ? 34  TYR A CA    1 
ATOM   232   C C     . TYR A  1 34  ? 28.346  -4.380  -93.129 1.00 51.00  ? 34  TYR A C     1 
ATOM   233   O O     . TYR A  1 34  ? 27.614  -4.174  -94.085 1.00 49.55  ? 34  TYR A O     1 
ATOM   234   C CB    . TYR A  1 34  ? 29.290  -2.179  -92.415 1.00 55.61  ? 34  TYR A CB    1 
ATOM   235   C CG    . TYR A  1 34  ? 30.542  -1.460  -91.969 1.00 60.06  ? 34  TYR A CG    1 
ATOM   236   C CD1   . TYR A  1 34  ? 31.300  -1.939  -90.905 1.00 62.18  ? 34  TYR A CD1   1 
ATOM   237   C CD2   . TYR A  1 34  ? 31.022  -0.357  -92.666 1.00 62.02  ? 34  TYR A CD2   1 
ATOM   238   C CE1   . TYR A  1 34  ? 32.470  -1.302  -90.506 1.00 63.76  ? 34  TYR A CE1   1 
ATOM   239   C CE2   . TYR A  1 34  ? 32.207  0.273   -92.293 1.00 63.80  ? 34  TYR A CE2   1 
ATOM   240   C CZ    . TYR A  1 34  ? 32.927  -0.197  -91.206 1.00 71.82  ? 34  TYR A CZ    1 
ATOM   241   O OH    . TYR A  1 34  ? 34.087  0.428   -90.810 1.00 72.20  ? 34  TYR A OH    1 
ATOM   242   N N     . SER A  1 35  ? 28.060  -5.258  -92.146 1.00 43.62  ? 35  SER A N     1 
ATOM   243   C CA    . SER A  1 35  ? 26.799  -6.007  -92.080 1.00 41.97  ? 35  SER A CA    1 
ATOM   244   C C     . SER A  1 35  ? 26.002  -5.418  -90.939 1.00 42.20  ? 35  SER A C     1 
ATOM   245   O O     . SER A  1 35  ? 26.458  -5.474  -89.807 1.00 41.77  ? 35  SER A O     1 
ATOM   246   C CB    . SER A  1 35  ? 27.054  -7.492  -91.897 1.00 45.39  ? 35  SER A CB    1 
ATOM   247   O OG    . SER A  1 35  ? 27.549  -7.996  -93.124 1.00 54.51  ? 35  SER A OG    1 
ATOM   248   N N     . TYR A  1 36  ? 24.846  -4.810  -91.231 1.00 37.58  ? 36  TYR A N     1 
ATOM   249   C CA    . TYR A  1 36  ? 24.037  -4.096  -90.227 1.00 36.29  ? 36  TYR A CA    1 
ATOM   250   C C     . TYR A  1 36  ? 23.081  -5.038  -89.534 1.00 39.89  ? 36  TYR A C     1 
ATOM   251   O O     . TYR A  1 36  ? 21.890  -5.002  -89.773 1.00 39.65  ? 36  TYR A O     1 
ATOM   252   C CB    . TYR A  1 36  ? 23.321  -2.927  -90.885 1.00 38.40  ? 36  TYR A CB    1 
ATOM   253   C CG    . TYR A  1 36  ? 24.284  -1.865  -91.360 1.00 41.72  ? 36  TYR A CG    1 
ATOM   254   C CD1   . TYR A  1 36  ? 24.802  -0.925  -90.478 1.00 44.39  ? 36  TYR A CD1   1 
ATOM   255   C CD2   . TYR A  1 36  ? 24.778  -1.875  -92.661 1.00 43.56  ? 36  TYR A CD2   1 
ATOM   256   C CE1   . TYR A  1 36  ? 25.741  0.014   -90.889 1.00 46.62  ? 36  TYR A CE1   1 
ATOM   257   C CE2   . TYR A  1 36  ? 25.789  -0.997  -93.058 1.00 45.15  ? 36  TYR A CE2   1 
ATOM   258   C CZ    . TYR A  1 36  ? 26.223  -0.013  -92.185 1.00 54.89  ? 36  TYR A CZ    1 
ATOM   259   O OH    . TYR A  1 36  ? 27.142  0.939   -92.558 1.00 63.15  ? 36  TYR A OH    1 
ATOM   260   N N     . LEU A  1 37  ? 23.641  -5.891  -88.673 1.00 35.41  ? 37  LEU A N     1 
ATOM   261   C CA    . LEU A  1 37  ? 22.946  -6.980  -88.033 1.00 34.56  ? 37  LEU A CA    1 
ATOM   262   C C     . LEU A  1 37  ? 23.528  -7.143  -86.633 1.00 36.10  ? 37  LEU A C     1 
ATOM   263   O O     . LEU A  1 37  ? 24.708  -7.350  -86.512 1.00 35.93  ? 37  LEU A O     1 
ATOM   264   C CB    . LEU A  1 37  ? 23.152  -8.276  -88.898 1.00 33.97  ? 37  LEU A CB    1 
ATOM   265   C CG    . LEU A  1 37  ? 22.259  -9.522  -88.640 1.00 36.75  ? 37  LEU A CG    1 
ATOM   266   C CD1   . LEU A  1 37  ? 22.543  -10.173 -87.280 1.00 36.28  ? 37  LEU A CD1   1 
ATOM   267   C CD2   . LEU A  1 37  ? 20.842  -9.216  -88.755 1.00 36.10  ? 37  LEU A CD2   1 
ATOM   268   N N     . HIS A  1 38  ? 22.708  -6.957  -85.588 1.00 32.84  ? 38  HIS A N     1 
ATOM   269   C CA    . HIS A  1 38  ? 23.123  -7.031  -84.189 1.00 31.96  ? 38  HIS A CA    1 
ATOM   270   C C     . HIS A  1 38  ? 22.313  -8.099  -83.430 1.00 35.14  ? 38  HIS A C     1 
ATOM   271   O O     . HIS A  1 38  ? 21.230  -8.490  -83.872 1.00 33.57  ? 38  HIS A O     1 
ATOM   272   C CB    . HIS A  1 38  ? 22.919  -5.662  -83.544 1.00 33.06  ? 38  HIS A CB    1 
ATOM   273   C CG    . HIS A  1 38  ? 23.216  -4.512  -84.456 1.00 36.62  ? 38  HIS A CG    1 
ATOM   274   N ND1   . HIS A  1 38  ? 24.508  -4.151  -84.771 1.00 38.84  ? 38  HIS A ND1   1 
ATOM   275   C CD2   . HIS A  1 38  ? 22.368  -3.735  -85.163 1.00 38.19  ? 38  HIS A CD2   1 
ATOM   276   C CE1   . HIS A  1 38  ? 24.402  -3.140  -85.617 1.00 38.17  ? 38  HIS A CE1   1 
ATOM   277   N NE2   . HIS A  1 38  ? 23.138  -2.860  -85.880 1.00 38.00  ? 38  HIS A NE2   1 
ATOM   278   N N     . TRP A  1 39  ? 22.895  -8.605  -82.333 1.00 32.18  ? 39  TRP A N     1 
ATOM   279   C CA    . TRP A  1 39  ? 22.336  -9.656  -81.516 1.00 31.61  ? 39  TRP A CA    1 
ATOM   280   C C     . TRP A  1 39  ? 22.151  -9.172  -80.113 1.00 34.93  ? 39  TRP A C     1 
ATOM   281   O O     . TRP A  1 39  ? 23.045  -8.531  -79.579 1.00 32.63  ? 39  TRP A O     1 
ATOM   282   C CB    . TRP A  1 39  ? 23.272  -10.851 -81.451 1.00 30.31  ? 39  TRP A CB    1 
ATOM   283   C CG    . TRP A  1 39  ? 23.345  -11.667 -82.699 1.00 31.81  ? 39  TRP A CG    1 
ATOM   284   C CD1   . TRP A  1 39  ? 24.275  -11.567 -83.692 1.00 35.32  ? 39  TRP A CD1   1 
ATOM   285   C CD2   . TRP A  1 39  ? 22.457  -12.723 -83.084 1.00 31.43  ? 39  TRP A CD2   1 
ATOM   286   N NE1   . TRP A  1 39  ? 24.016  -12.488 -84.669 1.00 34.79  ? 39  TRP A NE1   1 
ATOM   287   C CE2   . TRP A  1 39  ? 22.918  -13.226 -84.315 1.00 34.89  ? 39  TRP A CE2   1 
ATOM   288   C CE3   . TRP A  1 39  ? 21.346  -13.338 -82.473 1.00 32.45  ? 39  TRP A CE3   1 
ATOM   289   C CZ2   . TRP A  1 39  ? 22.311  -14.303 -84.958 1.00 34.11  ? 39  TRP A CZ2   1 
ATOM   290   C CZ3   . TRP A  1 39  ? 20.757  -14.428 -83.106 1.00 33.00  ? 39  TRP A CZ3   1 
ATOM   291   C CH2   . TRP A  1 39  ? 21.269  -14.921 -84.315 1.00 33.97  ? 39  TRP A CH2   1 
ATOM   292   N N     . TYR A  1 40  ? 21.013  -9.538  -79.489 1.00 32.28  ? 40  TYR A N     1 
ATOM   293   C CA    . TYR A  1 40  ? 20.721  -9.163  -78.103 1.00 30.70  ? 40  TYR A CA    1 
ATOM   294   C C     . TYR A  1 40  ? 20.341  -10.367 -77.320 1.00 34.21  ? 40  TYR A C     1 
ATOM   295   O O     . TYR A  1 40  ? 19.816  -11.326 -77.884 1.00 31.33  ? 40  TYR A O     1 
ATOM   296   C CB    . TYR A  1 40  ? 19.571  -8.173  -78.015 1.00 29.49  ? 40  TYR A CB    1 
ATOM   297   C CG    . TYR A  1 40  ? 19.812  -6.928  -78.827 1.00 28.72  ? 40  TYR A CG    1 
ATOM   298   C CD1   . TYR A  1 40  ? 19.494  -6.880  -80.179 1.00 30.17  ? 40  TYR A CD1   1 
ATOM   299   C CD2   . TYR A  1 40  ? 20.356  -5.799  -78.248 1.00 28.69  ? 40  TYR A CD2   1 
ATOM   300   C CE1   . TYR A  1 40  ? 19.760  -5.752  -80.936 1.00 31.01  ? 40  TYR A CE1   1 
ATOM   301   C CE2   . TYR A  1 40  ? 20.651  -4.673  -79.000 1.00 30.22  ? 40  TYR A CE2   1 
ATOM   302   C CZ    . TYR A  1 40  ? 20.360  -4.650  -80.344 1.00 34.10  ? 40  TYR A CZ    1 
ATOM   303   O OH    . TYR A  1 40  ? 20.578  -3.478  -81.019 1.00 32.41  ? 40  TYR A OH    1 
ATOM   304   N N     . GLN A  1 41  ? 20.522  -10.257 -75.999 1.00 32.27  ? 41  GLN A N     1 
ATOM   305   C CA    . GLN A  1 41  ? 20.164  -11.273 -75.030 1.00 33.03  ? 41  GLN A CA    1 
ATOM   306   C C     . GLN A  1 41  ? 19.127  -10.646 -74.126 1.00 34.51  ? 41  GLN A C     1 
ATOM   307   O O     . GLN A  1 41  ? 19.386  -9.584  -73.582 1.00 32.92  ? 41  GLN A O     1 
ATOM   308   C CB    . GLN A  1 41  ? 21.395  -11.677 -74.187 1.00 34.93  ? 41  GLN A CB    1 
ATOM   309   C CG    . GLN A  1 41  ? 21.093  -12.666 -73.054 1.00 37.43  ? 41  GLN A CG    1 
ATOM   310   C CD    . GLN A  1 41  ? 22.280  -12.808 -72.167 1.00 31.87  ? 41  GLN A CD    1 
ATOM   311   O OE1   . GLN A  1 41  ? 22.707  -11.852 -71.533 1.00 33.04  ? 41  GLN A OE1   1 
ATOM   312   N NE2   . GLN A  1 41  ? 22.929  -13.956 -72.187 1.00 34.01  ? 41  GLN A NE2   1 
ATOM   313   N N     . GLN A  1 42  ? 17.959  -11.276 -73.974 1.00 30.36  ? 42  GLN A N     1 
ATOM   314   C CA    . GLN A  1 42  ? 16.937  -10.772 -73.045 1.00 29.61  ? 42  GLN A CA    1 
ATOM   315   C C     . GLN A  1 42  ? 16.592  -11.818 -71.994 1.00 33.81  ? 42  GLN A C     1 
ATOM   316   O O     . GLN A  1 42  ? 16.041  -12.845 -72.321 1.00 33.40  ? 42  GLN A O     1 
ATOM   317   C CB    . GLN A  1 42  ? 15.667  -10.302 -73.743 1.00 29.71  ? 42  GLN A CB    1 
ATOM   318   C CG    . GLN A  1 42  ? 14.768  -9.531  -72.762 1.00 31.90  ? 42  GLN A CG    1 
ATOM   319   C CD    . GLN A  1 42  ? 13.523  -8.977  -73.416 1.00 40.02  ? 42  GLN A CD    1 
ATOM   320   O OE1   . GLN A  1 42  ? 13.002  -9.523  -74.360 1.00 37.09  ? 42  GLN A OE1   1 
ATOM   321   N NE2   . GLN A  1 42  ? 13.005  -7.903  -72.900 1.00 36.78  ? 42  GLN A NE2   1 
ATOM   322   N N     . LYS A  1 43  ? 16.893  -11.528 -70.743 1.00 35.73  ? 43  LYS A N     1 
ATOM   323   C CA    . LYS A  1 43  ? 16.616  -12.396 -69.593 1.00 36.49  ? 43  LYS A CA    1 
ATOM   324   C C     . LYS A  1 43  ? 15.312  -11.969 -68.942 1.00 41.43  ? 43  LYS A C     1 
ATOM   325   O O     . LYS A  1 43  ? 14.947  -10.809 -69.057 1.00 40.07  ? 43  LYS A O     1 
ATOM   326   C CB    . LYS A  1 43  ? 17.753  -12.321 -68.550 1.00 36.61  ? 43  LYS A CB    1 
ATOM   327   C CG    . LYS A  1 43  ? 19.016  -13.011 -69.023 1.00 36.81  ? 43  LYS A CG    1 
ATOM   328   C CD    . LYS A  1 43  ? 20.169  -12.951 -68.008 1.00 38.79  ? 43  LYS A CD    1 
ATOM   329   C CE    . LYS A  1 43  ? 21.470  -13.382 -68.674 1.00 40.85  ? 43  LYS A CE    1 
ATOM   330   N NZ    . LYS A  1 43  ? 22.617  -13.549 -67.718 1.00 48.17  ? 43  LYS A NZ    1 
ATOM   331   N N     . PRO A  1 44  ? 14.604  -12.889 -68.245 1.00 42.65  ? 44  PRO A N     1 
ATOM   332   C CA    . PRO A  1 44  ? 13.365  -12.504 -67.544 1.00 43.71  ? 44  PRO A CA    1 
ATOM   333   C C     . PRO A  1 44  ? 13.446  -11.224 -66.717 1.00 46.74  ? 44  PRO A C     1 
ATOM   334   O O     . PRO A  1 44  ? 14.378  -11.071 -65.932 1.00 47.09  ? 44  PRO A O     1 
ATOM   335   C CB    . PRO A  1 44  ? 13.139  -13.700 -66.605 1.00 45.72  ? 44  PRO A CB    1 
ATOM   336   C CG    . PRO A  1 44  ? 13.643  -14.824 -67.335 1.00 48.66  ? 44  PRO A CG    1 
ATOM   337   C CD    . PRO A  1 44  ? 14.889  -14.328 -68.027 1.00 44.15  ? 44  PRO A CD    1 
ATOM   338   N N     . GLY A  1 45  ? 12.509  -10.304 -66.950 1.00 43.09  ? 45  GLY A N     1 
ATOM   339   C CA    . GLY A  1 45  ? 12.420  -9.062  -66.189 1.00 43.31  ? 45  GLY A CA    1 
ATOM   340   C C     . GLY A  1 45  ? 13.424  -7.985  -66.527 1.00 48.96  ? 45  GLY A C     1 
ATOM   341   O O     . GLY A  1 45  ? 13.516  -6.994  -65.796 1.00 50.16  ? 45  GLY A O     1 
ATOM   342   N N     . GLN A  1 46  ? 14.195  -8.149  -67.622 1.00 43.38  ? 46  GLN A N     1 
ATOM   343   C CA    . GLN A  1 46  ? 15.187  -7.157  -67.989 1.00 39.04  ? 46  GLN A CA    1 
ATOM   344   C C     . GLN A  1 46  ? 15.026  -6.662  -69.389 1.00 38.03  ? 46  GLN A C     1 
ATOM   345   O O     . GLN A  1 46  ? 14.446  -7.329  -70.264 1.00 37.10  ? 46  GLN A O     1 
ATOM   346   C CB    . GLN A  1 46  ? 16.573  -7.771  -67.849 1.00 40.03  ? 46  GLN A CB    1 
ATOM   347   C CG    . GLN A  1 46  ? 16.923  -8.266  -66.449 1.00 48.96  ? 46  GLN A CG    1 
ATOM   348   C CD    . GLN A  1 46  ? 18.333  -8.850  -66.382 1.00 63.26  ? 46  GLN A CD    1 
ATOM   349   O OE1   . GLN A  1 46  ? 19.088  -8.887  -67.369 1.00 55.85  ? 46  GLN A OE1   1 
ATOM   350   N NE2   . GLN A  1 46  ? 18.725  -9.332  -65.218 1.00 54.83  ? 46  GLN A NE2   1 
ATOM   351   N N     . ALA A  1 47  ? 15.664  -5.526  -69.642 1.00 33.88  ? 47  ALA A N     1 
ATOM   352   C CA    . ALA A  1 47  ? 15.779  -4.977  -70.971 1.00 34.31  ? 47  ALA A CA    1 
ATOM   353   C C     . ALA A  1 47  ? 16.718  -5.881  -71.797 1.00 35.59  ? 47  ALA A C     1 
ATOM   354   O O     . ALA A  1 47  ? 17.610  -6.547  -71.235 1.00 34.33  ? 47  ALA A O     1 
ATOM   355   C CB    . ALA A  1 47  ? 16.385  -3.562  -70.891 1.00 37.11  ? 47  ALA A CB    1 
ATOM   356   N N     . PRO A  1 48  ? 16.561  -5.906  -73.133 1.00 31.55  ? 48  PRO A N     1 
ATOM   357   C CA    . PRO A  1 48  ? 17.529  -6.615  -73.960 1.00 31.34  ? 48  PRO A CA    1 
ATOM   358   C C     . PRO A  1 48  ? 18.933  -6.055  -73.752 1.00 37.43  ? 48  PRO A C     1 
ATOM   359   O O     . PRO A  1 48  ? 19.090  -4.881  -73.457 1.00 39.54  ? 48  PRO A O     1 
ATOM   360   C CB    . PRO A  1 48  ? 17.054  -6.328  -75.388 1.00 33.52  ? 48  PRO A CB    1 
ATOM   361   C CG    . PRO A  1 48  ? 15.667  -5.900  -75.260 1.00 37.42  ? 48  PRO A CG    1 
ATOM   362   C CD    . PRO A  1 48  ? 15.534  -5.244  -73.955 1.00 34.17  ? 48  PRO A CD    1 
ATOM   363   N N     . ARG A  1 49  ? 19.937  -6.909  -73.859 1.00 33.12  ? 49  ARG A N     1 
ATOM   364   C CA    . ARG A  1 49  ? 21.341  -6.576  -73.710 1.00 32.10  ? 49  ARG A CA    1 
ATOM   365   C C     . ARG A  1 49  ? 22.077  -6.788  -75.018 1.00 33.87  ? 49  ARG A C     1 
ATOM   366   O O     . ARG A  1 49  ? 22.081  -7.893  -75.510 1.00 34.48  ? 49  ARG A O     1 
ATOM   367   C CB    . ARG A  1 49  ? 21.921  -7.529  -72.666 1.00 31.70  ? 49  ARG A CB    1 
ATOM   368   C CG    . ARG A  1 49  ? 23.410  -7.343  -72.347 1.00 33.93  ? 49  ARG A CG    1 
ATOM   369   C CD    . ARG A  1 49  ? 23.909  -8.631  -71.725 1.00 38.25  ? 49  ARG A CD    1 
ATOM   370   N NE    . ARG A  1 49  ? 25.292  -8.580  -71.249 1.00 46.62  ? 49  ARG A NE    1 
ATOM   371   C CZ    . ARG A  1 49  ? 25.962  -9.610  -70.727 1.00 53.58  ? 49  ARG A CZ    1 
ATOM   372   N NH1   . ARG A  1 49  ? 25.383  -10.810 -70.609 1.00 46.18  ? 49  ARG A NH1   1 
ATOM   373   N NH2   . ARG A  1 49  ? 27.206  -9.450  -70.311 1.00 42.79  ? 49  ARG A NH2   1 
ATOM   374   N N     . LEU A  1 50  ? 22.732  -5.779  -75.568 1.00 31.12  ? 50  LEU A N     1 
ATOM   375   C CA    . LEU A  1 50  ? 23.573  -5.964  -76.781 1.00 31.19  ? 50  LEU A CA    1 
ATOM   376   C C     . LEU A  1 50  ? 24.753  -6.906  -76.532 1.00 34.46  ? 50  LEU A C     1 
ATOM   377   O O     . LEU A  1 50  ? 25.554  -6.667  -75.615 1.00 33.81  ? 50  LEU A O     1 
ATOM   378   C CB    . LEU A  1 50  ? 24.144  -4.597  -77.249 1.00 31.17  ? 50  LEU A CB    1 
ATOM   379   C CG    . LEU A  1 50  ? 24.959  -4.565  -78.563 1.00 32.50  ? 50  LEU A CG    1 
ATOM   380   C CD1   . LEU A  1 50  ? 24.125  -4.933  -79.727 1.00 29.94  ? 50  LEU A CD1   1 
ATOM   381   C CD2   . LEU A  1 50  ? 25.533  -3.172  -78.810 1.00 35.49  ? 50  LEU A CD2   1 
ATOM   382   N N     . LEU A  1 51  ? 24.858  -7.966  -77.353 1.00 32.37  ? 51  LEU A N     1 
ATOM   383   C CA    . LEU A  1 51  ? 25.989  -8.902  -77.308 1.00 32.47  ? 51  LEU A CA    1 
ATOM   384   C C     . LEU A  1 51  ? 27.001  -8.605  -78.397 1.00 38.01  ? 51  LEU A C     1 
ATOM   385   O O     . LEU A  1 51  ? 28.202  -8.499  -78.125 1.00 37.80  ? 51  LEU A O     1 
ATOM   386   C CB    . LEU A  1 51  ? 25.511  -10.349 -77.488 1.00 31.88  ? 51  LEU A CB    1 
ATOM   387   C CG    . LEU A  1 51  ? 24.518  -10.906 -76.464 1.00 36.28  ? 51  LEU A CG    1 
ATOM   388   C CD1   . LEU A  1 51  ? 24.075  -12.283 -76.897 1.00 36.34  ? 51  LEU A CD1   1 
ATOM   389   C CD2   . LEU A  1 51  ? 25.108  -10.921 -75.048 1.00 33.51  ? 51  LEU A CD2   1 
ATOM   390   N N     . ILE A  1 52  ? 26.503  -8.555  -79.646 1.00 34.70  ? 52  ILE A N     1 
ATOM   391   C CA    . ILE A  1 52  ? 27.281  -8.422  -80.885 1.00 33.87  ? 52  ILE A CA    1 
ATOM   392   C C     . ILE A  1 52  ? 26.675  -7.337  -81.738 1.00 37.47  ? 52  ILE A C     1 
ATOM   393   O O     . ILE A  1 52  ? 25.463  -7.325  -81.941 1.00 34.90  ? 52  ILE A O     1 
ATOM   394   C CB    . ILE A  1 52  ? 27.278  -9.749  -81.724 1.00 35.77  ? 52  ILE A CB    1 
ATOM   395   C CG1   . ILE A  1 52  ? 27.784  -10.976 -80.925 1.00 35.50  ? 52  ILE A CG1   1 
ATOM   396   C CG2   . ILE A  1 52  ? 28.040  -9.605  -83.057 1.00 34.75  ? 52  ILE A CG2   1 
ATOM   397   C CD1   . ILE A  1 52  ? 29.269  -10.967 -80.525 1.00 34.76  ? 52  ILE A CD1   1 
ATOM   398   N N     . TYR A  1 53  ? 27.532  -6.486  -82.311 1.00 35.94  ? 53  TYR A N     1 
ATOM   399   C CA    . TYR A  1 53  ? 27.095  -5.461  -83.227 1.00 34.52  ? 53  TYR A CA    1 
ATOM   400   C C     . TYR A  1 53  ? 27.836  -5.621  -84.535 1.00 36.81  ? 53  TYR A C     1 
ATOM   401   O O     . TYR A  1 53  ? 28.915  -6.207  -84.591 1.00 34.00  ? 53  TYR A O     1 
ATOM   402   C CB    . TYR A  1 53  ? 27.219  -4.057  -82.631 1.00 35.31  ? 53  TYR A CB    1 
ATOM   403   C CG    . TYR A  1 53  ? 28.626  -3.588  -82.380 1.00 35.38  ? 53  TYR A CG    1 
ATOM   404   C CD1   . TYR A  1 53  ? 29.384  -3.018  -83.399 1.00 38.69  ? 53  TYR A CD1   1 
ATOM   405   C CD2   . TYR A  1 53  ? 29.208  -3.721  -81.131 1.00 35.13  ? 53  TYR A CD2   1 
ATOM   406   C CE1   . TYR A  1 53  ? 30.709  -2.658  -83.198 1.00 38.27  ? 53  TYR A CE1   1 
ATOM   407   C CE2   . TYR A  1 53  ? 30.526  -3.336  -80.907 1.00 36.13  ? 53  TYR A CE2   1 
ATOM   408   C CZ    . TYR A  1 53  ? 31.265  -2.780  -81.938 1.00 43.36  ? 53  TYR A CZ    1 
ATOM   409   O OH    . TYR A  1 53  ? 32.551  -2.350  -81.730 1.00 39.60  ? 53  TYR A OH    1 
ATOM   410   N N     . LEU A  1 54  ? 27.174  -5.195  -85.615 1.00 36.64  ? 54  LEU A N     1 
ATOM   411   C CA    . LEU A  1 54  ? 27.695  -5.262  -86.980 1.00 36.21  ? 54  LEU A CA    1 
ATOM   412   C C     . LEU A  1 54  ? 28.204  -6.656  -87.316 1.00 40.71  ? 54  LEU A C     1 
ATOM   413   O O     . LEU A  1 54  ? 29.355  -6.854  -87.695 1.00 40.75  ? 54  LEU A O     1 
ATOM   414   C CB    . LEU A  1 54  ? 28.736  -4.162  -87.236 1.00 36.28  ? 54  LEU A CB    1 
ATOM   415   C CG    . LEU A  1 54  ? 28.226  -2.740  -87.217 1.00 39.49  ? 54  LEU A CG    1 
ATOM   416   C CD1   . LEU A  1 54  ? 29.388  -1.765  -87.255 1.00 38.23  ? 54  LEU A CD1   1 
ATOM   417   C CD2   . LEU A  1 54  ? 27.238  -2.482  -88.358 1.00 47.17  ? 54  LEU A CD2   1 
ATOM   418   N N     . ALA A  1 55  ? 27.350  -7.643  -87.016 1.00 38.49  ? 55  ALA A N     1 
ATOM   419   C CA    . ALA A  1 55  ? 27.498  -9.064  -87.312 1.00 36.89  ? 55  ALA A CA    1 
ATOM   420   C C     . ALA A  1 55  ? 28.511  -9.819  -86.465 1.00 39.67  ? 55  ALA A C     1 
ATOM   421   O O     . ALA A  1 55  ? 28.283  -10.991 -86.159 1.00 35.46  ? 55  ALA A O     1 
ATOM   422   C CB    . ALA A  1 55  ? 27.826  -9.257  -88.795 1.00 37.35  ? 55  ALA A CB    1 
ATOM   423   N N     . SER A  1 56  ? 29.660  -9.215  -86.179 1.00 39.77  ? 56  SER A N     1 
ATOM   424   C CA    . SER A  1 56  ? 30.725  -9.947  -85.510 1.00 40.32  ? 56  SER A CA    1 
ATOM   425   C C     . SER A  1 56  ? 31.562  -9.186  -84.500 1.00 42.35  ? 56  SER A C     1 
ATOM   426   O O     . SER A  1 56  ? 32.518  -9.785  -84.033 1.00 41.24  ? 56  SER A O     1 
ATOM   427   C CB    . SER A  1 56  ? 31.641  -10.559 -86.574 1.00 44.18  ? 56  SER A CB    1 
ATOM   428   O OG    . SER A  1 56  ? 32.198  -9.579  -87.435 1.00 48.60  ? 56  SER A OG    1 
ATOM   429   N N     . TYR A  1 57  ? 31.234  -7.926  -84.114 1.00 39.45  ? 57  TYR A N     1 
ATOM   430   C CA    . TYR A  1 57  ? 32.051  -7.230  -83.122 1.00 39.45  ? 57  TYR A CA    1 
ATOM   431   C C     . TYR A  1 57  ? 31.428  -7.430  -81.754 1.00 42.17  ? 57  TYR A C     1 
ATOM   432   O O     . TYR A  1 57  ? 30.238  -7.152  -81.562 1.00 39.01  ? 57  TYR A O     1 
ATOM   433   C CB    . TYR A  1 57  ? 32.170  -5.758  -83.432 1.00 41.50  ? 57  TYR A CB    1 
ATOM   434   C CG    . TYR A  1 57  ? 32.827  -5.490  -84.760 1.00 44.28  ? 57  TYR A CG    1 
ATOM   435   C CD1   . TYR A  1 57  ? 34.210  -5.503  -84.893 1.00 46.19  ? 57  TYR A CD1   1 
ATOM   436   C CD2   . TYR A  1 57  ? 32.068  -5.301  -85.904 1.00 45.81  ? 57  TYR A CD2   1 
ATOM   437   C CE1   . TYR A  1 57  ? 34.821  -5.204  -86.113 1.00 42.45  ? 57  TYR A CE1   1 
ATOM   438   C CE2   . TYR A  1 57  ? 32.662  -5.016  -87.127 1.00 47.98  ? 57  TYR A CE2   1 
ATOM   439   C CZ    . TYR A  1 57  ? 34.045  -4.993  -87.233 1.00 51.66  ? 57  TYR A CZ    1 
ATOM   440   O OH    . TYR A  1 57  ? 34.637  -4.809  -88.450 1.00 55.36  ? 57  TYR A OH    1 
ATOM   441   N N     . LEU A  1 58  ? 32.256  -7.853  -80.795 1.00 39.38  ? 58  LEU A N     1 
ATOM   442   C CA    . LEU A  1 58  ? 31.831  -8.124  -79.444 1.00 38.35  ? 58  LEU A CA    1 
ATOM   443   C C     . LEU A  1 58  ? 31.685  -6.839  -78.685 1.00 42.48  ? 58  LEU A C     1 
ATOM   444   O O     . LEU A  1 58  ? 32.613  -6.051  -78.644 1.00 41.65  ? 58  LEU A O     1 
ATOM   445   C CB    . LEU A  1 58  ? 32.842  -9.045  -78.761 1.00 38.29  ? 58  LEU A CB    1 
ATOM   446   C CG    . LEU A  1 58  ? 32.549  -9.509  -77.317 1.00 42.21  ? 58  LEU A CG    1 
ATOM   447   C CD1   . LEU A  1 58  ? 31.357  -10.419 -77.242 1.00 41.43  ? 58  LEU A CD1   1 
ATOM   448   C CD2   . LEU A  1 58  ? 33.756  -10.283 -76.784 1.00 42.55  ? 58  LEU A CD2   1 
ATOM   449   N N     . GLU A  1 59  ? 30.535  -6.654  -78.033 1.00 40.33  ? 59  GLU A N     1 
ATOM   450   C CA    . GLU A  1 59  ? 30.273  -5.457  -77.255 1.00 40.51  ? 59  GLU A CA    1 
ATOM   451   C C     . GLU A  1 59  ? 31.123  -5.474  -75.988 1.00 42.90  ? 59  GLU A C     1 
ATOM   452   O O     . GLU A  1 59  ? 31.291  -6.532  -75.408 1.00 41.82  ? 59  GLU A O     1 
ATOM   453   C CB    . GLU A  1 59  ? 28.747  -5.376  -76.928 1.00 40.18  ? 59  GLU A CB    1 
ATOM   454   C CG    . GLU A  1 59  ? 28.325  -4.255  -75.997 1.00 42.00  ? 59  GLU A CG    1 
ATOM   455   C CD    . GLU A  1 59  ? 28.547  -2.823  -76.445 1.00 47.60  ? 59  GLU A CD    1 
ATOM   456   O OE1   . GLU A  1 59  ? 28.382  -1.918  -75.594 1.00 39.58  ? 59  GLU A OE1   1 
ATOM   457   O OE2   . GLU A  1 59  ? 28.885  -2.599  -77.630 1.00 36.53  ? 59  GLU A OE2   1 
ATOM   458   N N     . SER A  1 60  ? 31.724  -4.327  -75.609 1.00 41.44  ? 60  SER A N     1 
ATOM   459   C CA    . SER A  1 60  ? 32.484  -4.230  -74.352 1.00 42.17  ? 60  SER A CA    1 
ATOM   460   C C     . SER A  1 60  ? 31.659  -4.706  -73.165 1.00 45.62  ? 60  SER A C     1 
ATOM   461   O O     . SER A  1 60  ? 30.476  -4.406  -73.056 1.00 44.65  ? 60  SER A O     1 
ATOM   462   C CB    . SER A  1 60  ? 32.958  -2.808  -74.091 1.00 47.87  ? 60  SER A CB    1 
ATOM   463   O OG    . SER A  1 60  ? 34.108  -2.598  -74.894 1.00 69.99  ? 60  SER A OG    1 
ATOM   464   N N     . GLY A  1 61  ? 32.293  -5.510  -72.338 1.00 42.84  ? 61  GLY A N     1 
ATOM   465   C CA    . GLY A  1 61  ? 31.702  -6.085  -71.148 1.00 41.76  ? 61  GLY A CA    1 
ATOM   466   C C     . GLY A  1 61  ? 31.063  -7.429  -71.357 1.00 45.52  ? 61  GLY A C     1 
ATOM   467   O O     . GLY A  1 61  ? 30.761  -8.110  -70.375 1.00 46.90  ? 61  GLY A O     1 
ATOM   468   N N     . VAL A  1 62  ? 30.795  -7.816  -72.619 1.00 41.54  ? 62  VAL A N     1 
ATOM   469   C CA    . VAL A  1 62  ? 30.185  -9.115  -72.899 1.00 40.14  ? 62  VAL A CA    1 
ATOM   470   C C     . VAL A  1 62  ? 31.276  -10.225 -72.876 1.00 43.20  ? 62  VAL A C     1 
ATOM   471   O O     . VAL A  1 62  ? 32.346  -10.026 -73.441 1.00 41.61  ? 62  VAL A O     1 
ATOM   472   C CB    . VAL A  1 62  ? 29.382  -9.079  -74.214 1.00 41.82  ? 62  VAL A CB    1 
ATOM   473   C CG1   . VAL A  1 62  ? 28.755  -10.444 -74.506 1.00 40.34  ? 62  VAL A CG1   1 
ATOM   474   C CG2   . VAL A  1 62  ? 28.303  -8.016  -74.121 1.00 40.64  ? 62  VAL A CG2   1 
ATOM   475   N N     . PRO A  1 63  ? 31.035  -11.394 -72.245 1.00 41.07  ? 63  PRO A N     1 
ATOM   476   C CA    . PRO A  1 63  ? 32.068  -12.455 -72.238 1.00 41.62  ? 63  PRO A CA    1 
ATOM   477   C C     . PRO A  1 63  ? 32.431  -12.953 -73.640 1.00 48.35  ? 63  PRO A C     1 
ATOM   478   O O     . PRO A  1 63  ? 31.608  -12.960 -74.561 1.00 48.00  ? 63  PRO A O     1 
ATOM   479   C CB    . PRO A  1 63  ? 31.442  -13.574 -71.395 1.00 42.76  ? 63  PRO A CB    1 
ATOM   480   C CG    . PRO A  1 63  ? 30.293  -12.968 -70.714 1.00 46.55  ? 63  PRO A CG    1 
ATOM   481   C CD    . PRO A  1 63  ? 29.829  -11.815 -71.513 1.00 41.39  ? 63  PRO A CD    1 
ATOM   482   N N     . ALA A  1 64  ? 33.680  -13.367 -73.786 1.00 47.34  ? 64  ALA A N     1 
ATOM   483   C CA    . ALA A  1 64  ? 34.269  -13.851 -75.035 1.00 47.11  ? 64  ALA A CA    1 
ATOM   484   C C     . ALA A  1 64  ? 33.622  -15.146 -75.570 1.00 45.88  ? 64  ALA A C     1 
ATOM   485   O O     . ALA A  1 64  ? 33.789  -15.488 -76.726 1.00 44.81  ? 64  ALA A O     1 
ATOM   486   C CB    . ALA A  1 64  ? 35.747  -14.095 -74.808 1.00 49.79  ? 64  ALA A CB    1 
ATOM   487   N N     . ARG A  1 65  ? 32.909  -15.877 -74.725 1.00 43.00  ? 65  ARG A N     1 
ATOM   488   C CA    . ARG A  1 65  ? 32.237  -17.085 -75.151 1.00 41.37  ? 65  ARG A CA    1 
ATOM   489   C C     . ARG A  1 65  ? 31.125  -16.793 -76.189 1.00 43.22  ? 65  ARG A C     1 
ATOM   490   O O     . ARG A  1 65  ? 30.740  -17.724 -76.893 1.00 41.64  ? 65  ARG A O     1 
ATOM   491   C CB    . ARG A  1 65  ? 31.743  -17.888 -73.934 1.00 42.34  ? 65  ARG A CB    1 
ATOM   492   C CG    . ARG A  1 65  ? 30.584  -17.283 -73.195 1.00 47.30  ? 65  ARG A CG    1 
ATOM   493   C CD    . ARG A  1 65  ? 30.110  -18.267 -72.186 1.00 47.38  ? 65  ARG A CD    1 
ATOM   494   N NE    . ARG A  1 65  ? 29.040  -17.726 -71.368 1.00 39.63  ? 65  ARG A NE    1 
ATOM   495   C CZ    . ARG A  1 65  ? 29.199  -16.892 -70.348 1.00 44.85  ? 65  ARG A CZ    1 
ATOM   496   N NH1   . ARG A  1 65  ? 28.147  -16.445 -69.680 1.00 43.38  ? 65  ARG A NH1   1 
ATOM   497   N NH2   . ARG A  1 65  ? 30.408  -16.472 -70.004 1.00 57.43  ? 65  ARG A NH2   1 
ATOM   498   N N     . PHE A  1 66  ? 30.640  -15.506 -76.306 1.00 38.54  ? 66  PHE A N     1 
ATOM   499   C CA    . PHE A  1 66  ? 29.672  -15.102 -77.312 1.00 37.17  ? 66  PHE A CA    1 
ATOM   500   C C     . PHE A  1 66  ? 30.419  -14.655 -78.550 1.00 40.37  ? 66  PHE A C     1 
ATOM   501   O O     . PHE A  1 66  ? 31.354  -13.889 -78.434 1.00 41.47  ? 66  PHE A O     1 
ATOM   502   C CB    . PHE A  1 66  ? 28.751  -13.956 -76.800 1.00 37.35  ? 66  PHE A CB    1 
ATOM   503   C CG    . PHE A  1 66  ? 27.863  -14.363 -75.645 1.00 36.73  ? 66  PHE A CG    1 
ATOM   504   C CD1   . PHE A  1 66  ? 26.638  -14.962 -75.873 1.00 37.26  ? 66  PHE A CD1   1 
ATOM   505   C CD2   . PHE A  1 66  ? 28.294  -14.223 -74.329 1.00 38.93  ? 66  PHE A CD2   1 
ATOM   506   C CE1   . PHE A  1 66  ? 25.849  -15.398 -74.819 1.00 37.99  ? 66  PHE A CE1   1 
ATOM   507   C CE2   . PHE A  1 66  ? 27.498  -14.658 -73.268 1.00 40.74  ? 66  PHE A CE2   1 
ATOM   508   C CZ    . PHE A  1 66  ? 26.292  -15.264 -73.522 1.00 38.35  ? 66  PHE A CZ    1 
ATOM   509   N N     . SER A  1 67  ? 30.005  -15.100 -79.739 1.00 38.63  ? 67  SER A N     1 
ATOM   510   C CA    . SER A  1 67  ? 30.611  -14.637 -81.000 1.00 39.16  ? 67  SER A CA    1 
ATOM   511   C C     . SER A  1 67  ? 29.593  -14.657 -82.121 1.00 40.83  ? 67  SER A C     1 
ATOM   512   O O     . SER A  1 67  ? 28.738  -15.515 -82.157 1.00 40.83  ? 67  SER A O     1 
ATOM   513   C CB    . SER A  1 67  ? 31.846  -15.453 -81.390 1.00 43.58  ? 67  SER A CB    1 
ATOM   514   O OG    . SER A  1 67  ? 31.515  -16.743 -81.866 1.00 56.92  ? 67  SER A OG    1 
ATOM   515   N N     . GLY A  1 68  ? 29.733  -13.740 -83.053 1.00 36.62  ? 68  GLY A N     1 
ATOM   516   C CA    . GLY A  1 68  ? 28.857  -13.645 -84.192 1.00 36.02  ? 68  GLY A CA    1 
ATOM   517   C C     . GLY A  1 68  ? 29.622  -13.787 -85.481 1.00 41.32  ? 68  GLY A C     1 
ATOM   518   O O     . GLY A  1 68  ? 30.789  -13.398 -85.575 1.00 40.89  ? 68  GLY A O     1 
ATOM   519   N N     . SER A  1 69  ? 28.946  -14.298 -86.504 1.00 38.85  ? 69  SER A N     1 
ATOM   520   C CA    . SER A  1 69  ? 29.545  -14.434 -87.824 1.00 38.57  ? 69  SER A CA    1 
ATOM   521   C C     . SER A  1 69  ? 28.502  -14.359 -88.918 1.00 43.94  ? 69  SER A C     1 
ATOM   522   O O     . SER A  1 69  ? 27.310  -14.492 -88.680 1.00 43.58  ? 69  SER A O     1 
ATOM   523   C CB    . SER A  1 69  ? 30.314  -15.743 -87.926 1.00 41.72  ? 69  SER A CB    1 
ATOM   524   O OG    . SER A  1 69  ? 29.447  -16.860 -87.843 1.00 56.99  ? 69  SER A OG    1 
ATOM   525   N N     . GLY A  1 70  ? 28.978  -14.170 -90.120 1.00 43.47  ? 70  GLY A N     1 
ATOM   526   C CA    . GLY A  1 70  ? 28.138  -14.118 -91.295 1.00 43.44  ? 70  GLY A CA    1 
ATOM   527   C C     . GLY A  1 70  ? 28.191  -12.800 -92.008 1.00 46.63  ? 70  GLY A C     1 
ATOM   528   O O     . GLY A  1 70  ? 28.758  -11.808 -91.523 1.00 43.47  ? 70  GLY A O     1 
ATOM   529   N N     . SER A  1 71  ? 27.514  -12.803 -93.150 1.00 46.59  ? 71  SER A N     1 
ATOM   530   C CA    . SER A  1 71  ? 27.405  -11.652 -94.047 1.00 48.41  ? 71  SER A CA    1 
ATOM   531   C C     . SER A  1 71  ? 26.249  -11.886 -95.022 1.00 52.11  ? 71  SER A C     1 
ATOM   532   O O     . SER A  1 71  ? 25.839  -13.026 -95.268 1.00 52.15  ? 71  SER A O     1 
ATOM   533   C CB    . SER A  1 71  ? 28.693  -11.483 -94.847 1.00 55.10  ? 71  SER A CB    1 
ATOM   534   O OG    . SER A  1 71  ? 28.885  -12.650 -95.633 1.00 66.71  ? 71  SER A OG    1 
ATOM   535   N N     . GLY A  1 72  ? 25.755  -10.800 -95.569 1.00 48.12  ? 72  GLY A N     1 
ATOM   536   C CA    . GLY A  1 72  ? 24.706  -10.845 -96.569 1.00 48.00  ? 72  GLY A CA    1 
ATOM   537   C C     . GLY A  1 72  ? 23.367  -11.135 -95.986 1.00 47.67  ? 72  GLY A C     1 
ATOM   538   O O     . GLY A  1 72  ? 22.739  -10.227 -95.443 1.00 47.48  ? 72  GLY A O     1 
ATOM   539   N N     . THR A  1 73  ? 22.946  -12.401 -96.064 1.00 42.44  ? 73  THR A N     1 
ATOM   540   C CA    . THR A  1 73  ? 21.670  -12.852 -95.536 1.00 41.49  ? 73  THR A CA    1 
ATOM   541   C C     . THR A  1 73  ? 21.745  -13.881 -94.425 1.00 43.11  ? 73  THR A C     1 
ATOM   542   O O     . THR A  1 73  ? 20.730  -14.076 -93.793 1.00 42.32  ? 73  THR A O     1 
ATOM   543   C CB    . THR A  1 73  ? 20.793  -13.405 -96.675 1.00 51.64  ? 73  THR A CB    1 
ATOM   544   O OG1   . THR A  1 73  ? 21.415  -14.565 -97.250 1.00 50.28  ? 73  THR A OG1   1 
ATOM   545   C CG2   . THR A  1 73  ? 20.497  -12.362 -97.742 1.00 51.31  ? 73  THR A CG2   1 
ATOM   546   N N     . ASP A  1 74  ? 22.875  -14.543 -94.175 1.00 39.87  ? 74  ASP A N     1 
ATOM   547   C CA    . ASP A  1 74  ? 22.955  -15.657 -93.190 1.00 38.99  ? 74  ASP A CA    1 
ATOM   548   C C     . ASP A  1 74  ? 23.861  -15.326 -92.051 1.00 38.55  ? 74  ASP A C     1 
ATOM   549   O O     . ASP A  1 74  ? 25.018  -15.099 -92.260 1.00 40.69  ? 74  ASP A O     1 
ATOM   550   C CB    . ASP A  1 74  ? 23.452  -16.955 -93.894 1.00 41.88  ? 74  ASP A CB    1 
ATOM   551   C CG    . ASP A  1 74  ? 22.717  -17.200 -95.201 1.00 60.30  ? 74  ASP A CG    1 
ATOM   552   O OD1   . ASP A  1 74  ? 21.467  -17.227 -95.180 1.00 61.76  ? 74  ASP A OD1   1 
ATOM   553   O OD2   . ASP A  1 74  ? 23.395  -17.281 -96.268 1.00 66.96  ? 74  ASP A OD2   1 
ATOM   554   N N     . PHE A  1 75  ? 23.347  -15.313 -90.848 1.00 36.24  ? 75  PHE A N     1 
ATOM   555   C CA    . PHE A  1 75  ? 24.094  -14.920 -89.649 1.00 34.29  ? 75  PHE A CA    1 
ATOM   556   C C     . PHE A  1 75  ? 23.953  -15.940 -88.515 1.00 37.56  ? 75  PHE A C     1 
ATOM   557   O O     . PHE A  1 75  ? 22.931  -16.619 -88.368 1.00 35.78  ? 75  PHE A O     1 
ATOM   558   C CB    . PHE A  1 75  ? 23.668  -13.517 -89.199 1.00 34.24  ? 75  PHE A CB    1 
ATOM   559   C CG    . PHE A  1 75  ? 23.853  -12.478 -90.279 1.00 35.04  ? 75  PHE A CG    1 
ATOM   560   C CD1   . PHE A  1 75  ? 22.834  -12.208 -91.190 1.00 36.88  ? 75  PHE A CD1   1 
ATOM   561   C CD2   . PHE A  1 75  ? 25.033  -11.764 -90.379 1.00 32.75  ? 75  PHE A CD2   1 
ATOM   562   C CE1   . PHE A  1 75  ? 23.047  -11.331 -92.248 1.00 37.81  ? 75  PHE A CE1   1 
ATOM   563   C CE2   . PHE A  1 75  ? 25.227  -10.856 -91.401 1.00 36.33  ? 75  PHE A CE2   1 
ATOM   564   C CZ    . PHE A  1 75  ? 24.224  -10.628 -92.328 1.00 36.14  ? 75  PHE A CZ    1 
ATOM   565   N N     . THR A  1 76  ? 25.011  -16.039 -87.717 1.00 35.55  ? 76  THR A N     1 
ATOM   566   C CA    . THR A  1 76  ? 25.090  -17.000 -86.624 1.00 36.07  ? 76  THR A CA    1 
ATOM   567   C C     . THR A  1 76  ? 25.626  -16.370 -85.341 1.00 39.83  ? 76  THR A C     1 
ATOM   568   O O     . THR A  1 76  ? 26.591  -15.631 -85.390 1.00 40.75  ? 76  THR A O     1 
ATOM   569   C CB    . THR A  1 76  ? 26.023  -18.148 -87.054 1.00 43.13  ? 76  THR A CB    1 
ATOM   570   O OG1   . THR A  1 76  ? 25.547  -18.679 -88.277 1.00 50.05  ? 76  THR A OG1   1 
ATOM   571   C CG2   . THR A  1 76  ? 26.110  -19.264 -86.039 1.00 40.54  ? 76  THR A CG2   1 
ATOM   572   N N     . LEU A  1 77  ? 24.971  -16.640 -84.219 1.00 35.60  ? 77  LEU A N     1 
ATOM   573   C CA    . LEU A  1 77  ? 25.430  -16.309 -82.886 1.00 34.70  ? 77  LEU A CA    1 
ATOM   574   C C     . LEU A  1 77  ? 25.866  -17.656 -82.299 1.00 39.29  ? 77  LEU A C     1 
ATOM   575   O O     . LEU A  1 77  ? 25.116  -18.625 -82.330 1.00 36.81  ? 77  LEU A O     1 
ATOM   576   C CB    . LEU A  1 77  ? 24.322  -15.737 -82.000 1.00 33.74  ? 77  LEU A CB    1 
ATOM   577   C CG    . LEU A  1 77  ? 24.671  -15.502 -80.519 1.00 36.31  ? 77  LEU A CG    1 
ATOM   578   C CD1   . LEU A  1 77  ? 25.758  -14.497 -80.375 1.00 36.87  ? 77  LEU A CD1   1 
ATOM   579   C CD2   . LEU A  1 77  ? 23.452  -15.036 -79.768 1.00 38.22  ? 77  LEU A CD2   1 
ATOM   580   N N     . THR A  1 78  ? 27.058  -17.692 -81.731 1.00 38.93  ? 78  THR A N     1 
ATOM   581   C CA    . THR A  1 78  ? 27.596  -18.877 -81.090 1.00 39.02  ? 78  THR A CA    1 
ATOM   582   C C     . THR A  1 78  ? 27.884  -18.571 -79.636 1.00 42.72  ? 78  THR A C     1 
ATOM   583   O O     . THR A  1 78  ? 28.413  -17.504 -79.327 1.00 38.79  ? 78  THR A O     1 
ATOM   584   C CB    . THR A  1 78  ? 28.880  -19.376 -81.792 1.00 44.26  ? 78  THR A CB    1 
ATOM   585   O OG1   . THR A  1 78  ? 28.615  -19.558 -83.184 1.00 43.93  ? 78  THR A OG1   1 
ATOM   586   C CG2   . THR A  1 78  ? 29.366  -20.711 -81.227 1.00 41.88  ? 78  THR A CG2   1 
ATOM   587   N N     . ILE A  1 79  ? 27.454  -19.482 -78.742 1.00 41.55  ? 79  ILE A N     1 
ATOM   588   C CA    . ILE A  1 79  ? 27.811  -19.473 -77.323 1.00 41.46  ? 79  ILE A CA    1 
ATOM   589   C C     . ILE A  1 79  ? 28.680  -20.758 -77.187 1.00 45.23  ? 79  ILE A C     1 
ATOM   590   O O     . ILE A  1 79  ? 28.150  -21.853 -77.110 1.00 41.85  ? 79  ILE A O     1 
ATOM   591   C CB    . ILE A  1 79  ? 26.606  -19.461 -76.360 1.00 42.77  ? 79  ILE A CB    1 
ATOM   592   C CG1   . ILE A  1 79  ? 25.499  -18.484 -76.831 1.00 42.67  ? 79  ILE A CG1   1 
ATOM   593   C CG2   . ILE A  1 79  ? 27.084  -19.118 -74.943 1.00 42.49  ? 79  ILE A CG2   1 
ATOM   594   C CD1   . ILE A  1 79  ? 24.212  -18.640 -76.030 1.00 46.88  ? 79  ILE A CD1   1 
ATOM   595   N N     . SER A  1 80  ? 29.997  -20.618 -77.254 1.00 47.59  ? 80  SER A N     1 
ATOM   596   C CA    . SER A  1 80  ? 30.958  -21.756 -77.296 1.00 49.56  ? 80  SER A CA    1 
ATOM   597   C C     . SER A  1 80  ? 30.927  -22.735 -76.100 1.00 58.27  ? 80  SER A C     1 
ATOM   598   O O     . SER A  1 80  ? 31.144  -23.950 -76.292 1.00 60.19  ? 80  SER A O     1 
ATOM   599   C CB    . SER A  1 80  ? 32.368  -21.233 -77.477 1.00 49.65  ? 80  SER A CB    1 
ATOM   600   O OG    . SER A  1 80  ? 32.761  -20.454 -76.359 1.00 58.14  ? 80  SER A OG    1 
ATOM   601   N N     . SER A  1 81  ? 30.677  -22.216 -74.885 1.00 53.32  ? 81  SER A N     1 
ATOM   602   C CA    . SER A  1 81  ? 30.652  -23.050 -73.692 1.00 52.28  ? 81  SER A CA    1 
ATOM   603   C C     . SER A  1 81  ? 29.562  -22.517 -72.750 1.00 53.22  ? 81  SER A C     1 
ATOM   604   O O     . SER A  1 81  ? 29.835  -21.696 -71.875 1.00 51.76  ? 81  SER A O     1 
ATOM   605   C CB    . SER A  1 81  ? 32.020  -23.047 -73.022 1.00 57.66  ? 81  SER A CB    1 
ATOM   606   O OG    . SER A  1 81  ? 32.006  -23.928 -71.911 1.00 78.63  ? 81  SER A OG    1 
ATOM   607   N N     . LEU A  1 82  ? 28.313  -22.974 -72.988 1.00 47.74  ? 82  LEU A N     1 
ATOM   608   C CA    . LEU A  1 82  ? 27.124  -22.548 -72.275 1.00 45.95  ? 82  LEU A CA    1 
ATOM   609   C C     . LEU A  1 82  ? 27.265  -22.575 -70.791 1.00 47.52  ? 82  LEU A C     1 
ATOM   610   O O     . LEU A  1 82  ? 27.741  -23.560 -70.241 1.00 48.76  ? 82  LEU A O     1 
ATOM   611   C CB    . LEU A  1 82  ? 25.924  -23.445 -72.598 1.00 45.64  ? 82  LEU A CB    1 
ATOM   612   C CG    . LEU A  1 82  ? 24.850  -23.020 -73.586 1.00 49.83  ? 82  LEU A CG    1 
ATOM   613   C CD1   . LEU A  1 82  ? 23.636  -23.879 -73.374 1.00 50.75  ? 82  LEU A CD1   1 
ATOM   614   C CD2   . LEU A  1 82  ? 24.405  -21.615 -73.405 1.00 46.49  ? 82  LEU A CD2   1 
ATOM   615   N N     . GLU A  1 83  ? 26.706  -21.569 -70.138 1.00 41.08  ? 83  GLU A N     1 
ATOM   616   C CA    . GLU A  1 83  ? 26.641  -21.504 -68.680 1.00 40.38  ? 83  GLU A CA    1 
ATOM   617   C C     . GLU A  1 83  ? 25.210  -21.462 -68.262 1.00 41.29  ? 83  GLU A C     1 
ATOM   618   O O     . GLU A  1 83  ? 24.361  -21.043 -69.066 1.00 39.24  ? 83  GLU A O     1 
ATOM   619   C CB    . GLU A  1 83  ? 27.354  -20.257 -68.182 1.00 42.45  ? 83  GLU A CB    1 
ATOM   620   C CG    . GLU A  1 83  ? 28.864  -20.414 -68.215 1.00 49.79  ? 83  GLU A CG    1 
ATOM   621   C CD    . GLU A  1 83  ? 29.655  -19.240 -67.681 1.00 71.34  ? 83  GLU A CD    1 
ATOM   622   O OE1   . GLU A  1 83  ? 30.895  -19.243 -67.854 1.00 85.75  ? 83  GLU A OE1   1 
ATOM   623   O OE2   . GLU A  1 83  ? 29.044  -18.316 -67.099 1.00 60.97  ? 83  GLU A OE2   1 
ATOM   624   N N     . PRO A  1 84  ? 24.887  -21.831 -67.005 1.00 38.35  ? 84  PRO A N     1 
ATOM   625   C CA    . PRO A  1 84  ? 23.481  -21.731 -66.548 1.00 36.83  ? 84  PRO A CA    1 
ATOM   626   C C     . PRO A  1 84  ? 22.833  -20.348 -66.666 1.00 38.23  ? 84  PRO A C     1 
ATOM   627   O O     . PRO A  1 84  ? 21.646  -20.227 -66.975 1.00 37.38  ? 84  PRO A O     1 
ATOM   628   C CB    . PRO A  1 84  ? 23.559  -22.170 -65.081 1.00 39.21  ? 84  PRO A CB    1 
ATOM   629   C CG    . PRO A  1 84  ? 24.744  -23.023 -65.011 1.00 44.19  ? 84  PRO A CG    1 
ATOM   630   C CD    . PRO A  1 84  ? 25.743  -22.404 -65.947 1.00 40.29  ? 84  PRO A CD    1 
ATOM   631   N N     . GLU A  1 85  ? 23.623  -19.303 -66.487 1.00 36.36  ? 85  GLU A N     1 
ATOM   632   C CA    . GLU A  1 85  ? 23.138  -17.920 -66.577 1.00 36.47  ? 85  GLU A CA    1 
ATOM   633   C C     . GLU A  1 85  ? 22.810  -17.479 -68.047 1.00 37.93  ? 85  GLU A C     1 
ATOM   634   O O     . GLU A  1 85  ? 22.280  -16.385 -68.227 1.00 35.78  ? 85  GLU A O     1 
ATOM   635   C CB    . GLU A  1 85  ? 24.135  -16.922 -65.892 1.00 38.22  ? 85  GLU A CB    1 
ATOM   636   C CG    . GLU A  1 85  ? 25.399  -16.617 -66.689 1.00 57.35  ? 85  GLU A CG    1 
ATOM   637   C CD    . GLU A  1 85  ? 26.407  -15.692 -66.027 1.00 100.60 ? 85  GLU A CD    1 
ATOM   638   O OE1   . GLU A  1 85  ? 25.985  -14.659 -65.455 1.00 115.60 ? 85  GLU A OE1   1 
ATOM   639   O OE2   . GLU A  1 85  ? 27.624  -15.969 -66.137 1.00 94.37  ? 85  GLU A OE2   1 
ATOM   640   N N     . ASP A  1 86  ? 23.142  -18.309 -69.067 1.00 33.87  ? 86  ASP A N     1 
ATOM   641   C CA    . ASP A  1 86  ? 22.864  -18.052 -70.476 1.00 33.51  ? 86  ASP A CA    1 
ATOM   642   C C     . ASP A  1 86  ? 21.416  -18.365 -70.857 1.00 37.49  ? 86  ASP A C     1 
ATOM   643   O O     . ASP A  1 86  ? 21.009  -18.092 -71.990 1.00 36.40  ? 86  ASP A O     1 
ATOM   644   C CB    . ASP A  1 86  ? 23.876  -18.786 -71.381 1.00 35.77  ? 86  ASP A CB    1 
ATOM   645   C CG    . ASP A  1 86  ? 25.296  -18.317 -71.117 1.00 42.09  ? 86  ASP A CG    1 
ATOM   646   O OD1   . ASP A  1 86  ? 25.455  -17.251 -70.515 1.00 41.41  ? 86  ASP A OD1   1 
ATOM   647   O OD2   . ASP A  1 86  ? 26.248  -19.068 -71.442 1.00 46.80  ? 86  ASP A OD2   1 
ATOM   648   N N     . PHE A  1 87  ? 20.607  -18.824 -69.889 1.00 34.09  ? 87  PHE A N     1 
ATOM   649   C CA    . PHE A  1 87  ? 19.174  -18.970 -70.069 1.00 32.12  ? 87  PHE A CA    1 
ATOM   650   C C     . PHE A  1 87  ? 18.611  -17.554 -70.439 1.00 32.96  ? 87  PHE A C     1 
ATOM   651   O O     . PHE A  1 87  ? 18.787  -16.605 -69.682 1.00 32.57  ? 87  PHE A O     1 
ATOM   652   C CB    . PHE A  1 87  ? 18.549  -19.523 -68.760 1.00 34.21  ? 87  PHE A CB    1 
ATOM   653   C CG    . PHE A  1 87  ? 17.070  -19.409 -68.775 1.00 37.32  ? 87  PHE A CG    1 
ATOM   654   C CD1   . PHE A  1 87  ? 16.307  -20.248 -69.571 1.00 43.27  ? 87  PHE A CD1   1 
ATOM   655   C CD2   . PHE A  1 87  ? 16.436  -18.354 -68.135 1.00 39.72  ? 87  PHE A CD2   1 
ATOM   656   C CE1   . PHE A  1 87  ? 14.950  -20.026 -69.742 1.00 43.72  ? 87  PHE A CE1   1 
ATOM   657   C CE2   . PHE A  1 87  ? 15.066  -18.165 -68.266 1.00 42.77  ? 87  PHE A CE2   1 
ATOM   658   C CZ    . PHE A  1 87  ? 14.336  -18.986 -69.082 1.00 41.00  ? 87  PHE A CZ    1 
ATOM   659   N N     . ALA A  1 88  ? 17.956  -17.427 -71.597 1.00 29.41  ? 88  ALA A N     1 
ATOM   660   C CA    . ALA A  1 88  ? 17.438  -16.151 -72.110 1.00 29.83  ? 88  ALA A CA    1 
ATOM   661   C C     . ALA A  1 88  ? 16.803  -16.374 -73.456 1.00 32.44  ? 88  ALA A C     1 
ATOM   662   O O     . ALA A  1 88  ? 16.996  -17.420 -74.055 1.00 31.88  ? 88  ALA A O     1 
ATOM   663   C CB    . ALA A  1 88  ? 18.593  -15.154 -72.308 1.00 32.04  ? 88  ALA A CB    1 
ATOM   664   N N     . VAL A  1 89  ? 16.197  -15.327 -73.987 1.00 28.86  ? 89  VAL A N     1 
ATOM   665   C CA    . VAL A  1 89  ? 15.724  -15.256 -75.374 1.00 29.11  ? 89  VAL A CA    1 
ATOM   666   C C     . VAL A  1 89  ? 16.782  -14.392 -76.121 1.00 33.16  ? 89  VAL A C     1 
ATOM   667   O O     . VAL A  1 89  ? 17.206  -13.342 -75.629 1.00 33.99  ? 89  VAL A O     1 
ATOM   668   C CB    . VAL A  1 89  ? 14.278  -14.701 -75.519 1.00 33.36  ? 89  VAL A CB    1 
ATOM   669   C CG1   . VAL A  1 89  ? 13.843  -14.703 -76.970 1.00 32.85  ? 89  VAL A CG1   1 
ATOM   670   C CG2   . VAL A  1 89  ? 13.313  -15.547 -74.711 1.00 33.55  ? 89  VAL A CG2   1 
ATOM   671   N N     . TYR A  1 90  ? 17.227  -14.854 -77.285 1.00 30.62  ? 90  TYR A N     1 
ATOM   672   C CA    . TYR A  1 90  ? 18.235  -14.166 -78.081 1.00 29.70  ? 90  TYR A CA    1 
ATOM   673   C C     . TYR A  1 90  ? 17.604  -13.649 -79.336 1.00 32.96  ? 90  TYR A C     1 
ATOM   674   O O     . TYR A  1 90  ? 16.939  -14.403 -80.002 1.00 33.04  ? 90  TYR A O     1 
ATOM   675   C CB    . TYR A  1 90  ? 19.400  -15.115 -78.396 1.00 30.53  ? 90  TYR A CB    1 
ATOM   676   C CG    . TYR A  1 90  ? 20.184  -15.494 -77.165 1.00 30.00  ? 90  TYR A CG    1 
ATOM   677   C CD1   . TYR A  1 90  ? 19.726  -16.474 -76.303 1.00 29.02  ? 90  TYR A CD1   1 
ATOM   678   C CD2   . TYR A  1 90  ? 21.353  -14.815 -76.820 1.00 33.06  ? 90  TYR A CD2   1 
ATOM   679   C CE1   . TYR A  1 90  ? 20.426  -16.800 -75.150 1.00 31.56  ? 90  TYR A CE1   1 
ATOM   680   C CE2   . TYR A  1 90  ? 22.048  -15.119 -75.650 1.00 32.84  ? 90  TYR A CE2   1 
ATOM   681   C CZ    . TYR A  1 90  ? 21.599  -16.137 -74.838 1.00 34.12  ? 90  TYR A CZ    1 
ATOM   682   O OH    . TYR A  1 90  ? 22.278  -16.411 -73.678 1.00 35.51  ? 90  TYR A OH    1 
ATOM   683   N N     . TYR A  1 91  ? 17.770  -12.362 -79.648 1.00 31.91  ? 91  TYR A N     1 
ATOM   684   C CA    . TYR A  1 91  ? 17.170  -11.743 -80.844 1.00 30.11  ? 91  TYR A CA    1 
ATOM   685   C C     . TYR A  1 91  ? 18.229  -11.167 -81.722 1.00 34.04  ? 91  TYR A C     1 
ATOM   686   O O     . TYR A  1 91  ? 19.178  -10.581 -81.218 1.00 34.38  ? 91  TYR A O     1 
ATOM   687   C CB    . TYR A  1 91  ? 16.239  -10.572 -80.469 1.00 29.35  ? 91  TYR A CB    1 
ATOM   688   C CG    . TYR A  1 91  ? 15.066  -10.918 -79.594 1.00 31.30  ? 91  TYR A CG    1 
ATOM   689   C CD1   . TYR A  1 91  ? 13.855  -11.331 -80.148 1.00 34.57  ? 91  TYR A CD1   1 
ATOM   690   C CD2   . TYR A  1 91  ? 15.133  -10.780 -78.215 1.00 31.69  ? 91  TYR A CD2   1 
ATOM   691   C CE1   . TYR A  1 91  ? 12.760  -11.652 -79.346 1.00 33.46  ? 91  TYR A CE1   1 
ATOM   692   C CE2   . TYR A  1 91  ? 14.015  -11.022 -77.407 1.00 31.96  ? 91  TYR A CE2   1 
ATOM   693   C CZ    . TYR A  1 91  ? 12.832  -11.470 -77.979 1.00 36.94  ? 91  TYR A CZ    1 
ATOM   694   O OH    . TYR A  1 91  ? 11.695  -11.706 -77.234 1.00 40.28  ? 91  TYR A OH    1 
ATOM   695   N N     . CYS A  1 92  ? 18.028  -11.254 -83.032 1.00 31.58  ? 92  CYS A N     1 
ATOM   696   C CA    . CYS A  1 92  ? 18.845  -10.557 -84.003 1.00 32.66  ? 92  CYS A CA    1 
ATOM   697   C C     . CYS A  1 92  ? 18.041  -9.335  -84.449 1.00 34.70  ? 92  CYS A C     1 
ATOM   698   O O     . CYS A  1 92  ? 16.827  -9.283  -84.253 1.00 31.75  ? 92  CYS A O     1 
ATOM   699   C CB    . CYS A  1 92  ? 19.210  -11.455 -85.175 1.00 34.36  ? 92  CYS A CB    1 
ATOM   700   S SG    . CYS A  1 92  ? 17.784  -12.071 -86.063 1.00 38.70  ? 92  CYS A SG    1 
ATOM   701   N N     . GLN A  1 93  ? 18.729  -8.340  -85.019 1.00 34.19  ? 93  GLN A N     1 
ATOM   702   C CA    . GLN A  1 93  ? 18.101  -7.085  -85.446 1.00 33.75  ? 93  GLN A CA    1 
ATOM   703   C C     . GLN A  1 93  ? 18.936  -6.432  -86.554 1.00 36.82  ? 93  GLN A C     1 
ATOM   704   O O     . GLN A  1 93  ? 20.159  -6.356  -86.436 1.00 36.76  ? 93  GLN A O     1 
ATOM   705   C CB    . GLN A  1 93  ? 18.027  -6.130  -84.250 1.00 33.93  ? 93  GLN A CB    1 
ATOM   706   C CG    . GLN A  1 93  ? 17.503  -4.714  -84.540 1.00 34.61  ? 93  GLN A CG    1 
ATOM   707   C CD    . GLN A  1 93  ? 18.529  -3.623  -84.348 1.00 38.53  ? 93  GLN A CD    1 
ATOM   708   O OE1   . GLN A  1 93  ? 19.275  -3.615  -83.362 1.00 38.05  ? 93  GLN A OE1   1 
ATOM   709   N NE2   . GLN A  1 93  ? 18.589  -2.654  -85.272 1.00 34.37  ? 93  GLN A NE2   1 
ATOM   710   N N     . HIS A  1 94  ? 18.282  -5.887  -87.576 1.00 32.51  ? 94  HIS A N     1 
ATOM   711   C CA    . HIS A  1 94  ? 19.026  -5.241  -88.641 1.00 33.67  ? 94  HIS A CA    1 
ATOM   712   C C     . HIS A  1 94  ? 18.801  -3.776  -88.589 1.00 39.69  ? 94  HIS A C     1 
ATOM   713   O O     . HIS A  1 94  ? 17.803  -3.294  -88.025 1.00 37.21  ? 94  HIS A O     1 
ATOM   714   C CB    . HIS A  1 94  ? 18.660  -5.773  -90.036 1.00 34.00  ? 94  HIS A CB    1 
ATOM   715   C CG    . HIS A  1 94  ? 17.412  -5.151  -90.557 1.00 37.36  ? 94  HIS A CG    1 
ATOM   716   N ND1   . HIS A  1 94  ? 17.445  -3.962  -91.257 1.00 39.65  ? 94  HIS A ND1   1 
ATOM   717   C CD2   . HIS A  1 94  ? 16.126  -5.457  -90.289 1.00 38.03  ? 94  HIS A CD2   1 
ATOM   718   C CE1   . HIS A  1 94  ? 16.185  -3.607  -91.417 1.00 38.03  ? 94  HIS A CE1   1 
ATOM   719   N NE2   . HIS A  1 94  ? 15.363  -4.478  -90.857 1.00 37.79  ? 94  HIS A NE2   1 
ATOM   720   N N     . SER A  1 95  ? 19.712  -3.073  -89.270 1.00 37.52  ? 95  SER A N     1 
ATOM   721   C CA    . SER A  1 95  ? 19.608  -1.638  -89.518 1.00 37.33  ? 95  SER A CA    1 
ATOM   722   C C     . SER A  1 95  ? 20.115  -1.315  -90.921 1.00 43.64  ? 95  SER A C     1 
ATOM   723   O O     . SER A  1 95  ? 20.807  -0.331  -91.155 1.00 42.38  ? 95  SER A O     1 
ATOM   724   C CB    . SER A  1 95  ? 20.322  -0.842  -88.436 1.00 41.01  ? 95  SER A CB    1 
ATOM   725   O OG    . SER A  1 95  ? 21.544  -1.474  -88.110 1.00 52.24  ? 95  SER A OG    1 
ATOM   726   N N     . ARG A  1 96  ? 19.728  -2.150  -91.875 1.00 43.49  ? 96  ARG A N     1 
ATOM   727   C CA    . ARG A  1 96  ? 20.069  -1.917  -93.270 1.00 45.45  ? 96  ARG A CA    1 
ATOM   728   C C     . ARG A  1 96  ? 19.118  -0.880  -93.894 1.00 49.83  ? 96  ARG A C     1 
ATOM   729   O O     . ARG A  1 96  ? 19.502  -0.103  -94.754 1.00 51.37  ? 96  ARG A O     1 
ATOM   730   C CB    . ARG A  1 96  ? 19.961  -3.240  -94.049 1.00 42.91  ? 96  ARG A CB    1 
ATOM   731   C CG    . ARG A  1 96  ? 20.234  -3.108  -95.550 1.00 51.20  ? 96  ARG A CG    1 
ATOM   732   C CD    . ARG A  1 96  ? 21.671  -2.680  -95.886 1.00 49.51  ? 96  ARG A CD    1 
ATOM   733   N NE    . ARG A  1 96  ? 21.865  -2.602  -97.337 1.00 60.64  ? 96  ARG A NE    1 
ATOM   734   C CZ    . ARG A  1 96  ? 21.493  -1.583  -98.111 1.00 82.88  ? 96  ARG A CZ    1 
ATOM   735   N NH1   . ARG A  1 96  ? 20.895  -0.517  -97.584 1.00 73.70  ? 96  ARG A NH1   1 
ATOM   736   N NH2   . ARG A  1 96  ? 21.719  -1.620  -99.419 1.00 76.88  ? 96  ARG A NH2   1 
ATOM   737   N N     . ASP A  1 97  ? 17.896  -0.885  -93.408 1.00 45.74  ? 97  ASP A N     1 
ATOM   738   C CA    . ASP A  1 97  ? 16.686  -0.264  -93.923 1.00 44.31  ? 97  ASP A CA    1 
ATOM   739   C C     . ASP A  1 97  ? 15.813  0.223   -92.832 1.00 42.98  ? 97  ASP A C     1 
ATOM   740   O O     . ASP A  1 97  ? 15.868  -0.318  -91.739 1.00 40.52  ? 97  ASP A O     1 
ATOM   741   C CB    . ASP A  1 97  ? 15.805  -1.459  -94.471 1.00 46.68  ? 97  ASP A CB    1 
ATOM   742   C CG    . ASP A  1 97  ? 15.423  -1.355  -95.884 1.00 65.84  ? 97  ASP A CG    1 
ATOM   743   O OD1   . ASP A  1 97  ? 16.131  -0.654  -96.628 1.00 71.11  ? 97  ASP A OD1   1 
ATOM   744   O OD2   . ASP A  1 97  ? 14.427  -2.004  -96.268 1.00 73.09  ? 97  ASP A OD2   1 
ATOM   745   N N     . LEU A  1 98  ? 14.810  0.985   -93.232 1.00 39.32  ? 98  LEU A N     1 
ATOM   746   C CA    . LEU A  1 98  ? 13.677  1.355   -92.436 1.00 38.71  ? 98  LEU A CA    1 
ATOM   747   C C     . LEU A  1 98  ? 12.489  0.557   -92.989 1.00 41.88  ? 98  LEU A C     1 
ATOM   748   O O     . LEU A  1 98  ? 12.326  0.440   -94.201 1.00 40.87  ? 98  LEU A O     1 
ATOM   749   C CB    . LEU A  1 98  ? 13.402  2.863   -92.527 1.00 39.25  ? 98  LEU A CB    1 
ATOM   750   C CG    . LEU A  1 98  ? 14.411  3.780   -91.836 1.00 44.18  ? 98  LEU A CG    1 
ATOM   751   C CD1   . LEU A  1 98  ? 13.925  5.209   -91.888 1.00 45.99  ? 98  LEU A CD1   1 
ATOM   752   C CD2   . LEU A  1 98  ? 14.645  3.390   -90.407 1.00 41.57  ? 98  LEU A CD2   1 
ATOM   753   N N     . PRO A  1 99  ? 11.632  0.000   -92.137 1.00 39.71  ? 99  PRO A N     1 
ATOM   754   C CA    . PRO A  1 99  ? 11.722  -0.018  -90.676 1.00 39.41  ? 99  PRO A CA    1 
ATOM   755   C C     . PRO A  1 99  ? 12.782  -0.962  -90.125 1.00 43.13  ? 99  PRO A C     1 
ATOM   756   O O     . PRO A  1 99  ? 13.008  -2.058  -90.654 1.00 42.57  ? 99  PRO A O     1 
ATOM   757   C CB    . PRO A  1 99  ? 10.326  -0.498  -90.256 1.00 41.45  ? 99  PRO A CB    1 
ATOM   758   C CG    . PRO A  1 99  ? 9.862   -1.366  -91.388 1.00 45.40  ? 99  PRO A CG    1 
ATOM   759   C CD    . PRO A  1 99  ? 10.492  -0.797  -92.631 1.00 41.58  ? 99  PRO A CD    1 
ATOM   760   N N     . LEU A  1 100 ? 13.390  -0.552  -89.002 1.00 39.79  ? 100 LEU A N     1 
ATOM   761   C CA    . LEU A  1 100 ? 14.279  -1.410  -88.234 1.00 37.51  ? 100 LEU A CA    1 
ATOM   762   C C     . LEU A  1 100 ? 13.375  -2.541  -87.718 1.00 37.96  ? 100 LEU A C     1 
ATOM   763   O O     . LEU A  1 100 ? 12.223  -2.320  -87.319 1.00 37.49  ? 100 LEU A O     1 
ATOM   764   C CB    . LEU A  1 100 ? 14.905  -0.712  -87.037 1.00 36.77  ? 100 LEU A CB    1 
ATOM   765   C CG    . LEU A  1 100 ? 15.717  0.549   -87.248 1.00 42.39  ? 100 LEU A CG    1 
ATOM   766   C CD1   . LEU A  1 100 ? 16.300  0.985   -85.944 1.00 42.42  ? 100 LEU A CD1   1 
ATOM   767   C CD2   . LEU A  1 100 ? 16.858  0.316   -88.222 1.00 47.22  ? 100 LEU A CD2   1 
ATOM   768   N N     . THR A  1 101 ? 13.890  -3.727  -87.713 1.00 34.01  ? 101 THR A N     1 
ATOM   769   C CA    . THR A  1 101 ? 13.081  -4.895  -87.362 1.00 34.25  ? 101 THR A CA    1 
ATOM   770   C C     . THR A  1 101 ? 13.951  -5.948  -86.649 1.00 35.90  ? 101 THR A C     1 
ATOM   771   O O     . THR A  1 101 ? 15.184  -5.956  -86.769 1.00 31.57  ? 101 THR A O     1 
ATOM   772   C CB    . THR A  1 101 ? 12.370  -5.307  -88.690 1.00 41.25  ? 101 THR A CB    1 
ATOM   773   O OG1   . THR A  1 101 ? 10.983  -5.524  -88.473 1.00 56.44  ? 101 THR A OG1   1 
ATOM   774   C CG2   . THR A  1 101 ? 13.001  -6.416  -89.364 1.00 33.31  ? 101 THR A CG2   1 
ATOM   775   N N     . PHE A  1 102 ? 13.290  -6.749  -85.807 1.00 33.15  ? 102 PHE A N     1 
ATOM   776   C CA    . PHE A  1 102 ? 13.901  -7.754  -84.976 1.00 31.21  ? 102 PHE A CA    1 
ATOM   777   C C     . PHE A  1 102 ? 13.438  -9.125  -85.450 1.00 35.79  ? 102 PHE A C     1 
ATOM   778   O O     . PHE A  1 102 ? 12.355  -9.224  -85.999 1.00 33.09  ? 102 PHE A O     1 
ATOM   779   C CB    . PHE A  1 102 ? 13.462  -7.562  -83.515 1.00 32.18  ? 102 PHE A CB    1 
ATOM   780   C CG    . PHE A  1 102 ? 14.037  -6.364  -82.798 1.00 33.29  ? 102 PHE A CG    1 
ATOM   781   C CD1   . PHE A  1 102 ? 13.453  -5.109  -82.925 1.00 34.34  ? 102 PHE A CD1   1 
ATOM   782   C CD2   . PHE A  1 102 ? 15.174  -6.488  -82.014 1.00 34.56  ? 102 PHE A CD2   1 
ATOM   783   C CE1   . PHE A  1 102 ? 14.006  -4.002  -82.285 1.00 34.14  ? 102 PHE A CE1   1 
ATOM   784   C CE2   . PHE A  1 102 ? 15.750  -5.375  -81.423 1.00 36.55  ? 102 PHE A CE2   1 
ATOM   785   C CZ    . PHE A  1 102 ? 15.140  -4.153  -81.519 1.00 34.26  ? 102 PHE A CZ    1 
ATOM   786   N N     . GLY A  1 103 ? 14.253  -10.164 -85.209 1.00 32.36  ? 103 GLY A N     1 
ATOM   787   C CA    . GLY A  1 103 ? 13.854  -11.537 -85.461 1.00 31.86  ? 103 GLY A CA    1 
ATOM   788   C C     . GLY A  1 103 ? 12.927  -11.924 -84.344 1.00 36.88  ? 103 GLY A C     1 
ATOM   789   O O     . GLY A  1 103 ? 12.792  -11.187 -83.367 1.00 36.00  ? 103 GLY A O     1 
ATOM   790   N N     . GLY A  1 104 ? 12.297  -13.075 -84.486 1.00 33.35  ? 104 GLY A N     1 
ATOM   791   C CA    . GLY A  1 104 ? 11.354  -13.580 -83.512 1.00 31.47  ? 104 GLY A CA    1 
ATOM   792   C C     . GLY A  1 104 ? 11.879  -14.226 -82.250 1.00 34.34  ? 104 GLY A C     1 
ATOM   793   O O     . GLY A  1 104 ? 11.088  -14.612 -81.386 1.00 35.18  ? 104 GLY A O     1 
ATOM   794   N N     . GLY A  1 105 ? 13.170  -14.396 -82.157 1.00 30.11  ? 105 GLY A N     1 
ATOM   795   C CA    . GLY A  1 105 ? 13.816  -14.934 -80.967 1.00 31.11  ? 105 GLY A CA    1 
ATOM   796   C C     . GLY A  1 105 ? 14.075  -16.426 -80.946 1.00 37.58  ? 105 GLY A C     1 
ATOM   797   O O     . GLY A  1 105 ? 13.317  -17.208 -81.523 1.00 37.32  ? 105 GLY A O     1 
ATOM   798   N N     . THR A  1 106 ? 15.203  -16.819 -80.312 1.00 34.95  ? 106 THR A N     1 
ATOM   799   C CA    . THR A  1 106 ? 15.522  -18.190 -79.985 1.00 33.73  ? 106 THR A CA    1 
ATOM   800   C C     . THR A  1 106 ? 15.653  -18.252 -78.441 1.00 36.77  ? 106 THR A C     1 
ATOM   801   O O     . THR A  1 106 ? 16.463  -17.530 -77.844 1.00 32.70  ? 106 THR A O     1 
ATOM   802   C CB    . THR A  1 106 ? 16.790  -18.712 -80.652 1.00 34.81  ? 106 THR A CB    1 
ATOM   803   O OG1   . THR A  1 106 ? 16.591  -18.802 -82.046 1.00 31.26  ? 106 THR A OG1   1 
ATOM   804   C CG2   . THR A  1 106 ? 17.169  -20.129 -80.143 1.00 30.54  ? 106 THR A CG2   1 
ATOM   805   N N     . LYS A  1 107 ? 14.872  -19.132 -77.809 1.00 33.77  ? 107 LYS A N     1 
ATOM   806   C CA    . LYS A  1 107 ? 14.924  -19.295 -76.351 1.00 33.00  ? 107 LYS A CA    1 
ATOM   807   C C     . LYS A  1 107 ? 15.918  -20.392 -76.009 1.00 37.56  ? 107 LYS A C     1 
ATOM   808   O O     . LYS A  1 107 ? 15.791  -21.486 -76.542 1.00 35.99  ? 107 LYS A O     1 
ATOM   809   C CB    . LYS A  1 107 ? 13.539  -19.642 -75.823 1.00 33.76  ? 107 LYS A CB    1 
ATOM   810   C CG    . LYS A  1 107 ? 13.473  -19.918 -74.328 1.00 52.58  ? 107 LYS A CG    1 
ATOM   811   C CD    . LYS A  1 107 ? 12.003  -20.073 -73.928 1.00 58.20  ? 107 LYS A CD    1 
ATOM   812   C CE    . LYS A  1 107 ? 11.764  -20.248 -72.451 1.00 68.53  ? 107 LYS A CE    1 
ATOM   813   N NZ    . LYS A  1 107 ? 10.747  -19.280 -71.929 1.00 67.73  ? 107 LYS A NZ    1 
ATOM   814   N N     . VAL A  1 108 ? 16.962  -20.072 -75.206 1.00 34.28  ? 108 VAL A N     1 
ATOM   815   C CA    . VAL A  1 108 ? 17.973  -21.043 -74.814 1.00 33.74  ? 108 VAL A CA    1 
ATOM   816   C C     . VAL A  1 108 ? 17.622  -21.529 -73.411 1.00 40.21  ? 108 VAL A C     1 
ATOM   817   O O     . VAL A  1 108 ? 17.498  -20.726 -72.490 1.00 38.06  ? 108 VAL A O     1 
ATOM   818   C CB    . VAL A  1 108 ? 19.436  -20.550 -74.937 1.00 36.66  ? 108 VAL A CB    1 
ATOM   819   C CG1   . VAL A  1 108 ? 20.402  -21.593 -74.376 1.00 37.30  ? 108 VAL A CG1   1 
ATOM   820   C CG2   . VAL A  1 108 ? 19.772  -20.255 -76.391 1.00 35.91  ? 108 VAL A CG2   1 
ATOM   821   N N     . GLU A  1 109 ? 17.386  -22.841 -73.287 1.00 39.42  ? 109 GLU A N     1 
ATOM   822   C CA    . GLU A  1 109 ? 17.052  -23.505 -72.044 1.00 38.95  ? 109 GLU A CA    1 
ATOM   823   C C     . GLU A  1 109 ? 18.243  -24.379 -71.629 1.00 38.15  ? 109 GLU A C     1 
ATOM   824   O O     . GLU A  1 109 ? 18.985  -24.901 -72.472 1.00 36.48  ? 109 GLU A O     1 
ATOM   825   C CB    . GLU A  1 109 ? 15.784  -24.330 -72.226 1.00 41.17  ? 109 GLU A CB    1 
ATOM   826   C CG    . GLU A  1 109 ? 14.642  -23.537 -72.848 1.00 58.03  ? 109 GLU A CG    1 
ATOM   827   C CD    . GLU A  1 109 ? 13.379  -24.332 -73.124 1.00 88.57  ? 109 GLU A CD    1 
ATOM   828   O OE1   . GLU A  1 109 ? 12.290  -23.711 -73.177 1.00 79.92  ? 109 GLU A OE1   1 
ATOM   829   O OE2   . GLU A  1 109 ? 13.487  -25.561 -73.354 1.00 77.62  ? 109 GLU A OE2   1 
ATOM   830   N N     . ILE A  1 110 ? 18.486  -24.424 -70.326 1.00 34.08  ? 110 ILE A N     1 
ATOM   831   C CA    . ILE A  1 110 ? 19.589  -25.179 -69.731 1.00 34.52  ? 110 ILE A CA    1 
ATOM   832   C C     . ILE A  1 110 ? 19.146  -26.545 -69.237 1.00 39.38  ? 110 ILE A C     1 
ATOM   833   O O     . ILE A  1 110 ? 18.191  -26.649 -68.471 1.00 40.58  ? 110 ILE A O     1 
ATOM   834   C CB    . ILE A  1 110 ? 20.307  -24.344 -68.622 1.00 37.17  ? 110 ILE A CB    1 
ATOM   835   C CG1   . ILE A  1 110 ? 20.624  -22.897 -69.133 1.00 36.24  ? 110 ILE A CG1   1 
ATOM   836   C CG2   . ILE A  1 110 ? 21.568  -25.039 -68.164 1.00 39.07  ? 110 ILE A CG2   1 
ATOM   837   C CD1   . ILE A  1 110 ? 21.560  -22.817 -70.392 1.00 40.67  ? 110 ILE A CD1   1 
ATOM   838   N N     . LYS A  1 111 ? 19.868  -27.583 -69.643 1.00 37.46  ? 111 LYS A N     1 
ATOM   839   C CA    . LYS A  1 111 ? 19.603  -28.955 -69.223 1.00 38.98  ? 111 LYS A CA    1 
ATOM   840   C C     . LYS A  1 111 ? 20.344  -29.226 -67.958 1.00 42.40  ? 111 LYS A C     1 
ATOM   841   O O     . LYS A  1 111 ? 21.460  -28.783 -67.789 1.00 42.14  ? 111 LYS A O     1 
ATOM   842   C CB    . LYS A  1 111 ? 20.062  -29.990 -70.255 1.00 43.60  ? 111 LYS A CB    1 
ATOM   843   C CG    . LYS A  1 111 ? 19.216  -30.049 -71.493 1.00 54.08  ? 111 LYS A CG    1 
ATOM   844   C CD    . LYS A  1 111 ? 19.739  -31.146 -72.444 1.00 59.76  ? 111 LYS A CD    1 
ATOM   845   C CE    . LYS A  1 111 ? 18.710  -31.494 -73.506 1.00 82.21  ? 111 LYS A CE    1 
ATOM   846   N NZ    . LYS A  1 111 ? 19.284  -32.309 -74.618 1.00 91.53  ? 111 LYS A NZ    1 
ATOM   847   N N     . ARG A  1 112 ? 19.727  -29.960 -67.071 1.00 41.81  ? 112 ARG A N     1 
ATOM   848   C CA    . ARG A  1 112 ? 20.346  -30.397 -65.824 1.00 40.87  ? 112 ARG A CA    1 
ATOM   849   C C     . ARG A  1 112 ? 19.788  -31.762 -65.467 1.00 43.05  ? 112 ARG A C     1 
ATOM   850   O O     . ARG A  1 112 ? 18.926  -32.277 -66.178 1.00 42.94  ? 112 ARG A O     1 
ATOM   851   C CB    . ARG A  1 112 ? 20.126  -29.374 -64.700 1.00 34.15  ? 112 ARG A CB    1 
ATOM   852   C CG    . ARG A  1 112 ? 18.710  -29.090 -64.348 1.00 39.85  ? 112 ARG A CG    1 
ATOM   853   C CD    . ARG A  1 112 ? 18.578  -28.645 -62.904 1.00 32.19  ? 112 ARG A CD    1 
ATOM   854   N NE    . ARG A  1 112 ? 18.863  -29.757 -61.992 1.00 38.93  ? 112 ARG A NE    1 
ATOM   855   C CZ    . ARG A  1 112 ? 19.395  -29.661 -60.780 1.00 46.06  ? 112 ARG A CZ    1 
ATOM   856   N NH1   . ARG A  1 112 ? 19.707  -28.477 -60.273 1.00 35.62  ? 112 ARG A NH1   1 
ATOM   857   N NH2   . ARG A  1 112 ? 19.596  -30.747 -60.052 1.00 46.49  ? 112 ARG A NH2   1 
ATOM   858   N N     . THR A  1 113 ? 20.273  -32.335 -64.387 1.00 40.04  ? 113 THR A N     1 
ATOM   859   C CA    . THR A  1 113 ? 19.790  -33.609 -63.889 1.00 40.71  ? 113 THR A CA    1 
ATOM   860   C C     . THR A  1 113 ? 18.401  -33.408 -63.226 1.00 43.97  ? 113 THR A C     1 
ATOM   861   O O     . THR A  1 113 ? 18.053  -32.315 -62.763 1.00 43.63  ? 113 THR A O     1 
ATOM   862   C CB    . THR A  1 113 ? 20.799  -34.208 -62.884 1.00 43.62  ? 113 THR A CB    1 
ATOM   863   O OG1   . THR A  1 113 ? 20.898  -33.311 -61.797 1.00 43.24  ? 113 THR A OG1   1 
ATOM   864   C CG2   . THR A  1 113 ? 22.182  -34.466 -63.502 1.00 37.64  ? 113 THR A CG2   1 
ATOM   865   N N     . VAL A  1 114 ? 17.627  -34.489 -63.195 1.00 39.91  ? 114 VAL A N     1 
ATOM   866   C CA    . VAL A  1 114 ? 16.300  -34.511 -62.608 1.00 37.25  ? 114 VAL A CA    1 
ATOM   867   C C     . VAL A  1 114 ? 16.361  -34.103 -61.112 1.00 41.00  ? 114 VAL A C     1 
ATOM   868   O O     . VAL A  1 114 ? 17.223  -34.561 -60.352 1.00 40.89  ? 114 VAL A O     1 
ATOM   869   C CB    . VAL A  1 114 ? 15.633  -35.920 -62.822 1.00 39.61  ? 114 VAL A CB    1 
ATOM   870   C CG1   . VAL A  1 114 ? 14.318  -36.055 -62.024 1.00 38.21  ? 114 VAL A CG1   1 
ATOM   871   C CG2   . VAL A  1 114 ? 15.374  -36.178 -64.308 1.00 38.42  ? 114 VAL A CG2   1 
ATOM   872   N N     . ALA A  1 115 ? 15.456  -33.203 -60.721 1.00 37.48  ? 115 ALA A N     1 
ATOM   873   C CA    . ALA A  1 115 ? 15.331  -32.705 -59.359 1.00 35.67  ? 115 ALA A CA    1 
ATOM   874   C C     . ALA A  1 115 ? 13.875  -32.796 -58.963 1.00 37.08  ? 115 ALA A C     1 
ATOM   875   O O     . ALA A  1 115 ? 13.022  -32.208 -59.607 1.00 36.26  ? 115 ALA A O     1 
ATOM   876   C CB    . ALA A  1 115 ? 15.820  -31.268 -59.289 1.00 36.26  ? 115 ALA A CB    1 
ATOM   877   N N     . ALA A  1 116 ? 13.566  -33.604 -57.974 1.00 35.27  ? 116 ALA A N     1 
ATOM   878   C CA    . ALA A  1 116 ? 12.184  -33.717 -57.492 1.00 35.32  ? 116 ALA A CA    1 
ATOM   879   C C     . ALA A  1 116 ? 11.757  -32.432 -56.776 1.00 38.00  ? 116 ALA A C     1 
ATOM   880   O O     . ALA A  1 116 ? 12.580  -31.818 -56.106 1.00 38.00  ? 116 ALA A O     1 
ATOM   881   C CB    . ALA A  1 116 ? 12.075  -34.873 -56.517 1.00 36.16  ? 116 ALA A CB    1 
ATOM   882   N N     . PRO A  1 117 ? 10.496  -31.992 -56.881 1.00 36.21  ? 117 PRO A N     1 
ATOM   883   C CA    . PRO A  1 117 ? 10.082  -30.817 -56.088 1.00 36.27  ? 117 PRO A CA    1 
ATOM   884   C C     . PRO A  1 117 ? 9.934   -31.150 -54.604 1.00 39.96  ? 117 PRO A C     1 
ATOM   885   O O     . PRO A  1 117 ? 9.623   -32.282 -54.244 1.00 41.18  ? 117 PRO A O     1 
ATOM   886   C CB    . PRO A  1 117 ? 8.711   -30.464 -56.662 1.00 36.81  ? 117 PRO A CB    1 
ATOM   887   C CG    . PRO A  1 117 ? 8.204   -31.737 -57.228 1.00 40.55  ? 117 PRO A CG    1 
ATOM   888   C CD    . PRO A  1 117 ? 9.369   -32.547 -57.659 1.00 36.91  ? 117 PRO A CD    1 
ATOM   889   N N     . SER A  1 118 ? 10.201  -30.161 -53.776 1.00 36.25  ? 118 SER A N     1 
ATOM   890   C CA    . SER A  1 118 ? 9.909   -30.115 -52.339 1.00 36.49  ? 118 SER A CA    1 
ATOM   891   C C     . SER A  1 118 ? 8.544   -29.425 -52.304 1.00 37.27  ? 118 SER A C     1 
ATOM   892   O O     . SER A  1 118 ? 8.376   -28.363 -52.889 1.00 35.03  ? 118 SER A O     1 
ATOM   893   C CB    . SER A  1 118 ? 10.926  -29.252 -51.592 1.00 38.27  ? 118 SER A CB    1 
ATOM   894   O OG    . SER A  1 118 ? 12.208  -29.812 -51.806 1.00 47.36  ? 118 SER A OG    1 
ATOM   895   N N     . VAL A  1 119 ? 7.591   -30.041 -51.659 1.00 36.32  ? 119 VAL A N     1 
ATOM   896   C CA    . VAL A  1 119 ? 6.216   -29.593 -51.626 1.00 35.59  ? 119 VAL A CA    1 
ATOM   897   C C     . VAL A  1 119 ? 5.822   -29.025 -50.269 1.00 38.54  ? 119 VAL A C     1 
ATOM   898   O O     . VAL A  1 119 ? 6.211   -29.543 -49.230 1.00 38.76  ? 119 VAL A O     1 
ATOM   899   C CB    . VAL A  1 119 ? 5.293   -30.741 -52.078 1.00 38.02  ? 119 VAL A CB    1 
ATOM   900   C CG1   . VAL A  1 119 ? 3.852   -30.271 -52.276 1.00 36.54  ? 119 VAL A CG1   1 
ATOM   901   C CG2   . VAL A  1 119 ? 5.851   -31.377 -53.345 1.00 36.65  ? 119 VAL A CG2   1 
ATOM   902   N N     . PHE A  1 120 ? 5.065   -27.931 -50.307 1.00 34.65  ? 120 PHE A N     1 
ATOM   903   C CA    . PHE A  1 120 ? 4.556   -27.263 -49.128 1.00 35.13  ? 120 PHE A CA    1 
ATOM   904   C C     . PHE A  1 120 ? 3.130   -26.840 -49.402 1.00 39.21  ? 120 PHE A C     1 
ATOM   905   O O     . PHE A  1 120 ? 2.852   -26.311 -50.465 1.00 36.47  ? 120 PHE A O     1 
ATOM   906   C CB    . PHE A  1 120 ? 5.370   -25.998 -48.799 1.00 35.77  ? 120 PHE A CB    1 
ATOM   907   C CG    . PHE A  1 120 ? 6.849   -26.212 -48.621 1.00 36.69  ? 120 PHE A CG    1 
ATOM   908   C CD1   . PHE A  1 120 ? 7.702   -26.221 -49.715 1.00 36.69  ? 120 PHE A CD1   1 
ATOM   909   C CD2   . PHE A  1 120 ? 7.386   -26.458 -47.361 1.00 36.79  ? 120 PHE A CD2   1 
ATOM   910   C CE1   . PHE A  1 120 ? 9.078   -26.429 -49.547 1.00 38.33  ? 120 PHE A CE1   1 
ATOM   911   C CE2   . PHE A  1 120 ? 8.764   -26.676 -47.199 1.00 39.13  ? 120 PHE A CE2   1 
ATOM   912   C CZ    . PHE A  1 120 ? 9.600   -26.643 -48.289 1.00 36.47  ? 120 PHE A CZ    1 
ATOM   913   N N     . ILE A  1 121 ? 2.256   -27.007 -48.415 1.00 38.31  ? 121 ILE A N     1 
ATOM   914   C CA    . ILE A  1 121 ? 0.842   -26.581 -48.498 1.00 37.77  ? 121 ILE A CA    1 
ATOM   915   C C     . ILE A  1 121 ? 0.625   -25.447 -47.439 1.00 40.17  ? 121 ILE A C     1 
ATOM   916   O O     . ILE A  1 121 ? 1.279   -25.426 -46.389 1.00 38.66  ? 121 ILE A O     1 
ATOM   917   C CB    . ILE A  1 121 ? -0.157  -27.790 -48.362 1.00 40.34  ? 121 ILE A CB    1 
ATOM   918   C CG1   . ILE A  1 121 ? -1.625  -27.350 -48.655 1.00 39.72  ? 121 ILE A CG1   1 
ATOM   919   C CG2   . ILE A  1 121 ? -0.057  -28.461 -47.000 1.00 40.84  ? 121 ILE A CG2   1 
ATOM   920   C CD1   . ILE A  1 121 ? -2.651  -28.532 -48.900 1.00 43.55  ? 121 ILE A CD1   1 
ATOM   921   N N     . PHE A  1 122 ? -0.217  -24.472 -47.781 1.00 37.62  ? 122 PHE A N     1 
ATOM   922   C CA    . PHE A  1 122 ? -0.531  -23.344 -46.915 1.00 38.77  ? 122 PHE A CA    1 
ATOM   923   C C     . PHE A  1 122 ? -2.021  -23.194 -46.806 1.00 44.34  ? 122 PHE A C     1 
ATOM   924   O O     . PHE A  1 122 ? -2.705  -23.048 -47.831 1.00 43.04  ? 122 PHE A O     1 
ATOM   925   C CB    . PHE A  1 122 ? 0.025   -22.013 -47.453 1.00 39.54  ? 122 PHE A CB    1 
ATOM   926   C CG    . PHE A  1 122 ? 1.512   -21.991 -47.632 1.00 40.08  ? 122 PHE A CG    1 
ATOM   927   C CD1   . PHE A  1 122 ? 2.356   -21.874 -46.536 1.00 41.35  ? 122 PHE A CD1   1 
ATOM   928   C CD2   . PHE A  1 122 ? 2.075   -22.022 -48.903 1.00 40.28  ? 122 PHE A CD2   1 
ATOM   929   C CE1   . PHE A  1 122 ? 3.736   -21.855 -46.696 1.00 40.77  ? 122 PHE A CE1   1 
ATOM   930   C CE2   . PHE A  1 122 ? 3.454   -22.071 -49.060 1.00 41.69  ? 122 PHE A CE2   1 
ATOM   931   C CZ    . PHE A  1 122 ? 4.281   -21.930 -47.958 1.00 40.35  ? 122 PHE A CZ    1 
ATOM   932   N N     . PRO A  1 123 ? -2.551  -23.156 -45.575 1.00 42.72  ? 123 PRO A N     1 
ATOM   933   C CA    . PRO A  1 123 ? -3.977  -22.886 -45.417 1.00 42.71  ? 123 PRO A CA    1 
ATOM   934   C C     . PRO A  1 123 ? -4.296  -21.404 -45.665 1.00 46.84  ? 123 PRO A C     1 
ATOM   935   O O     . PRO A  1 123 ? -3.411  -20.514 -45.635 1.00 46.90  ? 123 PRO A O     1 
ATOM   936   C CB    . PRO A  1 123 ? -4.213  -23.247 -43.950 1.00 45.14  ? 123 PRO A CB    1 
ATOM   937   C CG    . PRO A  1 123 ? -2.998  -22.872 -43.296 1.00 50.08  ? 123 PRO A CG    1 
ATOM   938   C CD    . PRO A  1 123 ? -1.909  -23.316 -44.253 1.00 44.80  ? 123 PRO A CD    1 
ATOM   939   N N     . PRO A  1 124 ? -5.578  -21.104 -45.865 1.00 44.06  ? 124 PRO A N     1 
ATOM   940   C CA    . PRO A  1 124 ? -5.989  -19.703 -45.963 1.00 44.51  ? 124 PRO A CA    1 
ATOM   941   C C     . PRO A  1 124 ? -5.724  -18.943 -44.652 1.00 46.73  ? 124 PRO A C     1 
ATOM   942   O O     . PRO A  1 124 ? -5.773  -19.537 -43.582 1.00 44.66  ? 124 PRO A O     1 
ATOM   943   C CB    . PRO A  1 124 ? -7.494  -19.805 -46.268 1.00 46.45  ? 124 PRO A CB    1 
ATOM   944   C CG    . PRO A  1 124 ? -7.890  -21.071 -45.817 1.00 50.88  ? 124 PRO A CG    1 
ATOM   945   C CD    . PRO A  1 124 ? -6.740  -21.997 -45.953 1.00 46.27  ? 124 PRO A CD    1 
ATOM   946   N N     . SER A  1 125 ? -5.402  -17.652 -44.729 1.00 43.91  ? 125 SER A N     1 
ATOM   947   C CA    . SER A  1 125 ? -5.223  -16.852 -43.484 1.00 46.66  ? 125 SER A CA    1 
ATOM   948   C C     . SER A  1 125 ? -6.557  -16.464 -42.890 1.00 53.72  ? 125 SER A C     1 
ATOM   949   O O     . SER A  1 125 ? -7.465  -16.146 -43.644 1.00 53.33  ? 125 SER A O     1 
ATOM   950   C CB    . SER A  1 125 ? -4.467  -15.555 -43.758 1.00 48.28  ? 125 SER A CB    1 
ATOM   951   O OG    . SER A  1 125 ? -5.099  -14.804 -44.782 1.00 52.88  ? 125 SER A OG    1 
ATOM   952   N N     . ASP A  1 126 ? -6.652  -16.380 -41.546 1.00 55.04  ? 126 ASP A N     1 
ATOM   953   C CA    . ASP A  1 126 ? -7.845  -15.855 -40.863 1.00 57.01  ? 126 ASP A CA    1 
ATOM   954   C C     . ASP A  1 126 ? -8.215  -14.465 -41.369 1.00 60.24  ? 126 ASP A C     1 
ATOM   955   O O     . ASP A  1 126 ? -9.397  -14.121 -41.425 1.00 59.67  ? 126 ASP A O     1 
ATOM   956   C CB    . ASP A  1 126 ? -7.621  -15.763 -39.356 1.00 61.89  ? 126 ASP A CB    1 
ATOM   957   C CG    . ASP A  1 126 ? -7.724  -17.089 -38.619 1.00 81.88  ? 126 ASP A CG    1 
ATOM   958   O OD1   . ASP A  1 126 ? -8.379  -18.014 -39.148 1.00 84.36  ? 126 ASP A OD1   1 
ATOM   959   O OD2   . ASP A  1 126 ? -7.210  -17.177 -37.481 1.00 91.51  ? 126 ASP A OD2   1 
ATOM   960   N N     . GLU A  1 127 ? -7.202  -13.663 -41.735 1.00 57.73  ? 127 GLU A N     1 
ATOM   961   C CA    . GLU A  1 127 ? -7.395  -12.349 -42.318 1.00 57.35  ? 127 GLU A CA    1 
ATOM   962   C C     . GLU A  1 127 ? -8.201  -12.460 -43.623 1.00 59.51  ? 127 GLU A C     1 
ATOM   963   O O     . GLU A  1 127 ? -9.116  -11.689 -43.834 1.00 62.41  ? 127 GLU A O     1 
ATOM   964   C CB    . GLU A  1 127 ? -6.027  -11.701 -42.556 1.00 58.86  ? 127 GLU A CB    1 
ATOM   965   C CG    . GLU A  1 127 ? -6.069  -10.250 -42.999 1.00 76.03  ? 127 GLU A CG    1 
ATOM   966   C CD    . GLU A  1 127 ? -4.741  -9.725  -43.521 1.00 103.72 ? 127 GLU A CD    1 
ATOM   967   O OE1   . GLU A  1 127 ? -3.687  -10.270 -43.116 1.00 102.20 ? 127 GLU A OE1   1 
ATOM   968   O OE2   . GLU A  1 127 ? -4.752  -8.764  -44.327 1.00 93.46  ? 127 GLU A OE2   1 
ATOM   969   N N     . GLN A  1 128 ? -7.870  -13.400 -44.494 1.00 54.40  ? 128 GLN A N     1 
ATOM   970   C CA    . GLN A  1 128 ? -8.605  -13.565 -45.764 1.00 51.93  ? 128 GLN A CA    1 
ATOM   971   C C     . GLN A  1 128 ? -10.021 -14.102 -45.522 1.00 54.82  ? 128 GLN A C     1 
ATOM   972   O O     . GLN A  1 128 ? -10.965 -13.735 -46.229 1.00 51.56  ? 128 GLN A O     1 
ATOM   973   C CB    . GLN A  1 128 ? -7.866  -14.510 -46.694 1.00 49.85  ? 128 GLN A CB    1 
ATOM   974   C CG    . GLN A  1 128 ? -8.491  -14.563 -48.082 1.00 51.37  ? 128 GLN A CG    1 
ATOM   975   C CD    . GLN A  1 128 ? -7.908  -15.596 -48.983 1.00 53.71  ? 128 GLN A CD    1 
ATOM   976   O OE1   . GLN A  1 128 ? -7.264  -16.562 -48.538 1.00 48.05  ? 128 GLN A OE1   1 
ATOM   977   N NE2   . GLN A  1 128 ? -8.246  -15.475 -50.263 1.00 46.00  ? 128 GLN A NE2   1 
ATOM   978   N N     . LEU A  1 129 ? -10.162 -14.957 -44.517 1.00 53.15  ? 129 LEU A N     1 
ATOM   979   C CA    . LEU A  1 129 ? -11.465 -15.501 -44.176 1.00 55.11  ? 129 LEU A CA    1 
ATOM   980   C C     . LEU A  1 129 ? -12.443 -14.447 -43.659 1.00 64.68  ? 129 LEU A C     1 
ATOM   981   O O     . LEU A  1 129 ? -13.631 -14.746 -43.662 1.00 67.88  ? 129 LEU A O     1 
ATOM   982   C CB    . LEU A  1 129 ? -11.337 -16.689 -43.216 1.00 55.26  ? 129 LEU A CB    1 
ATOM   983   C CG    . LEU A  1 129 ? -10.595 -17.909 -43.786 1.00 58.31  ? 129 LEU A CG    1 
ATOM   984   C CD1   . LEU A  1 129 ? -10.295 -18.920 -42.708 1.00 59.99  ? 129 LEU A CD1   1 
ATOM   985   C CD2   . LEU A  1 129 ? -11.380 -18.589 -44.867 1.00 56.51  ? 129 LEU A CD2   1 
ATOM   986   N N     . LYS A  1 130 ? -11.996 -13.217 -43.265 1.00 62.00  ? 130 LYS A N     1 
ATOM   987   C CA    . LYS A  1 130 ? -12.917 -12.124 -42.895 1.00 63.05  ? 130 LYS A CA    1 
ATOM   988   C C     . LYS A  1 130 ? -13.713 -11.684 -44.134 1.00 67.28  ? 130 LYS A C     1 
ATOM   989   O O     . LYS A  1 130 ? -14.895 -11.356 -44.011 1.00 69.83  ? 130 LYS A O     1 
ATOM   990   C CB    . LYS A  1 130 ? -12.187 -10.940 -42.261 1.00 66.25  ? 130 LYS A CB    1 
ATOM   991   C CG    . LYS A  1 130 ? -11.734 -11.223 -40.835 1.00 82.47  ? 130 LYS A CG    1 
ATOM   992   C CD    . LYS A  1 130 ? -10.976 -10.041 -40.245 1.00 94.93  ? 130 LYS A CD    1 
ATOM   993   C CE    . LYS A  1 130 ? -10.491 -10.274 -38.834 1.00 107.90 ? 130 LYS A CE    1 
ATOM   994   N NZ    . LYS A  1 130 ? -11.578 -10.159 -37.823 1.00 125.05 ? 130 LYS A NZ    1 
ATOM   995   N N     . SER A  1 131 ? -13.084 -11.709 -45.332 1.00 60.59  ? 131 SER A N     1 
ATOM   996   C CA    . SER A  1 131 ? -13.800 -11.539 -46.600 1.00 59.29  ? 131 SER A CA    1 
ATOM   997   C C     . SER A  1 131 ? -14.475 -12.919 -46.846 1.00 64.24  ? 131 SER A C     1 
ATOM   998   O O     . SER A  1 131 ? -14.347 -13.836 -46.018 1.00 65.75  ? 131 SER A O     1 
ATOM   999   C CB    . SER A  1 131 ? -12.861 -11.164 -47.743 1.00 62.46  ? 131 SER A CB    1 
ATOM   1000  O OG    . SER A  1 131 ? -12.169 -12.262 -48.351 1.00 72.41  ? 131 SER A OG    1 
ATOM   1001  N N     . GLY A  1 132 ? -15.192 -13.084 -47.946 1.00 57.94  ? 132 GLY A N     1 
ATOM   1002  C CA    . GLY A  1 132 ? -15.897 -14.353 -48.166 1.00 55.87  ? 132 GLY A CA    1 
ATOM   1003  C C     . GLY A  1 132 ? -15.214 -15.364 -49.051 1.00 57.87  ? 132 GLY A C     1 
ATOM   1004  O O     . GLY A  1 132 ? -15.906 -16.193 -49.646 1.00 58.16  ? 132 GLY A O     1 
ATOM   1005  N N     . THR A  1 133 ? -13.871 -15.329 -49.143 1.00 53.86  ? 133 THR A N     1 
ATOM   1006  C CA    . THR A  1 133 ? -13.074 -16.243 -49.994 1.00 51.41  ? 133 THR A CA    1 
ATOM   1007  C C     . THR A  1 133 ? -11.974 -16.914 -49.191 1.00 51.35  ? 133 THR A C     1 
ATOM   1008  O O     . THR A  1 133 ? -11.501 -16.372 -48.192 1.00 52.69  ? 133 THR A O     1 
ATOM   1009  C CB    . THR A  1 133 ? -12.477 -15.469 -51.180 1.00 60.22  ? 133 THR A CB    1 
ATOM   1010  O OG1   . THR A  1 133 ? -13.547 -14.885 -51.901 1.00 67.27  ? 133 THR A OG1   1 
ATOM   1011  C CG2   . THR A  1 133 ? -11.686 -16.348 -52.147 1.00 60.65  ? 133 THR A CG2   1 
ATOM   1012  N N     . ALA A  1 134 ? -11.630 -18.125 -49.595 1.00 44.94  ? 134 ALA A N     1 
ATOM   1013  C CA    . ALA A  1 134 ? -10.554 -18.906 -49.019 1.00 44.19  ? 134 ALA A CA    1 
ATOM   1014  C C     . ALA A  1 134 ? -9.578  -19.326 -50.125 1.00 46.34  ? 134 ALA A C     1 
ATOM   1015  O O     . ALA A  1 134 ? -9.972  -20.030 -51.060 1.00 46.43  ? 134 ALA A O     1 
ATOM   1016  C CB    . ALA A  1 134 ? -11.124 -20.130 -48.347 1.00 45.40  ? 134 ALA A CB    1 
ATOM   1017  N N     . SER A  1 135 ? -8.292  -18.940 -50.000 1.00 42.14  ? 135 SER A N     1 
ATOM   1018  C CA    . SER A  1 135 ? -7.242  -19.358 -50.942 1.00 40.15  ? 135 SER A CA    1 
ATOM   1019  C C     . SER A  1 135 ? -6.323  -20.350 -50.252 1.00 41.72  ? 135 SER A C     1 
ATOM   1020  O O     . SER A  1 135 ? -5.741  -20.042 -49.212 1.00 41.38  ? 135 SER A O     1 
ATOM   1021  C CB    . SER A  1 135 ? -6.441  -18.174 -51.478 1.00 40.88  ? 135 SER A CB    1 
ATOM   1022  O OG    . SER A  1 135 ? -7.307  -17.274 -52.151 1.00 43.93  ? 135 SER A OG    1 
ATOM   1023  N N     . VAL A  1 136 ? -6.199  -21.539 -50.848 1.00 37.28  ? 136 VAL A N     1 
ATOM   1024  C CA    . VAL A  1 136 ? -5.331  -22.599 -50.372 1.00 35.52  ? 136 VAL A CA    1 
ATOM   1025  C C     . VAL A  1 136 ? -4.188  -22.632 -51.363 1.00 39.16  ? 136 VAL A C     1 
ATOM   1026  O O     . VAL A  1 136 ? -4.430  -22.637 -52.568 1.00 38.37  ? 136 VAL A O     1 
ATOM   1027  C CB    . VAL A  1 136 ? -6.044  -23.965 -50.305 1.00 37.11  ? 136 VAL A CB    1 
ATOM   1028  C CG1   . VAL A  1 136 ? -5.196  -24.972 -49.537 1.00 37.71  ? 136 VAL A CG1   1 
ATOM   1029  C CG2   . VAL A  1 136 ? -7.434  -23.848 -49.700 1.00 35.63  ? 136 VAL A CG2   1 
ATOM   1030  N N     . VAL A  1 137 ? -2.948  -22.632 -50.881 1.00 36.51  ? 137 VAL A N     1 
ATOM   1031  C CA    . VAL A  1 137 ? -1.802  -22.564 -51.779 1.00 35.57  ? 137 VAL A CA    1 
ATOM   1032  C C     . VAL A  1 137 ? -0.882  -23.785 -51.638 1.00 38.90  ? 137 VAL A C     1 
ATOM   1033  O O     . VAL A  1 137 ? -0.657  -24.289 -50.546 1.00 36.62  ? 137 VAL A O     1 
ATOM   1034  C CB    . VAL A  1 137 ? -1.083  -21.200 -51.560 1.00 38.87  ? 137 VAL A CB    1 
ATOM   1035  C CG1   . VAL A  1 137 ? 0.164   -21.070 -52.411 1.00 38.06  ? 137 VAL A CG1   1 
ATOM   1036  C CG2   . VAL A  1 137 ? -2.047  -20.037 -51.841 1.00 38.23  ? 137 VAL A CG2   1 
ATOM   1037  N N     . CYS A  1 138 ? -0.386  -24.263 -52.768 1.00 37.53  ? 138 CYS A N     1 
ATOM   1038  C CA    . CYS A  1 138 ? 0.576   -25.337 -52.814 1.00 40.19  ? 138 CYS A CA    1 
ATOM   1039  C C     . CYS A  1 138 ? 1.810   -24.870 -53.534 1.00 42.20  ? 138 CYS A C     1 
ATOM   1040  O O     . CYS A  1 138 ? 1.678   -24.406 -54.656 1.00 41.95  ? 138 CYS A O     1 
ATOM   1041  C CB    . CYS A  1 138 ? 0.004   -26.566 -53.503 1.00 41.95  ? 138 CYS A CB    1 
ATOM   1042  S SG    . CYS A  1 138 ? 1.062   -28.015 -53.336 1.00 46.74  ? 138 CYS A SG    1 
ATOM   1043  N N     . LEU A  1 139 ? 3.006   -25.071 -52.937 1.00 36.74  ? 139 LEU A N     1 
ATOM   1044  C CA    . LEU A  1 139 ? 4.302   -24.722 -53.531 1.00 34.58  ? 139 LEU A CA    1 
ATOM   1045  C C     . LEU A  1 139 ? 5.086   -25.969 -53.894 1.00 38.82  ? 139 LEU A C     1 
ATOM   1046  O O     . LEU A  1 139 ? 5.243   -26.854 -53.059 1.00 37.85  ? 139 LEU A O     1 
ATOM   1047  C CB    . LEU A  1 139 ? 5.119   -23.861 -52.540 1.00 34.42  ? 139 LEU A CB    1 
ATOM   1048  C CG    . LEU A  1 139 ? 6.581   -23.538 -52.889 1.00 38.26  ? 139 LEU A CG    1 
ATOM   1049  C CD1   . LEU A  1 139 ? 6.671   -22.729 -54.205 1.00 38.40  ? 139 LEU A CD1   1 
ATOM   1050  C CD2   . LEU A  1 139 ? 7.236   -22.798 -51.737 1.00 39.71  ? 139 LEU A CD2   1 
ATOM   1051  N N     . LEU A  1 140 ? 5.592   -26.023 -55.149 1.00 35.43  ? 140 LEU A N     1 
ATOM   1052  C CA    . LEU A  1 140 ? 6.480   -27.081 -55.670 1.00 33.73  ? 140 LEU A CA    1 
ATOM   1053  C C     . LEU A  1 140 ? 7.776   -26.337 -55.905 1.00 36.79  ? 140 LEU A C     1 
ATOM   1054  O O     . LEU A  1 140 ? 7.855   -25.517 -56.807 1.00 35.91  ? 140 LEU A O     1 
ATOM   1055  C CB    . LEU A  1 140 ? 5.964   -27.679 -57.008 1.00 33.05  ? 140 LEU A CB    1 
ATOM   1056  C CG    . LEU A  1 140 ? 4.757   -28.636 -56.955 1.00 36.86  ? 140 LEU A CG    1 
ATOM   1057  C CD1   . LEU A  1 140 ? 3.488   -27.970 -56.281 1.00 35.53  ? 140 LEU A CD1   1 
ATOM   1058  C CD2   . LEU A  1 140 ? 4.367   -29.073 -58.341 1.00 38.93  ? 140 LEU A CD2   1 
ATOM   1059  N N     . ASN A  1 141 ? 8.765   -26.549 -55.052 1.00 34.64  ? 141 ASN A N     1 
ATOM   1060  C CA    . ASN A  1 141 ? 10.007  -25.786 -55.106 1.00 33.48  ? 141 ASN A CA    1 
ATOM   1061  C C     . ASN A  1 141 ? 11.222  -26.473 -55.688 1.00 36.25  ? 141 ASN A C     1 
ATOM   1062  O O     . ASN A  1 141 ? 11.559  -27.544 -55.249 1.00 36.40  ? 141 ASN A O     1 
ATOM   1063  C CB    . ASN A  1 141 ? 10.350  -25.324 -53.690 1.00 36.08  ? 141 ASN A CB    1 
ATOM   1064  C CG    . ASN A  1 141 ? 11.109  -24.032 -53.666 1.00 43.56  ? 141 ASN A CG    1 
ATOM   1065  O OD1   . ASN A  1 141 ? 10.764  -23.084 -54.351 1.00 41.85  ? 141 ASN A OD1   1 
ATOM   1066  N ND2   . ASN A  1 141 ? 12.150  -23.966 -52.895 1.00 49.28  ? 141 ASN A ND2   1 
ATOM   1067  N N     . ASN A  1 142 ? 11.934  -25.792 -56.619 1.00 34.41  ? 142 ASN A N     1 
ATOM   1068  C CA    . ASN A  1 142 ? 13.218  -26.189 -57.186 1.00 34.22  ? 142 ASN A CA    1 
ATOM   1069  C C     . ASN A  1 142 ? 13.261  -27.589 -57.771 1.00 37.76  ? 142 ASN A C     1 
ATOM   1070  O O     . ASN A  1 142 ? 14.002  -28.455 -57.307 1.00 38.67  ? 142 ASN A O     1 
ATOM   1071  C CB    . ASN A  1 142 ? 14.329  -25.997 -56.135 1.00 32.56  ? 142 ASN A CB    1 
ATOM   1072  C CG    . ASN A  1 142 ? 14.503  -24.560 -55.716 1.00 39.27  ? 142 ASN A CG    1 
ATOM   1073  O OD1   . ASN A  1 142 ? 14.097  -23.622 -56.394 1.00 38.53  ? 142 ASN A OD1   1 
ATOM   1074  N ND2   . ASN A  1 142 ? 15.064  -24.369 -54.579 1.00 38.72  ? 142 ASN A ND2   1 
ATOM   1075  N N     . PHE A  1 143 ? 12.571  -27.751 -58.873 1.00 33.66  ? 143 PHE A N     1 
ATOM   1076  C CA    . PHE A  1 143 ? 12.468  -29.041 -59.577 1.00 32.59  ? 143 PHE A CA    1 
ATOM   1077  C C     . PHE A  1 143 ? 12.881  -28.919 -61.068 1.00 36.51  ? 143 PHE A C     1 
ATOM   1078  O O     . PHE A  1 143 ? 12.888  -27.829 -61.644 1.00 35.79  ? 143 PHE A O     1 
ATOM   1079  C CB    . PHE A  1 143 ? 11.009  -29.595 -59.441 1.00 33.10  ? 143 PHE A CB    1 
ATOM   1080  C CG    . PHE A  1 143 ? 9.914   -28.775 -60.070 1.00 32.60  ? 143 PHE A CG    1 
ATOM   1081  C CD1   . PHE A  1 143 ? 9.623   -28.898 -61.415 1.00 35.25  ? 143 PHE A CD1   1 
ATOM   1082  C CD2   . PHE A  1 143 ? 9.186   -27.862 -59.323 1.00 32.83  ? 143 PHE A CD2   1 
ATOM   1083  C CE1   . PHE A  1 143 ? 8.652   -28.111 -62.008 1.00 33.89  ? 143 PHE A CE1   1 
ATOM   1084  C CE2   . PHE A  1 143 ? 8.216   -27.073 -59.922 1.00 33.79  ? 143 PHE A CE2   1 
ATOM   1085  C CZ    . PHE A  1 143 ? 7.957   -27.198 -61.258 1.00 30.98  ? 143 PHE A CZ    1 
ATOM   1086  N N     . TYR A  1 144 ? 13.216  -30.049 -61.661 1.00 33.84  ? 144 TYR A N     1 
ATOM   1087  C CA    . TYR A  1 144 ? 13.604  -30.146 -63.061 1.00 33.99  ? 144 TYR A CA    1 
ATOM   1088  C C     . TYR A  1 144 ? 13.300  -31.537 -63.512 1.00 35.93  ? 144 TYR A C     1 
ATOM   1089  O O     . TYR A  1 144 ? 13.644  -32.463 -62.794 1.00 36.42  ? 144 TYR A O     1 
ATOM   1090  C CB    . TYR A  1 144 ? 15.100  -29.865 -63.268 1.00 36.05  ? 144 TYR A CB    1 
ATOM   1091  C CG    . TYR A  1 144 ? 15.464  -29.799 -64.731 1.00 36.08  ? 144 TYR A CG    1 
ATOM   1092  C CD1   . TYR A  1 144 ? 15.317  -28.620 -65.447 1.00 37.09  ? 144 TYR A CD1   1 
ATOM   1093  C CD2   . TYR A  1 144 ? 15.803  -30.947 -65.437 1.00 36.88  ? 144 TYR A CD2   1 
ATOM   1094  C CE1   . TYR A  1 144 ? 15.546  -28.572 -66.820 1.00 36.89  ? 144 TYR A CE1   1 
ATOM   1095  C CE2   . TYR A  1 144 ? 15.977  -30.923 -66.821 1.00 37.15  ? 144 TYR A CE2   1 
ATOM   1096  C CZ    . TYR A  1 144 ? 15.878  -29.726 -67.504 1.00 41.13  ? 144 TYR A CZ    1 
ATOM   1097  O OH    . TYR A  1 144 ? 16.059  -29.658 -68.865 1.00 39.57  ? 144 TYR A OH    1 
ATOM   1098  N N     . PRO A  1 145 ? 12.678  -31.769 -64.661 1.00 33.48  ? 145 PRO A N     1 
ATOM   1099  C CA    . PRO A  1 145 ? 12.230  -30.833 -65.704 1.00 33.80  ? 145 PRO A CA    1 
ATOM   1100  C C     . PRO A  1 145 ? 10.946  -30.068 -65.351 1.00 37.74  ? 145 PRO A C     1 
ATOM   1101  O O     . PRO A  1 145 ? 10.410  -30.227 -64.276 1.00 35.67  ? 145 PRO A O     1 
ATOM   1102  C CB    . PRO A  1 145 ? 12.117  -31.752 -66.935 1.00 34.92  ? 145 PRO A CB    1 
ATOM   1103  C CG    . PRO A  1 145 ? 11.672  -33.039 -66.367 1.00 39.08  ? 145 PRO A CG    1 
ATOM   1104  C CD    . PRO A  1 145 ? 12.429  -33.169 -65.066 1.00 35.45  ? 145 PRO A CD    1 
ATOM   1105  N N     . ARG A  1 146 ? 10.491  -29.203 -66.253 1.00 36.79  ? 146 ARG A N     1 
ATOM   1106  C CA    . ARG A  1 146 ? 9.338   -28.328 -66.035 1.00 38.05  ? 146 ARG A CA    1 
ATOM   1107  C C     . ARG A  1 146 ? 8.006   -29.030 -65.762 1.00 39.11  ? 146 ARG A C     1 
ATOM   1108  O O     . ARG A  1 146 ? 7.205   -28.516 -64.971 1.00 36.01  ? 146 ARG A O     1 
ATOM   1109  C CB    . ARG A  1 146 ? 9.151   -27.347 -67.223 1.00 38.22  ? 146 ARG A CB    1 
ATOM   1110  C CG    . ARG A  1 146 ? 8.343   -26.099 -66.882 1.00 45.74  ? 146 ARG A CG    1 
ATOM   1111  C CD    . ARG A  1 146 ? 8.415   -25.097 -68.027 1.00 57.19  ? 146 ARG A CD    1 
ATOM   1112  N NE    . ARG A  1 146 ? 7.796   -23.791 -67.738 1.00 64.82  ? 146 ARG A NE    1 
ATOM   1113  C CZ    . ARG A  1 146 ? 6.514   -23.462 -67.893 1.00 73.64  ? 146 ARG A CZ    1 
ATOM   1114  N NH1   . ARG A  1 146 ? 5.624   -24.370 -68.282 1.00 59.93  ? 146 ARG A NH1   1 
ATOM   1115  N NH2   . ARG A  1 146 ? 6.103   -22.227 -67.624 1.00 77.67  ? 146 ARG A NH2   1 
ATOM   1116  N N     . GLU A  1 147 ? 7.765   -30.157 -66.450 1.00 35.37  ? 147 GLU A N     1 
ATOM   1117  C CA    . GLU A  1 147 ? 6.514   -30.886 -66.368 1.00 34.79  ? 147 GLU A CA    1 
ATOM   1118  C C     . GLU A  1 147 ? 6.206   -31.329 -64.919 1.00 41.33  ? 147 GLU A C     1 
ATOM   1119  O O     . GLU A  1 147 ? 6.996   -31.997 -64.282 1.00 42.25  ? 147 GLU A O     1 
ATOM   1120  C CB    . GLU A  1 147 ? 6.523   -32.103 -67.315 1.00 35.83  ? 147 GLU A CB    1 
ATOM   1121  N N     . ALA A  1 148 ? 5.094   -30.907 -64.398 1.00 39.24  ? 148 ALA A N     1 
ATOM   1122  C CA    . ALA A  1 148 ? 4.659   -31.264 -63.067 1.00 38.44  ? 148 ALA A CA    1 
ATOM   1123  C C     . ALA A  1 148 ? 3.158   -31.157 -63.066 1.00 43.36  ? 148 ALA A C     1 
ATOM   1124  O O     . ALA A  1 148 ? 2.607   -30.327 -63.786 1.00 43.03  ? 148 ALA A O     1 
ATOM   1125  C CB    . ALA A  1 148 ? 5.269   -30.315 -62.037 1.00 38.25  ? 148 ALA A CB    1 
ATOM   1126  N N     . LYS A  1 149 ? 2.492   -32.014 -62.287 1.00 39.48  ? 149 LYS A N     1 
ATOM   1127  C CA    . LYS A  1 149 ? 1.049   -31.993 -62.169 1.00 37.39  ? 149 LYS A CA    1 
ATOM   1128  C C     . LYS A  1 149 ? 0.715   -31.833 -60.713 1.00 39.36  ? 149 LYS A C     1 
ATOM   1129  O O     . LYS A  1 149 ? 1.338   -32.462 -59.854 1.00 36.51  ? 149 LYS A O     1 
ATOM   1130  C CB    . LYS A  1 149 ? 0.427   -33.284 -62.705 1.00 38.95  ? 149 LYS A CB    1 
ATOM   1131  C CG    . LYS A  1 149 ? -1.102  -33.257 -62.793 1.00 56.97  ? 149 LYS A CG    1 
ATOM   1132  C CD    . LYS A  1 149 ? -1.681  -34.518 -63.480 1.00 70.86  ? 149 LYS A CD    1 
ATOM   1133  C CE    . LYS A  1 149 ? -1.765  -35.729 -62.571 1.00 81.77  ? 149 LYS A CE    1 
ATOM   1134  N NZ    . LYS A  1 149 ? -2.313  -36.935 -63.267 1.00 95.04  ? 149 LYS A NZ    1 
ATOM   1135  N N     . VAL A  1 150 ? -0.271  -30.993 -60.446 1.00 37.55  ? 150 VAL A N     1 
ATOM   1136  C CA    . VAL A  1 150 ? -0.867  -30.778 -59.133 1.00 37.46  ? 150 VAL A CA    1 
ATOM   1137  C C     . VAL A  1 150 ? -2.315  -31.197 -59.232 1.00 40.49  ? 150 VAL A C     1 
ATOM   1138  O O     . VAL A  1 150 ? -3.027  -30.817 -60.178 1.00 38.47  ? 150 VAL A O     1 
ATOM   1139  C CB    . VAL A  1 150 ? -0.809  -29.313 -58.664 1.00 39.47  ? 150 VAL A CB    1 
ATOM   1140  C CG1   . VAL A  1 150 ? -1.411  -29.152 -57.277 1.00 39.22  ? 150 VAL A CG1   1 
ATOM   1141  C CG2   . VAL A  1 150 ? 0.600   -28.831 -58.652 1.00 39.48  ? 150 VAL A CG2   1 
ATOM   1142  N N     . GLN A  1 151 ? -2.759  -31.937 -58.231 1.00 37.80  ? 151 GLN A N     1 
ATOM   1143  C CA    . GLN A  1 151 ? -4.172  -32.287 -58.070 1.00 37.20  ? 151 GLN A CA    1 
ATOM   1144  C C     . GLN A  1 151 ? -4.616  -31.863 -56.696 1.00 38.16  ? 151 GLN A C     1 
ATOM   1145  O O     . GLN A  1 151 ? -3.913  -32.103 -55.724 1.00 36.30  ? 151 GLN A O     1 
ATOM   1146  C CB    . GLN A  1 151 ? -4.388  -33.760 -58.262 1.00 38.50  ? 151 GLN A CB    1 
ATOM   1147  C CG    . GLN A  1 151 ? -4.292  -34.146 -59.707 1.00 46.94  ? 151 GLN A CG    1 
ATOM   1148  C CD    . GLN A  1 151 ? -4.519  -35.628 -59.838 1.00 61.94  ? 151 GLN A CD    1 
ATOM   1149  O OE1   . GLN A  1 151 ? -5.532  -36.049 -60.412 1.00 55.35  ? 151 GLN A OE1   1 
ATOM   1150  N NE2   . GLN A  1 151 ? -3.582  -36.442 -59.287 1.00 44.12  ? 151 GLN A NE2   1 
ATOM   1151  N N     . TRP A  1 152 ? -5.763  -31.175 -56.625 1.00 36.35  ? 152 TRP A N     1 
ATOM   1152  C CA    . TRP A  1 152 ? -6.354  -30.705 -55.379 1.00 35.02  ? 152 TRP A CA    1 
ATOM   1153  C C     . TRP A  1 152 ? -7.475  -31.651 -54.987 1.00 36.94  ? 152 TRP A C     1 
ATOM   1154  O O     . TRP A  1 152 ? -8.303  -32.024 -55.823 1.00 34.21  ? 152 TRP A O     1 
ATOM   1155  C CB    . TRP A  1 152 ? -6.892  -29.268 -55.535 1.00 34.24  ? 152 TRP A CB    1 
ATOM   1156  C CG    . TRP A  1 152 ? -5.835  -28.210 -55.481 1.00 34.82  ? 152 TRP A CG    1 
ATOM   1157  C CD1   . TRP A  1 152 ? -5.324  -27.508 -56.528 1.00 36.13  ? 152 TRP A CD1   1 
ATOM   1158  C CD2   . TRP A  1 152 ? -5.163  -27.725 -54.309 1.00 35.72  ? 152 TRP A CD2   1 
ATOM   1159  N NE1   . TRP A  1 152 ? -4.423  -26.574 -56.077 1.00 34.17  ? 152 TRP A NE1   1 
ATOM   1160  C CE2   . TRP A  1 152 ? -4.279  -26.706 -54.725 1.00 37.14  ? 152 TRP A CE2   1 
ATOM   1161  C CE3   . TRP A  1 152 ? -5.230  -28.043 -52.940 1.00 38.04  ? 152 TRP A CE3   1 
ATOM   1162  C CZ2   . TRP A  1 152 ? -3.495  -25.983 -53.821 1.00 37.26  ? 152 TRP A CZ2   1 
ATOM   1163  C CZ3   . TRP A  1 152 ? -4.390  -27.378 -52.068 1.00 39.15  ? 152 TRP A CZ3   1 
ATOM   1164  C CH2   . TRP A  1 152 ? -3.580  -26.324 -52.503 1.00 38.73  ? 152 TRP A CH2   1 
ATOM   1165  N N     . LYS A  1 153 ? -7.508  -32.038 -53.712 1.00 36.37  ? 153 LYS A N     1 
ATOM   1166  C CA    . LYS A  1 153 ? -8.599  -32.873 -53.144 1.00 36.02  ? 153 LYS A CA    1 
ATOM   1167  C C     . LYS A  1 153 ? -9.104  -32.219 -51.890 1.00 40.85  ? 153 LYS A C     1 
ATOM   1168  O O     . LYS A  1 153 ? -8.320  -31.695 -51.097 1.00 42.69  ? 153 LYS A O     1 
ATOM   1169  C CB    . LYS A  1 153 ? -8.179  -34.346 -52.853 1.00 36.31  ? 153 LYS A CB    1 
ATOM   1170  C CG    . LYS A  1 153 ? -7.885  -35.202 -54.076 1.00 36.68  ? 153 LYS A CG    1 
ATOM   1171  C CD    . LYS A  1 153 ? -6.389  -35.303 -54.472 1.00 43.25  ? 153 LYS A CD    1 
ATOM   1172  C CE    . LYS A  1 153 ? -5.766  -36.700 -54.366 1.00 59.80  ? 153 LYS A CE    1 
ATOM   1173  N NZ    . LYS A  1 153 ? -5.560  -37.340 -55.709 1.00 71.60  ? 153 LYS A NZ    1 
ATOM   1174  N N     . VAL A  1 154 ? -10.419 -32.140 -51.764 1.00 39.10  ? 154 VAL A N     1 
ATOM   1175  C CA    . VAL A  1 154 ? -11.093 -31.539 -50.614 1.00 39.29  ? 154 VAL A CA    1 
ATOM   1176  C C     . VAL A  1 154 ? -11.965 -32.656 -50.106 1.00 45.30  ? 154 VAL A C     1 
ATOM   1177  O O     . VAL A  1 154 ? -12.897 -33.028 -50.797 1.00 44.88  ? 154 VAL A O     1 
ATOM   1178  C CB    . VAL A  1 154 ? -11.911 -30.280 -50.979 1.00 41.87  ? 154 VAL A CB    1 
ATOM   1179  C CG1   . VAL A  1 154 ? -12.718 -29.777 -49.763 1.00 43.06  ? 154 VAL A CG1   1 
ATOM   1180  C CG2   . VAL A  1 154 ? -11.009 -29.177 -51.510 1.00 41.20  ? 154 VAL A CG2   1 
ATOM   1181  N N     . ASP A  1 155 ? -11.621 -33.237 -48.944 1.00 42.65  ? 155 ASP A N     1 
ATOM   1182  C CA    . ASP A  1 155 ? -12.285 -34.401 -48.364 1.00 41.38  ? 155 ASP A CA    1 
ATOM   1183  C C     . ASP A  1 155 ? -12.346 -35.509 -49.379 1.00 41.96  ? 155 ASP A C     1 
ATOM   1184  O O     . ASP A  1 155 ? -13.402 -36.095 -49.570 1.00 42.18  ? 155 ASP A O     1 
ATOM   1185  C CB    . ASP A  1 155 ? -13.686 -34.078 -47.836 1.00 43.53  ? 155 ASP A CB    1 
ATOM   1186  C CG    . ASP A  1 155 ? -13.687 -33.403 -46.489 1.00 47.14  ? 155 ASP A CG    1 
ATOM   1187  O OD1   . ASP A  1 155 ? -12.656 -33.492 -45.778 1.00 44.39  ? 155 ASP A OD1   1 
ATOM   1188  O OD2   . ASP A  1 155 ? -14.710 -32.763 -46.150 1.00 48.28  ? 155 ASP A OD2   1 
ATOM   1189  N N     . ASN A  1 156 ? -11.229 -35.752 -50.073 1.00 37.56  ? 156 ASN A N     1 
ATOM   1190  C CA    . ASN A  1 156 ? -11.093 -36.793 -51.118 1.00 36.53  ? 156 ASN A CA    1 
ATOM   1191  C C     . ASN A  1 156 ? -11.869 -36.536 -52.416 1.00 39.19  ? 156 ASN A C     1 
ATOM   1192  O O     . ASN A  1 156 ? -11.865 -37.394 -53.291 1.00 38.50  ? 156 ASN A O     1 
ATOM   1193  C CB    . ASN A  1 156 ? -11.444 -38.188 -50.550 1.00 36.66  ? 156 ASN A CB    1 
ATOM   1194  C CG    . ASN A  1 156 ? -10.498 -38.593 -49.451 1.00 45.29  ? 156 ASN A CG    1 
ATOM   1195  O OD1   . ASN A  1 156 ? -9.267  -38.478 -49.575 1.00 38.67  ? 156 ASN A OD1   1 
ATOM   1196  N ND2   . ASN A  1 156 ? -11.021 -39.173 -48.398 1.00 38.48  ? 156 ASN A ND2   1 
ATOM   1197  N N     . ALA A  1 157 ? -12.460 -35.352 -52.597 1.00 36.52  ? 157 ALA A N     1 
ATOM   1198  C CA    . ALA A  1 157 ? -13.177 -35.016 -53.810 1.00 35.95  ? 157 ALA A CA    1 
ATOM   1199  C C     . ALA A  1 157 ? -12.237 -34.256 -54.689 1.00 39.64  ? 157 ALA A C     1 
ATOM   1200  O O     . ALA A  1 157 ? -11.712 -33.240 -54.260 1.00 40.58  ? 157 ALA A O     1 
ATOM   1201  C CB    . ALA A  1 157 ? -14.409 -34.182 -53.487 1.00 36.74  ? 157 ALA A CB    1 
ATOM   1202  N N     . LEU A  1 158 ? -11.984 -34.749 -55.911 1.00 37.44  ? 158 LEU A N     1 
ATOM   1203  C CA    . LEU A  1 158 ? -11.077 -34.103 -56.867 1.00 35.80  ? 158 LEU A CA    1 
ATOM   1204  C C     . LEU A  1 158 ? -11.662 -32.765 -57.293 1.00 40.96  ? 158 LEU A C     1 
ATOM   1205  O O     . LEU A  1 158 ? -12.829 -32.709 -57.678 1.00 41.27  ? 158 LEU A O     1 
ATOM   1206  C CB    . LEU A  1 158 ? -10.882 -34.986 -58.103 1.00 36.51  ? 158 LEU A CB    1 
ATOM   1207  C CG    . LEU A  1 158 ? -9.883  -34.504 -59.196 1.00 41.42  ? 158 LEU A CG    1 
ATOM   1208  C CD1   . LEU A  1 158 ? -8.403  -34.438 -58.671 1.00 42.88  ? 158 LEU A CD1   1 
ATOM   1209  C CD2   . LEU A  1 158 ? -9.950  -35.412 -60.418 1.00 39.93  ? 158 LEU A CD2   1 
ATOM   1210  N N     . GLN A  1 159 ? -10.840 -31.697 -57.258 1.00 36.89  ? 159 GLN A N     1 
ATOM   1211  C CA    . GLN A  1 159 ? -11.283 -30.374 -57.630 1.00 37.21  ? 159 GLN A CA    1 
ATOM   1212  C C     . GLN A  1 159 ? -10.993 -30.077 -59.076 1.00 41.56  ? 159 GLN A C     1 
ATOM   1213  O O     . GLN A  1 159 ? -9.951  -30.475 -59.559 1.00 41.69  ? 159 GLN A O     1 
ATOM   1214  C CB    . GLN A  1 159 ? -10.592 -29.303 -56.750 1.00 37.41  ? 159 GLN A CB    1 
ATOM   1215  C CG    . GLN A  1 159 ? -10.760 -29.523 -55.286 1.00 33.96  ? 159 GLN A CG    1 
ATOM   1216  C CD    . GLN A  1 159 ? -12.207 -29.431 -54.919 1.00 40.65  ? 159 GLN A CD    1 
ATOM   1217  O OE1   . GLN A  1 159 ? -12.809 -28.395 -55.089 1.00 40.26  ? 159 GLN A OE1   1 
ATOM   1218  N NE2   . GLN A  1 159 ? -12.827 -30.515 -54.502 1.00 36.68  ? 159 GLN A NE2   1 
ATOM   1219  N N     . SER A  1 160 ? -11.899 -29.359 -59.764 1.00 41.57  ? 160 SER A N     1 
ATOM   1220  C CA    . SER A  1 160 ? -11.667 -28.895 -61.141 1.00 42.97  ? 160 SER A CA    1 
ATOM   1221  C C     . SER A  1 160 ? -12.362 -27.544 -61.380 1.00 44.84  ? 160 SER A C     1 
ATOM   1222  O O     . SER A  1 160 ? -13.402 -27.267 -60.788 1.00 43.35  ? 160 SER A O     1 
ATOM   1223  C CB    . SER A  1 160 ? -12.079 -29.940 -62.174 1.00 47.50  ? 160 SER A CB    1 
ATOM   1224  O OG    . SER A  1 160 ? -13.484 -30.051 -62.257 1.00 62.40  ? 160 SER A OG    1 
ATOM   1225  N N     . GLY A  1 161 ? -11.727 -26.696 -62.178 1.00 40.82  ? 161 GLY A N     1 
ATOM   1226  C CA    . GLY A  1 161 ? -12.242 -25.365 -62.493 1.00 40.32  ? 161 GLY A CA    1 
ATOM   1227  C C     . GLY A  1 161 ? -12.043 -24.254 -61.477 1.00 42.87  ? 161 GLY A C     1 
ATOM   1228  O O     . GLY A  1 161 ? -12.494 -23.144 -61.724 1.00 46.83  ? 161 GLY A O     1 
ATOM   1229  N N     . ASN A  1 162 ? -11.355 -24.500 -60.369 1.00 36.91  ? 162 ASN A N     1 
ATOM   1230  C CA    . ASN A  1 162 ? -11.203 -23.542 -59.260 1.00 35.25  ? 162 ASN A CA    1 
ATOM   1231  C C     . ASN A  1 162 ? -9.764  -23.458 -58.748 1.00 38.18  ? 162 ASN A C     1 
ATOM   1232  O O     . ASN A  1 162 ? -9.520  -22.998 -57.622 1.00 38.17  ? 162 ASN A O     1 
ATOM   1233  C CB    . ASN A  1 162 ? -12.144 -23.961 -58.130 1.00 33.18  ? 162 ASN A CB    1 
ATOM   1234  C CG    . ASN A  1 162 ? -11.910 -25.375 -57.613 1.00 42.63  ? 162 ASN A CG    1 
ATOM   1235  O OD1   . ASN A  1 162 ? -11.115 -26.128 -58.167 1.00 39.80  ? 162 ASN A OD1   1 
ATOM   1236  N ND2   . ASN A  1 162 ? -12.699 -25.818 -56.647 1.00 35.66  ? 162 ASN A ND2   1 
ATOM   1237  N N     . SER A  1 163 ? -8.812  -23.765 -59.637 1.00 32.60  ? 163 SER A N     1 
ATOM   1238  C CA    . SER A  1 163 ? -7.382  -23.797 -59.370 1.00 31.58  ? 163 SER A CA    1 
ATOM   1239  C C     . SER A  1 163 ? -6.688  -22.954 -60.480 1.00 36.31  ? 163 SER A C     1 
ATOM   1240  O O     . SER A  1 163 ? -7.205  -22.846 -61.595 1.00 36.31  ? 163 SER A O     1 
ATOM   1241  C CB    . SER A  1 163 ? -6.891  -25.257 -59.426 1.00 35.87  ? 163 SER A CB    1 
ATOM   1242  O OG    . SER A  1 163 ? -5.503  -25.382 -59.243 1.00 61.15  ? 163 SER A OG    1 
ATOM   1243  N N     . GLN A  1 164 ? -5.565  -22.316 -60.145 1.00 31.72  ? 164 GLN A N     1 
ATOM   1244  C CA    . GLN A  1 164 ? -4.710  -21.612 -61.103 1.00 30.70  ? 164 GLN A CA    1 
ATOM   1245  C C     . GLN A  1 164 ? -3.270  -21.858 -60.677 1.00 32.36  ? 164 GLN A C     1 
ATOM   1246  O O     . GLN A  1 164 ? -3.013  -21.978 -59.479 1.00 31.72  ? 164 GLN A O     1 
ATOM   1247  C CB    . GLN A  1 164 ? -4.978  -20.116 -61.168 1.00 32.40  ? 164 GLN A CB    1 
ATOM   1248  C CG    . GLN A  1 164 ? -6.337  -19.738 -61.658 1.00 40.16  ? 164 GLN A CG    1 
ATOM   1249  C CD    . GLN A  1 164 ? -6.384  -18.269 -62.016 1.00 47.79  ? 164 GLN A CD    1 
ATOM   1250  O OE1   . GLN A  1 164 ? -6.144  -17.388 -61.187 1.00 45.90  ? 164 GLN A OE1   1 
ATOM   1251  N NE2   . GLN A  1 164 ? -6.791  -17.968 -63.220 1.00 35.22  ? 164 GLN A NE2   1 
ATOM   1252  N N     . GLU A  1 165 ? -2.356  -21.957 -61.642 1.00 31.06  ? 165 GLU A N     1 
ATOM   1253  C CA    . GLU A  1 165 ? -0.912  -22.181 -61.422 1.00 31.67  ? 165 GLU A CA    1 
ATOM   1254  C C     . GLU A  1 165 ? -0.082  -21.125 -62.085 1.00 33.82  ? 165 GLU A C     1 
ATOM   1255  O O     . GLU A  1 165 ? -0.410  -20.792 -63.217 1.00 32.21  ? 165 GLU A O     1 
ATOM   1256  C CB    . GLU A  1 165 ? -0.396  -23.434 -62.149 1.00 32.29  ? 165 GLU A CB    1 
ATOM   1257  C CG    . GLU A  1 165 ? -0.921  -24.713 -61.669 1.00 49.48  ? 165 GLU A CG    1 
ATOM   1258  C CD    . GLU A  1 165 ? -0.235  -25.908 -62.283 1.00 55.60  ? 165 GLU A CD    1 
ATOM   1259  O OE1   . GLU A  1 165 ? -0.322  -26.990 -61.667 1.00 70.36  ? 165 GLU A OE1   1 
ATOM   1260  O OE2   . GLU A  1 165 ? 0.400   -25.772 -63.357 1.00 47.06  ? 165 GLU A OE2   1 
ATOM   1261  N N     . SER A  1 166 ? 1.141   -20.891 -61.535 1.00 30.23  ? 166 SER A N     1 
ATOM   1262  C CA    . SER A  1 166 ? 2.213   -20.063 -62.106 1.00 30.85  ? 166 SER A CA    1 
ATOM   1263  C C     . SER A  1 166 ? 3.534   -20.811 -61.948 1.00 33.19  ? 166 SER A C     1 
ATOM   1264  O O     . SER A  1 166 ? 3.803   -21.342 -60.904 1.00 32.24  ? 166 SER A O     1 
ATOM   1265  C CB    . SER A  1 166 ? 2.287   -18.673 -61.443 1.00 30.77  ? 166 SER A CB    1 
ATOM   1266  O OG    . SER A  1 166 ? 3.360   -17.959 -61.994 0.60 31.86  ? 166 SER A OG    1 
ATOM   1267  N N     . VAL A  1 167 ? 4.331   -20.828 -62.980 1.00 32.78  ? 167 VAL A N     1 
ATOM   1268  C CA    . VAL A  1 167 ? 5.650   -21.449 -63.038 1.00 33.10  ? 167 VAL A CA    1 
ATOM   1269  C C     . VAL A  1 167 ? 6.699   -20.356 -63.199 1.00 35.98  ? 167 VAL A C     1 
ATOM   1270  O O     . VAL A  1 167 ? 6.571   -19.510 -64.075 1.00 33.97  ? 167 VAL A O     1 
ATOM   1271  C CB    . VAL A  1 167 ? 5.746   -22.473 -64.206 1.00 36.25  ? 167 VAL A CB    1 
ATOM   1272  C CG1   . VAL A  1 167 ? 6.985   -23.327 -64.065 1.00 36.75  ? 167 VAL A CG1   1 
ATOM   1273  C CG2   . VAL A  1 167 ? 4.507   -23.368 -64.241 1.00 36.81  ? 167 VAL A CG2   1 
ATOM   1274  N N     . THR A  1 168 ? 7.776   -20.417 -62.416 1.00 33.27  ? 168 THR A N     1 
ATOM   1275  C CA    . THR A  1 168 ? 8.834   -19.445 -62.558 1.00 33.84  ? 168 THR A CA    1 
ATOM   1276  C C     . THR A  1 168 ? 9.617   -19.733 -63.847 1.00 38.19  ? 168 THR A C     1 
ATOM   1277  O O     . THR A  1 168 ? 9.586   -20.845 -64.398 1.00 38.66  ? 168 THR A O     1 
ATOM   1278  C CB    . THR A  1 168 ? 9.815   -19.483 -61.346 1.00 39.11  ? 168 THR A CB    1 
ATOM   1279  O OG1   . THR A  1 168 ? 10.357  -20.791 -61.212 1.00 45.67  ? 168 THR A OG1   1 
ATOM   1280  C CG2   . THR A  1 168 ? 9.169   -19.087 -60.057 1.00 40.53  ? 168 THR A CG2   1 
ATOM   1281  N N     . GLU A  1 169 ? 10.370  -18.752 -64.295 1.00 37.88  ? 169 GLU A N     1 
ATOM   1282  C CA    . GLU A  1 169 ? 11.284  -18.956 -65.424 1.00 39.00  ? 169 GLU A CA    1 
ATOM   1283  C C     . GLU A  1 169 ? 12.464  -19.745 -64.818 1.00 40.63  ? 169 GLU A C     1 
ATOM   1284  O O     . GLU A  1 169 ? 12.691  -19.710 -63.602 1.00 38.99  ? 169 GLU A O     1 
ATOM   1285  C CB    . GLU A  1 169 ? 11.754  -17.607 -66.055 1.00 40.72  ? 169 GLU A CB    1 
ATOM   1286  C CG    . GLU A  1 169 ? 10.657  -16.857 -66.811 1.00 54.35  ? 169 GLU A CG    1 
ATOM   1287  C CD    . GLU A  1 169 ? 10.423  -17.170 -68.286 1.00 77.27  ? 169 GLU A CD    1 
ATOM   1288  O OE1   . GLU A  1 169 ? 9.863   -16.283 -68.974 1.00 89.32  ? 169 GLU A OE1   1 
ATOM   1289  O OE2   . GLU A  1 169 ? 10.725  -18.299 -68.744 1.00 59.46  ? 169 GLU A OE2   1 
ATOM   1290  N N     . GLN A  1 170 ? 13.170  -20.465 -65.651 1.00 37.40  ? 170 GLN A N     1 
ATOM   1291  C CA    . GLN A  1 170 ? 14.312  -21.251 -65.202 1.00 39.91  ? 170 GLN A CA    1 
ATOM   1292  C C     . GLN A  1 170 ? 15.301  -20.419 -64.399 1.00 44.61  ? 170 GLN A C     1 
ATOM   1293  O O     . GLN A  1 170 ? 15.607  -19.310 -64.787 1.00 45.78  ? 170 GLN A O     1 
ATOM   1294  C CB    . GLN A  1 170 ? 14.984  -21.891 -66.403 1.00 41.24  ? 170 GLN A CB    1 
ATOM   1295  C CG    . GLN A  1 170 ? 16.138  -22.757 -66.064 1.00 49.20  ? 170 GLN A CG    1 
ATOM   1296  C CD    . GLN A  1 170 ? 16.455  -23.704 -67.208 1.00 53.75  ? 170 GLN A CD    1 
ATOM   1297  O OE1   . GLN A  1 170 ? 16.388  -23.344 -68.388 1.00 46.50  ? 170 GLN A OE1   1 
ATOM   1298  N NE2   . GLN A  1 170 ? 16.723  -24.949 -66.895 1.00 41.77  ? 170 GLN A NE2   1 
ATOM   1299  N N     . ASP A  1 171 ? 15.743  -20.933 -63.254 1.00 38.81  ? 171 ASP A N     1 
ATOM   1300  C CA    . ASP A  1 171 ? 16.657  -20.225 -62.378 1.00 37.81  ? 171 ASP A CA    1 
ATOM   1301  C C     . ASP A  1 171 ? 18.035  -20.064 -63.024 1.00 45.39  ? 171 ASP A C     1 
ATOM   1302  O O     . ASP A  1 171 ? 18.556  -21.023 -63.601 1.00 45.62  ? 171 ASP A O     1 
ATOM   1303  C CB    . ASP A  1 171 ? 16.781  -20.989 -61.059 1.00 39.00  ? 171 ASP A CB    1 
ATOM   1304  C CG    . ASP A  1 171 ? 17.578  -20.270 -60.010 1.00 45.92  ? 171 ASP A CG    1 
ATOM   1305  O OD1   . ASP A  1 171 ? 17.001  -19.404 -59.332 1.00 50.64  ? 171 ASP A OD1   1 
ATOM   1306  O OD2   . ASP A  1 171 ? 18.788  -20.572 -59.865 1.00 48.83  ? 171 ASP A OD2   1 
ATOM   1307  N N     . SER A  1 172 ? 18.642  -18.865 -62.896 1.00 42.80  ? 172 SER A N     1 
ATOM   1308  C CA    . SER A  1 172 ? 19.928  -18.563 -63.530 1.00 42.63  ? 172 SER A CA    1 
ATOM   1309  C C     . SER A  1 172 ? 21.117  -19.252 -62.909 1.00 45.76  ? 172 SER A C     1 
ATOM   1310  O O     . SER A  1 172 ? 22.132  -19.349 -63.589 1.00 46.90  ? 172 SER A O     1 
ATOM   1311  C CB    . SER A  1 172 ? 20.176  -17.059 -63.581 1.00 46.83  ? 172 SER A CB    1 
ATOM   1312  O OG    . SER A  1 172 ? 20.497  -16.536 -62.301 1.00 59.80  ? 172 SER A OG    1 
ATOM   1313  N N     . LYS A  1 173 ? 21.022  -19.727 -61.660 1.00 41.59  ? 173 LYS A N     1 
ATOM   1314  C CA    . LYS A  1 173 ? 22.135  -20.439 -61.021 1.00 43.27  ? 173 LYS A CA    1 
ATOM   1315  C C     . LYS A  1 173 ? 21.939  -21.960 -61.034 1.00 44.42  ? 173 LYS A C     1 
ATOM   1316  O O     . LYS A  1 173 ? 22.818  -22.667 -61.514 1.00 44.14  ? 173 LYS A O     1 
ATOM   1317  C CB    . LYS A  1 173 ? 22.364  -19.961 -59.562 1.00 47.61  ? 173 LYS A CB    1 
ATOM   1318  C CG    . LYS A  1 173 ? 22.432  -18.441 -59.422 1.00 68.80  ? 173 LYS A CG    1 
ATOM   1319  C CD    . LYS A  1 173 ? 22.811  -18.005 -58.016 1.00 81.69  ? 173 LYS A CD    1 
ATOM   1320  C CE    . LYS A  1 173 ? 22.932  -16.498 -57.893 1.00 86.16  ? 173 LYS A CE    1 
ATOM   1321  N NZ    . LYS A  1 173 ? 23.520  -16.085 -56.576 1.00 91.58  ? 173 LYS A NZ    1 
ATOM   1322  N N     . ASP A  1 174 ? 20.815  -22.473 -60.505 1.00 40.49  ? 174 ASP A N     1 
ATOM   1323  C CA    . ASP A  1 174 ? 20.612  -23.935 -60.414 1.00 40.23  ? 174 ASP A CA    1 
ATOM   1324  C C     . ASP A  1 174 ? 19.819  -24.551 -61.562 1.00 42.54  ? 174 ASP A C     1 
ATOM   1325  O O     . ASP A  1 174 ? 19.790  -25.772 -61.629 1.00 41.99  ? 174 ASP A O     1 
ATOM   1326  C CB    . ASP A  1 174 ? 20.019  -24.378 -59.068 1.00 42.15  ? 174 ASP A CB    1 
ATOM   1327  C CG    . ASP A  1 174 ? 18.660  -23.844 -58.709 1.00 51.19  ? 174 ASP A CG    1 
ATOM   1328  O OD1   . ASP A  1 174 ? 17.863  -23.591 -59.634 1.00 47.39  ? 174 ASP A OD1   1 
ATOM   1329  O OD2   . ASP A  1 174 ? 18.364  -23.744 -57.486 1.00 60.29  ? 174 ASP A OD2   1 
ATOM   1330  N N     . SER A  1 175 ? 19.206  -23.745 -62.453 1.00 36.73  ? 175 SER A N     1 
ATOM   1331  C CA    . SER A  1 175 ? 18.449  -24.226 -63.624 1.00 34.95  ? 175 SER A CA    1 
ATOM   1332  C C     . SER A  1 175 ? 17.135  -24.963 -63.282 1.00 38.01  ? 175 SER A C     1 
ATOM   1333  O O     . SER A  1 175 ? 16.536  -25.569 -64.169 1.00 35.28  ? 175 SER A O     1 
ATOM   1334  C CB    . SER A  1 175 ? 19.325  -25.090 -64.541 1.00 38.94  ? 175 SER A CB    1 
ATOM   1335  O OG    . SER A  1 175 ? 20.603  -24.534 -64.772 1.00 40.95  ? 175 SER A OG    1 
ATOM   1336  N N     . THR A  1 176 ? 16.611  -24.786 -62.063 1.00 37.82  ? 176 THR A N     1 
ATOM   1337  C CA    . THR A  1 176 ? 15.351  -25.397 -61.662 1.00 37.02  ? 176 THR A CA    1 
ATOM   1338  C C     . THR A  1 176 ? 14.161  -24.490 -61.943 1.00 39.32  ? 176 THR A C     1 
ATOM   1339  O O     . THR A  1 176 ? 14.318  -23.334 -62.318 1.00 38.74  ? 176 THR A O     1 
ATOM   1340  C CB    . THR A  1 176 ? 15.357  -25.725 -60.176 1.00 39.08  ? 176 THR A CB    1 
ATOM   1341  O OG1   . THR A  1 176 ? 15.380  -24.515 -59.434 1.00 35.39  ? 176 THR A OG1   1 
ATOM   1342  C CG2   . THR A  1 176 ? 16.462  -26.630 -59.783 1.00 34.65  ? 176 THR A CG2   1 
ATOM   1343  N N     . TYR A  1 177 ? 12.959  -25.050 -61.760 1.00 37.33  ? 177 TYR A N     1 
ATOM   1344  C CA    . TYR A  1 177 ? 11.692  -24.340 -61.822 1.00 36.27  ? 177 TYR A CA    1 
ATOM   1345  C C     . TYR A  1 177 ? 11.032  -24.498 -60.466 1.00 36.13  ? 177 TYR A C     1 
ATOM   1346  O O     . TYR A  1 177 ? 11.377  -25.395 -59.694 1.00 34.35  ? 177 TYR A O     1 
ATOM   1347  C CB    . TYR A  1 177 ? 10.741  -24.945 -62.864 1.00 37.47  ? 177 TYR A CB    1 
ATOM   1348  C CG    . TYR A  1 177 ? 11.296  -24.979 -64.250 1.00 38.15  ? 177 TYR A CG    1 
ATOM   1349  C CD1   . TYR A  1 177 ? 11.204  -23.874 -65.080 1.00 39.96  ? 177 TYR A CD1   1 
ATOM   1350  C CD2   . TYR A  1 177 ? 12.013  -26.082 -64.706 1.00 38.70  ? 177 TYR A CD2   1 
ATOM   1351  C CE1   . TYR A  1 177 ? 11.744  -23.887 -66.367 1.00 41.49  ? 177 TYR A CE1   1 
ATOM   1352  C CE2   . TYR A  1 177 ? 12.644  -26.068 -65.948 1.00 39.61  ? 177 TYR A CE2   1 
ATOM   1353  C CZ    . TYR A  1 177 ? 12.466  -24.987 -66.797 1.00 46.75  ? 177 TYR A CZ    1 
ATOM   1354  O OH    . TYR A  1 177 ? 12.998  -24.972 -68.056 1.00 50.06  ? 177 TYR A OH    1 
ATOM   1355  N N     . SER A  1 178 ? 10.053  -23.633 -60.218 1.00 33.29  ? 178 SER A N     1 
ATOM   1356  C CA    . SER A  1 178 ? 9.187   -23.655 -59.050 1.00 32.60  ? 178 SER A CA    1 
ATOM   1357  C C     . SER A  1 178 ? 7.797   -23.335 -59.544 1.00 36.82  ? 178 SER A C     1 
ATOM   1358  O O     . SER A  1 178 ? 7.639   -22.734 -60.616 1.00 34.41  ? 178 SER A O     1 
ATOM   1359  C CB    . SER A  1 178 ? 9.678   -22.726 -57.954 1.00 31.46  ? 178 SER A CB    1 
ATOM   1360  O OG    . SER A  1 178 ? 10.958  -23.145 -57.516 1.00 41.58  ? 178 SER A OG    1 
ATOM   1361  N N     . LEU A  1 179 ? 6.781   -23.873 -58.845 1.00 34.64  ? 179 LEU A N     1 
ATOM   1362  C CA    . LEU A  1 179 ? 5.395   -23.757 -59.275 1.00 33.29  ? 179 LEU A CA    1 
ATOM   1363  C C     . LEU A  1 179 ? 4.547   -23.494 -58.067 1.00 35.93  ? 179 LEU A C     1 
ATOM   1364  O O     . LEU A  1 179 ? 4.725   -24.160 -57.047 1.00 34.77  ? 179 LEU A O     1 
ATOM   1365  C CB    . LEU A  1 179 ? 4.973   -25.072 -59.992 1.00 33.24  ? 179 LEU A CB    1 
ATOM   1366  C CG    . LEU A  1 179 ? 3.594   -25.145 -60.595 1.00 36.80  ? 179 LEU A CG    1 
ATOM   1367  C CD1   . LEU A  1 179 ? 3.582   -26.135 -61.732 1.00 37.00  ? 179 LEU A CD1   1 
ATOM   1368  C CD2   . LEU A  1 179 ? 2.495   -25.528 -59.541 1.00 39.40  ? 179 LEU A CD2   1 
ATOM   1369  N N     . SER A  1 180 ? 3.607   -22.532 -58.186 1.00 32.20  ? 180 SER A N     1 
ATOM   1370  C CA    . SER A  1 180 ? 2.662   -22.226 -57.122 1.00 32.64  ? 180 SER A CA    1 
ATOM   1371  C C     . SER A  1 180 ? 1.258   -22.459 -57.683 1.00 37.78  ? 180 SER A C     1 
ATOM   1372  O O     . SER A  1 180 ? 0.944   -21.925 -58.730 1.00 36.62  ? 180 SER A O     1 
ATOM   1373  C CB    . SER A  1 180 ? 2.790   -20.782 -56.631 1.00 35.62  ? 180 SER A CB    1 
ATOM   1374  O OG    . SER A  1 180 ? 2.372   -20.716 -55.273 1.00 52.03  ? 180 SER A OG    1 
ATOM   1375  N N     . SER A  1 181 ? 0.431   -23.262 -57.003 1.00 35.55  ? 181 SER A N     1 
ATOM   1376  C CA    . SER A  1 181 ? -0.942  -23.528 -57.415 1.00 34.58  ? 181 SER A CA    1 
ATOM   1377  C C     . SER A  1 181 ? -1.851  -22.977 -56.321 1.00 38.43  ? 181 SER A C     1 
ATOM   1378  O O     . SER A  1 181 ? -1.534  -23.123 -55.150 1.00 38.97  ? 181 SER A O     1 
ATOM   1379  C CB    . SER A  1 181 ? -1.183  -25.022 -57.579 1.00 34.71  ? 181 SER A CB    1 
ATOM   1380  O OG    . SER A  1 181 ? -2.562  -25.258 -57.821 1.00 37.93  ? 181 SER A OG    1 
ATOM   1381  N N     . THR A  1 182 ? -2.956  -22.341 -56.689 1.00 34.71  ? 182 THR A N     1 
ATOM   1382  C CA    . THR A  1 182 ? -3.891  -21.796 -55.708 1.00 35.42  ? 182 THR A CA    1 
ATOM   1383  C C     . THR A  1 182 ? -5.238  -22.375 -55.951 1.00 37.10  ? 182 THR A C     1 
ATOM   1384  O O     . THR A  1 182 ? -5.739  -22.213 -57.046 1.00 36.65  ? 182 THR A O     1 
ATOM   1385  C CB    . THR A  1 182 ? -3.964  -20.239 -55.819 1.00 40.75  ? 182 THR A CB    1 
ATOM   1386  O OG1   . THR A  1 182 ? -2.675  -19.706 -55.594 1.00 41.27  ? 182 THR A OG1   1 
ATOM   1387  C CG2   . THR A  1 182 ? -4.903  -19.600 -54.807 1.00 33.41  ? 182 THR A CG2   1 
ATOM   1388  N N     . LEU A  1 183 ? -5.846  -22.986 -54.936 1.00 34.53  ? 183 LEU A N     1 
ATOM   1389  C CA    . LEU A  1 183 ? -7.225  -23.474 -54.966 1.00 34.99  ? 183 LEU A CA    1 
ATOM   1390  C C     . LEU A  1 183 ? -8.085  -22.362 -54.377 1.00 41.20  ? 183 LEU A C     1 
ATOM   1391  O O     . LEU A  1 183 ? -7.841  -21.941 -53.226 1.00 41.10  ? 183 LEU A O     1 
ATOM   1392  C CB    . LEU A  1 183 ? -7.392  -24.746 -54.105 1.00 34.59  ? 183 LEU A CB    1 
ATOM   1393  C CG    . LEU A  1 183 ? -8.783  -25.344 -54.002 1.00 37.90  ? 183 LEU A CG    1 
ATOM   1394  C CD1   . LEU A  1 183 ? -9.272  -25.832 -55.323 1.00 36.08  ? 183 LEU A CD1   1 
ATOM   1395  C CD2   . LEU A  1 183 ? -8.807  -26.464 -52.994 1.00 41.95  ? 183 LEU A CD2   1 
ATOM   1396  N N     . THR A  1 184 ? -9.082  -21.870 -55.140 1.00 37.69  ? 184 THR A N     1 
ATOM   1397  C CA    . THR A  1 184 ? -9.921  -20.796 -54.609 1.00 38.85  ? 184 THR A CA    1 
ATOM   1398  C C     . THR A  1 184 ? -11.327 -21.275 -54.335 1.00 43.72  ? 184 THR A C     1 
ATOM   1399  O O     . THR A  1 184 ? -11.990 -21.771 -55.229 1.00 43.11  ? 184 THR A O     1 
ATOM   1400  C CB    . THR A  1 184 ? -9.895  -19.545 -55.481 1.00 46.87  ? 184 THR A CB    1 
ATOM   1401  O OG1   . THR A  1 184 ? -8.549  -19.185 -55.689 1.00 47.53  ? 184 THR A OG1   1 
ATOM   1402  C CG2   . THR A  1 184 ? -10.587 -18.352 -54.808 1.00 49.44  ? 184 THR A CG2   1 
ATOM   1403  N N     . LEU A  1 185 ? -11.788 -21.065 -53.102 1.00 41.45  ? 185 LEU A N     1 
ATOM   1404  C CA    . LEU A  1 185 ? -13.100 -21.473 -52.661 1.00 44.03  ? 185 LEU A CA    1 
ATOM   1405  C C     . LEU A  1 185 ? -13.833 -20.346 -51.978 1.00 48.39  ? 185 LEU A C     1 
ATOM   1406  O O     . LEU A  1 185 ? -13.225 -19.427 -51.439 1.00 48.26  ? 185 LEU A O     1 
ATOM   1407  C CB    . LEU A  1 185 ? -12.938 -22.609 -51.635 1.00 45.21  ? 185 LEU A CB    1 
ATOM   1408  C CG    . LEU A  1 185 ? -12.064 -23.808 -52.021 1.00 48.99  ? 185 LEU A CG    1 
ATOM   1409  C CD1   . LEU A  1 185 ? -11.932 -24.756 -50.863 1.00 49.43  ? 185 LEU A CD1   1 
ATOM   1410  C CD2   . LEU A  1 185 ? -12.663 -24.561 -53.177 1.00 51.22  ? 185 LEU A CD2   1 
ATOM   1411  N N     . SER A  1 186 ? -15.141 -20.456 -51.889 1.00 46.67  ? 186 SER A N     1 
ATOM   1412  C CA    . SER A  1 186 ? -15.886 -19.500 -51.041 1.00 46.50  ? 186 SER A CA    1 
ATOM   1413  C C     . SER A  1 186 ? -15.599 -19.953 -49.601 1.00 50.06  ? 186 SER A C     1 
ATOM   1414  O O     . SER A  1 186 ? -15.331 -21.148 -49.372 1.00 48.27  ? 186 SER A O     1 
ATOM   1415  C CB    . SER A  1 186 ? -17.384 -19.587 -51.301 1.00 47.39  ? 186 SER A CB    1 
ATOM   1416  O OG    . SER A  1 186 ? -17.858 -20.902 -51.068 1.00 47.78  ? 186 SER A OG    1 
ATOM   1417  N N     . LYS A  1 187 ? -15.597 -19.009 -48.659 1.00 47.29  ? 187 LYS A N     1 
ATOM   1418  C CA    . LYS A  1 187 ? -15.407 -19.312 -47.230 1.00 48.49  ? 187 LYS A CA    1 
ATOM   1419  C C     . LYS A  1 187 ? -16.427 -20.366 -46.770 1.00 52.54  ? 187 LYS A C     1 
ATOM   1420  O O     . LYS A  1 187 ? -16.072 -21.251 -45.995 1.00 51.06  ? 187 LYS A O     1 
ATOM   1421  C CB    . LYS A  1 187 ? -15.556 -18.036 -46.372 1.00 51.45  ? 187 LYS A CB    1 
ATOM   1422  C CG    . LYS A  1 187 ? -15.485 -18.280 -44.854 1.00 54.83  ? 187 LYS A CG    1 
ATOM   1423  C CD    . LYS A  1 187 ? -15.965 -17.127 -44.040 1.00 60.72  ? 187 LYS A CD    1 
ATOM   1424  C CE    . LYS A  1 187 ? -15.857 -17.371 -42.547 1.00 77.45  ? 187 LYS A CE    1 
ATOM   1425  N NZ    . LYS A  1 187 ? -15.389 -16.151 -41.816 1.00 98.36  ? 187 LYS A NZ    1 
ATOM   1426  N N     . ALA A  1 188 ? -17.704 -20.231 -47.217 1.00 51.74  ? 188 ALA A N     1 
ATOM   1427  C CA    . ALA A  1 188 ? -18.796 -21.172 -46.887 1.00 52.64  ? 188 ALA A CA    1 
ATOM   1428  C C     . ALA A  1 188 ? -18.407 -22.605 -47.240 1.00 56.47  ? 188 ALA A C     1 
ATOM   1429  O O     . ALA A  1 188 ? -18.502 -23.490 -46.398 1.00 55.91  ? 188 ALA A O     1 
ATOM   1430  C CB    . ALA A  1 188 ? -20.069 -20.786 -47.631 1.00 53.59  ? 188 ALA A CB    1 
ATOM   1431  N N     . ASP A  1 189 ? -17.903 -22.812 -48.463 1.00 54.08  ? 189 ASP A N     1 
ATOM   1432  C CA    . ASP A  1 189 ? -17.451 -24.136 -48.915 1.00 53.88  ? 189 ASP A CA    1 
ATOM   1433  C C     . ASP A  1 189 ? -16.211 -24.584 -48.171 1.00 52.05  ? 189 ASP A C     1 
ATOM   1434  O O     . ASP A  1 189 ? -16.140 -25.738 -47.776 1.00 49.01  ? 189 ASP A O     1 
ATOM   1435  C CB    . ASP A  1 189 ? -17.219 -24.163 -50.434 1.00 56.85  ? 189 ASP A CB    1 
ATOM   1436  C CG    . ASP A  1 189 ? -18.489 -23.971 -51.259 1.00 82.67  ? 189 ASP A CG    1 
ATOM   1437  O OD1   . ASP A  1 189 ? -19.606 -24.074 -50.680 1.00 88.01  ? 189 ASP A OD1   1 
ATOM   1438  O OD2   . ASP A  1 189 ? -18.371 -23.720 -52.480 1.00 92.46  ? 189 ASP A OD2   1 
ATOM   1439  N N     . TYR A  1 190 ? -15.253 -23.669 -47.939 1.00 47.36  ? 190 TYR A N     1 
ATOM   1440  C CA    . TYR A  1 190 ? -14.061 -23.980 -47.147 1.00 45.92  ? 190 TYR A CA    1 
ATOM   1441  C C     . TYR A  1 190 ? -14.429 -24.522 -45.744 1.00 50.14  ? 190 TYR A C     1 
ATOM   1442  O O     . TYR A  1 190 ? -13.862 -25.521 -45.301 1.00 49.29  ? 190 TYR A O     1 
ATOM   1443  C CB    . TYR A  1 190 ? -13.169 -22.731 -47.009 1.00 47.01  ? 190 TYR A CB    1 
ATOM   1444  C CG    . TYR A  1 190 ? -11.939 -22.988 -46.176 1.00 46.36  ? 190 TYR A CG    1 
ATOM   1445  C CD1   . TYR A  1 190 ? -10.933 -23.832 -46.631 1.00 45.30  ? 190 TYR A CD1   1 
ATOM   1446  C CD2   . TYR A  1 190 ? -11.798 -22.422 -44.908 1.00 47.56  ? 190 TYR A CD2   1 
ATOM   1447  C CE1   . TYR A  1 190 ? -9.812  -24.103 -45.856 1.00 45.56  ? 190 TYR A CE1   1 
ATOM   1448  C CE2   . TYR A  1 190 ? -10.663 -22.653 -44.141 1.00 48.19  ? 190 TYR A CE2   1 
ATOM   1449  C CZ    . TYR A  1 190 ? -9.686  -23.524 -44.604 1.00 54.24  ? 190 TYR A CZ    1 
ATOM   1450  O OH    . TYR A  1 190 ? -8.570  -23.801 -43.853 1.00 52.86  ? 190 TYR A OH    1 
ATOM   1451  N N     . GLU A  1 191 ? -15.399 -23.867 -45.065 1.00 47.49  ? 191 GLU A N     1 
ATOM   1452  C CA    . GLU A  1 191 ? -15.797 -24.229 -43.709 1.00 48.77  ? 191 GLU A CA    1 
ATOM   1453  C C     . GLU A  1 191 ? -16.658 -25.492 -43.634 1.00 51.74  ? 191 GLU A C     1 
ATOM   1454  O O     . GLU A  1 191 ? -16.759 -26.048 -42.557 1.00 52.61  ? 191 GLU A O     1 
ATOM   1455  C CB    . GLU A  1 191 ? -16.487 -23.033 -43.003 1.00 51.58  ? 191 GLU A CB    1 
ATOM   1456  C CG    . GLU A  1 191 ? -15.591 -21.813 -42.805 1.00 59.28  ? 191 GLU A CG    1 
ATOM   1457  C CD    . GLU A  1 191 ? -14.527 -21.867 -41.728 1.00 76.50  ? 191 GLU A CD    1 
ATOM   1458  O OE1   . GLU A  1 191 ? -14.540 -22.807 -40.903 1.00 71.50  ? 191 GLU A OE1   1 
ATOM   1459  O OE2   . GLU A  1 191 ? -13.686 -20.940 -41.696 1.00 76.94  ? 191 GLU A OE2   1 
ATOM   1460  N N     . LYS A  1 192 ? -17.225 -25.974 -44.751 1.00 49.72  ? 192 LYS A N     1 
ATOM   1461  C CA    . LYS A  1 192 ? -18.009 -27.234 -44.814 1.00 51.00  ? 192 LYS A CA    1 
ATOM   1462  C C     . LYS A  1 192 ? -17.120 -28.502 -44.981 1.00 51.57  ? 192 LYS A C     1 
ATOM   1463  O O     . LYS A  1 192 ? -17.647 -29.614 -44.981 1.00 50.13  ? 192 LYS A O     1 
ATOM   1464  C CB    . LYS A  1 192 ? -18.995 -27.197 -46.020 1.00 55.28  ? 192 LYS A CB    1 
ATOM   1465  C CG    . LYS A  1 192 ? -20.252 -26.385 -45.778 1.00 80.68  ? 192 LYS A CG    1 
ATOM   1466  C CD    . LYS A  1 192 ? -20.874 -25.840 -47.069 1.00 101.11 ? 192 LYS A CD    1 
ATOM   1467  C CE    . LYS A  1 192 ? -21.180 -26.880 -48.126 1.00 114.83 ? 192 LYS A CE    1 
ATOM   1468  N NZ    . LYS A  1 192 ? -21.810 -26.268 -49.327 1.00 124.92 ? 192 LYS A NZ    1 
ATOM   1469  N N     . HIS A  1 193 ? -15.806 -28.342 -45.187 1.00 46.70  ? 193 HIS A N     1 
ATOM   1470  C CA    . HIS A  1 193 ? -14.921 -29.455 -45.470 1.00 44.83  ? 193 HIS A CA    1 
ATOM   1471  C C     . HIS A  1 193 ? -13.728 -29.464 -44.539 1.00 47.56  ? 193 HIS A C     1 
ATOM   1472  O O     . HIS A  1 193 ? -13.410 -28.441 -43.939 1.00 48.12  ? 193 HIS A O     1 
ATOM   1473  C CB    . HIS A  1 193 ? -14.555 -29.451 -46.948 1.00 44.45  ? 193 HIS A CB    1 
ATOM   1474  C CG    . HIS A  1 193 ? -15.742 -29.635 -47.845 1.00 48.37  ? 193 HIS A CG    1 
ATOM   1475  N ND1   . HIS A  1 193 ? -16.523 -30.800 -47.796 1.00 51.04  ? 193 HIS A ND1   1 
ATOM   1476  C CD2   . HIS A  1 193 ? -16.235 -28.823 -48.810 1.00 49.33  ? 193 HIS A CD2   1 
ATOM   1477  C CE1   . HIS A  1 193 ? -17.493 -30.618 -48.680 1.00 50.45  ? 193 HIS A CE1   1 
ATOM   1478  N NE2   . HIS A  1 193 ? -17.356 -29.445 -49.323 1.00 50.09  ? 193 HIS A NE2   1 
ATOM   1479  N N     . LYS A  1 194 ? -13.154 -30.658 -44.313 1.00 43.02  ? 194 LYS A N     1 
ATOM   1480  C CA    . LYS A  1 194 ? -12.086 -30.871 -43.325 1.00 42.96  ? 194 LYS A CA    1 
ATOM   1481  C C     . LYS A  1 194 ? -10.650 -31.016 -43.901 1.00 46.51  ? 194 LYS A C     1 
ATOM   1482  O O     . LYS A  1 194 ? -9.775  -30.254 -43.474 1.00 43.85  ? 194 LYS A O     1 
ATOM   1483  C CB    . LYS A  1 194 ? -12.451 -32.094 -42.442 1.00 44.58  ? 194 LYS A CB    1 
ATOM   1484  C CG    . LYS A  1 194 ? -11.496 -32.400 -41.277 1.00 77.59  ? 194 LYS A CG    1 
ATOM   1485  C CD    . LYS A  1 194 ? -11.325 -31.236 -40.307 1.00 102.02 ? 194 LYS A CD    1 
ATOM   1486  C CE    . LYS A  1 194 ? -10.935 -31.702 -38.922 1.00 130.23 ? 194 LYS A CE    1 
ATOM   1487  N NZ    . LYS A  1 194 ? -10.494 -30.573 -38.056 1.00 146.36 ? 194 LYS A NZ    1 
ATOM   1488  N N     . VAL A  1 195 ? -10.369 -31.971 -44.815 1.00 45.81  ? 195 VAL A N     1 
ATOM   1489  C CA    . VAL A  1 195 ? -8.956  -32.146 -45.221 1.00 45.47  ? 195 VAL A CA    1 
ATOM   1490  C C     . VAL A  1 195 ? -8.713  -31.633 -46.658 1.00 44.61  ? 195 VAL A C     1 
ATOM   1491  O O     . VAL A  1 195 ? -9.464  -31.886 -47.607 1.00 44.27  ? 195 VAL A O     1 
ATOM   1492  C CB    . VAL A  1 195 ? -8.351  -33.554 -44.917 1.00 50.81  ? 195 VAL A CB    1 
ATOM   1493  C CG1   . VAL A  1 195 ? -9.311  -34.456 -44.162 1.00 51.65  ? 195 VAL A CG1   1 
ATOM   1494  C CG2   . VAL A  1 195 ? -7.662  -34.246 -46.087 1.00 49.78  ? 195 VAL A CG2   1 
ATOM   1495  N N     . TYR A  1 196 ? -7.656  -30.832 -46.748 1.00 38.23  ? 196 TYR A N     1 
ATOM   1496  C CA    . TYR A  1 196 ? -7.207  -30.140 -47.942 1.00 36.70  ? 196 TYR A CA    1 
ATOM   1497  C C     . TYR A  1 196 ? -5.892  -30.706 -48.290 1.00 41.13  ? 196 TYR A C     1 
ATOM   1498  O O     . TYR A  1 196 ? -4.987  -30.684 -47.453 1.00 41.08  ? 196 TYR A O     1 
ATOM   1499  C CB    . TYR A  1 196 ? -7.088  -28.636 -47.672 1.00 37.69  ? 196 TYR A CB    1 
ATOM   1500  C CG    . TYR A  1 196 ? -8.458  -28.044 -47.451 1.00 37.60  ? 196 TYR A CG    1 
ATOM   1501  C CD1   . TYR A  1 196 ? -9.091  -28.149 -46.213 1.00 39.90  ? 196 TYR A CD1   1 
ATOM   1502  C CD2   . TYR A  1 196 ? -9.194  -27.541 -48.515 1.00 37.13  ? 196 TYR A CD2   1 
ATOM   1503  C CE1   . TYR A  1 196 ? -10.432 -27.807 -46.053 1.00 37.85  ? 196 TYR A CE1   1 
ATOM   1504  C CE2   . TYR A  1 196 ? -10.518 -27.143 -48.353 1.00 38.72  ? 196 TYR A CE2   1 
ATOM   1505  C CZ    . TYR A  1 196 ? -11.146 -27.320 -47.138 1.00 42.68  ? 196 TYR A CZ    1 
ATOM   1506  O OH    . TYR A  1 196 ? -12.444 -26.906 -47.047 1.00 43.61  ? 196 TYR A OH    1 
ATOM   1507  N N     . ALA A  1 197 ? -5.800  -31.265 -49.505 1.00 36.72  ? 197 ALA A N     1 
ATOM   1508  C CA    . ALA A  1 197 ? -4.636  -31.979 -49.978 1.00 35.95  ? 197 ALA A CA    1 
ATOM   1509  C C     . ALA A  1 197 ? -4.177  -31.505 -51.349 1.00 40.02  ? 197 ALA A C     1 
ATOM   1510  O O     . ALA A  1 197 ? -4.964  -31.304 -52.262 1.00 38.70  ? 197 ALA A O     1 
ATOM   1511  C CB    . ALA A  1 197 ? -4.938  -33.461 -50.040 1.00 36.31  ? 197 ALA A CB    1 
ATOM   1512  N N     . CYS A  1 198 ? -2.881  -31.432 -51.489 1.00 37.66  ? 198 CYS A N     1 
ATOM   1513  C CA    . CYS A  1 198 ? -2.207  -31.073 -52.693 1.00 37.91  ? 198 CYS A CA    1 
ATOM   1514  C C     . CYS A  1 198 ? -1.403  -32.319 -53.105 1.00 37.76  ? 198 CYS A C     1 
ATOM   1515  O O     . CYS A  1 198 ? -0.559  -32.736 -52.333 1.00 37.50  ? 198 CYS A O     1 
ATOM   1516  C CB    . CYS A  1 198 ? -1.288  -29.880 -52.404 1.00 40.83  ? 198 CYS A CB    1 
ATOM   1517  S SG    . CYS A  1 198 ? -0.238  -29.492 -53.770 1.00 47.01  ? 198 CYS A SG    1 
ATOM   1518  N N     . GLU A  1 199 ? -1.685  -32.939 -54.259 1.00 34.31  ? 199 GLU A N     1 
ATOM   1519  C CA    . GLU A  1 199 ? -0.941  -34.113 -54.748 1.00 33.26  ? 199 GLU A CA    1 
ATOM   1520  C C     . GLU A  1 199 ? -0.080  -33.753 -55.928 1.00 34.11  ? 199 GLU A C     1 
ATOM   1521  O O     . GLU A  1 199 ? -0.563  -33.196 -56.892 1.00 32.17  ? 199 GLU A O     1 
ATOM   1522  C CB    . GLU A  1 199 ? -1.830  -35.284 -55.111 1.00 35.31  ? 199 GLU A CB    1 
ATOM   1523  C CG    . GLU A  1 199 ? -1.002  -36.507 -55.504 1.00 41.48  ? 199 GLU A CG    1 
ATOM   1524  C CD    . GLU A  1 199 ? -1.783  -37.773 -55.719 1.00 52.09  ? 199 GLU A CD    1 
ATOM   1525  O OE1   . GLU A  1 199 ? -2.954  -37.795 -55.312 1.00 37.40  ? 199 GLU A OE1   1 
ATOM   1526  O OE2   . GLU A  1 199 ? -1.239  -38.746 -56.281 1.00 51.87  ? 199 GLU A OE2   1 
ATOM   1527  N N     . VAL A  1 200 ? 1.187   -34.128 -55.863 1.00 32.18  ? 200 VAL A N     1 
ATOM   1528  C CA    . VAL A  1 200 ? 2.195   -33.748 -56.831 1.00 32.33  ? 200 VAL A CA    1 
ATOM   1529  C C     . VAL A  1 200 ? 2.775   -34.933 -57.547 1.00 34.69  ? 200 VAL A C     1 
ATOM   1530  O O     . VAL A  1 200 ? 3.177   -35.897 -56.910 1.00 36.49  ? 200 VAL A O     1 
ATOM   1531  C CB    . VAL A  1 200 ? 3.288   -32.883 -56.137 1.00 34.99  ? 200 VAL A CB    1 
ATOM   1532  C CG1   . VAL A  1 200 ? 4.458   -32.615 -57.075 1.00 35.50  ? 200 VAL A CG1   1 
ATOM   1533  C CG2   . VAL A  1 200 ? 2.679   -31.576 -55.649 1.00 33.51  ? 200 VAL A CG2   1 
ATOM   1534  N N     . THR A  1 201 ? 2.844   -34.841 -58.880 1.00 32.04  ? 201 THR A N     1 
ATOM   1535  C CA    . THR A  1 201 ? 3.429   -35.874 -59.725 1.00 33.86  ? 201 THR A CA    1 
ATOM   1536  C C     . THR A  1 201 ? 4.547   -35.215 -60.552 1.00 34.78  ? 201 THR A C     1 
ATOM   1537  O O     . THR A  1 201 ? 4.393   -34.103 -61.036 1.00 35.91  ? 201 THR A O     1 
ATOM   1538  C CB    . THR A  1 201 ? 2.381   -36.682 -60.565 1.00 43.56  ? 201 THR A CB    1 
ATOM   1539  O OG1   . THR A  1 201 ? 1.787   -35.878 -61.540 1.00 54.59  ? 201 THR A OG1   1 
ATOM   1540  C CG2   . THR A  1 201 ? 1.311   -37.254 -59.771 1.00 37.21  ? 201 THR A CG2   1 
ATOM   1541  N N     . HIS A  1 202 ? 5.705   -35.853 -60.575 1.00 31.80  ? 202 HIS A N     1 
ATOM   1542  C CA    . HIS A  1 202 ? 6.896   -35.357 -61.246 1.00 31.09  ? 202 HIS A CA    1 
ATOM   1543  C C     . HIS A  1 202 ? 7.779   -36.498 -61.513 1.00 37.49  ? 202 HIS A C     1 
ATOM   1544  O O     . HIS A  1 202 ? 7.761   -37.439 -60.753 1.00 40.76  ? 202 HIS A O     1 
ATOM   1545  C CB    . HIS A  1 202 ? 7.626   -34.326 -60.367 1.00 31.79  ? 202 HIS A CB    1 
ATOM   1546  C CG    . HIS A  1 202 ? 8.736   -33.612 -61.064 1.00 33.19  ? 202 HIS A CG    1 
ATOM   1547  N ND1   . HIS A  1 202 ? 10.047  -34.024 -60.931 1.00 34.68  ? 202 HIS A ND1   1 
ATOM   1548  C CD2   . HIS A  1 202 ? 8.705   -32.497 -61.827 1.00 33.90  ? 202 HIS A CD2   1 
ATOM   1549  C CE1   . HIS A  1 202 ? 10.761  -33.197 -61.679 1.00 33.15  ? 202 HIS A CE1   1 
ATOM   1550  N NE2   . HIS A  1 202 ? 9.981   -32.296 -62.281 1.00 33.18  ? 202 HIS A NE2   1 
ATOM   1551  N N     . GLN A  1 203 ? 8.606   -36.404 -62.548 1.00 36.35  ? 203 GLN A N     1 
ATOM   1552  C CA    . GLN A  1 203 ? 9.572   -37.431 -62.931 1.00 35.94  ? 203 GLN A CA    1 
ATOM   1553  C C     . GLN A  1 203 ? 10.551  -37.788 -61.792 1.00 39.51  ? 203 GLN A C     1 
ATOM   1554  O O     . GLN A  1 203 ? 10.936  -38.933 -61.675 1.00 39.88  ? 203 GLN A O     1 
ATOM   1555  C CB    . GLN A  1 203 ? 10.370  -36.953 -64.155 1.00 36.77  ? 203 GLN A CB    1 
ATOM   1556  C CG    . GLN A  1 203 ? 11.107  -38.083 -64.854 1.00 45.46  ? 203 GLN A CG    1 
ATOM   1557  C CD    . GLN A  1 203 ? 11.983  -37.592 -65.972 1.00 61.31  ? 203 GLN A CD    1 
ATOM   1558  O OE1   . GLN A  1 203 ? 11.780  -36.509 -66.546 1.00 61.68  ? 203 GLN A OE1   1 
ATOM   1559  N NE2   . GLN A  1 203 ? 12.968  -38.396 -66.315 1.00 58.71  ? 203 GLN A NE2   1 
ATOM   1560  N N     . GLY A  1 204 ? 10.936  -36.823 -60.970 1.00 36.53  ? 204 GLY A N     1 
ATOM   1561  C CA    . GLY A  1 204 ? 11.832  -37.070 -59.845 1.00 36.33  ? 204 GLY A CA    1 
ATOM   1562  C C     . GLY A  1 204 ? 11.197  -37.822 -58.687 1.00 39.04  ? 204 GLY A C     1 
ATOM   1563  O O     . GLY A  1 204 ? 11.895  -38.158 -57.732 1.00 38.92  ? 204 GLY A O     1 
ATOM   1564  N N     . LEU A  1 205 ? 9.866   -38.022 -58.718 1.00 35.14  ? 205 LEU A N     1 
ATOM   1565  C CA    . LEU A  1 205 ? 9.115   -38.693 -57.667 1.00 36.22  ? 205 LEU A CA    1 
ATOM   1566  C C     . LEU A  1 205 ? 8.545   -40.037 -58.169 1.00 39.51  ? 205 LEU A C     1 
ATOM   1567  O O     . LEU A  1 205 ? 7.628   -40.038 -58.980 1.00 41.14  ? 205 LEU A O     1 
ATOM   1568  C CB    . LEU A  1 205 ? 7.958   -37.794 -57.222 1.00 36.01  ? 205 LEU A CB    1 
ATOM   1569  C CG    . LEU A  1 205 ? 8.284   -36.482 -56.633 1.00 38.43  ? 205 LEU A CG    1 
ATOM   1570  C CD1   . LEU A  1 205 ? 7.030   -35.672 -56.467 1.00 38.32  ? 205 LEU A CD1   1 
ATOM   1571  C CD2   . LEU A  1 205 ? 8.985   -36.646 -55.349 1.00 40.87  ? 205 LEU A CD2   1 
ATOM   1572  N N     . SER A  1 206 ? 9.106   -41.162 -57.730 1.00 35.27  ? 206 SER A N     1 
ATOM   1573  C CA    . SER A  1 206 ? 8.604   -42.515 -58.115 1.00 36.74  ? 206 SER A CA    1 
ATOM   1574  C C     . SER A  1 206 ? 7.122   -42.671 -57.852 1.00 39.11  ? 206 SER A C     1 
ATOM   1575  O O     . SER A  1 206 ? 6.397   -43.171 -58.689 1.00 38.13  ? 206 SER A O     1 
ATOM   1576  C CB    . SER A  1 206 ? 9.333   -43.580 -57.320 1.00 41.86  ? 206 SER A CB    1 
ATOM   1577  O OG    . SER A  1 206 ? 10.732  -43.404 -57.479 1.00 53.80  ? 206 SER A OG    1 
ATOM   1578  N N     . SER A  1 207 ? 6.687   -42.207 -56.681 1.00 35.61  ? 207 SER A N     1 
ATOM   1579  C CA    . SER A  1 207 ? 5.310   -42.216 -56.269 1.00 34.22  ? 207 SER A CA    1 
ATOM   1580  C C     . SER A  1 207 ? 4.964   -40.777 -55.999 1.00 36.38  ? 207 SER A C     1 
ATOM   1581  O O     . SER A  1 207 ? 5.828   -40.003 -55.581 1.00 36.52  ? 207 SER A O     1 
ATOM   1582  C CB    . SER A  1 207 ? 5.103   -43.104 -55.031 1.00 33.97  ? 207 SER A CB    1 
ATOM   1583  O OG    . SER A  1 207 ? 4.883   -44.443 -55.421 1.00 43.90  ? 207 SER A OG    1 
ATOM   1584  N N     . PRO A  1 208 ? 3.725   -40.376 -56.251 1.00 34.39  ? 208 PRO A N     1 
ATOM   1585  C CA    . PRO A  1 208 ? 3.339   -38.975 -55.971 1.00 33.57  ? 208 PRO A CA    1 
ATOM   1586  C C     . PRO A  1 208 ? 3.503   -38.576 -54.506 1.00 37.70  ? 208 PRO A C     1 
ATOM   1587  O O     . PRO A  1 208 ? 3.348   -39.393 -53.609 1.00 37.86  ? 208 PRO A O     1 
ATOM   1588  C CB    . PRO A  1 208 ? 1.862   -38.927 -56.349 1.00 36.13  ? 208 PRO A CB    1 
ATOM   1589  C CG    . PRO A  1 208 ? 1.566   -40.175 -57.080 1.00 40.90  ? 208 PRO A CG    1 
ATOM   1590  C CD    . PRO A  1 208 ? 2.606   -41.168 -56.798 1.00 37.30  ? 208 PRO A CD    1 
ATOM   1591  N N     . VAL A  1 209 ? 3.681   -37.301 -54.276 1.00 36.00  ? 209 VAL A N     1 
ATOM   1592  C CA    . VAL A  1 209 ? 3.793   -36.719 -52.937 1.00 37.31  ? 209 VAL A CA    1 
ATOM   1593  C C     . VAL A  1 209 ? 2.511   -35.950 -52.630 1.00 38.41  ? 209 VAL A C     1 
ATOM   1594  O O     . VAL A  1 209 ? 2.101   -35.134 -53.427 1.00 37.07  ? 209 VAL A O     1 
ATOM   1595  C CB    . VAL A  1 209 ? 5.039   -35.798 -52.810 1.00 41.20  ? 209 VAL A CB    1 
ATOM   1596  C CG1   . VAL A  1 209 ? 5.001   -34.994 -51.530 1.00 41.43  ? 209 VAL A CG1   1 
ATOM   1597  C CG2   . VAL A  1 209 ? 6.313   -36.628 -52.874 1.00 42.17  ? 209 VAL A CG2   1 
ATOM   1598  N N     . THR A  1 210 ? 1.919   -36.196 -51.464 1.00 36.04  ? 210 THR A N     1 
ATOM   1599  C CA    . THR A  1 210 ? 0.729   -35.486 -50.995 1.00 35.29  ? 210 THR A CA    1 
ATOM   1600  C C     . THR A  1 210 ? 1.062   -34.728 -49.708 1.00 38.20  ? 210 THR A C     1 
ATOM   1601  O O     . THR A  1 210 ? 1.701   -35.279 -48.810 1.00 36.14  ? 210 THR A O     1 
ATOM   1602  C CB    . THR A  1 210 ? -0.451  -36.435 -50.771 1.00 41.83  ? 210 THR A CB    1 
ATOM   1603  O OG1   . THR A  1 210 ? -0.734  -37.131 -51.988 1.00 43.22  ? 210 THR A OG1   1 
ATOM   1604  C CG2   . THR A  1 210 ? -1.705  -35.696 -50.316 1.00 40.47  ? 210 THR A CG2   1 
ATOM   1605  N N     . LYS A  1 211 ? 0.748   -33.417 -49.698 1.00 36.11  ? 211 LYS A N     1 
ATOM   1606  C CA    . LYS A  1 211 ? 0.833   -32.569 -48.531 1.00 36.17  ? 211 LYS A CA    1 
ATOM   1607  C C     . LYS A  1 211 ? -0.617  -32.179 -48.240 1.00 41.84  ? 211 LYS A C     1 
ATOM   1608  O O     . LYS A  1 211 ? -1.374  -31.825 -49.163 1.00 41.05  ? 211 LYS A O     1 
ATOM   1609  C CB    . LYS A  1 211 ? 1.759   -31.350 -48.730 1.00 36.49  ? 211 LYS A CB    1 
ATOM   1610  C CG    . LYS A  1 211 ? 3.214   -31.683 -49.000 1.00 38.85  ? 211 LYS A CG    1 
ATOM   1611  C CD    . LYS A  1 211 ? 3.847   -32.520 -47.932 1.00 40.81  ? 211 LYS A CD    1 
ATOM   1612  C CE    . LYS A  1 211 ? 5.285   -32.794 -48.247 1.00 48.14  ? 211 LYS A CE    1 
ATOM   1613  N NZ    . LYS A  1 211 ? 6.044   -33.199 -47.039 1.00 59.30  ? 211 LYS A NZ    1 
ATOM   1614  N N     . SER A  1 212 ? -0.996  -32.312 -46.964 1.00 39.33  ? 212 SER A N     1 
ATOM   1615  C CA    . SER A  1 212 ? -2.328  -32.032 -46.441 1.00 39.86  ? 212 SER A CA    1 
ATOM   1616  C C     . SER A  1 212 ? -2.304  -31.230 -45.175 1.00 44.03  ? 212 SER A C     1 
ATOM   1617  O O     . SER A  1 212 ? -1.317  -31.228 -44.466 1.00 43.50  ? 212 SER A O     1 
ATOM   1618  C CB    . SER A  1 212 ? -3.031  -33.346 -46.083 1.00 43.00  ? 212 SER A CB    1 
ATOM   1619  O OG    . SER A  1 212 ? -3.659  -33.909 -47.217 1.00 65.47  ? 212 SER A OG    1 
ATOM   1620  N N     . PHE A  1 213 ? -3.472  -30.699 -44.815 1.00 42.02  ? 213 PHE A N     1 
ATOM   1621  C CA    . PHE A  1 213 ? -3.779  -30.103 -43.496 1.00 41.61  ? 213 PHE A CA    1 
ATOM   1622  C C     . PHE A  1 213 ? -5.283  -30.274 -43.215 1.00 47.55  ? 213 PHE A C     1 
ATOM   1623  O O     . PHE A  1 213 ? -6.076  -30.439 -44.142 1.00 44.62  ? 213 PHE A O     1 
ATOM   1624  C CB    . PHE A  1 213 ? -3.328  -28.644 -43.325 1.00 42.49  ? 213 PHE A CB    1 
ATOM   1625  C CG    . PHE A  1 213 ? -4.120  -27.615 -44.087 1.00 41.87  ? 213 PHE A CG    1 
ATOM   1626  C CD1   . PHE A  1 213 ? -5.330  -27.147 -43.599 1.00 43.84  ? 213 PHE A CD1   1 
ATOM   1627  C CD2   . PHE A  1 213 ? -3.718  -27.205 -45.348 1.00 41.14  ? 213 PHE A CD2   1 
ATOM   1628  C CE1   . PHE A  1 213 ? -6.137  -26.320 -44.364 1.00 44.56  ? 213 PHE A CE1   1 
ATOM   1629  C CE2   . PHE A  1 213 ? -4.558  -26.424 -46.140 1.00 42.88  ? 213 PHE A CE2   1 
ATOM   1630  C CZ    . PHE A  1 213 ? -5.731  -25.931 -45.621 1.00 41.96  ? 213 PHE A CZ    1 
ATOM   1631  N N     . ASN A  1 214 ? -5.663  -30.323 -41.932 1.00 48.98  ? 214 ASN A N     1 
ATOM   1632  C CA    . ASN A  1 214 ? -7.059  -30.365 -41.540 1.00 49.87  ? 214 ASN A CA    1 
ATOM   1633  C C     . ASN A  1 214 ? -7.441  -28.976 -41.084 1.00 55.04  ? 214 ASN A C     1 
ATOM   1634  O O     . ASN A  1 214 ? -6.752  -28.415 -40.236 1.00 55.72  ? 214 ASN A O     1 
ATOM   1635  C CB    . ASN A  1 214 ? -7.286  -31.359 -40.412 1.00 59.11  ? 214 ASN A CB    1 
ATOM   1636  C CG    . ASN A  1 214 ? -6.985  -32.786 -40.817 1.00 78.03  ? 214 ASN A CG    1 
ATOM   1637  O OD1   . ASN A  1 214 ? -7.249  -33.190 -41.944 1.00 63.89  ? 214 ASN A OD1   1 
ATOM   1638  N ND2   . ASN A  1 214 ? -6.352  -33.570 -39.953 1.00 71.69  ? 214 ASN A ND2   1 
ATOM   1639  N N     . ARG A  1 215 ? -8.486  -28.382 -41.685 1.00 53.23  ? 215 ARG A N     1 
ATOM   1640  C CA    . ARG A  1 215 ? -9.003  -27.070 -41.263 1.00 54.73  ? 215 ARG A CA    1 
ATOM   1641  C C     . ARG A  1 215 ? -9.406  -27.170 -39.784 1.00 65.42  ? 215 ARG A C     1 
ATOM   1642  O O     . ARG A  1 215 ? -10.080 -28.130 -39.390 1.00 64.33  ? 215 ARG A O     1 
ATOM   1643  C CB    . ARG A  1 215 ? -10.244 -26.685 -42.080 1.00 51.21  ? 215 ARG A CB    1 
ATOM   1644  C CG    . ARG A  1 215 ? -10.898 -25.336 -41.673 1.00 55.90  ? 215 ARG A CG    1 
ATOM   1645  C CD    . ARG A  1 215 ? -12.260 -25.109 -42.317 1.00 53.29  ? 215 ARG A CD    1 
ATOM   1646  N NE    . ARG A  1 215 ? -13.116 -26.291 -42.211 1.00 56.95  ? 215 ARG A NE    1 
ATOM   1647  C CZ    . ARG A  1 215 ? -13.724 -26.719 -41.110 1.00 68.95  ? 215 ARG A CZ    1 
ATOM   1648  N NH1   . ARG A  1 215 ? -14.457 -27.828 -41.138 1.00 66.25  ? 215 ARG A NH1   1 
ATOM   1649  N NH2   . ARG A  1 215 ? -13.605 -26.046 -39.969 1.00 58.62  ? 215 ARG A NH2   1 
ATOM   1650  N N     . GLY A  1 216 ? -8.984  -26.193 -38.990 1.00 68.27  ? 216 GLY A N     1 
ATOM   1651  C CA    . GLY A  1 216 ? -9.284  -26.178 -37.557 1.00 72.63  ? 216 GLY A CA    1 
ATOM   1652  C C     . GLY A  1 216 ? -8.147  -26.657 -36.673 1.00 80.37  ? 216 GLY A C     1 
ATOM   1653  O O     . GLY A  1 216 ? -8.150  -26.381 -35.469 1.00 82.14  ? 216 GLY A O     1 
ATOM   1654  N N     . GLU A  1 217 ? -7.152  -27.356 -37.268 1.00 76.83  ? 217 GLU A N     1 
ATOM   1655  C CA    . GLU A  1 217 ? -5.948  -27.826 -36.593 1.00 76.95  ? 217 GLU A CA    1 
ATOM   1656  C C     . GLU A  1 217 ? -4.774  -26.903 -36.950 1.00 81.01  ? 217 GLU A C     1 
ATOM   1657  O O     . GLU A  1 217 ? -3.632  -27.349 -36.903 1.00 82.04  ? 217 GLU A O     1 
ATOM   1658  C CB    . GLU A  1 217 ? -5.659  -29.276 -37.007 1.00 77.70  ? 217 GLU A CB    1 
ATOM   1659  C CG    . GLU A  1 217 ? -6.794  -30.216 -36.635 1.00 89.44  ? 217 GLU A CG    1 
ATOM   1660  C CD    . GLU A  1 217 ? -6.519  -31.691 -36.842 1.00 108.58 ? 217 GLU A CD    1 
ATOM   1661  O OE1   . GLU A  1 217 ? -5.407  -32.034 -37.309 1.00 96.54  ? 217 GLU A OE1   1 
ATOM   1662  O OE2   . GLU A  1 217 ? -7.438  -32.503 -36.583 1.00 101.60 ? 217 GLU A OE2   1 
ATOM   1663  N N     . CYS A  1 218 ? -5.053  -25.605 -37.269 1.00 77.15  ? 218 CYS A N     1 
ATOM   1664  C CA    . CYS A  1 218 ? -4.060  -24.599 -37.656 1.00 93.00  ? 218 CYS A CA    1 
ATOM   1665  C C     . CYS A  1 218 ? -4.098  -23.451 -36.644 1.00 131.40 ? 218 CYS A C     1 
ATOM   1666  O O     . CYS A  1 218 ? -3.287  -22.528 -36.721 1.00 99.36  ? 218 CYS A O     1 
ATOM   1667  C CB    . CYS A  1 218 ? -4.340  -24.092 -39.074 1.00 91.68  ? 218 CYS A CB    1 
ATOM   1668  S SG    . CYS A  1 218 ? -4.486  -25.397 -40.335 1.00 93.71  ? 218 CYS A SG    1 
ATOM   1669  N N     . GLN B  2 1   ? 29.748  5.028   -66.741 1.00 65.32  ? 1   GLN B N     1 
ATOM   1670  C CA    . GLN B  2 1   ? 28.594  5.273   -65.876 1.00 62.58  ? 1   GLN B CA    1 
ATOM   1671  C C     . GLN B  2 1   ? 27.382  5.712   -66.755 1.00 56.85  ? 1   GLN B C     1 
ATOM   1672  O O     . GLN B  2 1   ? 26.628  6.600   -66.367 1.00 53.72  ? 1   GLN B O     1 
ATOM   1673  C CB    . GLN B  2 1   ? 28.988  6.345   -64.829 1.00 65.16  ? 1   GLN B CB    1 
ATOM   1674  C CG    . GLN B  2 1   ? 28.271  6.219   -63.494 1.00 86.97  ? 1   GLN B CG    1 
ATOM   1675  C CD    . GLN B  2 1   ? 28.208  7.570   -62.799 1.00 113.61 ? 1   GLN B CD    1 
ATOM   1676  O OE1   . GLN B  2 1   ? 27.129  8.143   -62.589 1.00 111.99 ? 1   GLN B OE1   1 
ATOM   1677  N NE2   . GLN B  2 1   ? 29.366  8.151   -62.498 1.00 102.59 ? 1   GLN B NE2   1 
ATOM   1678  N N     . VAL B  2 2   ? 27.181  5.047   -67.921 1.00 50.58  ? 2   VAL B N     1 
ATOM   1679  C CA    . VAL B  2 2   ? 26.067  5.346   -68.832 1.00 48.18  ? 2   VAL B CA    1 
ATOM   1680  C C     . VAL B  2 2   ? 24.791  4.813   -68.230 1.00 46.46  ? 2   VAL B C     1 
ATOM   1681  O O     . VAL B  2 2   ? 24.705  3.631   -67.934 1.00 44.35  ? 2   VAL B O     1 
ATOM   1682  C CB    . VAL B  2 2   ? 26.253  4.786   -70.264 1.00 51.25  ? 2   VAL B CB    1 
ATOM   1683  C CG1   . VAL B  2 2   ? 25.007  5.043   -71.125 1.00 50.05  ? 2   VAL B CG1   1 
ATOM   1684  C CG2   . VAL B  2 2   ? 27.493  5.375   -70.909 1.00 51.22  ? 2   VAL B CG2   1 
ATOM   1685  N N     . GLN B  2 3   ? 23.818  5.692   -68.044 1.00 41.03  ? 3   GLN B N     1 
ATOM   1686  C CA    . GLN B  2 3   ? 22.523  5.328   -67.506 1.00 41.33  ? 3   GLN B CA    1 
ATOM   1687  C C     . GLN B  2 3   ? 21.375  5.966   -68.269 1.00 41.19  ? 3   GLN B C     1 
ATOM   1688  O O     . GLN B  2 3   ? 21.417  7.149   -68.616 1.00 38.74  ? 3   GLN B O     1 
ATOM   1689  C CB    . GLN B  2 3   ? 22.424  5.782   -66.047 1.00 44.74  ? 3   GLN B CB    1 
ATOM   1690  C CG    . GLN B  2 3   ? 23.415  5.108   -65.114 1.00 58.42  ? 3   GLN B CG    1 
ATOM   1691  C CD    . GLN B  2 3   ? 23.081  5.469   -63.684 1.00 86.86  ? 3   GLN B CD    1 
ATOM   1692  O OE1   . GLN B  2 3   ? 22.047  5.060   -63.141 1.00 88.94  ? 3   GLN B OE1   1 
ATOM   1693  N NE2   . GLN B  2 3   ? 23.866  6.332   -63.078 1.00 83.42  ? 3   GLN B NE2   1 
ATOM   1694  N N     . LEU B  2 4   ? 20.332  5.181   -68.493 1.00 37.99  ? 4   LEU B N     1 
ATOM   1695  C CA    . LEU B  2 4   ? 19.092  5.638   -69.077 1.00 36.06  ? 4   LEU B CA    1 
ATOM   1696  C C     . LEU B  2 4   ? 17.987  5.284   -68.044 1.00 38.57  ? 4   LEU B C     1 
ATOM   1697  O O     . LEU B  2 4   ? 17.739  4.125   -67.815 1.00 37.97  ? 4   LEU B O     1 
ATOM   1698  C CB    . LEU B  2 4   ? 18.835  4.974   -70.432 1.00 35.57  ? 4   LEU B CB    1 
ATOM   1699  C CG    . LEU B  2 4   ? 19.819  5.265   -71.569 1.00 39.12  ? 4   LEU B CG    1 
ATOM   1700  C CD1   . LEU B  2 4   ? 19.359  4.569   -72.835 1.00 38.04  ? 4   LEU B CD1   1 
ATOM   1701  C CD2   . LEU B  2 4   ? 19.946  6.752   -71.833 1.00 42.62  ? 4   LEU B CD2   1 
ATOM   1702  N N     . VAL B  2 5   ? 17.368  6.295   -67.384 1.00 34.84  ? 5   VAL B N     1 
ATOM   1703  C CA    . VAL B  2 5   ? 16.343  6.087   -66.362 1.00 32.59  ? 5   VAL B CA    1 
ATOM   1704  C C     . VAL B  2 5   ? 14.996  6.534   -66.851 1.00 33.90  ? 5   VAL B C     1 
ATOM   1705  O O     . VAL B  2 5   ? 14.777  7.699   -67.114 1.00 33.63  ? 5   VAL B O     1 
ATOM   1706  C CB    . VAL B  2 5   ? 16.770  6.813   -65.056 1.00 36.85  ? 5   VAL B CB    1 
ATOM   1707  C CG1   . VAL B  2 5   ? 15.716  6.658   -63.956 1.00 36.88  ? 5   VAL B CG1   1 
ATOM   1708  C CG2   . VAL B  2 5   ? 18.102  6.257   -64.603 1.00 36.63  ? 5   VAL B CG2   1 
ATOM   1709  N N     . GLN B  2 6   ? 14.089  5.600   -66.969 1.00 33.14  ? 6   GLN B N     1 
ATOM   1710  C CA    . GLN B  2 6   ? 12.734  5.860   -67.425 1.00 31.93  ? 6   GLN B CA    1 
ATOM   1711  C C     . GLN B  2 6   ? 11.738  6.138   -66.290 1.00 38.07  ? 6   GLN B C     1 
ATOM   1712  O O     . GLN B  2 6   ? 11.855  5.591   -65.186 1.00 39.59  ? 6   GLN B O     1 
ATOM   1713  C CB    . GLN B  2 6   ? 12.238  4.652   -68.215 1.00 30.46  ? 6   GLN B CB    1 
ATOM   1714  C CG    . GLN B  2 6   ? 13.066  4.359   -69.433 1.00 33.62  ? 6   GLN B CG    1 
ATOM   1715  C CD    . GLN B  2 6   ? 12.517  3.267   -70.316 1.00 32.23  ? 6   GLN B CD    1 
ATOM   1716  O OE1   . GLN B  2 6   ? 13.268  2.469   -70.834 1.00 31.97  ? 6   GLN B OE1   1 
ATOM   1717  N NE2   . GLN B  2 6   ? 11.234  3.287   -70.652 1.00 38.44  ? 6   GLN B NE2   1 
ATOM   1718  N N     . SER B  2 7   ? 10.658  6.832   -66.642 1.00 34.28  ? 7   SER B N     1 
ATOM   1719  C CA    . SER B  2 7   ? 9.545   7.122   -65.744 1.00 34.42  ? 7   SER B CA    1 
ATOM   1720  C C     . SER B  2 7   ? 8.809   5.818   -65.384 1.00 38.13  ? 7   SER B C     1 
ATOM   1721  O O     . SER B  2 7   ? 9.039   4.745   -65.959 1.00 39.93  ? 7   SER B O     1 
ATOM   1722  C CB    . SER B  2 7   ? 8.610   8.159   -66.387 1.00 38.50  ? 7   SER B CB    1 
ATOM   1723  O OG    . SER B  2 7   ? 8.260   7.857   -67.733 1.00 39.33  ? 7   SER B OG    1 
ATOM   1724  N N     . GLY B  2 8   ? 7.972   5.916   -64.398 1.00 36.65  ? 8   GLY B N     1 
ATOM   1725  C CA    . GLY B  2 8   ? 7.259   4.785   -63.811 1.00 37.36  ? 8   GLY B CA    1 
ATOM   1726  C C     . GLY B  2 8   ? 6.015   4.288   -64.519 1.00 44.87  ? 8   GLY B C     1 
ATOM   1727  O O     . GLY B  2 8   ? 5.587   4.842   -65.536 1.00 43.41  ? 8   GLY B O     1 
ATOM   1728  N N     . VAL B  2 9   ? 5.441   3.205   -63.954 1.00 43.83  ? 9   VAL B N     1 
ATOM   1729  C CA    . VAL B  2 9   ? 4.246   2.502   -64.451 1.00 42.75  ? 9   VAL B CA    1 
ATOM   1730  C C     . VAL B  2 9   ? 3.159   3.508   -64.825 1.00 42.62  ? 9   VAL B C     1 
ATOM   1731  O O     . VAL B  2 9   ? 2.960   4.468   -64.125 1.00 43.45  ? 9   VAL B O     1 
ATOM   1732  C CB    . VAL B  2 9   ? 3.654   1.483   -63.414 1.00 46.92  ? 9   VAL B CB    1 
ATOM   1733  C CG1   . VAL B  2 9   ? 2.412   0.785   -63.976 1.00 44.84  ? 9   VAL B CG1   1 
ATOM   1734  C CG2   . VAL B  2 9   ? 4.667   0.430   -63.023 1.00 48.90  ? 9   VAL B CG2   1 
ATOM   1735  N N     . GLU B  2 10  ? 2.430   3.248   -65.885 1.00 38.31  ? 10  GLU B N     1 
ATOM   1736  C CA    . GLU B  2 10  ? 1.300   4.069   -66.296 1.00 37.57  ? 10  GLU B CA    1 
ATOM   1737  C C     . GLU B  2 10  ? 0.120   3.182   -66.656 1.00 40.52  ? 10  GLU B C     1 
ATOM   1738  O O     . GLU B  2 10  ? 0.288   2.097   -67.238 1.00 39.08  ? 10  GLU B O     1 
ATOM   1739  C CB    . GLU B  2 10  ? 1.644   4.871   -67.551 1.00 38.56  ? 10  GLU B CB    1 
ATOM   1740  C CG    . GLU B  2 10  ? 2.849   5.777   -67.414 1.00 43.57  ? 10  GLU B CG    1 
ATOM   1741  C CD    . GLU B  2 10  ? 2.628   6.984   -66.530 1.00 65.12  ? 10  GLU B CD    1 
ATOM   1742  O OE1   . GLU B  2 10  ? 1.462   7.265   -66.172 1.00 52.75  ? 10  GLU B OE1   1 
ATOM   1743  O OE2   . GLU B  2 10  ? 3.621   7.688   -66.249 1.00 67.62  ? 10  GLU B OE2   1 
ATOM   1744  N N     . VAL B  2 11  ? -1.073  3.673   -66.342 1.00 37.17  ? 11  VAL B N     1 
ATOM   1745  C CA    . VAL B  2 11  ? -2.322  3.086   -66.756 1.00 36.81  ? 11  VAL B CA    1 
ATOM   1746  C C     . VAL B  2 11  ? -3.165  4.224   -67.301 1.00 38.33  ? 11  VAL B C     1 
ATOM   1747  O O     . VAL B  2 11  ? -3.285  5.257   -66.674 1.00 37.50  ? 11  VAL B O     1 
ATOM   1748  C CB    . VAL B  2 11  ? -3.008  2.160   -65.721 1.00 40.35  ? 11  VAL B CB    1 
ATOM   1749  C CG1   . VAL B  2 11  ? -3.312  2.863   -64.433 1.00 39.15  ? 11  VAL B CG1   1 
ATOM   1750  C CG2   . VAL B  2 11  ? -4.261  1.516   -66.288 1.00 40.29  ? 11  VAL B CG2   1 
ATOM   1751  N N     . LYS B  2 12  ? -3.660  4.053   -68.515 1.00 35.95  ? 12  LYS B N     1 
ATOM   1752  C CA    . LYS B  2 12  ? -4.424  5.064   -69.245 1.00 35.46  ? 12  LYS B CA    1 
ATOM   1753  C C     . LYS B  2 12  ? -5.640  4.475   -69.879 1.00 39.15  ? 12  LYS B C     1 
ATOM   1754  O O     . LYS B  2 12  ? -5.694  3.282   -70.177 1.00 37.36  ? 12  LYS B O     1 
ATOM   1755  C CB    . LYS B  2 12  ? -3.572  5.681   -70.380 1.00 37.13  ? 12  LYS B CB    1 
ATOM   1756  C CG    . LYS B  2 12  ? -2.317  6.376   -69.905 1.00 34.25  ? 12  LYS B CG    1 
ATOM   1757  C CD    . LYS B  2 12  ? -2.612  7.610   -69.069 1.00 39.49  ? 12  LYS B CD    1 
ATOM   1758  C CE    . LYS B  2 12  ? -1.326  8.170   -68.532 1.00 45.72  ? 12  LYS B CE    1 
ATOM   1759  N NZ    . LYS B  2 12  ? -1.572  9.324   -67.641 1.00 51.91  ? 12  LYS B NZ    1 
ATOM   1760  N N     . LYS B  2 13  ? -6.577  5.340   -70.176 1.00 37.37  ? 13  LYS B N     1 
ATOM   1761  C CA    . LYS B  2 13  ? -7.811  4.939   -70.828 1.00 38.04  ? 13  LYS B CA    1 
ATOM   1762  C C     . LYS B  2 13  ? -7.617  4.912   -72.334 1.00 38.96  ? 13  LYS B C     1 
ATOM   1763  O O     . LYS B  2 13  ? -6.838  5.704   -72.866 1.00 37.21  ? 13  LYS B O     1 
ATOM   1764  C CB    . LYS B  2 13  ? -8.946  5.907   -70.473 1.00 42.97  ? 13  LYS B CB    1 
ATOM   1765  C CG    . LYS B  2 13  ? -9.499  5.675   -69.062 1.00 55.40  ? 13  LYS B CG    1 
ATOM   1766  C CD    . LYS B  2 13  ? -10.319 6.844   -68.527 1.00 68.39  ? 13  LYS B CD    1 
ATOM   1767  C CE    . LYS B  2 13  ? -11.695 6.964   -69.150 1.00 94.24  ? 13  LYS B CE    1 
ATOM   1768  N NZ    . LYS B  2 13  ? -12.716 6.144   -68.435 1.00 106.48 ? 13  LYS B NZ    1 
ATOM   1769  N N     . PRO B  2 14  ? -8.348  4.032   -73.048 1.00 36.79  ? 14  PRO B N     1 
ATOM   1770  C CA    . PRO B  2 14  ? -8.317  4.079   -74.519 1.00 36.16  ? 14  PRO B CA    1 
ATOM   1771  C C     . PRO B  2 14  ? -8.725  5.477   -75.022 1.00 38.80  ? 14  PRO B C     1 
ATOM   1772  O O     . PRO B  2 14  ? -9.517  6.145   -74.377 1.00 38.98  ? 14  PRO B O     1 
ATOM   1773  C CB    . PRO B  2 14  ? -9.334  3.029   -74.937 1.00 37.61  ? 14  PRO B CB    1 
ATOM   1774  C CG    . PRO B  2 14  ? -9.697  2.320   -73.761 1.00 42.11  ? 14  PRO B CG    1 
ATOM   1775  C CD    . PRO B  2 14  ? -9.314  3.031   -72.555 1.00 37.48  ? 14  PRO B CD    1 
ATOM   1776  N N     . GLY B  2 15  ? -8.106  5.934   -76.104 1.00 34.79  ? 15  GLY B N     1 
ATOM   1777  C CA    . GLY B  2 15  ? -8.314  7.268   -76.640 1.00 33.57  ? 15  GLY B CA    1 
ATOM   1778  C C     . GLY B  2 15  ? -7.453  8.327   -75.956 1.00 37.48  ? 15  GLY B C     1 
ATOM   1779  O O     . GLY B  2 15  ? -7.358  9.457   -76.457 1.00 35.75  ? 15  GLY B O     1 
ATOM   1780  N N     . ALA B  2 16  ? -6.832  7.997   -74.792 1.00 33.71  ? 16  ALA B N     1 
ATOM   1781  C CA    . ALA B  2 16  ? -5.993  8.936   -74.060 1.00 32.74  ? 16  ALA B CA    1 
ATOM   1782  C C     . ALA B  2 16  ? -4.551  8.847   -74.561 1.00 36.42  ? 16  ALA B C     1 
ATOM   1783  O O     . ALA B  2 16  ? -4.312  8.306   -75.643 1.00 35.40  ? 16  ALA B O     1 
ATOM   1784  C CB    . ALA B  2 16  ? -6.072  8.696   -72.564 1.00 32.83  ? 16  ALA B CB    1 
ATOM   1785  N N     . SER B  2 17  ? -3.597  9.445   -73.833 1.00 34.58  ? 17  SER B N     1 
ATOM   1786  C CA    . SER B  2 17  ? -2.191  9.436   -74.234 1.00 32.47  ? 17  SER B CA    1 
ATOM   1787  C C     . SER B  2 17  ? -1.295  9.063   -73.076 1.00 33.63  ? 17  SER B C     1 
ATOM   1788  O O     . SER B  2 17  ? -1.647  9.219   -71.921 1.00 31.46  ? 17  SER B O     1 
ATOM   1789  C CB    . SER B  2 17  ? -1.778  10.798  -74.792 1.00 37.07  ? 17  SER B CB    1 
ATOM   1790  O OG    . SER B  2 17  ? -1.804  11.817  -73.808 1.00 40.49  ? 17  SER B OG    1 
ATOM   1791  N N     . VAL B  2 18  ? -0.091  8.631   -73.403 1.00 33.20  ? 18  VAL B N     1 
ATOM   1792  C CA    . VAL B  2 18  ? 0.931   8.340   -72.394 1.00 32.75  ? 18  VAL B CA    1 
ATOM   1793  C C     . VAL B  2 18  ? 2.201   8.996   -72.849 1.00 35.63  ? 18  VAL B C     1 
ATOM   1794  O O     . VAL B  2 18  ? 2.493   9.004   -74.040 1.00 33.39  ? 18  VAL B O     1 
ATOM   1795  C CB    . VAL B  2 18  ? 1.138   6.820   -72.165 1.00 36.18  ? 18  VAL B CB    1 
ATOM   1796  C CG1   . VAL B  2 18  ? 1.506   6.119   -73.460 1.00 32.71  ? 18  VAL B CG1   1 
ATOM   1797  C CG2   . VAL B  2 18  ? 2.197   6.583   -71.067 1.00 36.59  ? 18  VAL B CG2   1 
ATOM   1798  N N     . LYS B  2 19  ? 2.948   9.569   -71.906 1.00 37.22  ? 19  LYS B N     1 
ATOM   1799  C CA    . LYS B  2 19  ? 4.232   10.199  -72.196 1.00 37.34  ? 19  LYS B CA    1 
ATOM   1800  C C     . LYS B  2 19  ? 5.293   9.519   -71.336 1.00 41.80  ? 19  LYS B C     1 
ATOM   1801  O O     . LYS B  2 19  ? 5.256   9.657   -70.123 1.00 44.38  ? 19  LYS B O     1 
ATOM   1802  C CB    . LYS B  2 19  ? 4.217   11.709  -71.973 1.00 38.08  ? 19  LYS B CB    1 
ATOM   1803  C CG    . LYS B  2 19  ? 5.551   12.336  -72.419 1.00 40.03  ? 19  LYS B CG    1 
ATOM   1804  C CD    . LYS B  2 19  ? 5.469   13.810  -72.682 1.00 43.79  ? 19  LYS B CD    1 
ATOM   1805  C CE    . LYS B  2 19  ? 5.212   14.599  -71.402 1.00 58.68  ? 19  LYS B CE    1 
ATOM   1806  N NZ    . LYS B  2 19  ? 4.806   16.002  -71.671 1.00 65.87  ? 19  LYS B NZ    1 
ATOM   1807  N N     . VAL B  2 20  ? 6.211   8.784   -71.964 1.00 36.17  ? 20  VAL B N     1 
ATOM   1808  C CA    . VAL B  2 20  ? 7.281   8.078   -71.276 1.00 36.37  ? 20  VAL B CA    1 
ATOM   1809  C C     . VAL B  2 20  ? 8.568   8.910   -71.377 1.00 40.81  ? 20  VAL B C     1 
ATOM   1810  O O     . VAL B  2 20  ? 8.944   9.317   -72.474 1.00 40.27  ? 20  VAL B O     1 
ATOM   1811  C CB    . VAL B  2 20  ? 7.464   6.643   -71.855 1.00 37.99  ? 20  VAL B CB    1 
ATOM   1812  C CG1   . VAL B  2 20  ? 8.555   5.891   -71.115 1.00 38.84  ? 20  VAL B CG1   1 
ATOM   1813  C CG2   . VAL B  2 20  ? 6.157   5.865   -71.774 1.00 36.72  ? 20  VAL B CG2   1 
ATOM   1814  N N     . SER B  2 21  ? 9.222   9.179   -70.232 1.00 36.40  ? 21  SER B N     1 
ATOM   1815  C CA    . SER B  2 21  ? 10.471  9.931   -70.220 1.00 35.54  ? 21  SER B CA    1 
ATOM   1816  C C     . SER B  2 21  ? 11.656  8.992   -70.086 1.00 37.82  ? 21  SER B C     1 
ATOM   1817  O O     . SER B  2 21  ? 11.532  7.883   -69.582 1.00 35.01  ? 21  SER B O     1 
ATOM   1818  C CB    . SER B  2 21  ? 10.464  10.981  -69.115 1.00 38.23  ? 21  SER B CB    1 
ATOM   1819  O OG    . SER B  2 21  ? 10.698  10.398  -67.847 1.00 47.46  ? 21  SER B OG    1 
ATOM   1820  N N     . CYS B  2 22  ? 12.791  9.424   -70.613 1.00 37.25  ? 22  CYS B N     1 
ATOM   1821  C CA    . CYS B  2 22  ? 14.042  8.700   -70.552 1.00 38.70  ? 22  CYS B CA    1 
ATOM   1822  C C     . CYS B  2 22  ? 15.143  9.685   -70.202 1.00 39.36  ? 22  CYS B C     1 
ATOM   1823  O O     . CYS B  2 22  ? 15.578  10.433  -71.078 1.00 38.73  ? 22  CYS B O     1 
ATOM   1824  C CB    . CYS B  2 22  ? 14.307  8.019   -71.893 1.00 41.05  ? 22  CYS B CB    1 
ATOM   1825  S SG    . CYS B  2 22  ? 15.885  7.140   -71.977 1.00 45.59  ? 22  CYS B SG    1 
ATOM   1826  N N     . LYS B  2 23  ? 15.601  9.686   -68.941 1.00 35.88  ? 23  LYS B N     1 
ATOM   1827  C CA    . LYS B  2 23  ? 16.648  10.603  -68.451 1.00 36.10  ? 23  LYS B CA    1 
ATOM   1828  C C     . LYS B  2 23  ? 18.031  10.010  -68.698 1.00 40.01  ? 23  LYS B C     1 
ATOM   1829  O O     . LYS B  2 23  ? 18.353  8.948   -68.164 1.00 39.22  ? 23  LYS B O     1 
ATOM   1830  C CB    . LYS B  2 23  ? 16.406  10.921  -66.951 1.00 39.26  ? 23  LYS B CB    1 
ATOM   1831  C CG    . LYS B  2 23  ? 17.515  11.657  -66.190 1.00 48.98  ? 23  LYS B CG    1 
ATOM   1832  C CD    . LYS B  2 23  ? 17.906  12.966  -66.779 1.00 61.95  ? 23  LYS B CD    1 
ATOM   1833  C CE    . LYS B  2 23  ? 18.867  13.735  -65.893 1.00 70.12  ? 23  LYS B CE    1 
ATOM   1834  N NZ    . LYS B  2 23  ? 20.077  14.198  -66.638 1.00 79.42  ? 23  LYS B NZ    1 
ATOM   1835  N N     . ALA B  2 24  ? 18.841  10.670  -69.532 1.00 38.90  ? 24  ALA B N     1 
ATOM   1836  C CA    . ALA B  2 24  ? 20.163  10.144  -69.878 1.00 40.07  ? 24  ALA B CA    1 
ATOM   1837  C C     . ALA B  2 24  ? 21.218  10.741  -69.022 1.00 44.57  ? 24  ALA B C     1 
ATOM   1838  O O     . ALA B  2 24  ? 21.140  11.914  -68.738 1.00 44.23  ? 24  ALA B O     1 
ATOM   1839  C CB    . ALA B  2 24  ? 20.487  10.447  -71.311 1.00 41.28  ? 24  ALA B CB    1 
ATOM   1840  N N     . SER B  2 25  ? 22.194  9.941   -68.588 1.00 43.75  ? 25  SER B N     1 
ATOM   1841  C CA    . SER B  2 25  ? 23.326  10.455  -67.815 1.00 45.01  ? 25  SER B CA    1 
ATOM   1842  C C     . SER B  2 25  ? 24.585  9.615   -68.073 1.00 48.02  ? 25  SER B C     1 
ATOM   1843  O O     . SER B  2 25  ? 24.495  8.537   -68.632 1.00 46.82  ? 25  SER B O     1 
ATOM   1844  C CB    . SER B  2 25  ? 22.976  10.562  -66.338 1.00 46.96  ? 25  SER B CB    1 
ATOM   1845  O OG    . SER B  2 25  ? 23.106  9.330   -65.656 1.00 56.39  ? 25  SER B OG    1 
ATOM   1846  N N     . GLY B  2 26  ? 25.741  10.211  -67.820 1.00 46.30  ? 26  GLY B N     1 
ATOM   1847  C CA    . GLY B  2 26  ? 27.039  9.568   -67.963 1.00 45.18  ? 26  GLY B CA    1 
ATOM   1848  C C     . GLY B  2 26  ? 27.639  9.584   -69.349 1.00 46.19  ? 26  GLY B C     1 
ATOM   1849  O O     . GLY B  2 26  ? 28.585  8.842   -69.610 1.00 44.68  ? 26  GLY B O     1 
ATOM   1850  N N     . TYR B  2 27  ? 27.129  10.446  -70.236 1.00 42.12  ? 27  TYR B N     1 
ATOM   1851  C CA    . TYR B  2 27  ? 27.610  10.524  -71.614 1.00 41.09  ? 27  TYR B CA    1 
ATOM   1852  C C     . TYR B  2 27  ? 27.165  11.828  -72.237 1.00 46.22  ? 27  TYR B C     1 
ATOM   1853  O O     . TYR B  2 27  ? 26.388  12.538  -71.630 1.00 45.26  ? 27  TYR B O     1 
ATOM   1854  C CB    . TYR B  2 27  ? 27.136  9.305   -72.438 1.00 41.13  ? 27  TYR B CB    1 
ATOM   1855  C CG    . TYR B  2 27  ? 25.673  9.270   -72.843 1.00 41.72  ? 27  TYR B CG    1 
ATOM   1856  C CD1   . TYR B  2 27  ? 24.728  8.628   -72.057 1.00 43.48  ? 27  TYR B CD1   1 
ATOM   1857  C CD2   . TYR B  2 27  ? 25.268  9.724   -74.089 1.00 43.47  ? 27  TYR B CD2   1 
ATOM   1858  C CE1   . TYR B  2 27  ? 23.404  8.480   -72.482 1.00 43.03  ? 27  TYR B CE1   1 
ATOM   1859  C CE2   . TYR B  2 27  ? 23.928  9.682   -74.480 1.00 43.79  ? 27  TYR B CE2   1 
ATOM   1860  C CZ    . TYR B  2 27  ? 22.994  9.057   -73.672 1.00 48.15  ? 27  TYR B CZ    1 
ATOM   1861  O OH    . TYR B  2 27  ? 21.686  8.961   -74.073 1.00 44.72  ? 27  TYR B OH    1 
ATOM   1862  N N     . THR B  2 28  ? 27.651  12.138  -73.444 1.00 46.29  ? 28  THR B N     1 
ATOM   1863  C CA    . THR B  2 28  ? 27.312  13.359  -74.159 1.00 45.88  ? 28  THR B CA    1 
ATOM   1864  C C     . THR B  2 28  ? 26.005  13.087  -74.853 1.00 49.80  ? 28  THR B C     1 
ATOM   1865  O O     . THR B  2 28  ? 25.990  12.415  -75.875 1.00 50.35  ? 28  THR B O     1 
ATOM   1866  C CB    . THR B  2 28  ? 28.431  13.772  -75.141 1.00 49.62  ? 28  THR B CB    1 
ATOM   1867  O OG1   . THR B  2 28  ? 29.641  13.958  -74.415 1.00 52.36  ? 28  THR B OG1   1 
ATOM   1868  C CG2   . THR B  2 28  ? 28.106  15.073  -75.884 1.00 41.61  ? 28  THR B CG2   1 
ATOM   1869  N N     . PHE B  2 29  ? 24.901  13.566  -74.255 1.00 45.24  ? 29  PHE B N     1 
ATOM   1870  C CA    . PHE B  2 29  ? 23.513  13.409  -74.732 1.00 41.81  ? 29  PHE B CA    1 
ATOM   1871  C C     . PHE B  2 29  ? 23.318  13.601  -76.219 1.00 43.94  ? 29  PHE B C     1 
ATOM   1872  O O     . PHE B  2 29  ? 22.612  12.856  -76.858 1.00 41.69  ? 29  PHE B O     1 
ATOM   1873  C CB    . PHE B  2 29  ? 22.575  14.386  -73.976 1.00 42.76  ? 29  PHE B CB    1 
ATOM   1874  C CG    . PHE B  2 29  ? 21.094  14.207  -74.270 1.00 42.14  ? 29  PHE B CG    1 
ATOM   1875  C CD1   . PHE B  2 29  ? 20.451  13.008  -73.988 1.00 41.13  ? 29  PHE B CD1   1 
ATOM   1876  C CD2   . PHE B  2 29  ? 20.348  15.243  -74.803 1.00 41.14  ? 29  PHE B CD2   1 
ATOM   1877  C CE1   . PHE B  2 29  ? 19.091  12.852  -74.229 1.00 40.70  ? 29  PHE B CE1   1 
ATOM   1878  C CE2   . PHE B  2 29  ? 18.993  15.080  -75.057 1.00 42.92  ? 29  PHE B CE2   1 
ATOM   1879  C CZ    . PHE B  2 29  ? 18.378  13.869  -74.807 1.00 39.40  ? 29  PHE B CZ    1 
ATOM   1880  N N     . THR B  2 30  ? 23.935  14.589  -76.757 1.00 46.17  ? 30  THR B N     1 
ATOM   1881  C CA    . THR B  2 30  ? 23.775  14.957  -78.157 1.00 46.00  ? 30  THR B CA    1 
ATOM   1882  C C     . THR B  2 30  ? 24.584  14.061  -79.137 1.00 50.28  ? 30  THR B C     1 
ATOM   1883  O O     . THR B  2 30  ? 24.342  14.146  -80.334 1.00 51.37  ? 30  THR B O     1 
ATOM   1884  C CB    . THR B  2 30  ? 24.059  16.474  -78.258 1.00 56.63  ? 30  THR B CB    1 
ATOM   1885  O OG1   . THR B  2 30  ? 23.457  17.000  -79.417 1.00 67.96  ? 30  THR B OG1   1 
ATOM   1886  C CG2   . THR B  2 30  ? 25.479  16.831  -78.172 1.00 50.57  ? 30  THR B CG2   1 
ATOM   1887  N N     . ASN B  2 31  ? 25.469  13.162  -78.667 1.00 45.20  ? 31  ASN B N     1 
ATOM   1888  C CA    . ASN B  2 31  ? 26.202  12.274  -79.581 1.00 45.14  ? 31  ASN B CA    1 
ATOM   1889  C C     . ASN B  2 31  ? 25.516  10.922  -79.860 1.00 48.09  ? 31  ASN B C     1 
ATOM   1890  O O     . ASN B  2 31  ? 26.123  10.039  -80.499 1.00 46.87  ? 31  ASN B O     1 
ATOM   1891  C CB    . ASN B  2 31  ? 27.606  12.038  -79.036 1.00 49.96  ? 31  ASN B CB    1 
ATOM   1892  C CG    . ASN B  2 31  ? 28.500  13.247  -79.104 1.00 58.41  ? 31  ASN B CG    1 
ATOM   1893  O OD1   . ASN B  2 31  ? 28.233  14.231  -79.821 1.00 53.44  ? 31  ASN B OD1   1 
ATOM   1894  N ND2   . ASN B  2 31  ? 29.605  13.178  -78.367 1.00 52.59  ? 31  ASN B ND2   1 
ATOM   1895  N N     . TYR B  2 32  ? 24.264  10.738  -79.372 1.00 42.91  ? 32  TYR B N     1 
ATOM   1896  C CA    . TYR B  2 32  ? 23.568  9.480   -79.533 1.00 41.08  ? 32  TYR B CA    1 
ATOM   1897  C C     . TYR B  2 32  ? 22.175  9.713   -79.895 1.00 42.30  ? 32  TYR B C     1 
ATOM   1898  O O     . TYR B  2 32  ? 21.522  10.555  -79.291 1.00 39.54  ? 32  TYR B O     1 
ATOM   1899  C CB    . TYR B  2 32  ? 23.609  8.643   -78.229 1.00 40.68  ? 32  TYR B CB    1 
ATOM   1900  C CG    . TYR B  2 32  ? 24.992  8.136   -77.875 1.00 41.67  ? 32  TYR B CG    1 
ATOM   1901  C CD1   . TYR B  2 32  ? 25.970  8.996   -77.394 1.00 43.87  ? 32  TYR B CD1   1 
ATOM   1902  C CD2   . TYR B  2 32  ? 25.340  6.803   -78.073 1.00 43.03  ? 32  TYR B CD2   1 
ATOM   1903  C CE1   . TYR B  2 32  ? 27.277  8.564   -77.186 1.00 43.42  ? 32  TYR B CE1   1 
ATOM   1904  C CE2   . TYR B  2 32  ? 26.647  6.365   -77.900 1.00 44.81  ? 32  TYR B CE2   1 
ATOM   1905  C CZ    . TYR B  2 32  ? 27.611  7.242   -77.434 1.00 50.32  ? 32  TYR B CZ    1 
ATOM   1906  O OH    . TYR B  2 32  ? 28.875  6.755   -77.205 1.00 49.48  ? 32  TYR B OH    1 
ATOM   1907  N N     . TYR B  2 33  ? 21.668  8.884   -80.808 1.00 41.86  ? 33  TYR B N     1 
ATOM   1908  C CA    . TYR B  2 33  ? 20.256  8.891   -81.131 1.00 42.42  ? 33  TYR B CA    1 
ATOM   1909  C C     . TYR B  2 33  ? 19.560  8.192   -79.950 1.00 42.21  ? 33  TYR B C     1 
ATOM   1910  O O     . TYR B  2 33  ? 20.162  7.329   -79.290 1.00 38.99  ? 33  TYR B O     1 
ATOM   1911  C CB    . TYR B  2 33  ? 19.969  8.023   -82.352 1.00 44.84  ? 33  TYR B CB    1 
ATOM   1912  C CG    . TYR B  2 33  ? 20.530  8.500   -83.663 1.00 50.22  ? 33  TYR B CG    1 
ATOM   1913  C CD1   . TYR B  2 33  ? 20.132  9.704   -84.207 1.00 54.92  ? 33  TYR B CD1   1 
ATOM   1914  C CD2   . TYR B  2 33  ? 21.322  7.672   -84.448 1.00 51.10  ? 33  TYR B CD2   1 
ATOM   1915  C CE1   . TYR B  2 33  ? 20.647  10.159  -85.414 1.00 59.95  ? 33  TYR B CE1   1 
ATOM   1916  C CE2   . TYR B  2 33  ? 21.817  8.100   -85.679 1.00 52.25  ? 33  TYR B CE2   1 
ATOM   1917  C CZ    . TYR B  2 33  ? 21.456  9.340   -86.170 1.00 64.94  ? 33  TYR B CZ    1 
ATOM   1918  O OH    . TYR B  2 33  ? 21.961  9.849   -87.346 1.00 69.49  ? 33  TYR B OH    1 
ATOM   1919  N N     . MET B  2 34  ? 18.292  8.522   -79.732 1.00 36.63  ? 34  MET B N     1 
ATOM   1920  C CA    . MET B  2 34  ? 17.467  7.815   -78.771 1.00 33.86  ? 34  MET B CA    1 
ATOM   1921  C C     . MET B  2 34  ? 16.386  7.135   -79.531 1.00 34.40  ? 34  MET B C     1 
ATOM   1922  O O     . MET B  2 34  ? 15.676  7.762   -80.304 1.00 31.60  ? 34  MET B O     1 
ATOM   1923  C CB    . MET B  2 34  ? 16.884  8.712   -77.700 1.00 36.35  ? 34  MET B CB    1 
ATOM   1924  C CG    . MET B  2 34  ? 16.344  7.901   -76.517 1.00 39.41  ? 34  MET B CG    1 
ATOM   1925  S SD    . MET B  2 34  ? 17.733  7.215   -75.536 1.00 43.50  ? 34  MET B SD    1 
ATOM   1926  C CE    . MET B  2 34  ? 18.256  8.730   -74.664 1.00 42.27  ? 34  MET B CE    1 
ATOM   1927  N N     . TYR B  2 35  ? 16.259  5.835   -79.290 1.00 33.21  ? 35  TYR B N     1 
ATOM   1928  C CA    . TYR B  2 35  ? 15.308  4.950   -79.907 1.00 34.23  ? 35  TYR B CA    1 
ATOM   1929  C C     . TYR B  2 35  ? 14.333  4.456   -78.921 1.00 36.63  ? 35  TYR B C     1 
ATOM   1930  O O     . TYR B  2 35  ? 14.659  4.383   -77.749 1.00 34.40  ? 35  TYR B O     1 
ATOM   1931  C CB    . TYR B  2 35  ? 16.054  3.767   -80.473 1.00 39.94  ? 35  TYR B CB    1 
ATOM   1932  C CG    . TYR B  2 35  ? 16.707  4.097   -81.787 1.00 48.22  ? 35  TYR B CG    1 
ATOM   1933  C CD1   . TYR B  2 35  ? 17.893  4.817   -81.842 1.00 52.94  ? 35  TYR B CD1   1 
ATOM   1934  C CD2   . TYR B  2 35  ? 16.105  3.765   -82.973 1.00 51.30  ? 35  TYR B CD2   1 
ATOM   1935  C CE1   . TYR B  2 35  ? 18.497  5.113   -83.061 1.00 55.21  ? 35  TYR B CE1   1 
ATOM   1936  C CE2   . TYR B  2 35  ? 16.704  4.045   -84.198 1.00 53.92  ? 35  TYR B CE2   1 
ATOM   1937  C CZ    . TYR B  2 35  ? 17.918  4.687   -84.234 1.00 56.22  ? 35  TYR B CZ    1 
ATOM   1938  O OH    . TYR B  2 35  ? 18.533  4.889   -85.430 1.00 59.23  ? 35  TYR B OH    1 
ATOM   1939  N N     . TRP B  2 36  ? 13.125  4.069   -79.410 1.00 33.86  ? 36  TRP B N     1 
ATOM   1940  C CA    . TRP B  2 36  ? 12.044  3.559   -78.587 1.00 32.55  ? 36  TRP B CA    1 
ATOM   1941  C C     . TRP B  2 36  ? 11.615  2.257   -79.150 1.00 34.63  ? 36  TRP B C     1 
ATOM   1942  O O     . TRP B  2 36  ? 11.410  2.148   -80.344 1.00 33.67  ? 36  TRP B O     1 
ATOM   1943  C CB    . TRP B  2 36  ? 10.896  4.567   -78.538 1.00 31.00  ? 36  TRP B CB    1 
ATOM   1944  C CG    . TRP B  2 36  ? 11.364  5.844   -77.920 1.00 31.70  ? 36  TRP B CG    1 
ATOM   1945  C CD1   . TRP B  2 36  ? 11.927  6.914   -78.543 1.00 34.51  ? 36  TRP B CD1   1 
ATOM   1946  C CD2   . TRP B  2 36  ? 11.376  6.133   -76.527 1.00 31.63  ? 36  TRP B CD2   1 
ATOM   1947  N NE1   . TRP B  2 36  ? 12.258  7.879   -77.620 1.00 34.25  ? 36  TRP B NE1   1 
ATOM   1948  C CE2   . TRP B  2 36  ? 11.885  7.442   -76.376 1.00 35.00  ? 36  TRP B CE2   1 
ATOM   1949  C CE3   . TRP B  2 36  ? 10.845  5.482   -75.405 1.00 33.17  ? 36  TRP B CE3   1 
ATOM   1950  C CZ2   . TRP B  2 36  ? 11.979  8.059   -75.140 1.00 34.23  ? 36  TRP B CZ2   1 
ATOM   1951  C CZ3   . TRP B  2 36  ? 10.932  6.111   -74.173 1.00 35.18  ? 36  TRP B CZ3   1 
ATOM   1952  C CH2   . TRP B  2 36  ? 11.458  7.399   -74.059 1.00 35.51  ? 36  TRP B CH2   1 
ATOM   1953  N N     . VAL B  2 37  ? 11.576  1.251   -78.295 1.00 32.61  ? 37  VAL B N     1 
ATOM   1954  C CA    . VAL B  2 37  ? 11.247  -0.110  -78.633 1.00 31.63  ? 37  VAL B CA    1 
ATOM   1955  C C     . VAL B  2 37  ? 10.221  -0.613  -77.627 1.00 35.01  ? 37  VAL B C     1 
ATOM   1956  O O     . VAL B  2 37  ? 10.387  -0.391  -76.431 1.00 33.49  ? 37  VAL B O     1 
ATOM   1957  C CB    . VAL B  2 37  ? 12.560  -0.985  -78.644 1.00 34.06  ? 37  VAL B CB    1 
ATOM   1958  C CG1   . VAL B  2 37  ? 12.271  -2.465  -78.814 1.00 33.95  ? 37  VAL B CG1   1 
ATOM   1959  C CG2   . VAL B  2 37  ? 13.527  -0.516  -79.716 1.00 33.49  ? 37  VAL B CG2   1 
ATOM   1960  N N     . ARG B  2 38  ? 9.179   -1.319  -78.100 1.00 31.19  ? 38  ARG B N     1 
ATOM   1961  C CA    . ARG B  2 38  ? 8.220   -1.909  -77.182 1.00 31.29  ? 38  ARG B CA    1 
ATOM   1962  C C     . ARG B  2 38  ? 8.159   -3.431  -77.274 1.00 31.54  ? 38  ARG B C     1 
ATOM   1963  O O     . ARG B  2 38  ? 8.588   -4.031  -78.244 1.00 30.01  ? 38  ARG B O     1 
ATOM   1964  C CB    . ARG B  2 38  ? 6.836   -1.307  -77.348 1.00 32.31  ? 38  ARG B CB    1 
ATOM   1965  C CG    . ARG B  2 38  ? 6.065   -1.790  -78.577 1.00 32.08  ? 38  ARG B CG    1 
ATOM   1966  C CD    . ARG B  2 38  ? 4.731   -1.118  -78.564 1.00 34.71  ? 38  ARG B CD    1 
ATOM   1967  N NE    . ARG B  2 38  ? 3.824   -1.684  -79.534 1.00 40.61  ? 38  ARG B NE    1 
ATOM   1968  C CZ    . ARG B  2 38  ? 2.597   -1.249  -79.768 1.00 48.37  ? 38  ARG B CZ    1 
ATOM   1969  N NH1   . ARG B  2 38  ? 2.113   -0.199  -79.104 1.00 37.58  ? 38  ARG B NH1   1 
ATOM   1970  N NH2   . ARG B  2 38  ? 1.848   -1.841  -80.678 1.00 38.86  ? 38  ARG B NH2   1 
ATOM   1971  N N     . GLN B  2 39  ? 7.636   -4.025  -76.233 1.00 29.88  ? 39  GLN B N     1 
ATOM   1972  C CA    . GLN B  2 39  ? 7.390   -5.464  -76.115 1.00 30.36  ? 39  GLN B CA    1 
ATOM   1973  C C     . GLN B  2 39  ? 6.004   -5.705  -75.576 1.00 34.81  ? 39  GLN B C     1 
ATOM   1974  O O     . GLN B  2 39  ? 5.755   -5.567  -74.381 1.00 33.82  ? 39  GLN B O     1 
ATOM   1975  C CB    . GLN B  2 39  ? 8.434   -6.164  -75.239 1.00 30.83  ? 39  GLN B CB    1 
ATOM   1976  C CG    . GLN B  2 39  ? 8.379   -7.671  -75.410 1.00 41.11  ? 39  GLN B CG    1 
ATOM   1977  C CD    . GLN B  2 39  ? 9.561   -8.388  -74.829 1.00 44.67  ? 39  GLN B CD    1 
ATOM   1978  O OE1   . GLN B  2 39  ? 10.115  -7.983  -73.830 1.00 40.19  ? 39  GLN B OE1   1 
ATOM   1979  N NE2   . GLN B  2 39  ? 9.918   -9.511  -75.404 1.00 41.61  ? 39  GLN B NE2   1 
ATOM   1980  N N     . ALA B  2 40  ? 5.081   -6.025  -76.476 1.00 33.97  ? 40  ALA B N     1 
ATOM   1981  C CA    . ALA B  2 40  ? 3.689   -6.306  -76.076 1.00 33.63  ? 40  ALA B CA    1 
ATOM   1982  C C     . ALA B  2 40  ? 3.581   -7.701  -75.478 1.00 35.26  ? 40  ALA B C     1 
ATOM   1983  O O     . ALA B  2 40  ? 4.453   -8.530  -75.715 1.00 32.26  ? 40  ALA B O     1 
ATOM   1984  C CB    . ALA B  2 40  ? 2.739   -6.143  -77.259 1.00 34.07  ? 40  ALA B CB    1 
ATOM   1985  N N     . PRO B  2 41  ? 2.541   -7.965  -74.661 1.00 35.12  ? 41  PRO B N     1 
ATOM   1986  C CA    . PRO B  2 41  ? 2.418   -9.295  -74.011 1.00 36.32  ? 41  PRO B CA    1 
ATOM   1987  C C     . PRO B  2 41  ? 2.375   -10.474 -74.998 1.00 40.14  ? 41  PRO B C     1 
ATOM   1988  O O     . PRO B  2 41  ? 1.650   -10.448 -75.972 1.00 38.42  ? 41  PRO B O     1 
ATOM   1989  C CB    . PRO B  2 41  ? 1.107   -9.198  -73.206 1.00 37.12  ? 41  PRO B CB    1 
ATOM   1990  C CG    . PRO B  2 41  ? 0.679   -7.848  -73.257 1.00 40.43  ? 41  PRO B CG    1 
ATOM   1991  C CD    . PRO B  2 41  ? 1.457   -7.062  -74.256 1.00 36.55  ? 41  PRO B CD    1 
ATOM   1992  N N     . GLY B  2 42  ? 3.172   -11.476 -74.732 1.00 41.17  ? 42  GLY B N     1 
ATOM   1993  C CA    . GLY B  2 42  ? 3.345   -12.622 -75.624 1.00 43.77  ? 42  GLY B CA    1 
ATOM   1994  C C     . GLY B  2 42  ? 4.019   -12.322 -76.960 1.00 50.59  ? 42  GLY B C     1 
ATOM   1995  O O     . GLY B  2 42  ? 3.843   -13.080 -77.917 1.00 51.75  ? 42  GLY B O     1 
ATOM   1996  N N     . GLN B  2 43  ? 4.769   -11.189 -77.065 1.00 43.80  ? 43  GLN B N     1 
ATOM   1997  C CA    . GLN B  2 43  ? 5.366   -10.751 -78.317 1.00 39.77  ? 43  GLN B CA    1 
ATOM   1998  C C     . GLN B  2 43  ? 6.834   -10.559 -78.191 1.00 39.03  ? 43  GLN B C     1 
ATOM   1999  O O     . GLN B  2 43  ? 7.402   -10.536 -77.092 1.00 38.06  ? 43  GLN B O     1 
ATOM   2000  C CB    . GLN B  2 43  ? 4.757   -9.396  -78.775 1.00 41.08  ? 43  GLN B CB    1 
ATOM   2001  C CG    . GLN B  2 43  ? 3.242   -9.323  -78.821 1.00 48.21  ? 43  GLN B CG    1 
ATOM   2002  C CD    . GLN B  2 43  ? 2.709   -10.529 -79.574 1.00 63.34  ? 43  GLN B CD    1 
ATOM   2003  O OE1   . GLN B  2 43  ? 3.178   -10.845 -80.672 1.00 55.16  ? 43  GLN B OE1   1 
ATOM   2004  N NE2   . GLN B  2 43  ? 1.769   -11.258 -79.000 1.00 50.08  ? 43  GLN B NE2   1 
ATOM   2005  N N     . GLY B  2 44  ? 7.429   -10.303 -79.338 1.00 34.38  ? 44  GLY B N     1 
ATOM   2006  C CA    . GLY B  2 44  ? 8.835   -9.947  -79.430 1.00 33.91  ? 44  GLY B CA    1 
ATOM   2007  C C     . GLY B  2 44  ? 9.012   -8.457  -79.306 1.00 36.26  ? 44  GLY B C     1 
ATOM   2008  O O     . GLY B  2 44  ? 8.118   -7.742  -78.835 1.00 37.41  ? 44  GLY B O     1 
ATOM   2009  N N     . LEU B  2 45  ? 10.115  -7.975  -79.831 1.00 32.50  ? 45  LEU B N     1 
ATOM   2010  C CA    . LEU B  2 45  ? 10.493  -6.558  -79.826 1.00 31.12  ? 45  LEU B CA    1 
ATOM   2011  C C     . LEU B  2 45  ? 10.021  -5.823  -81.063 1.00 35.73  ? 45  LEU B C     1 
ATOM   2012  O O     . LEU B  2 45  ? 10.235  -6.284  -82.179 1.00 37.26  ? 45  LEU B O     1 
ATOM   2013  C CB    . LEU B  2 45  ? 12.013  -6.449  -79.703 1.00 30.73  ? 45  LEU B CB    1 
ATOM   2014  C CG    . LEU B  2 45  ? 12.608  -7.102  -78.467 1.00 34.21  ? 45  LEU B CG    1 
ATOM   2015  C CD1   . LEU B  2 45  ? 14.099  -7.199  -78.590 1.00 35.17  ? 45  LEU B CD1   1 
ATOM   2016  C CD2   . LEU B  2 45  ? 12.181  -6.343  -77.202 1.00 35.68  ? 45  LEU B CD2   1 
ATOM   2017  N N     . GLU B  2 46  ? 9.517   -4.603  -80.870 1.00 32.98  ? 46  GLU B N     1 
ATOM   2018  C CA    . GLU B  2 46  ? 9.031   -3.767  -81.961 1.00 31.89  ? 46  GLU B CA    1 
ATOM   2019  C C     . GLU B  2 46  ? 9.630   -2.376  -81.944 1.00 34.59  ? 46  GLU B C     1 
ATOM   2020  O O     . GLU B  2 46  ? 9.457   -1.654  -80.969 1.00 34.59  ? 46  GLU B O     1 
ATOM   2021  C CB    . GLU B  2 46  ? 7.521   -3.718  -81.866 1.00 33.27  ? 46  GLU B CB    1 
ATOM   2022  C CG    . GLU B  2 46  ? 6.823   -3.023  -83.008 1.00 45.15  ? 46  GLU B CG    1 
ATOM   2023  C CD    . GLU B  2 46  ? 5.313   -3.117  -82.902 1.00 64.82  ? 46  GLU B CD    1 
ATOM   2024  O OE1   . GLU B  2 46  ? 4.791   -3.509  -81.830 1.00 71.78  ? 46  GLU B OE1   1 
ATOM   2025  O OE2   . GLU B  2 46  ? 4.645   -2.756  -83.894 1.00 62.37  ? 46  GLU B OE2   1 
ATOM   2026  N N     . TRP B  2 47  ? 10.302  -1.971  -83.040 1.00 32.14  ? 47  TRP B N     1 
ATOM   2027  C CA    . TRP B  2 47  ? 10.854  -0.629  -83.132 1.00 34.70  ? 47  TRP B CA    1 
ATOM   2028  C C     . TRP B  2 47  ? 9.749   0.376   -83.357 1.00 39.03  ? 47  TRP B C     1 
ATOM   2029  O O     . TRP B  2 47  ? 8.902   0.163   -84.220 1.00 40.36  ? 47  TRP B O     1 
ATOM   2030  C CB    . TRP B  2 47  ? 11.900  -0.548  -84.268 1.00 34.98  ? 47  TRP B CB    1 
ATOM   2031  C CG    . TRP B  2 47  ? 12.376  0.831   -84.523 1.00 36.63  ? 47  TRP B CG    1 
ATOM   2032  C CD1   . TRP B  2 47  ? 13.183  1.575   -83.722 1.00 39.67  ? 47  TRP B CD1   1 
ATOM   2033  C CD2   . TRP B  2 47  ? 12.131  1.621   -85.691 1.00 37.43  ? 47  TRP B CD2   1 
ATOM   2034  N NE1   . TRP B  2 47  ? 13.414  2.802   -84.300 1.00 40.39  ? 47  TRP B NE1   1 
ATOM   2035  C CE2   . TRP B  2 47  ? 12.835  2.832   -85.532 1.00 41.38  ? 47  TRP B CE2   1 
ATOM   2036  C CE3   . TRP B  2 47  ? 11.427  1.411   -86.879 1.00 38.87  ? 47  TRP B CE3   1 
ATOM   2037  C CZ2   . TRP B  2 47  ? 12.831  3.832   -86.491 1.00 39.69  ? 47  TRP B CZ2   1 
ATOM   2038  C CZ3   . TRP B  2 47  ? 11.450  2.408   -87.841 1.00 39.84  ? 47  TRP B CZ3   1 
ATOM   2039  C CH2   . TRP B  2 47  ? 12.063  3.631   -87.597 1.00 39.86  ? 47  TRP B CH2   1 
ATOM   2040  N N     . MET B  2 48  ? 9.742   1.471   -82.581 1.00 34.49  ? 48  MET B N     1 
ATOM   2041  C CA    . MET B  2 48  ? 8.718   2.519   -82.725 1.00 33.91  ? 48  MET B CA    1 
ATOM   2042  C C     . MET B  2 48  ? 9.229   3.706   -83.482 1.00 38.95  ? 48  MET B C     1 
ATOM   2043  O O     . MET B  2 48  ? 8.579   4.176   -84.402 1.00 40.51  ? 48  MET B O     1 
ATOM   2044  C CB    . MET B  2 48  ? 8.190   2.944   -81.364 1.00 35.50  ? 48  MET B CB    1 
ATOM   2045  C CG    . MET B  2 48  ? 7.388   1.814   -80.663 1.00 39.62  ? 48  MET B CG    1 
ATOM   2046  S SD    . MET B  2 48  ? 7.066   2.367   -79.035 1.00 45.86  ? 48  MET B SD    1 
ATOM   2047  C CE    . MET B  2 48  ? 5.554   3.574   -79.402 1.00 42.04  ? 48  MET B CE    1 
ATOM   2048  N N     . GLY B  2 49  ? 10.390  4.180   -83.109 1.00 34.32  ? 49  GLY B N     1 
ATOM   2049  C CA    . GLY B  2 49  ? 10.984  5.345   -83.763 1.00 32.65  ? 49  GLY B CA    1 
ATOM   2050  C C     . GLY B  2 49  ? 12.274  5.761   -83.109 1.00 36.02  ? 49  GLY B C     1 
ATOM   2051  O O     . GLY B  2 49  ? 12.747  5.115   -82.180 1.00 35.69  ? 49  GLY B O     1 
ATOM   2052  N N     . GLY B  2 50  ? 12.860  6.818   -83.628 1.00 36.03  ? 50  GLY B N     1 
ATOM   2053  C CA    . GLY B  2 50  ? 14.110  7.377   -83.124 1.00 33.87  ? 50  GLY B CA    1 
ATOM   2054  C C     . GLY B  2 50  ? 14.203  8.855   -83.376 1.00 35.93  ? 50  GLY B C     1 
ATOM   2055  O O     . GLY B  2 50  ? 13.556  9.375   -84.289 1.00 35.68  ? 50  GLY B O     1 
ATOM   2056  N N     . ILE B  2 51  ? 14.977  9.532   -82.545 1.00 32.22  ? 51  ILE B N     1 
ATOM   2057  C CA    . ILE B  2 51  ? 15.207  10.962  -82.630 1.00 32.40  ? 51  ILE B CA    1 
ATOM   2058  C C     . ILE B  2 51  ? 16.710  11.268  -82.499 1.00 37.52  ? 51  ILE B C     1 
ATOM   2059  O O     . ILE B  2 51  ? 17.444  10.583  -81.793 1.00 37.33  ? 51  ILE B O     1 
ATOM   2060  C CB    . ILE B  2 51  ? 14.375  11.740  -81.551 1.00 35.31  ? 51  ILE B CB    1 
ATOM   2061  C CG1   . ILE B  2 51  ? 14.498  13.275  -81.783 1.00 34.47  ? 51  ILE B CG1   1 
ATOM   2062  C CG2   . ILE B  2 51  ? 14.788  11.335  -80.088 1.00 33.14  ? 51  ILE B CG2   1 
ATOM   2063  C CD1   . ILE B  2 51  ? 13.493  14.108  -81.130 1.00 38.59  ? 51  ILE B CD1   1 
ATOM   2064  N N     . ASN B  2 52  ? 17.126  12.338  -83.142 1.00 36.45  ? 52  ASN B N     1 
ATOM   2065  C CA    . ASN B  2 52  ? 18.470  12.854  -83.086 1.00 37.76  ? 52  ASN B CA    1 
ATOM   2066  C C     . ASN B  2 52  ? 18.417  14.050  -82.161 1.00 41.83  ? 52  ASN B C     1 
ATOM   2067  O O     . ASN B  2 52  ? 17.873  15.048  -82.559 1.00 40.33  ? 52  ASN B O     1 
ATOM   2068  C CB    . ASN B  2 52  ? 18.925  13.263  -84.479 1.00 36.23  ? 52  ASN B CB    1 
ATOM   2069  C CG    . ASN B  2 52  ? 20.361  13.698  -84.549 1.00 50.37  ? 52  ASN B CG    1 
ATOM   2070  O OD1   . ASN B  2 52  ? 21.026  13.949  -83.540 1.00 44.22  ? 52  ASN B OD1   1 
ATOM   2071  N ND2   . ASN B  2 52  ? 20.883  13.771  -85.754 1.00 46.83  ? 52  ASN B ND2   1 
ATOM   2072  N N     . PRO B  2 53  ? 18.965  13.969  -80.922 1.00 40.87  ? 53  PRO B N     1 
ATOM   2073  C CA    . PRO B  2 53  ? 18.912  15.123  -80.007 1.00 40.41  ? 53  PRO B CA    1 
ATOM   2074  C C     . PRO B  2 53  ? 19.653  16.372  -80.439 1.00 47.58  ? 53  PRO B C     1 
ATOM   2075  O O     . PRO B  2 53  ? 19.349  17.441  -79.897 1.00 47.13  ? 53  PRO B O     1 
ATOM   2076  C CB    . PRO B  2 53  ? 19.500  14.566  -78.699 1.00 41.50  ? 53  PRO B CB    1 
ATOM   2077  C CG    . PRO B  2 53  ? 19.313  13.044  -78.811 1.00 45.05  ? 53  PRO B CG    1 
ATOM   2078  C CD    . PRO B  2 53  ? 19.577  12.798  -80.262 1.00 41.15  ? 53  PRO B CD    1 
ATOM   2079  N N     . SER B  2 54  ? 20.656  16.265  -81.343 1.00 46.22  ? 54  SER B N     1 
ATOM   2080  C CA    . SER B  2 54  ? 21.385  17.466  -81.784 1.00 46.09  ? 54  SER B CA    1 
ATOM   2081  C C     . SER B  2 54  ? 20.499  18.336  -82.670 1.00 46.40  ? 54  SER B C     1 
ATOM   2082  O O     . SER B  2 54  ? 20.516  19.537  -82.506 1.00 46.22  ? 54  SER B O     1 
ATOM   2083  C CB    . SER B  2 54  ? 22.694  17.110  -82.496 1.00 49.96  ? 54  SER B CB    1 
ATOM   2084  O OG    . SER B  2 54  ? 22.384  16.505  -83.739 1.00 64.77  ? 54  SER B OG    1 
ATOM   2085  N N     . ASN B  2 55  ? 19.684  17.763  -83.537 1.00 41.55  ? 55  ASN B N     1 
ATOM   2086  C CA    . ASN B  2 55  ? 18.849  18.604  -84.409 1.00 41.01  ? 55  ASN B CA    1 
ATOM   2087  C C     . ASN B  2 55  ? 17.339  18.282  -84.443 1.00 41.95  ? 55  ASN B C     1 
ATOM   2088  O O     . ASN B  2 55  ? 16.628  18.885  -85.240 1.00 42.95  ? 55  ASN B O     1 
ATOM   2089  C CB    . ASN B  2 55  ? 19.416  18.549  -85.825 1.00 41.19  ? 55  ASN B CB    1 
ATOM   2090  C CG    . ASN B  2 55  ? 19.308  17.188  -86.477 1.00 48.79  ? 55  ASN B CG    1 
ATOM   2091  O OD1   . ASN B  2 55  ? 18.449  16.369  -86.181 1.00 49.96  ? 55  ASN B OD1   1 
ATOM   2092  N ND2   . ASN B  2 55  ? 20.256  16.857  -87.271 1.00 47.27  ? 55  ASN B ND2   1 
ATOM   2093  N N     . GLY B  2 56  ? 16.881  17.282  -83.698 1.00 36.55  ? 56  GLY B N     1 
ATOM   2094  C CA    . GLY B  2 56  ? 15.476  16.917  -83.679 1.00 34.69  ? 56  GLY B CA    1 
ATOM   2095  C C     . GLY B  2 56  ? 14.953  16.119  -84.842 1.00 39.20  ? 56  GLY B C     1 
ATOM   2096  O O     . GLY B  2 56  ? 13.740  15.919  -84.937 1.00 37.43  ? 56  GLY B O     1 
ATOM   2097  N N     . GLY B  2 57  ? 15.834  15.607  -85.700 1.00 37.24  ? 57  GLY B N     1 
ATOM   2098  C CA    . GLY B  2 57  ? 15.377  14.787  -86.811 1.00 36.43  ? 57  GLY B CA    1 
ATOM   2099  C C     . GLY B  2 57  ? 14.841  13.458  -86.311 1.00 38.08  ? 57  GLY B C     1 
ATOM   2100  O O     . GLY B  2 57  ? 15.356  12.918  -85.340 1.00 34.37  ? 57  GLY B O     1 
ATOM   2101  N N     . THR B  2 58  ? 13.768  12.947  -86.928 1.00 37.84  ? 58  THR B N     1 
ATOM   2102  C CA    . THR B  2 58  ? 13.142  11.713  -86.483 1.00 38.82  ? 58  THR B CA    1 
ATOM   2103  C C     . THR B  2 58  ? 12.885  10.721  -87.601 1.00 43.77  ? 58  THR B C     1 
ATOM   2104  O O     . THR B  2 58  ? 12.816  11.077  -88.778 1.00 42.51  ? 58  THR B O     1 
ATOM   2105  C CB    . THR B  2 58  ? 11.774  11.998  -85.811 1.00 43.38  ? 58  THR B CB    1 
ATOM   2106  O OG1   . THR B  2 58  ? 10.947  12.692  -86.742 1.00 49.57  ? 58  THR B OG1   1 
ATOM   2107  C CG2   . THR B  2 58  ? 11.894  12.767  -84.515 1.00 41.68  ? 58  THR B CG2   1 
ATOM   2108  N N     . ASN B  2 59  ? 12.687  9.467   -87.191 1.00 39.48  ? 59  ASN B N     1 
ATOM   2109  C CA    . ASN B  2 59  ? 12.233  8.391   -88.064 1.00 39.15  ? 59  ASN B CA    1 
ATOM   2110  C C     . ASN B  2 59  ? 11.246  7.592   -87.257 1.00 43.66  ? 59  ASN B C     1 
ATOM   2111  O O     . ASN B  2 59  ? 11.382  7.486   -86.053 1.00 43.40  ? 59  ASN B O     1 
ATOM   2112  C CB    . ASN B  2 59  ? 13.366  7.505   -88.599 1.00 38.60  ? 59  ASN B CB    1 
ATOM   2113  C CG    . ASN B  2 59  ? 14.047  8.109   -89.816 1.00 61.38  ? 59  ASN B CG    1 
ATOM   2114  O OD1   . ASN B  2 59  ? 13.431  8.376   -90.864 1.00 56.63  ? 59  ASN B OD1   1 
ATOM   2115  N ND2   . ASN B  2 59  ? 15.316  8.396   -89.703 1.00 54.42  ? 59  ASN B ND2   1 
ATOM   2116  N N     . PHE B  2 60  ? 10.221  7.097   -87.915 1.00 41.92  ? 60  PHE B N     1 
ATOM   2117  C CA    . PHE B  2 60  ? 9.150   6.365   -87.298 1.00 41.14  ? 60  PHE B CA    1 
ATOM   2118  C C     . PHE B  2 60  ? 8.855   5.137   -88.068 1.00 45.37  ? 60  PHE B C     1 
ATOM   2119  O O     . PHE B  2 60  ? 9.012   5.103   -89.286 1.00 45.38  ? 60  PHE B O     1 
ATOM   2120  C CB    . PHE B  2 60  ? 7.880   7.211   -87.311 1.00 42.23  ? 60  PHE B CB    1 
ATOM   2121  C CG    . PHE B  2 60  ? 7.950   8.345   -86.362 1.00 44.01  ? 60  PHE B CG    1 
ATOM   2122  C CD1   . PHE B  2 60  ? 8.040   8.116   -85.005 1.00 48.01  ? 60  PHE B CD1   1 
ATOM   2123  C CD2   . PHE B  2 60  ? 8.137   9.637   -86.818 1.00 46.87  ? 60  PHE B CD2   1 
ATOM   2124  C CE1   . PHE B  2 60  ? 8.251   9.158   -84.120 1.00 48.51  ? 60  PHE B CE1   1 
ATOM   2125  C CE2   . PHE B  2 60  ? 8.294   10.692  -85.911 1.00 48.70  ? 60  PHE B CE2   1 
ATOM   2126  C CZ    . PHE B  2 60  ? 8.328   10.443  -84.569 1.00 44.70  ? 60  PHE B CZ    1 
ATOM   2127  N N     . ASN B  2 61  ? 8.337   4.168   -87.348 1.00 41.75  ? 61  ASN B N     1 
ATOM   2128  C CA    . ASN B  2 61  ? 7.770   2.966   -87.889 1.00 42.70  ? 61  ASN B CA    1 
ATOM   2129  C C     . ASN B  2 61  ? 6.359   3.427   -88.371 1.00 47.32  ? 61  ASN B C     1 
ATOM   2130  O O     . ASN B  2 61  ? 5.622   4.031   -87.596 1.00 44.99  ? 61  ASN B O     1 
ATOM   2131  C CB    . ASN B  2 61  ? 7.700   1.916   -86.797 1.00 39.59  ? 61  ASN B CB    1 
ATOM   2132  C CG    . ASN B  2 61  ? 7.089   0.603   -87.225 1.00 49.34  ? 61  ASN B CG    1 
ATOM   2133  O OD1   . ASN B  2 61  ? 6.220   0.543   -88.081 1.00 49.28  ? 61  ASN B OD1   1 
ATOM   2134  N ND2   . ASN B  2 61  ? 7.387   -0.449  -86.508 1.00 41.96  ? 61  ASN B ND2   1 
ATOM   2135  N N     . GLU B  2 62  ? 6.026   3.171   -89.659 1.00 46.08  ? 62  GLU B N     1 
ATOM   2136  C CA    . GLU B  2 62  ? 4.770   3.596   -90.316 1.00 45.10  ? 62  GLU B CA    1 
ATOM   2137  C C     . GLU B  2 62  ? 3.532   3.158   -89.539 1.00 46.83  ? 62  GLU B C     1 
ATOM   2138  O O     . GLU B  2 62  ? 2.523   3.849   -89.563 1.00 46.15  ? 62  GLU B O     1 
ATOM   2139  C CB    . GLU B  2 62  ? 4.680   3.083   -91.778 1.00 46.27  ? 62  GLU B CB    1 
ATOM   2140  N N     . LYS B  2 63  ? 3.611   2.038   -88.844 1.00 42.93  ? 63  LYS B N     1 
ATOM   2141  C CA    . LYS B  2 63  ? 2.508   1.542   -88.022 1.00 44.17  ? 63  LYS B CA    1 
ATOM   2142  C C     . LYS B  2 63  ? 2.080   2.560   -86.912 1.00 50.62  ? 63  LYS B C     1 
ATOM   2143  O O     . LYS B  2 63  ? 0.917   2.555   -86.517 1.00 49.56  ? 63  LYS B O     1 
ATOM   2144  C CB    . LYS B  2 63  ? 2.919   0.193   -87.388 1.00 47.03  ? 63  LYS B CB    1 
ATOM   2145  C CG    . LYS B  2 63  ? 1.960   -0.342  -86.358 1.00 63.45  ? 63  LYS B CG    1 
ATOM   2146  C CD    . LYS B  2 63  ? 2.322   -1.752  -85.933 1.00 67.90  ? 63  LYS B CD    1 
ATOM   2147  C CE    . LYS B  2 63  ? 1.711   -2.050  -84.566 1.00 70.75  ? 63  LYS B CE    1 
ATOM   2148  N NZ    . LYS B  2 63  ? 1.875   -3.465  -84.174 1.00 74.55  ? 63  LYS B NZ    1 
ATOM   2149  N N     . PHE B  2 64  ? 3.027   3.370   -86.389 1.00 49.19  ? 64  PHE B N     1 
ATOM   2150  C CA    . PHE B  2 64  ? 2.792   4.369   -85.339 1.00 50.11  ? 64  PHE B CA    1 
ATOM   2151  C C     . PHE B  2 64  ? 2.885   5.794   -85.846 1.00 64.07  ? 64  PHE B C     1 
ATOM   2152  O O     . PHE B  2 64  ? 2.515   6.710   -85.092 1.00 65.42  ? 64  PHE B O     1 
ATOM   2153  C CB    . PHE B  2 64  ? 3.835   4.257   -84.232 1.00 50.18  ? 64  PHE B CB    1 
ATOM   2154  C CG    . PHE B  2 64  ? 3.937   2.902   -83.618 1.00 49.53  ? 64  PHE B CG    1 
ATOM   2155  C CD1   . PHE B  2 64  ? 2.967   2.451   -82.738 1.00 52.38  ? 64  PHE B CD1   1 
ATOM   2156  C CD2   . PHE B  2 64  ? 4.968   2.053   -83.960 1.00 48.19  ? 64  PHE B CD2   1 
ATOM   2157  C CE1   . PHE B  2 64  ? 3.041   1.182   -82.207 1.00 54.11  ? 64  PHE B CE1   1 
ATOM   2158  C CE2   . PHE B  2 64  ? 5.056   0.794   -83.415 1.00 52.61  ? 64  PHE B CE2   1 
ATOM   2159  C CZ    . PHE B  2 64  ? 4.079   0.351   -82.560 1.00 52.45  ? 64  PHE B CZ    1 
ATOM   2160  N N     . LYS B  2 65  ? 3.456   6.026   -87.066 1.00 63.50  ? 65  LYS B N     1 
ATOM   2161  C CA    . LYS B  2 65  ? 3.496   7.376   -87.611 1.00 63.55  ? 65  LYS B CA    1 
ATOM   2162  C C     . LYS B  2 65  ? 2.043   7.889   -87.503 1.00 67.71  ? 65  LYS B C     1 
ATOM   2163  O O     . LYS B  2 65  ? 1.098   7.108   -87.716 1.00 71.45  ? 65  LYS B O     1 
ATOM   2164  C CB    . LYS B  2 65  ? 4.007   7.402   -89.065 1.00 65.24  ? 65  LYS B CB    1 
ATOM   2165  N N     . ASN B  2 66  ? 1.886   9.112   -87.001 1.00 59.28  ? 66  ASN B N     1 
ATOM   2166  C CA    . ASN B  2 66  ? 0.608   9.802   -86.732 1.00 58.42  ? 66  ASN B CA    1 
ATOM   2167  C C     . ASN B  2 66  ? 0.175   9.736   -85.276 1.00 56.53  ? 66  ASN B C     1 
ATOM   2168  O O     . ASN B  2 66  ? -0.662  10.538  -84.902 1.00 57.84  ? 66  ASN B O     1 
ATOM   2169  C CB    . ASN B  2 66  ? -0.561  9.386   -87.639 1.00 61.21  ? 66  ASN B CB    1 
ATOM   2170  C CG    . ASN B  2 66  ? -0.289  9.612   -89.121 1.00 87.60  ? 66  ASN B CG    1 
ATOM   2171  O OD1   . ASN B  2 66  ? 0.409   10.577  -89.516 1.00 70.31  ? 66  ASN B OD1   1 
ATOM   2172  N ND2   . ASN B  2 66  ? -0.833  8.722   -89.973 1.00 78.19  ? 66  ASN B ND2   1 
ATOM   2173  N N     . ARG B  2 67  ? 0.653   8.763   -84.483 1.00 46.37  ? 67  ARG B N     1 
ATOM   2174  C CA    . ARG B  2 67  ? 0.307   8.658   -83.068 1.00 43.43  ? 67  ARG B CA    1 
ATOM   2175  C C     . ARG B  2 67  ? 1.470   8.886   -82.135 1.00 40.57  ? 67  ARG B C     1 
ATOM   2176  O O     . ARG B  2 67  ? 1.212   9.078   -80.961 1.00 35.59  ? 67  ARG B O     1 
ATOM   2177  C CB    . ARG B  2 67  ? -0.333  7.303   -82.760 1.00 41.46  ? 67  ARG B CB    1 
ATOM   2178  C CG    . ARG B  2 67  ? -1.648  7.118   -83.448 1.00 40.82  ? 67  ARG B CG    1 
ATOM   2179  C CD    . ARG B  2 67  ? -2.486  6.107   -82.742 1.00 39.56  ? 67  ARG B CD    1 
ATOM   2180  N NE    . ARG B  2 67  ? -1.866  4.786   -82.740 1.00 33.40  ? 67  ARG B NE    1 
ATOM   2181  C CZ    . ARG B  2 67  ? -1.678  3.987   -81.680 1.00 43.34  ? 67  ARG B CZ    1 
ATOM   2182  N NH1   . ARG B  2 67  ? -1.995  4.397   -80.458 1.00 31.97  ? 67  ARG B NH1   1 
ATOM   2183  N NH2   . ARG B  2 67  ? -1.121  2.800   -81.832 1.00 36.64  ? 67  ARG B NH2   1 
ATOM   2184  N N     . VAL B  2 68  ? 2.741   8.862   -82.624 1.00 39.15  ? 68  VAL B N     1 
ATOM   2185  C CA    . VAL B  2 68  ? 3.909   9.026   -81.774 1.00 38.85  ? 68  VAL B CA    1 
ATOM   2186  C C     . VAL B  2 68  ? 4.560   10.366  -82.010 1.00 41.91  ? 68  VAL B C     1 
ATOM   2187  O O     . VAL B  2 68  ? 4.769   10.787  -83.151 1.00 40.54  ? 68  VAL B O     1 
ATOM   2188  C CB    . VAL B  2 68  ? 4.933   7.882   -81.936 1.00 43.35  ? 68  VAL B CB    1 
ATOM   2189  C CG1   . VAL B  2 68  ? 6.152   8.099   -81.044 1.00 43.72  ? 68  VAL B CG1   1 
ATOM   2190  C CG2   . VAL B  2 68  ? 4.319   6.569   -81.553 1.00 44.54  ? 68  VAL B CG2   1 
ATOM   2191  N N     . THR B  2 69  ? 4.941   11.010  -80.904 1.00 37.67  ? 69  THR B N     1 
ATOM   2192  C CA    . THR B  2 69  ? 5.707   12.244  -80.931 1.00 36.50  ? 69  THR B CA    1 
ATOM   2193  C C     . THR B  2 69  ? 6.964   12.019  -80.097 1.00 39.38  ? 69  THR B C     1 
ATOM   2194  O O     . THR B  2 69  ? 6.867   11.609  -78.950 1.00 40.73  ? 69  THR B O     1 
ATOM   2195  C CB    . THR B  2 69  ? 4.872   13.402  -80.393 1.00 43.81  ? 69  THR B CB    1 
ATOM   2196  O OG1   . THR B  2 69  ? 3.774   13.592  -81.268 1.00 44.52  ? 69  THR B OG1   1 
ATOM   2197  C CG2   . THR B  2 69  ? 5.653   14.687  -80.293 1.00 46.12  ? 69  THR B CG2   1 
ATOM   2198  N N     . LEU B  2 70  ? 8.130   12.307  -80.663 1.00 35.72  ? 70  LEU B N     1 
ATOM   2199  C CA    . LEU B  2 70  ? 9.417   12.235  -79.968 1.00 34.91  ? 70  LEU B CA    1 
ATOM   2200  C C     . LEU B  2 70  ? 9.914   13.634  -79.765 1.00 35.90  ? 70  LEU B C     1 
ATOM   2201  O O     . LEU B  2 70  ? 9.838   14.468  -80.665 1.00 36.03  ? 70  LEU B O     1 
ATOM   2202  C CB    . LEU B  2 70  ? 10.442  11.403  -80.732 1.00 34.90  ? 70  LEU B CB    1 
ATOM   2203  C CG    . LEU B  2 70  ? 9.986   10.063  -81.187 1.00 39.19  ? 70  LEU B CG    1 
ATOM   2204  C CD1   . LEU B  2 70  ? 11.090  9.371   -81.927 1.00 40.26  ? 70  LEU B CD1   1 
ATOM   2205  C CD2   . LEU B  2 70  ? 9.474   9.202   -80.018 1.00 39.07  ? 70  LEU B CD2   1 
ATOM   2206  N N     . THR B  2 71  ? 10.357  13.922  -78.555 1.00 31.34  ? 71  THR B N     1 
ATOM   2207  C CA    . THR B  2 71  ? 10.815  15.252  -78.187 1.00 29.63  ? 71  THR B CA    1 
ATOM   2208  C C     . THR B  2 71  ? 12.045  15.126  -77.297 1.00 35.33  ? 71  THR B C     1 
ATOM   2209  O O     . THR B  2 71  ? 12.278  14.076  -76.716 1.00 34.96  ? 71  THR B O     1 
ATOM   2210  C CB    . THR B  2 71  ? 9.714   16.048  -77.439 1.00 36.79  ? 71  THR B CB    1 
ATOM   2211  O OG1   . THR B  2 71  ? 9.412   15.370  -76.258 1.00 48.89  ? 71  THR B OG1   1 
ATOM   2212  C CG2   . THR B  2 71  ? 8.439   16.203  -78.215 1.00 30.63  ? 71  THR B CG2   1 
ATOM   2213  N N     . THR B  2 72  ? 12.848  16.180  -77.210 1.00 35.50  ? 72  THR B N     1 
ATOM   2214  C CA    . THR B  2 72  ? 14.012  16.185  -76.325 1.00 37.26  ? 72  THR B CA    1 
ATOM   2215  C C     . THR B  2 72  ? 14.033  17.452  -75.515 1.00 39.44  ? 72  THR B C     1 
ATOM   2216  O O     . THR B  2 72  ? 13.494  18.474  -75.919 1.00 36.75  ? 72  THR B O     1 
ATOM   2217  C CB    . THR B  2 72  ? 15.369  16.048  -77.074 1.00 40.21  ? 72  THR B CB    1 
ATOM   2218  O OG1   . THR B  2 72  ? 15.450  17.043  -78.071 1.00 46.50  ? 72  THR B OG1   1 
ATOM   2219  C CG2   . THR B  2 72  ? 15.550  14.739  -77.676 1.00 37.94  ? 72  THR B CG2   1 
ATOM   2220  N N     . ASP B  2 73  ? 14.663  17.354  -74.363 1.00 38.56  ? 73  ASP B N     1 
ATOM   2221  C CA    . ASP B  2 73  ? 14.928  18.470  -73.472 1.00 40.56  ? 73  ASP B CA    1 
ATOM   2222  C C     . ASP B  2 73  ? 16.439  18.433  -73.181 1.00 44.99  ? 73  ASP B C     1 
ATOM   2223  O O     . ASP B  2 73  ? 16.890  17.643  -72.365 1.00 42.19  ? 73  ASP B O     1 
ATOM   2224  C CB    . ASP B  2 73  ? 14.072  18.389  -72.189 1.00 42.26  ? 73  ASP B CB    1 
ATOM   2225  C CG    . ASP B  2 73  ? 14.146  19.647  -71.329 1.00 54.53  ? 73  ASP B CG    1 
ATOM   2226  O OD1   . ASP B  2 73  ? 15.046  20.470  -71.558 1.00 54.26  ? 73  ASP B OD1   1 
ATOM   2227  O OD2   . ASP B  2 73  ? 13.354  19.764  -70.389 1.00 62.04  ? 73  ASP B OD2   1 
ATOM   2228  N N     . SER B  2 74  ? 17.208  19.284  -73.890 1.00 46.85  ? 74  SER B N     1 
ATOM   2229  C CA    . SER B  2 74  ? 18.673  19.382  -73.783 1.00 48.79  ? 74  SER B CA    1 
ATOM   2230  C C     . SER B  2 74  ? 19.192  19.763  -72.403 1.00 54.22  ? 74  SER B C     1 
ATOM   2231  O O     . SER B  2 74  ? 20.254  19.273  -72.016 1.00 56.27  ? 74  SER B O     1 
ATOM   2232  C CB    . SER B  2 74  ? 19.200  20.374  -74.807 1.00 53.60  ? 74  SER B CB    1 
ATOM   2233  O OG    . SER B  2 74  ? 18.641  21.641  -74.516 1.00 72.21  ? 74  SER B OG    1 
ATOM   2234  N N     . SER B  2 75  ? 18.460  20.600  -71.657 1.00 50.25  ? 75  SER B N     1 
ATOM   2235  C CA    . SER B  2 75  ? 18.885  21.047  -70.320 1.00 50.59  ? 75  SER B CA    1 
ATOM   2236  C C     . SER B  2 75  ? 18.818  19.954  -69.260 1.00 54.55  ? 75  SER B C     1 
ATOM   2237  O O     . SER B  2 75  ? 19.641  19.956  -68.347 1.00 55.88  ? 75  SER B O     1 
ATOM   2238  C CB    . SER B  2 75  ? 18.054  22.238  -69.866 1.00 54.54  ? 75  SER B CB    1 
ATOM   2239  O OG    . SER B  2 75  ? 16.671  22.007  -70.077 1.00 68.91  ? 75  SER B OG    1 
ATOM   2240  N N     . THR B  2 76  ? 17.866  19.023  -69.385 1.00 48.42  ? 76  THR B N     1 
ATOM   2241  C CA    . THR B  2 76  ? 17.708  17.898  -68.462 1.00 46.67  ? 76  THR B CA    1 
ATOM   2242  C C     . THR B  2 76  ? 18.178  16.594  -69.095 1.00 48.81  ? 76  THR B C     1 
ATOM   2243  O O     . THR B  2 76  ? 17.951  15.535  -68.499 1.00 50.16  ? 76  THR B O     1 
ATOM   2244  C CB    . THR B  2 76  ? 16.226  17.792  -68.035 1.00 51.48  ? 76  THR B CB    1 
ATOM   2245  O OG1   . THR B  2 76  ? 15.423  17.604  -69.200 1.00 54.21  ? 76  THR B OG1   1 
ATOM   2246  C CG2   . THR B  2 76  ? 15.731  19.038  -67.306 1.00 48.95  ? 76  THR B CG2   1 
ATOM   2247  N N     . THR B  2 77  ? 18.764  16.642  -70.313 1.00 42.85  ? 77  THR B N     1 
ATOM   2248  C CA    . THR B  2 77  ? 19.218  15.482  -71.104 1.00 41.36  ? 77  THR B CA    1 
ATOM   2249  C C     . THR B  2 77  ? 18.220  14.312  -71.027 1.00 42.92  ? 77  THR B C     1 
ATOM   2250  O O     . THR B  2 77  ? 18.563  13.142  -70.720 1.00 38.91  ? 77  THR B O     1 
ATOM   2251  C CB    . THR B  2 77  ? 20.650  15.094  -70.752 1.00 48.33  ? 77  THR B CB    1 
ATOM   2252  O OG1   . THR B  2 77  ? 20.724  14.581  -69.421 1.00 50.41  ? 77  THR B OG1   1 
ATOM   2253  C CG2   . THR B  2 77  ? 21.596  16.269  -70.910 1.00 48.50  ? 77  THR B CG2   1 
ATOM   2254  N N     . THR B  2 78  ? 16.977  14.664  -71.345 1.00 39.75  ? 78  THR B N     1 
ATOM   2255  C CA    . THR B  2 78  ? 15.849  13.739  -71.302 1.00 40.06  ? 78  THR B CA    1 
ATOM   2256  C C     . THR B  2 78  ? 15.194  13.661  -72.658 1.00 41.16  ? 78  THR B C     1 
ATOM   2257  O O     . THR B  2 78  ? 14.956  14.682  -73.285 1.00 39.48  ? 78  THR B O     1 
ATOM   2258  C CB    . THR B  2 78  ? 14.778  14.188  -70.231 1.00 39.55  ? 78  THR B CB    1 
ATOM   2259  O OG1   . THR B  2 78  ? 15.396  14.222  -68.963 1.00 40.85  ? 78  THR B OG1   1 
ATOM   2260  C CG2   . THR B  2 78  ? 13.575  13.239  -70.149 1.00 35.91  ? 78  THR B CG2   1 
ATOM   2261  N N     . ALA B  2 79  ? 14.797  12.452  -73.023 1.00 38.02  ? 79  ALA B N     1 
ATOM   2262  C CA    . ALA B  2 79  ? 14.047  12.153  -74.246 1.00 36.87  ? 79  ALA B CA    1 
ATOM   2263  C C     . ALA B  2 79  ? 12.664  11.681  -73.818 1.00 38.39  ? 79  ALA B C     1 
ATOM   2264  O O     . ALA B  2 79  ? 12.521  11.035  -72.786 1.00 36.82  ? 79  ALA B O     1 
ATOM   2265  C CB    . ALA B  2 79  ? 14.753  11.053  -75.060 1.00 36.15  ? 79  ALA B CB    1 
ATOM   2266  N N     . TYR B  2 80  ? 11.644  12.027  -74.605 1.00 35.34  ? 80  TYR B N     1 
ATOM   2267  C CA    . TYR B  2 80  ? 10.272  11.668  -74.329 1.00 33.47  ? 80  TYR B CA    1 
ATOM   2268  C C     . TYR B  2 80  ? 9.657   10.998  -75.525 1.00 35.44  ? 80  TYR B C     1 
ATOM   2269  O O     . TYR B  2 80  ? 9.863   11.399  -76.663 1.00 32.82  ? 80  TYR B O     1 
ATOM   2270  C CB    . TYR B  2 80  ? 9.421   12.895  -73.980 1.00 34.66  ? 80  TYR B CB    1 
ATOM   2271  C CG    . TYR B  2 80  ? 9.949   13.716  -72.833 1.00 37.46  ? 80  TYR B CG    1 
ATOM   2272  C CD1   . TYR B  2 80  ? 10.858  14.754  -73.049 1.00 40.47  ? 80  TYR B CD1   1 
ATOM   2273  C CD2   . TYR B  2 80  ? 9.494   13.508  -71.534 1.00 38.24  ? 80  TYR B CD2   1 
ATOM   2274  C CE1   . TYR B  2 80  ? 11.371  15.496  -71.984 1.00 39.84  ? 80  TYR B CE1   1 
ATOM   2275  C CE2   . TYR B  2 80  ? 9.941   14.294  -70.476 1.00 39.14  ? 80  TYR B CE2   1 
ATOM   2276  C CZ    . TYR B  2 80  ? 10.915  15.252  -70.694 1.00 44.72  ? 80  TYR B CZ    1 
ATOM   2277  O OH    . TYR B  2 80  ? 11.351  16.011  -69.642 1.00 48.26  ? 80  TYR B OH    1 
ATOM   2278  N N     . MET B  2 81  ? 8.839   9.999   -75.237 1.00 34.00  ? 81  MET B N     1 
ATOM   2279  C CA    . MET B  2 81  ? 8.043   9.292   -76.201 1.00 32.95  ? 81  MET B CA    1 
ATOM   2280  C C     . MET B  2 81  ? 6.590   9.530   -75.787 1.00 34.14  ? 81  MET B C     1 
ATOM   2281  O O     . MET B  2 81  ? 6.201   9.099   -74.711 1.00 31.58  ? 81  MET B O     1 
ATOM   2282  C CB    . MET B  2 81  ? 8.370   7.798   -76.121 1.00 34.49  ? 81  MET B CB    1 
ATOM   2283  C CG    . MET B  2 81  ? 7.835   6.970   -77.268 1.00 39.82  ? 81  MET B CG    1 
ATOM   2284  S SD    . MET B  2 81  ? 6.059   6.640   -77.291 1.00 47.48  ? 81  MET B SD    1 
ATOM   2285  C CE    . MET B  2 81  ? 5.786   5.793   -75.707 1.00 43.25  ? 81  MET B CE    1 
ATOM   2286  N N     . GLU B  2 82  ? 5.796   10.160  -76.650 1.00 31.24  ? 82  GLU B N     1 
ATOM   2287  C CA    . GLU B  2 82  ? 4.375   10.344  -76.391 1.00 31.41  ? 82  GLU B CA    1 
ATOM   2288  C C     . GLU B  2 82  ? 3.569   9.591   -77.410 1.00 34.91  ? 82  GLU B C     1 
ATOM   2289  O O     . GLU B  2 82  ? 3.691   9.855   -78.607 1.00 33.37  ? 82  GLU B O     1 
ATOM   2290  C CB    . GLU B  2 82  ? 3.996   11.813  -76.333 1.00 32.14  ? 82  GLU B CB    1 
ATOM   2291  C CG    . GLU B  2 82  ? 2.596   12.024  -75.828 1.00 36.50  ? 82  GLU B CG    1 
ATOM   2292  C CD    . GLU B  2 82  ? 2.267   13.492  -75.640 1.00 49.33  ? 82  GLU B CD    1 
ATOM   2293  O OE1   . GLU B  2 82  ? 1.785   13.846  -74.542 1.00 43.52  ? 82  GLU B OE1   1 
ATOM   2294  O OE2   . GLU B  2 82  ? 2.490   14.287  -76.582 1.00 49.24  ? 82  GLU B OE2   1 
ATOM   2295  N N     . LEU B  2 83  ? 2.725   8.649   -76.914 1.00 32.98  ? 83  LEU B N     1 
ATOM   2296  C CA    . LEU B  2 83  ? 1.846   7.846   -77.736 1.00 32.49  ? 83  LEU B CA    1 
ATOM   2297  C C     . LEU B  2 83  ? 0.435   8.256   -77.422 1.00 36.43  ? 83  LEU B C     1 
ATOM   2298  O O     . LEU B  2 83  ? -0.034  8.132   -76.287 1.00 35.45  ? 83  LEU B O     1 
ATOM   2299  C CB    . LEU B  2 83  ? 2.072   6.367   -77.493 1.00 32.35  ? 83  LEU B CB    1 
ATOM   2300  C CG    . LEU B  2 83  ? 1.257   5.354   -78.353 1.00 37.05  ? 83  LEU B CG    1 
ATOM   2301  C CD1   . LEU B  2 83  ? 1.641   5.385   -79.818 1.00 37.76  ? 83  LEU B CD1   1 
ATOM   2302  C CD2   . LEU B  2 83  ? 1.456   4.001   -77.841 1.00 33.04  ? 83  LEU B CD2   1 
ATOM   2303  N N     . LYS B  2 84  ? -0.215  8.815   -78.438 1.00 34.68  ? 84  LYS B N     1 
ATOM   2304  C CA    . LYS B  2 84  ? -1.585  9.370   -78.366 1.00 36.01  ? 84  LYS B CA    1 
ATOM   2305  C C     . LYS B  2 84  ? -2.637  8.402   -78.947 1.00 37.17  ? 84  LYS B C     1 
ATOM   2306  O O     . LYS B  2 84  ? -2.262  7.421   -79.600 1.00 33.28  ? 84  LYS B O     1 
ATOM   2307  C CB    . LYS B  2 84  ? -1.608  10.746  -79.102 1.00 35.54  ? 84  LYS B CB    1 
ATOM   2308  N N     . SER B  2 85  ? -3.945  8.691   -78.693 1.00 35.66  ? 85  SER B N     1 
ATOM   2309  C CA    . SER B  2 85  ? -5.107  7.887   -79.172 1.00 35.98  ? 85  SER B CA    1 
ATOM   2310  C C     . SER B  2 85  ? -4.921  6.411   -78.852 1.00 37.17  ? 85  SER B C     1 
ATOM   2311  O O     . SER B  2 85  ? -4.998  5.541   -79.707 1.00 36.71  ? 85  SER B O     1 
ATOM   2312  C CB    . SER B  2 85  ? -5.334  8.097   -80.665 1.00 38.58  ? 85  SER B CB    1 
ATOM   2313  O OG    . SER B  2 85  ? -5.472  9.482   -80.933 1.00 49.36  ? 85  SER B OG    1 
ATOM   2314  N N     . LEU B  2 86  ? -4.621  6.156   -77.591 1.00 35.96  ? 86  LEU B N     1 
ATOM   2315  C CA    . LEU B  2 86  ? -4.302  4.837   -77.094 1.00 34.48  ? 86  LEU B CA    1 
ATOM   2316  C C     . LEU B  2 86  ? -5.349  3.792   -77.407 1.00 37.98  ? 86  LEU B C     1 
ATOM   2317  O O     . LEU B  2 86  ? -6.555  4.023   -77.305 1.00 37.88  ? 86  LEU B O     1 
ATOM   2318  C CB    . LEU B  2 86  ? -3.995  4.874   -75.580 1.00 33.79  ? 86  LEU B CB    1 
ATOM   2319  C CG    . LEU B  2 86  ? -2.623  5.508   -75.209 1.00 36.21  ? 86  LEU B CG    1 
ATOM   2320  C CD1   . LEU B  2 86  ? -2.512  5.762   -73.726 1.00 33.74  ? 86  LEU B CD1   1 
ATOM   2321  C CD2   . LEU B  2 86  ? -1.469  4.653   -75.691 1.00 36.55  ? 86  LEU B CD2   1 
ATOM   2322  N N     . GLN B  2 87  ? -4.858  2.626   -77.748 1.00 34.79  ? 87  GLN B N     1 
ATOM   2323  C CA    . GLN B  2 87  ? -5.646  1.442   -78.067 1.00 33.84  ? 87  GLN B CA    1 
ATOM   2324  C C     . GLN B  2 87  ? -5.375  0.400   -77.009 1.00 37.19  ? 87  GLN B C     1 
ATOM   2325  O O     . GLN B  2 87  ? -4.278  0.359   -76.462 1.00 35.95  ? 87  GLN B O     1 
ATOM   2326  C CB    . GLN B  2 87  ? -5.172  0.912   -79.409 1.00 34.83  ? 87  GLN B CB    1 
ATOM   2327  C CG    . GLN B  2 87  ? -5.427  1.883   -80.546 1.00 36.40  ? 87  GLN B CG    1 
ATOM   2328  C CD    . GLN B  2 87  ? -4.680  1.537   -81.809 1.00 49.79  ? 87  GLN B CD    1 
ATOM   2329  O OE1   . GLN B  2 87  ? -4.090  0.446   -81.972 1.00 47.88  ? 87  GLN B OE1   1 
ATOM   2330  N NE2   . GLN B  2 87  ? -4.782  2.429   -82.768 1.00 47.59  ? 87  GLN B NE2   1 
ATOM   2331  N N     . PHE B  2 88  ? -6.321  -0.492  -76.777 1.00 36.74  ? 88  PHE B N     1 
ATOM   2332  C CA    . PHE B  2 88  ? -6.164  -1.601  -75.841 1.00 37.07  ? 88  PHE B CA    1 
ATOM   2333  C C     . PHE B  2 88  ? -4.851  -2.401  -76.150 1.00 37.30  ? 88  PHE B C     1 
ATOM   2334  O O     . PHE B  2 88  ? -4.134  -2.793  -75.240 1.00 34.81  ? 88  PHE B O     1 
ATOM   2335  C CB    . PHE B  2 88  ? -7.401  -2.560  -75.896 1.00 39.54  ? 88  PHE B CB    1 
ATOM   2336  C CG    . PHE B  2 88  ? -8.620  -2.079  -75.164 1.00 40.78  ? 88  PHE B CG    1 
ATOM   2337  C CD1   . PHE B  2 88  ? -8.650  -2.056  -73.782 1.00 46.00  ? 88  PHE B CD1   1 
ATOM   2338  C CD2   . PHE B  2 88  ? -9.777  -1.746  -75.852 1.00 40.88  ? 88  PHE B CD2   1 
ATOM   2339  C CE1   . PHE B  2 88  ? -9.800  -1.647  -73.102 1.00 47.27  ? 88  PHE B CE1   1 
ATOM   2340  C CE2   . PHE B  2 88  ? -10.893 -1.271  -75.176 1.00 43.91  ? 88  PHE B CE2   1 
ATOM   2341  C CZ    . PHE B  2 88  ? -10.907 -1.225  -73.810 1.00 43.43  ? 88  PHE B CZ    1 
ATOM   2342  N N     . ASP B  2 89  ? -4.539  -2.578  -77.429 1.00 34.81  ? 89  ASP B N     1 
ATOM   2343  C CA    . ASP B  2 89  ? -3.337  -3.302  -77.864 1.00 35.41  ? 89  ASP B CA    1 
ATOM   2344  C C     . ASP B  2 89  ? -2.029  -2.492  -77.805 1.00 38.47  ? 89  ASP B C     1 
ATOM   2345  O O     . ASP B  2 89  ? -1.031  -2.935  -78.362 1.00 36.74  ? 89  ASP B O     1 
ATOM   2346  C CB    . ASP B  2 89  ? -3.524  -3.914  -79.276 1.00 36.97  ? 89  ASP B CB    1 
ATOM   2347  C CG    . ASP B  2 89  ? -3.682  -2.936  -80.418 1.00 46.14  ? 89  ASP B CG    1 
ATOM   2348  O OD1   . ASP B  2 89  ? -3.528  -1.691  -80.177 1.00 45.34  ? 89  ASP B OD1   1 
ATOM   2349  O OD2   . ASP B  2 89  ? -3.938  -3.398  -81.562 1.00 48.73  ? 89  ASP B OD2   1 
ATOM   2350  N N     . ASP B  2 90  ? -2.035  -1.302  -77.190 1.00 35.00  ? 90  ASP B N     1 
ATOM   2351  C CA    . ASP B  2 90  ? -0.824  -0.538  -76.951 1.00 32.96  ? 90  ASP B CA    1 
ATOM   2352  C C     . ASP B  2 90  ? -0.241  -0.942  -75.566 1.00 35.42  ? 90  ASP B C     1 
ATOM   2353  O O     . ASP B  2 90  ? 0.801   -0.409  -75.160 1.00 35.07  ? 90  ASP B O     1 
ATOM   2354  C CB    . ASP B  2 90  ? -1.094  0.980   -77.038 1.00 34.86  ? 90  ASP B CB    1 
ATOM   2355  C CG    . ASP B  2 90  ? -1.312  1.516   -78.441 1.00 37.71  ? 90  ASP B CG    1 
ATOM   2356  O OD1   . ASP B  2 90  ? -0.631  1.048   -79.376 1.00 36.89  ? 90  ASP B OD1   1 
ATOM   2357  O OD2   . ASP B  2 90  ? -2.075  2.476   -78.590 1.00 38.86  ? 90  ASP B OD2   1 
ATOM   2358  N N     . THR B  2 91  ? -0.934  -1.816  -74.818 1.00 31.30  ? 91  THR B N     1 
ATOM   2359  C CA    . THR B  2 91  ? -0.431  -2.365  -73.556 1.00 32.58  ? 91  THR B CA    1 
ATOM   2360  C C     . THR B  2 91  ? 0.895   -3.067  -73.811 1.00 33.97  ? 91  THR B C     1 
ATOM   2361  O O     . THR B  2 91  ? 0.930   -3.949  -74.625 1.00 35.43  ? 91  THR B O     1 
ATOM   2362  C CB    . THR B  2 91  ? -1.465  -3.308  -72.931 1.00 30.88  ? 91  THR B CB    1 
ATOM   2363  O OG1   . THR B  2 91  ? -2.561  -2.496  -72.548 1.00 32.98  ? 91  THR B OG1   1 
ATOM   2364  C CG2   . THR B  2 91  ? -0.955  -4.072  -71.694 1.00 24.67  ? 91  THR B CG2   1 
ATOM   2365  N N     . ALA B  2 92  ? 1.992   -2.595  -73.214 1.00 28.71  ? 92  ALA B N     1 
ATOM   2366  C CA    . ALA B  2 92  ? 3.304   -3.167  -73.453 1.00 28.38  ? 92  ALA B CA    1 
ATOM   2367  C C     . ALA B  2 92  ? 4.310   -2.623  -72.486 1.00 33.13  ? 92  ALA B C     1 
ATOM   2368  O O     . ALA B  2 92  ? 4.035   -1.663  -71.761 1.00 33.18  ? 92  ALA B O     1 
ATOM   2369  C CB    . ALA B  2 92  ? 3.763   -2.844  -74.891 1.00 29.11  ? 92  ALA B CB    1 
ATOM   2370  N N     . VAL B  2 93  ? 5.524   -3.164  -72.547 1.00 30.40  ? 93  VAL B N     1 
ATOM   2371  C CA    . VAL B  2 93  ? 6.649   -2.552  -71.836 1.00 30.17  ? 93  VAL B CA    1 
ATOM   2372  C C     . VAL B  2 93  ? 7.339   -1.698  -72.909 1.00 31.62  ? 93  VAL B C     1 
ATOM   2373  O O     . VAL B  2 93  ? 7.644   -2.180  -74.008 1.00 29.28  ? 93  VAL B O     1 
ATOM   2374  C CB    . VAL B  2 93  ? 7.631   -3.537  -71.157 1.00 32.10  ? 93  VAL B CB    1 
ATOM   2375  C CG1   . VAL B  2 93  ? 8.873   -2.811  -70.631 1.00 30.58  ? 93  VAL B CG1   1 
ATOM   2376  C CG2   . VAL B  2 93  ? 6.941   -4.301  -70.047 1.00 31.21  ? 93  VAL B CG2   1 
ATOM   2377  N N     . TYR B  2 94  ? 7.561   -0.429  -72.593 1.00 29.23  ? 94  TYR B N     1 
ATOM   2378  C CA    . TYR B  2 94  ? 8.231   0.505   -73.488 1.00 27.69  ? 94  TYR B CA    1 
ATOM   2379  C C     . TYR B  2 94  ? 9.630   0.797   -73.006 1.00 32.44  ? 94  TYR B C     1 
ATOM   2380  O O     . TYR B  2 94  ? 9.799   1.138   -71.852 1.00 30.29  ? 94  TYR B O     1 
ATOM   2381  C CB    . TYR B  2 94  ? 7.436   1.798   -73.567 1.00 28.40  ? 94  TYR B CB    1 
ATOM   2382  C CG    . TYR B  2 94  ? 6.141   1.610   -74.314 1.00 30.36  ? 94  TYR B CG    1 
ATOM   2383  C CD1   . TYR B  2 94  ? 4.999   1.145   -73.669 1.00 29.55  ? 94  TYR B CD1   1 
ATOM   2384  C CD2   . TYR B  2 94  ? 6.041   1.938   -75.660 1.00 32.67  ? 94  TYR B CD2   1 
ATOM   2385  C CE1   . TYR B  2 94  ? 3.832   0.892   -74.381 1.00 29.48  ? 94  TYR B CE1   1 
ATOM   2386  C CE2   . TYR B  2 94  ? 4.832   1.852   -76.327 1.00 34.59  ? 94  TYR B CE2   1 
ATOM   2387  C CZ    . TYR B  2 94  ? 3.771   1.203   -75.733 1.00 37.63  ? 94  TYR B CZ    1 
ATOM   2388  O OH    . TYR B  2 94  ? 2.654   1.023   -76.504 1.00 35.57  ? 94  TYR B OH    1 
ATOM   2389  N N     . TYR B  2 95  ? 10.622  0.748   -73.921 1.00 31.87  ? 95  TYR B N     1 
ATOM   2390  C CA    . TYR B  2 95  ? 12.027  1.034   -73.632 1.00 31.63  ? 95  TYR B CA    1 
ATOM   2391  C C     . TYR B  2 95  ? 12.559  2.156   -74.454 1.00 34.95  ? 95  TYR B C     1 
ATOM   2392  O O     . TYR B  2 95  ? 12.220  2.225   -75.636 1.00 31.36  ? 95  TYR B O     1 
ATOM   2393  C CB    . TYR B  2 95  ? 12.917  -0.152  -74.039 1.00 31.94  ? 95  TYR B CB    1 
ATOM   2394  C CG    . TYR B  2 95  ? 12.646  -1.418  -73.276 1.00 31.91  ? 95  TYR B CG    1 
ATOM   2395  C CD1   . TYR B  2 95  ? 13.217  -1.635  -72.027 1.00 33.07  ? 95  TYR B CD1   1 
ATOM   2396  C CD2   . TYR B  2 95  ? 11.851  -2.421  -73.813 1.00 32.80  ? 95  TYR B CD2   1 
ATOM   2397  C CE1   . TYR B  2 95  ? 12.963  -2.795  -71.309 1.00 31.82  ? 95  TYR B CE1   1 
ATOM   2398  C CE2   . TYR B  2 95  ? 11.600  -3.596  -73.107 1.00 34.33  ? 95  TYR B CE2   1 
ATOM   2399  C CZ    . TYR B  2 95  ? 12.184  -3.790  -71.865 1.00 40.86  ? 95  TYR B CZ    1 
ATOM   2400  O OH    . TYR B  2 95  ? 11.945  -4.943  -71.164 1.00 42.07  ? 95  TYR B OH    1 
ATOM   2401  N N     . CYS B  2 96  ? 13.539  2.913   -73.887 1.00 34.13  ? 96  CYS B N     1 
ATOM   2402  C CA    . CYS B  2 96  ? 14.389  3.828   -74.652 1.00 35.04  ? 96  CYS B CA    1 
ATOM   2403  C C     . CYS B  2 96  ? 15.708  3.074   -74.790 1.00 34.53  ? 96  CYS B C     1 
ATOM   2404  O O     . CYS B  2 96  ? 16.007  2.199   -73.992 1.00 32.77  ? 96  CYS B O     1 
ATOM   2405  C CB    . CYS B  2 96  ? 14.585  5.209   -74.011 1.00 38.52  ? 96  CYS B CB    1 
ATOM   2406  S SG    . CYS B  2 96  ? 15.244  5.188   -72.322 1.00 43.93  ? 96  CYS B SG    1 
ATOM   2407  N N     . ALA B  2 97  ? 16.439  3.323   -75.834 1.00 34.13  ? 97  ALA B N     1 
ATOM   2408  C CA    . ALA B  2 97  ? 17.782  2.755   -75.997 1.00 35.01  ? 97  ALA B CA    1 
ATOM   2409  C C     . ALA B  2 97  ? 18.600  3.674   -76.855 1.00 37.30  ? 97  ALA B C     1 
ATOM   2410  O O     . ALA B  2 97  ? 18.055  4.364   -77.695 1.00 36.00  ? 97  ALA B O     1 
ATOM   2411  C CB    . ALA B  2 97  ? 17.733  1.343   -76.574 1.00 35.89  ? 97  ALA B CB    1 
ATOM   2412  N N     . ARG B  2 98  ? 19.877  3.812   -76.552 1.00 37.04  ? 98  ARG B N     1 
ATOM   2413  C CA    . ARG B  2 98  ? 20.708  4.711   -77.323 1.00 37.76  ? 98  ARG B CA    1 
ATOM   2414  C C     . ARG B  2 98  ? 21.453  4.022   -78.470 1.00 39.69  ? 98  ARG B C     1 
ATOM   2415  O O     . ARG B  2 98  ? 21.670  2.822   -78.457 1.00 36.09  ? 98  ARG B O     1 
ATOM   2416  C CB    . ARG B  2 98  ? 21.661  5.498   -76.438 1.00 39.21  ? 98  ARG B CB    1 
ATOM   2417  C CG    . ARG B  2 98  ? 22.791  4.681   -75.965 1.00 40.52  ? 98  ARG B CG    1 
ATOM   2418  C CD    . ARG B  2 98  ? 23.825  5.529   -75.291 1.00 38.07  ? 98  ARG B CD    1 
ATOM   2419  N NE    . ARG B  2 98  ? 25.086  4.816   -75.347 1.00 41.67  ? 98  ARG B NE    1 
ATOM   2420  C CZ    . ARG B  2 98  ? 26.250  5.277   -74.929 1.00 46.52  ? 98  ARG B CZ    1 
ATOM   2421  N NH1   . ARG B  2 98  ? 26.340  6.490   -74.401 1.00 41.85  ? 98  ARG B NH1   1 
ATOM   2422  N NH2   . ARG B  2 98  ? 27.339  4.529   -75.036 1.00 40.29  ? 98  ARG B NH2   1 
ATOM   2423  N N     . ARG B  2 99  ? 21.901  4.835   -79.431 1.00 37.65  ? 99  ARG B N     1 
ATOM   2424  C CA    . ARG B  2 99  ? 22.646  4.360   -80.594 1.00 36.67  ? 99  ARG B CA    1 
ATOM   2425  C C     . ARG B  2 99  ? 23.618  5.437   -80.930 1.00 40.18  ? 99  ARG B C     1 
ATOM   2426  O O     . ARG B  2 99  ? 23.239  6.614   -81.008 1.00 40.07  ? 99  ARG B O     1 
ATOM   2427  C CB    . ARG B  2 99  ? 21.685  4.095   -81.776 1.00 38.06  ? 99  ARG B CB    1 
ATOM   2428  C CG    . ARG B  2 99  ? 22.227  3.154   -82.854 1.00 38.39  ? 99  ARG B CG    1 
ATOM   2429  C CD    . ARG B  2 99  ? 23.035  3.952   -83.859 1.00 53.39  ? 99  ARG B CD    1 
ATOM   2430  N NE    . ARG B  2 99  ? 22.413  3.976   -85.167 1.00 58.41  ? 99  ARG B NE    1 
ATOM   2431  C CZ    . ARG B  2 99  ? 22.811  4.719   -86.188 1.00 59.64  ? 99  ARG B CZ    1 
ATOM   2432  N NH1   . ARG B  2 99  ? 23.857  5.532   -86.063 1.00 45.72  ? 99  ARG B NH1   1 
ATOM   2433  N NH2   . ARG B  2 99  ? 22.158  4.672   -87.338 1.00 63.15  ? 99  ARG B NH2   1 
ATOM   2434  N N     . ASP B  2 100 ? 24.881  5.060   -81.150 1.00 37.97  ? 100 ASP B N     1 
ATOM   2435  C CA    . ASP B  2 100 ? 25.918  6.022   -81.509 1.00 37.33  ? 100 ASP B CA    1 
ATOM   2436  C C     . ASP B  2 100 ? 25.558  6.745   -82.817 1.00 42.74  ? 100 ASP B C     1 
ATOM   2437  O O     . ASP B  2 100 ? 25.253  6.086   -83.803 1.00 40.27  ? 100 ASP B O     1 
ATOM   2438  C CB    . ASP B  2 100 ? 27.270  5.302   -81.607 1.00 40.24  ? 100 ASP B CB    1 
ATOM   2439  C CG    . ASP B  2 100 ? 28.465  6.245   -81.731 1.00 50.28  ? 100 ASP B CG    1 
ATOM   2440  O OD1   . ASP B  2 100 ? 28.920  6.749   -80.704 1.00 60.38  ? 100 ASP B OD1   1 
ATOM   2441  O OD2   . ASP B  2 100 ? 28.842  6.577   -82.863 1.00 50.56  ? 100 ASP B OD2   1 
ATOM   2442  N N     . TYR B  2 101 ? 25.565  8.092   -82.820 1.00 45.13  ? 101 TYR B N     1 
ATOM   2443  C CA    . TYR B  2 101 ? 25.252  8.870   -84.022 1.00 48.02  ? 101 TYR B CA    1 
ATOM   2444  C C     . TYR B  2 101 ? 26.153  8.577   -85.234 1.00 52.45  ? 101 TYR B C     1 
ATOM   2445  O O     . TYR B  2 101 ? 25.631  8.389   -86.337 1.00 53.10  ? 101 TYR B O     1 
ATOM   2446  C CB    . TYR B  2 101 ? 25.294  10.383  -83.731 1.00 53.33  ? 101 TYR B CB    1 
ATOM   2447  C CG    . TYR B  2 101 ? 25.287  11.219  -84.994 1.00 61.22  ? 101 TYR B CG    1 
ATOM   2448  C CD1   . TYR B  2 101 ? 24.120  11.391  -85.732 1.00 63.99  ? 101 TYR B CD1   1 
ATOM   2449  C CD2   . TYR B  2 101 ? 26.473  11.704  -85.537 1.00 64.31  ? 101 TYR B CD2   1 
ATOM   2450  C CE1   . TYR B  2 101 ? 24.112  12.123  -86.919 1.00 66.39  ? 101 TYR B CE1   1 
ATOM   2451  C CE2   . TYR B  2 101 ? 26.493  12.349  -86.775 1.00 66.59  ? 101 TYR B CE2   1 
ATOM   2452  C CZ    . TYR B  2 101 ? 25.307  12.573  -87.455 1.00 77.51  ? 101 TYR B CZ    1 
ATOM   2453  O OH    . TYR B  2 101 ? 25.321  13.232  -88.663 1.00 83.01  ? 101 TYR B OH    1 
ATOM   2454  N N     . ARG B  2 102 ? 27.484  8.584   -85.043 1.00 49.36  ? 102 ARG B N     1 
ATOM   2455  C CA    . ARG B  2 102 ? 28.445  8.446   -86.149 1.00 50.11  ? 102 ARG B CA    1 
ATOM   2456  C C     . ARG B  2 102 ? 28.561  7.039   -86.729 1.00 50.44  ? 102 ARG B C     1 
ATOM   2457  O O     . ARG B  2 102 ? 28.775  6.893   -87.922 1.00 49.30  ? 102 ARG B O     1 
ATOM   2458  C CB    . ARG B  2 102 ? 29.839  8.973   -85.737 1.00 52.50  ? 102 ARG B CB    1 
ATOM   2459  N N     . PHE B  2 103 ? 28.474  6.017   -85.897 1.00 47.46  ? 103 PHE B N     1 
ATOM   2460  C CA    . PHE B  2 103 ? 28.586  4.628   -86.324 1.00 47.18  ? 103 PHE B CA    1 
ATOM   2461  C C     . PHE B  2 103 ? 27.430  3.870   -85.737 1.00 48.58  ? 103 PHE B C     1 
ATOM   2462  O O     . PHE B  2 103 ? 27.151  4.010   -84.564 1.00 48.61  ? 103 PHE B O     1 
ATOM   2463  C CB    . PHE B  2 103 ? 29.913  3.994   -85.818 1.00 50.75  ? 103 PHE B CB    1 
ATOM   2464  C CG    . PHE B  2 103 ? 31.132  4.743   -86.265 1.00 54.33  ? 103 PHE B CG    1 
ATOM   2465  C CD1   . PHE B  2 103 ? 31.659  4.544   -87.526 1.00 57.65  ? 103 PHE B CD1   1 
ATOM   2466  C CD2   . PHE B  2 103 ? 31.688  5.731   -85.469 1.00 58.54  ? 103 PHE B CD2   1 
ATOM   2467  C CE1   . PHE B  2 103 ? 32.712  5.325   -87.989 1.00 59.72  ? 103 PHE B CE1   1 
ATOM   2468  C CE2   . PHE B  2 103 ? 32.756  6.493   -85.926 1.00 62.56  ? 103 PHE B CE2   1 
ATOM   2469  C CZ    . PHE B  2 103 ? 33.247  6.299   -87.191 1.00 60.54  ? 103 PHE B CZ    1 
ATOM   2470  N N     . ASP B  2 104 ? 26.800  3.027   -86.519 1.00 43.28  ? 104 ASP B N     1 
ATOM   2471  C CA    . ASP B  2 104 ? 25.777  2.166   -86.020 1.00 41.68  ? 104 ASP B CA    1 
ATOM   2472  C C     . ASP B  2 104 ? 26.418  0.937   -85.349 1.00 45.23  ? 104 ASP B C     1 
ATOM   2473  O O     . ASP B  2 104 ? 26.741  -0.036  -86.020 1.00 46.23  ? 104 ASP B O     1 
ATOM   2474  C CB    . ASP B  2 104 ? 24.869  1.746   -87.149 1.00 43.51  ? 104 ASP B CB    1 
ATOM   2475  C CG    . ASP B  2 104 ? 23.689  0.874   -86.758 1.00 48.64  ? 104 ASP B CG    1 
ATOM   2476  O OD1   . ASP B  2 104 ? 23.487  0.627   -85.530 1.00 46.50  ? 104 ASP B OD1   1 
ATOM   2477  O OD2   . ASP B  2 104 ? 22.926  0.531   -87.639 1.00 57.55  ? 104 ASP B OD2   1 
ATOM   2478  N N     . MET B  2 105 ? 26.543  0.962   -84.029 1.00 39.98  ? 105 MET B N     1 
ATOM   2479  C CA    . MET B  2 105 ? 27.113  -0.162  -83.297 1.00 39.91  ? 105 MET B CA    1 
ATOM   2480  C C     . MET B  2 105 ? 26.067  -0.755  -82.359 1.00 40.33  ? 105 MET B C     1 
ATOM   2481  O O     . MET B  2 105 ? 26.409  -1.250  -81.297 1.00 39.27  ? 105 MET B O     1 
ATOM   2482  C CB    . MET B  2 105 ? 28.385  0.276   -82.565 1.00 42.77  ? 105 MET B CB    1 
ATOM   2483  C CG    . MET B  2 105 ? 29.514  0.708   -83.526 1.00 46.11  ? 105 MET B CG    1 
ATOM   2484  S SD    . MET B  2 105 ? 30.792  1.716   -82.743 1.00 51.51  ? 105 MET B SD    1 
ATOM   2485  C CE    . MET B  2 105 ? 31.529  0.648   -81.843 1.00 49.80  ? 105 MET B CE    1 
ATOM   2486  N N     . GLY B  2 106 ? 24.802  -0.712  -82.779 1.00 34.72  ? 106 GLY B N     1 
ATOM   2487  C CA    . GLY B  2 106 ? 23.695  -1.257  -82.012 1.00 34.95  ? 106 GLY B CA    1 
ATOM   2488  C C     . GLY B  2 106 ? 23.197  -0.414  -80.871 1.00 34.95  ? 106 GLY B C     1 
ATOM   2489  O O     . GLY B  2 106 ? 23.736  0.653   -80.575 1.00 33.86  ? 106 GLY B O     1 
ATOM   2490  N N     . PHE B  2 107 ? 22.141  -0.914  -80.238 1.00 34.31  ? 107 PHE B N     1 
ATOM   2491  C CA    . PHE B  2 107 ? 21.506  -0.268  -79.080 1.00 35.29  ? 107 PHE B CA    1 
ATOM   2492  C C     . PHE B  2 107 ? 22.283  -0.761  -77.859 1.00 37.41  ? 107 PHE B C     1 
ATOM   2493  O O     . PHE B  2 107 ? 21.986  -1.794  -77.291 1.00 34.44  ? 107 PHE B O     1 
ATOM   2494  C CB    . PHE B  2 107 ? 20.015  -0.595  -79.010 1.00 37.54  ? 107 PHE B CB    1 
ATOM   2495  C CG    . PHE B  2 107 ? 19.211  -0.266  -80.249 1.00 41.39  ? 107 PHE B CG    1 
ATOM   2496  C CD1   . PHE B  2 107 ? 19.441  0.909   -80.962 1.00 50.60  ? 107 PHE B CD1   1 
ATOM   2497  C CD2   . PHE B  2 107 ? 18.100  -1.010  -80.586 1.00 42.63  ? 107 PHE B CD2   1 
ATOM   2498  C CE1   . PHE B  2 107 ? 18.699  1.192   -82.120 1.00 52.41  ? 107 PHE B CE1   1 
ATOM   2499  C CE2   . PHE B  2 107 ? 17.364  -0.727  -81.736 1.00 46.01  ? 107 PHE B CE2   1 
ATOM   2500  C CZ    . PHE B  2 107 ? 17.715  0.308   -82.535 1.00 46.78  ? 107 PHE B CZ    1 
ATOM   2501  N N     . ASP B  2 108 ? 23.355  -0.065  -77.544 1.00 36.23  ? 108 ASP B N     1 
ATOM   2502  C CA    . ASP B  2 108 ? 24.281  -0.533  -76.526 1.00 35.82  ? 108 ASP B CA    1 
ATOM   2503  C C     . ASP B  2 108 ? 23.785  -0.341  -75.088 1.00 37.15  ? 108 ASP B C     1 
ATOM   2504  O O     . ASP B  2 108 ? 24.120  -1.168  -74.261 1.00 34.76  ? 108 ASP B O     1 
ATOM   2505  C CB    . ASP B  2 108 ? 25.685  0.051   -76.736 1.00 35.31  ? 108 ASP B CB    1 
ATOM   2506  C CG    . ASP B  2 108 ? 25.865  1.567   -76.686 1.00 36.54  ? 108 ASP B CG    1 
ATOM   2507  O OD1   . ASP B  2 108 ? 24.861  2.286   -76.715 1.00 34.38  ? 108 ASP B OD1   1 
ATOM   2508  O OD2   . ASP B  2 108 ? 27.032  2.035   -76.714 1.00 40.05  ? 108 ASP B OD2   1 
ATOM   2509  N N     . TYR B  2 109 ? 22.979  0.687   -74.795 1.00 34.37  ? 109 TYR B N     1 
ATOM   2510  C CA    . TYR B  2 109 ? 22.446  0.905   -73.433 1.00 34.19  ? 109 TYR B CA    1 
ATOM   2511  C C     . TYR B  2 109 ? 20.985  1.163   -73.552 1.00 37.46  ? 109 TYR B C     1 
ATOM   2512  O O     . TYR B  2 109 ? 20.552  1.877   -74.468 1.00 35.60  ? 109 TYR B O     1 
ATOM   2513  C CB    . TYR B  2 109 ? 23.142  2.082   -72.676 1.00 35.84  ? 109 TYR B CB    1 
ATOM   2514  C CG    . TYR B  2 109 ? 24.549  1.742   -72.241 1.00 38.64  ? 109 TYR B CG    1 
ATOM   2515  C CD1   . TYR B  2 109 ? 24.790  1.110   -71.033 1.00 40.97  ? 109 TYR B CD1   1 
ATOM   2516  C CD2   . TYR B  2 109 ? 25.639  2.043   -73.045 1.00 40.27  ? 109 TYR B CD2   1 
ATOM   2517  C CE1   . TYR B  2 109 ? 26.087  0.859   -70.598 1.00 41.29  ? 109 TYR B CE1   1 
ATOM   2518  C CE2   . TYR B  2 109 ? 26.930  1.710   -72.666 1.00 41.60  ? 109 TYR B CE2   1 
ATOM   2519  C CZ    . TYR B  2 109 ? 27.156  1.108   -71.443 1.00 49.40  ? 109 TYR B CZ    1 
ATOM   2520  O OH    . TYR B  2 109 ? 28.437  0.737   -71.072 1.00 51.15  ? 109 TYR B OH    1 
ATOM   2521  N N     . TRP B  2 110 ? 20.216  0.549   -72.636 1.00 34.79  ? 110 TRP B N     1 
ATOM   2522  C CA    . TRP B  2 110 ? 18.761  0.612   -72.614 1.00 33.72  ? 110 TRP B CA    1 
ATOM   2523  C C     . TRP B  2 110 ? 18.271  1.097   -71.274 1.00 37.82  ? 110 TRP B C     1 
ATOM   2524  O O     . TRP B  2 110 ? 18.920  0.868   -70.273 1.00 37.49  ? 110 TRP B O     1 
ATOM   2525  C CB    . TRP B  2 110 ? 18.171  -0.782  -72.827 1.00 31.60  ? 110 TRP B CB    1 
ATOM   2526  C CG    . TRP B  2 110 ? 18.462  -1.407  -74.144 1.00 31.78  ? 110 TRP B CG    1 
ATOM   2527  C CD1   . TRP B  2 110 ? 19.674  -1.778  -74.623 1.00 34.13  ? 110 TRP B CD1   1 
ATOM   2528  C CD2   . TRP B  2 110 ? 17.491  -1.906  -75.079 1.00 31.49  ? 110 TRP B CD2   1 
ATOM   2529  N NE1   . TRP B  2 110 ? 19.537  -2.314  -75.875 1.00 34.05  ? 110 TRP B NE1   1 
ATOM   2530  C CE2   . TRP B  2 110 ? 18.208  -2.467  -76.158 1.00 34.65  ? 110 TRP B CE2   1 
ATOM   2531  C CE3   . TRP B  2 110 ? 16.082  -1.941  -75.105 1.00 31.51  ? 110 TRP B CE3   1 
ATOM   2532  C CZ2   . TRP B  2 110 ? 17.578  -3.003  -77.283 1.00 32.61  ? 110 TRP B CZ2   1 
ATOM   2533  C CZ3   . TRP B  2 110 ? 15.452  -2.450  -76.236 1.00 32.41  ? 110 TRP B CZ3   1 
ATOM   2534  C CH2   . TRP B  2 110 ? 16.208  -2.927  -77.333 1.00 33.06  ? 110 TRP B CH2   1 
ATOM   2535  N N     . GLY B  2 111 ? 17.102  1.717   -71.265 1.00 34.64  ? 111 GLY B N     1 
ATOM   2536  C CA    . GLY B  2 111 ? 16.423  2.065   -70.024 1.00 35.34  ? 111 GLY B CA    1 
ATOM   2537  C C     . GLY B  2 111 ? 15.849  0.786   -69.411 1.00 35.09  ? 111 GLY B C     1 
ATOM   2538  O O     . GLY B  2 111 ? 15.902  -0.283  -70.020 1.00 32.88  ? 111 GLY B O     1 
ATOM   2539  N N     . GLN B  2 112 ? 15.311  0.874   -68.207 1.00 32.23  ? 112 GLN B N     1 
ATOM   2540  C CA    . GLN B  2 112 ? 14.810  -0.301  -67.480 1.00 31.33  ? 112 GLN B CA    1 
ATOM   2541  C C     . GLN B  2 112 ? 13.424  -0.777  -67.934 1.00 34.29  ? 112 GLN B C     1 
ATOM   2542  O O     . GLN B  2 112 ? 13.007  -1.896  -67.620 1.00 34.47  ? 112 GLN B O     1 
ATOM   2543  C CB    . GLN B  2 112 ? 14.861  -0.068  -65.959 1.00 32.92  ? 112 GLN B CB    1 
ATOM   2544  C CG    . GLN B  2 112 ? 13.704  0.777   -65.332 1.00 35.87  ? 112 GLN B CG    1 
ATOM   2545  C CD    . GLN B  2 112 ? 13.784  2.248   -65.590 1.00 45.82  ? 112 GLN B CD    1 
ATOM   2546  O OE1   . GLN B  2 112 ? 14.606  2.724   -66.374 1.00 40.51  ? 112 GLN B OE1   1 
ATOM   2547  N NE2   . GLN B  2 112 ? 12.920  3.017   -64.924 1.00 41.70  ? 112 GLN B NE2   1 
ATOM   2548  N N     . GLY B  2 113 ? 12.748  0.049   -68.695 1.00 30.67  ? 113 GLY B N     1 
ATOM   2549  C CA    . GLY B  2 113 ? 11.440  -0.260  -69.234 1.00 29.91  ? 113 GLY B CA    1 
ATOM   2550  C C     . GLY B  2 113 ? 10.342  0.380   -68.402 1.00 34.93  ? 113 GLY B C     1 
ATOM   2551  O O     . GLY B  2 113 ? 10.536  0.652   -67.202 1.00 33.35  ? 113 GLY B O     1 
ATOM   2552  N N     . THR B  2 114 ? 9.241   0.756   -69.081 1.00 32.84  ? 114 THR B N     1 
ATOM   2553  C CA    . THR B  2 114 ? 8.041   1.345   -68.459 1.00 32.66  ? 114 THR B CA    1 
ATOM   2554  C C     . THR B  2 114 ? 6.885   0.444   -68.821 1.00 34.73  ? 114 THR B C     1 
ATOM   2555  O O     . THR B  2 114 ? 6.604   0.281   -69.995 1.00 32.60  ? 114 THR B O     1 
ATOM   2556  C CB    . THR B  2 114 ? 7.767   2.782   -68.939 1.00 37.47  ? 114 THR B CB    1 
ATOM   2557  O OG1   . THR B  2 114 ? 8.892   3.617   -68.649 1.00 35.09  ? 114 THR B OG1   1 
ATOM   2558  C CG2   . THR B  2 114 ? 6.565   3.394   -68.276 1.00 33.02  ? 114 THR B CG2   1 
ATOM   2559  N N     . THR B  2 115 ? 6.186   -0.090  -67.828 1.00 32.21  ? 115 THR B N     1 
ATOM   2560  C CA    . THR B  2 115 ? 4.999   -0.904  -68.091 1.00 32.99  ? 115 THR B CA    1 
ATOM   2561  C C     . THR B  2 115 ? 3.846   0.040   -68.318 1.00 34.92  ? 115 THR B C     1 
ATOM   2562  O O     . THR B  2 115 ? 3.628   0.942   -67.517 1.00 31.81  ? 115 THR B O     1 
ATOM   2563  C CB    . THR B  2 115 ? 4.708   -1.841  -66.924 1.00 38.67  ? 115 THR B CB    1 
ATOM   2564  O OG1   . THR B  2 115 ? 5.868   -2.659  -66.738 1.00 43.58  ? 115 THR B OG1   1 
ATOM   2565  C CG2   . THR B  2 115 ? 3.521   -2.681  -67.182 1.00 34.26  ? 115 THR B CG2   1 
ATOM   2566  N N     . VAL B  2 116 ? 3.185   -0.100  -69.477 1.00 32.96  ? 116 VAL B N     1 
ATOM   2567  C CA    . VAL B  2 116 ? 2.044   0.741   -69.821 1.00 33.42  ? 116 VAL B CA    1 
ATOM   2568  C C     . VAL B  2 116 ? 0.844   -0.158  -70.079 1.00 34.89  ? 116 VAL B C     1 
ATOM   2569  O O     . VAL B  2 116 ? 0.935   -1.042  -70.899 1.00 31.48  ? 116 VAL B O     1 
ATOM   2570  C CB    . VAL B  2 116 ? 2.280   1.700   -71.017 1.00 36.23  ? 116 VAL B CB    1 
ATOM   2571  C CG1   . VAL B  2 116 ? 0.972   2.454   -71.369 1.00 35.77  ? 116 VAL B CG1   1 
ATOM   2572  C CG2   . VAL B  2 116 ? 3.411   2.664   -70.700 1.00 36.72  ? 116 VAL B CG2   1 
ATOM   2573  N N     . THR B  2 117 ? -0.270  0.092   -69.380 1.00 33.85  ? 117 THR B N     1 
ATOM   2574  C CA    . THR B  2 117 ? -1.504  -0.661  -69.578 1.00 33.11  ? 117 THR B CA    1 
ATOM   2575  C C     . THR B  2 117 ? -2.551  0.298   -70.078 1.00 35.37  ? 117 THR B C     1 
ATOM   2576  O O     . THR B  2 117 ? -2.704  1.379   -69.524 1.00 33.61  ? 117 THR B O     1 
ATOM   2577  C CB    . THR B  2 117 ? -1.969  -1.371  -68.282 1.00 38.04  ? 117 THR B CB    1 
ATOM   2578  O OG1   . THR B  2 117 ? -0.941  -2.275  -67.863 1.00 39.30  ? 117 THR B OG1   1 
ATOM   2579  C CG2   . THR B  2 117 ? -3.295  -2.143  -68.484 1.00 35.78  ? 117 THR B CG2   1 
ATOM   2580  N N     . VAL B  2 118 ? -3.267  -0.101  -71.129 1.00 34.10  ? 118 VAL B N     1 
ATOM   2581  C CA    . VAL B  2 118 ? -4.366  0.664   -71.675 1.00 34.72  ? 118 VAL B CA    1 
ATOM   2582  C C     . VAL B  2 118 ? -5.640  -0.061  -71.265 1.00 38.40  ? 118 VAL B C     1 
ATOM   2583  O O     . VAL B  2 118 ? -5.840  -1.202  -71.624 1.00 36.65  ? 118 VAL B O     1 
ATOM   2584  C CB    . VAL B  2 118 ? -4.252  0.879   -73.204 1.00 38.11  ? 118 VAL B CB    1 
ATOM   2585  C CG1   . VAL B  2 118 ? -5.449  1.699   -73.717 1.00 37.76  ? 118 VAL B CG1   1 
ATOM   2586  C CG2   . VAL B  2 118 ? -2.929  1.572   -73.536 1.00 37.51  ? 118 VAL B CG2   1 
ATOM   2587  N N     . SER B  2 119 ? -6.465  0.570   -70.457 1.00 38.70  ? 119 SER B N     1 
ATOM   2588  C CA    . SER B  2 119 ? -7.698  -0.053  -69.985 1.00 39.53  ? 119 SER B CA    1 
ATOM   2589  C C     . SER B  2 119 ? -8.703  0.982   -69.453 1.00 45.50  ? 119 SER B C     1 
ATOM   2590  O O     . SER B  2 119 ? -8.319  1.959   -68.832 1.00 44.56  ? 119 SER B O     1 
ATOM   2591  C CB    . SER B  2 119 ? -7.393  -1.064  -68.878 1.00 40.57  ? 119 SER B CB    1 
ATOM   2592  O OG    . SER B  2 119 ? -8.575  -1.714  -68.457 1.00 48.93  ? 119 SER B OG    1 
ATOM   2593  N N     . SER B  2 120 ? -9.986  0.714   -69.665 1.00 45.64  ? 120 SER B N     1 
ATOM   2594  C CA    . SER B  2 120 ? -11.084 1.488   -69.100 1.00 46.59  ? 120 SER B CA    1 
ATOM   2595  C C     . SER B  2 120 ? -11.507 0.809   -67.784 1.00 52.03  ? 120 SER B C     1 
ATOM   2596  O O     . SER B  2 120 ? -12.292 1.405   -67.068 1.00 53.51  ? 120 SER B O     1 
ATOM   2597  C CB    . SER B  2 120 ? -12.251 1.602   -70.076 1.00 48.15  ? 120 SER B CB    1 
ATOM   2598  O OG    . SER B  2 120 ? -12.373 0.427   -70.851 1.00 62.57  ? 120 SER B OG    1 
ATOM   2599  N N     . ALA B  2 121 ? -10.892 -0.369  -67.395 1.00 46.39  ? 121 ALA B N     1 
ATOM   2600  C CA    . ALA B  2 121 ? -11.192 -0.991  -66.107 1.00 44.38  ? 121 ALA B CA    1 
ATOM   2601  C C     . ALA B  2 121 ? -10.571 -0.182  -64.986 1.00 49.20  ? 121 ALA B C     1 
ATOM   2602  O O     . ALA B  2 121 ? -9.573  0.500   -65.186 1.00 49.60  ? 121 ALA B O     1 
ATOM   2603  C CB    . ALA B  2 121 ? -10.696 -2.425  -66.049 1.00 43.62  ? 121 ALA B CB    1 
ATOM   2604  N N     . SER B  2 122 ? -11.151 -0.270  -63.796 1.00 47.55  ? 122 SER B N     1 
ATOM   2605  C CA    . SER B  2 122 ? -10.662 0.512   -62.673 1.00 48.46  ? 122 SER B CA    1 
ATOM   2606  C C     . SER B  2 122 ? -9.429  -0.074  -62.008 1.00 50.46  ? 122 SER B C     1 
ATOM   2607  O O     . SER B  2 122 ? -9.254  -1.302  -61.886 1.00 49.56  ? 122 SER B O     1 
ATOM   2608  C CB    . SER B  2 122 ? -11.774 0.724   -61.642 1.00 53.47  ? 122 SER B CB    1 
ATOM   2609  O OG    . SER B  2 122 ? -12.227 -0.524  -61.156 1.00 61.53  ? 122 SER B OG    1 
ATOM   2610  N N     . THR B  2 123 ? -8.576  0.841   -61.564 1.00 45.45  ? 123 THR B N     1 
ATOM   2611  C CA    . THR B  2 123 ? -7.376  0.512   -60.815 1.00 44.50  ? 123 THR B CA    1 
ATOM   2612  C C     . THR B  2 123 ? -7.775  -0.012  -59.433 1.00 47.90  ? 123 THR B C     1 
ATOM   2613  O O     . THR B  2 123 ? -8.631  0.594   -58.799 1.00 47.93  ? 123 THR B O     1 
ATOM   2614  C CB    . THR B  2 123 ? -6.492  1.741   -60.719 1.00 40.33  ? 123 THR B CB    1 
ATOM   2615  O OG1   . THR B  2 123 ? -5.924  1.930   -62.000 1.00 46.36  ? 123 THR B OG1   1 
ATOM   2616  C CG2   . THR B  2 123 ? -5.405  1.595   -59.722 1.00 43.20  ? 123 THR B CG2   1 
ATOM   2617  N N     . LYS B  2 124 ? -7.162  -1.132  -58.973 1.00 43.46  ? 124 LYS B N     1 
ATOM   2618  C CA    . LYS B  2 124 ? -7.469  -1.738  -57.672 1.00 41.25  ? 124 LYS B CA    1 
ATOM   2619  C C     . LYS B  2 124 ? -6.186  -2.207  -56.992 1.00 43.98  ? 124 LYS B C     1 
ATOM   2620  O O     . LYS B  2 124 ? -5.397  -2.919  -57.596 1.00 41.73  ? 124 LYS B O     1 
ATOM   2621  C CB    . LYS B  2 124 ? -8.448  -2.915  -57.872 1.00 41.92  ? 124 LYS B CB    1 
ATOM   2622  C CG    . LYS B  2 124 ? -9.054  -3.421  -56.587 1.00 59.62  ? 124 LYS B CG    1 
ATOM   2623  C CD    . LYS B  2 124 ? -9.799  -4.753  -56.769 1.00 68.16  ? 124 LYS B CD    1 
ATOM   2624  C CE    . LYS B  2 124 ? -10.443 -5.221  -55.481 1.00 71.98  ? 124 LYS B CE    1 
ATOM   2625  N NZ    . LYS B  2 124 ? -9.432  -5.584  -54.436 1.00 88.58  ? 124 LYS B NZ    1 
ATOM   2626  N N     . GLY B  2 125 ? -5.989  -1.811  -55.739 1.00 41.64  ? 125 GLY B N     1 
ATOM   2627  C CA    . GLY B  2 125 ? -4.825  -2.212  -54.965 1.00 40.53  ? 125 GLY B CA    1 
ATOM   2628  C C     . GLY B  2 125 ? -5.016  -3.625  -54.432 1.00 45.48  ? 125 GLY B C     1 
ATOM   2629  O O     . GLY B  2 125 ? -6.152  -4.074  -54.238 1.00 43.30  ? 125 GLY B O     1 
ATOM   2630  N N     . PRO B  2 126 ? -3.911  -4.362  -54.211 1.00 42.31  ? 126 PRO B N     1 
ATOM   2631  C CA    . PRO B  2 126 ? -4.034  -5.757  -53.737 1.00 42.08  ? 126 PRO B CA    1 
ATOM   2632  C C     . PRO B  2 126 ? -4.324  -5.904  -52.259 1.00 48.51  ? 126 PRO B C     1 
ATOM   2633  O O     . PRO B  2 126 ? -3.992  -5.018  -51.482 1.00 48.34  ? 126 PRO B O     1 
ATOM   2634  C CB    . PRO B  2 126 ? -2.632  -6.314  -53.971 1.00 42.18  ? 126 PRO B CB    1 
ATOM   2635  C CG    . PRO B  2 126 ? -1.740  -5.114  -53.838 1.00 46.15  ? 126 PRO B CG    1 
ATOM   2636  C CD    . PRO B  2 126 ? -2.498  -3.989  -54.434 1.00 42.05  ? 126 PRO B CD    1 
ATOM   2637  N N     . SER B  2 127 ? -4.831  -7.086  -51.877 1.00 45.44  ? 127 SER B N     1 
ATOM   2638  C CA    . SER B  2 127 ? -4.945  -7.508  -50.484 1.00 45.74  ? 127 SER B CA    1 
ATOM   2639  C C     . SER B  2 127 ? -3.729  -8.398  -50.311 1.00 46.35  ? 127 SER B C     1 
ATOM   2640  O O     . SER B  2 127 ? -3.410  -9.131  -51.246 1.00 46.78  ? 127 SER B O     1 
ATOM   2641  C CB    . SER B  2 127 ? -6.224  -8.293  -50.227 1.00 49.68  ? 127 SER B CB    1 
ATOM   2642  O OG    . SER B  2 127 ? -7.363  -7.456  -50.331 1.00 51.01  ? 127 SER B OG    1 
ATOM   2643  N N     . VAL B  2 128 ? -3.001  -8.280  -49.189 1.00 42.00  ? 128 VAL B N     1 
ATOM   2644  C CA    . VAL B  2 128 ? -1.778  -9.054  -48.941 1.00 42.62  ? 128 VAL B CA    1 
ATOM   2645  C C     . VAL B  2 128 ? -2.033  -10.017 -47.802 1.00 46.46  ? 128 VAL B C     1 
ATOM   2646  O O     . VAL B  2 128 ? -2.417  -9.593  -46.715 1.00 46.01  ? 128 VAL B O     1 
ATOM   2647  C CB    . VAL B  2 128 ? -0.530  -8.171  -48.733 1.00 46.16  ? 128 VAL B CB    1 
ATOM   2648  C CG1   . VAL B  2 128 ? 0.732   -9.039  -48.549 1.00 45.15  ? 128 VAL B CG1   1 
ATOM   2649  C CG2   . VAL B  2 128 ? -0.359  -7.229  -49.928 1.00 45.46  ? 128 VAL B CG2   1 
ATOM   2650  N N     . PHE B  2 129 ? -1.923  -11.340 -48.088 1.00 41.87  ? 129 PHE B N     1 
ATOM   2651  C CA    . PHE B  2 129 ? -2.240  -12.376 -47.113 1.00 40.52  ? 129 PHE B CA    1 
ATOM   2652  C C     . PHE B  2 129 ? -1.049  -13.197 -46.859 1.00 44.16  ? 129 PHE B C     1 
ATOM   2653  O O     . PHE B  2 129 ? -0.398  -13.593 -47.811 1.00 45.48  ? 129 PHE B O     1 
ATOM   2654  C CB    . PHE B  2 129 ? -3.395  -13.238 -47.633 1.00 41.51  ? 129 PHE B CB    1 
ATOM   2655  C CG    . PHE B  2 129 ? -4.689  -12.467 -47.824 1.00 41.90  ? 129 PHE B CG    1 
ATOM   2656  C CD1   . PHE B  2 129 ? -5.261  -11.770 -46.777 1.00 46.22  ? 129 PHE B CD1   1 
ATOM   2657  C CD2   . PHE B  2 129 ? -5.343  -12.466 -49.043 1.00 42.75  ? 129 PHE B CD2   1 
ATOM   2658  C CE1   . PHE B  2 129 ? -6.443  -11.057 -46.960 1.00 47.32  ? 129 PHE B CE1   1 
ATOM   2659  C CE2   . PHE B  2 129 ? -6.550  -11.801 -49.204 1.00 44.95  ? 129 PHE B CE2   1 
ATOM   2660  C CZ    . PHE B  2 129 ? -7.079  -11.083 -48.172 1.00 44.20  ? 129 PHE B CZ    1 
ATOM   2661  N N     . PRO B  2 130 ? -0.713  -13.466 -45.587 1.00 41.99  ? 130 PRO B N     1 
ATOM   2662  C CA    . PRO B  2 130 ? 0.491   -14.281 -45.299 1.00 41.33  ? 130 PRO B CA    1 
ATOM   2663  C C     . PRO B  2 130 ? 0.326   -15.776 -45.568 1.00 45.76  ? 130 PRO B C     1 
ATOM   2664  O O     . PRO B  2 130 ? -0.750  -16.341 -45.333 1.00 45.82  ? 130 PRO B O     1 
ATOM   2665  C CB    . PRO B  2 130 ? 0.705   -14.039 -43.804 1.00 42.74  ? 130 PRO B CB    1 
ATOM   2666  C CG    . PRO B  2 130 ? -0.707  -13.859 -43.286 1.00 46.96  ? 130 PRO B CG    1 
ATOM   2667  C CD    . PRO B  2 130 ? -1.378  -13.038 -44.331 1.00 42.63  ? 130 PRO B CD    1 
ATOM   2668  N N     . LEU B  2 131 ? 1.421   -16.427 -46.024 1.00 41.60  ? 131 LEU B N     1 
ATOM   2669  C CA    . LEU B  2 131 ? 1.471   -17.870 -46.250 1.00 39.94  ? 131 LEU B CA    1 
ATOM   2670  C C     . LEU B  2 131 ? 2.361   -18.516 -45.198 1.00 45.87  ? 131 LEU B C     1 
ATOM   2671  O O     . LEU B  2 131 ? 3.581   -18.399 -45.269 1.00 44.36  ? 131 LEU B O     1 
ATOM   2672  C CB    . LEU B  2 131 ? 1.925   -18.221 -47.660 1.00 38.59  ? 131 LEU B CB    1 
ATOM   2673  C CG    . LEU B  2 131 ? 1.123   -17.651 -48.804 1.00 40.61  ? 131 LEU B CG    1 
ATOM   2674  C CD1   . LEU B  2 131 ? 1.874   -17.837 -50.115 1.00 39.73  ? 131 LEU B CD1   1 
ATOM   2675  C CD2   . LEU B  2 131 ? -0.195  -18.323 -48.914 1.00 42.59  ? 131 LEU B CD2   1 
ATOM   2676  N N     . ALA B  2 132 ? 1.747   -19.176 -44.190 1.00 47.26  ? 132 ALA B N     1 
ATOM   2677  C CA    . ALA B  2 132 ? 2.513   -19.811 -43.108 1.00 49.05  ? 132 ALA B CA    1 
ATOM   2678  C C     . ALA B  2 132 ? 2.069   -21.238 -42.901 1.00 56.29  ? 132 ALA B C     1 
ATOM   2679  O O     . ALA B  2 132 ? 0.909   -21.533 -43.123 1.00 55.67  ? 132 ALA B O     1 
ATOM   2680  C CB    . ALA B  2 132 ? 2.378   -19.006 -41.819 1.00 50.07  ? 132 ALA B CB    1 
ATOM   2681  N N     . PRO B  2 133 ? 2.981   -22.164 -42.562 1.00 58.29  ? 133 PRO B N     1 
ATOM   2682  C CA    . PRO B  2 133 ? 2.568   -23.572 -42.421 1.00 60.31  ? 133 PRO B CA    1 
ATOM   2683  C C     . PRO B  2 133 ? 1.577   -23.840 -41.281 1.00 69.75  ? 133 PRO B C     1 
ATOM   2684  O O     . PRO B  2 133 ? 1.628   -23.183 -40.251 1.00 66.95  ? 133 PRO B O     1 
ATOM   2685  C CB    . PRO B  2 133 ? 3.895   -24.322 -42.241 1.00 61.49  ? 133 PRO B CB    1 
ATOM   2686  C CG    . PRO B  2 133 ? 4.860   -23.323 -41.774 1.00 65.23  ? 133 PRO B CG    1 
ATOM   2687  C CD    . PRO B  2 133 ? 4.427   -21.991 -42.314 1.00 60.37  ? 133 PRO B CD    1 
ATOM   2688  N N     . CYS B  2 134 ? 0.652   -24.791 -41.505 1.00 74.58  ? 134 CYS B N     1 
ATOM   2689  C CA    . CYS B  2 134 ? -0.363  -25.198 -40.528 1.00 79.34  ? 134 CYS B CA    1 
ATOM   2690  C C     . CYS B  2 134 ? 0.335   -26.100 -39.509 1.00 91.81  ? 134 CYS B C     1 
ATOM   2691  O O     . CYS B  2 134 ? 0.378   -27.319 -39.692 1.00 92.99  ? 134 CYS B O     1 
ATOM   2692  C CB    . CYS B  2 134 ? -1.537  -25.910 -41.212 1.00 80.07  ? 134 CYS B CB    1 
ATOM   2693  S SG    . CYS B  2 134 ? -2.812  -26.536 -40.075 1.00 85.63  ? 134 CYS B SG    1 
ATOM   2694  N N     . SER B  2 135 ? 0.933   -25.496 -38.471 1.00 93.94  ? 135 SER B N     1 
ATOM   2695  C CA    . SER B  2 135 ? 1.653   -26.217 -37.409 1.00 96.84  ? 135 SER B CA    1 
ATOM   2696  C C     . SER B  2 135 ? 2.794   -27.092 -37.967 1.00 103.10 ? 135 SER B C     1 
ATOM   2697  O O     . SER B  2 135 ? 2.596   -28.278 -38.240 1.00 101.17 ? 135 SER B O     1 
ATOM   2698  C CB    . SER B  2 135 ? 0.687   -27.032 -36.549 1.00 102.12 ? 135 SER B CB    1 
ATOM   2699  O OG    . SER B  2 135 ? -0.332  -26.199 -36.012 1.00 112.54 ? 135 SER B OG    1 
ATOM   2700  N N     . ARG B  2 136 ? 3.981   -26.472 -38.145 1.00 103.33 ? 136 ARG B N     1 
ATOM   2701  C CA    . ARG B  2 136 ? 5.184   -27.109 -38.696 1.00 103.99 ? 136 ARG B CA    1 
ATOM   2702  C C     . ARG B  2 136 ? 5.639   -28.314 -37.869 1.00 112.07 ? 136 ARG B C     1 
ATOM   2703  O O     . ARG B  2 136 ? 5.593   -28.281 -36.639 1.00 112.18 ? 136 ARG B O     1 
ATOM   2704  C CB    . ARG B  2 136 ? 6.341   -26.105 -38.846 1.00 103.76 ? 136 ARG B CB    1 
ATOM   2705  N N     . SER B  2 137 ? 6.096   -29.369 -38.574 1.00 111.00 ? 137 SER B N     1 
ATOM   2706  C CA    . SER B  2 137 ? 6.509   -30.652 -38.003 1.00 111.77 ? 137 SER B CA    1 
ATOM   2707  C C     . SER B  2 137 ? 8.026   -30.854 -37.993 1.00 115.96 ? 137 SER B C     1 
ATOM   2708  O O     . SER B  2 137 ? 8.764   -30.108 -38.643 1.00 115.73 ? 137 SER B O     1 
ATOM   2709  C CB    . SER B  2 137 ? 5.886   -31.790 -38.812 1.00 115.17 ? 137 SER B CB    1 
ATOM   2710  O OG    . SER B  2 137 ? 6.629   -32.064 -39.992 1.00 122.87 ? 137 SER B OG    1 
ATOM   2711  N N     . THR B  2 138 ? 8.461   -31.927 -37.295 1.00 111.67 ? 138 THR B N     1 
ATOM   2712  C CA    . THR B  2 138 ? 9.853   -32.369 -37.206 1.00 110.75 ? 138 THR B CA    1 
ATOM   2713  C C     . THR B  2 138 ? 9.972   -33.697 -37.992 1.00 111.90 ? 138 THR B C     1 
ATOM   2714  O O     . THR B  2 138 ? 8.985   -34.428 -38.067 1.00 111.70 ? 138 THR B O     1 
ATOM   2715  C CB    . THR B  2 138 ? 10.304  -32.541 -35.735 1.00 120.10 ? 138 THR B CB    1 
ATOM   2716  O OG1   . THR B  2 138 ? 9.230   -33.043 -34.935 1.00 118.81 ? 138 THR B OG1   1 
ATOM   2717  C CG2   . THR B  2 138 ? 10.840  -31.250 -35.134 1.00 118.85 ? 138 THR B CG2   1 
ATOM   2718  N N     . SER B  2 139 ? 11.130  -34.029 -38.594 1.00 105.67 ? 139 SER B N     1 
ATOM   2719  C CA    . SER B  2 139 ? 12.376  -33.264 -38.570 1.00 104.44 ? 139 SER B CA    1 
ATOM   2720  C C     . SER B  2 139 ? 12.603  -32.665 -39.964 1.00 103.84 ? 139 SER B C     1 
ATOM   2721  O O     . SER B  2 139 ? 13.497  -33.084 -40.712 1.00 103.85 ? 139 SER B O     1 
ATOM   2722  C CB    . SER B  2 139 ? 13.528  -34.163 -38.147 1.00 108.18 ? 139 SER B CB    1 
ATOM   2723  O OG    . SER B  2 139 ? 13.246  -34.771 -36.894 1.00 115.34 ? 139 SER B OG    1 
ATOM   2724  N N     . GLU B  2 140 ? 11.728  -31.700 -40.316 1.00 94.84  ? 140 GLU B N     1 
ATOM   2725  C CA    . GLU B  2 140 ? 11.778  -30.960 -41.574 1.00 90.63  ? 140 GLU B CA    1 
ATOM   2726  C C     . GLU B  2 140 ? 12.884  -29.913 -41.381 1.00 84.29  ? 140 GLU B C     1 
ATOM   2727  O O     . GLU B  2 140 ? 12.778  -29.106 -40.466 1.00 84.92  ? 140 GLU B O     1 
ATOM   2728  C CB    . GLU B  2 140 ? 10.407  -30.283 -41.844 1.00 92.17  ? 140 GLU B CB    1 
ATOM   2729  C CG    . GLU B  2 140 ? 10.064  -30.105 -43.318 1.00 107.64 ? 140 GLU B CG    1 
ATOM   2730  C CD    . GLU B  2 140 ? 8.952   -30.990 -43.856 1.00 131.83 ? 140 GLU B CD    1 
ATOM   2731  O OE1   . GLU B  2 140 ? 9.064   -32.234 -43.743 1.00 115.45 ? 140 GLU B OE1   1 
ATOM   2732  O OE2   . GLU B  2 140 ? 7.981   -30.437 -44.422 1.00 129.70 ? 140 GLU B OE2   1 
ATOM   2733  N N     . SER B  2 141 ? 13.976  -29.982 -42.151 1.00 71.94  ? 141 SER B N     1 
ATOM   2734  C CA    . SER B  2 141 ? 15.079  -29.022 -42.004 1.00 68.96  ? 141 SER B CA    1 
ATOM   2735  C C     . SER B  2 141 ? 14.791  -27.688 -42.732 1.00 65.25  ? 141 SER B C     1 
ATOM   2736  O O     . SER B  2 141 ? 15.391  -26.672 -42.385 1.00 62.89  ? 141 SER B O     1 
ATOM   2737  C CB    . SER B  2 141 ? 16.398  -29.629 -42.487 1.00 72.15  ? 141 SER B CB    1 
ATOM   2738  O OG    . SER B  2 141 ? 16.250  -30.345 -43.700 1.00 82.80  ? 141 SER B OG    1 
ATOM   2739  N N     . THR B  2 142 ? 13.905  -27.700 -43.753 1.00 58.25  ? 142 THR B N     1 
ATOM   2740  C CA    . THR B  2 142 ? 13.546  -26.516 -44.522 1.00 56.72  ? 142 THR B CA    1 
ATOM   2741  C C     . THR B  2 142 ? 12.067  -26.181 -44.339 1.00 57.72  ? 142 THR B C     1 
ATOM   2742  O O     . THR B  2 142 ? 11.222  -27.067 -44.307 1.00 58.14  ? 142 THR B O     1 
ATOM   2743  C CB    . THR B  2 142 ? 13.924  -26.689 -45.977 1.00 56.70  ? 142 THR B CB    1 
ATOM   2744  O OG1   . THR B  2 142 ? 15.344  -26.748 -46.049 1.00 57.24  ? 142 THR B OG1   1 
ATOM   2745  C CG2   . THR B  2 142 ? 13.479  -25.529 -46.835 1.00 56.47  ? 142 THR B CG2   1 
ATOM   2746  N N     . ALA B  2 143 ? 11.773  -24.896 -44.212 1.00 49.98  ? 143 ALA B N     1 
ATOM   2747  C CA    . ALA B  2 143 ? 10.417  -24.398 -44.072 1.00 48.35  ? 143 ALA B CA    1 
ATOM   2748  C C     . ALA B  2 143 ? 10.164  -23.434 -45.204 1.00 48.46  ? 143 ALA B C     1 
ATOM   2749  O O     . ALA B  2 143 ? 11.100  -22.790 -45.667 1.00 47.48  ? 143 ALA B O     1 
ATOM   2750  C CB    . ALA B  2 143 ? 10.273  -23.677 -42.747 1.00 49.41  ? 143 ALA B CB    1 
ATOM   2751  N N     . ALA B  2 144 ? 8.910   -23.299 -45.625 1.00 42.92  ? 144 ALA B N     1 
ATOM   2752  C CA    . ALA B  2 144 ? 8.547   -22.293 -46.615 1.00 42.26  ? 144 ALA B CA    1 
ATOM   2753  C C     . ALA B  2 144 ? 7.531   -21.329 -46.014 1.00 43.51  ? 144 ALA B C     1 
ATOM   2754  O O     . ALA B  2 144 ? 6.742   -21.685 -45.134 1.00 40.67  ? 144 ALA B O     1 
ATOM   2755  C CB    . ALA B  2 144 ? 7.999   -22.926 -47.880 1.00 42.59  ? 144 ALA B CB    1 
ATOM   2756  N N     . LEU B  2 145 ? 7.637   -20.082 -46.416 1.00 42.23  ? 145 LEU B N     1 
ATOM   2757  C CA    . LEU B  2 145 ? 6.671   -19.063 -46.040 1.00 45.67  ? 145 LEU B CA    1 
ATOM   2758  C C     . LEU B  2 145 ? 6.498   -18.125 -47.208 1.00 48.34  ? 145 LEU B C     1 
ATOM   2759  O O     . LEU B  2 145 ? 7.243   -18.201 -48.187 1.00 49.48  ? 145 LEU B O     1 
ATOM   2760  C CB    . LEU B  2 145 ? 6.976   -18.375 -44.691 1.00 49.30  ? 145 LEU B CB    1 
ATOM   2761  C CG    . LEU B  2 145 ? 8.415   -17.974 -44.413 1.00 56.86  ? 145 LEU B CG    1 
ATOM   2762  C CD1   . LEU B  2 145 ? 8.648   -16.531 -44.832 1.00 59.96  ? 145 LEU B CD1   1 
ATOM   2763  C CD2   . LEU B  2 145 ? 8.739   -18.128 -42.941 1.00 58.15  ? 145 LEU B CD2   1 
ATOM   2764  N N     . GLY B  2 146 ? 5.432   -17.373 -47.210 1.00 43.64  ? 146 GLY B N     1 
ATOM   2765  C CA    . GLY B  2 146 ? 5.188   -16.519 -48.355 1.00 41.98  ? 146 GLY B CA    1 
ATOM   2766  C C     . GLY B  2 146 ? 4.134   -15.474 -48.142 1.00 45.39  ? 146 GLY B C     1 
ATOM   2767  O O     . GLY B  2 146 ? 3.659   -15.277 -47.020 1.00 43.73  ? 146 GLY B O     1 
ATOM   2768  N N     . CYS B  2 147 ? 3.710   -14.874 -49.244 1.00 45.74  ? 147 CYS B N     1 
ATOM   2769  C CA    . CYS B  2 147 ? 2.659   -13.855 -49.278 1.00 48.41  ? 147 CYS B CA    1 
ATOM   2770  C C     . CYS B  2 147 ? 1.806   -14.046 -50.518 1.00 46.70  ? 147 CYS B C     1 
ATOM   2771  O O     . CYS B  2 147 ? 2.349   -14.140 -51.605 1.00 43.37  ? 147 CYS B O     1 
ATOM   2772  C CB    . CYS B  2 147 ? 3.260   -12.447 -49.240 1.00 51.74  ? 147 CYS B CB    1 
ATOM   2773  S SG    . CYS B  2 147 ? 3.662   -11.892 -47.568 1.00 59.28  ? 147 CYS B SG    1 
ATOM   2774  N N     . LEU B  2 148 ? 0.486   -14.016 -50.361 1.00 43.48  ? 148 LEU B N     1 
ATOM   2775  C CA    . LEU B  2 148 ? -0.459  -14.033 -51.487 1.00 42.23  ? 148 LEU B CA    1 
ATOM   2776  C C     . LEU B  2 148 ? -0.893  -12.552 -51.690 1.00 45.30  ? 148 LEU B C     1 
ATOM   2777  O O     . LEU B  2 148 ? -1.429  -11.950 -50.774 1.00 45.40  ? 148 LEU B O     1 
ATOM   2778  C CB    . LEU B  2 148 ? -1.673  -14.906 -51.137 1.00 41.58  ? 148 LEU B CB    1 
ATOM   2779  C CG    . LEU B  2 148 ? -2.821  -14.991 -52.143 1.00 44.32  ? 148 LEU B CG    1 
ATOM   2780  C CD1   . LEU B  2 148 ? -2.334  -15.506 -53.517 1.00 44.48  ? 148 LEU B CD1   1 
ATOM   2781  C CD2   . LEU B  2 148 ? -3.929  -15.869 -51.587 1.00 43.69  ? 148 LEU B CD2   1 
ATOM   2782  N N     . VAL B  2 149 ? -0.612  -11.985 -52.863 1.00 41.64  ? 149 VAL B N     1 
ATOM   2783  C CA    . VAL B  2 149 ? -0.931  -10.602 -53.263 1.00 40.75  ? 149 VAL B CA    1 
ATOM   2784  C C     . VAL B  2 149 ? -2.110  -10.749 -54.215 1.00 42.19  ? 149 VAL B C     1 
ATOM   2785  O O     . VAL B  2 149 ? -1.928  -11.076 -55.379 1.00 39.04  ? 149 VAL B O     1 
ATOM   2786  C CB    . VAL B  2 149 ? 0.305   -9.942  -53.894 1.00 43.05  ? 149 VAL B CB    1 
ATOM   2787  C CG1   . VAL B  2 149 ? 0.030   -8.472  -54.225 1.00 43.68  ? 149 VAL B CG1   1 
ATOM   2788  C CG2   . VAL B  2 149 ? 1.499   -10.068 -52.955 1.00 42.20  ? 149 VAL B CG2   1 
ATOM   2789  N N     . LYS B  2 150 ? -3.325  -10.613 -53.687 1.00 40.32  ? 150 LYS B N     1 
ATOM   2790  C CA    . LYS B  2 150 ? -4.529  -10.961 -54.424 1.00 39.28  ? 150 LYS B CA    1 
ATOM   2791  C C     . LYS B  2 150 ? -5.380  -9.822  -54.886 1.00 41.41  ? 150 LYS B C     1 
ATOM   2792  O O     . LYS B  2 150 ? -5.645  -8.901  -54.134 1.00 43.02  ? 150 LYS B O     1 
ATOM   2793  C CB    . LYS B  2 150 ? -5.378  -11.929 -53.558 1.00 41.36  ? 150 LYS B CB    1 
ATOM   2794  C CG    . LYS B  2 150 ? -6.726  -12.355 -54.120 1.00 43.37  ? 150 LYS B CG    1 
ATOM   2795  C CD    . LYS B  2 150 ? -7.265  -13.560 -53.410 1.00 42.01  ? 150 LYS B CD    1 
ATOM   2796  C CE    . LYS B  2 150 ? -8.716  -13.860 -53.723 1.00 45.85  ? 150 LYS B CE    1 
ATOM   2797  N NZ    . LYS B  2 150 ? -8.912  -14.308 -55.132 1.00 49.50  ? 150 LYS B NZ    1 
ATOM   2798  N N     . ASP B  2 151 ? -5.888  -9.940  -56.126 1.00 37.87  ? 151 ASP B N     1 
ATOM   2799  C CA    . ASP B  2 151 ? -6.915  -9.072  -56.672 1.00 38.81  ? 151 ASP B CA    1 
ATOM   2800  C C     . ASP B  2 151 ? -6.460  -7.629  -56.896 1.00 44.22  ? 151 ASP B C     1 
ATOM   2801  O O     . ASP B  2 151 ? -6.844  -6.733  -56.152 1.00 45.50  ? 151 ASP B O     1 
ATOM   2802  C CB    . ASP B  2 151 ? -8.196  -9.104  -55.763 1.00 39.35  ? 151 ASP B CB    1 
ATOM   2803  C CG    . ASP B  2 151 ? -9.017  -10.372 -55.806 1.00 43.01  ? 151 ASP B CG    1 
ATOM   2804  O OD1   . ASP B  2 151 ? -8.719  -11.236 -56.624 1.00 44.13  ? 151 ASP B OD1   1 
ATOM   2805  O OD2   . ASP B  2 151 ? -9.975  -10.484 -55.020 1.00 56.00  ? 151 ASP B OD2   1 
ATOM   2806  N N     . TYR B  2 152 ? -5.575  -7.436  -57.860 1.00 40.54  ? 152 TYR B N     1 
ATOM   2807  C CA    . TYR B  2 152 ? -5.125  -6.107  -58.221 1.00 40.55  ? 152 TYR B CA    1 
ATOM   2808  C C     . TYR B  2 152 ? -5.152  -5.910  -59.726 1.00 44.47  ? 152 TYR B C     1 
ATOM   2809  O O     . TYR B  2 152 ? -5.166  -6.863  -60.528 1.00 42.24  ? 152 TYR B O     1 
ATOM   2810  C CB    . TYR B  2 152 ? -3.752  -5.782  -57.615 1.00 40.62  ? 152 TYR B CB    1 
ATOM   2811  C CG    . TYR B  2 152 ? -2.642  -6.635  -58.165 1.00 40.18  ? 152 TYR B CG    1 
ATOM   2812  C CD1   . TYR B  2 152 ? -1.937  -6.247  -59.302 1.00 40.67  ? 152 TYR B CD1   1 
ATOM   2813  C CD2   . TYR B  2 152 ? -2.325  -7.861  -57.590 1.00 40.54  ? 152 TYR B CD2   1 
ATOM   2814  C CE1   . TYR B  2 152 ? -0.993  -7.074  -59.884 1.00 38.41  ? 152 TYR B CE1   1 
ATOM   2815  C CE2   . TYR B  2 152 ? -1.336  -8.686  -58.144 1.00 39.73  ? 152 TYR B CE2   1 
ATOM   2816  C CZ    . TYR B  2 152 ? -0.683  -8.294  -59.295 1.00 39.55  ? 152 TYR B CZ    1 
ATOM   2817  O OH    . TYR B  2 152 ? 0.301   -9.088  -59.828 1.00 42.59  ? 152 TYR B OH    1 
ATOM   2818  N N     . PHE B  2 153 ? -5.220  -4.639  -60.098 1.00 40.68  ? 153 PHE B N     1 
ATOM   2819  C CA    . PHE B  2 153 ? -5.247  -4.241  -61.477 1.00 38.07  ? 153 PHE B CA    1 
ATOM   2820  C C     . PHE B  2 153 ? -4.766  -2.809  -61.584 1.00 41.92  ? 153 PHE B C     1 
ATOM   2821  O O     . PHE B  2 153 ? -5.185  -1.971  -60.809 1.00 39.72  ? 153 PHE B O     1 
ATOM   2822  C CB    . PHE B  2 153 ? -6.651  -4.385  -62.074 1.00 39.56  ? 153 PHE B CB    1 
ATOM   2823  C CG    . PHE B  2 153 ? -6.612  -4.126  -63.557 1.00 40.21  ? 153 PHE B CG    1 
ATOM   2824  C CD1   . PHE B  2 153 ? -6.246  -5.131  -64.444 1.00 40.40  ? 153 PHE B CD1   1 
ATOM   2825  C CD2   . PHE B  2 153 ? -6.769  -2.841  -64.054 1.00 41.31  ? 153 PHE B CD2   1 
ATOM   2826  C CE1   . PHE B  2 153 ? -6.124  -4.869  -65.794 1.00 40.02  ? 153 PHE B CE1   1 
ATOM   2827  C CE2   . PHE B  2 153 ? -6.669  -2.589  -65.407 1.00 42.35  ? 153 PHE B CE2   1 
ATOM   2828  C CZ    . PHE B  2 153 ? -6.352  -3.597  -66.269 1.00 39.27  ? 153 PHE B CZ    1 
ATOM   2829  N N     . PRO B  2 154 ? -3.887  -2.487  -62.543 1.00 41.54  ? 154 PRO B N     1 
ATOM   2830  C CA    . PRO B  2 154 ? -3.204  -3.351  -63.512 1.00 40.59  ? 154 PRO B CA    1 
ATOM   2831  C C     . PRO B  2 154 ? -1.912  -3.890  -62.930 1.00 42.06  ? 154 PRO B C     1 
ATOM   2832  O O     . PRO B  2 154 ? -1.561  -3.655  -61.784 1.00 39.88  ? 154 PRO B O     1 
ATOM   2833  C CB    . PRO B  2 154 ? -2.912  -2.360  -64.638 1.00 42.13  ? 154 PRO B CB    1 
ATOM   2834  C CG    . PRO B  2 154 ? -2.572  -1.131  -63.917 1.00 46.87  ? 154 PRO B CG    1 
ATOM   2835  C CD    . PRO B  2 154 ? -3.391  -1.111  -62.664 1.00 43.53  ? 154 PRO B CD    1 
ATOM   2836  N N     . GLU B  2 155 ? -1.150  -4.532  -63.762 1.00 40.85  ? 155 GLU B N     1 
ATOM   2837  C CA    . GLU B  2 155 ? 0.204   -4.910  -63.388 1.00 40.23  ? 155 GLU B CA    1 
ATOM   2838  C C     . GLU B  2 155 ? 1.127   -3.679  -63.427 1.00 43.90  ? 155 GLU B C     1 
ATOM   2839  O O     . GLU B  2 155 ? 0.813   -2.699  -64.097 1.00 43.72  ? 155 GLU B O     1 
ATOM   2840  C CB    . GLU B  2 155 ? 0.730   -5.894  -64.393 1.00 39.73  ? 155 GLU B CB    1 
ATOM   2841  C CG    . GLU B  2 155 ? -0.024  -7.204  -64.384 1.00 45.35  ? 155 GLU B CG    1 
ATOM   2842  C CD    . GLU B  2 155 ? 0.846   -8.304  -63.844 1.00 69.48  ? 155 GLU B CD    1 
ATOM   2843  O OE1   . GLU B  2 155 ? 1.270   -9.119  -64.686 1.00 42.76  ? 155 GLU B OE1   1 
ATOM   2844  O OE2   . GLU B  2 155 ? 1.243   -8.255  -62.653 1.00 60.18  ? 155 GLU B OE2   1 
ATOM   2845  N N     . PRO B  2 156 ? 2.297   -3.736  -62.794 1.00 40.94  ? 156 PRO B N     1 
ATOM   2846  C CA    . PRO B  2 156 ? 2.836   -4.827  -61.981 1.00 42.33  ? 156 PRO B CA    1 
ATOM   2847  C C     . PRO B  2 156 ? 2.774   -4.542  -60.495 1.00 45.82  ? 156 PRO B C     1 
ATOM   2848  O O     . PRO B  2 156 ? 2.456   -3.423  -60.092 1.00 46.13  ? 156 PRO B O     1 
ATOM   2849  C CB    . PRO B  2 156 ? 4.303   -4.850  -62.446 1.00 43.05  ? 156 PRO B CB    1 
ATOM   2850  C CG    . PRO B  2 156 ? 4.631   -3.372  -62.618 1.00 46.50  ? 156 PRO B CG    1 
ATOM   2851  C CD    . PRO B  2 156 ? 3.295   -2.657  -62.892 1.00 42.22  ? 156 PRO B CD    1 
ATOM   2852  N N     . VAL B  2 157 ? 3.176   -5.534  -59.690 1.00 42.83  ? 157 VAL B N     1 
ATOM   2853  C CA    . VAL B  2 157 ? 3.391   -5.367  -58.253 1.00 43.59  ? 157 VAL B CA    1 
ATOM   2854  C C     . VAL B  2 157 ? 4.825   -5.774  -58.011 1.00 48.80  ? 157 VAL B C     1 
ATOM   2855  O O     . VAL B  2 157 ? 5.306   -6.683  -58.676 1.00 46.75  ? 157 VAL B O     1 
ATOM   2856  C CB    . VAL B  2 157 ? 2.454   -6.116  -57.281 1.00 47.01  ? 157 VAL B CB    1 
ATOM   2857  C CG1   . VAL B  2 157 ? 1.016   -5.701  -57.466 1.00 47.12  ? 157 VAL B CG1   1 
ATOM   2858  C CG2   . VAL B  2 157 ? 2.634   -7.610  -57.340 1.00 47.28  ? 157 VAL B CG2   1 
ATOM   2859  N N     . THR B  2 158 ? 5.507   -5.120  -57.063 1.00 47.07  ? 158 THR B N     1 
ATOM   2860  C CA    . THR B  2 158 ? 6.858   -5.531  -56.706 1.00 47.28  ? 158 THR B CA    1 
ATOM   2861  C C     . THR B  2 158 ? 6.806   -6.144  -55.330 1.00 47.67  ? 158 THR B C     1 
ATOM   2862  O O     . THR B  2 158 ? 5.996   -5.735  -54.499 1.00 45.31  ? 158 THR B O     1 
ATOM   2863  C CB    . THR B  2 158 ? 7.847   -4.368  -56.748 1.00 60.37  ? 158 THR B CB    1 
ATOM   2864  O OG1   . THR B  2 158 ? 7.566   -3.477  -55.683 1.00 59.80  ? 158 THR B OG1   1 
ATOM   2865  C CG2   . THR B  2 158 ? 7.840   -3.642  -58.079 1.00 61.25  ? 158 THR B CG2   1 
ATOM   2866  N N     . VAL B  2 159 ? 7.654   -7.139  -55.091 1.00 45.33  ? 159 VAL B N     1 
ATOM   2867  C CA    . VAL B  2 159 ? 7.744   -7.779  -53.774 1.00 45.85  ? 159 VAL B CA    1 
ATOM   2868  C C     . VAL B  2 159 ? 9.190   -7.934  -53.373 1.00 47.74  ? 159 VAL B C     1 
ATOM   2869  O O     . VAL B  2 159 ? 10.031  -8.349  -54.179 1.00 47.98  ? 159 VAL B O     1 
ATOM   2870  C CB    . VAL B  2 159 ? 7.037   -9.171  -53.678 1.00 48.51  ? 159 VAL B CB    1 
ATOM   2871  C CG1   . VAL B  2 159 ? 6.964   -9.653  -52.220 1.00 47.77  ? 159 VAL B CG1   1 
ATOM   2872  C CG2   . VAL B  2 159 ? 5.640   -9.126  -54.293 1.00 48.53  ? 159 VAL B CG2   1 
ATOM   2873  N N     . SER B  2 160 ? 9.449   -7.666  -52.111 1.00 43.13  ? 160 SER B N     1 
ATOM   2874  C CA    . SER B  2 160 ? 10.726  -7.890  -51.480 1.00 44.05  ? 160 SER B CA    1 
ATOM   2875  C C     . SER B  2 160 ? 10.457  -8.486  -50.081 1.00 48.39  ? 160 SER B C     1 
ATOM   2876  O O     . SER B  2 160 ? 9.337   -8.470  -49.585 1.00 46.64  ? 160 SER B O     1 
ATOM   2877  C CB    . SER B  2 160 ? 11.547  -6.597  -51.422 1.00 46.89  ? 160 SER B CB    1 
ATOM   2878  O OG    . SER B  2 160 ? 11.023  -5.697  -50.469 1.00 55.98  ? 160 SER B OG    1 
ATOM   2879  N N     . TRP B  2 161 ? 11.487  -9.045  -49.484 1.00 47.00  ? 161 TRP B N     1 
ATOM   2880  C CA    . TRP B  2 161 ? 11.432  -9.670  -48.182 1.00 46.92  ? 161 TRP B CA    1 
ATOM   2881  C C     . TRP B  2 161 ? 12.420  -8.961  -47.247 1.00 52.29  ? 161 TRP B C     1 
ATOM   2882  O O     . TRP B  2 161 ? 13.559  -8.693  -47.643 1.00 51.00  ? 161 TRP B O     1 
ATOM   2883  C CB    . TRP B  2 161 ? 11.777  -11.153 -48.309 1.00 44.43  ? 161 TRP B CB    1 
ATOM   2884  C CG    . TRP B  2 161 ? 10.667  -11.924 -48.918 1.00 44.13  ? 161 TRP B CG    1 
ATOM   2885  C CD1   . TRP B  2 161 ? 10.415  -12.122 -50.241 1.00 45.30  ? 161 TRP B CD1   1 
ATOM   2886  C CD2   . TRP B  2 161 ? 9.567   -12.467 -48.213 1.00 44.41  ? 161 TRP B CD2   1 
ATOM   2887  N NE1   . TRP B  2 161 ? 9.260   -12.833 -50.400 1.00 43.63  ? 161 TRP B NE1   1 
ATOM   2888  C CE2   . TRP B  2 161 ? 8.704   -13.050 -49.168 1.00 47.18  ? 161 TRP B CE2   1 
ATOM   2889  C CE3   . TRP B  2 161 ? 9.266   -12.596 -46.856 1.00 46.51  ? 161 TRP B CE3   1 
ATOM   2890  C CZ2   . TRP B  2 161 ? 7.522   -13.703 -48.804 1.00 46.68  ? 161 TRP B CZ2   1 
ATOM   2891  C CZ3   . TRP B  2 161 ? 8.102   -13.259 -46.491 1.00 48.92  ? 161 TRP B CZ3   1 
ATOM   2892  C CH2   . TRP B  2 161 ? 7.247   -13.804 -47.459 1.00 48.67  ? 161 TRP B CH2   1 
ATOM   2893  N N     . ASN B  2 162 ? 11.971  -8.644  -46.027 1.00 51.21  ? 162 ASN B N     1 
ATOM   2894  C CA    . ASN B  2 162 ? 12.796  -7.963  -45.008 1.00 52.71  ? 162 ASN B CA    1 
ATOM   2895  C C     . ASN B  2 162 ? 13.548  -6.739  -45.581 1.00 57.79  ? 162 ASN B C     1 
ATOM   2896  O O     . ASN B  2 162 ? 14.747  -6.570  -45.383 1.00 58.12  ? 162 ASN B O     1 
ATOM   2897  C CB    . ASN B  2 162 ? 13.723  -9.004  -44.350 1.00 49.10  ? 162 ASN B CB    1 
ATOM   2898  C CG    . ASN B  2 162 ? 12.928  -10.006 -43.565 1.00 60.21  ? 162 ASN B CG    1 
ATOM   2899  O OD1   . ASN B  2 162 ? 11.715  -9.869  -43.411 1.00 60.27  ? 162 ASN B OD1   1 
ATOM   2900  N ND2   . ASN B  2 162 ? 13.573  -11.035 -43.050 1.00 52.00  ? 162 ASN B ND2   1 
ATOM   2901  N N     . SER B  2 163 ? 12.814  -5.948  -46.375 1.00 54.48  ? 163 SER B N     1 
ATOM   2902  C CA    . SER B  2 163 ? 13.266  -4.723  -47.027 1.00 54.10  ? 163 SER B CA    1 
ATOM   2903  C C     . SER B  2 163 ? 14.458  -4.889  -47.957 1.00 59.79  ? 163 SER B C     1 
ATOM   2904  O O     . SER B  2 163 ? 15.290  -3.985  -48.061 1.00 62.19  ? 163 SER B O     1 
ATOM   2905  C CB    . SER B  2 163 ? 13.555  -3.657  -45.976 1.00 56.93  ? 163 SER B CB    1 
ATOM   2906  O OG    . SER B  2 163 ? 12.512  -3.616  -45.015 1.00 65.37  ? 163 SER B OG    1 
ATOM   2907  N N     . GLY B  2 164 ? 14.527  -6.026  -48.640 1.00 55.00  ? 164 GLY B N     1 
ATOM   2908  C CA    . GLY B  2 164 ? 15.600  -6.320  -49.577 1.00 53.29  ? 164 GLY B CA    1 
ATOM   2909  C C     . GLY B  2 164 ? 16.773  -7.051  -48.965 1.00 57.06  ? 164 GLY B C     1 
ATOM   2910  O O     . GLY B  2 164 ? 17.663  -7.498  -49.700 1.00 58.09  ? 164 GLY B O     1 
ATOM   2911  N N     . ALA B  2 165 ? 16.781  -7.202  -47.626 1.00 52.89  ? 165 ALA B N     1 
ATOM   2912  C CA    . ALA B  2 165 ? 17.840  -7.902  -46.911 1.00 54.10  ? 165 ALA B CA    1 
ATOM   2913  C C     . ALA B  2 165 ? 17.770  -9.409  -47.182 1.00 61.89  ? 165 ALA B C     1 
ATOM   2914  O O     . ALA B  2 165 ? 18.810  -10.076 -47.144 1.00 63.92  ? 165 ALA B O     1 
ATOM   2915  C CB    . ALA B  2 165 ? 17.720  -7.643  -45.411 1.00 55.32  ? 165 ALA B CB    1 
ATOM   2916  N N     . LEU B  2 166 ? 16.554  -9.958  -47.382 1.00 57.03  ? 166 LEU B N     1 
ATOM   2917  C CA    . LEU B  2 166 ? 16.384  -11.387 -47.667 1.00 55.56  ? 166 LEU B CA    1 
ATOM   2918  C C     . LEU B  2 166 ? 16.135  -11.574 -49.169 1.00 57.42  ? 166 LEU B C     1 
ATOM   2919  O O     . LEU B  2 166 ? 15.157  -11.062 -49.710 1.00 56.21  ? 166 LEU B O     1 
ATOM   2920  C CB    . LEU B  2 166 ? 15.242  -11.972 -46.823 1.00 55.10  ? 166 LEU B CB    1 
ATOM   2921  C CG    . LEU B  2 166 ? 15.013  -13.473 -46.917 1.00 57.79  ? 166 LEU B CG    1 
ATOM   2922  C CD1   . LEU B  2 166 ? 16.258  -14.254 -46.524 1.00 56.07  ? 166 LEU B CD1   1 
ATOM   2923  C CD2   . LEU B  2 166 ? 13.871  -13.860 -46.064 1.00 62.88  ? 166 LEU B CD2   1 
ATOM   2924  N N     . THR B  2 167 ? 17.097  -12.191 -49.847 1.00 53.76  ? 167 THR B N     1 
ATOM   2925  C CA    . THR B  2 167 ? 17.031  -12.469 -51.286 1.00 52.93  ? 167 THR B CA    1 
ATOM   2926  C C     . THR B  2 167 ? 17.209  -13.954 -51.617 1.00 56.29  ? 167 THR B C     1 
ATOM   2927  O O     . THR B  2 167 ? 16.608  -14.420 -52.589 1.00 56.74  ? 167 THR B O     1 
ATOM   2928  C CB    . THR B  2 167 ? 18.074  -11.649 -52.013 1.00 59.69  ? 167 THR B CB    1 
ATOM   2929  O OG1   . THR B  2 167 ? 19.331  -11.874 -51.375 1.00 63.63  ? 167 THR B OG1   1 
ATOM   2930  C CG2   . THR B  2 167 ? 17.723  -10.175 -52.038 1.00 55.91  ? 167 THR B CG2   1 
ATOM   2931  N N     . SER B  2 168 ? 18.057  -14.674 -50.863 1.00 52.08  ? 168 SER B N     1 
ATOM   2932  C CA    . SER B  2 168 ? 18.324  -16.089 -51.096 1.00 52.80  ? 168 SER B CA    1 
ATOM   2933  C C     . SER B  2 168 ? 17.103  -16.939 -50.762 1.00 56.75  ? 168 SER B C     1 
ATOM   2934  O O     . SER B  2 168 ? 16.483  -16.754 -49.717 1.00 57.51  ? 168 SER B O     1 
ATOM   2935  C CB    . SER B  2 168 ? 19.506  -16.568 -50.261 1.00 57.87  ? 168 SER B CB    1 
ATOM   2936  O OG    . SER B  2 168 ? 20.652  -15.790 -50.565 1.00 77.74  ? 168 SER B OG    1 
ATOM   2937  N N     . GLY B  2 169 ? 16.786  -17.860 -51.661 1.00 51.06  ? 169 GLY B N     1 
ATOM   2938  C CA    . GLY B  2 169 ? 15.653  -18.757 -51.529 1.00 48.12  ? 169 GLY B CA    1 
ATOM   2939  C C     . GLY B  2 169 ? 14.322  -18.119 -51.863 1.00 46.65  ? 169 GLY B C     1 
ATOM   2940  O O     . GLY B  2 169 ? 13.299  -18.733 -51.609 1.00 43.97  ? 169 GLY B O     1 
ATOM   2941  N N     . VAL B  2 170 ? 14.306  -16.878 -52.391 1.00 44.20  ? 170 VAL B N     1 
ATOM   2942  C CA    . VAL B  2 170 ? 13.072  -16.164 -52.724 1.00 42.16  ? 170 VAL B CA    1 
ATOM   2943  C C     . VAL B  2 170 ? 12.620  -16.516 -54.161 1.00 44.38  ? 170 VAL B C     1 
ATOM   2944  O O     . VAL B  2 170 ? 13.423  -16.413 -55.093 1.00 45.18  ? 170 VAL B O     1 
ATOM   2945  C CB    . VAL B  2 170 ? 13.247  -14.617 -52.577 1.00 45.43  ? 170 VAL B CB    1 
ATOM   2946  C CG1   . VAL B  2 170 ? 11.982  -13.868 -53.013 1.00 44.78  ? 170 VAL B CG1   1 
ATOM   2947  C CG2   . VAL B  2 170 ? 13.624  -14.232 -51.154 1.00 45.55  ? 170 VAL B CG2   1 
ATOM   2948  N N     . HIS B  2 171 ? 11.330  -16.827 -54.344 1.00 38.78  ? 171 HIS B N     1 
ATOM   2949  C CA    . HIS B  2 171 ? 10.713  -16.996 -55.665 1.00 38.00  ? 171 HIS B CA    1 
ATOM   2950  C C     . HIS B  2 171 ? 9.482   -16.121 -55.670 1.00 41.69  ? 171 HIS B C     1 
ATOM   2951  O O     . HIS B  2 171 ? 8.558   -16.365 -54.894 1.00 40.23  ? 171 HIS B O     1 
ATOM   2952  C CB    . HIS B  2 171 ? 10.275  -18.431 -56.003 1.00 37.72  ? 171 HIS B CB    1 
ATOM   2953  C CG    . HIS B  2 171 ? 11.399  -19.379 -56.137 1.00 40.63  ? 171 HIS B CG    1 
ATOM   2954  N ND1   . HIS B  2 171 ? 12.337  -19.239 -57.138 1.00 42.89  ? 171 HIS B ND1   1 
ATOM   2955  C CD2   . HIS B  2 171 ? 11.777  -20.381 -55.322 1.00 40.41  ? 171 HIS B CD2   1 
ATOM   2956  C CE1   . HIS B  2 171 ? 13.209  -20.214 -56.949 1.00 41.33  ? 171 HIS B CE1   1 
ATOM   2957  N NE2   . HIS B  2 171 ? 12.890  -20.940 -55.883 1.00 40.97  ? 171 HIS B NE2   1 
ATOM   2958  N N     . THR B  2 172 ? 9.486   -15.088 -56.514 1.00 38.03  ? 172 THR B N     1 
ATOM   2959  C CA    . THR B  2 172 ? 8.332   -14.246 -56.724 1.00 37.24  ? 172 THR B CA    1 
ATOM   2960  C C     . THR B  2 172 ? 7.791   -14.759 -57.998 1.00 38.41  ? 172 THR B C     1 
ATOM   2961  O O     . THR B  2 172 ? 8.487   -14.704 -59.003 1.00 37.45  ? 172 THR B O     1 
ATOM   2962  C CB    . THR B  2 172 ? 8.676   -12.756 -56.738 1.00 42.83  ? 172 THR B CB    1 
ATOM   2963  O OG1   . THR B  2 172 ? 9.040   -12.393 -55.398 1.00 50.76  ? 172 THR B OG1   1 
ATOM   2964  C CG2   . THR B  2 172 ? 7.476   -11.894 -57.152 1.00 41.37  ? 172 THR B CG2   1 
ATOM   2965  N N     . PHE B  2 173 ? 6.559   -15.262 -57.980 1.00 37.03  ? 173 PHE B N     1 
ATOM   2966  C CA    . PHE B  2 173 ? 5.964   -15.879 -59.166 1.00 36.14  ? 173 PHE B CA    1 
ATOM   2967  C C     . PHE B  2 173 ? 5.364   -14.913 -60.144 1.00 38.61  ? 173 PHE B C     1 
ATOM   2968  O O     . PHE B  2 173 ? 4.708   -13.992 -59.722 1.00 38.87  ? 173 PHE B O     1 
ATOM   2969  C CB    . PHE B  2 173 ? 4.863   -16.876 -58.745 1.00 36.95  ? 173 PHE B CB    1 
ATOM   2970  C CG    . PHE B  2 173 ? 5.413   -18.142 -58.147 1.00 37.64  ? 173 PHE B CG    1 
ATOM   2971  C CD1   . PHE B  2 173 ? 5.775   -18.197 -56.808 1.00 40.01  ? 173 PHE B CD1   1 
ATOM   2972  C CD2   . PHE B  2 173 ? 5.711   -19.235 -58.953 1.00 36.66  ? 173 PHE B CD2   1 
ATOM   2973  C CE1   . PHE B  2 173 ? 6.357   -19.344 -56.277 1.00 40.47  ? 173 PHE B CE1   1 
ATOM   2974  C CE2   . PHE B  2 173 ? 6.249   -20.387 -58.409 1.00 38.62  ? 173 PHE B CE2   1 
ATOM   2975  C CZ    . PHE B  2 173 ? 6.635   -20.420 -57.094 1.00 37.43  ? 173 PHE B CZ    1 
ATOM   2976  N N     . PRO B  2 174 ? 5.421   -15.178 -61.459 1.00 34.88  ? 174 PRO B N     1 
ATOM   2977  C CA    . PRO B  2 174 ? 4.613   -14.375 -62.398 1.00 33.86  ? 174 PRO B CA    1 
ATOM   2978  C C     . PRO B  2 174 ? 3.143   -14.337 -61.956 1.00 37.25  ? 174 PRO B C     1 
ATOM   2979  O O     . PRO B  2 174 ? 2.628   -15.326 -61.448 1.00 34.01  ? 174 PRO B O     1 
ATOM   2980  C CB    . PRO B  2 174 ? 4.713   -15.162 -63.712 1.00 34.60  ? 174 PRO B CB    1 
ATOM   2981  C CG    . PRO B  2 174 ? 5.955   -15.921 -63.609 1.00 39.32  ? 174 PRO B CG    1 
ATOM   2982  C CD    . PRO B  2 174 ? 6.142   -16.257 -62.152 1.00 35.68  ? 174 PRO B CD    1 
ATOM   2983  N N     . ALA B  2 175 ? 2.447   -13.238 -62.202 1.00 35.78  ? 175 ALA B N     1 
ATOM   2984  C CA    . ALA B  2 175 ? 1.055   -13.144 -61.790 1.00 35.13  ? 175 ALA B CA    1 
ATOM   2985  C C     . ALA B  2 175 ? 0.133   -14.064 -62.595 1.00 36.83  ? 175 ALA B C     1 
ATOM   2986  O O     . ALA B  2 175 ? 0.465   -14.463 -63.693 1.00 35.68  ? 175 ALA B O     1 
ATOM   2987  C CB    . ALA B  2 175 ? 0.588   -11.688 -61.889 1.00 35.75  ? 175 ALA B CB    1 
ATOM   2988  N N     . VAL B  2 176 ? -1.021  -14.395 -62.025 1.00 34.20  ? 176 VAL B N     1 
ATOM   2989  C CA    . VAL B  2 176 ? -2.091  -15.140 -62.696 1.00 31.97  ? 176 VAL B CA    1 
ATOM   2990  C C     . VAL B  2 176 ? -3.227  -14.160 -62.914 1.00 36.23  ? 176 VAL B C     1 
ATOM   2991  O O     . VAL B  2 176 ? -3.416  -13.221 -62.129 1.00 34.03  ? 176 VAL B O     1 
ATOM   2992  C CB    . VAL B  2 176 ? -2.617  -16.408 -61.988 1.00 33.17  ? 176 VAL B CB    1 
ATOM   2993  C CG1   . VAL B  2 176 ? -1.578  -17.536 -62.005 1.00 31.94  ? 176 VAL B CG1   1 
ATOM   2994  C CG2   . VAL B  2 176 ? -3.097  -16.112 -60.558 1.00 33.25  ? 176 VAL B CG2   1 
ATOM   2995  N N     . LEU B  2 177 ? -3.963  -14.359 -63.984 1.00 34.25  ? 177 LEU B N     1 
ATOM   2996  C CA    . LEU B  2 177 ? -5.088  -13.491 -64.301 1.00 35.22  ? 177 LEU B CA    1 
ATOM   2997  C C     . LEU B  2 177 ? -6.347  -14.253 -63.995 1.00 37.87  ? 177 LEU B C     1 
ATOM   2998  O O     . LEU B  2 177 ? -6.585  -15.290 -64.577 1.00 36.39  ? 177 LEU B O     1 
ATOM   2999  C CB    . LEU B  2 177 ? -5.001  -13.066 -65.760 1.00 35.03  ? 177 LEU B CB    1 
ATOM   3000  C CG    . LEU B  2 177 ? -6.062  -12.100 -66.339 1.00 39.71  ? 177 LEU B CG    1 
ATOM   3001  C CD1   . LEU B  2 177 ? -6.337  -10.862 -65.447 1.00 35.44  ? 177 LEU B CD1   1 
ATOM   3002  C CD2   . LEU B  2 177 ? -5.618  -11.643 -67.706 1.00 41.92  ? 177 LEU B CD2   1 
ATOM   3003  N N     . GLN B  2 178 ? -7.126  -13.767 -63.039 1.00 37.03  ? 178 GLN B N     1 
ATOM   3004  C CA    . GLN B  2 178 ? -8.381  -14.391 -62.641 1.00 38.03  ? 178 GLN B CA    1 
ATOM   3005  C C     . GLN B  2 178 ? -9.499  -14.073 -63.649 1.00 40.65  ? 178 GLN B C     1 
ATOM   3006  O O     . GLN B  2 178 ? -9.369  -13.157 -64.459 1.00 37.90  ? 178 GLN B O     1 
ATOM   3007  C CB    . GLN B  2 178 ? -8.747  -13.962 -61.209 1.00 40.29  ? 178 GLN B CB    1 
ATOM   3008  C CG    . GLN B  2 178 ? -7.625  -14.302 -60.208 1.00 43.77  ? 178 GLN B CG    1 
ATOM   3009  C CD    . GLN B  2 178 ? -7.836  -13.627 -58.882 1.00 54.63  ? 178 GLN B CD    1 
ATOM   3010  O OE1   . GLN B  2 178 ? -8.411  -14.199 -57.952 1.00 52.97  ? 178 GLN B OE1   1 
ATOM   3011  N NE2   . GLN B  2 178 ? -7.396  -12.379 -58.776 1.00 39.37  ? 178 GLN B NE2   1 
ATOM   3012  N N     . SER B  2 179 ? -10.577 -14.848 -63.613 1.00 39.52  ? 179 SER B N     1 
ATOM   3013  C CA    . SER B  2 179 ? -11.731 -14.664 -64.515 1.00 41.19  ? 179 SER B CA    1 
ATOM   3014  C C     . SER B  2 179 ? -12.464 -13.342 -64.324 1.00 45.52  ? 179 SER B C     1 
ATOM   3015  O O     . SER B  2 179 ? -13.166 -12.869 -65.221 1.00 44.20  ? 179 SER B O     1 
ATOM   3016  C CB    . SER B  2 179 ? -12.692 -15.842 -64.391 1.00 45.75  ? 179 SER B CB    1 
ATOM   3017  O OG    . SER B  2 179 ? -13.059 -16.012 -63.033 1.00 60.32  ? 179 SER B OG    1 
ATOM   3018  N N     . SER B  2 180 ? -12.255 -12.715 -63.166 1.00 44.63  ? 180 SER B N     1 
ATOM   3019  C CA    . SER B  2 180 ? -12.745 -11.377 -62.866 1.00 42.75  ? 180 SER B CA    1 
ATOM   3020  C C     . SER B  2 180 ? -11.981 -10.275 -63.625 1.00 50.95  ? 180 SER B C     1 
ATOM   3021  O O     . SER B  2 180 ? -12.403 -9.110  -63.587 1.00 54.20  ? 180 SER B O     1 
ATOM   3022  C CB    . SER B  2 180 ? -12.553 -11.107 -61.386 1.00 41.97  ? 180 SER B CB    1 
ATOM   3023  O OG    . SER B  2 180 ? -11.169 -11.142 -61.073 1.00 46.66  ? 180 SER B OG    1 
ATOM   3024  N N     . GLY B  2 181 ? -10.826 -10.607 -64.224 1.00 45.26  ? 181 GLY B N     1 
ATOM   3025  C CA    . GLY B  2 181 ? -9.979  -9.631  -64.889 1.00 42.91  ? 181 GLY B CA    1 
ATOM   3026  C C     . GLY B  2 181 ? -8.949  -9.017  -63.965 1.00 43.78  ? 181 GLY B C     1 
ATOM   3027  O O     . GLY B  2 181 ? -8.166  -8.175  -64.406 1.00 44.00  ? 181 GLY B O     1 
ATOM   3028  N N     . LEU B  2 182 ? -8.907  -9.453  -62.687 1.00 38.36  ? 182 LEU B N     1 
ATOM   3029  C CA    . LEU B  2 182 ? -7.926  -9.005  -61.694 1.00 36.59  ? 182 LEU B CA    1 
ATOM   3030  C C     . LEU B  2 182 ? -6.807  -10.007 -61.596 1.00 39.83  ? 182 LEU B C     1 
ATOM   3031  O O     . LEU B  2 182 ? -7.013  -11.211 -61.746 1.00 40.75  ? 182 LEU B O     1 
ATOM   3032  C CB    . LEU B  2 182 ? -8.550  -8.836  -60.298 1.00 36.42  ? 182 LEU B CB    1 
ATOM   3033  C CG    . LEU B  2 182 ? -9.795  -7.941  -60.170 1.00 40.93  ? 182 LEU B CG    1 
ATOM   3034  C CD1   . LEU B  2 182 ? -10.354 -8.011  -58.791 1.00 41.17  ? 182 LEU B CD1   1 
ATOM   3035  C CD2   . LEU B  2 182 ? -9.479  -6.498  -60.499 1.00 36.29  ? 182 LEU B CD2   1 
ATOM   3036  N N     . TYR B  2 183 ? -5.633  -9.514  -61.258 1.00 36.92  ? 183 TYR B N     1 
ATOM   3037  C CA    . TYR B  2 183 ? -4.423  -10.314 -61.074 1.00 35.45  ? 183 TYR B CA    1 
ATOM   3038  C C     . TYR B  2 183 ? -4.202  -10.740 -59.620 1.00 37.40  ? 183 TYR B C     1 
ATOM   3039  O O     . TYR B  2 183 ? -4.719  -10.121 -58.682 1.00 35.98  ? 183 TYR B O     1 
ATOM   3040  C CB    . TYR B  2 183 ? -3.182  -9.507  -61.471 1.00 36.03  ? 183 TYR B CB    1 
ATOM   3041  C CG    . TYR B  2 183 ? -3.105  -9.258  -62.941 1.00 36.62  ? 183 TYR B CG    1 
ATOM   3042  C CD1   . TYR B  2 183 ? -2.627  -10.237 -63.805 1.00 39.92  ? 183 TYR B CD1   1 
ATOM   3043  C CD2   . TYR B  2 183 ? -3.563  -8.061  -63.490 1.00 35.37  ? 183 TYR B CD2   1 
ATOM   3044  C CE1   . TYR B  2 183 ? -2.598  -10.034 -65.179 1.00 39.45  ? 183 TYR B CE1   1 
ATOM   3045  C CE2   . TYR B  2 183 ? -3.553  -7.849  -64.866 1.00 34.95  ? 183 TYR B CE2   1 
ATOM   3046  C CZ    . TYR B  2 183 ? -3.042  -8.830  -65.705 1.00 41.33  ? 183 TYR B CZ    1 
ATOM   3047  O OH    . TYR B  2 183 ? -3.026  -8.671  -67.055 1.00 45.25  ? 183 TYR B OH    1 
ATOM   3048  N N     . SER B  2 184 ? -3.404  -11.802 -59.469 1.00 34.96  ? 184 SER B N     1 
ATOM   3049  C CA    . SER B  2 184 ? -2.907  -12.312 -58.194 1.00 34.64  ? 184 SER B CA    1 
ATOM   3050  C C     . SER B  2 184 ? -1.472  -12.748 -58.358 1.00 40.09  ? 184 SER B C     1 
ATOM   3051  O O     . SER B  2 184 ? -1.100  -13.291 -59.403 1.00 38.35  ? 184 SER B O     1 
ATOM   3052  C CB    . SER B  2 184 ? -3.700  -13.524 -57.720 1.00 36.09  ? 184 SER B CB    1 
ATOM   3053  O OG    . SER B  2 184 ? -4.858  -13.164 -57.006 1.00 47.27  ? 184 SER B OG    1 
ATOM   3054  N N     . LEU B  2 185 ? -0.658  -12.559 -57.325 1.00 40.18  ? 185 LEU B N     1 
ATOM   3055  C CA    . LEU B  2 185 ? 0.670   -13.135 -57.383 1.00 39.95  ? 185 LEU B CA    1 
ATOM   3056  C C     . LEU B  2 185 ? 1.099   -13.605 -56.015 1.00 40.97  ? 185 LEU B C     1 
ATOM   3057  O O     . LEU B  2 185 ? 0.613   -13.134 -54.991 1.00 41.27  ? 185 LEU B O     1 
ATOM   3058  C CB    . LEU B  2 185 ? 1.733   -12.315 -58.128 1.00 40.14  ? 185 LEU B CB    1 
ATOM   3059  C CG    . LEU B  2 185 ? 2.647   -11.261 -57.560 1.00 44.31  ? 185 LEU B CG    1 
ATOM   3060  C CD1   . LEU B  2 185 ? 3.489   -11.701 -56.330 1.00 41.88  ? 185 LEU B CD1   1 
ATOM   3061  C CD2   . LEU B  2 185 ? 3.647   -10.901 -58.617 1.00 48.21  ? 185 LEU B CD2   1 
ATOM   3062  N N     . SER B  2 186 ? 1.982   -14.588 -56.037 1.00 35.57  ? 186 SER B N     1 
ATOM   3063  C CA    . SER B  2 186 ? 2.522   -15.241 -54.872 1.00 36.18  ? 186 SER B CA    1 
ATOM   3064  C C     . SER B  2 186 ? 4.030   -15.047 -54.857 1.00 40.64  ? 186 SER B C     1 
ATOM   3065  O O     . SER B  2 186 ? 4.676   -15.092 -55.897 1.00 39.75  ? 186 SER B O     1 
ATOM   3066  C CB    . SER B  2 186 ? 2.164   -16.722 -54.904 1.00 42.12  ? 186 SER B CB    1 
ATOM   3067  O OG    . SER B  2 186 ? 0.770   -16.835 -54.674 1.00 56.41  ? 186 SER B OG    1 
ATOM   3068  N N     . SER B  2 187 ? 4.561   -14.746 -53.688 1.00 39.00  ? 187 SER B N     1 
ATOM   3069  C CA    . SER B  2 187 ? 5.976   -14.673 -53.426 1.00 39.02  ? 187 SER B CA    1 
ATOM   3070  C C     . SER B  2 187 ? 6.254   -15.613 -52.267 1.00 40.58  ? 187 SER B C     1 
ATOM   3071  O O     . SER B  2 187 ? 5.516   -15.627 -51.276 1.00 38.26  ? 187 SER B O     1 
ATOM   3072  C CB    . SER B  2 187 ? 6.421   -13.249 -53.098 1.00 43.69  ? 187 SER B CB    1 
ATOM   3073  O OG    . SER B  2 187 ? 7.837   -13.190 -53.001 1.00 50.05  ? 187 SER B OG    1 
ATOM   3074  N N     . VAL B  2 188 ? 7.296   -16.429 -52.402 1.00 39.01  ? 188 VAL B N     1 
ATOM   3075  C CA    . VAL B  2 188 ? 7.676   -17.379 -51.357 1.00 38.74  ? 188 VAL B CA    1 
ATOM   3076  C C     . VAL B  2 188 ? 9.153   -17.305 -51.022 1.00 43.41  ? 188 VAL B C     1 
ATOM   3077  O O     . VAL B  2 188 ? 9.978   -16.808 -51.789 1.00 40.45  ? 188 VAL B O     1 
ATOM   3078  C CB    . VAL B  2 188 ? 7.266   -18.852 -51.679 1.00 41.13  ? 188 VAL B CB    1 
ATOM   3079  C CG1   . VAL B  2 188 ? 5.771   -18.977 -51.931 1.00 39.12  ? 188 VAL B CG1   1 
ATOM   3080  C CG2   . VAL B  2 188 ? 8.071   -19.421 -52.851 1.00 41.47  ? 188 VAL B CG2   1 
ATOM   3081  N N     . VAL B  2 189 ? 9.486   -17.829 -49.855 1.00 44.55  ? 189 VAL B N     1 
ATOM   3082  C CA    . VAL B  2 189 ? 10.879  -17.930 -49.456 1.00 44.55  ? 189 VAL B CA    1 
ATOM   3083  C C     . VAL B  2 189 ? 11.080  -19.220 -48.659 1.00 43.74  ? 189 VAL B C     1 
ATOM   3084  O O     . VAL B  2 189 ? 10.215  -19.580 -47.885 1.00 39.92  ? 189 VAL B O     1 
ATOM   3085  C CB    . VAL B  2 189 ? 11.377  -16.624 -48.760 1.00 49.03  ? 189 VAL B CB    1 
ATOM   3086  C CG1   . VAL B  2 189 ? 10.607  -16.323 -47.484 1.00 49.71  ? 189 VAL B CG1   1 
ATOM   3087  C CG2   . VAL B  2 189 ? 12.874  -16.679 -48.497 1.00 49.67  ? 189 VAL B CG2   1 
ATOM   3088  N N     . THR B  2 190 ? 12.171  -19.955 -48.929 1.00 42.65  ? 190 THR B N     1 
ATOM   3089  C CA    . THR B  2 190 ? 12.510  -21.171 -48.170 1.00 43.64  ? 190 THR B CA    1 
ATOM   3090  C C     . THR B  2 190 ? 13.626  -20.787 -47.221 1.00 49.29  ? 190 THR B C     1 
ATOM   3091  O O     . THR B  2 190 ? 14.523  -20.039 -47.580 1.00 50.06  ? 190 THR B O     1 
ATOM   3092  C CB    . THR B  2 190 ? 12.845  -22.403 -49.044 1.00 46.03  ? 190 THR B CB    1 
ATOM   3093  O OG1   . THR B  2 190 ? 13.803  -22.033 -50.034 1.00 50.39  ? 190 THR B OG1   1 
ATOM   3094  C CG2   . THR B  2 190 ? 11.603  -23.008 -49.681 1.00 43.09  ? 190 THR B CG2   1 
ATOM   3095  N N     . VAL B  2 191 ? 13.510  -21.218 -45.992 1.00 47.30  ? 191 VAL B N     1 
ATOM   3096  C CA    . VAL B  2 191 ? 14.453  -20.877 -44.947 1.00 48.13  ? 191 VAL B CA    1 
ATOM   3097  C C     . VAL B  2 191 ? 14.703  -22.124 -44.114 1.00 53.49  ? 191 VAL B C     1 
ATOM   3098  O O     . VAL B  2 191 ? 13.871  -23.040 -44.107 1.00 51.30  ? 191 VAL B O     1 
ATOM   3099  C CB    . VAL B  2 191 ? 13.905  -19.703 -44.060 1.00 51.31  ? 191 VAL B CB    1 
ATOM   3100  C CG1   . VAL B  2 191 ? 13.684  -18.442 -44.884 1.00 50.33  ? 191 VAL B CG1   1 
ATOM   3101  C CG2   . VAL B  2 191 ? 12.627  -20.091 -43.319 1.00 50.67  ? 191 VAL B CG2   1 
ATOM   3102  N N     . PRO B  2 192 ? 15.794  -22.167 -43.333 1.00 53.71  ? 192 PRO B N     1 
ATOM   3103  C CA    . PRO B  2 192 ? 15.974  -23.319 -42.442 1.00 54.19  ? 192 PRO B CA    1 
ATOM   3104  C C     . PRO B  2 192 ? 14.893  -23.288 -41.375 1.00 61.35  ? 192 PRO B C     1 
ATOM   3105  O O     . PRO B  2 192 ? 14.531  -22.210 -40.897 1.00 61.88  ? 192 PRO B O     1 
ATOM   3106  C CB    . PRO B  2 192 ? 17.370  -23.104 -41.853 1.00 56.52  ? 192 PRO B CB    1 
ATOM   3107  C CG    . PRO B  2 192 ? 17.981  -21.983 -42.610 1.00 60.23  ? 192 PRO B CG    1 
ATOM   3108  C CD    . PRO B  2 192 ? 16.868  -21.172 -43.153 1.00 55.64  ? 192 PRO B CD    1 
ATOM   3109  N N     . SER B  2 193 ? 14.366  -24.449 -41.004 1.00 60.64  ? 193 SER B N     1 
ATOM   3110  C CA    . SER B  2 193 ? 13.348  -24.542 -39.935 1.00 61.56  ? 193 SER B CA    1 
ATOM   3111  C C     . SER B  2 193 ? 13.864  -23.957 -38.622 1.00 67.25  ? 193 SER B C     1 
ATOM   3112  O O     . SER B  2 193 ? 13.088  -23.410 -37.843 1.00 67.94  ? 193 SER B O     1 
ATOM   3113  C CB    . SER B  2 193 ? 12.951  -25.995 -39.698 1.00 63.09  ? 193 SER B CB    1 
ATOM   3114  O OG    . SER B  2 193 ? 12.193  -26.481 -40.789 1.00 74.30  ? 193 SER B OG    1 
ATOM   3115  N N     . SER B  2 194 ? 15.176  -24.102 -38.378 1.00 65.29  ? 194 SER B N     1 
ATOM   3116  C CA    . SER B  2 194 ? 15.857  -23.602 -37.180 1.00 66.38  ? 194 SER B CA    1 
ATOM   3117  C C     . SER B  2 194 ? 15.735  -22.092 -37.047 1.00 70.28  ? 194 SER B C     1 
ATOM   3118  O O     . SER B  2 194 ? 15.759  -21.599 -35.917 1.00 72.31  ? 194 SER B O     1 
ATOM   3119  C CB    . SER B  2 194 ? 17.333  -23.997 -37.198 1.00 69.72  ? 194 SER B CB    1 
ATOM   3120  O OG    . SER B  2 194 ? 17.992  -23.507 -38.356 1.00 78.40  ? 194 SER B OG    1 
ATOM   3121  N N     . SER B  2 195 ? 15.622  -21.366 -38.189 1.00 64.39  ? 195 SER B N     1 
ATOM   3122  C CA    . SER B  2 195 ? 15.488  -19.900 -38.227 1.00 64.18  ? 195 SER B CA    1 
ATOM   3123  C C     . SER B  2 195 ? 14.108  -19.368 -37.851 1.00 67.33  ? 195 SER B C     1 
ATOM   3124  O O     . SER B  2 195 ? 14.005  -18.184 -37.558 1.00 68.55  ? 195 SER B O     1 
ATOM   3125  C CB    . SER B  2 195 ? 15.850  -19.353 -39.607 1.00 66.91  ? 195 SER B CB    1 
ATOM   3126  O OG    . SER B  2 195 ? 17.194  -19.645 -39.944 1.00 79.53  ? 195 SER B OG    1 
ATOM   3127  N N     . LEU B  2 196 ? 13.051  -20.189 -37.877 1.00 63.17  ? 196 LEU B N     1 
ATOM   3128  C CA    . LEU B  2 196 ? 11.715  -19.697 -37.528 1.00 63.09  ? 196 LEU B CA    1 
ATOM   3129  C C     . LEU B  2 196 ? 11.679  -19.387 -36.040 1.00 68.61  ? 196 LEU B C     1 
ATOM   3130  O O     . LEU B  2 196 ? 12.034  -20.240 -35.224 1.00 68.31  ? 196 LEU B O     1 
ATOM   3131  C CB    . LEU B  2 196 ? 10.613  -20.697 -37.872 1.00 62.32  ? 196 LEU B CB    1 
ATOM   3132  C CG    . LEU B  2 196 ? 10.511  -21.146 -39.319 1.00 65.93  ? 196 LEU B CG    1 
ATOM   3133  C CD1   . LEU B  2 196 ? 9.424   -22.159 -39.458 1.00 65.72  ? 196 LEU B CD1   1 
ATOM   3134  C CD2   . LEU B  2 196 ? 10.279  -19.978 -40.257 1.00 68.24  ? 196 LEU B CD2   1 
ATOM   3135  N N     . GLY B  2 197 ? 11.290  -18.154 -35.716 1.00 66.19  ? 197 GLY B N     1 
ATOM   3136  C CA    . GLY B  2 197 ? 11.269  -17.635 -34.353 1.00 66.83  ? 197 GLY B CA    1 
ATOM   3137  C C     . GLY B  2 197 ? 12.540  -16.948 -33.889 1.00 70.33  ? 197 GLY B C     1 
ATOM   3138  O O     . GLY B  2 197 ? 12.558  -16.375 -32.802 1.00 72.50  ? 197 GLY B O     1 
ATOM   3139  N N     . THR B  2 198 ? 13.599  -16.978 -34.702 1.00 66.73  ? 198 THR B N     1 
ATOM   3140  C CA    . THR B  2 198 ? 14.895  -16.336 -34.459 1.00 67.87  ? 198 THR B CA    1 
ATOM   3141  C C     . THR B  2 198 ? 14.904  -14.946 -35.088 1.00 72.30  ? 198 THR B C     1 
ATOM   3142  O O     . THR B  2 198 ? 15.450  -14.008 -34.519 1.00 73.54  ? 198 THR B O     1 
ATOM   3143  C CB    . THR B  2 198 ? 16.015  -17.179 -35.117 1.00 82.96  ? 198 THR B CB    1 
ATOM   3144  O OG1   . THR B  2 198 ? 15.974  -18.502 -34.593 1.00 89.14  ? 198 THR B OG1   1 
ATOM   3145  C CG2   . THR B  2 198 ? 17.388  -16.606 -34.904 1.00 87.88  ? 198 THR B CG2   1 
ATOM   3146  N N     . LYS B  2 199 ? 14.377  -14.859 -36.310 1.00 67.84  ? 199 LYS B N     1 
ATOM   3147  C CA    . LYS B  2 199 ? 14.319  -13.666 -37.147 1.00 66.32  ? 199 LYS B CA    1 
ATOM   3148  C C     . LYS B  2 199 ? 12.863  -13.433 -37.546 1.00 67.38  ? 199 LYS B C     1 
ATOM   3149  O O     . LYS B  2 199 ? 12.112  -14.402 -37.692 1.00 65.98  ? 199 LYS B O     1 
ATOM   3150  C CB    . LYS B  2 199 ? 15.151  -13.954 -38.435 1.00 67.36  ? 199 LYS B CB    1 
ATOM   3151  C CG    . LYS B  2 199 ? 15.476  -12.726 -39.273 1.00 90.35  ? 199 LYS B CG    1 
ATOM   3152  C CD    . LYS B  2 199 ? 15.827  -13.070 -40.725 1.00 95.80  ? 199 LYS B CD    1 
ATOM   3153  C CE    . LYS B  2 199 ? 17.150  -13.780 -40.857 1.00 101.40 ? 199 LYS B CE    1 
ATOM   3154  N NZ    . LYS B  2 199 ? 17.596  -13.831 -42.280 1.00 107.78 ? 199 LYS B NZ    1 
ATOM   3155  N N     . THR B  2 200 ? 12.477  -12.178 -37.790 1.00 62.58  ? 200 THR B N     1 
ATOM   3156  C CA    . THR B  2 200 ? 11.142  -11.892 -38.308 1.00 61.18  ? 200 THR B CA    1 
ATOM   3157  C C     . THR B  2 200 ? 11.162  -12.016 -39.837 1.00 61.59  ? 200 THR B C     1 
ATOM   3158  O O     . THR B  2 200 ? 12.209  -11.831 -40.481 1.00 61.08  ? 200 THR B O     1 
ATOM   3159  C CB    . THR B  2 200 ? 10.656  -10.499 -37.918 1.00 72.35  ? 200 THR B CB    1 
ATOM   3160  O OG1   . THR B  2 200 ? 11.580  -9.533  -38.415 1.00 73.46  ? 200 THR B OG1   1 
ATOM   3161  C CG2   . THR B  2 200 ? 10.449  -10.357 -36.425 1.00 70.65  ? 200 THR B CG2   1 
ATOM   3162  N N     . TYR B  2 201 ? 9.998   -12.321 -40.416 1.00 55.39  ? 201 TYR B N     1 
ATOM   3163  C CA    . TYR B  2 201 ? 9.854   -12.455 -41.870 1.00 51.96  ? 201 TYR B CA    1 
ATOM   3164  C C     . TYR B  2 201 ? 8.659   -11.641 -42.305 1.00 51.04  ? 201 TYR B C     1 
ATOM   3165  O O     . TYR B  2 201 ? 7.557   -11.851 -41.830 1.00 47.49  ? 201 TYR B O     1 
ATOM   3166  C CB    . TYR B  2 201 ? 9.732   -13.933 -42.248 1.00 51.47  ? 201 TYR B CB    1 
ATOM   3167  C CG    . TYR B  2 201 ? 11.027  -14.695 -42.064 1.00 51.09  ? 201 TYR B CG    1 
ATOM   3168  C CD1   . TYR B  2 201 ? 12.069  -14.571 -42.981 1.00 51.66  ? 201 TYR B CD1   1 
ATOM   3169  C CD2   . TYR B  2 201 ? 11.168  -15.632 -41.047 1.00 52.28  ? 201 TYR B CD2   1 
ATOM   3170  C CE1   . TYR B  2 201 ? 13.266  -15.263 -42.811 1.00 53.71  ? 201 TYR B CE1   1 
ATOM   3171  C CE2   . TYR B  2 201 ? 12.342  -16.371 -40.898 1.00 53.23  ? 201 TYR B CE2   1 
ATOM   3172  C CZ    . TYR B  2 201 ? 13.401  -16.168 -41.763 1.00 60.65  ? 201 TYR B CZ    1 
ATOM   3173  O OH    . TYR B  2 201 ? 14.563  -16.889 -41.568 1.00 58.16  ? 201 TYR B OH    1 
ATOM   3174  N N     . THR B  2 202 ? 8.906   -10.678 -43.176 1.00 50.52  ? 202 THR B N     1 
ATOM   3175  C CA    . THR B  2 202 ? 7.922   -9.703  -43.647 1.00 50.79  ? 202 THR B CA    1 
ATOM   3176  C C     . THR B  2 202 ? 8.092   -9.524  -45.155 1.00 54.13  ? 202 THR B C     1 
ATOM   3177  O O     . THR B  2 202 ? 9.226   -9.355  -45.611 1.00 52.48  ? 202 THR B O     1 
ATOM   3178  C CB    . THR B  2 202 ? 8.192   -8.316  -42.981 1.00 55.12  ? 202 THR B CB    1 
ATOM   3179  O OG1   . THR B  2 202 ? 8.340   -8.466  -41.570 1.00 55.13  ? 202 THR B OG1   1 
ATOM   3180  C CG2   . THR B  2 202 ? 7.102   -7.260  -43.298 1.00 47.60  ? 202 THR B CG2   1 
ATOM   3181  N N     . CYS B  2 203 ? 6.988   -9.514  -45.911 1.00 50.84  ? 203 CYS B N     1 
ATOM   3182  C CA    . CYS B  2 203 ? 7.050   -9.239  -47.341 1.00 51.31  ? 203 CYS B CA    1 
ATOM   3183  C C     . CYS B  2 203 ? 6.636   -7.777  -47.549 1.00 52.13  ? 203 CYS B C     1 
ATOM   3184  O O     . CYS B  2 203 ? 5.713   -7.286  -46.911 1.00 51.94  ? 203 CYS B O     1 
ATOM   3185  C CB    . CYS B  2 203 ? 6.174   -10.206 -48.137 1.00 53.03  ? 203 CYS B CB    1 
ATOM   3186  S SG    . CYS B  2 203 ? 4.403   -9.994  -47.854 1.00 59.00  ? 203 CYS B SG    1 
ATOM   3187  N N     . ASN B  2 204 ? 7.336   -7.080  -48.416 1.00 47.27  ? 204 ASN B N     1 
ATOM   3188  C CA    . ASN B  2 204 ? 7.078   -5.669  -48.690 1.00 45.57  ? 204 ASN B CA    1 
ATOM   3189  C C     . ASN B  2 204 ? 6.517   -5.584  -50.072 1.00 47.56  ? 204 ASN B C     1 
ATOM   3190  O O     . ASN B  2 204 ? 7.212   -5.889  -51.035 1.00 47.08  ? 204 ASN B O     1 
ATOM   3191  C CB    . ASN B  2 204 ? 8.366   -4.847  -48.538 1.00 41.51  ? 204 ASN B CB    1 
ATOM   3192  C CG    . ASN B  2 204 ? 9.270   -5.377  -47.459 1.00 56.12  ? 204 ASN B CG    1 
ATOM   3193  O OD1   . ASN B  2 204 ? 10.274  -6.018  -47.741 1.00 51.73  ? 204 ASN B OD1   1 
ATOM   3194  N ND2   . ASN B  2 204 ? 8.891   -5.183  -46.193 1.00 51.41  ? 204 ASN B ND2   1 
ATOM   3195  N N     . VAL B  2 205 ? 5.232   -5.253  -50.171 1.00 44.81  ? 205 VAL B N     1 
ATOM   3196  C CA    . VAL B  2 205 ? 4.509   -5.220  -51.442 1.00 43.95  ? 205 VAL B CA    1 
ATOM   3197  C C     . VAL B  2 205 ? 4.221   -3.784  -51.874 1.00 48.23  ? 205 VAL B C     1 
ATOM   3198  O O     . VAL B  2 205 ? 3.735   -2.994  -51.076 1.00 49.33  ? 205 VAL B O     1 
ATOM   3199  C CB    . VAL B  2 205 ? 3.199   -6.052  -51.331 1.00 47.47  ? 205 VAL B CB    1 
ATOM   3200  C CG1   . VAL B  2 205 ? 2.435   -6.022  -52.647 1.00 47.54  ? 205 VAL B CG1   1 
ATOM   3201  C CG2   . VAL B  2 205 ? 3.487   -7.495  -50.890 1.00 46.74  ? 205 VAL B CG2   1 
ATOM   3202  N N     . ASP B  2 206 ? 4.476   -3.476  -53.147 1.00 45.01  ? 206 ASP B N     1 
ATOM   3203  C CA    . ASP B  2 206 ? 4.246   -2.173  -53.728 1.00 45.47  ? 206 ASP B CA    1 
ATOM   3204  C C     . ASP B  2 206 ? 3.413   -2.325  -55.006 1.00 46.13  ? 206 ASP B C     1 
ATOM   3205  O O     . ASP B  2 206 ? 3.777   -3.114  -55.866 1.00 44.00  ? 206 ASP B O     1 
ATOM   3206  C CB    . ASP B  2 206 ? 5.603   -1.487  -54.046 1.00 49.29  ? 206 ASP B CB    1 
ATOM   3207  C CG    . ASP B  2 206 ? 5.617   0.026   -54.053 1.00 72.28  ? 206 ASP B CG    1 
ATOM   3208  O OD1   . ASP B  2 206 ? 4.519   0.643   -54.005 1.00 73.86  ? 206 ASP B OD1   1 
ATOM   3209  O OD2   . ASP B  2 206 ? 6.718   0.599   -54.153 1.00 85.77  ? 206 ASP B OD2   1 
ATOM   3210  N N     . HIS B  2 207 ? 2.266   -1.611  -55.096 1.00 42.85  ? 207 HIS B N     1 
ATOM   3211  C CA    . HIS B  2 207 ? 1.411   -1.560  -56.284 1.00 40.48  ? 207 HIS B CA    1 
ATOM   3212  C C     . HIS B  2 207 ? 1.290   -0.072  -56.594 1.00 46.18  ? 207 HIS B C     1 
ATOM   3213  O O     . HIS B  2 207 ? 0.400   0.620   -56.086 1.00 45.36  ? 207 HIS B O     1 
ATOM   3214  C CB    . HIS B  2 207 ? 0.034   -2.186  -56.069 1.00 39.47  ? 207 HIS B CB    1 
ATOM   3215  C CG    . HIS B  2 207 ? -0.776  -2.216  -57.330 1.00 40.89  ? 207 HIS B CG    1 
ATOM   3216  N ND1   . HIS B  2 207 ? -1.990  -1.583  -57.417 1.00 41.94  ? 207 HIS B ND1   1 
ATOM   3217  C CD2   . HIS B  2 207 ? -0.486  -2.763  -58.529 1.00 41.60  ? 207 HIS B CD2   1 
ATOM   3218  C CE1   . HIS B  2 207 ? -2.410  -1.776  -58.651 1.00 40.72  ? 207 HIS B CE1   1 
ATOM   3219  N NE2   . HIS B  2 207 ? -1.529  -2.483  -59.350 1.00 40.92  ? 207 HIS B NE2   1 
ATOM   3220  N N     . LYS B  2 208 ? 2.232   0.417   -57.395 1.00 43.94  ? 208 LYS B N     1 
ATOM   3221  C CA    . LYS B  2 208 ? 2.360   1.828   -57.694 1.00 45.38  ? 208 LYS B CA    1 
ATOM   3222  C C     . LYS B  2 208 ? 1.094   2.427   -58.371 1.00 48.44  ? 208 LYS B C     1 
ATOM   3223  O O     . LYS B  2 208 ? 0.626   3.473   -57.912 1.00 47.00  ? 208 LYS B O     1 
ATOM   3224  C CB    . LYS B  2 208 ? 3.665   2.085   -58.481 1.00 49.25  ? 208 LYS B CB    1 
ATOM   3225  C CG    . LYS B  2 208 ? 4.918   1.856   -57.607 1.00 65.16  ? 208 LYS B CG    1 
ATOM   3226  C CD    . LYS B  2 208 ? 6.242   1.838   -58.388 1.00 73.79  ? 208 LYS B CD    1 
ATOM   3227  C CE    . LYS B  2 208 ? 7.436   1.577   -57.485 1.00 85.83  ? 208 LYS B CE    1 
ATOM   3228  N NZ    . LYS B  2 208 ? 7.810   0.127   -57.428 1.00 96.56  ? 208 LYS B NZ    1 
ATOM   3229  N N     . PRO B  2 209 ? 0.392   1.719   -59.290 1.00 44.61  ? 209 PRO B N     1 
ATOM   3230  C CA    . PRO B  2 209 ? -0.838  2.310   -59.849 1.00 43.89  ? 209 PRO B CA    1 
ATOM   3231  C C     . PRO B  2 209 ? -1.895  2.752   -58.837 1.00 50.72  ? 209 PRO B C     1 
ATOM   3232  O O     . PRO B  2 209 ? -2.580  3.738   -59.083 1.00 50.44  ? 209 PRO B O     1 
ATOM   3233  C CB    . PRO B  2 209 ? -1.359  1.232   -60.789 1.00 44.53  ? 209 PRO B CB    1 
ATOM   3234  C CG    . PRO B  2 209 ? -0.137  0.435   -61.173 1.00 47.80  ? 209 PRO B CG    1 
ATOM   3235  C CD    . PRO B  2 209 ? 0.767   0.466   -59.983 1.00 43.92  ? 209 PRO B CD    1 
ATOM   3236  N N     . SER B  2 210 ? -2.020  2.065   -57.696 1.00 48.36  ? 210 SER B N     1 
ATOM   3237  C CA    . SER B  2 210 ? -2.999  2.444   -56.666 1.00 47.42  ? 210 SER B CA    1 
ATOM   3238  C C     . SER B  2 210 ? -2.320  3.070   -55.404 1.00 51.32  ? 210 SER B C     1 
ATOM   3239  O O     . SER B  2 210 ? -2.980  3.232   -54.369 1.00 50.33  ? 210 SER B O     1 
ATOM   3240  C CB    . SER B  2 210 ? -3.760  1.190   -56.249 1.00 49.69  ? 210 SER B CB    1 
ATOM   3241  O OG    . SER B  2 210 ? -2.855  0.294   -55.629 1.00 45.63  ? 210 SER B OG    1 
ATOM   3242  N N     . ASN B  2 211 ? -0.990  3.295   -55.451 1.00 48.65  ? 211 ASN B N     1 
ATOM   3243  C CA    . ASN B  2 211 ? -0.197  3.807   -54.326 1.00 50.82  ? 211 ASN B CA    1 
ATOM   3244  C C     . ASN B  2 211 ? -0.350  2.950   -53.075 1.00 57.06  ? 211 ASN B C     1 
ATOM   3245  O O     . ASN B  2 211 ? -0.491  3.462   -51.968 1.00 58.64  ? 211 ASN B O     1 
ATOM   3246  C CB    . ASN B  2 211 ? -0.480  5.317   -54.058 1.00 52.55  ? 211 ASN B CB    1 
ATOM   3247  C CG    . ASN B  2 211 ? -0.229  6.151   -55.310 1.00 80.41  ? 211 ASN B CG    1 
ATOM   3248  O OD1   . ASN B  2 211 ? 0.926   6.316   -55.739 1.00 76.83  ? 211 ASN B OD1   1 
ATOM   3249  N ND2   . ASN B  2 211 ? -1.302  6.533   -56.031 1.00 66.83  ? 211 ASN B ND2   1 
ATOM   3250  N N     . THR B  2 212 ? -0.276  1.627   -53.262 1.00 54.48  ? 212 THR B N     1 
ATOM   3251  C CA    . THR B  2 212 ? -0.368  0.660   -52.185 1.00 53.78  ? 212 THR B CA    1 
ATOM   3252  C C     . THR B  2 212 ? 1.046   0.258   -51.842 1.00 57.75  ? 212 THR B C     1 
ATOM   3253  O O     . THR B  2 212 ? 1.838   -0.050  -52.737 1.00 54.28  ? 212 THR B O     1 
ATOM   3254  C CB    . THR B  2 212 ? -1.229  -0.529  -52.573 1.00 58.55  ? 212 THR B CB    1 
ATOM   3255  O OG1   . THR B  2 212 ? -2.444  -0.045  -53.116 1.00 57.65  ? 212 THR B OG1   1 
ATOM   3256  C CG2   . THR B  2 212 ? -1.551  -1.422  -51.391 1.00 59.64  ? 212 THR B CG2   1 
ATOM   3257  N N     . LYS B  2 213 ? 1.390   0.372   -50.548 1.00 57.48  ? 213 LYS B N     1 
ATOM   3258  C CA    . LYS B  2 213 ? 2.701   -0.006  -50.020 1.00 56.79  ? 213 LYS B CA    1 
ATOM   3259  C C     . LYS B  2 213 ? 2.400   -0.718  -48.706 1.00 59.83  ? 213 LYS B C     1 
ATOM   3260  O O     . LYS B  2 213 ? 1.982   -0.064  -47.764 1.00 59.20  ? 213 LYS B O     1 
ATOM   3261  C CB    . LYS B  2 213 ? 3.592   1.236   -49.874 1.00 58.36  ? 213 LYS B CB    1 
ATOM   3262  C CG    . LYS B  2 213 ? 5.083   0.966   -49.956 1.00 73.92  ? 213 LYS B CG    1 
ATOM   3263  C CD    . LYS B  2 213 ? 5.888   2.222   -50.223 1.00 87.65  ? 213 LYS B CD    1 
ATOM   3264  C CE    . LYS B  2 213 ? 7.343   1.912   -50.486 1.00 104.04 ? 213 LYS B CE    1 
ATOM   3265  N NZ    . LYS B  2 213 ? 8.210   3.105   -50.265 1.00 116.49 ? 213 LYS B NZ    1 
ATOM   3266  N N     . VAL B  2 214 ? 2.443   -2.077  -48.710 1.00 55.98  ? 214 VAL B N     1 
ATOM   3267  C CA    . VAL B  2 214 ? 2.099   -2.928  -47.551 1.00 55.42  ? 214 VAL B CA    1 
ATOM   3268  C C     . VAL B  2 214 ? 3.314   -3.719  -47.075 1.00 58.83  ? 214 VAL B C     1 
ATOM   3269  O O     . VAL B  2 214 ? 4.025   -4.292  -47.887 1.00 57.67  ? 214 VAL B O     1 
ATOM   3270  C CB    . VAL B  2 214 ? 0.941   -3.898  -47.904 1.00 58.14  ? 214 VAL B CB    1 
ATOM   3271  C CG1   . VAL B  2 214 ? 0.639   -4.862  -46.750 1.00 58.58  ? 214 VAL B CG1   1 
ATOM   3272  C CG2   . VAL B  2 214 ? -0.301  -3.129  -48.266 1.00 58.16  ? 214 VAL B CG2   1 
ATOM   3273  N N     . ASP B  2 215 ? 3.513   -3.791  -45.761 1.00 56.72  ? 215 ASP B N     1 
ATOM   3274  C CA    . ASP B  2 215 ? 4.597   -4.554  -45.140 1.00 56.67  ? 215 ASP B CA    1 
ATOM   3275  C C     . ASP B  2 215 ? 3.873   -5.593  -44.287 1.00 61.51  ? 215 ASP B C     1 
ATOM   3276  O O     . ASP B  2 215 ? 3.391   -5.262  -43.208 1.00 62.97  ? 215 ASP B O     1 
ATOM   3277  C CB    . ASP B  2 215 ? 5.516   -3.628  -44.301 1.00 58.35  ? 215 ASP B CB    1 
ATOM   3278  C CG    . ASP B  2 215 ? 6.179   -2.535  -45.114 1.00 65.82  ? 215 ASP B CG    1 
ATOM   3279  O OD1   . ASP B  2 215 ? 6.667   -2.829  -46.224 1.00 65.58  ? 215 ASP B OD1   1 
ATOM   3280  O OD2   . ASP B  2 215 ? 6.203   -1.380  -44.645 1.00 77.94  ? 215 ASP B OD2   1 
ATOM   3281  N N     . LYS B  2 216 ? 3.661   -6.799  -44.839 1.00 56.56  ? 216 LYS B N     1 
ATOM   3282  C CA    . LYS B  2 216 ? 2.869   -7.837  -44.176 1.00 55.67  ? 216 LYS B CA    1 
ATOM   3283  C C     . LYS B  2 216 ? 3.756   -8.770  -43.407 1.00 59.27  ? 216 LYS B C     1 
ATOM   3284  O O     . LYS B  2 216 ? 4.622   -9.395  -44.010 1.00 59.19  ? 216 LYS B O     1 
ATOM   3285  C CB    . LYS B  2 216 ? 2.037   -8.625  -45.211 1.00 56.40  ? 216 LYS B CB    1 
ATOM   3286  C CG    . LYS B  2 216 ? 1.155   -9.764  -44.650 1.00 57.73  ? 216 LYS B CG    1 
ATOM   3287  C CD    . LYS B  2 216 ? 0.210   -9.310  -43.505 1.00 59.39  ? 216 LYS B CD    1 
ATOM   3288  C CE    . LYS B  2 216 ? -0.751  -8.230  -43.950 1.00 61.50  ? 216 LYS B CE    1 
ATOM   3289  N NZ    . LYS B  2 216 ? -1.869  -8.022  -42.981 1.00 80.57  ? 216 LYS B NZ    1 
ATOM   3290  N N     . ARG B  2 217 ? 3.527   -8.901  -42.086 1.00 56.06  ? 217 ARG B N     1 
ATOM   3291  C CA    . ARG B  2 217 ? 4.313   -9.798  -41.254 1.00 54.66  ? 217 ARG B CA    1 
ATOM   3292  C C     . ARG B  2 217 ? 3.781   -11.193 -41.435 1.00 57.91  ? 217 ARG B C     1 
ATOM   3293  O O     . ARG B  2 217 ? 2.600   -11.453 -41.184 1.00 58.98  ? 217 ARG B O     1 
ATOM   3294  C CB    . ARG B  2 217 ? 4.265   -9.408  -39.763 1.00 51.05  ? 217 ARG B CB    1 
ATOM   3295  C CG    . ARG B  2 217 ? 5.094   -10.376 -38.894 1.00 64.08  ? 217 ARG B CG    1 
ATOM   3296  C CD    . ARG B  2 217 ? 5.805   -9.728  -37.736 1.00 92.10  ? 217 ARG B CD    1 
ATOM   3297  N NE    . ARG B  2 217 ? 6.828   -8.772  -38.160 1.00 105.74 ? 217 ARG B NE    1 
ATOM   3298  C CZ    . ARG B  2 217 ? 7.597   -8.081  -37.322 1.00 124.20 ? 217 ARG B CZ    1 
ATOM   3299  N NH1   . ARG B  2 217 ? 7.474   -8.241  -36.006 1.00 112.85 ? 217 ARG B NH1   1 
ATOM   3300  N NH2   . ARG B  2 217 ? 8.500   -7.226  -37.791 1.00 111.74 ? 217 ARG B NH2   1 
ATOM   3301  N N     . VAL B  2 218 ? 4.662   -12.101 -41.833 1.00 51.84  ? 218 VAL B N     1 
ATOM   3302  C CA    . VAL B  2 218 ? 4.319   -13.501 -42.058 1.00 47.91  ? 218 VAL B CA    1 
ATOM   3303  C C     . VAL B  2 218 ? 4.735   -14.313 -40.833 1.00 52.42  ? 218 VAL B C     1 
ATOM   3304  O O     . VAL B  2 218 ? 3.952   -15.133 -40.348 1.00 52.07  ? 218 VAL B O     1 
ATOM   3305  C CB    . VAL B  2 218 ? 4.998   -14.006 -43.364 1.00 47.22  ? 218 VAL B CB    1 
ATOM   3306  C CG1   . VAL B  2 218 ? 4.562   -15.428 -43.694 1.00 44.23  ? 218 VAL B CG1   1 
ATOM   3307  C CG2   . VAL B  2 218 ? 4.707   -13.058 -44.524 1.00 46.18  ? 218 VAL B CG2   1 
ATOM   3308  N N     . GLU B  2 219 ? 5.977   -14.149 -40.367 1.00 50.74  ? 219 GLU B N     1 
ATOM   3309  C CA    . GLU B  2 219 ? 6.441   -14.921 -39.190 1.00 52.69  ? 219 GLU B CA    1 
ATOM   3310  C C     . GLU B  2 219 ? 7.172   -14.031 -38.134 1.00 58.28  ? 219 GLU B C     1 
ATOM   3311  O O     . GLU B  2 219 ? 8.051   -13.248 -38.507 1.00 56.30  ? 219 GLU B O     1 
ATOM   3312  C CB    . GLU B  2 219 ? 7.314   -16.122 -39.649 1.00 52.94  ? 219 GLU B CB    1 
ATOM   3313  C CG    . GLU B  2 219 ? 7.308   -17.277 -38.676 1.00 66.27  ? 219 GLU B CG    1 
ATOM   3314  C CD    . GLU B  2 219 ? 6.140   -18.227 -38.837 1.00 86.63  ? 219 GLU B CD    1 
ATOM   3315  O OE1   . GLU B  2 219 ? 5.040   -17.775 -39.225 1.00 77.05  ? 219 GLU B OE1   1 
ATOM   3316  O OE2   . GLU B  2 219 ? 6.324   -19.432 -38.559 1.00 91.44  ? 219 GLU B OE2   1 
ATOM   3317  N N     . SER B  2 220 ? 6.785   -14.155 -36.825 1.00 57.40  ? 220 SER B N     1 
ATOM   3318  C CA    . SER B  2 220 ? 7.371   -13.362 -35.715 1.00 59.64  ? 220 SER B CA    1 
ATOM   3319  C C     . SER B  2 220 ? 8.442   -14.161 -34.922 1.00 64.37  ? 220 SER B C     1 
ATOM   3320  O O     . SER B  2 220 ? 8.689   -15.313 -35.256 1.00 60.62  ? 220 SER B O     1 
ATOM   3321  C CB    . SER B  2 220 ? 6.254   -12.907 -34.765 1.00 63.54  ? 220 SER B CB    1 
ATOM   3322  O OG    . SER B  2 220 ? 5.279   -12.136 -35.449 1.00 71.85  ? 220 SER B OG    1 
ATOM   3323  N N     . LYS B  2 221 ? 9.041   -13.561 -33.844 1.00 65.99  ? 221 LYS B N     1 
ATOM   3324  C CA    . LYS B  2 221 ? 10.011  -14.242 -32.959 1.00 66.55  ? 221 LYS B CA    1 
ATOM   3325  C C     . LYS B  2 221 ? 9.268   -15.070 -31.863 1.00 75.47  ? 221 LYS B C     1 
ATOM   3326  O O     . LYS B  2 221 ? 8.038   -15.052 -31.856 1.00 75.47  ? 221 LYS B O     1 
ATOM   3327  C CB    . LYS B  2 221 ? 11.057  -13.276 -32.417 1.00 69.42  ? 221 LYS B CB    1 
ATOM   3328  C CG    . LYS B  2 221 ? 11.860  -12.589 -33.509 1.00 74.65  ? 221 LYS B CG    1 
ATOM   3329  C CD    . LYS B  2 221 ? 13.018  -11.760 -32.919 1.00 86.23  ? 221 LYS B CD    1 
ATOM   3330  C CE    . LYS B  2 221 ? 13.110  -10.345 -33.452 1.00 102.11 ? 221 LYS B CE    1 
ATOM   3331  N NZ    . LYS B  2 221 ? 13.801  -9.426  -32.497 1.00 108.88 ? 221 LYS B NZ    1 
ATOM   3332  N N     . TYR B  2 222 ? 9.990   -15.746 -30.919 1.00 76.57  ? 222 TYR B N     1 
ATOM   3333  C CA    . TYR B  2 222 ? 9.438   -16.771 -29.995 1.00 78.35  ? 222 TYR B CA    1 
ATOM   3334  C C     . TYR B  2 222 ? 8.856   -16.468 -28.526 1.00 85.42  ? 222 TYR B C     1 
ATOM   3335  O O     . TYR B  2 222 ? 8.516   -17.450 -27.852 1.00 87.07  ? 222 TYR B O     1 
ATOM   3336  C CB    . TYR B  2 222 ? 10.540  -17.856 -29.766 1.00 79.50  ? 222 TYR B CB    1 
ATOM   3337  C CG    . TYR B  2 222 ? 10.438  -19.051 -30.683 1.00 81.09  ? 222 TYR B CG    1 
ATOM   3338  C CD1   . TYR B  2 222 ? 9.266   -19.793 -30.761 1.00 83.13  ? 222 TYR B CD1   1 
ATOM   3339  C CD2   . TYR B  2 222 ? 11.554  -19.535 -31.352 1.00 81.96  ? 222 TYR B CD2   1 
ATOM   3340  C CE1   . TYR B  2 222 ? 9.170   -20.912 -31.583 1.00 83.46  ? 222 TYR B CE1   1 
ATOM   3341  C CE2   . TYR B  2 222 ? 11.473  -20.649 -32.184 1.00 82.67  ? 222 TYR B CE2   1 
ATOM   3342  C CZ    . TYR B  2 222 ? 10.275  -21.336 -32.304 1.00 91.86  ? 222 TYR B CZ    1 
ATOM   3343  O OH    . TYR B  2 222 ? 10.176  -22.449 -33.114 1.00 93.99  ? 222 TYR B OH    1 
ATOM   3344  N N     . GLY B  2 223 ? 8.853   -15.290 -27.935 1.00 80.97  ? 223 GLY B N     1 
ATOM   3345  C CA    . GLY B  2 223 ? 8.954   -13.954 -28.454 1.00 79.36  ? 223 GLY B CA    1 
ATOM   3346  C C     . GLY B  2 223 ? 7.659   -13.265 -28.029 1.00 80.08  ? 223 GLY B C     1 
ATOM   3347  O O     . GLY B  2 223 ? 6.771   -13.125 -28.878 1.00 78.85  ? 223 GLY B O     1 
ATOM   3348  N N     . PRO B  2 224 ? 7.456   -12.897 -26.715 1.00 75.30  ? 224 PRO B N     1 
ATOM   3349  C CA    . PRO B  2 224 ? 6.203   -12.189 -26.299 1.00 73.98  ? 224 PRO B CA    1 
ATOM   3350  C C     . PRO B  2 224 ? 5.857   -11.058 -27.260 1.00 71.01  ? 224 PRO B C     1 
ATOM   3351  O O     . PRO B  2 224 ? 6.785   -10.382 -27.695 1.00 68.71  ? 224 PRO B O     1 
ATOM   3352  C CB    . PRO B  2 224 ? 6.514   -11.659 -24.882 1.00 77.63  ? 224 PRO B CB    1 
ATOM   3353  C CG    . PRO B  2 224 ? 7.991   -11.821 -24.707 1.00 83.08  ? 224 PRO B CG    1 
ATOM   3354  C CD    . PRO B  2 224 ? 8.384   -13.003 -25.573 1.00 78.17  ? 224 PRO B CD    1 
ATOM   3355  N N     . PRO B  2 225 ? 4.609   -10.933 -27.754 1.00 66.36  ? 225 PRO B N     1 
ATOM   3356  C CA    . PRO B  2 225 ? 3.361   -11.542 -27.262 1.00 67.27  ? 225 PRO B CA    1 
ATOM   3357  C C     . PRO B  2 225 ? 3.003   -12.960 -27.739 1.00 72.32  ? 225 PRO B C     1 
ATOM   3358  O O     . PRO B  2 225 ? 1.887   -13.412 -27.473 1.00 70.70  ? 225 PRO B O     1 
ATOM   3359  C CB    . PRO B  2 225 ? 2.302   -10.520 -27.697 1.00 68.82  ? 225 PRO B CB    1 
ATOM   3360  C CG    . PRO B  2 225 ? 2.850   -9.986  -28.988 1.00 71.32  ? 225 PRO B CG    1 
ATOM   3361  C CD    . PRO B  2 225 ? 4.324   -9.870  -28.739 1.00 67.11  ? 225 PRO B CD    1 
ATOM   3362  N N     . CYS B  2 226 ? 3.932   -13.685 -28.354 1.00 71.54  ? 226 CYS B N     1 
ATOM   3363  C CA    . CYS B  2 226 ? 3.657   -15.055 -28.770 1.00 73.40  ? 226 CYS B CA    1 
ATOM   3364  C C     . CYS B  2 226 ? 3.754   -15.957 -27.544 1.00 79.88  ? 226 CYS B C     1 
ATOM   3365  O O     . CYS B  2 226 ? 4.788   -15.910 -26.880 1.00 79.79  ? 226 CYS B O     1 
ATOM   3366  C CB    . CYS B  2 226 ? 4.643   -15.479 -29.851 1.00 74.00  ? 226 CYS B CB    1 
ATOM   3367  S SG    . CYS B  2 226 ? 4.483   -14.537 -31.388 1.00 78.16  ? 226 CYS B SG    1 
ATOM   3368  N N     . PRO B  2 227 ? 2.733   -16.777 -27.190 1.00 78.65  ? 227 PRO B N     1 
ATOM   3369  C CA    . PRO B  2 227 ? 2.879   -17.637 -25.994 1.00 80.13  ? 227 PRO B CA    1 
ATOM   3370  C C     . PRO B  2 227 ? 4.144   -18.514 -26.019 1.00 84.68  ? 227 PRO B C     1 
ATOM   3371  O O     . PRO B  2 227 ? 4.664   -18.804 -27.104 1.00 83.15  ? 227 PRO B O     1 
ATOM   3372  C CB    . PRO B  2 227 ? 1.585   -18.453 -25.970 1.00 81.66  ? 227 PRO B CB    1 
ATOM   3373  C CG    . PRO B  2 227 ? 0.600   -17.607 -26.729 1.00 85.39  ? 227 PRO B CG    1 
ATOM   3374  C CD    . PRO B  2 227 ? 1.404   -16.950 -27.812 1.00 79.55  ? 227 PRO B CD    1 
ATOM   3375  N N     . PRO B  2 228 ? 4.712   -18.893 -24.851 1.00 83.06  ? 228 PRO B N     1 
ATOM   3376  C CA    . PRO B  2 228 ? 5.975   -19.662 -24.872 1.00 82.91  ? 228 PRO B CA    1 
ATOM   3377  C C     . PRO B  2 228 ? 5.894   -21.100 -25.407 1.00 85.55  ? 228 PRO B C     1 
ATOM   3378  O O     . PRO B  2 228 ? 6.941   -21.645 -25.747 1.00 83.52  ? 228 PRO B O     1 
ATOM   3379  C CB    . PRO B  2 228 ? 6.428   -19.640 -23.396 1.00 85.93  ? 228 PRO B CB    1 
ATOM   3380  C CG    . PRO B  2 228 ? 5.539   -18.638 -22.718 1.00 90.79  ? 228 PRO B CG    1 
ATOM   3381  C CD    . PRO B  2 228 ? 4.265   -18.659 -23.464 1.00 85.30  ? 228 PRO B CD    1 
ATOM   3382  N N     . CYS B  2 229 ? 4.661   -21.685 -25.475 1.00 83.80  ? 229 CYS B N     1 
ATOM   3383  C CA    . CYS B  2 229 ? 4.260   -23.059 -25.881 1.00 130.77 ? 229 CYS B CA    1 
ATOM   3384  C C     . CYS B  2 229 ? 4.119   -23.944 -24.638 1.00 175.36 ? 229 CYS B C     1 
ATOM   3385  O O     . CYS B  2 229 ? 3.228   -23.716 -23.817 1.00 142.89 ? 229 CYS B O     1 
ATOM   3386  C CB    . CYS B  2 229 ? 5.157   -23.707 -26.943 1.00 129.87 ? 229 CYS B CB    1 
ATOM   3387  S SG    . CYS B  2 229 ? 4.594   -23.464 -28.651 1.00 132.38 ? 229 CYS B SG    1 
ATOM   3388  N N     . GLU B  2 233 ? 10.238  -25.563 -23.534 1.00 120.58 ? 233 GLU B N     1 
ATOM   3389  C CA    . GLU B  2 233 ? 11.683  -25.393 -23.642 1.00 120.68 ? 233 GLU B CA    1 
ATOM   3390  C C     . GLU B  2 233 ? 12.035  -24.319 -24.669 1.00 124.73 ? 233 GLU B C     1 
ATOM   3391  O O     . GLU B  2 233 ? 11.260  -24.063 -25.592 1.00 124.18 ? 233 GLU B O     1 
ATOM   3392  C CB    . GLU B  2 233 ? 12.356  -26.717 -24.009 1.00 121.33 ? 233 GLU B CB    1 
ATOM   3393  N N     . PHE B  2 234 ? 13.227  -23.720 -24.516 1.00 121.00 ? 234 PHE B N     1 
ATOM   3394  C CA    . PHE B  2 234 ? 13.717  -22.613 -25.346 1.00 119.84 ? 234 PHE B CA    1 
ATOM   3395  C C     . PHE B  2 234 ? 14.803  -23.032 -26.379 1.00 121.13 ? 234 PHE B C     1 
ATOM   3396  O O     . PHE B  2 234 ? 15.001  -24.233 -26.594 1.00 119.64 ? 234 PHE B O     1 
ATOM   3397  C CB    . PHE B  2 234 ? 14.238  -21.517 -24.406 1.00 122.92 ? 234 PHE B CB    1 
ATOM   3398  N N     . LEU B  2 235 ? 15.441  -22.028 -27.075 1.00 116.22 ? 235 LEU B N     1 
ATOM   3399  C CA    . LEU B  2 235 ? 16.523  -22.190 -28.071 1.00 114.36 ? 235 LEU B CA    1 
ATOM   3400  C C     . LEU B  2 235 ? 16.040  -22.634 -29.483 1.00 114.70 ? 235 LEU B C     1 
ATOM   3401  O O     . LEU B  2 235 ? 16.871  -22.778 -30.380 1.00 114.16 ? 235 LEU B O     1 
ATOM   3402  C CB    . LEU B  2 235 ? 17.623  -23.162 -27.546 1.00 114.69 ? 235 LEU B CB    1 
ATOM   3403  C CG    . LEU B  2 235 ? 19.087  -22.708 -27.618 1.00 119.68 ? 235 LEU B CG    1 
ATOM   3404  C CD1   . LEU B  2 235 ? 19.994  -23.740 -26.966 1.00 119.85 ? 235 LEU B CD1   1 
ATOM   3405  C CD2   . LEU B  2 235 ? 19.541  -22.441 -29.047 1.00 121.08 ? 235 LEU B CD2   1 
ATOM   3406  N N     . GLY B  2 236 ? 14.735  -22.859 -29.672 1.00 108.09 ? 236 GLY B N     1 
ATOM   3407  C CA    . GLY B  2 236 ? 14.194  -23.371 -30.929 1.00 104.90 ? 236 GLY B CA    1 
ATOM   3408  C C     . GLY B  2 236 ? 14.028  -24.882 -30.895 1.00 104.32 ? 236 GLY B C     1 
ATOM   3409  O O     . GLY B  2 236 ? 13.034  -25.414 -31.399 1.00 103.58 ? 236 GLY B O     1 
ATOM   3410  N N     . GLY B  2 237 ? 15.005  -25.565 -30.297 1.00 97.43  ? 237 GLY B N     1 
ATOM   3411  C CA    . GLY B  2 237 ? 15.021  -27.010 -30.136 1.00 94.78  ? 237 GLY B CA    1 
ATOM   3412  C C     . GLY B  2 237 ? 16.402  -27.581 -30.403 1.00 93.60  ? 237 GLY B C     1 
ATOM   3413  O O     . GLY B  2 237 ? 17.172  -26.978 -31.160 1.00 91.56  ? 237 GLY B O     1 
ATOM   3414  N N     . PRO B  2 238 ? 16.764  -28.748 -29.815 1.00 88.24  ? 238 PRO B N     1 
ATOM   3415  C CA    . PRO B  2 238 ? 18.083  -29.335 -30.128 1.00 86.88  ? 238 PRO B CA    1 
ATOM   3416  C C     . PRO B  2 238 ? 18.193  -29.770 -31.592 1.00 85.98  ? 238 PRO B C     1 
ATOM   3417  O O     . PRO B  2 238 ? 17.185  -30.135 -32.197 1.00 84.19  ? 238 PRO B O     1 
ATOM   3418  C CB    . PRO B  2 238 ? 18.207  -30.530 -29.157 1.00 89.00  ? 238 PRO B CB    1 
ATOM   3419  C CG    . PRO B  2 238 ? 17.036  -30.467 -28.251 1.00 94.01  ? 238 PRO B CG    1 
ATOM   3420  C CD    . PRO B  2 238 ? 15.992  -29.608 -28.894 1.00 89.58  ? 238 PRO B CD    1 
ATOM   3421  N N     . SER B  2 239 ? 19.407  -29.696 -32.165 1.00 81.02  ? 239 SER B N     1 
ATOM   3422  C CA    . SER B  2 239 ? 19.656  -30.101 -33.558 1.00 79.47  ? 239 SER B CA    1 
ATOM   3423  C C     . SER B  2 239 ? 20.407  -31.438 -33.635 1.00 78.47  ? 239 SER B C     1 
ATOM   3424  O O     . SER B  2 239 ? 21.398  -31.645 -32.931 1.00 75.45  ? 239 SER B O     1 
ATOM   3425  C CB    . SER B  2 239 ? 20.421  -29.016 -34.311 1.00 84.53  ? 239 SER B CB    1 
ATOM   3426  O OG    . SER B  2 239 ? 19.535  -27.977 -34.691 1.00 98.46  ? 239 SER B OG    1 
ATOM   3427  N N     . VAL B  2 240 ? 19.927  -32.333 -34.515 1.00 74.25  ? 240 VAL B N     1 
ATOM   3428  C CA    . VAL B  2 240 ? 20.496  -33.670 -34.706 1.00 72.17  ? 240 VAL B CA    1 
ATOM   3429  C C     . VAL B  2 240 ? 21.203  -33.751 -36.055 1.00 72.88  ? 240 VAL B C     1 
ATOM   3430  O O     . VAL B  2 240 ? 20.629  -33.377 -37.089 1.00 69.30  ? 240 VAL B O     1 
ATOM   3431  C CB    . VAL B  2 240 ? 19.408  -34.766 -34.592 1.00 74.67  ? 240 VAL B CB    1 
ATOM   3432  C CG1   . VAL B  2 240 ? 20.026  -36.169 -34.725 1.00 73.84  ? 240 VAL B CG1   1 
ATOM   3433  C CG2   . VAL B  2 240 ? 18.636  -34.633 -33.274 1.00 75.12  ? 240 VAL B CG2   1 
ATOM   3434  N N     . PHE B  2 241 ? 22.431  -34.296 -36.032 1.00 70.35  ? 241 PHE B N     1 
ATOM   3435  C CA    . PHE B  2 241 ? 23.256  -34.530 -37.215 1.00 70.58  ? 241 PHE B CA    1 
ATOM   3436  C C     . PHE B  2 241 ? 23.725  -35.996 -37.249 1.00 70.96  ? 241 PHE B C     1 
ATOM   3437  O O     . PHE B  2 241 ? 24.464  -36.463 -36.364 1.00 70.10  ? 241 PHE B O     1 
ATOM   3438  C CB    . PHE B  2 241 ? 24.434  -33.551 -37.242 1.00 74.08  ? 241 PHE B CB    1 
ATOM   3439  C CG    . PHE B  2 241 ? 23.951  -32.122 -37.379 1.00 77.12  ? 241 PHE B CG    1 
ATOM   3440  C CD1   . PHE B  2 241 ? 23.426  -31.659 -38.585 1.00 80.55  ? 241 PHE B CD1   1 
ATOM   3441  C CD2   . PHE B  2 241 ? 23.937  -31.266 -36.283 1.00 80.56  ? 241 PHE B CD2   1 
ATOM   3442  C CE1   . PHE B  2 241 ? 22.980  -30.340 -38.714 1.00 81.75  ? 241 PHE B CE1   1 
ATOM   3443  C CE2   . PHE B  2 241 ? 23.484  -29.950 -36.411 1.00 83.97  ? 241 PHE B CE2   1 
ATOM   3444  C CZ    . PHE B  2 241 ? 23.010  -29.495 -37.626 1.00 81.63  ? 241 PHE B CZ    1 
ATOM   3445  N N     . LEU B  2 242 ? 23.263  -36.711 -38.280 1.00 65.08  ? 242 LEU B N     1 
ATOM   3446  C CA    . LEU B  2 242 ? 23.515  -38.132 -38.496 1.00 64.19  ? 242 LEU B CA    1 
ATOM   3447  C C     . LEU B  2 242 ? 24.545  -38.304 -39.628 1.00 68.81  ? 242 LEU B C     1 
ATOM   3448  O O     . LEU B  2 242 ? 24.277  -37.951 -40.779 1.00 66.33  ? 242 LEU B O     1 
ATOM   3449  C CB    . LEU B  2 242 ? 22.166  -38.796 -38.837 1.00 62.84  ? 242 LEU B CB    1 
ATOM   3450  C CG    . LEU B  2 242 ? 22.092  -40.304 -38.907 1.00 65.08  ? 242 LEU B CG    1 
ATOM   3451  C CD1   . LEU B  2 242 ? 22.576  -40.950 -37.632 1.00 64.13  ? 242 LEU B CD1   1 
ATOM   3452  C CD2   . LEU B  2 242 ? 20.661  -40.747 -39.190 1.00 65.69  ? 242 LEU B CD2   1 
ATOM   3453  N N     . PHE B  2 243 ? 25.742  -38.813 -39.274 1.00 68.25  ? 243 PHE B N     1 
ATOM   3454  C CA    . PHE B  2 243 ? 26.868  -38.993 -40.194 1.00 69.21  ? 243 PHE B CA    1 
ATOM   3455  C C     . PHE B  2 243 ? 27.032  -40.461 -40.729 1.00 72.69  ? 243 PHE B C     1 
ATOM   3456  O O     . PHE B  2 243 ? 26.906  -41.414 -39.951 1.00 71.18  ? 243 PHE B O     1 
ATOM   3457  C CB    . PHE B  2 243 ? 28.168  -38.552 -39.504 1.00 72.35  ? 243 PHE B CB    1 
ATOM   3458  C CG    . PHE B  2 243 ? 28.136  -37.097 -39.110 1.00 75.28  ? 243 PHE B CG    1 
ATOM   3459  C CD1   . PHE B  2 243 ? 28.326  -36.101 -40.058 1.00 79.11  ? 243 PHE B CD1   1 
ATOM   3460  C CD2   . PHE B  2 243 ? 27.783  -36.719 -37.823 1.00 78.62  ? 243 PHE B CD2   1 
ATOM   3461  C CE1   . PHE B  2 243 ? 28.225  -34.755 -39.710 1.00 80.59  ? 243 PHE B CE1   1 
ATOM   3462  C CE2   . PHE B  2 243 ? 27.690  -35.370 -37.474 1.00 82.22  ? 243 PHE B CE2   1 
ATOM   3463  C CZ    . PHE B  2 243 ? 27.913  -34.398 -38.418 1.00 80.25  ? 243 PHE B CZ    1 
ATOM   3464  N N     . PRO B  2 244 ? 27.374  -40.634 -42.033 1.00 67.99  ? 244 PRO B N     1 
ATOM   3465  C CA    . PRO B  2 244 ? 27.630  -41.982 -42.555 1.00 67.62  ? 244 PRO B CA    1 
ATOM   3466  C C     . PRO B  2 244 ? 29.019  -42.531 -42.184 1.00 72.00  ? 244 PRO B C     1 
ATOM   3467  O O     . PRO B  2 244 ? 29.829  -41.816 -41.585 1.00 71.00  ? 244 PRO B O     1 
ATOM   3468  C CB    . PRO B  2 244 ? 27.479  -41.810 -44.069 1.00 68.68  ? 244 PRO B CB    1 
ATOM   3469  C CG    . PRO B  2 244 ? 27.697  -40.371 -44.340 1.00 73.18  ? 244 PRO B CG    1 
ATOM   3470  C CD    . PRO B  2 244 ? 27.624  -39.604 -43.062 1.00 69.41  ? 244 PRO B CD    1 
ATOM   3471  N N     . PRO B  2 245 ? 29.316  -43.813 -42.502 1.00 69.64  ? 245 PRO B N     1 
ATOM   3472  C CA    . PRO B  2 245 ? 30.645  -44.344 -42.171 1.00 71.49  ? 245 PRO B CA    1 
ATOM   3473  C C     . PRO B  2 245 ? 31.760  -43.734 -43.032 1.00 81.28  ? 245 PRO B C     1 
ATOM   3474  O O     . PRO B  2 245 ? 31.580  -43.540 -44.232 1.00 79.94  ? 245 PRO B O     1 
ATOM   3475  C CB    . PRO B  2 245 ? 30.492  -45.864 -42.367 1.00 72.30  ? 245 PRO B CB    1 
ATOM   3476  C CG    . PRO B  2 245 ? 29.064  -46.097 -42.704 1.00 74.77  ? 245 PRO B CG    1 
ATOM   3477  C CD    . PRO B  2 245 ? 28.487  -44.829 -43.180 1.00 69.50  ? 245 PRO B CD    1 
ATOM   3478  N N     . LYS B  2 246 ? 32.887  -43.371 -42.387 1.00 84.45  ? 246 LYS B N     1 
ATOM   3479  C CA    . LYS B  2 246 ? 34.088  -42.795 -43.023 1.00 87.09  ? 246 LYS B CA    1 
ATOM   3480  C C     . LYS B  2 246 ? 35.260  -43.009 -42.013 1.00 99.50  ? 246 LYS B C     1 
ATOM   3481  O O     . LYS B  2 246 ? 35.555  -44.192 -41.822 1.00 98.37  ? 246 LYS B O     1 
ATOM   3482  C CB    . LYS B  2 246 ? 33.851  -41.355 -43.515 1.00 87.88  ? 246 LYS B CB    1 
ATOM   3483  N N     . PRO B  2 247 ? 35.889  -42.047 -41.266 1.00 104.02 ? 247 PRO B N     1 
ATOM   3484  C CA    . PRO B  2 247 ? 35.786  -40.574 -41.272 1.00 105.82 ? 247 PRO B CA    1 
ATOM   3485  C C     . PRO B  2 247 ? 36.818  -39.954 -42.240 1.00 113.21 ? 247 PRO B C     1 
ATOM   3486  O O     . PRO B  2 247 ? 36.459  -39.573 -43.353 1.00 112.24 ? 247 PRO B O     1 
ATOM   3487  C CB    . PRO B  2 247 ? 36.023  -40.215 -39.789 1.00 108.61 ? 247 PRO B CB    1 
ATOM   3488  C CG    . PRO B  2 247 ? 36.810  -41.406 -39.191 1.00 113.36 ? 247 PRO B CG    1 
ATOM   3489  C CD    . PRO B  2 247 ? 36.928  -42.452 -40.295 1.00 107.84 ? 247 PRO B CD    1 
ATOM   3490  N N     . LYS B  2 248 ? 38.102  -39.891 -41.829 1.00 113.02 ? 248 LYS B N     1 
ATOM   3491  C CA    . LYS B  2 248 ? 39.215  -39.367 -42.625 1.00 113.99 ? 248 LYS B CA    1 
ATOM   3492  C C     . LYS B  2 248 ? 40.539  -39.962 -42.048 1.00 120.72 ? 248 LYS B C     1 
ATOM   3493  O O     . LYS B  2 248 ? 40.499  -40.906 -41.254 1.00 120.23 ? 248 LYS B O     1 
ATOM   3494  C CB    . LYS B  2 248 ? 39.191  -37.814 -42.581 1.00 116.18 ? 248 LYS B CB    1 
ATOM   3495  C CG    . LYS B  2 248 ? 38.660  -37.145 -43.857 1.00 123.65 ? 248 LYS B CG    1 
ATOM   3496  C CD    . LYS B  2 248 ? 39.601  -37.274 -45.070 1.00 129.29 ? 248 LYS B CD    1 
ATOM   3497  C CE    . LYS B  2 248 ? 40.369  -36.015 -45.394 1.00 135.16 ? 248 LYS B CE    1 
ATOM   3498  N NZ    . LYS B  2 248 ? 41.222  -35.553 -44.265 1.00 143.49 ? 248 LYS B NZ    1 
ATOM   3499  N N     . ASP B  2 249 ? 41.688  -39.445 -42.493 1.00 119.77 ? 249 ASP B N     1 
ATOM   3500  C CA    . ASP B  2 249 ? 43.046  -39.755 -42.022 1.00 121.64 ? 249 ASP B CA    1 
ATOM   3501  C C     . ASP B  2 249 ? 43.617  -41.172 -42.345 1.00 125.87 ? 249 ASP B C     1 
ATOM   3502  O O     . ASP B  2 249 ? 44.460  -41.245 -43.248 1.00 125.47 ? 249 ASP B O     1 
ATOM   3503  C CB    . ASP B  2 249 ? 43.214  -39.468 -40.506 1.00 124.58 ? 249 ASP B CB    1 
ATOM   3504  C CG    . ASP B  2 249 ? 43.684  -38.054 -40.191 1.00 136.26 ? 249 ASP B CG    1 
ATOM   3505  O OD1   . ASP B  2 249 ? 43.243  -37.107 -40.890 1.00 136.33 ? 249 ASP B OD1   1 
ATOM   3506  O OD2   . ASP B  2 249 ? 44.487  -37.894 -39.243 1.00 143.46 ? 249 ASP B OD2   1 
ATOM   3507  N N     . THR B  2 250 ? 43.292  -42.250 -41.575 1.00 122.53 ? 250 THR B N     1 
ATOM   3508  C CA    . THR B  2 250 ? 44.032  -43.516 -41.756 1.00 122.71 ? 250 THR B CA    1 
ATOM   3509  C C     . THR B  2 250 ? 43.304  -44.886 -41.580 1.00 125.14 ? 250 THR B C     1 
ATOM   3510  O O     . THR B  2 250 ? 42.110  -44.971 -41.307 1.00 123.54 ? 250 THR B O     1 
ATOM   3511  C CB    . THR B  2 250 ? 45.232  -43.490 -40.754 1.00 131.37 ? 250 THR B CB    1 
ATOM   3512  O OG1   . THR B  2 250 ? 45.071  -42.412 -39.823 1.00 127.30 ? 250 THR B OG1   1 
ATOM   3513  C CG2   . THR B  2 250 ? 46.580  -43.344 -41.459 1.00 132.02 ? 250 THR B CG2   1 
ATOM   3514  N N     . LEU B  2 251 ? 44.118  -45.956 -41.791 1.00 122.05 ? 251 LEU B N     1 
ATOM   3515  C CA    . LEU B  2 251 ? 43.839  -47.412 -41.701 1.00 121.67 ? 251 LEU B CA    1 
ATOM   3516  C C     . LEU B  2 251 ? 43.522  -47.886 -40.223 1.00 126.03 ? 251 LEU B C     1 
ATOM   3517  O O     . LEU B  2 251 ? 43.356  -47.015 -39.368 1.00 126.11 ? 251 LEU B O     1 
ATOM   3518  C CB    . LEU B  2 251 ? 45.091  -48.156 -42.274 1.00 122.40 ? 251 LEU B CB    1 
ATOM   3519  C CG    . LEU B  2 251 ? 44.917  -48.881 -43.623 1.00 126.44 ? 251 LEU B CG    1 
ATOM   3520  C CD1   . LEU B  2 251 ? 45.341  -47.987 -44.796 1.00 126.72 ? 251 LEU B CD1   1 
ATOM   3521  C CD2   . LEU B  2 251 ? 45.698  -50.203 -43.647 1.00 129.26 ? 251 LEU B CD2   1 
ATOM   3522  N N     . MET B  2 252 ? 43.425  -49.223 -39.881 1.00 121.91 ? 252 MET B N     1 
ATOM   3523  C CA    . MET B  2 252 ? 43.557  -50.468 -40.671 1.00 120.77 ? 252 MET B CA    1 
ATOM   3524  C C     . MET B  2 252 ? 42.330  -51.361 -40.421 1.00 122.31 ? 252 MET B C     1 
ATOM   3525  O O     . MET B  2 252 ? 41.408  -51.316 -41.231 1.00 121.35 ? 252 MET B O     1 
ATOM   3526  C CB    . MET B  2 252 ? 44.876  -51.209 -40.335 1.00 124.00 ? 252 MET B CB    1 
ATOM   3527  N N     . ILE B  2 253 ? 42.303  -52.151 -39.318 1.00 117.49 ? 253 ILE B N     1 
ATOM   3528  C CA    . ILE B  2 253 ? 41.148  -52.959 -38.915 1.00 115.75 ? 253 ILE B CA    1 
ATOM   3529  C C     . ILE B  2 253 ? 40.477  -52.271 -37.712 1.00 118.86 ? 253 ILE B C     1 
ATOM   3530  O O     . ILE B  2 253 ? 39.600  -52.864 -37.085 1.00 118.09 ? 253 ILE B O     1 
ATOM   3531  C CB    . ILE B  2 253 ? 41.567  -54.399 -38.561 1.00 20.00  ? 253 ILE B CB    1 
ATOM   3532  N N     . SER B  2 254 ? 40.897  -51.010 -37.404 1.00 114.81 ? 254 SER B N     1 
ATOM   3533  C CA    . SER B  2 254 ? 40.337  -50.163 -36.355 1.00 113.87 ? 254 SER B CA    1 
ATOM   3534  C C     . SER B  2 254 ? 40.280  -48.683 -36.863 1.00 115.01 ? 254 SER B C     1 
ATOM   3535  O O     . SER B  2 254 ? 41.062  -47.860 -36.375 1.00 115.87 ? 254 SER B O     1 
ATOM   3536  C CB    . SER B  2 254 ? 41.163  -50.258 -35.070 1.00 20.00  ? 254 SER B CB    1 
ATOM   3537  O OG    . SER B  2 254 ? 42.481  -49.780 -35.275 1.00 20.00  ? 254 SER B OG    1 
ATOM   3538  N N     . ARG B  2 255 ? 39.416  -48.311 -37.855 1.00 107.10 ? 255 ARG B N     1 
ATOM   3539  C CA    . ARG B  2 255 ? 38.409  -49.088 -38.604 1.00 103.79 ? 255 ARG B CA    1 
ATOM   3540  C C     . ARG B  2 255 ? 37.278  -49.644 -37.723 1.00 102.07 ? 255 ARG B C     1 
ATOM   3541  O O     . ARG B  2 255 ? 37.238  -49.353 -36.533 1.00 102.80 ? 255 ARG B O     1 
ATOM   3542  C CB    . ARG B  2 255 ? 39.089  -50.240 -39.346 1.00 20.00  ? 255 ARG B CB    1 
ATOM   3543  N N     . THR B  2 256 ? 36.347  -50.405 -38.344 1.00 92.61  ? 256 THR B N     1 
ATOM   3544  C CA    . THR B  2 256 ? 35.058  -50.886 -37.841 1.00 89.22  ? 256 THR B CA    1 
ATOM   3545  C C     . THR B  2 256 ? 34.101  -49.745 -38.202 1.00 85.86  ? 256 THR B C     1 
ATOM   3546  O O     . THR B  2 256 ? 33.963  -48.787 -37.453 1.00 84.02  ? 256 THR B O     1 
ATOM   3547  C CB    . THR B  2 256 ? 35.035  -51.469 -36.385 1.00 97.94  ? 256 THR B CB    1 
ATOM   3548  O OG1   . THR B  2 256 ? 33.962  -52.415 -36.330 1.00 92.80  ? 256 THR B OG1   1 
ATOM   3549  C CG2   . THR B  2 256 ? 34.764  -50.436 -35.265 1.00 99.27  ? 256 THR B CG2   1 
ATOM   3550  N N     . PRO B  2 257 ? 33.585  -49.731 -39.446 1.00 79.36  ? 257 PRO B N     1 
ATOM   3551  C CA    . PRO B  2 257 ? 32.721  -48.616 -39.866 1.00 77.36  ? 257 PRO B CA    1 
ATOM   3552  C C     . PRO B  2 257 ? 31.489  -48.437 -38.984 1.00 76.04  ? 257 PRO B C     1 
ATOM   3553  O O     . PRO B  2 257 ? 30.895  -49.404 -38.500 1.00 72.68  ? 257 PRO B O     1 
ATOM   3554  C CB    . PRO B  2 257 ? 32.380  -48.939 -41.324 1.00 78.71  ? 257 PRO B CB    1 
ATOM   3555  C CG    . PRO B  2 257 ? 33.354  -49.976 -41.734 1.00 84.06  ? 257 PRO B CG    1 
ATOM   3556  C CD    . PRO B  2 257 ? 33.709  -50.739 -40.516 1.00 80.70  ? 257 PRO B CD    1 
ATOM   3557  N N     . GLU B  2 258 ? 31.166  -47.171 -38.722 1.00 72.05  ? 258 GLU B N     1 
ATOM   3558  C CA    . GLU B  2 258 ? 30.115  -46.791 -37.796 1.00 70.68  ? 258 GLU B CA    1 
ATOM   3559  C C     . GLU B  2 258 ? 29.273  -45.656 -38.337 1.00 71.23  ? 258 GLU B C     1 
ATOM   3560  O O     . GLU B  2 258 ? 29.775  -44.791 -39.038 1.00 68.47  ? 258 GLU B O     1 
ATOM   3561  C CB    . GLU B  2 258 ? 30.784  -46.339 -36.485 1.00 72.82  ? 258 GLU B CB    1 
ATOM   3562  C CG    . GLU B  2 258 ? 31.241  -47.490 -35.601 1.00 82.03  ? 258 GLU B CG    1 
ATOM   3563  C CD    . GLU B  2 258 ? 32.385  -47.206 -34.642 1.00 98.85  ? 258 GLU B CD    1 
ATOM   3564  O OE1   . GLU B  2 258 ? 32.922  -46.072 -34.651 1.00 83.44  ? 258 GLU B OE1   1 
ATOM   3565  O OE2   . GLU B  2 258 ? 32.727  -48.123 -33.858 1.00 80.02  ? 258 GLU B OE2   1 
ATOM   3566  N N     . VAL B  2 259 ? 27.990  -45.664 -38.004 1.00 68.79  ? 259 VAL B N     1 
ATOM   3567  C CA    . VAL B  2 259 ? 27.070  -44.575 -38.322 1.00 68.38  ? 259 VAL B CA    1 
ATOM   3568  C C     . VAL B  2 259 ? 27.087  -43.745 -37.025 1.00 71.99  ? 259 VAL B C     1 
ATOM   3569  O O     . VAL B  2 259 ? 27.024  -44.329 -35.941 1.00 72.64  ? 259 VAL B O     1 
ATOM   3570  C CB    . VAL B  2 259 ? 25.671  -45.112 -38.710 1.00 72.12  ? 259 VAL B CB    1 
ATOM   3571  C CG1   . VAL B  2 259 ? 24.657  -43.980 -38.842 1.00 71.84  ? 259 VAL B CG1   1 
ATOM   3572  C CG2   . VAL B  2 259 ? 25.759  -45.895 -40.020 1.00 71.88  ? 259 VAL B CG2   1 
ATOM   3573  N N     . THR B  2 260 ? 27.289  -42.427 -37.120 1.00 68.31  ? 260 THR B N     1 
ATOM   3574  C CA    . THR B  2 260 ? 27.397  -41.558 -35.931 1.00 69.28  ? 260 THR B CA    1 
ATOM   3575  C C     . THR B  2 260 ? 26.226  -40.565 -35.841 1.00 71.11  ? 260 THR B C     1 
ATOM   3576  O O     . THR B  2 260 ? 25.946  -39.866 -36.804 1.00 69.84  ? 260 THR B O     1 
ATOM   3577  C CB    . THR B  2 260 ? 28.767  -40.842 -35.893 1.00 79.47  ? 260 THR B CB    1 
ATOM   3578  O OG1   . THR B  2 260 ? 29.814  -41.808 -36.041 1.00 80.00  ? 260 THR B OG1   1 
ATOM   3579  C CG2   . THR B  2 260 ? 28.977  -40.065 -34.602 1.00 80.82  ? 260 THR B CG2   1 
ATOM   3580  N N     . CYS B  2 261 ? 25.554  -40.512 -34.680 1.00 67.36  ? 261 CYS B N     1 
ATOM   3581  C CA    . CYS B  2 261 ? 24.467  -39.568 -34.413 1.00 66.81  ? 261 CYS B CA    1 
ATOM   3582  C C     . CYS B  2 261 ? 24.998  -38.558 -33.412 1.00 70.96  ? 261 CYS B C     1 
ATOM   3583  O O     . CYS B  2 261 ? 25.457  -38.957 -32.339 1.00 69.90  ? 261 CYS B O     1 
ATOM   3584  C CB    . CYS B  2 261 ? 23.236  -40.278 -33.868 1.00 66.13  ? 261 CYS B CB    1 
ATOM   3585  S SG    . CYS B  2 261 ? 21.701  -39.342 -34.055 1.00 69.26  ? 261 CYS B SG    1 
ATOM   3586  N N     . VAL B  2 262 ? 24.985  -37.269 -33.776 1.00 69.40  ? 262 VAL B N     1 
ATOM   3587  C CA    . VAL B  2 262 ? 25.455  -36.204 -32.885 1.00 71.99  ? 262 VAL B CA    1 
ATOM   3588  C C     . VAL B  2 262 ? 24.342  -35.169 -32.684 1.00 77.15  ? 262 VAL B C     1 
ATOM   3589  O O     . VAL B  2 262 ? 23.698  -34.732 -33.644 1.00 74.22  ? 262 VAL B O     1 
ATOM   3590  C CB    . VAL B  2 262 ? 26.757  -35.548 -33.395 1.00 76.64  ? 262 VAL B CB    1 
ATOM   3591  C CG1   . VAL B  2 262 ? 27.294  -34.549 -32.371 1.00 78.00  ? 262 VAL B CG1   1 
ATOM   3592  C CG2   . VAL B  2 262 ? 27.803  -36.604 -33.733 1.00 76.33  ? 262 VAL B CG2   1 
ATOM   3593  N N     . VAL B  2 263 ? 24.122  -34.784 -31.422 1.00 77.51  ? 263 VAL B N     1 
ATOM   3594  C CA    . VAL B  2 263 ? 23.085  -33.822 -31.069 1.00 78.40  ? 263 VAL B CA    1 
ATOM   3595  C C     . VAL B  2 263 ? 23.702  -32.660 -30.371 1.00 82.78  ? 263 VAL B C     1 
ATOM   3596  O O     . VAL B  2 263 ? 24.505  -32.844 -29.455 1.00 82.97  ? 263 VAL B O     1 
ATOM   3597  C CB    . VAL B  2 263 ? 22.001  -34.451 -30.188 1.00 83.48  ? 263 VAL B CB    1 
ATOM   3598  C CG1   . VAL B  2 263 ? 20.812  -33.506 -30.037 1.00 83.14  ? 263 VAL B CG1   1 
ATOM   3599  C CG2   . VAL B  2 263 ? 21.558  -35.772 -30.785 1.00 83.33  ? 263 VAL B CG2   1 
ATOM   3600  N N     . VAL B  2 264 ? 23.280  -31.466 -30.777 1.00 79.61  ? 264 VAL B N     1 
ATOM   3601  C CA    . VAL B  2 264 ? 23.732  -30.188 -30.218 1.00 80.38  ? 264 VAL B CA    1 
ATOM   3602  C C     . VAL B  2 264 ? 22.499  -29.315 -29.873 1.00 83.72  ? 264 VAL B C     1 
ATOM   3603  O O     . VAL B  2 264 ? 21.360  -29.686 -30.202 1.00 80.74  ? 264 VAL B O     1 
ATOM   3604  C CB    . VAL B  2 264 ? 24.722  -29.463 -31.178 1.00 83.34  ? 264 VAL B CB    1 
ATOM   3605  C CG1   . VAL B  2 264 ? 26.033  -30.240 -31.295 1.00 83.22  ? 264 VAL B CG1   1 
ATOM   3606  C CG2   . VAL B  2 264 ? 24.102  -29.229 -32.549 1.00 81.57  ? 264 VAL B CG2   1 
ATOM   3607  N N     . ASP B  2 265 ? 22.746  -28.168 -29.183 1.00 81.65  ? 265 ASP B N     1 
ATOM   3608  C CA    . ASP B  2 265 ? 21.726  -27.216 -28.735 1.00 81.21  ? 265 ASP B CA    1 
ATOM   3609  C C     . ASP B  2 265 ? 20.760  -27.873 -27.728 1.00 86.14  ? 265 ASP B C     1 
ATOM   3610  O O     . ASP B  2 265 ? 19.552  -27.600 -27.717 1.00 83.46  ? 265 ASP B O     1 
ATOM   3611  C CB    . ASP B  2 265 ? 21.020  -26.532 -29.925 1.00 81.53  ? 265 ASP B CB    1 
ATOM   3612  C CG    . ASP B  2 265 ? 21.949  -25.679 -30.786 1.00 90.96  ? 265 ASP B CG    1 
ATOM   3613  O OD1   . ASP B  2 265 ? 23.002  -25.231 -30.267 1.00 92.50  ? 265 ASP B OD1   1 
ATOM   3614  O OD2   . ASP B  2 265 ? 21.617  -25.450 -31.975 1.00 93.80  ? 265 ASP B OD2   1 
ATOM   3615  N N     . VAL B  2 266 ? 21.356  -28.714 -26.843 1.00 85.82  ? 266 VAL B N     1 
ATOM   3616  C CA    . VAL B  2 266 ? 20.688  -29.430 -25.755 1.00 86.99  ? 266 VAL B CA    1 
ATOM   3617  C C     . VAL B  2 266 ? 20.979  -28.545 -24.557 1.00 94.36  ? 266 VAL B C     1 
ATOM   3618  O O     . VAL B  2 266 ? 22.146  -28.270 -24.290 1.00 94.11  ? 266 VAL B O     1 
ATOM   3619  C CB    . VAL B  2 266 ? 21.252  -30.870 -25.570 1.00 90.73  ? 266 VAL B CB    1 
ATOM   3620  C CG1   . VAL B  2 266 ? 20.730  -31.521 -24.289 1.00 91.16  ? 266 VAL B CG1   1 
ATOM   3621  C CG2   . VAL B  2 266 ? 20.939  -31.742 -26.787 1.00 88.90  ? 266 VAL B CG2   1 
ATOM   3622  N N     . SER B  2 267 ? 19.932  -28.056 -23.876 1.00 93.86  ? 267 SER B N     1 
ATOM   3623  C CA    . SER B  2 267 ? 20.074  -27.125 -22.751 1.00 95.84  ? 267 SER B CA    1 
ATOM   3624  C C     . SER B  2 267 ? 20.645  -27.748 -21.472 1.00 102.77 ? 267 SER B C     1 
ATOM   3625  O O     . SER B  2 267 ? 20.690  -28.972 -21.326 1.00 101.35 ? 267 SER B O     1 
ATOM   3626  C CB    . SER B  2 267 ? 18.731  -26.463 -22.449 1.00 98.97  ? 267 SER B CB    1 
ATOM   3627  O OG    . SER B  2 267 ? 17.733  -27.422 -22.148 1.00 105.68 ? 267 SER B OG    1 
ATOM   3628  N N     . GLN B  2 268 ? 21.075  -26.871 -20.548 1.00 103.31 ? 268 GLN B N     1 
ATOM   3629  C CA    . GLN B  2 268 ? 21.618  -27.251 -19.236 1.00 105.59 ? 268 GLN B CA    1 
ATOM   3630  C C     . GLN B  2 268 ? 20.487  -27.591 -18.247 1.00 112.56 ? 268 GLN B C     1 
ATOM   3631  O O     . GLN B  2 268 ? 20.706  -28.393 -17.336 1.00 112.83 ? 268 GLN B O     1 
ATOM   3632  C CB    . GLN B  2 268 ? 22.513  -26.138 -18.660 1.00 108.35 ? 268 GLN B CB    1 
ATOM   3633  N N     . GLU B  2 269 ? 19.296  -26.958 -18.403 1.00 110.70 ? 269 GLU B N     1 
ATOM   3634  C CA    . GLU B  2 269 ? 18.117  -27.252 -17.564 1.00 111.69 ? 269 GLU B CA    1 
ATOM   3635  C C     . GLU B  2 269 ? 17.437  -28.568 -17.978 1.00 114.89 ? 269 GLU B C     1 
ATOM   3636  O O     . GLU B  2 269 ? 16.759  -29.181 -17.150 1.00 114.71 ? 269 GLU B O     1 
ATOM   3637  C CB    . GLU B  2 269 ? 17.096  -26.089 -17.523 1.00 113.45 ? 269 GLU B CB    1 
ATOM   3638  C CG    . GLU B  2 269 ? 16.622  -25.544 -18.863 1.00 121.65 ? 269 GLU B CG    1 
ATOM   3639  C CD    . GLU B  2 269 ? 17.099  -24.129 -19.146 1.00 138.18 ? 269 GLU B CD    1 
ATOM   3640  O OE1   . GLU B  2 269 ? 16.421  -23.174 -18.702 1.00 128.41 ? 269 GLU B OE1   1 
ATOM   3641  O OE2   . GLU B  2 269 ? 18.173  -23.976 -19.772 1.00 128.10 ? 269 GLU B OE2   1 
ATOM   3642  N N     . ASP B  2 270 ? 17.639  -29.011 -19.239 1.00 110.45 ? 270 ASP B N     1 
ATOM   3643  C CA    . ASP B  2 270 ? 17.129  -30.286 -19.764 1.00 109.27 ? 270 ASP B CA    1 
ATOM   3644  C C     . ASP B  2 270 ? 18.313  -31.037 -20.419 1.00 110.14 ? 270 ASP B C     1 
ATOM   3645  O O     . ASP B  2 270 ? 18.402  -31.104 -21.650 1.00 107.82 ? 270 ASP B O     1 
ATOM   3646  C CB    . ASP B  2 270 ? 15.976  -30.047 -20.769 1.00 110.43 ? 270 ASP B CB    1 
ATOM   3647  C CG    . ASP B  2 270 ? 14.782  -29.331 -20.156 1.00 122.81 ? 270 ASP B CG    1 
ATOM   3648  O OD1   . ASP B  2 270 ? 14.135  -29.917 -19.256 1.00 124.52 ? 270 ASP B OD1   1 
ATOM   3649  O OD2   . ASP B  2 270 ? 14.502  -28.179 -20.565 1.00 126.61 ? 270 ASP B OD2   1 
ATOM   3650  N N     . PRO B  2 271 ? 19.247  -31.586 -19.603 1.00 106.23 ? 271 PRO B N     1 
ATOM   3651  C CA    . PRO B  2 271 ? 20.417  -32.275 -20.175 1.00 105.19 ? 271 PRO B CA    1 
ATOM   3652  C C     . PRO B  2 271 ? 20.189  -33.732 -20.607 1.00 107.43 ? 271 PRO B C     1 
ATOM   3653  O O     . PRO B  2 271 ? 20.804  -34.171 -21.578 1.00 105.61 ? 271 PRO B O     1 
ATOM   3654  C CB    . PRO B  2 271 ? 21.439  -32.196 -19.037 1.00 108.08 ? 271 PRO B CB    1 
ATOM   3655  C CG    . PRO B  2 271 ? 20.622  -32.246 -17.812 1.00 113.14 ? 271 PRO B CG    1 
ATOM   3656  C CD    . PRO B  2 271 ? 19.309  -31.575 -18.126 1.00 108.53 ? 271 PRO B CD    1 
ATOM   3657  N N     . GLU B  2 272 ? 19.359  -34.495 -19.864 1.00 104.05 ? 272 GLU B N     1 
ATOM   3658  C CA    . GLU B  2 272 ? 19.132  -35.920 -20.140 1.00 102.56 ? 272 GLU B CA    1 
ATOM   3659  C C     . GLU B  2 272 ? 18.604  -36.175 -21.557 1.00 102.69 ? 272 GLU B C     1 
ATOM   3660  O O     . GLU B  2 272 ? 17.539  -35.679 -21.926 1.00 102.44 ? 272 GLU B O     1 
ATOM   3661  C CB    . GLU B  2 272 ? 18.213  -36.559 -19.077 1.00 104.49 ? 272 GLU B CB    1 
ATOM   3662  N N     . VAL B  2 273 ? 19.386  -36.930 -22.352 1.00 95.67  ? 273 VAL B N     1 
ATOM   3663  C CA    . VAL B  2 273 ? 19.054  -37.295 -23.729 1.00 92.61  ? 273 VAL B CA    1 
ATOM   3664  C C     . VAL B  2 273 ? 19.029  -38.830 -23.851 1.00 91.06  ? 273 VAL B C     1 
ATOM   3665  O O     . VAL B  2 273 ? 19.837  -39.528 -23.216 1.00 91.80  ? 273 VAL B O     1 
ATOM   3666  C CB    . VAL B  2 273 ? 20.062  -36.641 -24.727 1.00 96.43  ? 273 VAL B CB    1 
ATOM   3667  C CG1   . VAL B  2 273 ? 20.015  -37.297 -26.110 1.00 95.03  ? 273 VAL B CG1   1 
ATOM   3668  C CG2   . VAL B  2 273 ? 19.804  -35.142 -24.852 1.00 96.53  ? 273 VAL B CG2   1 
ATOM   3669  N N     . GLN B  2 274 ? 18.079  -39.339 -24.664 1.00 81.41  ? 274 GLN B N     1 
ATOM   3670  C CA    . GLN B  2 274 ? 17.934  -40.753 -24.990 1.00 78.22  ? 274 GLN B CA    1 
ATOM   3671  C C     . GLN B  2 274 ? 18.087  -40.904 -26.514 1.00 77.56  ? 274 GLN B C     1 
ATOM   3672  O O     . GLN B  2 274 ? 17.578  -40.069 -27.270 1.00 77.23  ? 274 GLN B O     1 
ATOM   3673  C CB    . GLN B  2 274 ? 16.562  -41.282 -24.528 1.00 78.84  ? 274 GLN B CB    1 
ATOM   3674  C CG    . GLN B  2 274 ? 16.265  -42.709 -24.987 1.00 80.38  ? 274 GLN B CG    1 
ATOM   3675  C CD    . GLN B  2 274 ? 15.136  -43.361 -24.231 1.00 98.39  ? 274 GLN B CD    1 
ATOM   3676  O OE1   . GLN B  2 274 ? 14.052  -43.591 -24.785 1.00 89.66  ? 274 GLN B OE1   1 
ATOM   3677  N NE2   . GLN B  2 274 ? 15.391  -43.753 -22.974 1.00 87.69  ? 274 GLN B NE2   1 
ATOM   3678  N N     . PHE B  2 275 ? 18.782  -41.969 -26.955 1.00 70.15  ? 275 PHE B N     1 
ATOM   3679  C CA    . PHE B  2 275 ? 18.991  -42.280 -28.377 1.00 66.73  ? 275 PHE B CA    1 
ATOM   3680  C C     . PHE B  2 275 ? 18.304  -43.594 -28.723 1.00 67.37  ? 275 PHE B C     1 
ATOM   3681  O O     . PHE B  2 275 ? 18.465  -44.574 -27.999 1.00 66.34  ? 275 PHE B O     1 
ATOM   3682  C CB    . PHE B  2 275 ? 20.487  -42.413 -28.690 1.00 67.91  ? 275 PHE B CB    1 
ATOM   3683  C CG    . PHE B  2 275 ? 21.234  -41.113 -28.839 1.00 69.29  ? 275 PHE B CG    1 
ATOM   3684  C CD1   . PHE B  2 275 ? 21.185  -40.403 -30.023 1.00 70.58  ? 275 PHE B CD1   1 
ATOM   3685  C CD2   . PHE B  2 275 ? 22.059  -40.650 -27.829 1.00 72.98  ? 275 PHE B CD2   1 
ATOM   3686  C CE1   . PHE B  2 275 ? 21.901  -39.223 -30.178 1.00 71.66  ? 275 PHE B CE1   1 
ATOM   3687  C CE2   . PHE B  2 275 ? 22.804  -39.487 -27.998 1.00 75.90  ? 275 PHE B CE2   1 
ATOM   3688  C CZ    . PHE B  2 275 ? 22.722  -38.781 -29.176 1.00 72.65  ? 275 PHE B CZ    1 
ATOM   3689  N N     . ASN B  2 276 ? 17.536  -43.610 -29.816 1.00 62.10  ? 276 ASN B N     1 
ATOM   3690  C CA    . ASN B  2 276 ? 16.880  -44.812 -30.317 1.00 61.42  ? 276 ASN B CA    1 
ATOM   3691  C C     . ASN B  2 276 ? 17.346  -45.015 -31.763 1.00 63.34  ? 276 ASN B C     1 
ATOM   3692  O O     . ASN B  2 276 ? 17.292  -44.078 -32.569 1.00 61.51  ? 276 ASN B O     1 
ATOM   3693  C CB    . ASN B  2 276 ? 15.351  -44.725 -30.225 1.00 64.42  ? 276 ASN B CB    1 
ATOM   3694  C CG    . ASN B  2 276 ? 14.838  -44.864 -28.809 1.00 85.03  ? 276 ASN B CG    1 
ATOM   3695  O OD1   . ASN B  2 276 ? 14.977  -43.957 -27.995 1.00 75.51  ? 276 ASN B OD1   1 
ATOM   3696  N ND2   . ASN B  2 276 ? 14.239  -45.998 -28.468 1.00 79.89  ? 276 ASN B ND2   1 
ATOM   3697  N N     . TRP B  2 277 ? 17.828  -46.235 -32.073 1.00 58.99  ? 277 TRP B N     1 
ATOM   3698  C CA    . TRP B  2 277 ? 18.399  -46.578 -33.372 1.00 57.70  ? 277 TRP B CA    1 
ATOM   3699  C C     . TRP B  2 277 ? 17.555  -47.610 -34.099 1.00 58.61  ? 277 TRP B C     1 
ATOM   3700  O O     . TRP B  2 277 ? 17.221  -48.626 -33.508 1.00 59.27  ? 277 TRP B O     1 
ATOM   3701  C CB    . TRP B  2 277 ? 19.812  -47.135 -33.165 1.00 56.89  ? 277 TRP B CB    1 
ATOM   3702  C CG    . TRP B  2 277 ? 20.849  -46.104 -32.884 1.00 58.22  ? 277 TRP B CG    1 
ATOM   3703  C CD1   . TRP B  2 277 ? 21.327  -45.729 -31.665 1.00 62.45  ? 277 TRP B CD1   1 
ATOM   3704  C CD2   . TRP B  2 277 ? 21.610  -45.380 -33.855 1.00 57.71  ? 277 TRP B CD2   1 
ATOM   3705  N NE1   . TRP B  2 277 ? 22.344  -44.807 -31.815 1.00 62.48  ? 277 TRP B NE1   1 
ATOM   3706  C CE2   . TRP B  2 277 ? 22.540  -44.582 -33.153 1.00 62.74  ? 277 TRP B CE2   1 
ATOM   3707  C CE3   . TRP B  2 277 ? 21.592  -45.317 -35.256 1.00 57.75  ? 277 TRP B CE3   1 
ATOM   3708  C CZ2   . TRP B  2 277 ? 23.488  -43.801 -33.806 1.00 61.64  ? 277 TRP B CZ2   1 
ATOM   3709  C CZ3   . TRP B  2 277 ? 22.519  -44.518 -35.899 1.00 58.58  ? 277 TRP B CZ3   1 
ATOM   3710  C CH2   . TRP B  2 277 ? 23.453  -43.775 -35.179 1.00 59.73  ? 277 TRP B CH2   1 
ATOM   3711  N N     . TYR B  2 278 ? 17.222  -47.368 -35.375 1.00 52.31  ? 278 TYR B N     1 
ATOM   3712  C CA    . TYR B  2 278 ? 16.460  -48.323 -36.179 1.00 51.33  ? 278 TYR B CA    1 
ATOM   3713  C C     . TYR B  2 278 ? 17.221  -48.614 -37.496 1.00 53.79  ? 278 TYR B C     1 
ATOM   3714  O O     . TYR B  2 278 ? 17.805  -47.713 -38.095 1.00 52.73  ? 278 TYR B O     1 
ATOM   3715  C CB    . TYR B  2 278 ? 15.007  -47.841 -36.452 1.00 53.72  ? 278 TYR B CB    1 
ATOM   3716  C CG    . TYR B  2 278 ? 14.284  -47.319 -35.229 1.00 58.35  ? 278 TYR B CG    1 
ATOM   3717  C CD1   . TYR B  2 278 ? 14.552  -46.050 -34.728 1.00 61.03  ? 278 TYR B CD1   1 
ATOM   3718  C CD2   . TYR B  2 278 ? 13.403  -48.128 -34.515 1.00 59.89  ? 278 TYR B CD2   1 
ATOM   3719  C CE1   . TYR B  2 278 ? 13.982  -45.606 -33.537 1.00 64.08  ? 278 TYR B CE1   1 
ATOM   3720  C CE2   . TYR B  2 278 ? 12.801  -47.684 -33.338 1.00 61.21  ? 278 TYR B CE2   1 
ATOM   3721  C CZ    . TYR B  2 278 ? 13.085  -46.415 -32.855 1.00 71.01  ? 278 TYR B CZ    1 
ATOM   3722  O OH    . TYR B  2 278 ? 12.509  -45.940 -31.694 1.00 73.35  ? 278 TYR B OH    1 
ATOM   3723  N N     . VAL B  2 279 ? 17.288  -49.897 -37.889 1.00 50.91  ? 279 VAL B N     1 
ATOM   3724  C CA    . VAL B  2 279 ? 17.903  -50.325 -39.153 1.00 49.59  ? 279 VAL B CA    1 
ATOM   3725  C C     . VAL B  2 279 ? 16.727  -50.859 -39.936 1.00 52.21  ? 279 VAL B C     1 
ATOM   3726  O O     . VAL B  2 279 ? 16.147  -51.855 -39.530 1.00 52.64  ? 279 VAL B O     1 
ATOM   3727  C CB    . VAL B  2 279 ? 19.025  -51.353 -38.972 1.00 52.26  ? 279 VAL B CB    1 
ATOM   3728  C CG1   . VAL B  2 279 ? 19.602  -51.788 -40.329 1.00 52.01  ? 279 VAL B CG1   1 
ATOM   3729  C CG2   . VAL B  2 279 ? 20.119  -50.780 -38.094 1.00 52.29  ? 279 VAL B CG2   1 
ATOM   3730  N N     . ASP B  2 280 ? 16.325  -50.168 -40.994 1.00 48.14  ? 280 ASP B N     1 
ATOM   3731  C CA    . ASP B  2 280 ? 15.124  -50.498 -41.763 1.00 49.24  ? 280 ASP B CA    1 
ATOM   3732  C C     . ASP B  2 280 ? 13.856  -50.522 -40.869 1.00 57.61  ? 280 ASP B C     1 
ATOM   3733  O O     . ASP B  2 280 ? 13.010  -51.400 -40.986 1.00 56.83  ? 280 ASP B O     1 
ATOM   3734  C CB    . ASP B  2 280 ? 15.321  -51.795 -42.574 1.00 50.93  ? 280 ASP B CB    1 
ATOM   3735  C CG    . ASP B  2 280 ? 16.077  -51.609 -43.872 1.00 50.44  ? 280 ASP B CG    1 
ATOM   3736  O OD1   . ASP B  2 280 ? 16.397  -50.451 -44.218 1.00 46.29  ? 280 ASP B OD1   1 
ATOM   3737  O OD2   . ASP B  2 280 ? 16.324  -52.611 -44.549 1.00 54.41  ? 280 ASP B OD2   1 
ATOM   3738  N N     . GLY B  2 281 ? 13.774  -49.561 -39.953 1.00 58.87  ? 281 GLY B N     1 
ATOM   3739  C CA    . GLY B  2 281 ? 12.641  -49.424 -39.045 1.00 60.78  ? 281 GLY B CA    1 
ATOM   3740  C C     . GLY B  2 281 ? 12.508  -50.479 -37.971 1.00 66.61  ? 281 GLY B C     1 
ATOM   3741  O O     . GLY B  2 281 ? 11.445  -50.596 -37.360 1.00 67.71  ? 281 GLY B O     1 
ATOM   3742  N N     . VAL B  2 282 ? 13.574  -51.235 -37.723 1.00 62.66  ? 282 VAL B N     1 
ATOM   3743  C CA    . VAL B  2 282 ? 13.609  -52.308 -36.739 1.00 62.26  ? 282 VAL B CA    1 
ATOM   3744  C C     . VAL B  2 282 ? 14.557  -51.808 -35.694 1.00 64.74  ? 282 VAL B C     1 
ATOM   3745  O O     . VAL B  2 282 ? 15.727  -51.571 -36.008 1.00 62.35  ? 282 VAL B O     1 
ATOM   3746  C CB    . VAL B  2 282 ? 14.110  -53.645 -37.362 1.00 66.16  ? 282 VAL B CB    1 
ATOM   3747  C CG1   . VAL B  2 282 ? 14.337  -54.702 -36.296 1.00 65.79  ? 282 VAL B CG1   1 
ATOM   3748  C CG2   . VAL B  2 282 ? 13.141  -54.153 -38.422 1.00 65.97  ? 282 VAL B CG2   1 
ATOM   3749  N N     . GLU B  2 283 ? 14.081  -51.654 -34.459 1.00 63.45  ? 283 GLU B N     1 
ATOM   3750  C CA    . GLU B  2 283 ? 14.927  -51.129 -33.393 1.00 65.05  ? 283 GLU B CA    1 
ATOM   3751  C C     . GLU B  2 283 ? 16.092  -52.084 -33.081 1.00 68.35  ? 283 GLU B C     1 
ATOM   3752  O O     . GLU B  2 283 ? 15.907  -53.294 -33.001 1.00 68.24  ? 283 GLU B O     1 
ATOM   3753  C CB    . GLU B  2 283 ? 14.118  -50.798 -32.127 1.00 67.12  ? 283 GLU B CB    1 
ATOM   3754  C CG    . GLU B  2 283 ? 14.809  -49.778 -31.240 1.00 77.70  ? 283 GLU B CG    1 
ATOM   3755  C CD    . GLU B  2 283 ? 14.110  -49.436 -29.938 1.00 89.61  ? 283 GLU B CD    1 
ATOM   3756  O OE1   . GLU B  2 283 ? 14.803  -48.941 -29.019 1.00 77.83  ? 283 GLU B OE1   1 
ATOM   3757  O OE2   . GLU B  2 283 ? 12.878  -49.639 -29.838 1.00 80.30  ? 283 GLU B OE2   1 
ATOM   3758  N N     . VAL B  2 284 ? 17.285  -51.514 -32.934 1.00 64.71  ? 284 VAL B N     1 
ATOM   3759  C CA    . VAL B  2 284 ? 18.539  -52.223 -32.651 1.00 64.26  ? 284 VAL B CA    1 
ATOM   3760  C C     . VAL B  2 284 ? 19.086  -51.637 -31.344 1.00 71.95  ? 284 VAL B C     1 
ATOM   3761  O O     . VAL B  2 284 ? 18.767  -50.492 -31.013 1.00 71.06  ? 284 VAL B O     1 
ATOM   3762  C CB    . VAL B  2 284 ? 19.546  -52.134 -33.840 1.00 65.93  ? 284 VAL B CB    1 
ATOM   3763  C CG1   . VAL B  2 284 ? 18.973  -52.821 -35.080 1.00 63.83  ? 284 VAL B CG1   1 
ATOM   3764  C CG2   . VAL B  2 284 ? 19.952  -50.679 -34.161 1.00 65.61  ? 284 VAL B CG2   1 
ATOM   3765  N N     . HIS B  2 285 ? 19.873  -52.429 -30.597 1.00 72.10  ? 285 HIS B N     1 
ATOM   3766  C CA    . HIS B  2 285 ? 20.338  -52.072 -29.253 1.00 74.01  ? 285 HIS B CA    1 
ATOM   3767  C C     . HIS B  2 285 ? 21.849  -52.159 -29.040 1.00 82.23  ? 285 HIS B C     1 
ATOM   3768  O O     . HIS B  2 285 ? 22.296  -51.980 -27.907 1.00 83.87  ? 285 HIS B O     1 
ATOM   3769  C CB    . HIS B  2 285 ? 19.620  -52.987 -28.227 1.00 74.50  ? 285 HIS B CB    1 
ATOM   3770  C CG    . HIS B  2 285 ? 18.141  -53.086 -28.445 1.00 76.81  ? 285 HIS B CG    1 
ATOM   3771  N ND1   . HIS B  2 285 ? 17.282  -52.078 -28.038 1.00 78.71  ? 285 HIS B ND1   1 
ATOM   3772  C CD2   . HIS B  2 285 ? 17.424  -54.050 -29.069 1.00 77.79  ? 285 HIS B CD2   1 
ATOM   3773  C CE1   . HIS B  2 285 ? 16.071  -52.458 -28.422 1.00 77.68  ? 285 HIS B CE1   1 
ATOM   3774  N NE2   . HIS B  2 285 ? 16.110  -53.640 -29.053 1.00 77.45  ? 285 HIS B NE2   1 
ATOM   3775  N N     . ASN B  2 286 ? 22.638  -52.356 -30.103 1.00 79.67  ? 286 ASN B N     1 
ATOM   3776  C CA    . ASN B  2 286 ? 24.103  -52.484 -29.983 1.00 80.59  ? 286 ASN B CA    1 
ATOM   3777  C C     . ASN B  2 286 ? 24.862  -51.120 -29.961 1.00 85.53  ? 286 ASN B C     1 
ATOM   3778  O O     . ASN B  2 286 ? 26.087  -51.124 -29.810 1.00 85.20  ? 286 ASN B O     1 
ATOM   3779  C CB    . ASN B  2 286 ? 24.662  -53.428 -31.104 1.00 80.41  ? 286 ASN B CB    1 
ATOM   3780  C CG    . ASN B  2 286 ? 24.350  -53.033 -32.555 1.00 91.89  ? 286 ASN B CG    1 
ATOM   3781  O OD1   . ASN B  2 286 ? 23.192  -53.086 -33.008 1.00 81.00  ? 286 ASN B OD1   1 
ATOM   3782  N ND2   . ASN B  2 286 ? 25.372  -52.690 -33.342 1.00 77.36  ? 286 ASN B ND2   1 
ATOM   3783  N N     . ALA B  2 287 ? 24.150  -49.967 -30.057 1.00 82.88  ? 287 ALA B N     1 
ATOM   3784  C CA    . ALA B  2 287 ? 24.793  -48.646 -30.124 1.00 83.20  ? 287 ALA B CA    1 
ATOM   3785  C C     . ALA B  2 287 ? 25.620  -48.262 -28.900 1.00 89.33  ? 287 ALA B C     1 
ATOM   3786  O O     . ALA B  2 287 ? 25.335  -48.707 -27.789 1.00 89.14  ? 287 ALA B O     1 
ATOM   3787  C CB    . ALA B  2 287 ? 23.761  -47.563 -30.410 1.00 83.47  ? 287 ALA B CB    1 
ATOM   3788  N N     . LYS B  2 288 ? 26.644  -47.414 -29.134 1.00 87.38  ? 288 LYS B N     1 
ATOM   3789  C CA    . LYS B  2 288 ? 27.560  -46.897 -28.120 1.00 88.70  ? 288 LYS B CA    1 
ATOM   3790  C C     . LYS B  2 288 ? 27.253  -45.434 -27.867 1.00 94.86  ? 288 LYS B C     1 
ATOM   3791  O O     . LYS B  2 288 ? 27.690  -44.566 -28.628 1.00 93.96  ? 288 LYS B O     1 
ATOM   3792  C CB    . LYS B  2 288 ? 29.027  -47.057 -28.555 1.00 91.19  ? 288 LYS B CB    1 
ATOM   3793  N N     . THR B  2 289 ? 26.475  -45.162 -26.807 1.00 93.72  ? 289 THR B N     1 
ATOM   3794  C CA    . THR B  2 289 ? 26.121  -43.797 -26.425 1.00 94.53  ? 289 THR B CA    1 
ATOM   3795  C C     . THR B  2 289 ? 27.250  -43.290 -25.540 1.00 99.93  ? 289 THR B C     1 
ATOM   3796  O O     . THR B  2 289 ? 27.487  -43.847 -24.457 1.00 100.55 ? 289 THR B O     1 
ATOM   3797  C CB    . THR B  2 289 ? 24.746  -43.741 -25.740 1.00 104.06 ? 289 THR B CB    1 
ATOM   3798  O OG1   . THR B  2 289 ? 23.775  -44.397 -26.564 1.00 103.56 ? 289 THR B OG1   1 
ATOM   3799  C CG2   . THR B  2 289 ? 24.297  -42.320 -25.483 1.00 101.83 ? 289 THR B CG2   1 
ATOM   3800  N N     . LYS B  2 290 ? 27.976  -42.270 -26.027 1.00 96.42  ? 290 LYS B N     1 
ATOM   3801  C CA    . LYS B  2 290 ? 29.111  -41.684 -25.313 1.00 97.78  ? 290 LYS B CA    1 
ATOM   3802  C C     . LYS B  2 290 ? 28.589  -40.804 -24.158 1.00 104.00 ? 290 LYS B C     1 
ATOM   3803  O O     . LYS B  2 290 ? 27.486  -40.259 -24.265 1.00 102.74 ? 290 LYS B O     1 
ATOM   3804  C CB    . LYS B  2 290 ? 29.980  -40.852 -26.286 1.00 99.80  ? 290 LYS B CB    1 
ATOM   3805  C CG    . LYS B  2 290 ? 30.522  -41.654 -27.473 1.00 108.62 ? 290 LYS B CG    1 
ATOM   3806  C CD    . LYS B  2 290 ? 31.644  -40.935 -28.214 1.00 117.79 ? 290 LYS B CD    1 
ATOM   3807  C CE    . LYS B  2 290 ? 32.354  -41.847 -29.186 1.00 129.63 ? 290 LYS B CE    1 
ATOM   3808  N NZ    . LYS B  2 290 ? 33.510  -41.177 -29.839 1.00 141.92 ? 290 LYS B NZ    1 
ATOM   3809  N N     . PRO B  2 291 ? 29.335  -40.658 -23.039 1.00 103.68 ? 291 PRO B N     1 
ATOM   3810  C CA    . PRO B  2 291 ? 28.847  -39.787 -21.950 1.00 104.82 ? 291 PRO B CA    1 
ATOM   3811  C C     . PRO B  2 291 ? 28.746  -38.321 -22.393 1.00 108.74 ? 291 PRO B C     1 
ATOM   3812  O O     . PRO B  2 291 ? 29.643  -37.826 -23.085 1.00 107.56 ? 291 PRO B O     1 
ATOM   3813  C CB    . PRO B  2 291 ? 29.886  -39.987 -20.838 1.00 107.98 ? 291 PRO B CB    1 
ATOM   3814  C CG    . PRO B  2 291 ? 31.124  -40.415 -21.545 1.00 112.27 ? 291 PRO B CG    1 
ATOM   3815  C CD    . PRO B  2 291 ? 30.663  -41.225 -22.726 1.00 106.34 ? 291 PRO B CD    1 
ATOM   3816  N N     . ARG B  2 292 ? 27.640  -37.643 -22.014 1.00 106.14 ? 292 ARG B N     1 
ATOM   3817  C CA    . ARG B  2 292 ? 27.372  -36.237 -22.381 1.00 106.51 ? 292 ARG B CA    1 
ATOM   3818  C C     . ARG B  2 292 ? 28.517  -35.293 -21.993 1.00 111.03 ? 292 ARG B C     1 
ATOM   3819  O O     . ARG B  2 292 ? 29.184  -35.526 -20.982 1.00 110.95 ? 292 ARG B O     1 
ATOM   3820  C CB    . ARG B  2 292 ? 26.058  -35.740 -21.743 1.00 107.40 ? 292 ARG B CB    1 
ATOM   3821  N N     . GLU B  2 293 ? 28.746  -34.241 -22.814 1.00 108.01 ? 293 GLU B N     1 
ATOM   3822  C CA    . GLU B  2 293 ? 29.805  -33.247 -22.583 1.00 109.01 ? 293 GLU B CA    1 
ATOM   3823  C C     . GLU B  2 293 ? 29.284  -31.795 -22.706 1.00 113.29 ? 293 GLU B C     1 
ATOM   3824  O O     . GLU B  2 293 ? 28.527  -31.475 -23.627 1.00 110.53 ? 293 GLU B O     1 
ATOM   3825  C CB    . GLU B  2 293 ? 31.001  -33.498 -23.528 1.00 109.84 ? 293 GLU B CB    1 
ATOM   3826  C CG    . GLU B  2 293 ? 31.867  -34.691 -23.133 1.00 117.67 ? 293 GLU B CG    1 
ATOM   3827  C CD    . GLU B  2 293 ? 32.631  -34.564 -21.823 1.00 140.62 ? 293 GLU B CD    1 
ATOM   3828  O OE1   . GLU B  2 293 ? 32.991  -33.424 -21.443 1.00 140.80 ? 293 GLU B OE1   1 
ATOM   3829  O OE2   . GLU B  2 293 ? 32.870  -35.610 -21.176 1.00 126.04 ? 293 GLU B OE2   1 
ATOM   3830  N N     . GLU B  2 294 ? 29.708  -30.930 -21.753 1.00 112.52 ? 294 GLU B N     1 
ATOM   3831  C CA    . GLU B  2 294 ? 29.328  -29.512 -21.657 1.00 113.16 ? 294 GLU B CA    1 
ATOM   3832  C C     . GLU B  2 294 ? 29.960  -28.685 -22.784 1.00 118.77 ? 294 GLU B C     1 
ATOM   3833  O O     . GLU B  2 294 ? 29.280  -27.824 -23.339 1.00 117.80 ? 294 GLU B O     1 
ATOM   3834  C CB    . GLU B  2 294 ? 29.745  -28.956 -20.266 1.00 116.11 ? 294 GLU B CB    1 
ATOM   3835  C CG    . GLU B  2 294 ? 29.485  -27.476 -19.996 1.00 124.37 ? 294 GLU B CG    1 
ATOM   3836  C CD    . GLU B  2 294 ? 28.031  -27.064 -19.891 1.00 133.51 ? 294 GLU B CD    1 
ATOM   3837  O OE1   . GLU B  2 294 ? 27.393  -27.407 -18.870 1.00 113.03 ? 294 GLU B OE1   1 
ATOM   3838  O OE2   . GLU B  2 294 ? 27.552  -26.335 -20.791 1.00 123.52 ? 294 GLU B OE2   1 
ATOM   3839  N N     . GLN B  2 295 ? 31.259  -28.929 -23.096 1.00 117.45 ? 295 GLN B N     1 
ATOM   3840  C CA    . GLN B  2 295 ? 32.044  -28.222 -24.139 1.00 118.10 ? 295 GLN B CA    1 
ATOM   3841  C C     . GLN B  2 295 ? 31.192  -27.597 -25.311 1.00 122.31 ? 295 GLN B C     1 
ATOM   3842  O O     . GLN B  2 295 ? 30.695  -28.353 -26.162 1.00 120.71 ? 295 GLN B O     1 
ATOM   3843  C CB    . GLN B  2 295 ? 33.145  -29.149 -24.718 1.00 119.26 ? 295 GLN B CB    1 
ATOM   3844  C CG    . GLN B  2 295 ? 34.528  -28.939 -24.102 1.00 131.65 ? 295 GLN B CG    1 
ATOM   3845  C CD    . GLN B  2 295 ? 34.580  -29.327 -22.645 1.00 151.37 ? 295 GLN B CD    1 
ATOM   3846  O OE1   . GLN B  2 295 ? 34.158  -30.428 -22.258 1.00 145.47 ? 295 GLN B OE1   1 
ATOM   3847  N NE2   . GLN B  2 295 ? 35.108  -28.443 -21.800 1.00 144.68 ? 295 GLN B NE2   1 
ATOM   3848  N N     . PHE B  2 296 ? 30.998  -26.244 -25.364 1.00 119.51 ? 296 PHE B N     1 
ATOM   3849  C CA    . PHE B  2 296 ? 31.530  -25.238 -24.415 1.00 120.95 ? 296 PHE B CA    1 
ATOM   3850  C C     . PHE B  2 296 ? 30.652  -23.974 -24.318 1.00 124.78 ? 296 PHE B C     1 
ATOM   3851  O O     . PHE B  2 296 ? 30.324  -23.552 -23.207 1.00 125.45 ? 296 PHE B O     1 
ATOM   3852  C CB    . PHE B  2 296 ? 32.975  -24.852 -24.786 1.00 123.35 ? 296 PHE B CB    1 
ATOM   3853  C CG    . PHE B  2 296 ? 33.687  -24.070 -23.708 1.00 126.48 ? 296 PHE B CG    1 
ATOM   3854  C CD1   . PHE B  2 296 ? 34.068  -24.680 -22.521 1.00 130.49 ? 296 PHE B CD1   1 
ATOM   3855  C CD2   . PHE B  2 296 ? 33.959  -22.719 -23.871 1.00 129.18 ? 296 PHE B CD2   1 
ATOM   3856  C CE1   . PHE B  2 296 ? 34.713  -23.956 -21.521 1.00 133.09 ? 296 PHE B CE1   1 
ATOM   3857  C CE2   . PHE B  2 296 ? 34.612  -21.996 -22.873 1.00 133.67 ? 296 PHE B CE2   1 
ATOM   3858  C CZ    . PHE B  2 296 ? 34.986  -22.619 -21.704 1.00 132.84 ? 296 PHE B CZ    1 
ATOM   3859  N N     . ASN B  2 297 ? 30.335  -23.351 -25.475 1.00 119.78 ? 297 ASN B N     1 
ATOM   3860  C CA    . ASN B  2 297 ? 29.451  -22.178 -25.639 1.00 119.18 ? 297 ASN B CA    1 
ATOM   3861  C C     . ASN B  2 297 ? 28.492  -21.948 -24.456 1.00 122.90 ? 297 ASN B C     1 
ATOM   3862  O O     . ASN B  2 297 ? 28.529  -20.890 -23.834 1.00 125.07 ? 297 ASN B O     1 
ATOM   3863  C CB    . ASN B  2 297 ? 28.579  -22.321 -26.914 1.00 118.47 ? 297 ASN B CB    1 
ATOM   3864  C CG    . ASN B  2 297 ? 29.301  -22.523 -28.233 1.00 138.88 ? 297 ASN B CG    1 
ATOM   3865  O OD1   . ASN B  2 297 ? 29.632  -21.559 -28.937 1.00 133.36 ? 297 ASN B OD1   1 
ATOM   3866  N ND2   . ASN B  2 297 ? 29.570  -23.790 -28.597 1.00 126.18 ? 297 ASN B ND2   1 
ATOM   3867  N N     . SER B  2 298 ? 27.687  -22.983 -24.130 1.00 116.55 ? 298 SER B N     1 
ATOM   3868  C CA    . SER B  2 298 ? 26.637  -23.002 -23.091 1.00 115.60 ? 298 SER B CA    1 
ATOM   3869  C C     . SER B  2 298 ? 25.794  -24.308 -23.121 1.00 116.34 ? 298 SER B C     1 
ATOM   3870  O O     . SER B  2 298 ? 25.319  -24.744 -22.072 1.00 116.09 ? 298 SER B O     1 
ATOM   3871  C CB    . SER B  2 298 ? 25.677  -21.823 -23.265 1.00 118.64 ? 298 SER B CB    1 
ATOM   3872  O OG    . SER B  2 298 ? 25.256  -21.682 -24.612 1.00 123.25 ? 298 SER B OG    1 
ATOM   3873  N N     . THR B  2 299 ? 25.573  -24.890 -24.328 1.00 109.75 ? 299 THR B N     1 
ATOM   3874  C CA    . THR B  2 299 ? 24.754  -26.087 -24.552 1.00 107.44 ? 299 THR B CA    1 
ATOM   3875  C C     . THR B  2 299 ? 25.513  -27.385 -24.230 1.00 109.11 ? 299 THR B C     1 
ATOM   3876  O O     . THR B  2 299 ? 26.632  -27.341 -23.727 1.00 108.02 ? 299 THR B O     1 
ATOM   3877  C CB    . THR B  2 299 ? 24.247  -26.094 -26.026 1.00 113.29 ? 299 THR B CB    1 
ATOM   3878  O OG1   . THR B  2 299 ? 25.350  -26.320 -26.915 1.00 108.84 ? 299 THR B OG1   1 
ATOM   3879  C CG2   . THR B  2 299 ? 23.478  -24.808 -26.400 1.00 113.10 ? 299 THR B CG2   1 
ATOM   3880  N N     . TYR B  2 300 ? 24.875  -28.542 -24.508 1.00 105.10 ? 300 TYR B N     1 
ATOM   3881  C CA    . TYR B  2 300 ? 25.457  -29.874 -24.334 1.00 104.37 ? 300 TYR B CA    1 
ATOM   3882  C C     . TYR B  2 300 ? 25.626  -30.554 -25.695 1.00 104.31 ? 300 TYR B C     1 
ATOM   3883  O O     . TYR B  2 300 ? 24.932  -30.209 -26.657 1.00 102.48 ? 300 TYR B O     1 
ATOM   3884  C CB    . TYR B  2 300 ? 24.581  -30.738 -23.403 1.00 105.79 ? 300 TYR B CB    1 
ATOM   3885  C CG    . TYR B  2 300 ? 25.005  -30.648 -21.955 1.00 109.18 ? 300 TYR B CG    1 
ATOM   3886  C CD1   . TYR B  2 300 ? 26.026  -31.449 -21.457 1.00 111.80 ? 300 TYR B CD1   1 
ATOM   3887  C CD2   . TYR B  2 300 ? 24.419  -29.729 -21.092 1.00 110.88 ? 300 TYR B CD2   1 
ATOM   3888  C CE1   . TYR B  2 300 ? 26.439  -31.353 -20.130 1.00 114.32 ? 300 TYR B CE1   1 
ATOM   3889  C CE2   . TYR B  2 300 ? 24.817  -29.631 -19.761 1.00 113.27 ? 300 TYR B CE2   1 
ATOM   3890  C CZ    . TYR B  2 300 ? 25.821  -30.453 -19.279 1.00 121.38 ? 300 TYR B CZ    1 
ATOM   3891  O OH    . TYR B  2 300 ? 26.232  -30.358 -17.970 1.00 124.66 ? 300 TYR B OH    1 
ATOM   3892  N N     . ARG B  2 301 ? 26.587  -31.491 -25.773 1.00 99.62  ? 301 ARG B N     1 
ATOM   3893  C CA    . ARG B  2 301 ? 26.849  -32.299 -26.970 1.00 97.29  ? 301 ARG B CA    1 
ATOM   3894  C C     . ARG B  2 301 ? 26.891  -33.770 -26.552 1.00 98.70  ? 301 ARG B C     1 
ATOM   3895  O O     . ARG B  2 301 ? 27.735  -34.150 -25.725 1.00 98.66  ? 301 ARG B O     1 
ATOM   3896  C CB    . ARG B  2 301 ? 28.160  -31.905 -27.665 1.00 95.60  ? 301 ARG B CB    1 
ATOM   3897  C CG    . ARG B  2 301 ? 28.353  -32.613 -29.008 1.00 99.82  ? 301 ARG B CG    1 
ATOM   3898  C CD    . ARG B  2 301 ? 29.517  -32.027 -29.776 1.00 103.12 ? 301 ARG B CD    1 
ATOM   3899  N NE    . ARG B  2 301 ? 29.921  -32.844 -30.925 1.00 97.59  ? 301 ARG B NE    1 
ATOM   3900  C CZ    . ARG B  2 301 ? 30.731  -33.902 -30.882 1.00 101.58 ? 301 ARG B CZ    1 
ATOM   3901  N NH1   . ARG B  2 301 ? 31.233  -34.324 -29.725 1.00 82.53  ? 301 ARG B NH1   1 
ATOM   3902  N NH2   . ARG B  2 301 ? 31.040  -34.552 -31.997 1.00 88.33  ? 301 ARG B NH2   1 
ATOM   3903  N N     . VAL B  2 302 ? 25.968  -34.584 -27.109 1.00 92.32  ? 302 VAL B N     1 
ATOM   3904  C CA    . VAL B  2 302 ? 25.884  -36.024 -26.814 1.00 91.20  ? 302 VAL B CA    1 
ATOM   3905  C C     . VAL B  2 302 ? 26.054  -36.786 -28.143 1.00 91.45  ? 302 VAL B C     1 
ATOM   3906  O O     . VAL B  2 302 ? 25.427  -36.425 -29.150 1.00 90.20  ? 302 VAL B O     1 
ATOM   3907  C CB    . VAL B  2 302 ? 24.583  -36.433 -26.063 1.00 94.54  ? 302 VAL B CB    1 
ATOM   3908  C CG1   . VAL B  2 302 ? 24.815  -37.699 -25.236 1.00 94.64  ? 302 VAL B CG1   1 
ATOM   3909  C CG2   . VAL B  2 302 ? 24.078  -35.305 -25.168 1.00 95.09  ? 302 VAL B CG2   1 
ATOM   3910  N N     . VAL B  2 303 ? 26.941  -37.806 -28.142 1.00 85.81  ? 303 VAL B N     1 
ATOM   3911  C CA    . VAL B  2 303 ? 27.272  -38.588 -29.333 1.00 84.45  ? 303 VAL B CA    1 
ATOM   3912  C C     . VAL B  2 303 ? 26.928  -40.070 -29.168 1.00 83.80  ? 303 VAL B C     1 
ATOM   3913  O O     . VAL B  2 303 ? 27.312  -40.692 -28.182 1.00 82.99  ? 303 VAL B O     1 
ATOM   3914  C CB    . VAL B  2 303 ? 28.767  -38.405 -29.698 1.00 89.55  ? 303 VAL B CB    1 
ATOM   3915  C CG1   . VAL B  2 303 ? 29.170  -39.324 -30.855 1.00 88.89  ? 303 VAL B CG1   1 
ATOM   3916  C CG2   . VAL B  2 303 ? 29.059  -36.949 -30.044 1.00 89.73  ? 303 VAL B CG2   1 
ATOM   3917  N N     . SER B  2 304 ? 26.255  -40.635 -30.177 1.00 77.22  ? 304 SER B N     1 
ATOM   3918  C CA    . SER B  2 304 ? 25.916  -42.054 -30.225 1.00 75.30  ? 304 SER B CA    1 
ATOM   3919  C C     . SER B  2 304 ? 26.490  -42.624 -31.521 1.00 75.57  ? 304 SER B C     1 
ATOM   3920  O O     . SER B  2 304 ? 26.310  -42.040 -32.593 1.00 72.83  ? 304 SER B O     1 
ATOM   3921  C CB    . SER B  2 304 ? 24.408  -42.272 -30.158 1.00 78.03  ? 304 SER B CB    1 
ATOM   3922  O OG    . SER B  2 304 ? 24.077  -43.634 -29.924 1.00 85.40  ? 304 SER B OG    1 
ATOM   3923  N N     . VAL B  2 305 ? 27.229  -43.735 -31.397 1.00 71.11  ? 305 VAL B N     1 
ATOM   3924  C CA    . VAL B  2 305 ? 27.888  -44.422 -32.499 1.00 69.11  ? 305 VAL B CA    1 
ATOM   3925  C C     . VAL B  2 305 ? 27.259  -45.803 -32.672 1.00 68.90  ? 305 VAL B C     1 
ATOM   3926  O O     . VAL B  2 305 ? 27.255  -46.564 -31.710 1.00 68.93  ? 305 VAL B O     1 
ATOM   3927  C CB    . VAL B  2 305 ? 29.408  -44.494 -32.177 1.00 73.87  ? 305 VAL B CB    1 
ATOM   3928  C CG1   . VAL B  2 305 ? 30.054  -45.768 -32.705 1.00 74.04  ? 305 VAL B CG1   1 
ATOM   3929  C CG2   . VAL B  2 305 ? 30.133  -43.269 -32.711 1.00 73.83  ? 305 VAL B CG2   1 
ATOM   3930  N N     . LEU B  2 306 ? 26.727  -46.131 -33.876 1.00 62.40  ? 306 LEU B N     1 
ATOM   3931  C CA    . LEU B  2 306 ? 26.207  -47.477 -34.165 1.00 61.00  ? 306 LEU B CA    1 
ATOM   3932  C C     . LEU B  2 306 ? 27.134  -48.167 -35.172 1.00 65.95  ? 306 LEU B C     1 
ATOM   3933  O O     . LEU B  2 306 ? 27.300  -47.675 -36.283 1.00 66.77  ? 306 LEU B O     1 
ATOM   3934  C CB    . LEU B  2 306 ? 24.774  -47.458 -34.715 1.00 59.51  ? 306 LEU B CB    1 
ATOM   3935  C CG    . LEU B  2 306 ? 24.169  -48.852 -35.009 1.00 62.69  ? 306 LEU B CG    1 
ATOM   3936  C CD1   . LEU B  2 306 ? 23.705  -49.556 -33.741 1.00 64.14  ? 306 LEU B CD1   1 
ATOM   3937  C CD2   . LEU B  2 306 ? 23.046  -48.756 -35.946 1.00 62.70  ? 306 LEU B CD2   1 
ATOM   3938  N N     . THR B  2 307 ? 27.668  -49.333 -34.818 1.00 62.37  ? 307 THR B N     1 
ATOM   3939  C CA    . THR B  2 307 ? 28.527  -50.119 -35.718 1.00 61.93  ? 307 THR B CA    1 
ATOM   3940  C C     . THR B  2 307 ? 27.702  -50.733 -36.847 1.00 62.37  ? 307 THR B C     1 
ATOM   3941  O O     . THR B  2 307 ? 26.677  -51.357 -36.573 1.00 60.59  ? 307 THR B O     1 
ATOM   3942  C CB    . THR B  2 307 ? 29.193  -51.281 -34.949 1.00 74.30  ? 307 THR B CB    1 
ATOM   3943  O OG1   . THR B  2 307 ? 29.824  -50.763 -33.782 1.00 83.93  ? 307 THR B OG1   1 
ATOM   3944  C CG2   . THR B  2 307 ? 30.213  -52.041 -35.793 1.00 71.79  ? 307 THR B CG2   1 
ATOM   3945  N N     . VAL B  2 308 ? 28.179  -50.635 -38.095 1.00 59.33  ? 308 VAL B N     1 
ATOM   3946  C CA    . VAL B  2 308 ? 27.485  -51.296 -39.216 1.00 60.30  ? 308 VAL B CA    1 
ATOM   3947  C C     . VAL B  2 308 ? 27.710  -52.830 -39.077 1.00 68.75  ? 308 VAL B C     1 
ATOM   3948  O O     . VAL B  2 308 ? 28.763  -53.242 -38.578 1.00 70.23  ? 308 VAL B O     1 
ATOM   3949  C CB    . VAL B  2 308 ? 27.958  -50.815 -40.611 1.00 62.43  ? 308 VAL B CB    1 
ATOM   3950  C CG1   . VAL B  2 308 ? 27.911  -49.302 -40.724 1.00 60.34  ? 308 VAL B CG1   1 
ATOM   3951  C CG2   . VAL B  2 308 ? 29.343  -51.361 -40.934 1.00 63.54  ? 308 VAL B CG2   1 
ATOM   3952  N N     . LEU B  2 309 ? 26.733  -53.654 -39.496 1.00 65.85  ? 309 LEU B N     1 
ATOM   3953  C CA    . LEU B  2 309 ? 26.845  -55.120 -39.439 1.00 65.92  ? 309 LEU B CA    1 
ATOM   3954  C C     . LEU B  2 309 ? 26.661  -55.687 -40.821 1.00 65.79  ? 309 LEU B C     1 
ATOM   3955  O O     . LEU B  2 309 ? 26.021  -55.059 -41.659 1.00 63.40  ? 309 LEU B O     1 
ATOM   3956  C CB    . LEU B  2 309 ? 25.749  -55.712 -38.548 1.00 66.87  ? 309 LEU B CB    1 
ATOM   3957  C CG    . LEU B  2 309 ? 25.680  -55.242 -37.097 1.00 73.36  ? 309 LEU B CG    1 
ATOM   3958  C CD1   . LEU B  2 309 ? 24.445  -55.778 -36.446 1.00 74.29  ? 309 LEU B CD1   1 
ATOM   3959  C CD2   . LEU B  2 309 ? 26.861  -55.711 -36.306 1.00 76.88  ? 309 LEU B CD2   1 
ATOM   3960  N N     . HIS B  2 310 ? 27.182  -56.892 -41.051 1.00 62.62  ? 310 HIS B N     1 
ATOM   3961  C CA    . HIS B  2 310 ? 26.980  -57.646 -42.312 1.00 61.84  ? 310 HIS B CA    1 
ATOM   3962  C C     . HIS B  2 310 ? 27.409  -56.833 -43.565 1.00 61.86  ? 310 HIS B C     1 
ATOM   3963  O O     . HIS B  2 310 ? 28.568  -56.496 -43.647 1.00 62.63  ? 310 HIS B O     1 
ATOM   3964  C CB    . HIS B  2 310 ? 25.507  -58.142 -42.360 1.00 61.86  ? 310 HIS B CB    1 
ATOM   3965  C CG    . HIS B  2 310 ? 25.071  -58.742 -41.061 1.00 65.27  ? 310 HIS B CG    1 
ATOM   3966  N ND1   . HIS B  2 310 ? 25.724  -59.842 -40.521 1.00 67.10  ? 310 HIS B ND1   1 
ATOM   3967  C CD2   . HIS B  2 310 ? 24.101  -58.337 -40.201 1.00 66.95  ? 310 HIS B CD2   1 
ATOM   3968  C CE1   . HIS B  2 310 ? 25.137  -60.067 -39.354 1.00 66.86  ? 310 HIS B CE1   1 
ATOM   3969  N NE2   . HIS B  2 310 ? 24.148  -59.192 -39.124 1.00 66.86  ? 310 HIS B NE2   1 
ATOM   3970  N N     . GLN B  2 311 ? 26.538  -56.555 -44.533 1.00 56.20  ? 311 GLN B N     1 
ATOM   3971  C CA    . GLN B  2 311 ? 26.871  -55.691 -45.685 1.00 55.50  ? 311 GLN B CA    1 
ATOM   3972  C C     . GLN B  2 311 ? 25.741  -54.620 -45.792 1.00 50.34  ? 311 GLN B C     1 
ATOM   3973  O O     . GLN B  2 311 ? 25.391  -54.157 -46.872 1.00 46.01  ? 311 GLN B O     1 
ATOM   3974  C CB    . GLN B  2 311 ? 26.989  -56.550 -46.963 1.00 57.23  ? 311 GLN B CB    1 
ATOM   3975  N N     . ASP B  2 312 ? 25.222  -54.207 -44.628 1.00 47.51  ? 312 ASP B N     1 
ATOM   3976  C CA    . ASP B  2 312 ? 24.046  -53.338 -44.483 1.00 46.13  ? 312 ASP B CA    1 
ATOM   3977  C C     . ASP B  2 312 ? 24.145  -51.977 -45.130 1.00 49.01  ? 312 ASP B C     1 
ATOM   3978  O O     . ASP B  2 312 ? 23.191  -51.563 -45.775 1.00 46.42  ? 312 ASP B O     1 
ATOM   3979  C CB    . ASP B  2 312 ? 23.661  -53.169 -43.008 1.00 46.95  ? 312 ASP B CB    1 
ATOM   3980  C CG    . ASP B  2 312 ? 23.114  -54.428 -42.368 1.00 46.82  ? 312 ASP B CG    1 
ATOM   3981  O OD1   . ASP B  2 312 ? 23.012  -55.454 -43.070 1.00 45.56  ? 312 ASP B OD1   1 
ATOM   3982  O OD2   . ASP B  2 312 ? 22.841  -54.400 -41.152 1.00 47.37  ? 312 ASP B OD2   1 
ATOM   3983  N N     . TRP B  2 313 ? 25.276  -51.282 -44.977 1.00 48.12  ? 313 TRP B N     1 
ATOM   3984  C CA    . TRP B  2 313 ? 25.438  -49.967 -45.582 1.00 47.34  ? 313 TRP B CA    1 
ATOM   3985  C C     . TRP B  2 313 ? 25.441  -50.073 -47.102 1.00 48.91  ? 313 TRP B C     1 
ATOM   3986  O O     . TRP B  2 313 ? 24.704  -49.359 -47.779 1.00 47.67  ? 313 TRP B O     1 
ATOM   3987  C CB    . TRP B  2 313 ? 26.700  -49.271 -45.059 1.00 47.74  ? 313 TRP B CB    1 
ATOM   3988  C CG    . TRP B  2 313 ? 26.864  -47.889 -45.592 1.00 49.45  ? 313 TRP B CG    1 
ATOM   3989  C CD1   . TRP B  2 313 ? 27.585  -47.518 -46.684 1.00 52.52  ? 313 TRP B CD1   1 
ATOM   3990  C CD2   . TRP B  2 313 ? 26.109  -46.739 -45.198 1.00 50.00  ? 313 TRP B CD2   1 
ATOM   3991  N NE1   . TRP B  2 313 ? 27.378  -46.183 -46.956 1.00 52.32  ? 313 TRP B NE1   1 
ATOM   3992  C CE2   . TRP B  2 313 ? 26.445  -45.692 -46.081 1.00 54.06  ? 313 TRP B CE2   1 
ATOM   3993  C CE3   . TRP B  2 313 ? 25.147  -46.502 -44.202 1.00 52.06  ? 313 TRP B CE3   1 
ATOM   3994  C CZ2   . TRP B  2 313 ? 25.859  -44.428 -45.992 1.00 53.98  ? 313 TRP B CZ2   1 
ATOM   3995  C CZ3   . TRP B  2 313 ? 24.597  -45.237 -44.086 1.00 53.85  ? 313 TRP B CZ3   1 
ATOM   3996  C CH2   . TRP B  2 313 ? 24.930  -44.226 -44.992 1.00 54.84  ? 313 TRP B CH2   1 
ATOM   3997  N N     . LEU B  2 314 ? 26.192  -51.014 -47.621 1.00 47.50  ? 314 LEU B N     1 
ATOM   3998  C CA    . LEU B  2 314 ? 26.307  -51.225 -49.055 1.00 48.79  ? 314 LEU B CA    1 
ATOM   3999  C C     . LEU B  2 314 ? 25.025  -51.730 -49.663 1.00 49.82  ? 314 LEU B C     1 
ATOM   4000  O O     . LEU B  2 314 ? 24.748  -51.374 -50.798 1.00 45.69  ? 314 LEU B O     1 
ATOM   4001  C CB    . LEU B  2 314 ? 27.450  -52.190 -49.344 1.00 51.35  ? 314 LEU B CB    1 
ATOM   4002  C CG    . LEU B  2 314 ? 28.819  -51.717 -48.864 1.00 59.74  ? 314 LEU B CG    1 
ATOM   4003  C CD1   . LEU B  2 314 ? 29.819  -52.802 -48.977 1.00 61.53  ? 314 LEU B CD1   1 
ATOM   4004  C CD2   . LEU B  2 314 ? 29.272  -50.480 -49.615 1.00 61.92  ? 314 LEU B CD2   1 
ATOM   4005  N N     . ASN B  2 315 ? 24.210  -52.528 -48.906 1.00 47.95  ? 315 ASN B N     1 
ATOM   4006  C CA    . ASN B  2 315 ? 22.892  -52.993 -49.378 1.00 47.16  ? 315 ASN B CA    1 
ATOM   4007  C C     . ASN B  2 315 ? 21.909  -51.898 -49.534 1.00 49.68  ? 315 ASN B C     1 
ATOM   4008  O O     . ASN B  2 315 ? 20.951  -52.056 -50.285 1.00 48.41  ? 315 ASN B O     1 
ATOM   4009  C CB    . ASN B  2 315 ? 22.285  -54.024 -48.436 1.00 52.95  ? 315 ASN B CB    1 
ATOM   4010  C CG    . ASN B  2 315 ? 22.954  -55.364 -48.393 1.00 65.78  ? 315 ASN B CG    1 
ATOM   4011  O OD1   . ASN B  2 315 ? 22.873  -56.036 -47.376 1.00 70.53  ? 315 ASN B OD1   1 
ATOM   4012  N ND2   . ASN B  2 315 ? 23.570  -55.843 -49.469 1.00 55.75  ? 315 ASN B ND2   1 
ATOM   4013  N N     . GLY B  2 316 ? 22.131  -50.796 -48.830 1.00 47.04  ? 316 GLY B N     1 
ATOM   4014  C CA    . GLY B  2 316 ? 21.258  -49.637 -48.897 1.00 46.61  ? 316 GLY B CA    1 
ATOM   4015  C C     . GLY B  2 316 ? 20.292  -49.572 -47.725 1.00 50.49  ? 316 GLY B C     1 
ATOM   4016  O O     . GLY B  2 316 ? 19.272  -48.902 -47.827 1.00 52.08  ? 316 GLY B O     1 
ATOM   4017  N N     . LYS B  2 317 ? 20.609  -50.224 -46.592 1.00 43.21  ? 317 LYS B N     1 
ATOM   4018  C CA    . LYS B  2 317 ? 19.748  -50.183 -45.433 1.00 42.19  ? 317 LYS B CA    1 
ATOM   4019  C C     . LYS B  2 317 ? 19.673  -48.754 -44.836 1.00 48.83  ? 317 LYS B C     1 
ATOM   4020  O O     . LYS B  2 317 ? 20.639  -47.991 -44.915 1.00 47.48  ? 317 LYS B O     1 
ATOM   4021  C CB    . LYS B  2 317 ? 20.217  -51.189 -44.366 1.00 41.04  ? 317 LYS B CB    1 
ATOM   4022  C CG    . LYS B  2 317 ? 20.163  -52.611 -44.859 1.00 35.13  ? 317 LYS B CG    1 
ATOM   4023  C CD    . LYS B  2 317 ? 19.821  -53.551 -43.743 1.00 35.58  ? 317 LYS B CD    1 
ATOM   4024  C CE    . LYS B  2 317 ? 19.866  -54.987 -44.222 1.00 42.03  ? 317 LYS B CE    1 
ATOM   4025  N NZ    . LYS B  2 317 ? 19.397  -55.934 -43.161 1.00 52.63  ? 317 LYS B NZ    1 
ATOM   4026  N N     . GLU B  2 318 ? 18.515  -48.420 -44.240 1.00 47.06  ? 318 GLU B N     1 
ATOM   4027  C CA    . GLU B  2 318 ? 18.269  -47.104 -43.649 1.00 47.49  ? 318 GLU B CA    1 
ATOM   4028  C C     . GLU B  2 318 ? 18.610  -47.101 -42.193 1.00 50.95  ? 318 GLU B C     1 
ATOM   4029  O O     . GLU B  2 318 ? 18.059  -47.881 -41.429 1.00 51.46  ? 318 GLU B O     1 
ATOM   4030  C CB    . GLU B  2 318 ? 16.799  -46.672 -43.828 1.00 49.21  ? 318 GLU B CB    1 
ATOM   4031  C CG    . GLU B  2 318 ? 16.477  -46.095 -45.200 1.00 68.95  ? 318 GLU B CG    1 
ATOM   4032  C CD    . GLU B  2 318 ? 14.999  -45.785 -45.407 1.00 93.87  ? 318 GLU B CD    1 
ATOM   4033  O OE1   . GLU B  2 318 ? 14.427  -45.044 -44.573 1.00 83.11  ? 318 GLU B OE1   1 
ATOM   4034  O OE2   . GLU B  2 318 ? 14.413  -46.283 -46.397 1.00 82.92  ? 318 GLU B OE2   1 
ATOM   4035  N N     . TYR B  2 319 ? 19.490  -46.198 -41.801 1.00 47.71  ? 319 TYR B N     1 
ATOM   4036  C CA    . TYR B  2 319 ? 19.877  -46.013 -40.422 1.00 47.72  ? 319 TYR B CA    1 
ATOM   4037  C C     . TYR B  2 319 ? 19.091  -44.806 -39.924 1.00 55.42  ? 319 TYR B C     1 
ATOM   4038  O O     . TYR B  2 319 ? 19.173  -43.745 -40.525 1.00 54.91  ? 319 TYR B O     1 
ATOM   4039  C CB    . TYR B  2 319 ? 21.371  -45.790 -40.312 1.00 47.91  ? 319 TYR B CB    1 
ATOM   4040  C CG    . TYR B  2 319 ? 22.129  -47.055 -40.625 1.00 48.17  ? 319 TYR B CG    1 
ATOM   4041  C CD1   . TYR B  2 319 ? 22.365  -47.445 -41.939 1.00 48.99  ? 319 TYR B CD1   1 
ATOM   4042  C CD2   . TYR B  2 319 ? 22.569  -47.893 -39.609 1.00 48.52  ? 319 TYR B CD2   1 
ATOM   4043  C CE1   . TYR B  2 319 ? 23.066  -48.608 -42.229 1.00 49.42  ? 319 TYR B CE1   1 
ATOM   4044  C CE2   . TYR B  2 319 ? 23.273  -49.057 -39.888 1.00 48.66  ? 319 TYR B CE2   1 
ATOM   4045  C CZ    . TYR B  2 319 ? 23.544  -49.394 -41.202 1.00 53.71  ? 319 TYR B CZ    1 
ATOM   4046  O OH    . TYR B  2 319 ? 24.201  -50.546 -41.529 1.00 55.10  ? 319 TYR B OH    1 
ATOM   4047  N N     . LYS B  2 320 ? 18.262  -45.001 -38.897 1.00 54.64  ? 320 LYS B N     1 
ATOM   4048  C CA    . LYS B  2 320 ? 17.414  -43.967 -38.334 1.00 55.53  ? 320 LYS B CA    1 
ATOM   4049  C C     . LYS B  2 320 ? 17.808  -43.753 -36.903 1.00 61.26  ? 320 LYS B C     1 
ATOM   4050  O O     . LYS B  2 320 ? 17.810  -44.707 -36.123 1.00 60.88  ? 320 LYS B O     1 
ATOM   4051  C CB    . LYS B  2 320 ? 15.933  -44.389 -38.404 1.00 59.23  ? 320 LYS B CB    1 
ATOM   4052  C CG    . LYS B  2 320 ? 14.939  -43.396 -37.778 1.00 78.53  ? 320 LYS B CG    1 
ATOM   4053  C CD    . LYS B  2 320 ? 13.504  -43.780 -38.097 1.00 90.52  ? 320 LYS B CD    1 
ATOM   4054  C CE    . LYS B  2 320 ? 12.515  -42.893 -37.396 1.00 111.02 ? 320 LYS B CE    1 
ATOM   4055  N NZ    . LYS B  2 320 ? 11.149  -43.483 -37.378 1.00 126.43 ? 320 LYS B NZ    1 
ATOM   4056  N N     . CYS B  2 321 ? 18.113  -42.502 -36.553 1.00 60.23  ? 321 CYS B N     1 
ATOM   4057  C CA    . CYS B  2 321 ? 18.462  -42.100 -35.205 1.00 63.00  ? 321 CYS B CA    1 
ATOM   4058  C C     . CYS B  2 321 ? 17.366  -41.171 -34.688 1.00 69.44  ? 321 CYS B C     1 
ATOM   4059  O O     . CYS B  2 321 ? 17.071  -40.160 -35.325 1.00 68.68  ? 321 CYS B O     1 
ATOM   4060  C CB    . CYS B  2 321 ? 19.818  -41.414 -35.197 1.00 64.25  ? 321 CYS B CB    1 
ATOM   4061  S SG    . CYS B  2 321 ? 20.291  -40.746 -33.590 1.00 69.13  ? 321 CYS B SG    1 
ATOM   4062  N N     . LYS B  2 322 ? 16.776  -41.513 -33.536 1.00 68.24  ? 322 LYS B N     1 
ATOM   4063  C CA    . LYS B  2 322 ? 15.698  -40.741 -32.917 1.00 68.53  ? 322 LYS B CA    1 
ATOM   4064  C C     . LYS B  2 322 ? 16.210  -40.217 -31.596 1.00 72.03  ? 322 LYS B C     1 
ATOM   4065  O O     . LYS B  2 322 ? 16.721  -40.994 -30.792 1.00 72.38  ? 322 LYS B O     1 
ATOM   4066  C CB    . LYS B  2 322 ? 14.437  -41.600 -32.720 1.00 71.25  ? 322 LYS B CB    1 
ATOM   4067  N N     . VAL B  2 323 ? 16.131  -38.901 -31.390 1.00 68.32  ? 323 VAL B N     1 
ATOM   4068  C CA    . VAL B  2 323 ? 16.613  -38.275 -30.165 1.00 69.97  ? 323 VAL B CA    1 
ATOM   4069  C C     . VAL B  2 323 ? 15.445  -37.659 -29.379 1.00 74.02  ? 323 VAL B C     1 
ATOM   4070  O O     . VAL B  2 323 ? 14.671  -36.848 -29.907 1.00 72.36  ? 323 VAL B O     1 
ATOM   4071  C CB    . VAL B  2 323 ? 17.725  -37.238 -30.425 1.00 74.25  ? 323 VAL B CB    1 
ATOM   4072  C CG1   . VAL B  2 323 ? 18.461  -36.922 -29.122 1.00 74.99  ? 323 VAL B CG1   1 
ATOM   4073  C CG2   . VAL B  2 323 ? 18.701  -37.743 -31.498 1.00 73.38  ? 323 VAL B CG2   1 
ATOM   4074  N N     . SER B  2 324 ? 15.359  -38.047 -28.101 1.00 70.99  ? 324 SER B N     1 
ATOM   4075  C CA    . SER B  2 324 ? 14.334  -37.614 -27.172 1.00 71.57  ? 324 SER B CA    1 
ATOM   4076  C C     . SER B  2 324 ? 15.032  -36.922 -26.037 1.00 81.02  ? 324 SER B C     1 
ATOM   4077  O O     . SER B  2 324 ? 15.889  -37.530 -25.394 1.00 81.47  ? 324 SER B O     1 
ATOM   4078  C CB    . SER B  2 324 ? 13.552  -38.814 -26.653 1.00 72.22  ? 324 SER B CB    1 
ATOM   4079  O OG    . SER B  2 324 ? 12.939  -39.507 -27.727 1.00 75.68  ? 324 SER B OG    1 
ATOM   4080  N N     . ASN B  2 325 ? 14.719  -35.631 -25.824 1.00 81.18  ? 325 ASN B N     1 
ATOM   4081  C CA    . ASN B  2 325 ? 15.322  -34.856 -24.750 1.00 83.73  ? 325 ASN B CA    1 
ATOM   4082  C C     . ASN B  2 325 ? 14.340  -34.836 -23.574 1.00 91.36  ? 325 ASN B C     1 
ATOM   4083  O O     . ASN B  2 325 ? 13.155  -34.554 -23.775 1.00 90.63  ? 325 ASN B O     1 
ATOM   4084  C CB    . ASN B  2 325 ? 15.672  -33.440 -25.236 1.00 83.48  ? 325 ASN B CB    1 
ATOM   4085  C CG    . ASN B  2 325 ? 16.314  -32.532 -24.207 1.00 105.19 ? 325 ASN B CG    1 
ATOM   4086  O OD1   . ASN B  2 325 ? 16.137  -31.310 -24.260 1.00 107.52 ? 325 ASN B OD1   1 
ATOM   4087  N ND2   . ASN B  2 325 ? 17.124  -33.065 -23.276 1.00 89.26  ? 325 ASN B ND2   1 
ATOM   4088  N N     . LYS B  2 326 ? 14.820  -35.188 -22.364 1.00 91.21  ? 326 LYS B N     1 
ATOM   4089  C CA    . LYS B  2 326 ? 13.966  -35.241 -21.167 1.00 92.77  ? 326 LYS B CA    1 
ATOM   4090  C C     . LYS B  2 326 ? 13.536  -33.822 -20.762 1.00 98.40  ? 326 LYS B C     1 
ATOM   4091  O O     . LYS B  2 326 ? 14.336  -33.062 -20.207 1.00 98.25  ? 326 LYS B O     1 
ATOM   4092  C CB    . LYS B  2 326 ? 14.661  -35.976 -20.002 1.00 96.25  ? 326 LYS B CB    1 
ATOM   4093  N N     . GLY B  2 327 ? 12.280  -33.493 -21.079 1.00 95.72  ? 327 GLY B N     1 
ATOM   4094  C CA    . GLY B  2 327 ? 11.689  -32.183 -20.834 1.00 97.21  ? 327 GLY B CA    1 
ATOM   4095  C C     . GLY B  2 327 ? 10.964  -31.586 -22.027 1.00 102.66 ? 327 GLY B C     1 
ATOM   4096  O O     . GLY B  2 327 ? 10.231  -30.608 -21.852 1.00 102.18 ? 327 GLY B O     1 
ATOM   4097  N N     . LEU B  2 328 ? 11.164  -32.146 -23.250 1.00 100.37 ? 328 LEU B N     1 
ATOM   4098  C CA    . LEU B  2 328 ? 10.542  -31.642 -24.478 1.00 100.70 ? 328 LEU B CA    1 
ATOM   4099  C C     . LEU B  2 328 ? 9.370   -32.546 -24.953 1.00 105.57 ? 328 LEU B C     1 
ATOM   4100  O O     . LEU B  2 328 ? 9.402   -33.752 -24.683 1.00 104.87 ? 328 LEU B O     1 
ATOM   4101  C CB    . LEU B  2 328 ? 11.606  -31.478 -25.582 1.00 100.34 ? 328 LEU B CB    1 
ATOM   4102  C CG    . LEU B  2 328 ? 12.219  -30.077 -25.670 1.00 105.91 ? 328 LEU B CG    1 
ATOM   4103  C CD1   . LEU B  2 328 ? 13.549  -30.104 -26.368 1.00 105.84 ? 328 LEU B CD1   1 
ATOM   4104  C CD2   . LEU B  2 328 ? 11.286  -29.107 -26.402 1.00 109.35 ? 328 LEU B CD2   1 
ATOM   4105  N N     . PRO B  2 329 ? 8.349   -32.000 -25.680 1.00 102.66 ? 329 PRO B N     1 
ATOM   4106  C CA    . PRO B  2 329 ? 7.188   -32.827 -26.070 1.00 102.15 ? 329 PRO B CA    1 
ATOM   4107  C C     . PRO B  2 329 ? 7.366   -33.891 -27.158 1.00 105.05 ? 329 PRO B C     1 
ATOM   4108  O O     . PRO B  2 329 ? 6.640   -34.888 -27.115 1.00 104.37 ? 329 PRO B O     1 
ATOM   4109  C CB    . PRO B  2 329 ? 6.148   -31.790 -26.536 1.00 103.78 ? 329 PRO B CB    1 
ATOM   4110  C CG    . PRO B  2 329 ? 6.638   -30.486 -26.076 1.00 108.88 ? 329 PRO B CG    1 
ATOM   4111  C CD    . PRO B  2 329 ? 8.120   -30.589 -26.053 1.00 104.50 ? 329 PRO B CD    1 
ATOM   4112  N N     . SER B  2 330 ? 8.249   -33.668 -28.146 1.00 100.86 ? 330 SER B N     1 
ATOM   4113  C CA    . SER B  2 330 ? 8.420   -34.584 -29.287 1.00 99.81  ? 330 SER B CA    1 
ATOM   4114  C C     . SER B  2 330 ? 9.782   -35.332 -29.258 1.00 103.48 ? 330 SER B C     1 
ATOM   4115  O O     . SER B  2 330 ? 10.460  -35.350 -28.220 1.00 104.45 ? 330 SER B O     1 
ATOM   4116  C CB    . SER B  2 330 ? 8.257   -33.799 -30.594 1.00 102.08 ? 330 SER B CB    1 
ATOM   4117  N N     . SER B  2 331 ? 10.128  -36.013 -30.379 1.00 97.12  ? 331 SER B N     1 
ATOM   4118  C CA    . SER B  2 331 ? 11.405  -36.695 -30.582 1.00 95.30  ? 331 SER B CA    1 
ATOM   4119  C C     . SER B  2 331 ? 11.922  -36.289 -31.980 1.00 96.05  ? 331 SER B C     1 
ATOM   4120  O O     . SER B  2 331 ? 11.126  -36.219 -32.925 1.00 94.49  ? 331 SER B O     1 
ATOM   4121  C CB    . SER B  2 331 ? 11.258  -38.214 -30.470 1.00 20.00  ? 331 SER B CB    1 
ATOM   4122  O OG    . SER B  2 331 ? 10.388  -38.717 -31.468 1.00 20.00  ? 331 SER B OG    1 
ATOM   4123  N N     . ILE B  2 332 ? 13.233  -35.981 -32.095 1.00 90.79  ? 332 ILE B N     1 
ATOM   4124  C CA    . ILE B  2 332 ? 13.854  -35.558 -33.357 1.00 89.13  ? 332 ILE B CA    1 
ATOM   4125  C C     . ILE B  2 332 ? 14.436  -36.786 -34.064 1.00 89.50  ? 332 ILE B C     1 
ATOM   4126  O O     . ILE B  2 332 ? 15.373  -37.391 -33.547 1.00 88.58  ? 332 ILE B O     1 
ATOM   4127  C CB    . ILE B  2 332 ? 14.960  -34.499 -33.125 1.00 93.17  ? 332 ILE B CB    1 
ATOM   4128  C CG1   . ILE B  2 332 ? 14.509  -33.366 -32.173 1.00 94.67  ? 332 ILE B CG1   1 
ATOM   4129  C CG2   . ILE B  2 332 ? 15.424  -33.913 -34.459 1.00 93.73  ? 332 ILE B CG2   1 
ATOM   4130  C CD1   . ILE B  2 332 ? 15.558  -33.037 -31.076 1.00 103.12 ? 332 ILE B CD1   1 
ATOM   4131  N N     . GLU B  2 333 ? 13.889  -37.139 -35.243 1.00 83.86  ? 333 GLU B N     1 
ATOM   4132  C CA    . GLU B  2 333 ? 14.301  -38.291 -36.053 1.00 82.02  ? 333 GLU B CA    1 
ATOM   4133  C C     . GLU B  2 333 ? 15.104  -37.888 -37.309 1.00 83.75  ? 333 GLU B C     1 
ATOM   4134  O O     . GLU B  2 333 ? 14.647  -37.043 -38.072 1.00 82.68  ? 333 GLU B O     1 
ATOM   4135  C CB    . GLU B  2 333 ? 13.057  -39.083 -36.486 1.00 82.71  ? 333 GLU B CB    1 
ATOM   4136  C CG    . GLU B  2 333 ? 12.306  -39.737 -35.340 1.00 94.34  ? 333 GLU B CG    1 
ATOM   4137  C CD    . GLU B  2 333 ? 10.824  -39.925 -35.607 1.00 124.57 ? 333 GLU B CD    1 
ATOM   4138  O OE1   . GLU B  2 333 ? 10.459  -40.924 -36.269 1.00 121.28 ? 333 GLU B OE1   1 
ATOM   4139  O OE2   . GLU B  2 333 ? 10.027  -39.064 -35.167 1.00 122.33 ? 333 GLU B OE2   1 
ATOM   4140  N N     . LYS B  2 334 ? 16.268  -38.534 -37.549 1.00 79.08  ? 334 LYS B N     1 
ATOM   4141  C CA    . LYS B  2 334 ? 17.117  -38.306 -38.738 1.00 76.93  ? 334 LYS B CA    1 
ATOM   4142  C C     . LYS B  2 334 ? 17.405  -39.656 -39.395 1.00 77.48  ? 334 LYS B C     1 
ATOM   4143  O O     . LYS B  2 334 ? 17.584  -40.639 -38.683 1.00 77.52  ? 334 LYS B O     1 
ATOM   4144  C CB    . LYS B  2 334 ? 18.432  -37.599 -38.356 1.00 79.94  ? 334 LYS B CB    1 
ATOM   4145  N N     . THR B  2 335 ? 17.401  -39.723 -40.739 1.00 70.98  ? 335 THR B N     1 
ATOM   4146  C CA    . THR B  2 335 ? 17.645  -40.968 -41.474 1.00 68.98  ? 335 THR B CA    1 
ATOM   4147  C C     . THR B  2 335 ? 18.684  -40.786 -42.569 1.00 69.75  ? 335 THR B C     1 
ATOM   4148  O O     . THR B  2 335 ? 18.627  -39.800 -43.312 1.00 67.90  ? 335 THR B O     1 
ATOM   4149  C CB    . THR B  2 335 ? 16.364  -41.517 -42.112 1.00 74.29  ? 335 THR B CB    1 
ATOM   4150  O OG1   . THR B  2 335 ? 15.864  -40.592 -43.076 1.00 82.37  ? 335 THR B OG1   1 
ATOM   4151  C CG2   . THR B  2 335 ? 15.313  -41.812 -41.109 1.00 70.46  ? 335 THR B CG2   1 
ATOM   4152  N N     . ILE B  2 336 ? 19.590  -41.783 -42.708 1.00 64.73  ? 336 ILE B N     1 
ATOM   4153  C CA    . ILE B  2 336 ? 20.622  -41.810 -43.744 1.00 63.17  ? 336 ILE B CA    1 
ATOM   4154  C C     . ILE B  2 336 ? 20.775  -43.207 -44.296 1.00 67.04  ? 336 ILE B C     1 
ATOM   4155  O O     . ILE B  2 336 ? 20.505  -44.205 -43.616 1.00 65.96  ? 336 ILE B O     1 
ATOM   4156  C CB    . ILE B  2 336 ? 22.003  -41.248 -43.281 1.00 66.14  ? 336 ILE B CB    1 
ATOM   4157  C CG1   . ILE B  2 336 ? 22.653  -42.126 -42.192 1.00 66.43  ? 336 ILE B CG1   1 
ATOM   4158  C CG2   . ILE B  2 336 ? 21.868  -39.796 -42.824 1.00 67.82  ? 336 ILE B CG2   1 
ATOM   4159  C CD1   . ILE B  2 336 ? 24.078  -41.841 -41.975 1.00 72.76  ? 336 ILE B CD1   1 
ATOM   4160  N N     . SER B  2 337 ? 21.308  -43.263 -45.507 1.00 63.71  ? 337 SER B N     1 
ATOM   4161  C CA    . SER B  2 337 ? 21.550  -44.496 -46.217 1.00 63.00  ? 337 SER B CA    1 
ATOM   4162  C C     . SER B  2 337 ? 22.453  -44.231 -47.405 1.00 67.50  ? 337 SER B C     1 
ATOM   4163  O O     . SER B  2 337 ? 22.566  -43.086 -47.860 1.00 66.32  ? 337 SER B O     1 
ATOM   4164  C CB    . SER B  2 337 ? 20.229  -45.077 -46.716 1.00 64.97  ? 337 SER B CB    1 
ATOM   4165  O OG    . SER B  2 337 ? 19.533  -44.167 -47.546 1.00 68.78  ? 337 SER B OG    1 
ATOM   4166  N N     . LYS B  2 338 ? 23.055  -45.298 -47.943 1.00 64.36  ? 338 LYS B N     1 
ATOM   4167  C CA    . LYS B  2 338 ? 23.846  -45.193 -49.163 1.00 64.44  ? 338 LYS B CA    1 
ATOM   4168  C C     . LYS B  2 338 ? 22.852  -44.854 -50.288 1.00 70.81  ? 338 LYS B C     1 
ATOM   4169  O O     . LYS B  2 338 ? 21.718  -45.336 -50.268 1.00 69.93  ? 338 LYS B O     1 
ATOM   4170  C CB    . LYS B  2 338 ? 24.594  -46.496 -49.457 1.00 66.37  ? 338 LYS B CB    1 
ATOM   4171  C CG    . LYS B  2 338 ? 25.544  -46.392 -50.619 1.00 64.26  ? 338 LYS B CG    1 
ATOM   4172  C CD    . LYS B  2 338 ? 26.377  -47.650 -50.794 1.00 70.78  ? 338 LYS B CD    1 
ATOM   4173  C CE    . LYS B  2 338 ? 27.487  -47.478 -51.809 1.00 73.96  ? 338 LYS B CE    1 
ATOM   4174  N NZ    . LYS B  2 338 ? 27.032  -46.778 -53.045 1.00 89.80  ? 338 LYS B NZ    1 
ATOM   4175  N N     . ALA B  2 339 ? 23.247  -43.963 -51.204 1.00 70.31  ? 339 ALA B N     1 
ATOM   4176  C CA    . ALA B  2 339 ? 22.387  -43.509 -52.300 1.00 70.33  ? 339 ALA B CA    1 
ATOM   4177  C C     . ALA B  2 339 ? 21.882  -44.662 -53.149 1.00 72.50  ? 339 ALA B C     1 
ATOM   4178  O O     . ALA B  2 339 ? 20.680  -44.905 -53.205 1.00 73.15  ? 339 ALA B O     1 
ATOM   4179  C CB    . ALA B  2 339 ? 23.157  -42.520 -53.171 1.00 71.74  ? 339 ALA B CB    1 
ATOM   4180  N N     . LYS B  2 340 ? 22.808  -45.400 -53.753 1.00 67.96  ? 340 LYS B N     1 
ATOM   4181  C CA    . LYS B  2 340 ? 22.506  -46.546 -54.614 1.00 67.02  ? 340 LYS B CA    1 
ATOM   4182  C C     . LYS B  2 340 ? 23.007  -47.799 -53.883 1.00 67.00  ? 340 LYS B C     1 
ATOM   4183  O O     . LYS B  2 340 ? 24.215  -47.980 -53.738 1.00 65.93  ? 340 LYS B O     1 
ATOM   4184  C CB    . LYS B  2 340 ? 23.196  -46.402 -55.993 1.00 69.51  ? 340 LYS B CB    1 
ATOM   4185  N N     . GLY B  2 341 ? 22.069  -48.598 -53.368 1.00 60.31  ? 341 GLY B N     1 
ATOM   4186  C CA    . GLY B  2 341 ? 22.377  -49.832 -52.659 1.00 57.98  ? 341 GLY B CA    1 
ATOM   4187  C C     . GLY B  2 341 ? 22.642  -51.010 -53.578 1.00 56.43  ? 341 GLY B C     1 
ATOM   4188  O O     . GLY B  2 341 ? 22.170  -51.056 -54.716 1.00 55.96  ? 341 GLY B O     1 
ATOM   4189  N N     . GLN B  2 342 ? 23.414  -51.956 -53.086 1.00 51.00  ? 342 GLN B N     1 
ATOM   4190  C CA    . GLN B  2 342 ? 23.781  -53.185 -53.786 1.00 50.11  ? 342 GLN B CA    1 
ATOM   4191  C C     . GLN B  2 342 ? 22.811  -54.289 -53.301 1.00 51.55  ? 342 GLN B C     1 
ATOM   4192  O O     . GLN B  2 342 ? 22.945  -54.779 -52.187 1.00 49.60  ? 342 GLN B O     1 
ATOM   4193  C CB    . GLN B  2 342 ? 25.219  -53.592 -53.436 1.00 51.95  ? 342 GLN B CB    1 
ATOM   4194  N N     . PRO B  2 343 ? 21.808  -54.698 -54.075 1.00 48.18  ? 343 PRO B N     1 
ATOM   4195  C CA    . PRO B  2 343 ? 20.911  -55.757 -53.573 1.00 47.28  ? 343 PRO B CA    1 
ATOM   4196  C C     . PRO B  2 343 ? 21.572  -57.139 -53.444 1.00 46.89  ? 343 PRO B C     1 
ATOM   4197  O O     . PRO B  2 343 ? 22.688  -57.341 -53.928 1.00 44.57  ? 343 PRO B O     1 
ATOM   4198  C CB    . PRO B  2 343 ? 19.783  -55.733 -54.593 1.00 48.97  ? 343 PRO B CB    1 
ATOM   4199  C CG    . PRO B  2 343 ? 20.492  -55.377 -55.867 1.00 53.41  ? 343 PRO B CG    1 
ATOM   4200  C CD    . PRO B  2 343 ? 21.428  -54.275 -55.440 1.00 48.30  ? 343 PRO B CD    1 
ATOM   4201  N N     . ARG B  2 344 ? 20.938  -58.058 -52.690 1.00 42.67  ? 344 ARG B N     1 
ATOM   4202  C CA    . ARG B  2 344 ? 21.422  -59.438 -52.536 1.00 43.34  ? 344 ARG B CA    1 
ATOM   4203  C C     . ARG B  2 344 ? 20.458  -60.357 -53.305 1.00 47.48  ? 344 ARG B C     1 
ATOM   4204  O O     . ARG B  2 344 ? 19.238  -60.215 -53.234 1.00 47.30  ? 344 ARG B O     1 
ATOM   4205  C CB    . ARG B  2 344 ? 21.511  -59.886 -51.076 1.00 45.01  ? 344 ARG B CB    1 
ATOM   4206  C CG    . ARG B  2 344 ? 22.396  -59.028 -50.183 1.00 50.88  ? 344 ARG B CG    1 
ATOM   4207  C CD    . ARG B  2 344 ? 22.593  -59.723 -48.824 1.00 65.13  ? 344 ARG B CD    1 
ATOM   4208  N NE    . ARG B  2 344 ? 22.666  -58.794 -47.688 1.00 69.63  ? 344 ARG B NE    1 
ATOM   4209  C CZ    . ARG B  2 344 ? 23.029  -59.119 -46.442 1.00 83.40  ? 344 ARG B CZ    1 
ATOM   4210  N NH1   . ARG B  2 344 ? 23.347  -60.374 -46.138 1.00 63.31  ? 344 ARG B NH1   1 
ATOM   4211  N NH2   . ARG B  2 344 ? 23.095  -58.184 -45.494 1.00 74.59  ? 344 ARG B NH2   1 
ATOM   4212  N N     . GLU B  2 345 ? 21.012  -61.240 -54.081 1.00 45.42  ? 345 GLU B N     1 
ATOM   4213  C CA    . GLU B  2 345 ? 20.256  -62.146 -54.935 1.00 46.03  ? 345 GLU B CA    1 
ATOM   4214  C C     . GLU B  2 345 ? 19.560  -63.284 -54.167 1.00 48.47  ? 345 GLU B C     1 
ATOM   4215  O O     . GLU B  2 345 ? 20.218  -64.015 -53.413 1.00 50.32  ? 345 GLU B O     1 
ATOM   4216  C CB    . GLU B  2 345 ? 21.215  -62.774 -55.966 1.00 47.74  ? 345 GLU B CB    1 
ATOM   4217  C CG    . GLU B  2 345 ? 20.526  -63.577 -57.042 1.00 60.54  ? 345 GLU B CG    1 
ATOM   4218  C CD    . GLU B  2 345 ? 21.400  -63.827 -58.258 1.00 79.28  ? 345 GLU B CD    1 
ATOM   4219  O OE1   . GLU B  2 345 ? 21.624  -62.874 -59.040 1.00 79.99  ? 345 GLU B OE1   1 
ATOM   4220  O OE2   . GLU B  2 345 ? 21.895  -64.967 -58.406 1.00 63.76  ? 345 GLU B OE2   1 
ATOM   4221  N N     . PRO B  2 346 ? 18.266  -63.535 -54.427 1.00 43.39  ? 346 PRO B N     1 
ATOM   4222  C CA    . PRO B  2 346 ? 17.637  -64.716 -53.842 1.00 42.38  ? 346 PRO B CA    1 
ATOM   4223  C C     . PRO B  2 346 ? 18.232  -66.035 -54.333 1.00 44.03  ? 346 PRO B C     1 
ATOM   4224  O O     . PRO B  2 346 ? 18.541  -66.195 -55.510 1.00 42.28  ? 346 PRO B O     1 
ATOM   4225  C CB    . PRO B  2 346 ? 16.182  -64.630 -54.301 1.00 43.82  ? 346 PRO B CB    1 
ATOM   4226  C CG    . PRO B  2 346 ? 16.060  -63.463 -55.106 1.00 48.55  ? 346 PRO B CG    1 
ATOM   4227  C CD    . PRO B  2 346 ? 17.333  -62.791 -55.286 1.00 44.53  ? 346 PRO B CD    1 
ATOM   4228  N N     . GLN B  2 347 ? 18.358  -66.976 -53.415 1.00 43.01  ? 347 GLN B N     1 
ATOM   4229  C CA    . GLN B  2 347 ? 18.715  -68.382 -53.653 1.00 43.10  ? 347 GLN B CA    1 
ATOM   4230  C C     . GLN B  2 347 ? 17.367  -69.118 -53.529 1.00 46.27  ? 347 GLN B C     1 
ATOM   4231  O O     . GLN B  2 347 ? 16.643  -68.838 -52.573 1.00 45.39  ? 347 GLN B O     1 
ATOM   4232  C CB    . GLN B  2 347 ? 19.654  -68.876 -52.555 1.00 45.39  ? 347 GLN B CB    1 
ATOM   4233  C CG    . GLN B  2 347 ? 21.012  -68.146 -52.497 1.00 58.03  ? 347 GLN B CG    1 
ATOM   4234  C CD    . GLN B  2 347 ? 21.615  -68.331 -51.119 1.00 80.40  ? 347 GLN B CD    1 
ATOM   4235  O OE1   . GLN B  2 347 ? 21.618  -69.443 -50.561 1.00 82.13  ? 347 GLN B OE1   1 
ATOM   4236  N NE2   . GLN B  2 347 ? 22.089  -67.250 -50.512 1.00 63.70  ? 347 GLN B NE2   1 
ATOM   4237  N N     . VAL B  2 348 ? 16.994  -69.956 -54.518 1.00 41.33  ? 348 VAL B N     1 
ATOM   4238  C CA    . VAL B  2 348 ? 15.717  -70.661 -54.562 1.00 40.81  ? 348 VAL B CA    1 
ATOM   4239  C C     . VAL B  2 348 ? 15.909  -72.173 -54.468 1.00 45.10  ? 348 VAL B C     1 
ATOM   4240  O O     . VAL B  2 348 ? 16.619  -72.735 -55.268 1.00 45.19  ? 348 VAL B O     1 
ATOM   4241  C CB    . VAL B  2 348 ? 14.944  -70.272 -55.857 1.00 44.01  ? 348 VAL B CB    1 
ATOM   4242  C CG1   . VAL B  2 348 ? 13.570  -70.933 -55.906 1.00 43.14  ? 348 VAL B CG1   1 
ATOM   4243  C CG2   . VAL B  2 348 ? 14.816  -68.749 -55.985 1.00 42.91  ? 348 VAL B CG2   1 
ATOM   4244  N N     . TYR B  2 349 ? 15.242  -72.827 -53.517 1.00 41.82  ? 349 TYR B N     1 
ATOM   4245  C CA    . TYR B  2 349 ? 15.299  -74.290 -53.338 1.00 41.86  ? 349 TYR B CA    1 
ATOM   4246  C C     . TYR B  2 349 ? 13.881  -74.874 -53.214 1.00 43.43  ? 349 TYR B C     1 
ATOM   4247  O O     . TYR B  2 349 ? 13.083  -74.344 -52.472 1.00 42.99  ? 349 TYR B O     1 
ATOM   4248  C CB    . TYR B  2 349 ? 16.066  -74.669 -52.077 1.00 42.60  ? 349 TYR B CB    1 
ATOM   4249  C CG    . TYR B  2 349 ? 17.435  -74.049 -51.993 1.00 45.49  ? 349 TYR B CG    1 
ATOM   4250  C CD1   . TYR B  2 349 ? 18.516  -74.606 -52.664 1.00 47.11  ? 349 TYR B CD1   1 
ATOM   4251  C CD2   . TYR B  2 349 ? 17.653  -72.901 -51.247 1.00 46.24  ? 349 TYR B CD2   1 
ATOM   4252  C CE1   . TYR B  2 349 ? 19.765  -74.017 -52.620 1.00 47.96  ? 349 TYR B CE1   1 
ATOM   4253  C CE2   . TYR B  2 349 ? 18.901  -72.304 -51.194 1.00 46.87  ? 349 TYR B CE2   1 
ATOM   4254  C CZ    . TYR B  2 349 ? 19.953  -72.851 -51.899 1.00 55.00  ? 349 TYR B CZ    1 
ATOM   4255  O OH    . TYR B  2 349 ? 21.195  -72.254 -51.886 1.00 58.56  ? 349 TYR B OH    1 
ATOM   4256  N N     . THR B  2 350 ? 13.602  -75.961 -53.913 1.00 41.90  ? 350 THR B N     1 
ATOM   4257  C CA    . THR B  2 350 ? 12.336  -76.682 -53.888 1.00 41.40  ? 350 THR B CA    1 
ATOM   4258  C C     . THR B  2 350 ? 12.489  -77.928 -53.070 1.00 43.45  ? 350 THR B C     1 
ATOM   4259  O O     . THR B  2 350 ? 13.512  -78.591 -53.168 1.00 42.99  ? 350 THR B O     1 
ATOM   4260  C CB    . THR B  2 350 ? 11.878  -76.984 -55.311 1.00 50.18  ? 350 THR B CB    1 
ATOM   4261  O OG1   . THR B  2 350 ? 12.858  -77.768 -55.988 1.00 44.21  ? 350 THR B OG1   1 
ATOM   4262  C CG2   . THR B  2 350 ? 11.603  -75.721 -56.105 1.00 47.69  ? 350 THR B CG2   1 
ATOM   4263  N N     . LEU B  2 351 ? 11.521  -78.199 -52.195 1.00 41.09  ? 351 LEU B N     1 
ATOM   4264  C CA    . LEU B  2 351 ? 11.506  -79.360 -51.321 1.00 40.22  ? 351 LEU B CA    1 
ATOM   4265  C C     . LEU B  2 351 ? 10.257  -80.191 -51.584 1.00 43.03  ? 351 LEU B C     1 
ATOM   4266  O O     . LEU B  2 351 ? 9.143   -79.660 -51.553 1.00 42.50  ? 351 LEU B O     1 
ATOM   4267  C CB    . LEU B  2 351 ? 11.547  -78.947 -49.828 1.00 40.17  ? 351 LEU B CB    1 
ATOM   4268  C CG    . LEU B  2 351 ? 12.447  -77.768 -49.442 1.00 47.16  ? 351 LEU B CG    1 
ATOM   4269  C CD1   . LEU B  2 351 ? 12.409  -77.526 -47.958 1.00 47.60  ? 351 LEU B CD1   1 
ATOM   4270  C CD2   . LEU B  2 351 ? 13.890  -78.000 -49.826 1.00 53.05  ? 351 LEU B CD2   1 
ATOM   4271  N N     . PRO B  2 352 ? 10.406  -81.506 -51.835 1.00 40.30  ? 352 PRO B N     1 
ATOM   4272  C CA    . PRO B  2 352 ? 9.216   -82.361 -52.015 1.00 38.76  ? 352 PRO B CA    1 
ATOM   4273  C C     . PRO B  2 352 ? 8.408   -82.553 -50.719 1.00 41.32  ? 352 PRO B C     1 
ATOM   4274  O O     . PRO B  2 352 ? 8.795   -82.083 -49.643 1.00 36.43  ? 352 PRO B O     1 
ATOM   4275  C CB    . PRO B  2 352 ? 9.814   -83.698 -52.501 1.00 40.29  ? 352 PRO B CB    1 
ATOM   4276  C CG    . PRO B  2 352 ? 11.143  -83.737 -51.913 1.00 45.32  ? 352 PRO B CG    1 
ATOM   4277  C CD    . PRO B  2 352 ? 11.648  -82.308 -51.894 1.00 41.70  ? 352 PRO B CD    1 
ATOM   4278  N N     . PRO B  2 353 ? 7.226   -83.198 -50.811 1.00 41.81  ? 353 PRO B N     1 
ATOM   4279  C CA    . PRO B  2 353 ? 6.456   -83.440 -49.597 1.00 43.13  ? 353 PRO B CA    1 
ATOM   4280  C C     . PRO B  2 353 ? 7.178   -84.361 -48.610 1.00 49.81  ? 353 PRO B C     1 
ATOM   4281  O O     . PRO B  2 353 ? 7.803   -85.325 -49.023 1.00 48.55  ? 353 PRO B O     1 
ATOM   4282  C CB    . PRO B  2 353 ? 5.196   -84.156 -50.099 1.00 43.85  ? 353 PRO B CB    1 
ATOM   4283  C CG    . PRO B  2 353 ? 5.181   -84.012 -51.546 1.00 47.53  ? 353 PRO B CG    1 
ATOM   4284  C CD    . PRO B  2 353 ? 6.583   -83.820 -51.983 1.00 44.20  ? 353 PRO B CD    1 
ATOM   4285  N N     . SER B  2 354 ? 7.053   -84.089 -47.316 1.00 48.76  ? 354 SER B N     1 
ATOM   4286  C CA    . SER B  2 354 ? 7.528   -85.001 -46.278 1.00 50.20  ? 354 SER B CA    1 
ATOM   4287  C C     . SER B  2 354 ? 6.958   -86.410 -46.557 1.00 55.85  ? 354 SER B C     1 
ATOM   4288  O O     . SER B  2 354 ? 5.828   -86.541 -47.065 1.00 55.10  ? 354 SER B O     1 
ATOM   4289  C CB    . SER B  2 354 ? 7.021   -84.542 -44.908 1.00 55.91  ? 354 SER B CB    1 
ATOM   4290  O OG    . SER B  2 354 ? 7.115   -85.540 -43.905 1.00 71.39  ? 354 SER B OG    1 
ATOM   4291  N N     . GLN B  2 355 ? 7.719   -87.452 -46.208 1.00 54.12  ? 355 GLN B N     1 
ATOM   4292  C CA    . GLN B  2 355 ? 7.260   -88.841 -46.368 1.00 55.24  ? 355 GLN B CA    1 
ATOM   4293  C C     . GLN B  2 355 ? 5.967   -89.075 -45.576 1.00 54.88  ? 355 GLN B C     1 
ATOM   4294  O O     . GLN B  2 355 ? 5.060   -89.718 -46.095 1.00 54.21  ? 355 GLN B O     1 
ATOM   4295  C CB    . GLN B  2 355 ? 8.378   -89.799 -45.915 1.00 58.40  ? 355 GLN B CB    1 
ATOM   4296  C CG    . GLN B  2 355 ? 8.192   -91.281 -46.237 1.00 89.13  ? 355 GLN B CG    1 
ATOM   4297  C CD    . GLN B  2 355 ? 9.059   -92.192 -45.366 1.00 108.26 ? 355 GLN B CD    1 
ATOM   4298  O OE1   . GLN B  2 355 ? 8.589   -93.221 -44.846 1.00 103.01 ? 355 GLN B OE1   1 
ATOM   4299  N NE2   . GLN B  2 355 ? 10.356  -91.885 -45.236 1.00 91.00  ? 355 GLN B NE2   1 
ATOM   4300  N N     . GLU B  2 356 ? 5.842   -88.478 -44.377 1.00 50.64  ? 356 GLU B N     1 
ATOM   4301  C CA    . GLU B  2 356 ? 4.641   -88.625 -43.535 1.00 51.99  ? 356 GLU B CA    1 
ATOM   4302  C C     . GLU B  2 356 ? 3.413   -87.934 -44.090 1.00 55.43  ? 356 GLU B C     1 
ATOM   4303  O O     . GLU B  2 356 ? 2.291   -88.356 -43.780 1.00 54.93  ? 356 GLU B O     1 
ATOM   4304  C CB    . GLU B  2 356 ? 4.899   -88.154 -42.079 1.00 54.13  ? 356 GLU B CB    1 
ATOM   4305  C CG    . GLU B  2 356 ? 6.158   -88.739 -41.431 1.00 71.69  ? 356 GLU B CG    1 
ATOM   4306  C CD    . GLU B  2 356 ? 6.479   -90.192 -41.770 1.00 105.70 ? 356 GLU B CD    1 
ATOM   4307  O OE1   . GLU B  2 356 ? 5.655   -91.070 -41.420 1.00 117.06 ? 356 GLU B OE1   1 
ATOM   4308  O OE2   . GLU B  2 356 ? 7.528   -90.452 -42.410 1.00 88.07  ? 356 GLU B OE2   1 
ATOM   4309  N N     . GLU B  2 357 ? 3.600   -86.870 -44.897 1.00 50.63  ? 357 GLU B N     1 
ATOM   4310  C CA    . GLU B  2 357 ? 2.466   -86.177 -45.514 1.00 49.66  ? 357 GLU B CA    1 
ATOM   4311  C C     . GLU B  2 357 ? 1.944   -87.005 -46.711 1.00 52.32  ? 357 GLU B C     1 
ATOM   4312  O O     . GLU B  2 357 ? 0.778   -86.901 -47.034 1.00 51.61  ? 357 GLU B O     1 
ATOM   4313  C CB    . GLU B  2 357 ? 2.880   -84.752 -45.944 1.00 50.27  ? 357 GLU B CB    1 
ATOM   4314  C CG    . GLU B  2 357 ? 1.714   -83.833 -46.280 1.00 53.13  ? 357 GLU B CG    1 
ATOM   4315  C CD    . GLU B  2 357 ? 2.100   -82.484 -46.857 1.00 56.75  ? 357 GLU B CD    1 
ATOM   4316  O OE1   . GLU B  2 357 ? 3.075   -82.408 -47.642 1.00 49.19  ? 357 GLU B OE1   1 
ATOM   4317  O OE2   . GLU B  2 357 ? 1.334   -81.523 -46.633 1.00 42.65  ? 357 GLU B OE2   1 
ATOM   4318  N N     . MET B  2 358 ? 2.764   -87.898 -47.292 1.00 49.68  ? 358 MET B N     1 
ATOM   4319  C CA    . MET B  2 358 ? 2.357   -88.749 -48.425 1.00 49.95  ? 358 MET B CA    1 
ATOM   4320  C C     . MET B  2 358 ? 1.258   -89.777 -48.098 1.00 56.46  ? 358 MET B C     1 
ATOM   4321  O O     . MET B  2 358 ? 0.765   -90.417 -49.017 1.00 56.89  ? 358 MET B O     1 
ATOM   4322  C CB    . MET B  2 358 ? 3.571   -89.444 -49.064 1.00 51.96  ? 358 MET B CB    1 
ATOM   4323  C CG    . MET B  2 358 ? 4.568   -88.461 -49.694 1.00 54.61  ? 358 MET B CG    1 
ATOM   4324  S SD    . MET B  2 358 ? 3.991   -87.811 -51.280 1.00 57.71  ? 358 MET B SD    1 
ATOM   4325  C CE    . MET B  2 358 ? 4.041   -89.289 -52.286 1.00 54.81  ? 358 MET B CE    1 
ATOM   4326  N N     . THR B  2 359 ? 0.823   -89.887 -46.823 1.00 52.98  ? 359 THR B N     1 
ATOM   4327  C CA    . THR B  2 359 ? -0.314  -90.722 -46.435 1.00 53.15  ? 359 THR B CA    1 
ATOM   4328  C C     . THR B  2 359 ? -1.635  -89.938 -46.636 1.00 56.89  ? 359 THR B C     1 
ATOM   4329  O O     . THR B  2 359 ? -2.711  -90.532 -46.635 1.00 56.60  ? 359 THR B O     1 
ATOM   4330  C CB    . THR B  2 359 ? -0.134  -91.202 -44.962 1.00 62.28  ? 359 THR B CB    1 
ATOM   4331  O OG1   . THR B  2 359 ? -0.226  -90.088 -44.052 1.00 62.17  ? 359 THR B OG1   1 
ATOM   4332  C CG2   . THR B  2 359 ? 1.197   -91.990 -44.747 1.00 54.10  ? 359 THR B CG2   1 
ATOM   4333  N N     . LYS B  2 360 ? -1.557  -88.606 -46.840 1.00 53.35  ? 360 LYS B N     1 
ATOM   4334  C CA    . LYS B  2 360 ? -2.735  -87.781 -47.037 1.00 52.19  ? 360 LYS B CA    1 
ATOM   4335  C C     . LYS B  2 360 ? -3.194  -87.717 -48.512 1.00 51.86  ? 360 LYS B C     1 
ATOM   4336  O O     . LYS B  2 360 ? -2.504  -88.214 -49.397 1.00 49.19  ? 360 LYS B O     1 
ATOM   4337  C CB    . LYS B  2 360 ? -2.465  -86.383 -46.474 1.00 56.26  ? 360 LYS B CB    1 
ATOM   4338  C CG    . LYS B  2 360 ? -2.235  -86.388 -44.951 1.00 77.46  ? 360 LYS B CG    1 
ATOM   4339  C CD    . LYS B  2 360 ? -3.360  -85.655 -44.212 1.00 91.35  ? 360 LYS B CD    1 
ATOM   4340  C CE    . LYS B  2 360 ? -3.400  -85.950 -42.732 1.00 106.08 ? 360 LYS B CE    1 
ATOM   4341  N NZ    . LYS B  2 360 ? -4.612  -85.367 -42.090 1.00 118.39 ? 360 LYS B NZ    1 
ATOM   4342  N N     . ASN B  2 361 ? -4.396  -87.140 -48.747 1.00 49.21  ? 361 ASN B N     1 
ATOM   4343  C CA    . ASN B  2 361 ? -5.004  -86.937 -50.079 1.00 50.43  ? 361 ASN B CA    1 
ATOM   4344  C C     . ASN B  2 361 ? -4.357  -85.740 -50.788 1.00 53.31  ? 361 ASN B C     1 
ATOM   4345  O O     . ASN B  2 361 ? -4.353  -85.691 -52.020 1.00 52.20  ? 361 ASN B O     1 
ATOM   4346  C CB    . ASN B  2 361 ? -6.513  -86.691 -49.951 1.00 58.52  ? 361 ASN B CB    1 
ATOM   4347  C CG    . ASN B  2 361 ? -7.253  -86.472 -51.267 1.00 122.51 ? 361 ASN B CG    1 
ATOM   4348  O OD1   . ASN B  2 361 ? -6.991  -87.142 -52.276 1.00 126.96 ? 361 ASN B OD1   1 
ATOM   4349  N ND2   . ASN B  2 361 ? -8.209  -85.536 -51.291 1.00 120.69 ? 361 ASN B ND2   1 
ATOM   4350  N N     . GLN B  2 362 ? -3.905  -84.734 -50.000 1.00 48.91  ? 362 GLN B N     1 
ATOM   4351  C CA    . GLN B  2 362 ? -3.249  -83.532 -50.497 1.00 47.25  ? 362 GLN B CA    1 
ATOM   4352  C C     . GLN B  2 362 ? -1.885  -83.411 -49.864 1.00 47.27  ? 362 GLN B C     1 
ATOM   4353  O O     . GLN B  2 362 ? -1.718  -83.685 -48.668 1.00 46.44  ? 362 GLN B O     1 
ATOM   4354  C CB    . GLN B  2 362 ? -4.073  -82.293 -50.180 1.00 48.46  ? 362 GLN B CB    1 
ATOM   4355  C CG    . GLN B  2 362 ? -5.364  -82.240 -50.961 1.00 73.01  ? 362 GLN B CG    1 
ATOM   4356  C CD    . GLN B  2 362 ? -6.270  -81.237 -50.351 1.00 96.12  ? 362 GLN B CD    1 
ATOM   4357  O OE1   . GLN B  2 362 ? -6.391  -80.117 -50.854 1.00 99.32  ? 362 GLN B OE1   1 
ATOM   4358  N NE2   . GLN B  2 362 ? -6.861  -81.595 -49.211 1.00 81.31  ? 362 GLN B NE2   1 
ATOM   4359  N N     . VAL B  2 363 ? -0.907  -83.029 -50.683 1.00 42.19  ? 363 VAL B N     1 
ATOM   4360  C CA    . VAL B  2 363 ? 0.493   -82.863 -50.282 1.00 41.40  ? 363 VAL B CA    1 
ATOM   4361  C C     . VAL B  2 363 ? 0.953   -81.420 -50.533 1.00 42.99  ? 363 VAL B C     1 
ATOM   4362  O O     . VAL B  2 363 ? 0.379   -80.709 -51.349 1.00 41.12  ? 363 VAL B O     1 
ATOM   4363  C CB    . VAL B  2 363 ? 1.433   -83.920 -50.920 1.00 45.55  ? 363 VAL B CB    1 
ATOM   4364  C CG1   . VAL B  2 363 ? 1.071   -85.345 -50.462 1.00 45.89  ? 363 VAL B CG1   1 
ATOM   4365  C CG2   . VAL B  2 363 ? 1.458   -83.829 -52.440 1.00 45.23  ? 363 VAL B CG2   1 
ATOM   4366  N N     . SER B  2 364 ? 2.023   -81.028 -49.844 1.00 39.63  ? 364 SER B N     1 
ATOM   4367  C CA    . SER B  2 364 ? 2.615   -79.709 -49.899 1.00 37.11  ? 364 SER B CA    1 
ATOM   4368  C C     . SER B  2 364 ? 3.915   -79.728 -50.657 1.00 39.40  ? 364 SER B C     1 
ATOM   4369  O O     . SER B  2 364 ? 4.814   -80.507 -50.339 1.00 37.37  ? 364 SER B O     1 
ATOM   4370  C CB    . SER B  2 364 ? 2.923   -79.190 -48.506 1.00 36.47  ? 364 SER B CB    1 
ATOM   4371  O OG    . SER B  2 364 ? 1.774   -79.078 -47.688 1.00 39.32  ? 364 SER B OG    1 
ATOM   4372  N N     . LEU B  2 365 ? 4.047   -78.811 -51.612 1.00 37.34  ? 365 LEU B N     1 
ATOM   4373  C CA    . LEU B  2 365 ? 5.301   -78.592 -52.329 1.00 37.26  ? 365 LEU B CA    1 
ATOM   4374  C C     . LEU B  2 365 ? 5.815   -77.314 -51.740 1.00 37.28  ? 365 LEU B C     1 
ATOM   4375  O O     . LEU B  2 365 ? 5.052   -76.395 -51.581 1.00 35.42  ? 365 LEU B O     1 
ATOM   4376  C CB    . LEU B  2 365 ? 5.096   -78.466 -53.832 1.00 37.97  ? 365 LEU B CB    1 
ATOM   4377  C CG    . LEU B  2 365 ? 4.303   -79.604 -54.483 1.00 43.24  ? 365 LEU B CG    1 
ATOM   4378  C CD1   . LEU B  2 365 ? 4.457   -79.568 -55.990 1.00 43.77  ? 365 LEU B CD1   1 
ATOM   4379  C CD2   . LEU B  2 365 ? 4.735   -80.948 -53.964 1.00 45.83  ? 365 LEU B CD2   1 
ATOM   4380  N N     . THR B  2 366 ? 7.072   -77.297 -51.309 1.00 38.09  ? 366 THR B N     1 
ATOM   4381  C CA    . THR B  2 366 ? 7.692   -76.155 -50.633 1.00 37.30  ? 366 THR B CA    1 
ATOM   4382  C C     . THR B  2 366 ? 8.781   -75.513 -51.455 1.00 40.15  ? 366 THR B C     1 
ATOM   4383  O O     . THR B  2 366 ? 9.546   -76.196 -52.141 1.00 37.63  ? 366 THR B O     1 
ATOM   4384  C CB    . THR B  2 366 ? 8.286   -76.631 -49.316 1.00 39.01  ? 366 THR B CB    1 
ATOM   4385  O OG1   . THR B  2 366 ? 7.245   -77.241 -48.584 1.00 36.49  ? 366 THR B OG1   1 
ATOM   4386  C CG2   . THR B  2 366 ? 8.930   -75.503 -48.512 1.00 34.97  ? 366 THR B CG2   1 
ATOM   4387  N N     . CYS B  2 367 ? 8.864   -74.192 -51.336 1.00 39.34  ? 367 CYS B N     1 
ATOM   4388  C CA    . CYS B  2 367 ? 9.880   -73.392 -51.948 1.00 39.70  ? 367 CYS B CA    1 
ATOM   4389  C C     . CYS B  2 367 ? 10.523  -72.539 -50.883 1.00 42.15  ? 367 CYS B C     1 
ATOM   4390  O O     . CYS B  2 367 ? 9.854   -71.685 -50.295 1.00 40.07  ? 367 CYS B O     1 
ATOM   4391  C CB    . CYS B  2 367 ? 9.310   -72.527 -53.052 1.00 41.68  ? 367 CYS B CB    1 
ATOM   4392  S SG    . CYS B  2 367 ? 10.570  -71.755 -54.098 1.00 47.22  ? 367 CYS B SG    1 
ATOM   4393  N N     . LEU B  2 368 ? 11.814  -72.781 -50.620 1.00 39.24  ? 368 LEU B N     1 
ATOM   4394  C CA    . LEU B  2 368 ? 12.589  -71.958 -49.719 1.00 38.23  ? 368 LEU B CA    1 
ATOM   4395  C C     . LEU B  2 368 ? 13.322  -70.892 -50.592 1.00 39.84  ? 368 LEU B C     1 
ATOM   4396  O O     . LEU B  2 368 ? 14.002  -71.242 -51.537 1.00 36.82  ? 368 LEU B O     1 
ATOM   4397  C CB    . LEU B  2 368 ? 13.577  -72.814 -48.945 1.00 38.73  ? 368 LEU B CB    1 
ATOM   4398  C CG    . LEU B  2 368 ? 14.674  -72.071 -48.170 1.00 44.00  ? 368 LEU B CG    1 
ATOM   4399  C CD1   . LEU B  2 368 ? 14.072  -71.059 -47.159 1.00 41.82  ? 368 LEU B CD1   1 
ATOM   4400  C CD2   . LEU B  2 368 ? 15.628  -73.053 -47.533 1.00 46.47  ? 368 LEU B CD2   1 
ATOM   4401  N N     . VAL B  2 369 ? 13.099  -69.599 -50.297 1.00 37.96  ? 369 VAL B N     1 
ATOM   4402  C CA    . VAL B  2 369 ? 13.757  -68.483 -50.957 1.00 37.95  ? 369 VAL B CA    1 
ATOM   4403  C C     . VAL B  2 369 ? 14.549  -67.783 -49.850 1.00 40.86  ? 369 VAL B C     1 
ATOM   4404  O O     . VAL B  2 369 ? 13.971  -67.416 -48.838 1.00 39.95  ? 369 VAL B O     1 
ATOM   4405  C CB    . VAL B  2 369 ? 12.763  -67.517 -51.649 1.00 40.74  ? 369 VAL B CB    1 
ATOM   4406  C CG1   . VAL B  2 369 ? 13.507  -66.446 -52.439 1.00 41.13  ? 369 VAL B CG1   1 
ATOM   4407  C CG2   . VAL B  2 369 ? 11.811  -68.287 -52.546 1.00 40.05  ? 369 VAL B CG2   1 
ATOM   4408  N N     . LYS B  2 370 ? 15.858  -67.631 -50.014 1.00 39.42  ? 370 LYS B N     1 
ATOM   4409  C CA    . LYS B  2 370 ? 16.681  -67.023 -48.969 1.00 38.54  ? 370 LYS B CA    1 
ATOM   4410  C C     . LYS B  2 370 ? 17.804  -66.203 -49.539 1.00 41.80  ? 370 LYS B C     1 
ATOM   4411  O O     . LYS B  2 370 ? 18.058  -66.241 -50.735 1.00 41.13  ? 370 LYS B O     1 
ATOM   4412  C CB    . LYS B  2 370 ? 17.204  -68.099 -47.981 1.00 40.77  ? 370 LYS B CB    1 
ATOM   4413  C CG    . LYS B  2 370 ? 18.160  -69.127 -48.563 1.00 44.57  ? 370 LYS B CG    1 
ATOM   4414  C CD    . LYS B  2 370 ? 18.870  -69.966 -47.473 1.00 54.98  ? 370 LYS B CD    1 
ATOM   4415  C CE    . LYS B  2 370 ? 20.290  -70.356 -47.868 1.00 73.26  ? 370 LYS B CE    1 
ATOM   4416  N NZ    . LYS B  2 370 ? 20.969  -71.190 -46.838 1.00 86.04  ? 370 LYS B NZ    1 
ATOM   4417  N N     . GLY B  2 371 ? 18.429  -65.437 -48.666 1.00 39.10  ? 371 GLY B N     1 
ATOM   4418  C CA    . GLY B  2 371 ? 19.571  -64.623 -49.008 1.00 40.06  ? 371 GLY B CA    1 
ATOM   4419  C C     . GLY B  2 371 ? 19.304  -63.373 -49.821 1.00 43.45  ? 371 GLY B C     1 
ATOM   4420  O O     . GLY B  2 371 ? 20.225  -62.865 -50.460 1.00 44.09  ? 371 GLY B O     1 
ATOM   4421  N N     . PHE B  2 372 ? 18.101  -62.810 -49.727 1.00 37.83  ? 372 PHE B N     1 
ATOM   4422  C CA    . PHE B  2 372 ? 17.700  -61.647 -50.543 1.00 34.64  ? 372 PHE B CA    1 
ATOM   4423  C C     . PHE B  2 372 ? 17.558  -60.352 -49.789 1.00 37.58  ? 372 PHE B C     1 
ATOM   4424  O O     . PHE B  2 372 ? 17.302  -60.325 -48.590 1.00 38.02  ? 372 PHE B O     1 
ATOM   4425  C CB    . PHE B  2 372 ? 16.400  -61.924 -51.335 1.00 34.65  ? 372 PHE B CB    1 
ATOM   4426  C CG    . PHE B  2 372 ? 15.146  -62.253 -50.554 1.00 33.59  ? 372 PHE B CG    1 
ATOM   4427  C CD1   . PHE B  2 372 ? 14.222  -61.265 -50.235 1.00 33.09  ? 372 PHE B CD1   1 
ATOM   4428  C CD2   . PHE B  2 372 ? 14.836  -63.567 -50.237 1.00 33.02  ? 372 PHE B CD2   1 
ATOM   4429  C CE1   . PHE B  2 372 ? 13.069  -61.575 -49.537 1.00 34.16  ? 372 PHE B CE1   1 
ATOM   4430  C CE2   . PHE B  2 372 ? 13.683  -63.877 -49.537 1.00 34.07  ? 372 PHE B CE2   1 
ATOM   4431  C CZ    . PHE B  2 372 ? 12.774  -62.895 -49.239 1.00 33.26  ? 372 PHE B CZ    1 
ATOM   4432  N N     . TYR B  2 373 ? 17.797  -59.266 -50.517 1.00 34.61  ? 373 TYR B N     1 
ATOM   4433  C CA    . TYR B  2 373 ? 17.684  -57.901 -50.028 1.00 33.85  ? 373 TYR B CA    1 
ATOM   4434  C C     . TYR B  2 373 ? 17.529  -57.026 -51.269 1.00 36.94  ? 373 TYR B C     1 
ATOM   4435  O O     . TYR B  2 373 ? 18.287  -57.239 -52.201 1.00 35.68  ? 373 TYR B O     1 
ATOM   4436  C CB    . TYR B  2 373 ? 18.889  -57.461 -49.213 1.00 34.46  ? 373 TYR B CB    1 
ATOM   4437  C CG    . TYR B  2 373 ? 18.611  -56.135 -48.540 1.00 33.66  ? 373 TYR B CG    1 
ATOM   4438  C CD1   . TYR B  2 373 ? 17.877  -56.074 -47.360 1.00 33.70  ? 373 TYR B CD1   1 
ATOM   4439  C CD2   . TYR B  2 373 ? 18.854  -54.938 -49.204 1.00 34.25  ? 373 TYR B CD2   1 
ATOM   4440  C CE1   . TYR B  2 373 ? 17.457  -54.856 -46.829 1.00 30.77  ? 373 TYR B CE1   1 
ATOM   4441  C CE2   . TYR B  2 373 ? 18.387  -53.723 -48.710 1.00 32.71  ? 373 TYR B CE2   1 
ATOM   4442  C CZ    . TYR B  2 373 ? 17.695  -53.686 -47.520 1.00 34.26  ? 373 TYR B CZ    1 
ATOM   4443  O OH    . TYR B  2 373 ? 17.347  -52.465 -46.987 1.00 34.69  ? 373 TYR B OH    1 
ATOM   4444  N N     . PRO B  2 374 ? 16.525  -56.132 -51.380 1.00 36.21  ? 374 PRO B N     1 
ATOM   4445  C CA    . PRO B  2 374 ? 15.497  -55.795 -50.373 1.00 36.58  ? 374 PRO B CA    1 
ATOM   4446  C C     . PRO B  2 374 ? 14.488  -56.911 -50.142 1.00 36.55  ? 374 PRO B C     1 
ATOM   4447  O O     . PRO B  2 374 ? 14.510  -57.915 -50.822 1.00 35.87  ? 374 PRO B O     1 
ATOM   4448  C CB    . PRO B  2 374 ? 14.886  -54.495 -50.939 1.00 37.69  ? 374 PRO B CB    1 
ATOM   4449  C CG    . PRO B  2 374 ? 15.013  -54.630 -52.403 1.00 42.06  ? 374 PRO B CG    1 
ATOM   4450  C CD    . PRO B  2 374 ? 16.334  -55.340 -52.618 1.00 38.60  ? 374 PRO B CD    1 
ATOM   4451  N N     . SER B  2 375 ? 13.658  -56.746 -49.137 1.00 35.98  ? 375 SER B N     1 
ATOM   4452  C CA    . SER B  2 375 ? 12.583  -57.689 -48.776 1.00 35.00  ? 375 SER B CA    1 
ATOM   4453  C C     . SER B  2 375 ? 11.478  -57.786 -49.835 1.00 39.41  ? 375 SER B C     1 
ATOM   4454  O O     . SER B  2 375 ? 10.796  -58.806 -49.879 1.00 41.02  ? 375 SER B O     1 
ATOM   4455  C CB    . SER B  2 375 ? 11.959  -57.318 -47.442 1.00 35.26  ? 375 SER B CB    1 
ATOM   4456  O OG    . SER B  2 375 ? 11.230  -56.108 -47.565 1.00 48.87  ? 375 SER B OG    1 
ATOM   4457  N N     . ASP B  2 376 ? 11.288  -56.740 -50.657 1.00 35.03  ? 376 ASP B N     1 
ATOM   4458  C CA    . ASP B  2 376 ? 10.307  -56.714 -51.759 1.00 33.57  ? 376 ASP B CA    1 
ATOM   4459  C C     . ASP B  2 376 ? 10.534  -57.872 -52.752 1.00 36.05  ? 376 ASP B C     1 
ATOM   4460  O O     . ASP B  2 376 ? 11.496  -57.887 -53.496 1.00 35.80  ? 376 ASP B O     1 
ATOM   4461  C CB    . ASP B  2 376 ? 10.363  -55.363 -52.510 1.00 34.21  ? 376 ASP B CB    1 
ATOM   4462  C CG    . ASP B  2 376 ? 9.341   -55.176 -53.627 1.00 40.54  ? 376 ASP B CG    1 
ATOM   4463  O OD1   . ASP B  2 376 ? 8.345   -55.906 -53.642 1.00 42.45  ? 376 ASP B OD1   1 
ATOM   4464  O OD2   . ASP B  2 376 ? 9.519   -54.259 -54.454 1.00 45.36  ? 376 ASP B OD2   1 
ATOM   4465  N N     . ILE B  2 377 ? 9.624   -58.829 -52.766 1.00 32.83  ? 377 ILE B N     1 
ATOM   4466  C CA    . ILE B  2 377 ? 9.746   -59.991 -53.618 1.00 33.41  ? 377 ILE B CA    1 
ATOM   4467  C C     . ILE B  2 377 ? 8.364   -60.573 -53.883 1.00 37.18  ? 377 ILE B C     1 
ATOM   4468  O O     . ILE B  2 377 ? 7.404   -60.261 -53.172 1.00 33.11  ? 377 ILE B O     1 
ATOM   4469  C CB    . ILE B  2 377 ? 10.643  -61.012 -52.842 1.00 36.73  ? 377 ILE B CB    1 
ATOM   4470  C CG1   . ILE B  2 377 ? 11.220  -62.091 -53.755 1.00 36.69  ? 377 ILE B CG1   1 
ATOM   4471  C CG2   . ILE B  2 377 ? 9.903   -61.627 -51.638 1.00 36.63  ? 377 ILE B CG2   1 
ATOM   4472  C CD1   . ILE B  2 377 ? 12.402  -62.786 -53.149 1.00 47.17  ? 377 ILE B CD1   1 
ATOM   4473  N N     . ALA B  2 378 ? 8.267   -61.390 -54.921 1.00 35.13  ? 378 ALA B N     1 
ATOM   4474  C CA    . ALA B  2 378 ? 7.051   -62.128 -55.189 1.00 34.35  ? 378 ALA B CA    1 
ATOM   4475  C C     . ALA B  2 378 ? 7.381   -63.508 -55.613 1.00 35.72  ? 378 ALA B C     1 
ATOM   4476  O O     . ALA B  2 378 ? 8.356   -63.723 -56.322 1.00 35.26  ? 378 ALA B O     1 
ATOM   4477  C CB    . ALA B  2 378 ? 6.210   -61.458 -56.240 1.00 35.31  ? 378 ALA B CB    1 
ATOM   4478  N N     . VAL B  2 379 ? 6.541   -64.441 -55.200 1.00 31.50  ? 379 VAL B N     1 
ATOM   4479  C CA    . VAL B  2 379 ? 6.648   -65.827 -55.570 1.00 30.53  ? 379 VAL B CA    1 
ATOM   4480  C C     . VAL B  2 379 ? 5.327   -66.267 -56.229 1.00 32.08  ? 379 VAL B C     1 
ATOM   4481  O O     . VAL B  2 379 ? 4.264   -65.917 -55.757 1.00 30.15  ? 379 VAL B O     1 
ATOM   4482  C CB    . VAL B  2 379 ? 6.987   -66.712 -54.337 1.00 33.59  ? 379 VAL B CB    1 
ATOM   4483  C CG1   . VAL B  2 379 ? 7.267   -68.157 -54.754 1.00 32.44  ? 379 VAL B CG1   1 
ATOM   4484  C CG2   . VAL B  2 379 ? 8.174   -66.154 -53.586 1.00 33.81  ? 379 VAL B CG2   1 
ATOM   4485  N N     . GLU B  2 380 ? 5.416   -67.077 -57.270 1.00 30.38  ? 380 GLU B N     1 
ATOM   4486  C CA    . GLU B  2 380 ? 4.265   -67.682 -57.942 1.00 30.87  ? 380 GLU B CA    1 
ATOM   4487  C C     . GLU B  2 380 ? 4.625   -69.147 -58.167 1.00 33.09  ? 380 GLU B C     1 
ATOM   4488  O O     . GLU B  2 380 ? 5.802   -69.472 -58.133 1.00 33.36  ? 380 GLU B O     1 
ATOM   4489  C CB    . GLU B  2 380 ? 4.042   -67.078 -59.333 1.00 32.13  ? 380 GLU B CB    1 
ATOM   4490  C CG    . GLU B  2 380 ? 3.437   -65.719 -59.492 1.00 53.71  ? 380 GLU B CG    1 
ATOM   4491  C CD    . GLU B  2 380 ? 3.297   -65.390 -60.974 1.00 81.24  ? 380 GLU B CD    1 
ATOM   4492  O OE1   . GLU B  2 380 ? 2.150   -65.433 -61.478 1.00 84.15  ? 380 GLU B OE1   1 
ATOM   4493  O OE2   . GLU B  2 380 ? 4.338   -65.255 -61.662 1.00 68.64  ? 380 GLU B OE2   1 
ATOM   4494  N N     . TRP B  2 381 ? 3.646   -69.980 -58.536 1.00 30.75  ? 381 TRP B N     1 
ATOM   4495  C CA    . TRP B  2 381 ? 3.857   -71.382 -58.851 1.00 31.10  ? 381 TRP B CA    1 
ATOM   4496  C C     . TRP B  2 381 ? 3.216   -71.723 -60.177 1.00 32.81  ? 381 TRP B C     1 
ATOM   4497  O O     . TRP B  2 381 ? 2.215   -71.140 -60.559 1.00 32.31  ? 381 TRP B O     1 
ATOM   4498  C CB    . TRP B  2 381 ? 3.254   -72.308 -57.783 1.00 30.98  ? 381 TRP B CB    1 
ATOM   4499  C CG    . TRP B  2 381 ? 4.001   -72.369 -56.490 1.00 32.00  ? 381 TRP B CG    1 
ATOM   4500  C CD1   . TRP B  2 381 ? 3.787   -71.598 -55.388 1.00 33.92  ? 381 TRP B CD1   1 
ATOM   4501  C CD2   . TRP B  2 381 ? 4.954   -73.369 -56.102 1.00 31.77  ? 381 TRP B CD2   1 
ATOM   4502  N NE1   . TRP B  2 381 ? 4.598   -72.006 -54.365 1.00 33.38  ? 381 TRP B NE1   1 
ATOM   4503  C CE2   . TRP B  2 381 ? 5.281   -73.129 -54.752 1.00 35.01  ? 381 TRP B CE2   1 
ATOM   4504  C CE3   . TRP B  2 381 ? 5.456   -74.526 -56.720 1.00 33.55  ? 381 TRP B CE3   1 
ATOM   4505  C CZ2   . TRP B  2 381 ? 6.109   -73.986 -54.016 1.00 34.18  ? 381 TRP B CZ2   1 
ATOM   4506  C CZ3   . TRP B  2 381 ? 6.284   -75.362 -55.990 1.00 35.12  ? 381 TRP B CZ3   1 
ATOM   4507  C CH2   . TRP B  2 381 ? 6.676   -75.030 -54.683 1.00 35.21  ? 381 TRP B CH2   1 
ATOM   4508  N N     . GLU B  2 382 ? 3.747   -72.740 -60.826 1.00 31.03  ? 382 GLU B N     1 
ATOM   4509  C CA    . GLU B  2 382 ? 3.203   -73.260 -62.071 1.00 31.13  ? 382 GLU B CA    1 
ATOM   4510  C C     . GLU B  2 382 ? 3.213   -74.780 -62.039 1.00 31.20  ? 382 GLU B C     1 
ATOM   4511  O O     . GLU B  2 382 ? 3.953   -75.383 -61.277 1.00 29.83  ? 382 GLU B O     1 
ATOM   4512  C CB    . GLU B  2 382 ? 4.018   -72.807 -63.281 1.00 32.55  ? 382 GLU B CB    1 
ATOM   4513  C CG    . GLU B  2 382 ? 4.167   -71.290 -63.469 1.00 32.19  ? 382 GLU B CG    1 
ATOM   4514  C CD    . GLU B  2 382 ? 5.223   -70.605 -62.623 1.00 39.07  ? 382 GLU B CD    1 
ATOM   4515  O OE1   . GLU B  2 382 ? 6.332   -71.163 -62.546 1.00 38.17  ? 382 GLU B OE1   1 
ATOM   4516  O OE2   . GLU B  2 382 ? 4.963   -69.516 -62.055 1.00 35.52  ? 382 GLU B OE2   1 
ATOM   4517  N N     . SER B  2 383 ? 2.354   -75.382 -62.854 1.00 28.79  ? 383 SER B N     1 
ATOM   4518  C CA    . SER B  2 383 ? 2.257   -76.821 -63.053 1.00 30.03  ? 383 SER B CA    1 
ATOM   4519  C C     . SER B  2 383 ? 2.396   -77.051 -64.555 1.00 34.33  ? 383 SER B C     1 
ATOM   4520  O O     . SER B  2 383 ? 1.532   -76.619 -65.303 1.00 33.98  ? 383 SER B O     1 
ATOM   4521  C CB    . SER B  2 383 ? 0.927   -77.360 -62.538 1.00 30.78  ? 383 SER B CB    1 
ATOM   4522  O OG    . SER B  2 383 ? 0.793   -78.723 -62.874 1.00 45.14  ? 383 SER B OG    1 
ATOM   4523  N N     . ASN B  2 384 ? 3.501   -77.670 -65.004 1.00 34.45  ? 384 ASN B N     1 
ATOM   4524  C CA    . ASN B  2 384 ? 3.783   -77.916 -66.428 1.00 35.39  ? 384 ASN B CA    1 
ATOM   4525  C C     . ASN B  2 384 ? 3.811   -76.598 -67.210 1.00 36.73  ? 384 ASN B C     1 
ATOM   4526  O O     . ASN B  2 384 ? 3.446   -76.553 -68.371 1.00 38.72  ? 384 ASN B O     1 
ATOM   4527  C CB    . ASN B  2 384 ? 2.799   -78.927 -67.035 1.00 36.24  ? 384 ASN B CB    1 
ATOM   4528  C CG    . ASN B  2 384 ? 2.831   -80.252 -66.345 1.00 42.37  ? 384 ASN B CG    1 
ATOM   4529  O OD1   . ASN B  2 384 ? 3.873   -80.694 -65.845 1.00 43.31  ? 384 ASN B OD1   1 
ATOM   4530  N ND2   . ASN B  2 384 ? 1.676   -80.863 -66.162 1.00 40.08  ? 384 ASN B ND2   1 
ATOM   4531  N N     . GLY B  2 385 ? 4.225   -75.543 -66.524 1.00 30.00  ? 385 GLY B N     1 
ATOM   4532  C CA    . GLY B  2 385 ? 4.292   -74.187 -67.049 1.00 29.30  ? 385 GLY B CA    1 
ATOM   4533  C C     . GLY B  2 385 ? 3.058   -73.351 -66.825 1.00 31.83  ? 385 GLY B C     1 
ATOM   4534  O O     . GLY B  2 385 ? 3.121   -72.152 -66.992 1.00 30.17  ? 385 GLY B O     1 
ATOM   4535  N N     . GLN B  2 386 ? 1.920   -73.943 -66.443 1.00 31.91  ? 386 GLN B N     1 
ATOM   4536  C CA    . GLN B  2 386 ? 0.706   -73.151 -66.273 1.00 32.44  ? 386 GLN B CA    1 
ATOM   4537  C C     . GLN B  2 386 ? 0.585   -72.533 -64.851 1.00 37.39  ? 386 GLN B C     1 
ATOM   4538  O O     . GLN B  2 386 ? 0.592   -73.298 -63.885 1.00 37.13  ? 386 GLN B O     1 
ATOM   4539  C CB    . GLN B  2 386 ? -0.521  -74.033 -66.549 1.00 33.37  ? 386 GLN B CB    1 
ATOM   4540  C CG    . GLN B  2 386 ? -1.793  -73.184 -66.642 1.00 33.30  ? 386 GLN B CG    1 
ATOM   4541  C CD    . GLN B  2 386 ? -3.025  -74.031 -66.720 1.00 34.71  ? 386 GLN B CD    1 
ATOM   4542  O OE1   . GLN B  2 386 ? -2.988  -75.200 -67.077 1.00 33.61  ? 386 GLN B OE1   1 
ATOM   4543  N NE2   . GLN B  2 386 ? -4.175  -73.415 -66.492 1.00 37.12  ? 386 GLN B NE2   1 
ATOM   4544  N N     . PRO B  2 387 ? 0.439   -71.191 -64.725 1.00 32.29  ? 387 PRO B N     1 
ATOM   4545  C CA    . PRO B  2 387 ? 0.161   -70.573 -63.414 1.00 32.17  ? 387 PRO B CA    1 
ATOM   4546  C C     . PRO B  2 387 ? -0.887  -71.310 -62.564 1.00 38.51  ? 387 PRO B C     1 
ATOM   4547  O O     . PRO B  2 387 ? -1.980  -71.656 -63.035 1.00 37.80  ? 387 PRO B O     1 
ATOM   4548  C CB    . PRO B  2 387 ? -0.312  -69.159 -63.806 1.00 33.01  ? 387 PRO B CB    1 
ATOM   4549  C CG    . PRO B  2 387 ? 0.459   -68.887 -65.076 1.00 37.73  ? 387 PRO B CG    1 
ATOM   4550  C CD    . PRO B  2 387 ? 0.432   -70.172 -65.797 1.00 34.42  ? 387 PRO B CD    1 
ATOM   4551  N N     . GLU B  2 388 ? -0.490  -71.605 -61.308 1.00 35.42  ? 388 GLU B N     1 
ATOM   4552  C CA    . GLU B  2 388 ? -1.287  -72.333 -60.338 1.00 35.09  ? 388 GLU B CA    1 
ATOM   4553  C C     . GLU B  2 388 ? -2.359  -71.471 -59.632 1.00 41.29  ? 388 GLU B C     1 
ATOM   4554  O O     . GLU B  2 388 ? -2.386  -70.234 -59.742 1.00 37.57  ? 388 GLU B O     1 
ATOM   4555  C CB    . GLU B  2 388 ? -0.363  -73.040 -59.329 1.00 36.33  ? 388 GLU B CB    1 
ATOM   4556  C CG    . GLU B  2 388 ? 0.077   -74.414 -59.809 1.00 40.37  ? 388 GLU B CG    1 
ATOM   4557  C CD    . GLU B  2 388 ? -0.918  -75.535 -59.592 1.00 43.08  ? 388 GLU B CD    1 
ATOM   4558  O OE1   . GLU B  2 388 ? -2.086  -75.251 -59.242 1.00 51.28  ? 388 GLU B OE1   1 
ATOM   4559  O OE2   . GLU B  2 388 ? -0.516  -76.712 -59.729 1.00 43.74  ? 388 GLU B OE2   1 
ATOM   4560  N N     . ASN B  2 389 ? -3.225  -72.143 -58.878 1.00 44.27  ? 389 ASN B N     1 
ATOM   4561  C CA    . ASN B  2 389 ? -4.370  -71.511 -58.192 1.00 47.10  ? 389 ASN B CA    1 
ATOM   4562  C C     . ASN B  2 389 ? -4.324  -71.439 -56.674 1.00 56.67  ? 389 ASN B C     1 
ATOM   4563  O O     . ASN B  2 389 ? -4.964  -70.524 -56.164 1.00 64.94  ? 389 ASN B O     1 
ATOM   4564  C CB    . ASN B  2 389 ? -5.688  -72.221 -58.567 1.00 50.78  ? 389 ASN B CB    1 
ATOM   4565  C CG    . ASN B  2 389 ? -5.721  -73.688 -58.202 1.00 81.04  ? 389 ASN B CG    1 
ATOM   4566  O OD1   . ASN B  2 389 ? -4.883  -74.480 -58.668 1.00 83.70  ? 389 ASN B OD1   1 
ATOM   4567  N ND2   . ASN B  2 389 ? -6.642  -74.081 -57.324 1.00 75.94  ? 389 ASN B ND2   1 
ATOM   4568  N N     . ASN B  2 390 ? -3.710  -72.385 -55.944 1.00 46.98  ? 390 ASN B N     1 
ATOM   4569  C CA    . ASN B  2 390 ? -3.901  -72.451 -54.479 1.00 45.77  ? 390 ASN B CA    1 
ATOM   4570  C C     . ASN B  2 390 ? -2.550  -72.631 -53.755 1.00 48.04  ? 390 ASN B C     1 
ATOM   4571  O O     . ASN B  2 390 ? -2.173  -73.753 -53.249 1.00 48.38  ? 390 ASN B O     1 
ATOM   4572  C CB    . ASN B  2 390 ? -4.892  -73.656 -54.164 1.00 52.49  ? 390 ASN B CB    1 
ATOM   4573  C CG    . ASN B  2 390 ? -5.309  -73.979 -52.710 1.00 75.45  ? 390 ASN B CG    1 
ATOM   4574  O OD1   . ASN B  2 390 ? -5.699  -73.108 -51.924 1.00 68.71  ? 390 ASN B OD1   1 
ATOM   4575  N ND2   . ASN B  2 390 ? -5.453  -75.275 -52.381 1.00 58.77  ? 390 ASN B ND2   1 
ATOM   4576  N N     . TYR B  2 391 ? -1.876  -71.472 -53.617 1.00 35.65  ? 391 TYR B N     1 
ATOM   4577  C CA    . TYR B  2 391 ? -0.604  -71.409 -52.950 1.00 31.88  ? 391 TYR B CA    1 
ATOM   4578  C C     . TYR B  2 391 ? -0.550  -70.201 -52.071 1.00 35.77  ? 391 TYR B C     1 
ATOM   4579  O O     . TYR B  2 391 ? -1.287  -69.254 -52.264 1.00 32.67  ? 391 TYR B O     1 
ATOM   4580  C CB    . TYR B  2 391 ? 0.553   -71.412 -53.950 1.00 30.72  ? 391 TYR B CB    1 
ATOM   4581  C CG    . TYR B  2 391 ? 0.483   -70.317 -54.991 1.00 30.97  ? 391 TYR B CG    1 
ATOM   4582  C CD1   . TYR B  2 391 ? 1.052   -69.070 -54.755 1.00 30.98  ? 391 TYR B CD1   1 
ATOM   4583  C CD2   . TYR B  2 391 ? -0.037  -70.566 -56.258 1.00 30.95  ? 391 TYR B CD2   1 
ATOM   4584  C CE1   . TYR B  2 391 ? 1.069   -68.098 -55.728 1.00 31.61  ? 391 TYR B CE1   1 
ATOM   4585  C CE2   . TYR B  2 391 ? 0.092   -69.634 -57.277 1.00 32.61  ? 391 TYR B CE2   1 
ATOM   4586  C CZ    . TYR B  2 391 ? 0.665   -68.406 -57.010 1.00 32.48  ? 391 TYR B CZ    1 
ATOM   4587  O OH    . TYR B  2 391 ? 0.639   -67.386 -57.917 1.00 34.21  ? 391 TYR B OH    1 
ATOM   4588  N N     . LYS B  2 392 ? 0.306   -70.265 -51.064 1.00 35.49  ? 392 LYS B N     1 
ATOM   4589  C CA    . LYS B  2 392 ? 0.490   -69.200 -50.087 1.00 34.19  ? 392 LYS B CA    1 
ATOM   4590  C C     . LYS B  2 392 ? 1.957   -69.060 -49.769 1.00 34.89  ? 392 LYS B C     1 
ATOM   4591  O O     . LYS B  2 392 ? 2.692   -70.054 -49.660 1.00 35.98  ? 392 LYS B O     1 
ATOM   4592  C CB    . LYS B  2 392 ? -0.258  -69.522 -48.783 1.00 36.68  ? 392 LYS B CB    1 
ATOM   4593  C CG    . LYS B  2 392 ? -1.780  -69.651 -48.865 1.00 36.25  ? 392 LYS B CG    1 
ATOM   4594  C CD    . LYS B  2 392 ? -2.489  -68.319 -49.154 1.00 33.30  ? 392 LYS B CD    1 
ATOM   4595  C CE    . LYS B  2 392 ? -3.984  -68.467 -49.467 1.00 34.47  ? 392 LYS B CE    1 
ATOM   4596  N NZ    . LYS B  2 392 ? -4.221  -69.017 -50.852 1.00 46.07  ? 392 LYS B NZ    1 
ATOM   4597  N N     . THR B  2 393 ? 2.359   -67.844 -49.557 1.00 30.00  ? 393 THR B N     1 
ATOM   4598  C CA    . THR B  2 393 ? 3.707   -67.479 -49.225 1.00 30.54  ? 393 THR B CA    1 
ATOM   4599  C C     . THR B  2 393 ? 3.743   -66.734 -47.914 1.00 34.53  ? 393 THR B C     1 
ATOM   4600  O O     . THR B  2 393 ? 2.938   -65.851 -47.683 1.00 33.30  ? 393 THR B O     1 
ATOM   4601  C CB    . THR B  2 393 ? 4.275   -66.704 -50.406 1.00 37.97  ? 393 THR B CB    1 
ATOM   4602  O OG1   . THR B  2 393 ? 4.112   -67.513 -51.571 1.00 39.45  ? 393 THR B OG1   1 
ATOM   4603  C CG2   . THR B  2 393 ? 5.723   -66.343 -50.221 1.00 35.08  ? 393 THR B CG2   1 
ATOM   4604  N N     . THR B  2 394 ? 4.753   -67.005 -47.102 1.00 34.52  ? 394 THR B N     1 
ATOM   4605  C CA    . THR B  2 394 ? 4.905   -66.322 -45.818 1.00 33.87  ? 394 THR B CA    1 
ATOM   4606  C C     . THR B  2 394 ? 5.467   -64.927 -46.045 1.00 36.03  ? 394 THR B C     1 
ATOM   4607  O O     . THR B  2 394 ? 6.169   -64.704 -47.035 1.00 35.25  ? 394 THR B O     1 
ATOM   4608  C CB    . THR B  2 394 ? 5.898   -67.095 -44.894 1.00 36.88  ? 394 THR B CB    1 
ATOM   4609  O OG1   . THR B  2 394 ? 7.222   -67.020 -45.391 1.00 37.43  ? 394 THR B OG1   1 
ATOM   4610  C CG2   . THR B  2 394 ? 5.547   -68.558 -44.707 1.00 42.06  ? 394 THR B CG2   1 
ATOM   4611  N N     . PRO B  2 395 ? 5.341   -63.998 -45.089 1.00 32.43  ? 395 PRO B N     1 
ATOM   4612  C CA    . PRO B  2 395 ? 6.089   -62.761 -45.240 1.00 33.51  ? 395 PRO B CA    1 
ATOM   4613  C C     . PRO B  2 395 ? 7.612   -63.023 -45.124 1.00 38.10  ? 395 PRO B C     1 
ATOM   4614  O O     . PRO B  2 395 ? 8.061   -64.056 -44.579 1.00 36.66  ? 395 PRO B O     1 
ATOM   4615  C CB    . PRO B  2 395 ? 5.558   -61.864 -44.109 1.00 34.94  ? 395 PRO B CB    1 
ATOM   4616  C CG    . PRO B  2 395 ? 4.396   -62.540 -43.553 1.00 36.34  ? 395 PRO B CG    1 
ATOM   4617  C CD    . PRO B  2 395 ? 4.588   -64.004 -43.826 1.00 33.11  ? 395 PRO B CD    1 
ATOM   4618  N N     . PRO B  2 396 ? 8.424   -62.117 -45.678 1.00 36.02  ? 396 PRO B N     1 
ATOM   4619  C CA    . PRO B  2 396 ? 9.891   -62.240 -45.523 1.00 35.84  ? 396 PRO B CA    1 
ATOM   4620  C C     . PRO B  2 396 ? 10.302  -62.165 -44.051 1.00 39.81  ? 396 PRO B C     1 
ATOM   4621  O O     . PRO B  2 396 ? 9.693   -61.420 -43.297 1.00 38.65  ? 396 PRO B O     1 
ATOM   4622  C CB    . PRO B  2 396 ? 10.436  -61.019 -46.275 1.00 37.56  ? 396 PRO B CB    1 
ATOM   4623  C CG    . PRO B  2 396 ? 9.310   -60.551 -47.150 1.00 41.77  ? 396 PRO B CG    1 
ATOM   4624  C CD    . PRO B  2 396 ? 8.062   -60.889 -46.401 1.00 38.28  ? 396 PRO B CD    1 
ATOM   4625  N N     . VAL B  2 397 ? 11.296  -62.956 -43.639 1.00 38.27  ? 397 VAL B N     1 
ATOM   4626  C CA    . VAL B  2 397 ? 11.787  -62.959 -42.255 1.00 38.41  ? 397 VAL B CA    1 
ATOM   4627  C C     . VAL B  2 397 ? 13.249  -62.537 -42.282 1.00 40.88  ? 397 VAL B C     1 
ATOM   4628  O O     . VAL B  2 397 ? 14.020  -63.017 -43.112 1.00 39.78  ? 397 VAL B O     1 
ATOM   4629  C CB    . VAL B  2 397 ? 11.607  -64.364 -41.590 1.00 42.74  ? 397 VAL B CB    1 
ATOM   4630  C CG1   . VAL B  2 397 ? 12.117  -64.369 -40.146 1.00 42.91  ? 397 VAL B CG1   1 
ATOM   4631  C CG2   . VAL B  2 397 ? 10.152  -64.835 -41.648 1.00 41.70  ? 397 VAL B CG2   1 
ATOM   4632  N N     . LEU B  2 398 ? 13.621  -61.609 -41.420 1.00 38.27  ? 398 LEU B N     1 
ATOM   4633  C CA    . LEU B  2 398 ? 14.991  -61.141 -41.354 1.00 38.99  ? 398 LEU B CA    1 
ATOM   4634  C C     . LEU B  2 398 ? 15.870  -62.233 -40.752 1.00 44.76  ? 398 LEU B C     1 
ATOM   4635  O O     . LEU B  2 398 ? 15.594  -62.774 -39.677 1.00 42.61  ? 398 LEU B O     1 
ATOM   4636  C CB    . LEU B  2 398 ? 15.081  -59.842 -40.544 1.00 39.52  ? 398 LEU B CB    1 
ATOM   4637  C CG    . LEU B  2 398 ? 16.484  -59.197 -40.398 1.00 44.70  ? 398 LEU B CG    1 
ATOM   4638  C CD1   . LEU B  2 398 ? 17.045  -58.717 -41.734 1.00 44.36  ? 398 LEU B CD1   1 
ATOM   4639  C CD2   . LEU B  2 398 ? 16.446  -58.049 -39.445 1.00 41.27  ? 398 LEU B CD2   1 
ATOM   4640  N N     . ASP B  2 399 ? 16.890  -62.598 -41.504 1.00 45.90  ? 399 ASP B N     1 
ATOM   4641  C CA    . ASP B  2 399 ? 17.861  -63.595 -41.110 1.00 47.18  ? 399 ASP B CA    1 
ATOM   4642  C C     . ASP B  2 399 ? 19.014  -62.980 -40.291 1.00 50.66  ? 399 ASP B C     1 
ATOM   4643  O O     . ASP B  2 399 ? 19.178  -61.763 -40.234 1.00 51.01  ? 399 ASP B O     1 
ATOM   4644  C CB    . ASP B  2 399 ? 18.418  -64.289 -42.370 1.00 49.44  ? 399 ASP B CB    1 
ATOM   4645  C CG    . ASP B  2 399 ? 18.601  -65.769 -42.202 1.00 57.94  ? 399 ASP B CG    1 
ATOM   4646  O OD1   . ASP B  2 399 ? 18.490  -66.252 -41.061 1.00 61.95  ? 399 ASP B OD1   1 
ATOM   4647  O OD2   . ASP B  2 399 ? 18.744  -66.459 -43.217 1.00 62.38  ? 399 ASP B OD2   1 
ATOM   4648  N N     . SER B  2 400 ? 19.811  -63.844 -39.677 1.00 48.34  ? 400 SER B N     1 
ATOM   4649  C CA    . SER B  2 400 ? 21.010  -63.473 -38.878 1.00 48.93  ? 400 SER B CA    1 
ATOM   4650  C C     . SER B  2 400 ? 22.098  -62.702 -39.659 1.00 51.63  ? 400 SER B C     1 
ATOM   4651  O O     . SER B  2 400 ? 22.800  -61.874 -39.078 1.00 52.09  ? 400 SER B O     1 
ATOM   4652  C CB    . SER B  2 400 ? 21.646  -64.728 -38.287 1.00 51.87  ? 400 SER B CB    1 
ATOM   4653  O OG    . SER B  2 400 ? 20.846  -65.188 -37.214 1.00 68.38  ? 400 SER B OG    1 
ATOM   4654  N N     . ASP B  2 401 ? 22.243  -62.979 -40.953 1.00 45.22  ? 401 ASP B N     1 
ATOM   4655  C CA    . ASP B  2 401 ? 23.235  -62.306 -41.790 1.00 44.58  ? 401 ASP B CA    1 
ATOM   4656  C C     . ASP B  2 401 ? 22.744  -60.994 -42.451 1.00 46.05  ? 401 ASP B C     1 
ATOM   4657  O O     . ASP B  2 401 ? 23.383  -60.526 -43.397 1.00 46.13  ? 401 ASP B O     1 
ATOM   4658  C CB    . ASP B  2 401 ? 23.745  -63.276 -42.878 1.00 46.06  ? 401 ASP B CB    1 
ATOM   4659  C CG    . ASP B  2 401 ? 22.746  -63.626 -43.954 1.00 55.82  ? 401 ASP B CG    1 
ATOM   4660  O OD1   . ASP B  2 401 ? 21.542  -63.285 -43.791 1.00 55.31  ? 401 ASP B OD1   1 
ATOM   4661  O OD2   . ASP B  2 401 ? 23.143  -64.287 -44.929 1.00 62.07  ? 401 ASP B OD2   1 
ATOM   4662  N N     . GLY B  2 402 ? 21.604  -60.460 -42.025 1.00 40.13  ? 402 GLY B N     1 
ATOM   4663  C CA    . GLY B  2 402 ? 21.071  -59.225 -42.589 1.00 39.32  ? 402 GLY B CA    1 
ATOM   4664  C C     . GLY B  2 402 ? 20.237  -59.375 -43.848 1.00 41.41  ? 402 GLY B C     1 
ATOM   4665  O O     . GLY B  2 402 ? 19.684  -58.389 -44.335 1.00 42.37  ? 402 GLY B O     1 
ATOM   4666  N N     . SER B  2 403 ? 20.096  -60.585 -44.376 1.00 38.33  ? 403 SER B N     1 
ATOM   4667  C CA    . SER B  2 403 ? 19.276  -60.833 -45.558 1.00 37.62  ? 403 SER B CA    1 
ATOM   4668  C C     . SER B  2 403 ? 17.929  -61.402 -45.105 1.00 41.99  ? 403 SER B C     1 
ATOM   4669  O O     . SER B  2 403 ? 17.699  -61.559 -43.906 1.00 41.50  ? 403 SER B O     1 
ATOM   4670  C CB    . SER B  2 403 ? 19.985  -61.792 -46.501 1.00 42.54  ? 403 SER B CB    1 
ATOM   4671  O OG    . SER B  2 403 ? 19.977  -63.118 -45.986 1.00 47.52  ? 403 SER B OG    1 
ATOM   4672  N N     . PHE B  2 404 ? 17.012  -61.645 -46.050 1.00 38.20  ? 404 PHE B N     1 
ATOM   4673  C CA    . PHE B  2 404 ? 15.700  -62.174 -45.706 1.00 36.28  ? 404 PHE B CA    1 
ATOM   4674  C C     . PHE B  2 404 ? 15.526  -63.532 -46.277 1.00 38.44  ? 404 PHE B C     1 
ATOM   4675  O O     . PHE B  2 404 ? 16.135  -63.876 -47.281 1.00 35.70  ? 404 PHE B O     1 
ATOM   4676  C CB    . PHE B  2 404 ? 14.570  -61.271 -46.243 1.00 36.90  ? 404 PHE B CB    1 
ATOM   4677  C CG    . PHE B  2 404 ? 14.382  -59.965 -45.508 1.00 36.82  ? 404 PHE B CG    1 
ATOM   4678  C CD1   . PHE B  2 404 ? 15.080  -58.830 -45.890 1.00 39.93  ? 404 PHE B CD1   1 
ATOM   4679  C CD2   . PHE B  2 404 ? 13.430  -59.845 -44.516 1.00 35.37  ? 404 PHE B CD2   1 
ATOM   4680  C CE1   . PHE B  2 404 ? 14.903  -57.623 -45.208 1.00 41.18  ? 404 PHE B CE1   1 
ATOM   4681  C CE2   . PHE B  2 404 ? 13.253  -58.640 -43.824 1.00 37.69  ? 404 PHE B CE2   1 
ATOM   4682  C CZ    . PHE B  2 404 ? 13.986  -57.536 -44.173 1.00 37.00  ? 404 PHE B CZ    1 
ATOM   4683  N N     . PHE B  2 405 ? 14.599  -64.273 -45.700 1.00 37.73  ? 405 PHE B N     1 
ATOM   4684  C CA    . PHE B  2 405 ? 14.177  -65.547 -46.270 1.00 37.14  ? 405 PHE B CA    1 
ATOM   4685  C C     . PHE B  2 405 ? 12.656  -65.655 -46.188 1.00 37.77  ? 405 PHE B C     1 
ATOM   4686  O O     . PHE B  2 405 ? 12.018  -64.938 -45.419 1.00 36.91  ? 405 PHE B O     1 
ATOM   4687  C CB    . PHE B  2 405 ? 14.898  -66.753 -45.619 1.00 39.47  ? 405 PHE B CB    1 
ATOM   4688  C CG    . PHE B  2 405 ? 14.350  -67.158 -44.287 1.00 40.27  ? 405 PHE B CG    1 
ATOM   4689  C CD1   . PHE B  2 405 ? 14.825  -66.582 -43.122 1.00 42.58  ? 405 PHE B CD1   1 
ATOM   4690  C CD2   . PHE B  2 405 ? 13.345  -68.111 -44.195 1.00 41.13  ? 405 PHE B CD2   1 
ATOM   4691  C CE1   . PHE B  2 405 ? 14.257  -66.912 -41.886 1.00 44.93  ? 405 PHE B CE1   1 
ATOM   4692  C CE2   . PHE B  2 405 ? 12.789  -68.441 -42.965 1.00 42.37  ? 405 PHE B CE2   1 
ATOM   4693  C CZ    . PHE B  2 405 ? 13.249  -67.841 -41.818 1.00 41.69  ? 405 PHE B CZ    1 
ATOM   4694  N N     . LEU B  2 406 ? 12.077  -66.535 -47.002 1.00 34.03  ? 406 LEU B N     1 
ATOM   4695  C CA    . LEU B  2 406 ? 10.659  -66.886 -46.867 1.00 33.29  ? 406 LEU B CA    1 
ATOM   4696  C C     . LEU B  2 406 ? 10.404  -68.293 -47.366 1.00 36.90  ? 406 LEU B C     1 
ATOM   4697  O O     . LEU B  2 406 ? 11.308  -68.937 -47.897 1.00 37.51  ? 406 LEU B O     1 
ATOM   4698  C CB    . LEU B  2 406 ? 9.703   -65.871 -47.522 1.00 32.72  ? 406 LEU B CB    1 
ATOM   4699  C CG    . LEU B  2 406 ? 9.892   -65.540 -48.994 1.00 36.12  ? 406 LEU B CG    1 
ATOM   4700  C CD1   . LEU B  2 406 ? 9.481   -66.703 -49.879 1.00 36.48  ? 406 LEU B CD1   1 
ATOM   4701  C CD2   . LEU B  2 406 ? 9.076   -64.293 -49.318 1.00 34.98  ? 406 LEU B CD2   1 
ATOM   4702  N N     . TYR B  2 407 ? 9.163   -68.771 -47.183 1.00 33.62  ? 407 TYR B N     1 
ATOM   4703  C CA    . TYR B  2 407 ? 8.717   -70.025 -47.740 1.00 33.07  ? 407 TYR B CA    1 
ATOM   4704  C C     . TYR B  2 407 ? 7.424   -69.796 -48.511 1.00 36.17  ? 407 TYR B C     1 
ATOM   4705  O O     . TYR B  2 407 ? 6.593   -69.026 -48.102 1.00 34.85  ? 407 TYR B O     1 
ATOM   4706  C CB    . TYR B  2 407 ? 8.483   -71.078 -46.640 1.00 35.15  ? 407 TYR B CB    1 
ATOM   4707  C CG    . TYR B  2 407 ? 9.733   -71.703 -46.054 1.00 34.88  ? 407 TYR B CG    1 
ATOM   4708  C CD1   . TYR B  2 407 ? 10.258  -72.875 -46.578 1.00 36.06  ? 407 TYR B CD1   1 
ATOM   4709  C CD2   . TYR B  2 407 ? 10.291  -71.217 -44.885 1.00 36.56  ? 407 TYR B CD2   1 
ATOM   4710  C CE1   . TYR B  2 407 ? 11.352  -73.502 -45.993 1.00 36.98  ? 407 TYR B CE1   1 
ATOM   4711  C CE2   . TYR B  2 407 ? 11.423  -71.802 -44.323 1.00 37.02  ? 407 TYR B CE2   1 
ATOM   4712  C CZ    . TYR B  2 407 ? 11.902  -72.988 -44.831 1.00 43.61  ? 407 TYR B CZ    1 
ATOM   4713  O OH    . TYR B  2 407 ? 13.038  -73.535 -44.287 1.00 46.95  ? 407 TYR B OH    1 
ATOM   4714  N N     . SER B  2 408 ? 7.237   -70.541 -49.580 1.00 35.17  ? 408 SER B N     1 
ATOM   4715  C CA    . SER B  2 408 ? 6.010   -70.567 -50.359 1.00 33.89  ? 408 SER B CA    1 
ATOM   4716  C C     . SER B  2 408 ? 5.591   -72.053 -50.414 1.00 37.27  ? 408 SER B C     1 
ATOM   4717  O O     . SER B  2 408 ? 6.415   -72.961 -50.478 1.00 33.60  ? 408 SER B O     1 
ATOM   4718  C CB    . SER B  2 408 ? 6.204   -69.971 -51.747 1.00 35.21  ? 408 SER B CB    1 
ATOM   4719  O OG    . SER B  2 408 ? 4.987   -69.945 -52.474 1.00 40.91  ? 408 SER B OG    1 
ATOM   4720  N N     . ARG B  2 409 ? 4.321   -72.269 -50.268 1.00 35.78  ? 409 ARG B N     1 
ATOM   4721  C CA    . ARG B  2 409 ? 3.755   -73.579 -50.183 1.00 35.28  ? 409 ARG B CA    1 
ATOM   4722  C C     . ARG B  2 409 ? 2.643   -73.747 -51.196 1.00 37.67  ? 409 ARG B C     1 
ATOM   4723  O O     . ARG B  2 409 ? 1.669   -73.006 -51.150 1.00 36.63  ? 409 ARG B O     1 
ATOM   4724  C CB    . ARG B  2 409 ? 3.165   -73.713 -48.787 1.00 35.47  ? 409 ARG B CB    1 
ATOM   4725  C CG    . ARG B  2 409 ? 2.685   -75.101 -48.507 1.00 37.41  ? 409 ARG B CG    1 
ATOM   4726  C CD    . ARG B  2 409 ? 2.329   -75.258 -47.042 1.00 47.81  ? 409 ARG B CD    1 
ATOM   4727  N NE    . ARG B  2 409 ? 1.353   -76.317 -46.965 1.00 52.00  ? 409 ARG B NE    1 
ATOM   4728  C CZ    . ARG B  2 409 ? 0.066   -76.163 -46.747 1.00 55.95  ? 409 ARG B CZ    1 
ATOM   4729  N NH1   . ARG B  2 409 ? -0.423  -74.977 -46.446 1.00 47.28  ? 409 ARG B NH1   1 
ATOM   4730  N NH2   . ARG B  2 409 ? -0.740  -77.216 -46.763 1.00 60.67  ? 409 ARG B NH2   1 
ATOM   4731  N N     . LEU B  2 410 ? 2.735   -74.784 -52.020 1.00 34.55  ? 410 LEU B N     1 
ATOM   4732  C CA    . LEU B  2 410 ? 1.715   -75.142 -52.970 1.00 32.24  ? 410 LEU B CA    1 
ATOM   4733  C C     . LEU B  2 410 ? 1.107   -76.474 -52.554 1.00 35.03  ? 410 LEU B C     1 
ATOM   4734  O O     . LEU B  2 410 ? 1.791   -77.508 -52.491 1.00 36.12  ? 410 LEU B O     1 
ATOM   4735  C CB    . LEU B  2 410 ? 2.308   -75.232 -54.389 1.00 31.46  ? 410 LEU B CB    1 
ATOM   4736  C CG    . LEU B  2 410 ? 1.366   -75.777 -55.474 1.00 33.76  ? 410 LEU B CG    1 
ATOM   4737  C CD1   . LEU B  2 410 ? 0.296   -74.770 -55.820 1.00 33.12  ? 410 LEU B CD1   1 
ATOM   4738  C CD2   . LEU B  2 410 ? 2.113   -76.190 -56.662 1.00 31.10  ? 410 LEU B CD2   1 
ATOM   4739  N N     . THR B  2 411 ? -0.190  -76.470 -52.395 1.00 35.04  ? 411 THR B N     1 
ATOM   4740  C CA    . THR B  2 411 ? -0.989  -77.671 -52.097 1.00 36.67  ? 411 THR B CA    1 
ATOM   4741  C C     . THR B  2 411 ? -1.508  -78.245 -53.402 1.00 41.55  ? 411 THR B C     1 
ATOM   4742  O O     . THR B  2 411 ? -2.171  -77.533 -54.175 1.00 39.56  ? 411 THR B O     1 
ATOM   4743  C CB    . THR B  2 411 ? -2.185  -77.339 -51.192 1.00 47.92  ? 411 THR B CB    1 
ATOM   4744  O OG1   . THR B  2 411 ? -1.659  -77.008 -49.911 1.00 51.63  ? 411 THR B OG1   1 
ATOM   4745  C CG2   . THR B  2 411 ? -3.179  -78.514 -51.071 1.00 50.61  ? 411 THR B CG2   1 
ATOM   4746  N N     . VAL B  2 412 ? -1.261  -79.545 -53.603 1.00 41.02  ? 412 VAL B N     1 
ATOM   4747  C CA    . VAL B  2 412 ? -1.705  -80.274 -54.781 1.00 42.63  ? 412 VAL B CA    1 
ATOM   4748  C C     . VAL B  2 412 ? -2.273  -81.610 -54.371 1.00 48.55  ? 412 VAL B C     1 
ATOM   4749  O O     . VAL B  2 412 ? -1.892  -82.151 -53.340 1.00 49.80  ? 412 VAL B O     1 
ATOM   4750  C CB    . VAL B  2 412 ? -0.536  -80.451 -55.804 1.00 46.54  ? 412 VAL B CB    1 
ATOM   4751  C CG1   . VAL B  2 412 ? 0.027   -79.100 -56.202 1.00 45.69  ? 412 VAL B CG1   1 
ATOM   4752  C CG2   . VAL B  2 412 ? 0.586   -81.356 -55.274 1.00 46.51  ? 412 VAL B CG2   1 
ATOM   4753  N N     . ASP B  2 413 ? -3.114  -82.193 -55.212 1.00 45.81  ? 413 ASP B N     1 
ATOM   4754  C CA    . ASP B  2 413 ? -3.615  -83.550 -54.959 1.00 45.14  ? 413 ASP B CA    1 
ATOM   4755  C C     . ASP B  2 413 ? -2.437  -84.475 -55.079 1.00 46.82  ? 413 ASP B C     1 
ATOM   4756  O O     . ASP B  2 413 ? -1.623  -84.292 -55.973 1.00 46.67  ? 413 ASP B O     1 
ATOM   4757  C CB    . ASP B  2 413 ? -4.659  -83.962 -56.000 1.00 47.68  ? 413 ASP B CB    1 
ATOM   4758  C CG    . ASP B  2 413 ? -5.959  -83.198 -55.906 1.00 62.70  ? 413 ASP B CG    1 
ATOM   4759  O OD1   . ASP B  2 413 ? -6.194  -82.545 -54.851 1.00 64.08  ? 413 ASP B OD1   1 
ATOM   4760  O OD2   . ASP B  2 413 ? -6.751  -83.249 -56.887 1.00 65.74  ? 413 ASP B OD2   1 
ATOM   4761  N N     . LYS B  2 414 ? -2.331  -85.464 -54.197 1.00 43.69  ? 414 LYS B N     1 
ATOM   4762  C CA    . LYS B  2 414 ? -1.246  -86.439 -54.230 1.00 43.08  ? 414 LYS B CA    1 
ATOM   4763  C C     . LYS B  2 414 ? -1.138  -87.153 -55.600 1.00 48.02  ? 414 LYS B C     1 
ATOM   4764  O O     . LYS B  2 414 ? -0.026  -87.455 -56.039 1.00 48.52  ? 414 LYS B O     1 
ATOM   4765  C CB    . LYS B  2 414 ? -1.451  -87.469 -53.122 1.00 45.64  ? 414 LYS B CB    1 
ATOM   4766  C CG    . LYS B  2 414 ? -0.402  -88.578 -53.130 1.00 52.33  ? 414 LYS B CG    1 
ATOM   4767  C CD    . LYS B  2 414 ? -0.378  -89.373 -51.858 1.00 66.25  ? 414 LYS B CD    1 
ATOM   4768  C CE    . LYS B  2 414 ? -1.631  -90.191 -51.662 1.00 66.79  ? 414 LYS B CE    1 
ATOM   4769  N NZ    . LYS B  2 414 ? -1.708  -90.699 -50.283 1.00 70.70  ? 414 LYS B NZ    1 
ATOM   4770  N N     . SER B  2 415 ? -2.290  -87.469 -56.225 1.00 44.12  ? 415 SER B N     1 
ATOM   4771  C CA    . SER B  2 415 ? -2.378  -88.110 -57.537 1.00 44.50  ? 415 SER B CA    1 
ATOM   4772  C C     . SER B  2 415 ? -1.597  -87.305 -58.589 1.00 47.64  ? 415 SER B C     1 
ATOM   4773  O O     . SER B  2 415 ? -0.878  -87.886 -59.392 1.00 47.12  ? 415 SER B O     1 
ATOM   4774  C CB    . SER B  2 415 ? -3.843  -88.253 -57.960 1.00 47.90  ? 415 SER B CB    1 
ATOM   4775  O OG    . SER B  2 415 ? -4.505  -86.997 -58.005 1.00 60.04  ? 415 SER B OG    1 
ATOM   4776  N N     . ARG B  2 416 ? -1.718  -85.979 -58.555 1.00 44.12  ? 416 ARG B N     1 
ATOM   4777  C CA    . ARG B  2 416 ? -1.005  -85.083 -59.490 1.00 44.07  ? 416 ARG B CA    1 
ATOM   4778  C C     . ARG B  2 416 ? 0.500   -85.059 -59.287 1.00 46.48  ? 416 ARG B C     1 
ATOM   4779  O O     . ARG B  2 416 ? 1.246   -84.981 -60.262 1.00 45.36  ? 416 ARG B O     1 
ATOM   4780  C CB    . ARG B  2 416 ? -1.588  -83.666 -59.444 1.00 42.36  ? 416 ARG B CB    1 
ATOM   4781  C CG    . ARG B  2 416 ? -2.949  -83.588 -60.185 1.00 48.62  ? 416 ARG B CG    1 
ATOM   4782  C CD    . ARG B  2 416 ? -2.974  -82.450 -61.177 1.00 66.87  ? 416 ARG B CD    1 
ATOM   4783  N NE    . ARG B  2 416 ? -2.979  -81.148 -60.477 1.00 84.88  ? 416 ARG B NE    1 
ATOM   4784  C CZ    . ARG B  2 416 ? -2.202  -80.091 -60.748 1.00 78.22  ? 416 ARG B CZ    1 
ATOM   4785  N NH1   . ARG B  2 416 ? -1.286  -80.151 -61.722 1.00 55.92  ? 416 ARG B NH1   1 
ATOM   4786  N NH2   . ARG B  2 416 ? -2.322  -78.971 -60.038 1.00 39.49  ? 416 ARG B NH2   1 
ATOM   4787  N N     . TRP B  2 417 ? 0.944   -85.128 -58.030 1.00 41.88  ? 417 TRP B N     1 
ATOM   4788  C CA    . TRP B  2 417 ? 2.353   -85.223 -57.700 1.00 40.88  ? 417 TRP B CA    1 
ATOM   4789  C C     . TRP B  2 417 ? 2.853   -86.592 -58.153 1.00 47.94  ? 417 TRP B C     1 
ATOM   4790  O O     . TRP B  2 417 ? 3.865   -86.677 -58.859 1.00 48.29  ? 417 TRP B O     1 
ATOM   4791  C CB    . TRP B  2 417 ? 2.556   -85.010 -56.191 1.00 39.08  ? 417 TRP B CB    1 
ATOM   4792  C CG    . TRP B  2 417 ? 3.939   -85.275 -55.684 1.00 40.22  ? 417 TRP B CG    1 
ATOM   4793  C CD1   . TRP B  2 417 ? 4.334   -86.337 -54.928 1.00 43.68  ? 417 TRP B CD1   1 
ATOM   4794  C CD2   . TRP B  2 417 ? 5.136   -84.567 -56.036 1.00 39.78  ? 417 TRP B CD2   1 
ATOM   4795  N NE1   . TRP B  2 417 ? 5.683   -86.250 -54.662 1.00 43.13  ? 417 TRP B NE1   1 
ATOM   4796  C CE2   . TRP B  2 417 ? 6.205   -85.188 -55.347 1.00 43.14  ? 417 TRP B CE2   1 
ATOM   4797  C CE3   . TRP B  2 417 ? 5.393   -83.381 -56.759 1.00 40.35  ? 417 TRP B CE3   1 
ATOM   4798  C CZ2   . TRP B  2 417 ? 7.513   -84.715 -55.412 1.00 42.16  ? 417 TRP B CZ2   1 
ATOM   4799  C CZ3   . TRP B  2 417 ? 6.689   -82.897 -56.803 1.00 41.39  ? 417 TRP B CZ3   1 
ATOM   4800  C CH2   . TRP B  2 417 ? 7.727   -83.543 -56.103 1.00 42.47  ? 417 TRP B CH2   1 
ATOM   4801  N N     . GLN B  2 418 ? 2.115   -87.665 -57.785 1.00 46.19  ? 418 GLN B N     1 
ATOM   4802  C CA    . GLN B  2 418 ? 2.469   -89.040 -58.152 1.00 45.99  ? 418 GLN B CA    1 
ATOM   4803  C C     . GLN B  2 418 ? 2.502   -89.311 -59.625 1.00 50.68  ? 418 GLN B C     1 
ATOM   4804  O O     . GLN B  2 418 ? 3.319   -90.115 -60.039 1.00 49.00  ? 418 GLN B O     1 
ATOM   4805  C CB    . GLN B  2 418 ? 1.566   -90.057 -57.466 1.00 47.68  ? 418 GLN B CB    1 
ATOM   4806  C CG    . GLN B  2 418 ? 1.946   -90.235 -56.012 1.00 68.42  ? 418 GLN B CG    1 
ATOM   4807  C CD    . GLN B  2 418 ? 1.062   -91.199 -55.268 1.00 84.85  ? 418 GLN B CD    1 
ATOM   4808  O OE1   . GLN B  2 418 ? -0.143  -91.345 -55.540 1.00 79.90  ? 418 GLN B OE1   1 
ATOM   4809  N NE2   . GLN B  2 418 ? 1.634   -91.826 -54.257 1.00 75.53  ? 418 GLN B NE2   1 
ATOM   4810  N N     . GLN B  2 419 ? 1.713   -88.592 -60.452 1.00 50.43  ? 419 GLN B N     1 
ATOM   4811  C CA    . GLN B  2 419 ? 1.764   -88.868 -61.889 1.00 50.65  ? 419 GLN B CA    1 
ATOM   4812  C C     . GLN B  2 419 ? 2.862   -88.073 -62.642 1.00 54.65  ? 419 GLN B C     1 
ATOM   4813  O O     . GLN B  2 419 ? 2.871   -88.085 -63.879 1.00 55.83  ? 419 GLN B O     1 
ATOM   4814  C CB    . GLN B  2 419 ? 0.391   -88.776 -62.556 1.00 52.43  ? 419 GLN B CB    1 
ATOM   4815  C CG    . GLN B  2 419 ? -0.421  -87.503 -62.461 1.00 68.67  ? 419 GLN B CG    1 
ATOM   4816  C CD    . GLN B  2 419 ? -1.902  -87.825 -62.303 1.00 74.28  ? 419 GLN B CD    1 
ATOM   4817  O OE1   . GLN B  2 419 ? -2.325  -88.989 -62.257 1.00 64.91  ? 419 GLN B OE1   1 
ATOM   4818  N NE2   . GLN B  2 419 ? -2.738  -86.818 -62.296 1.00 65.19  ? 419 GLN B NE2   1 
ATOM   4819  N N     . GLY B  2 420 ? 3.834   -87.512 -61.903 1.00 48.93  ? 420 GLY B N     1 
ATOM   4820  C CA    . GLY B  2 420 ? 5.034   -86.908 -62.462 1.00 48.12  ? 420 GLY B CA    1 
ATOM   4821  C C     . GLY B  2 420 ? 4.931   -85.565 -63.143 1.00 52.25  ? 420 GLY B C     1 
ATOM   4822  O O     . GLY B  2 420 ? 5.761   -85.252 -64.001 1.00 50.90  ? 420 GLY B O     1 
ATOM   4823  N N     . ASN B  2 421 ? 3.934   -84.751 -62.757 1.00 47.39  ? 421 ASN B N     1 
ATOM   4824  C CA    . ASN B  2 421 ? 3.777   -83.405 -63.282 1.00 43.33  ? 421 ASN B CA    1 
ATOM   4825  C C     . ASN B  2 421 ? 4.904   -82.552 -62.765 1.00 43.82  ? 421 ASN B C     1 
ATOM   4826  O O     . ASN B  2 421 ? 5.369   -82.758 -61.635 1.00 43.28  ? 421 ASN B O     1 
ATOM   4827  C CB    . ASN B  2 421 ? 2.435   -82.802 -62.862 1.00 43.17  ? 421 ASN B CB    1 
ATOM   4828  C CG    . ASN B  2 421 ? 1.276   -83.446 -63.575 1.00 58.69  ? 421 ASN B CG    1 
ATOM   4829  O OD1   . ASN B  2 421 ? 1.131   -83.342 -64.794 1.00 46.47  ? 421 ASN B OD1   1 
ATOM   4830  N ND2   . ASN B  2 421 ? 0.452   -84.157 -62.860 1.00 57.20  ? 421 ASN B ND2   1 
ATOM   4831  N N     . VAL B  2 422 ? 5.345   -81.579 -63.572 1.00 39.11  ? 422 VAL B N     1 
ATOM   4832  C CA    . VAL B  2 422 ? 6.442   -80.701 -63.161 1.00 37.81  ? 422 VAL B CA    1 
ATOM   4833  C C     . VAL B  2 422 ? 5.887   -79.417 -62.565 1.00 41.15  ? 422 VAL B C     1 
ATOM   4834  O O     . VAL B  2 422 ? 5.193   -78.680 -63.243 1.00 41.49  ? 422 VAL B O     1 
ATOM   4835  C CB    . VAL B  2 422 ? 7.429   -80.419 -64.331 1.00 38.84  ? 422 VAL B CB    1 
ATOM   4836  C CG1   . VAL B  2 422 ? 8.555   -79.506 -63.880 1.00 36.43  ? 422 VAL B CG1   1 
ATOM   4837  C CG2   . VAL B  2 422 ? 7.976   -81.724 -64.883 1.00 38.07  ? 422 VAL B CG2   1 
ATOM   4838  N N     . PHE B  2 423 ? 6.210   -79.153 -61.302 1.00 36.32  ? 423 PHE B N     1 
ATOM   4839  C CA    . PHE B  2 423 ? 5.796   -77.963 -60.606 1.00 34.33  ? 423 PHE B CA    1 
ATOM   4840  C C     . PHE B  2 423 ? 6.998   -77.027 -60.540 1.00 38.39  ? 423 PHE B C     1 
ATOM   4841  O O     . PHE B  2 423 ? 8.122   -77.485 -60.423 1.00 37.61  ? 423 PHE B O     1 
ATOM   4842  C CB    . PHE B  2 423 ? 5.268   -78.331 -59.198 1.00 35.27  ? 423 PHE B CB    1 
ATOM   4843  C CG    . PHE B  2 423 ? 4.037   -79.182 -59.295 1.00 35.46  ? 423 PHE B CG    1 
ATOM   4844  C CD1   . PHE B  2 423 ? 2.792   -78.603 -59.489 1.00 36.13  ? 423 PHE B CD1   1 
ATOM   4845  C CD2   . PHE B  2 423 ? 4.129   -80.577 -59.297 1.00 37.73  ? 423 PHE B CD2   1 
ATOM   4846  C CE1   . PHE B  2 423 ? 1.658   -79.391 -59.684 1.00 36.78  ? 423 PHE B CE1   1 
ATOM   4847  C CE2   . PHE B  2 423 ? 3.005   -81.362 -59.499 1.00 40.48  ? 423 PHE B CE2   1 
ATOM   4848  C CZ    . PHE B  2 423 ? 1.761   -80.763 -59.651 1.00 39.01  ? 423 PHE B CZ    1 
ATOM   4849  N N     . SER B  2 424 ? 6.764   -75.708 -60.662 1.00 35.35  ? 424 SER B N     1 
ATOM   4850  C CA    . SER B  2 424 ? 7.828   -74.717 -60.618 1.00 33.67  ? 424 SER B CA    1 
ATOM   4851  C C     . SER B  2 424 ? 7.464   -73.626 -59.640 1.00 36.89  ? 424 SER B C     1 
ATOM   4852  O O     . SER B  2 424 ? 6.346   -73.145 -59.633 1.00 32.43  ? 424 SER B O     1 
ATOM   4853  C CB    . SER B  2 424 ? 8.052   -74.068 -61.993 1.00 34.97  ? 424 SER B CB    1 
ATOM   4854  O OG    . SER B  2 424 ? 8.184   -75.043 -63.009 1.00 49.15  ? 424 SER B OG    1 
ATOM   4855  N N     . CYS B  2 425 ? 8.470   -73.177 -58.912 1.00 37.96  ? 425 CYS B N     1 
ATOM   4856  C CA    . CYS B  2 425 ? 8.449   -72.066 -57.989 1.00 37.47  ? 425 CYS B CA    1 
ATOM   4857  C C     . CYS B  2 425 ? 9.151   -70.934 -58.786 1.00 39.98  ? 425 CYS B C     1 
ATOM   4858  O O     . CYS B  2 425 ? 10.268  -71.137 -59.271 1.00 37.79  ? 425 CYS B O     1 
ATOM   4859  C CB    . CYS B  2 425 ? 9.221   -72.429 -56.728 1.00 40.19  ? 425 CYS B CB    1 
ATOM   4860  S SG    . CYS B  2 425 ? 9.369   -71.062 -55.570 1.00 47.06  ? 425 CYS B SG    1 
ATOM   4861  N N     . SER B  2 426 ? 8.469   -69.777 -58.965 1.00 35.67  ? 426 SER B N     1 
ATOM   4862  C CA    . SER B  2 426 ? 8.954   -68.633 -59.721 1.00 34.39  ? 426 SER B CA    1 
ATOM   4863  C C     . SER B  2 426 ? 9.083   -67.424 -58.824 1.00 37.79  ? 426 SER B C     1 
ATOM   4864  O O     . SER B  2 426 ? 8.214   -67.156 -58.002 1.00 33.96  ? 426 SER B O     1 
ATOM   4865  C CB    . SER B  2 426 ? 8.030   -68.344 -60.889 1.00 36.85  ? 426 SER B CB    1 
ATOM   4866  O OG    . SER B  2 426 ? 8.231   -69.375 -61.846 1.00 50.80  ? 426 SER B OG    1 
ATOM   4867  N N     . VAL B  2 427 ? 10.216  -66.732 -58.926 1.00 37.36  ? 427 VAL B N     1 
ATOM   4868  C CA    . VAL B  2 427 ? 10.537  -65.600 -58.050 1.00 36.53  ? 427 VAL B CA    1 
ATOM   4869  C C     . VAL B  2 427 ? 10.825  -64.351 -58.878 1.00 39.19  ? 427 VAL B C     1 
ATOM   4870  O O     . VAL B  2 427 ? 11.485  -64.431 -59.890 1.00 36.66  ? 427 VAL B O     1 
ATOM   4871  C CB    . VAL B  2 427 ? 11.698  -65.996 -57.088 1.00 39.88  ? 427 VAL B CB    1 
ATOM   4872  C CG1   . VAL B  2 427 ? 11.990  -64.894 -56.076 1.00 39.78  ? 427 VAL B CG1   1 
ATOM   4873  C CG2   . VAL B  2 427 ? 11.363  -67.287 -56.347 1.00 39.03  ? 427 VAL B CG2   1 
ATOM   4874  N N     . MET B  2 428 ? 10.305  -63.201 -58.444 1.00 39.81  ? 428 MET B N     1 
ATOM   4875  C CA    . MET B  2 428 ? 10.498  -61.890 -59.068 1.00 39.14  ? 428 MET B CA    1 
ATOM   4876  C C     . MET B  2 428 ? 11.170  -61.009 -58.008 1.00 39.66  ? 428 MET B C     1 
ATOM   4877  O O     . MET B  2 428 ? 10.711  -60.947 -56.876 1.00 37.43  ? 428 MET B O     1 
ATOM   4878  C CB    . MET B  2 428 ? 9.160   -61.311 -59.560 1.00 43.23  ? 428 MET B CB    1 
ATOM   4879  C CG    . MET B  2 428 ? 8.383   -62.252 -60.550 1.00 51.22  ? 428 MET B CG    1 
ATOM   4880  S SD    . MET B  2 428 ? 7.143   -63.338 -59.741 1.00 61.67  ? 428 MET B SD    1 
ATOM   4881  C CE    . MET B  2 428 ? 7.097   -64.721 -60.994 1.00 60.86  ? 428 MET B CE    1 
ATOM   4882  N N     . HIS B  2 429 ? 12.295  -60.371 -58.361 1.00 37.54  ? 429 HIS B N     1 
ATOM   4883  C CA    . HIS B  2 429 ? 13.078  -59.587 -57.419 1.00 37.36  ? 429 HIS B CA    1 
ATOM   4884  C C     . HIS B  2 429 ? 14.012  -58.653 -58.177 1.00 42.18  ? 429 HIS B C     1 
ATOM   4885  O O     . HIS B  2 429 ? 14.379  -58.947 -59.317 1.00 41.50  ? 429 HIS B O     1 
ATOM   4886  C CB    . HIS B  2 429 ? 13.923  -60.552 -56.553 1.00 38.01  ? 429 HIS B CB    1 
ATOM   4887  C CG    . HIS B  2 429 ? 14.600  -59.909 -55.390 1.00 40.78  ? 429 HIS B CG    1 
ATOM   4888  N ND1   . HIS B  2 429 ? 15.914  -59.510 -55.458 1.00 41.84  ? 429 HIS B ND1   1 
ATOM   4889  C CD2   . HIS B  2 429 ? 14.102  -59.594 -54.169 1.00 42.21  ? 429 HIS B CD2   1 
ATOM   4890  C CE1   . HIS B  2 429 ? 16.170  -58.966 -54.278 1.00 41.61  ? 429 HIS B CE1   1 
ATOM   4891  N NE2   . HIS B  2 429 ? 15.081  -58.934 -53.500 1.00 41.61  ? 429 HIS B NE2   1 
ATOM   4892  N N     . GLU B  2 430 ? 14.447  -57.564 -57.542 1.00 41.86  ? 430 GLU B N     1 
ATOM   4893  C CA    . GLU B  2 430 ? 15.381  -56.651 -58.222 1.00 43.93  ? 430 GLU B CA    1 
ATOM   4894  C C     . GLU B  2 430 ? 16.749  -57.284 -58.591 1.00 49.04  ? 430 GLU B C     1 
ATOM   4895  O O     . GLU B  2 430 ? 17.288  -56.947 -59.642 1.00 50.34  ? 430 GLU B O     1 
ATOM   4896  C CB    . GLU B  2 430 ? 15.579  -55.338 -57.456 1.00 45.65  ? 430 GLU B CB    1 
ATOM   4897  C CG    . GLU B  2 430 ? 16.875  -55.171 -56.692 1.00 63.97  ? 430 GLU B CG    1 
ATOM   4898  C CD    . GLU B  2 430 ? 17.061  -53.750 -56.202 1.00 72.38  ? 430 GLU B CD    1 
ATOM   4899  O OE1   . GLU B  2 430 ? 17.990  -53.071 -56.697 1.00 66.81  ? 430 GLU B OE1   1 
ATOM   4900  O OE2   . GLU B  2 430 ? 16.244  -53.297 -55.367 1.00 51.74  ? 430 GLU B OE2   1 
ATOM   4901  N N     . ALA B  2 431 ? 17.305  -58.177 -57.755 1.00 44.22  ? 431 ALA B N     1 
ATOM   4902  C CA    . ALA B  2 431 ? 18.646  -58.734 -57.968 1.00 43.54  ? 431 ALA B CA    1 
ATOM   4903  C C     . ALA B  2 431 ? 18.725  -59.995 -58.802 1.00 52.26  ? 431 ALA B C     1 
ATOM   4904  O O     . ALA B  2 431 ? 19.661  -60.767 -58.617 1.00 55.98  ? 431 ALA B O     1 
ATOM   4905  C CB    . ALA B  2 431 ? 19.299  -58.976 -56.625 1.00 44.01  ? 431 ALA B CB    1 
ATOM   4906  N N     . LEU B  2 432 ? 17.784  -60.238 -59.713 1.00 47.86  ? 432 LEU B N     1 
ATOM   4907  C CA    . LEU B  2 432 ? 17.830  -61.443 -60.536 1.00 46.54  ? 432 LEU B CA    1 
ATOM   4908  C C     . LEU B  2 432 ? 17.972  -60.995 -61.964 1.00 52.24  ? 432 LEU B C     1 
ATOM   4909  O O     . LEU B  2 432 ? 17.480  -59.909 -62.330 1.00 47.57  ? 432 LEU B O     1 
ATOM   4910  C CB    . LEU B  2 432 ? 16.546  -62.259 -60.394 1.00 45.43  ? 432 LEU B CB    1 
ATOM   4911  C CG    . LEU B  2 432 ? 16.279  -62.927 -59.049 1.00 48.06  ? 432 LEU B CG    1 
ATOM   4912  C CD1   . LEU B  2 432 ? 14.843  -63.345 -58.965 1.00 46.50  ? 432 LEU B CD1   1 
ATOM   4913  C CD2   . LEU B  2 432 ? 17.186  -64.154 -58.840 1.00 47.83  ? 432 LEU B CD2   1 
ATOM   4914  N N     . HIS B  2 433 ? 18.572  -61.880 -62.794 1.00 53.66  ? 433 HIS B N     1 
ATOM   4915  C CA    . HIS B  2 433 ? 18.728  -61.656 -64.221 1.00 54.81  ? 433 HIS B CA    1 
ATOM   4916  C C     . HIS B  2 433 ? 17.353  -61.666 -64.819 1.00 55.61  ? 433 HIS B C     1 
ATOM   4917  O O     . HIS B  2 433 ? 16.618  -62.625 -64.612 1.00 54.38  ? 433 HIS B O     1 
ATOM   4918  C CB    . HIS B  2 433 ? 19.563  -62.772 -64.846 1.00 58.85  ? 433 HIS B CB    1 
ATOM   4919  C CG    . HIS B  2 433 ? 19.789  -62.553 -66.302 1.00 64.41  ? 433 HIS B CG    1 
ATOM   4920  N ND1   . HIS B  2 433 ? 19.352  -63.463 -67.240 1.00 67.55  ? 433 HIS B ND1   1 
ATOM   4921  C CD2   . HIS B  2 433 ? 20.292  -61.468 -66.935 1.00 67.35  ? 433 HIS B CD2   1 
ATOM   4922  C CE1   . HIS B  2 433 ? 19.671  -62.938 -68.416 1.00 68.26  ? 433 HIS B CE1   1 
ATOM   4923  N NE2   . HIS B  2 433 ? 20.201  -61.719 -68.277 1.00 68.30  ? 433 HIS B NE2   1 
ATOM   4924  N N     . ASN B  2 434 ? 16.981  -60.574 -65.490 1.00 52.02  ? 434 ASN B N     1 
ATOM   4925  C CA    . ASN B  2 434 ? 15.642  -60.329 -66.035 1.00 52.08  ? 434 ASN B CA    1 
ATOM   4926  C C     . ASN B  2 434 ? 14.590  -60.272 -64.911 1.00 55.77  ? 434 ASN B C     1 
ATOM   4927  O O     . ASN B  2 434 ? 13.412  -60.495 -65.184 1.00 57.10  ? 434 ASN B O     1 
ATOM   4928  C CB    . ASN B  2 434 ? 15.227  -61.352 -67.096 1.00 57.52  ? 434 ASN B CB    1 
ATOM   4929  C CG    . ASN B  2 434 ? 16.238  -61.596 -68.199 1.00 86.30  ? 434 ASN B CG    1 
ATOM   4930  O OD1   . ASN B  2 434 ? 16.644  -62.742 -68.465 1.00 88.97  ? 434 ASN B OD1   1 
ATOM   4931  N ND2   . ASN B  2 434 ? 16.568  -60.554 -68.942 1.00 68.88  ? 434 ASN B ND2   1 
ATOM   4932  N N     . HIS B  2 435 ? 15.003  -59.973 -63.655 1.00 50.40  ? 435 HIS B N     1 
ATOM   4933  C CA    . HIS B  2 435 ? 14.100  -59.930 -62.490 1.00 50.86  ? 435 HIS B CA    1 
ATOM   4934  C C     . HIS B  2 435 ? 13.217  -61.182 -62.405 1.00 52.25  ? 435 HIS B C     1 
ATOM   4935  O O     . HIS B  2 435 ? 12.044  -61.096 -62.049 1.00 53.58  ? 435 HIS B O     1 
ATOM   4936  C CB    . HIS B  2 435 ? 13.262  -58.649 -62.523 1.00 51.53  ? 435 HIS B CB    1 
ATOM   4937  C CG    . HIS B  2 435 ? 14.094  -57.461 -62.870 1.00 55.14  ? 435 HIS B CG    1 
ATOM   4938  N ND1   . HIS B  2 435 ? 14.127  -56.963 -64.166 1.00 57.02  ? 435 HIS B ND1   1 
ATOM   4939  C CD2   . HIS B  2 435 ? 15.033  -56.830 -62.136 1.00 55.78  ? 435 HIS B CD2   1 
ATOM   4940  C CE1   . HIS B  2 435 ? 15.035  -56.015 -64.158 1.00 55.71  ? 435 HIS B CE1   1 
ATOM   4941  N NE2   . HIS B  2 435 ? 15.580  -55.871 -62.946 1.00 55.76  ? 435 HIS B NE2   1 
ATOM   4942  N N     . TYR B  2 436 ? 13.778  -62.329 -62.790 1.00 46.65  ? 436 TYR B N     1 
ATOM   4943  C CA    . TYR B  2 436 ? 13.036  -63.572 -62.855 1.00 44.96  ? 436 TYR B CA    1 
ATOM   4944  C C     . TYR B  2 436 ? 13.899  -64.810 -62.786 1.00 49.58  ? 436 TYR B C     1 
ATOM   4945  O O     . TYR B  2 436 ? 14.907  -64.913 -63.456 1.00 50.66  ? 436 TYR B O     1 
ATOM   4946  C CB    . TYR B  2 436 ? 12.222  -63.628 -64.150 1.00 43.70  ? 436 TYR B CB    1 
ATOM   4947  C CG    . TYR B  2 436 ? 11.345  -64.856 -64.236 1.00 42.38  ? 436 TYR B CG    1 
ATOM   4948  C CD1   . TYR B  2 436 ? 10.095  -64.892 -63.614 1.00 42.24  ? 436 TYR B CD1   1 
ATOM   4949  C CD2   . TYR B  2 436 ? 11.825  -66.039 -64.794 1.00 41.99  ? 436 TYR B CD2   1 
ATOM   4950  C CE1   . TYR B  2 436 ? 9.318   -66.045 -63.626 1.00 41.21  ? 436 TYR B CE1   1 
ATOM   4951  C CE2   . TYR B  2 436 ? 11.035  -67.177 -64.861 1.00 41.98  ? 436 TYR B CE2   1 
ATOM   4952  C CZ    . TYR B  2 436 ? 9.802   -67.195 -64.238 1.00 47.78  ? 436 TYR B CZ    1 
ATOM   4953  O OH    . TYR B  2 436 ? 9.073   -68.364 -64.308 1.00 46.12  ? 436 TYR B OH    1 
ATOM   4954  N N     . THR B  2 437 ? 13.456  -65.774 -62.003 1.00 46.00  ? 437 THR B N     1 
ATOM   4955  C CA    . THR B  2 437 ? 14.056  -67.082 -61.946 1.00 44.77  ? 437 THR B CA    1 
ATOM   4956  C C     . THR B  2 437 ? 13.012  -68.098 -61.529 1.00 44.86  ? 437 THR B C     1 
ATOM   4957  O O     . THR B  2 437 ? 12.097  -67.764 -60.779 1.00 41.62  ? 437 THR B O     1 
ATOM   4958  C CB    . THR B  2 437 ? 15.295  -67.129 -61.035 1.00 47.91  ? 437 THR B CB    1 
ATOM   4959  O OG1   . THR B  2 437 ? 16.033  -68.318 -61.347 1.00 52.71  ? 437 THR B OG1   1 
ATOM   4960  C CG2   . THR B  2 437 ? 14.948  -67.088 -59.577 1.00 47.81  ? 437 THR B CG2   1 
ATOM   4961  N N     . GLN B  2 438 ? 13.179  -69.339 -61.982 1.00 42.07  ? 438 GLN B N     1 
ATOM   4962  C CA    . GLN B  2 438 ? 12.324  -70.425 -61.547 1.00 42.92  ? 438 GLN B CA    1 
ATOM   4963  C C     . GLN B  2 438 ? 13.122  -71.651 -61.173 1.00 46.27  ? 438 GLN B C     1 
ATOM   4964  O O     . GLN B  2 438 ? 14.242  -71.801 -61.607 1.00 43.64  ? 438 GLN B O     1 
ATOM   4965  C CB    . GLN B  2 438 ? 11.242  -70.757 -62.578 1.00 44.99  ? 438 GLN B CB    1 
ATOM   4966  C CG    . GLN B  2 438 ? 11.707  -71.200 -63.927 1.00 48.69  ? 438 GLN B CG    1 
ATOM   4967  C CD    . GLN B  2 438 ? 10.558  -71.734 -64.751 1.00 57.50  ? 438 GLN B CD    1 
ATOM   4968  O OE1   . GLN B  2 438 ? 10.511  -72.910 -65.136 1.00 60.76  ? 438 GLN B OE1   1 
ATOM   4969  N NE2   . GLN B  2 438 ? 9.611   -70.893 -65.066 1.00 49.76  ? 438 GLN B NE2   1 
ATOM   4970  N N     . LYS B  2 439 ? 12.574  -72.467 -60.270 1.00 43.58  ? 439 LYS B N     1 
ATOM   4971  C CA    . LYS B  2 439 ? 13.135  -73.759 -59.875 1.00 42.99  ? 439 LYS B CA    1 
ATOM   4972  C C     . LYS B  2 439 ? 11.995  -74.777 -59.932 1.00 45.13  ? 439 LYS B C     1 
ATOM   4973  O O     . LYS B  2 439 ? 10.898  -74.530 -59.415 1.00 43.49  ? 439 LYS B O     1 
ATOM   4974  C CB    . LYS B  2 439 ? 13.733  -73.726 -58.458 1.00 47.03  ? 439 LYS B CB    1 
ATOM   4975  C CG    . LYS B  2 439 ? 15.048  -72.992 -58.371 1.00 63.80  ? 439 LYS B CG    1 
ATOM   4976  C CD    . LYS B  2 439 ? 16.241  -73.855 -58.771 1.00 75.92  ? 439 LYS B CD    1 
ATOM   4977  C CE    . LYS B  2 439 ? 17.542  -73.075 -58.728 1.00 87.82  ? 439 LYS B CE    1 
ATOM   4978  N NZ    . LYS B  2 439 ? 17.517  -71.866 -59.604 1.00 99.90  ? 439 LYS B NZ    1 
ATOM   4979  N N     . SER B  2 440 ? 12.279  -75.919 -60.536 1.00 42.41  ? 440 SER B N     1 
ATOM   4980  C CA    . SER B  2 440 ? 11.346  -76.991 -60.755 1.00 41.73  ? 440 SER B CA    1 
ATOM   4981  C C     . SER B  2 440 ? 11.502  -78.125 -59.756 1.00 48.20  ? 440 SER B C     1 
ATOM   4982  O O     . SER B  2 440 ? 12.525  -78.253 -59.081 1.00 50.08  ? 440 SER B O     1 
ATOM   4983  C CB    . SER B  2 440 ? 11.438  -77.478 -62.193 1.00 43.70  ? 440 SER B CB    1 
ATOM   4984  O OG    . SER B  2 440 ? 11.067  -76.406 -63.053 1.00 50.37  ? 440 SER B OG    1 
ATOM   4985  N N     . LEU B  2 441 ? 10.439  -78.908 -59.640 1.00 43.26  ? 441 LEU B N     1 
ATOM   4986  C CA    . LEU B  2 441 ? 10.293  -80.001 -58.692 1.00 44.17  ? 441 LEU B CA    1 
ATOM   4987  C C     . LEU B  2 441 ? 9.328   -81.006 -59.353 1.00 45.68  ? 441 LEU B C     1 
ATOM   4988  O O     . LEU B  2 441 ? 8.285   -80.615 -59.867 1.00 41.77  ? 441 LEU B O     1 
ATOM   4989  C CB    . LEU B  2 441 ? 9.666   -79.393 -57.406 1.00 45.74  ? 441 LEU B CB    1 
ATOM   4990  C CG    . LEU B  2 441 ? 9.446   -80.271 -56.197 1.00 51.11  ? 441 LEU B CG    1 
ATOM   4991  C CD1   . LEU B  2 441 ? 10.696  -80.709 -55.612 1.00 52.14  ? 441 LEU B CD1   1 
ATOM   4992  C CD2   . LEU B  2 441 ? 8.649   -79.542 -55.163 1.00 53.15  ? 441 LEU B CD2   1 
ATOM   4993  N N     . SER B  2 442 ? 9.716   -82.272 -59.385 1.00 46.05  ? 442 SER B N     1 
ATOM   4994  C CA    . SER B  2 442 ? 8.973   -83.376 -60.004 1.00 46.32  ? 442 SER B CA    1 
ATOM   4995  C C     . SER B  2 442 ? 9.192   -84.622 -59.162 1.00 52.47  ? 442 SER B C     1 
ATOM   4996  O O     . SER B  2 442 ? 10.223  -84.707 -58.490 1.00 51.47  ? 442 SER B O     1 
ATOM   4997  C CB    . SER B  2 442 ? 9.527   -83.635 -61.397 1.00 49.30  ? 442 SER B CB    1 
ATOM   4998  O OG    . SER B  2 442 ? 8.534   -84.243 -62.193 1.00 66.40  ? 442 SER B OG    1 
ATOM   4999  N N     . LEU B  2 443 ? 8.261   -85.590 -59.194 1.00 51.96  ? 443 LEU B N     1 
ATOM   5000  C CA    . LEU B  2 443 ? 8.477   -86.849 -58.465 1.00 53.80  ? 443 LEU B CA    1 
ATOM   5001  C C     . LEU B  2 443 ? 9.594   -87.583 -59.172 1.00 60.02  ? 443 LEU B C     1 
ATOM   5002  O O     . LEU B  2 443 ? 9.472   -87.868 -60.373 1.00 58.63  ? 443 LEU B O     1 
ATOM   5003  C CB    . LEU B  2 443 ? 7.235   -87.740 -58.398 1.00 54.75  ? 443 LEU B CB    1 
ATOM   5004  C CG    . LEU B  2 443 ? 7.386   -89.082 -57.646 1.00 60.95  ? 443 LEU B CG    1 
ATOM   5005  C CD1   . LEU B  2 443 ? 7.990   -88.896 -56.263 1.00 62.49  ? 443 LEU B CD1   1 
ATOM   5006  C CD2   . LEU B  2 443 ? 6.066   -89.725 -57.468 1.00 61.77  ? 443 LEU B CD2   1 
ATOM   5007  N N     . SER B  2 444 ? 10.727  -87.780 -58.436 1.00 58.54  ? 444 SER B N     1 
ATOM   5008  C CA    . SER B  2 444 ? 11.956  -88.434 -58.902 1.00 98.81  ? 444 SER B CA    1 
ATOM   5009  C C     . SER B  2 444 ? 11.707  -89.774 -59.626 1.00 119.64 ? 444 SER B C     1 
ATOM   5010  O O     . SER B  2 444 ? 11.355  -90.775 -59.004 1.00 79.13  ? 444 SER B O     1 
ATOM   5011  C CB    . SER B  2 444 ? 12.906  -88.639 -57.723 1.00 102.72 ? 444 SER B CB    1 
ATOM   5012  O OG    . SER B  2 444 ? 14.155  -89.168 -58.140 1.00 115.88 ? 444 SER B OG    1 
ATOM   5013  N N     . GLU C  1 1   ? 15.755  20.582  22.516  1.00 111.78 ? 1   GLU F N     1 
ATOM   5014  C CA    . GLU C  1 1   ? 15.565  19.581  21.458  1.00 106.89 ? 1   GLU F CA    1 
ATOM   5015  C C     . GLU C  1 1   ? 15.340  18.200  22.107  1.00 107.32 ? 1   GLU F C     1 
ATOM   5016  O O     . GLU C  1 1   ? 16.293  17.591  22.608  1.00 110.99 ? 1   GLU F O     1 
ATOM   5017  C CB    . GLU C  1 1   ? 16.772  19.586  20.490  1.00 108.83 ? 1   GLU F CB    1 
ATOM   5018  C CG    . GLU C  1 1   ? 16.396  19.406  19.032  1.00 109.34 ? 1   GLU F CG    1 
ATOM   5019  C CD    . GLU C  1 1   ? 15.806  18.060  18.668  1.00 121.20 ? 1   GLU F CD    1 
ATOM   5020  O OE1   . GLU C  1 1   ? 16.136  17.059  19.343  1.00 122.14 ? 1   GLU F OE1   1 
ATOM   5021  O OE2   . GLU C  1 1   ? 15.055  17.995  17.669  1.00 103.26 ? 1   GLU F OE2   1 
ATOM   5022  N N     . ILE C  1 2   ? 14.069  17.744  22.144  1.00 95.33  ? 2   ILE F N     1 
ATOM   5023  C CA    . ILE C  1 2   ? 13.660  16.472  22.756  1.00 91.52  ? 2   ILE F CA    1 
ATOM   5024  C C     . ILE C  1 2   ? 13.435  15.460  21.649  1.00 87.77  ? 2   ILE F C     1 
ATOM   5025  O O     . ILE C  1 2   ? 12.814  15.802  20.650  1.00 84.57  ? 2   ILE F O     1 
ATOM   5026  C CB    . ILE C  1 2   ? 12.396  16.668  23.646  1.00 93.49  ? 2   ILE F CB    1 
ATOM   5027  C CG1   . ILE C  1 2   ? 12.765  17.492  24.874  1.00 98.03  ? 2   ILE F CG1   1 
ATOM   5028  C CG2   . ILE C  1 2   ? 11.754  15.320  24.058  1.00 91.23  ? 2   ILE F CG2   1 
ATOM   5029  C CD1   . ILE C  1 2   ? 11.611  17.958  25.759  1.00 96.08  ? 2   ILE F CD1   1 
ATOM   5030  N N     . VAL C  1 3   ? 13.882  14.210  21.851  1.00 82.99  ? 3   VAL F N     1 
ATOM   5031  C CA    . VAL C  1 3   ? 13.742  13.130  20.859  1.00 78.88  ? 3   VAL F CA    1 
ATOM   5032  C C     . VAL C  1 3   ? 12.934  11.972  21.429  1.00 83.02  ? 3   VAL F C     1 
ATOM   5033  O O     . VAL C  1 3   ? 12.965  11.729  22.634  1.00 84.73  ? 3   VAL F O     1 
ATOM   5034  C CB    . VAL C  1 3   ? 15.094  12.672  20.252  1.00 83.01  ? 3   VAL F CB    1 
ATOM   5035  C CG1   . VAL C  1 3   ? 15.743  13.804  19.475  1.00 83.90  ? 3   VAL F CG1   1 
ATOM   5036  C CG2   . VAL C  1 3   ? 16.059  12.141  21.316  1.00 86.05  ? 3   VAL F CG2   1 
ATOM   5037  N N     . LEU C  1 4   ? 12.176  11.292  20.549  1.00 78.97  ? 4   LEU F N     1 
ATOM   5038  C CA    . LEU C  1 4   ? 11.267  10.199  20.894  1.00 77.90  ? 4   LEU F CA    1 
ATOM   5039  C C     . LEU C  1 4   ? 11.612  8.899   20.169  1.00 82.20  ? 4   LEU F C     1 
ATOM   5040  O O     . LEU C  1 4   ? 11.693  8.878   18.938  1.00 80.74  ? 4   LEU F O     1 
ATOM   5041  C CB    . LEU C  1 4   ? 9.833   10.586  20.536  1.00 74.42  ? 4   LEU F CB    1 
ATOM   5042  C CG    . LEU C  1 4   ? 9.337   11.933  21.062  1.00 79.37  ? 4   LEU F CG    1 
ATOM   5043  C CD1   . LEU C  1 4   ? 7.926   12.220  20.559  1.00 75.50  ? 4   LEU F CD1   1 
ATOM   5044  C CD2   . LEU C  1 4   ? 9.430   12.001  22.605  1.00 87.05  ? 4   LEU F CD2   1 
ATOM   5045  N N     . THR C  1 5   ? 11.762  7.811   20.944  1.00 79.93  ? 5   THR F N     1 
ATOM   5046  C CA    . THR C  1 5   ? 12.061  6.468   20.465  1.00 78.12  ? 5   THR F CA    1 
ATOM   5047  C C     . THR C  1 5   ? 10.813  5.606   20.646  1.00 81.46  ? 5   THR F C     1 
ATOM   5048  O O     . THR C  1 5   ? 10.309  5.514   21.765  1.00 82.78  ? 5   THR F O     1 
ATOM   5049  C CB    . THR C  1 5   ? 13.215  5.867   21.293  1.00 84.67  ? 5   THR F CB    1 
ATOM   5050  O OG1   . THR C  1 5   ? 14.369  6.704   21.163  1.00 82.45  ? 5   THR F OG1   1 
ATOM   5051  C CG2   . THR C  1 5   ? 13.537  4.431   20.882  1.00 84.32  ? 5   THR F CG2   1 
ATOM   5052  N N     . GLN C  1 6   ? 10.325  4.967   19.562  1.00 76.32  ? 6   GLN F N     1 
ATOM   5053  C CA    . GLN C  1 6   ? 9.189   4.052   19.639  1.00 75.13  ? 6   GLN F CA    1 
ATOM   5054  C C     . GLN C  1 6   ? 9.644   2.601   19.563  1.00 82.66  ? 6   GLN F C     1 
ATOM   5055  O O     . GLN C  1 6   ? 10.693  2.298   18.979  1.00 81.41  ? 6   GLN F O     1 
ATOM   5056  C CB    . GLN C  1 6   ? 8.159   4.342   18.573  1.00 72.06  ? 6   GLN F CB    1 
ATOM   5057  C CG    . GLN C  1 6   ? 7.324   5.539   18.920  1.00 74.42  ? 6   GLN F CG    1 
ATOM   5058  C CD    . GLN C  1 6   ? 6.299   5.795   17.863  1.00 78.77  ? 6   GLN F CD    1 
ATOM   5059  O OE1   . GLN C  1 6   ? 6.490   6.629   16.975  1.00 68.10  ? 6   GLN F OE1   1 
ATOM   5060  N NE2   . GLN C  1 6   ? 5.230   5.024   17.890  1.00 73.03  ? 6   GLN F NE2   1 
ATOM   5061  N N     . SER C  1 7   ? 8.863   1.709   20.199  1.00 82.86  ? 7   SER F N     1 
ATOM   5062  C CA    . SER C  1 7   ? 9.180   0.287   20.266  1.00 85.37  ? 7   SER F CA    1 
ATOM   5063  C C     . SER C  1 7   ? 7.910   -0.571  20.327  1.00 89.76  ? 7   SER F C     1 
ATOM   5064  O O     . SER C  1 7   ? 6.943   -0.196  20.994  1.00 90.38  ? 7   SER F O     1 
ATOM   5065  C CB    . SER C  1 7   ? 10.076  -0.001  21.469  1.00 95.45  ? 7   SER F CB    1 
ATOM   5066  O OG    . SER C  1 7   ? 11.437  0.126   21.085  1.00 109.71 ? 7   SER F OG    1 
ATOM   5067  N N     . PRO C  1 8   ? 7.910   -1.757  19.685  1.00 86.24  ? 8   PRO F N     1 
ATOM   5068  C CA    . PRO C  1 8   ? 8.939   -2.289  18.782  1.00 84.17  ? 8   PRO F CA    1 
ATOM   5069  C C     . PRO C  1 8   ? 8.740   -1.591  17.442  1.00 79.13  ? 8   PRO F C     1 
ATOM   5070  O O     . PRO C  1 8   ? 7.681   -1.018  17.242  1.00 74.52  ? 8   PRO F O     1 
ATOM   5071  C CB    . PRO C  1 8   ? 8.590   -3.775  18.720  1.00 87.74  ? 8   PRO F CB    1 
ATOM   5072  C CG    . PRO C  1 8   ? 7.094   -3.789  18.782  1.00 92.36  ? 8   PRO F CG    1 
ATOM   5073  C CD    . PRO C  1 8   ? 6.701   -2.605  19.658  1.00 88.88  ? 8   PRO F CD    1 
ATOM   5074  N N     . ALA C  1 9   ? 9.736   -1.590  16.555  1.00 74.48  ? 9   ALA F N     1 
ATOM   5075  C CA    . ALA C  1 9   ? 9.578   -0.938  15.253  1.00 71.69  ? 9   ALA F CA    1 
ATOM   5076  C C     . ALA C  1 9   ? 8.415   -1.547  14.479  1.00 75.13  ? 9   ALA F C     1 
ATOM   5077  O O     . ALA C  1 9   ? 7.715   -0.853  13.730  1.00 72.48  ? 9   ALA F O     1 
ATOM   5078  C CB    . ALA C  1 9   ? 10.855  -1.086  14.437  1.00 72.27  ? 9   ALA F CB    1 
ATOM   5079  N N     . THR C  1 10  ? 8.233   -2.859  14.639  1.00 73.87  ? 10  THR F N     1 
ATOM   5080  C CA    . THR C  1 10  ? 7.184   -3.591  13.943  1.00 72.78  ? 10  THR F CA    1 
ATOM   5081  C C     . THR C  1 10  ? 6.549   -4.581  14.919  1.00 79.10  ? 10  THR F C     1 
ATOM   5082  O O     . THR C  1 10  ? 7.255   -5.259  15.665  1.00 80.55  ? 10  THR F O     1 
ATOM   5083  C CB    . THR C  1 10  ? 7.767   -4.205  12.650  1.00 76.97  ? 10  THR F CB    1 
ATOM   5084  O OG1   . THR C  1 10  ? 6.711   -4.779  11.889  1.00 76.34  ? 10  THR F OG1   1 
ATOM   5085  C CG2   . THR C  1 10  ? 8.863   -5.241  12.917  1.00 83.63  ? 10  THR F CG2   1 
ATOM   5086  N N     . LEU C  1 11  ? 5.213   -4.602  14.951  1.00 76.00  ? 11  LEU F N     1 
ATOM   5087  C CA    . LEU C  1 11  ? 4.422   -5.445  15.847  1.00 78.39  ? 11  LEU F CA    1 
ATOM   5088  C C     . LEU C  1 11  ? 3.509   -6.309  14.969  1.00 81.94  ? 11  LEU F C     1 
ATOM   5089  O O     . LEU C  1 11  ? 2.763   -5.788  14.144  1.00 78.52  ? 11  LEU F O     1 
ATOM   5090  C CB    . LEU C  1 11  ? 3.622   -4.533  16.781  1.00 78.75  ? 11  LEU F CB    1 
ATOM   5091  C CG    . LEU C  1 11  ? 2.909   -5.172  17.951  1.00 86.79  ? 11  LEU F CG    1 
ATOM   5092  C CD1   . LEU C  1 11  ? 3.860   -5.979  18.821  1.00 88.76  ? 11  LEU F CD1   1 
ATOM   5093  C CD2   . LEU C  1 11  ? 2.216   -4.107  18.788  1.00 88.95  ? 11  LEU F CD2   1 
ATOM   5094  N N     . SER C  1 12  ? 3.656   -7.627  15.085  1.00 81.58  ? 12  SER F N     1 
ATOM   5095  C CA    . SER C  1 12  ? 2.960   -8.619  14.269  1.00 81.66  ? 12  SER F CA    1 
ATOM   5096  C C     . SER C  1 12  ? 1.974   -9.386  15.157  1.00 88.45  ? 12  SER F C     1 
ATOM   5097  O O     . SER C  1 12  ? 2.392   -10.126 16.047  1.00 90.95  ? 12  SER F O     1 
ATOM   5098  C CB    . SER C  1 12  ? 3.978   -9.559  13.631  1.00 85.33  ? 12  SER F CB    1 
ATOM   5099  O OG    . SER C  1 12  ? 3.347   -10.370 12.659  1.00 97.15  ? 12  SER F OG    1 
ATOM   5100  N N     . LEU C  1 13  ? 0.668   -9.151  14.942  1.00 84.77  ? 13  LEU F N     1 
ATOM   5101  C CA    . LEU C  1 13  ? -0.420  -9.692  15.745  1.00 88.17  ? 13  LEU F CA    1 
ATOM   5102  C C     . LEU C  1 13  ? -1.599  -10.151 14.911  1.00 93.45  ? 13  LEU F C     1 
ATOM   5103  O O     . LEU C  1 13  ? -1.744  -9.738  13.780  1.00 91.02  ? 13  LEU F O     1 
ATOM   5104  C CB    . LEU C  1 13  ? -0.908  -8.581  16.685  1.00 88.20  ? 13  LEU F CB    1 
ATOM   5105  C CG    . LEU C  1 13  ? 0.086   -8.072  17.722  1.00 93.56  ? 13  LEU F CG    1 
ATOM   5106  C CD1   . LEU C  1 13  ? -0.415  -6.785  18.349  1.00 92.91  ? 13  LEU F CD1   1 
ATOM   5107  C CD2   . LEU C  1 13  ? 0.375   -9.148  18.791  1.00 100.51 ? 13  LEU F CD2   1 
ATOM   5108  N N     . SER C  1 14  ? -2.473  -10.968 15.488  1.00 95.56  ? 14  SER F N     1 
ATOM   5109  C CA    . SER C  1 14  ? -3.670  -11.483 14.819  1.00 96.27  ? 14  SER F CA    1 
ATOM   5110  C C     . SER C  1 14  ? -4.876  -10.614 15.214  1.00 100.80 ? 14  SER F C     1 
ATOM   5111  O O     . SER C  1 14  ? -4.924  -10.166 16.360  1.00 101.05 ? 14  SER F O     1 
ATOM   5112  C CB    . SER C  1 14  ? -3.934  -12.923 15.269  1.00 103.26 ? 14  SER F CB    1 
ATOM   5113  O OG    . SER C  1 14  ? -2.741  -13.686 15.360  1.00 105.78 ? 14  SER F OG    1 
ATOM   5114  N N     . PRO C  1 15  ? -5.883  -10.408 14.332  1.00 98.20  ? 15  PRO F N     1 
ATOM   5115  C CA    . PRO C  1 15  ? -7.069  -9.627  14.744  1.00 99.33  ? 15  PRO F CA    1 
ATOM   5116  C C     . PRO C  1 15  ? -7.784  -10.279 15.938  1.00 110.01 ? 15  PRO F C     1 
ATOM   5117  O O     . PRO C  1 15  ? -8.202  -11.432 15.847  1.00 113.76 ? 15  PRO F O     1 
ATOM   5118  C CB    . PRO C  1 15  ? -7.940  -9.593  13.483  1.00 100.24 ? 15  PRO F CB    1 
ATOM   5119  C CG    . PRO C  1 15  ? -7.426  -10.678 12.610  1.00 104.79 ? 15  PRO F CG    1 
ATOM   5120  C CD    . PRO C  1 15  ? -5.981  -10.842 12.924  1.00 98.58  ? 15  PRO F CD    1 
ATOM   5121  N N     . GLY C  1 16  ? -7.848  -9.547  17.052  1.00 106.63 ? 16  GLY F N     1 
ATOM   5122  C CA    . GLY C  1 16  ? -8.397  -9.996  18.321  1.00 111.14 ? 16  GLY F CA    1 
ATOM   5123  C C     . GLY C  1 16  ? -7.398  -9.785  19.445  1.00 115.56 ? 16  GLY F C     1 
ATOM   5124  O O     . GLY C  1 16  ? -7.785  -9.584  20.600  1.00 118.33 ? 16  GLY F O     1 
ATOM   5125  N N     . GLU C  1 17  ? -6.094  -9.839  19.114  1.00 109.32 ? 17  GLU F N     1 
ATOM   5126  C CA    . GLU C  1 17  ? -5.010  -9.639  20.082  1.00 109.23 ? 17  GLU F CA    1 
ATOM   5127  C C     . GLU C  1 17  ? -4.884  -8.176  20.528  1.00 109.62 ? 17  GLU F C     1 
ATOM   5128  O O     . GLU C  1 17  ? -5.420  -7.260  19.894  1.00 105.22 ? 17  GLU F O     1 
ATOM   5129  C CB    . GLU C  1 17  ? -3.652  -10.074 19.482  1.00 108.40 ? 17  GLU F CB    1 
ATOM   5130  C CG    . GLU C  1 17  ? -3.510  -11.560 19.212  1.00 120.83 ? 17  GLU F CG    1 
ATOM   5131  C CD    . GLU C  1 17  ? -2.067  -11.999 19.052  1.00 132.33 ? 17  GLU F CD    1 
ATOM   5132  O OE1   . GLU C  1 17  ? -1.374  -12.152 20.085  1.00 133.81 ? 17  GLU F OE1   1 
ATOM   5133  O OE2   . GLU C  1 17  ? -1.618  -12.157 17.894  1.00 111.34 ? 17  GLU F OE2   1 
ATOM   5134  N N     . ARG C  1 18  ? -4.110  -7.974  21.601  1.00 107.59 ? 18  ARG F N     1 
ATOM   5135  C CA    . ARG C  1 18  ? -3.805  -6.663  22.155  1.00 105.69 ? 18  ARG F CA    1 
ATOM   5136  C C     . ARG C  1 18  ? -2.501  -6.148  21.558  1.00 105.95 ? 18  ARG F C     1 
ATOM   5137  O O     . ARG C  1 18  ? -1.579  -6.933  21.317  1.00 106.38 ? 18  ARG F O     1 
ATOM   5138  C CB    . ARG C  1 18  ? -3.654  -6.759  23.670  1.00 110.01 ? 18  ARG F CB    1 
ATOM   5139  C CG    . ARG C  1 18  ? -3.472  -5.427  24.396  1.00 116.53 ? 18  ARG F CG    1 
ATOM   5140  C CD    . ARG C  1 18  ? -3.778  -5.643  25.865  1.00 121.20 ? 18  ARG F CD    1 
ATOM   5141  N NE    . ARG C  1 18  ? -3.432  -4.521  26.742  1.00 130.64 ? 18  ARG F NE    1 
ATOM   5142  C CZ    . ARG C  1 18  ? -2.362  -4.437  27.541  1.00 153.15 ? 18  ARG F CZ    1 
ATOM   5143  N NH1   . ARG C  1 18  ? -1.454  -5.412  27.564  1.00 144.34 ? 18  ARG F NH1   1 
ATOM   5144  N NH2   . ARG C  1 18  ? -2.178  -3.365  28.303  1.00 141.74 ? 18  ARG F NH2   1 
ATOM   5145  N N     . ALA C  1 19  ? -2.419  -4.827  21.351  1.00 97.80  ? 19  ALA F N     1 
ATOM   5146  C CA    . ALA C  1 19  ? -1.225  -4.160  20.845  1.00 92.88  ? 19  ALA F CA    1 
ATOM   5147  C C     . ALA C  1 19  ? -0.809  -3.111  21.868  1.00 95.91  ? 19  ALA F C     1 
ATOM   5148  O O     . ALA C  1 19  ? -1.597  -2.213  22.152  1.00 97.31  ? 19  ALA F O     1 
ATOM   5149  C CB    . ALA C  1 19  ? -1.527  -3.493  19.515  1.00 88.82  ? 19  ALA F CB    1 
ATOM   5150  N N     . THR C  1 20  ? 0.391   -3.239  22.456  1.00 89.92  ? 20  THR F N     1 
ATOM   5151  C CA    . THR C  1 20  ? 0.895   -2.253  23.410  1.00 90.18  ? 20  THR F CA    1 
ATOM   5152  C C     . THR C  1 20  ? 2.109   -1.634  22.765  1.00 90.06  ? 20  THR F C     1 
ATOM   5153  O O     . THR C  1 20  ? 3.120   -2.324  22.614  1.00 91.03  ? 20  THR F O     1 
ATOM   5154  C CB    . THR C  1 20  ? 1.211   -2.886  24.774  1.00 102.21 ? 20  THR F CB    1 
ATOM   5155  O OG1   . THR C  1 20  ? 2.139   -3.959  24.612  1.00 111.24 ? 20  THR F OG1   1 
ATOM   5156  C CG2   . THR C  1 20  ? -0.015  -3.395  25.456  1.00 97.83  ? 20  THR F CG2   1 
ATOM   5157  N N     . LEU C  1 21  ? 1.992   -0.370  22.308  1.00 82.47  ? 21  LEU F N     1 
ATOM   5158  C CA    . LEU C  1 21  ? 3.088   0.336   21.633  1.00 79.13  ? 21  LEU F CA    1 
ATOM   5159  C C     . LEU C  1 21  ? 3.734   1.240   22.655  1.00 83.69  ? 21  LEU F C     1 
ATOM   5160  O O     . LEU C  1 21  ? 3.023   1.829   23.454  1.00 84.90  ? 21  LEU F O     1 
ATOM   5161  C CB    . LEU C  1 21  ? 2.586   1.184   20.453  1.00 75.03  ? 21  LEU F CB    1 
ATOM   5162  C CG    . LEU C  1 21  ? 1.461   0.650   19.573  1.00 77.10  ? 21  LEU F CG    1 
ATOM   5163  C CD1   . LEU C  1 21  ? 1.421   1.428   18.300  1.00 73.10  ? 21  LEU F CD1   1 
ATOM   5164  C CD2   . LEU C  1 21  ? 1.596   -0.826  19.273  1.00 79.58  ? 21  LEU F CD2   1 
ATOM   5165  N N     . SER C  1 22  ? 5.064   1.354   22.641  1.00 79.19  ? 22  SER F N     1 
ATOM   5166  C CA    . SER C  1 22  ? 5.783   2.152   23.633  1.00 80.35  ? 22  SER F CA    1 
ATOM   5167  C C     . SER C  1 22  ? 6.418   3.379   23.013  1.00 80.79  ? 22  SER F C     1 
ATOM   5168  O O     . SER C  1 22  ? 6.887   3.315   21.885  1.00 74.36  ? 22  SER F O     1 
ATOM   5169  C CB    . SER C  1 22  ? 6.874   1.313   24.301  1.00 84.10  ? 22  SER F CB    1 
ATOM   5170  O OG    . SER C  1 22  ? 6.568   -0.071  24.251  1.00 92.41  ? 22  SER F OG    1 
ATOM   5171  N N     . CYS C  1 23  ? 6.532   4.461   23.796  1.00 81.32  ? 23  CYS F N     1 
ATOM   5172  C CA    . CYS C  1 23  ? 7.226   5.673   23.364  1.00 80.24  ? 23  CYS F CA    1 
ATOM   5173  C C     . CYS C  1 23  ? 8.026   6.218   24.534  1.00 83.55  ? 23  CYS F C     1 
ATOM   5174  O O     . CYS C  1 23  ? 7.487   6.393   25.617  1.00 82.53  ? 23  CYS F O     1 
ATOM   5175  C CB    . CYS C  1 23  ? 6.279   6.726   22.797  1.00 78.68  ? 23  CYS F CB    1 
ATOM   5176  S SG    . CYS C  1 23  ? 7.108   8.292   22.412  1.00 81.97  ? 23  CYS F SG    1 
ATOM   5177  N N     . ARG C  1 24  ? 9.313   6.473   24.297  1.00 82.84  ? 24  ARG F N     1 
ATOM   5178  C CA    . ARG C  1 24  ? 10.262  6.940   25.301  1.00 86.97  ? 24  ARG F CA    1 
ATOM   5179  C C     . ARG C  1 24  ? 10.815  8.294   24.879  1.00 91.50  ? 24  ARG F C     1 
ATOM   5180  O O     . ARG C  1 24  ? 11.367  8.401   23.783  1.00 89.47  ? 24  ARG F O     1 
ATOM   5181  C CB    . ARG C  1 24  ? 11.407  5.920   25.464  1.00 88.28  ? 24  ARG F CB    1 
ATOM   5182  C CG    . ARG C  1 24  ? 11.013  4.697   26.292  1.00 101.78 ? 24  ARG F CG    1 
ATOM   5183  C CD    . ARG C  1 24  ? 12.204  4.016   26.937  1.00 121.60 ? 24  ARG F CD    1 
ATOM   5184  N NE    . ARG C  1 24  ? 11.815  3.238   28.118  1.00 142.12 ? 24  ARG F NE    1 
ATOM   5185  C CZ    . ARG C  1 24  ? 12.664  2.636   28.954  1.00 161.41 ? 24  ARG F CZ    1 
ATOM   5186  N NH1   . ARG C  1 24  ? 13.977  2.706   28.750  1.00 151.27 ? 24  ARG F NH1   1 
ATOM   5187  N NH2   . ARG C  1 24  ? 12.205  1.959   30.001  1.00 150.28 ? 24  ARG F NH2   1 
ATOM   5188  N N     . ALA C  1 25  ? 10.716  9.304   25.768  1.00 90.09  ? 25  ALA F N     1 
ATOM   5189  C CA    . ALA C  1 25  ? 11.193  10.671  25.520  1.00 89.41  ? 25  ALA F CA    1 
ATOM   5190  C C     . ALA C  1 25  ? 12.566  10.869  26.208  1.00 92.90  ? 25  ALA F C     1 
ATOM   5191  O O     . ALA C  1 25  ? 12.747  10.392  27.326  1.00 93.45  ? 25  ALA F O     1 
ATOM   5192  C CB    . ALA C  1 25  ? 10.183  11.681  26.069  1.00 90.81  ? 25  ALA F CB    1 
ATOM   5193  N N     . SER C  1 26  ? 13.526  11.552  25.532  1.00 89.20  ? 26  SER F N     1 
ATOM   5194  C CA    . SER C  1 26  ? 14.860  11.813  26.090  1.00 93.51  ? 26  SER F CA    1 
ATOM   5195  C C     . SER C  1 26  ? 14.798  12.648  27.369  1.00 101.83 ? 26  SER F C     1 
ATOM   5196  O O     . SER C  1 26  ? 15.580  12.392  28.284  1.00 106.04 ? 26  SER F O     1 
ATOM   5197  C CB    . SER C  1 26  ? 15.781  12.463  25.059  1.00 96.13  ? 26  SER F CB    1 
ATOM   5198  O OG    . SER C  1 26  ? 15.265  13.673  24.533  1.00 101.69 ? 26  SER F OG    1 
ATOM   5199  N N     . LYS C  1 27  ? 13.856  13.617  27.450  1.00 96.84  ? 27  LYS F N     1 
ATOM   5200  C CA    . LYS C  1 27  ? 13.625  14.427  28.659  1.00 99.19  ? 27  LYS F CA    1 
ATOM   5201  C C     . LYS C  1 27  ? 12.136  14.323  29.005  1.00 101.23 ? 27  LYS F C     1 
ATOM   5202  O O     . LYS C  1 27  ? 11.307  13.924  28.160  1.00 94.84  ? 27  LYS F O     1 
ATOM   5203  C CB    . LYS C  1 27  ? 13.968  15.922  28.466  1.00 102.36 ? 27  LYS F CB    1 
ATOM   5204  C CG    . LYS C  1 27  ? 15.200  16.241  27.642  1.00 113.04 ? 27  LYS F CG    1 
ATOM   5205  C CD    . LYS C  1 27  ? 15.334  17.760  27.463  1.00 122.69 ? 27  LYS F CD    1 
ATOM   5206  C CE    . LYS C  1 27  ? 16.527  18.185  26.637  1.00 140.48 ? 27  LYS F CE    1 
ATOM   5207  N NZ    . LYS C  1 27  ? 16.533  17.579  25.283  1.00 148.28 ? 27  LYS F NZ    1 
ATOM   5208  N N     . GLY C  1 28  ? 11.813  14.733  30.230  1.00 100.94 ? 28  GLY F N     1 
ATOM   5209  C CA    . GLY C  1 28  ? 10.449  14.731  30.732  1.00 100.34 ? 28  GLY F CA    1 
ATOM   5210  C C     . GLY C  1 28  ? 9.558   15.652  29.929  1.00 102.85 ? 28  GLY F C     1 
ATOM   5211  O O     . GLY C  1 28  ? 9.973   16.761  29.582  1.00 103.41 ? 28  GLY F O     1 
ATOM   5212  N N     . VAL C  1 29  ? 8.359   15.174  29.573  1.00 96.64  ? 29  VAL F N     1 
ATOM   5213  C CA    . VAL C  1 29  ? 7.410   15.958  28.787  1.00 95.18  ? 29  VAL F CA    1 
ATOM   5214  C C     . VAL C  1 29  ? 6.231   16.427  29.640  1.00 103.82 ? 29  VAL F C     1 
ATOM   5215  O O     . VAL C  1 29  ? 5.466   17.266  29.173  1.00 102.58 ? 29  VAL F O     1 
ATOM   5216  C CB    . VAL C  1 29  ? 6.960   15.251  27.464  1.00 93.40  ? 29  VAL F CB    1 
ATOM   5217  C CG1   . VAL C  1 29  ? 8.147   15.058  26.533  1.00 91.50  ? 29  VAL F CG1   1 
ATOM   5218  C CG2   . VAL C  1 29  ? 6.271   13.912  27.715  1.00 92.09  ? 29  VAL F CG2   1 
ATOM   5219  N N     . SER C  1 30  ? 6.104   15.926  30.889  1.00 105.52 ? 30  SER F N     1 
ATOM   5220  C CA    . SER C  1 30  ? 5.050   16.335  31.813  1.00 109.03 ? 30  SER F CA    1 
ATOM   5221  C C     . SER C  1 30  ? 5.381   17.630  32.537  1.00 121.52 ? 30  SER F C     1 
ATOM   5222  O O     . SER C  1 30  ? 6.411   17.705  33.211  1.00 124.65 ? 30  SER F O     1 
ATOM   5223  C CB    . SER C  1 30  ? 4.754   15.234  32.825  1.00 114.14 ? 30  SER F CB    1 
ATOM   5224  O OG    . SER C  1 30  ? 4.288   14.066  32.171  1.00 120.21 ? 30  SER F OG    1 
ATOM   5225  N N     . THR C  1 31  ? 4.506   18.654  32.392  1.00 121.07 ? 31  THR F N     1 
ATOM   5226  C CA    . THR C  1 31  ? 4.658   19.963  33.043  1.00 125.75 ? 31  THR F CA    1 
ATOM   5227  C C     . THR C  1 31  ? 3.283   20.550  33.407  1.00 131.01 ? 31  THR F C     1 
ATOM   5228  O O     . THR C  1 31  ? 2.383   20.569  32.561  1.00 126.32 ? 31  THR F O     1 
ATOM   5229  C CB    . THR C  1 31  ? 5.398   20.951  32.112  1.00 135.11 ? 31  THR F CB    1 
ATOM   5230  O OG1   . THR C  1 31  ? 6.520   20.309  31.493  1.00 135.52 ? 31  THR F OG1   1 
ATOM   5231  C CG2   . THR C  1 31  ? 5.845   22.221  32.847  1.00 135.33 ? 31  THR F CG2   1 
ATOM   5232  N N     . SER C  1 32  ? 3.133   21.042  34.651  1.00 133.66 ? 32  SER F N     1 
ATOM   5233  C CA    . SER C  1 32  ? 1.906   21.695  35.158  1.00 136.05 ? 32  SER F CA    1 
ATOM   5234  C C     . SER C  1 32  ? 0.637   20.797  35.180  1.00 138.17 ? 32  SER F C     1 
ATOM   5235  O O     . SER C  1 32  ? -0.465  21.285  34.917  1.00 137.27 ? 32  SER F O     1 
ATOM   5236  C CB    . SER C  1 32  ? 1.624   22.983  34.381  1.00 139.43 ? 32  SER F CB    1 
ATOM   5237  O OG    . SER C  1 32  ? 2.793   23.763  34.193  1.00 150.65 ? 32  SER F OG    1 
ATOM   5238  N N     . GLY C  1 33  ? 0.800   19.517  35.516  1.00 133.69 ? 33  GLY F N     1 
ATOM   5239  C CA    . GLY C  1 33  ? -0.311  18.572  35.599  1.00 132.13 ? 33  GLY F CA    1 
ATOM   5240  C C     . GLY C  1 33  ? -0.697  17.863  34.313  1.00 129.95 ? 33  GLY F C     1 
ATOM   5241  O O     . GLY C  1 33  ? -1.602  17.029  34.338  1.00 128.97 ? 33  GLY F O     1 
ATOM   5242  N N     . TYR C  1 34  ? -0.029  18.167  33.182  1.00 123.46 ? 34  TYR F N     1 
ATOM   5243  C CA    . TYR C  1 34  ? -0.302  17.523  31.891  1.00 118.60 ? 34  TYR F CA    1 
ATOM   5244  C C     . TYR C  1 34  ? 0.986   16.969  31.273  1.00 115.32 ? 34  TYR F C     1 
ATOM   5245  O O     . TYR C  1 34  ? 2.047   17.575  31.420  1.00 114.20 ? 34  TYR F O     1 
ATOM   5246  C CB    . TYR C  1 34  ? -0.948  18.518  30.913  1.00 118.75 ? 34  TYR F CB    1 
ATOM   5247  C CG    . TYR C  1 34  ? -2.376  18.866  31.268  1.00 124.20 ? 34  TYR F CG    1 
ATOM   5248  C CD1   . TYR C  1 34  ? -3.411  17.966  31.038  1.00 125.38 ? 34  TYR F CD1   1 
ATOM   5249  C CD2   . TYR C  1 34  ? -2.696  20.096  31.833  1.00 128.43 ? 34  TYR F CD2   1 
ATOM   5250  C CE1   . TYR C  1 34  ? -4.729  18.281  31.358  1.00 127.82 ? 34  TYR F CE1   1 
ATOM   5251  C CE2   . TYR C  1 34  ? -4.011  20.424  32.156  1.00 130.90 ? 34  TYR F CE2   1 
ATOM   5252  C CZ    . TYR C  1 34  ? -5.028  19.516  31.913  1.00 137.64 ? 34  TYR F CZ    1 
ATOM   5253  O OH    . TYR C  1 34  ? -6.332  19.828  32.233  1.00 141.28 ? 34  TYR F OH    1 
ATOM   5254  N N     . SER C  1 35  ? 0.863   15.838  30.543  1.00 106.23 ? 35  SER F N     1 
ATOM   5255  C CA    . SER C  1 35  ? 1.959   15.187  29.825  1.00 102.01 ? 35  SER F CA    1 
ATOM   5256  C C     . SER C  1 35  ? 1.757   15.525  28.348  1.00 98.78  ? 35  SER F C     1 
ATOM   5257  O O     . SER C  1 35  ? 0.786   15.070  27.751  1.00 94.13  ? 35  SER F O     1 
ATOM   5258  C CB    . SER C  1 35  ? 1.943   13.675  30.055  1.00 104.62 ? 35  SER F CB    1 
ATOM   5259  O OG    . SER C  1 35  ? 1.750   13.318  31.414  1.00 111.21 ? 35  SER F OG    1 
ATOM   5260  N N     . TYR C  1 36  ? 2.616   16.389  27.783  1.00 93.71  ? 36  TYR F N     1 
ATOM   5261  C CA    . TYR C  1 36  ? 2.472   16.827  26.392  1.00 88.93  ? 36  TYR F CA    1 
ATOM   5262  C C     . TYR C  1 36  ? 2.960   15.772  25.362  1.00 89.53  ? 36  TYR F C     1 
ATOM   5263  O O     . TYR C  1 36  ? 3.954   15.999  24.673  1.00 88.50  ? 36  TYR F O     1 
ATOM   5264  C CB    . TYR C  1 36  ? 3.161   18.188  26.193  1.00 90.59  ? 36  TYR F CB    1 
ATOM   5265  C CG    . TYR C  1 36  ? 2.487   19.294  26.972  1.00 95.31  ? 36  TYR F CG    1 
ATOM   5266  C CD1   . TYR C  1 36  ? 1.254   19.803  26.573  1.00 96.18  ? 36  TYR F CD1   1 
ATOM   5267  C CD2   . TYR C  1 36  ? 3.059   19.804  28.136  1.00 99.54  ? 36  TYR F CD2   1 
ATOM   5268  C CE1   . TYR C  1 36  ? 0.605   20.786  27.314  1.00 100.31 ? 36  TYR F CE1   1 
ATOM   5269  C CE2   . TYR C  1 36  ? 2.428   20.808  28.869  1.00 102.83 ? 36  TYR F CE2   1 
ATOM   5270  C CZ    . TYR C  1 36  ? 1.196   21.291  28.458  1.00 110.71 ? 36  TYR F CZ    1 
ATOM   5271  O OH    . TYR C  1 36  ? 0.548   22.293  29.142  1.00 118.96 ? 36  TYR F OH    1 
ATOM   5272  N N     . LEU C  1 37  ? 2.229   14.639  25.250  1.00 83.73  ? 37  LEU F N     1 
ATOM   5273  C CA    . LEU C  1 37  ? 2.546   13.531  24.344  1.00 81.05  ? 37  LEU F CA    1 
ATOM   5274  C C     . LEU C  1 37  ? 1.248   13.065  23.694  1.00 81.37  ? 37  LEU F C     1 
ATOM   5275  O O     . LEU C  1 37  ? 0.261   12.881  24.390  1.00 79.79  ? 37  LEU F O     1 
ATOM   5276  C CB    . LEU C  1 37  ? 3.198   12.374  25.135  1.00 83.03  ? 37  LEU F CB    1 
ATOM   5277  C CG    . LEU C  1 37  ? 4.015   11.286  24.391  1.00 84.99  ? 37  LEU F CG    1 
ATOM   5278  C CD1   . LEU C  1 37  ? 3.128   10.221  23.777  1.00 81.58  ? 37  LEU F CD1   1 
ATOM   5279  C CD2   . LEU C  1 37  ? 5.028   11.871  23.398  1.00 86.70  ? 37  LEU F CD2   1 
ATOM   5280  N N     . HIS C  1 38  ? 1.242   12.898  22.374  1.00 77.10  ? 38  HIS F N     1 
ATOM   5281  C CA    . HIS C  1 38  ? 0.032   12.488  21.631  1.00 76.22  ? 38  HIS F CA    1 
ATOM   5282  C C     . HIS C  1 38  ? 0.345   11.337  20.683  1.00 77.55  ? 38  HIS F C     1 
ATOM   5283  O O     . HIS C  1 38  ? 1.501   11.150  20.312  1.00 75.94  ? 38  HIS F O     1 
ATOM   5284  C CB    . HIS C  1 38  ? -0.558  13.656  20.828  1.00 75.64  ? 38  HIS F CB    1 
ATOM   5285  C CG    . HIS C  1 38  ? -0.426  14.989  21.487  1.00 81.78  ? 38  HIS F CG    1 
ATOM   5286  N ND1   . HIS C  1 38  ? -1.279  15.385  22.497  1.00 86.48  ? 38  HIS F ND1   1 
ATOM   5287  C CD2   . HIS C  1 38  ? 0.464   15.977  21.253  1.00 84.57  ? 38  HIS F CD2   1 
ATOM   5288  C CE1   . HIS C  1 38  ? -0.890  16.603  22.837  1.00 88.03  ? 38  HIS F CE1   1 
ATOM   5289  N NE2   . HIS C  1 38  ? 0.149   17.002  22.103  1.00 87.17  ? 38  HIS F NE2   1 
ATOM   5290  N N     . TRP C  1 39  ? -0.701  10.578  20.294  1.00 72.98  ? 39  TRP F N     1 
ATOM   5291  C CA    . TRP C  1 39  ? -0.596  9.430   19.400  1.00 69.89  ? 39  TRP F CA    1 
ATOM   5292  C C     . TRP C  1 39  ? -1.408  9.642   18.136  1.00 70.81  ? 39  TRP F C     1 
ATOM   5293  O O     . TRP C  1 39  ? -2.472  10.265  18.181  1.00 70.93  ? 39  TRP F O     1 
ATOM   5294  C CB    . TRP C  1 39  ? -1.041  8.153   20.109  1.00 70.53  ? 39  TRP F CB    1 
ATOM   5295  C CG    . TRP C  1 39  ? -0.138  7.773   21.244  1.00 74.20  ? 39  TRP F CG    1 
ATOM   5296  C CD1   . TRP C  1 39  ? -0.199  8.218   22.531  1.00 79.99  ? 39  TRP F CD1   1 
ATOM   5297  C CD2   . TRP C  1 39  ? 1.039   6.956   21.158  1.00 74.27  ? 39  TRP F CD2   1 
ATOM   5298  N NE1   . TRP C  1 39  ? 0.831   7.674   23.271  1.00 81.29  ? 39  TRP F NE1   1 
ATOM   5299  C CE2   . TRP C  1 39  ? 1.585   6.868   22.460  1.00 81.20  ? 39  TRP F CE2   1 
ATOM   5300  C CE3   . TRP C  1 39  ? 1.624   6.203   20.129  1.00 73.11  ? 39  TRP F CE3   1 
ATOM   5301  C CZ2   . TRP C  1 39  ? 2.688   6.060   22.755  1.00 81.86  ? 39  TRP F CZ2   1 
ATOM   5302  C CZ3   . TRP C  1 39  ? 2.736   5.431   20.415  1.00 75.66  ? 39  TRP F CZ3   1 
ATOM   5303  C CH2   . TRP C  1 39  ? 3.266   5.375   21.708  1.00 79.78  ? 39  TRP F CH2   1 
ATOM   5304  N N     . TYR C  1 40  ? -0.878  9.146   16.991  1.00 63.91  ? 40  TYR F N     1 
ATOM   5305  C CA    . TYR C  1 40  ? -1.522  9.253   15.696  1.00 60.71  ? 40  TYR F CA    1 
ATOM   5306  C C     . TYR C  1 40  ? -1.467  7.939   14.942  1.00 63.04  ? 40  TYR F C     1 
ATOM   5307  O O     . TYR C  1 40  ? -0.443  7.273   14.981  1.00 62.28  ? 40  TYR F O     1 
ATOM   5308  C CB    . TYR C  1 40  ? -0.818  10.314  14.832  1.00 59.17  ? 40  TYR F CB    1 
ATOM   5309  C CG    . TYR C  1 40  ? -0.803  11.701  15.425  1.00 59.33  ? 40  TYR F CG    1 
ATOM   5310  C CD1   . TYR C  1 40  ? 0.245   12.121  16.235  1.00 63.76  ? 40  TYR F CD1   1 
ATOM   5311  C CD2   . TYR C  1 40  ? -1.774  12.633  15.086  1.00 57.70  ? 40  TYR F CD2   1 
ATOM   5312  C CE1   . TYR C  1 40  ? 0.282   13.411  16.756  1.00 67.70  ? 40  TYR F CE1   1 
ATOM   5313  C CE2   . TYR C  1 40  ? -1.735  13.930  15.579  1.00 59.17  ? 40  TYR F CE2   1 
ATOM   5314  C CZ    . TYR C  1 40  ? -0.705  14.321  16.414  1.00 70.51  ? 40  TYR F CZ    1 
ATOM   5315  O OH    . TYR C  1 40  ? -0.701  15.596  16.932  1.00 69.78  ? 40  TYR F OH    1 
ATOM   5316  N N     . GLN C  1 41  ? -2.525  7.630   14.178  1.00 58.90  ? 41  GLN F N     1 
ATOM   5317  C CA    . GLN C  1 41  ? -2.623  6.448   13.305  1.00 57.32  ? 41  GLN F CA    1 
ATOM   5318  C C     . GLN C  1 41  ? -2.412  6.902   11.840  1.00 58.59  ? 41  GLN F C     1 
ATOM   5319  O O     . GLN C  1 41  ? -3.014  7.894   11.430  1.00 56.59  ? 41  GLN F O     1 
ATOM   5320  C CB    . GLN C  1 41  ? -4.027  5.826   13.442  1.00 59.62  ? 41  GLN F CB    1 
ATOM   5321  C CG    . GLN C  1 41  ? -4.323  4.645   12.535  1.00 64.31  ? 41  GLN F CG    1 
ATOM   5322  C CD    . GLN C  1 41  ? -5.774  4.263   12.642  1.00 68.16  ? 41  GLN F CD    1 
ATOM   5323  O OE1   . GLN C  1 41  ? -6.640  4.947   12.112  1.00 65.24  ? 41  GLN F OE1   1 
ATOM   5324  N NE2   . GLN C  1 41  ? -6.090  3.160   13.308  1.00 59.58  ? 41  GLN F NE2   1 
ATOM   5325  N N     . GLN C  1 42  ? -1.619  6.167   11.042  1.00 53.83  ? 42  GLN F N     1 
ATOM   5326  C CA    . GLN C  1 42  ? -1.439  6.511   9.620   1.00 51.01  ? 42  GLN F CA    1 
ATOM   5327  C C     . GLN C  1 42  ? -1.636  5.309   8.716   1.00 57.06  ? 42  GLN F C     1 
ATOM   5328  O O     . GLN C  1 42  ? -0.835  4.380   8.764   1.00 57.32  ? 42  GLN F O     1 
ATOM   5329  C CB    . GLN C  1 42  ? -0.062  7.157   9.326   1.00 50.29  ? 42  GLN F CB    1 
ATOM   5330  C CG    . GLN C  1 42  ? -0.040  7.786   7.916   1.00 53.36  ? 42  GLN F CG    1 
ATOM   5331  C CD    . GLN C  1 42  ? 1.192   8.572   7.563   1.00 57.55  ? 42  GLN F CD    1 
ATOM   5332  O OE1   . GLN C  1 42  ? 2.299   8.259   7.976   1.00 55.12  ? 42  GLN F OE1   1 
ATOM   5333  N NE2   . GLN C  1 42  ? 1.050   9.523   6.665   1.00 48.59  ? 42  GLN F NE2   1 
ATOM   5334  N N     . LYS C  1 43  ? -2.655  5.357   7.844   1.00 55.87  ? 43  LYS F N     1 
ATOM   5335  C CA    . LYS C  1 43  ? -2.880  4.311   6.840   1.00 56.09  ? 43  LYS F CA    1 
ATOM   5336  C C     . LYS C  1 43  ? -2.132  4.741   5.574   1.00 60.17  ? 43  LYS F C     1 
ATOM   5337  O O     . LYS C  1 43  ? -1.914  5.941   5.390   1.00 57.99  ? 43  LYS F O     1 
ATOM   5338  C CB    . LYS C  1 43  ? -4.355  4.152   6.509   1.00 59.24  ? 43  LYS F CB    1 
ATOM   5339  C CG    . LYS C  1 43  ? -5.267  4.017   7.722   1.00 69.85  ? 43  LYS F CG    1 
ATOM   5340  C CD    . LYS C  1 43  ? -5.869  2.648   7.876   1.00 77.33  ? 43  LYS F CD    1 
ATOM   5341  C CE    . LYS C  1 43  ? -6.970  2.647   8.911   1.00 81.72  ? 43  LYS F CE    1 
ATOM   5342  N NZ    . LYS C  1 43  ? -7.967  1.592   8.637   1.00 92.38  ? 43  LYS F NZ    1 
ATOM   5343  N N     . PRO C  1 44  ? -1.710  3.813   4.686   1.00 59.81  ? 44  PRO F N     1 
ATOM   5344  C CA    . PRO C  1 44  ? -0.973  4.243   3.479   1.00 57.87  ? 44  PRO F CA    1 
ATOM   5345  C C     . PRO C  1 44  ? -1.782  5.205   2.596   1.00 61.10  ? 44  PRO F C     1 
ATOM   5346  O O     . PRO C  1 44  ? -2.984  5.027   2.432   1.00 61.88  ? 44  PRO F O     1 
ATOM   5347  C CB    . PRO C  1 44  ? -0.658  2.924   2.763   1.00 59.64  ? 44  PRO F CB    1 
ATOM   5348  C CG    . PRO C  1 44  ? -0.770  1.867   3.804   1.00 65.84  ? 44  PRO F CG    1 
ATOM   5349  C CD    . PRO C  1 44  ? -1.843  2.340   4.739   1.00 62.79  ? 44  PRO F CD    1 
ATOM   5350  N N     . GLY C  1 45  ? -1.134  6.280   2.149   1.00 57.80  ? 45  GLY F N     1 
ATOM   5351  C CA    . GLY C  1 45  ? -1.748  7.295   1.301   1.00 57.21  ? 45  GLY F CA    1 
ATOM   5352  C C     . GLY C  1 45  ? -2.678  8.257   2.010   1.00 61.67  ? 45  GLY F C     1 
ATOM   5353  O O     . GLY C  1 45  ? -3.340  9.061   1.353   1.00 62.27  ? 45  GLY F O     1 
ATOM   5354  N N     . GLN C  1 46  ? -2.758  8.183   3.351   1.00 56.97  ? 46  GLN F N     1 
ATOM   5355  C CA    . GLN C  1 46  ? -3.645  9.027   4.132   1.00 54.86  ? 46  GLN F CA    1 
ATOM   5356  C C     . GLN C  1 46  ? -2.839  9.842   5.114   1.00 53.35  ? 46  GLN F C     1 
ATOM   5357  O O     . GLN C  1 46  ? -1.750  9.438   5.520   1.00 51.80  ? 46  GLN F O     1 
ATOM   5358  C CB    . GLN C  1 46  ? -4.693  8.186   4.864   1.00 20.00  ? 46  GLN F CB    1 
ATOM   5359  C CG    . GLN C  1 46  ? -5.699  7.511   3.948   1.00 20.00  ? 46  GLN F CG    1 
ATOM   5360  C CD    . GLN C  1 46  ? -6.675  6.631   4.701   1.00 20.00  ? 46  GLN F CD    1 
ATOM   5361  O OE1   . GLN C  1 46  ? -6.371  6.147   5.792   1.00 20.00  ? 46  GLN F OE1   1 
ATOM   5362  N NE2   . GLN C  1 46  ? -7.853  6.420   4.122   1.00 20.00  ? 46  GLN F NE2   1 
ATOM   5363  N N     . ALA C  1 47  ? -3.391  10.974  5.531   1.00 48.62  ? 47  ALA F N     1 
ATOM   5364  C CA    . ALA C  1 47  ? -2.766  11.812  6.540   1.00 48.20  ? 47  ALA F CA    1 
ATOM   5365  C C     . ALA C  1 47  ? -2.801  11.128  7.888   1.00 52.36  ? 47  ALA F C     1 
ATOM   5366  O O     . ALA C  1 47  ? -3.698  10.335  8.143   1.00 52.00  ? 47  ALA F O     1 
ATOM   5367  C CB    . ALA C  1 47  ? -3.497  13.144  6.646   1.00 49.45  ? 47  ALA F CB    1 
ATOM   5368  N N     . PRO C  1 48  ? -1.875  11.465  8.805   1.00 51.06  ? 48  PRO F N     1 
ATOM   5369  C CA    . PRO C  1 48  ? -1.980  10.929  10.169  1.00 51.91  ? 48  PRO F CA    1 
ATOM   5370  C C     . PRO C  1 48  ? -3.314  11.339  10.818  1.00 56.66  ? 48  PRO F C     1 
ATOM   5371  O O     . PRO C  1 48  ? -3.901  12.370  10.455  1.00 55.65  ? 48  PRO F O     1 
ATOM   5372  C CB    . PRO C  1 48  ? -0.785  11.545  10.897  1.00 53.95  ? 48  PRO F CB    1 
ATOM   5373  C CG    . PRO C  1 48  ? 0.125   12.009  9.844   1.00 57.51  ? 48  PRO F CG    1 
ATOM   5374  C CD    . PRO C  1 48  ? -0.722  12.378  8.672   1.00 52.70  ? 48  PRO F CD    1 
ATOM   5375  N N     . ARG C  1 49  ? -3.815  10.499  11.727  1.00 54.82  ? 49  ARG F N     1 
ATOM   5376  C CA    . ARG C  1 49  ? -5.101  10.702  12.410  1.00 56.80  ? 49  ARG F CA    1 
ATOM   5377  C C     . ARG C  1 49  ? -4.858  10.716  13.886  1.00 62.01  ? 49  ARG F C     1 
ATOM   5378  O O     . ARG C  1 49  ? -4.287  9.754   14.392  1.00 61.57  ? 49  ARG F O     1 
ATOM   5379  C CB    . ARG C  1 49  ? -6.089  9.580   12.027  1.00 56.00  ? 49  ARG F CB    1 
ATOM   5380  C CG    . ARG C  1 49  ? -7.269  9.413   12.958  1.00 68.53  ? 49  ARG F CG    1 
ATOM   5381  C CD    . ARG C  1 49  ? -8.414  8.622   12.363  1.00 77.47  ? 49  ARG F CD    1 
ATOM   5382  N NE    . ARG C  1 49  ? -8.427  7.216   12.790  1.00 79.43  ? 49  ARG F NE    1 
ATOM   5383  C CZ    . ARG C  1 49  ? -9.400  6.600   13.467  1.00 93.76  ? 49  ARG F CZ    1 
ATOM   5384  N NH1   . ARG C  1 49  ? -10.481 7.270   13.862  1.00 82.57  ? 49  ARG F NH1   1 
ATOM   5385  N NH2   . ARG C  1 49  ? -9.293  5.312   13.768  1.00 87.67  ? 49  ARG F NH2   1 
ATOM   5386  N N     . LEU C  1 50  ? -5.298  11.781  14.587  1.00 60.89  ? 50  LEU F N     1 
ATOM   5387  C CA    . LEU C  1 50  ? -5.144  11.882  16.051  1.00 63.22  ? 50  LEU F CA    1 
ATOM   5388  C C     . LEU C  1 50  ? -6.046  10.863  16.762  1.00 69.33  ? 50  LEU F C     1 
ATOM   5389  O O     . LEU C  1 50  ? -7.229  10.756  16.442  1.00 69.16  ? 50  LEU F O     1 
ATOM   5390  C CB    . LEU C  1 50  ? -5.477  13.307  16.524  1.00 64.40  ? 50  LEU F CB    1 
ATOM   5391  C CG    . LEU C  1 50  ? -5.240  13.637  18.025  1.00 71.51  ? 50  LEU F CG    1 
ATOM   5392  C CD1   . LEU C  1 50  ? -3.741  13.676  18.394  1.00 72.20  ? 50  LEU F CD1   1 
ATOM   5393  C CD2   . LEU C  1 50  ? -5.839  14.987  18.394  1.00 72.99  ? 50  LEU F CD2   1 
ATOM   5394  N N     . LEU C  1 51  ? -5.465  10.095  17.696  1.00 68.03  ? 51  LEU F N     1 
ATOM   5395  C CA    . LEU C  1 51  ? -6.166  9.061   18.467  1.00 70.53  ? 51  LEU F CA    1 
ATOM   5396  C C     . LEU C  1 51  ? -6.355  9.482   19.922  1.00 75.56  ? 51  LEU F C     1 
ATOM   5397  O O     . LEU C  1 51  ? -7.458  9.409   20.458  1.00 76.47  ? 51  LEU F O     1 
ATOM   5398  C CB    . LEU C  1 51  ? -5.345  7.758   18.451  1.00 70.99  ? 51  LEU F CB    1 
ATOM   5399  C CG    . LEU C  1 51  ? -5.037  7.122   17.102  1.00 74.37  ? 51  LEU F CG    1 
ATOM   5400  C CD1   . LEU C  1 51  ? -3.880  6.134   17.244  1.00 74.99  ? 51  LEU F CD1   1 
ATOM   5401  C CD2   . LEU C  1 51  ? -6.264  6.434   16.533  1.00 78.30  ? 51  LEU F CD2   1 
ATOM   5402  N N     . ILE C  1 52  ? -5.233  9.835   20.576  1.00 72.75  ? 52  ILE F N     1 
ATOM   5403  C CA    . ILE C  1 52  ? -5.130  10.185  21.986  1.00 74.40  ? 52  ILE F CA    1 
ATOM   5404  C C     . ILE C  1 52  ? -4.314  11.464  22.087  1.00 77.34  ? 52  ILE F C     1 
ATOM   5405  O O     . ILE C  1 52  ? -3.257  11.553  21.449  1.00 74.41  ? 52  ILE F O     1 
ATOM   5406  C CB    . ILE C  1 52  ? -4.390  9.049   22.755  1.00 78.64  ? 52  ILE F CB    1 
ATOM   5407  C CG1   . ILE C  1 52  ? -5.118  7.687   22.655  1.00 79.61  ? 52  ILE F CG1   1 
ATOM   5408  C CG2   . ILE C  1 52  ? -4.112  9.440   24.229  1.00 82.50  ? 52  ILE F CG2   1 
ATOM   5409  C CD1   . ILE C  1 52  ? -6.408  7.569   23.414  1.00 87.51  ? 52  ILE F CD1   1 
ATOM   5410  N N     . TYR C  1 53  ? -4.770  12.420  22.928  1.00 76.16  ? 53  TYR F N     1 
ATOM   5411  C CA    . TYR C  1 53  ? -4.059  13.671  23.187  1.00 75.80  ? 53  TYR F CA    1 
ATOM   5412  C C     . TYR C  1 53  ? -3.767  13.766  24.675  1.00 83.31  ? 53  TYR F C     1 
ATOM   5413  O O     . TYR C  1 53  ? -4.557  13.294  25.494  1.00 83.47  ? 53  TYR F O     1 
ATOM   5414  C CB    . TYR C  1 53  ? -4.832  14.904  22.704  1.00 75.86  ? 53  TYR F CB    1 
ATOM   5415  C CG    . TYR C  1 53  ? -6.208  15.082  23.310  1.00 80.00  ? 53  TYR F CG    1 
ATOM   5416  C CD1   . TYR C  1 53  ? -7.335  14.555  22.692  1.00 80.37  ? 53  TYR F CD1   1 
ATOM   5417  C CD2   . TYR C  1 53  ? -6.394  15.847  24.458  1.00 85.04  ? 53  TYR F CD2   1 
ATOM   5418  C CE1   . TYR C  1 53  ? -8.603  14.730  23.232  1.00 82.48  ? 53  TYR F CE1   1 
ATOM   5419  C CE2   . TYR C  1 53  ? -7.663  16.047  24.997  1.00 88.99  ? 53  TYR F CE2   1 
ATOM   5420  C CZ    . TYR C  1 53  ? -8.770  15.499  24.369  1.00 94.38  ? 53  TYR F CZ    1 
ATOM   5421  O OH    . TYR C  1 53  ? -10.031 15.641  24.903  1.00 95.86  ? 53  TYR F OH    1 
ATOM   5422  N N     . LEU C  1 54  ? -2.611  14.350  25.013  1.00 83.02  ? 54  LEU F N     1 
ATOM   5423  C CA    . LEU C  1 54  ? -2.120  14.503  26.390  1.00 87.57  ? 54  LEU F CA    1 
ATOM   5424  C C     . LEU C  1 54  ? -1.943  13.131  27.065  1.00 92.94  ? 54  LEU F C     1 
ATOM   5425  O O     . LEU C  1 54  ? -2.306  12.937  28.220  1.00 94.46  ? 54  LEU F O     1 
ATOM   5426  C CB    . LEU C  1 54  ? -3.025  15.447  27.197  1.00 90.76  ? 54  LEU F CB    1 
ATOM   5427  C CG    . LEU C  1 54  ? -3.176  16.854  26.614  1.00 94.27  ? 54  LEU F CG    1 
ATOM   5428  C CD1   . LEU C  1 54  ? -4.285  17.608  27.327  1.00 98.08  ? 54  LEU F CD1   1 
ATOM   5429  C CD2   . LEU C  1 54  ? -1.852  17.620  26.684  1.00 95.97  ? 54  LEU F CD2   1 
ATOM   5430  N N     . ALA C  1 55  ? -1.471  12.163  26.265  1.00 89.35  ? 55  ALA F N     1 
ATOM   5431  C CA    . ALA C  1 55  ? -1.158  10.782  26.598  1.00 91.80  ? 55  ALA F CA    1 
ATOM   5432  C C     . ALA C  1 55  ? -2.284  9.896   27.128  1.00 100.39 ? 55  ALA F C     1 
ATOM   5433  O O     . ALA C  1 55  ? -2.022  8.710   27.294  1.00 101.71 ? 55  ALA F O     1 
ATOM   5434  C CB    . ALA C  1 55  ? -0.013  10.752  27.590  1.00 95.93  ? 55  ALA F CB    1 
ATOM   5435  N N     . SER C  1 56  ? -3.511  10.398  27.337  1.00 99.25  ? 56  SER F N     1 
ATOM   5436  C CA    . SER C  1 56  ? -4.583  9.595   27.945  1.00 101.79 ? 56  SER F CA    1 
ATOM   5437  C C     . SER C  1 56  ? -5.990  9.885   27.418  1.00 102.38 ? 56  SER F C     1 
ATOM   5438  O O     . SER C  1 56  ? -6.714  8.935   27.106  1.00 101.03 ? 56  SER F O     1 
ATOM   5439  C CB    . SER C  1 56  ? -4.546  9.741   29.465  1.00 110.33 ? 56  SER F CB    1 
ATOM   5440  O OG    . SER C  1 56  ? -4.309  11.079  29.881  1.00 122.80 ? 56  SER F OG    1 
ATOM   5441  N N     . TYR C  1 57  ? -6.387  11.171  27.349  1.00 98.14  ? 57  TYR F N     1 
ATOM   5442  C CA    . TYR C  1 57  ? -7.737  11.566  26.911  1.00 97.79  ? 57  TYR F CA    1 
ATOM   5443  C C     . TYR C  1 57  ? -8.021  11.175  25.442  1.00 94.71  ? 57  TYR F C     1 
ATOM   5444  O O     . TYR C  1 57  ? -7.252  11.499  24.521  1.00 89.51  ? 57  TYR F O     1 
ATOM   5445  C CB    . TYR C  1 57  ? -7.931  13.072  27.091  1.00 20.00  ? 57  TYR F CB    1 
ATOM   5446  C CG    . TYR C  1 57  ? -7.884  13.529  28.533  1.00 20.00  ? 57  TYR F CG    1 
ATOM   5447  C CD1   . TYR C  1 57  ? -9.029  13.523  29.320  1.00 20.00  ? 57  TYR F CD1   1 
ATOM   5448  C CD2   . TYR C  1 57  ? -6.697  13.964  29.103  1.00 20.00  ? 57  TYR F CD2   1 
ATOM   5449  C CE1   . TYR C  1 57  ? -8.991  13.939  30.637  1.00 20.00  ? 57  TYR F CE1   1 
ATOM   5450  C CE2   . TYR C  1 57  ? -6.649  14.383  30.421  1.00 20.00  ? 57  TYR F CE2   1 
ATOM   5451  C CZ    . TYR C  1 57  ? -7.798  14.368  31.182  1.00 20.00  ? 57  TYR F CZ    1 
ATOM   5452  O OH    . TYR C  1 57  ? -7.758  14.785  32.493  1.00 20.00  ? 57  TYR F OH    1 
ATOM   5453  N N     . LEU C  1 58  ? -9.132  10.442  25.250  1.00 92.16  ? 58  LEU F N     1 
ATOM   5454  C CA    . LEU C  1 58  ? -9.542  9.938   23.941  1.00 89.74  ? 58  LEU F CA    1 
ATOM   5455  C C     . LEU C  1 58  ? -10.092 11.051  23.059  1.00 93.55  ? 58  LEU F C     1 
ATOM   5456  O O     . LEU C  1 58  ? -10.876 11.887  23.515  1.00 96.39  ? 58  LEU F O     1 
ATOM   5457  C CB    . LEU C  1 58  ? -10.573 8.807   24.104  1.00 91.82  ? 58  LEU F CB    1 
ATOM   5458  C CG    . LEU C  1 58  ? -10.975 8.029   22.845  1.00 93.61  ? 58  LEU F CG    1 
ATOM   5459  C CD1   . LEU C  1 58  ? -9.782  7.311   22.231  1.00 91.07  ? 58  LEU F CD1   1 
ATOM   5460  C CD2   . LEU C  1 58  ? -12.050 7.020   23.188  1.00 97.96  ? 58  LEU F CD2   1 
ATOM   5461  N N     . GLU C  1 59  ? -9.669  11.055  21.798  1.00 86.82  ? 59  GLU F N     1 
ATOM   5462  C CA    . GLU C  1 59  ? -10.068 12.056  20.810  1.00 84.55  ? 59  GLU F CA    1 
ATOM   5463  C C     . GLU C  1 59  ? -11.485 11.768  20.311  1.00 88.43  ? 59  GLU F C     1 
ATOM   5464  O O     . GLU C  1 59  ? -11.803 10.620  20.010  1.00 87.77  ? 59  GLU F O     1 
ATOM   5465  C CB    . GLU C  1 59  ? -9.045  12.060  19.632  1.00 81.87  ? 59  GLU F CB    1 
ATOM   5466  C CG    . GLU C  1 59  ? -9.364  12.951  18.433  1.00 81.94  ? 59  GLU F CG    1 
ATOM   5467  C CD    . GLU C  1 59  ? -9.608  14.419  18.719  1.00 90.32  ? 59  GLU F CD    1 
ATOM   5468  O OE1   . GLU C  1 59  ? -9.031  14.955  19.697  1.00 87.61  ? 59  GLU F OE1   1 
ATOM   5469  O OE2   . GLU C  1 59  ? -10.351 15.044  17.928  1.00 69.89  ? 59  GLU F OE2   1 
ATOM   5470  N N     . SER C  1 60  ? -12.328 12.810  20.214  1.00 86.34  ? 60  SER F N     1 
ATOM   5471  C CA    . SER C  1 60  ? -13.693 12.696  19.653  1.00 86.54  ? 60  SER F CA    1 
ATOM   5472  C C     . SER C  1 60  ? -13.707 11.900  18.332  1.00 85.04  ? 60  SER F C     1 
ATOM   5473  O O     . SER C  1 60  ? -12.865 12.141  17.468  1.00 80.55  ? 60  SER F O     1 
ATOM   5474  C CB    . SER C  1 60  ? -14.277 14.079  19.399  1.00 89.42  ? 60  SER F CB    1 
ATOM   5475  O OG    . SER C  1 60  ? -14.325 14.802  20.615  1.00 106.21 ? 60  SER F OG    1 
ATOM   5476  N N     . GLY C  1 61  ? -14.631 10.945  18.222  1.00 83.76  ? 61  GLY F N     1 
ATOM   5477  C CA    . GLY C  1 61  ? -14.793 10.092  17.048  1.00 82.46  ? 61  GLY F CA    1 
ATOM   5478  C C     . GLY C  1 61  ? -13.934 8.836   17.004  1.00 88.43  ? 61  GLY F C     1 
ATOM   5479  O O     . GLY C  1 61  ? -14.148 7.996   16.125  1.00 88.26  ? 61  GLY F O     1 
ATOM   5480  N N     . VAL C  1 62  ? -12.963 8.670   17.941  1.00 85.51  ? 62  VAL F N     1 
ATOM   5481  C CA    . VAL C  1 62  ? -12.040 7.523   17.937  1.00 84.29  ? 62  VAL F CA    1 
ATOM   5482  C C     . VAL C  1 62  ? -12.619 6.350   18.796  1.00 89.78  ? 62  VAL F C     1 
ATOM   5483  O O     . VAL C  1 62  ? -13.101 6.600   19.899  1.00 90.76  ? 62  VAL F O     1 
ATOM   5484  C CB    . VAL C  1 62  ? -10.612 7.988   18.376  1.00 86.97  ? 62  VAL F CB    1 
ATOM   5485  C CG1   . VAL C  1 62  ? -9.640  6.813   18.595  1.00 86.70  ? 62  VAL F CG1   1 
ATOM   5486  C CG2   . VAL C  1 62  ? -10.040 8.957   17.339  1.00 83.05  ? 62  VAL F CG2   1 
ATOM   5487  N N     . PRO C  1 63  ? -12.554 5.079   18.315  1.00 86.82  ? 63  PRO F N     1 
ATOM   5488  C CA    . PRO C  1 63  ? -13.098 3.951   19.100  1.00 90.27  ? 63  PRO F CA    1 
ATOM   5489  C C     . PRO C  1 63  ? -12.545 3.777   20.505  1.00 97.88  ? 63  PRO F C     1 
ATOM   5490  O O     . PRO C  1 63  ? -11.402 4.137   20.804  1.00 95.08  ? 63  PRO F O     1 
ATOM   5491  C CB    . PRO C  1 63  ? -12.778 2.721   18.247  1.00 91.07  ? 63  PRO F CB    1 
ATOM   5492  C CG    . PRO C  1 63  ? -12.583 3.240   16.881  1.00 92.61  ? 63  PRO F CG    1 
ATOM   5493  C CD    . PRO C  1 63  ? -12.016 4.613   17.020  1.00 85.67  ? 63  PRO F CD    1 
ATOM   5494  N N     . ALA C  1 64  ? -13.385 3.173   21.356  1.00 100.23 ? 64  ALA F N     1 
ATOM   5495  C CA    . ALA C  1 64  ? -13.138 2.925   22.774  1.00 103.73 ? 64  ALA F CA    1 
ATOM   5496  C C     . ALA C  1 64  ? -11.910 2.041   23.024  1.00 105.80 ? 64  ALA F C     1 
ATOM   5497  O O     . ALA C  1 64  ? -11.195 2.242   24.012  1.00 105.85 ? 64  ALA F O     1 
ATOM   5498  C CB    . ALA C  1 64  ? -14.368 2.297   23.412  1.00 20.00  ? 64  ALA F CB    1 
ATOM   5499  N N     . ARG C  1 65  ? -11.679 1.067   22.123  1.00 100.87 ? 65  ARG F N     1 
ATOM   5500  C CA    . ARG C  1 65  ? -10.539 0.138   22.175  1.00 99.88  ? 65  ARG F CA    1 
ATOM   5501  C C     . ARG C  1 65  ? -9.147  0.814   22.221  1.00 99.83  ? 65  ARG F C     1 
ATOM   5502  O O     . ARG C  1 65  ? -8.193  0.180   22.671  1.00 100.82 ? 65  ARG F O     1 
ATOM   5503  C CB    . ARG C  1 65  ? -10.591 -0.876  21.012  1.00 97.79  ? 65  ARG F CB    1 
ATOM   5504  C CG    . ARG C  1 65  ? -10.635 -0.263  19.627  1.00 100.60 ? 65  ARG F CG    1 
ATOM   5505  C CD    . ARG C  1 65  ? -10.277 -1.280  18.573  1.00 113.24 ? 65  ARG F CD    1 
ATOM   5506  N NE    . ARG C  1 65  ? -10.578 -0.797  17.224  1.00 124.34 ? 65  ARG F NE    1 
ATOM   5507  C CZ    . ARG C  1 65  ? -11.777 -0.809  16.644  1.00 143.01 ? 65  ARG F CZ    1 
ATOM   5508  N NH1   . ARG C  1 65  ? -11.927 -0.344  15.412  1.00 132.39 ? 65  ARG F NH1   1 
ATOM   5509  N NH2   . ARG C  1 65  ? -12.836 -1.283  17.292  1.00 137.38 ? 65  ARG F NH2   1 
ATOM   5510  N N     . PHE C  1 66  ? -9.022  2.063   21.741  1.00 91.03  ? 66  PHE F N     1 
ATOM   5511  C CA    . PHE C  1 66  ? -7.756  2.781   21.810  1.00 87.12  ? 66  PHE F CA    1 
ATOM   5512  C C     . PHE C  1 66  ? -7.690  3.518   23.137  1.00 93.54  ? 66  PHE F C     1 
ATOM   5513  O O     . PHE C  1 66  ? -8.622  4.244   23.488  1.00 95.08  ? 66  PHE F O     1 
ATOM   5514  C CB    . PHE C  1 66  ? -7.623  3.802   20.674  1.00 83.81  ? 66  PHE F CB    1 
ATOM   5515  C CG    . PHE C  1 66  ? -7.557  3.192   19.302  1.00 81.98  ? 66  PHE F CG    1 
ATOM   5516  C CD1   . PHE C  1 66  ? -6.336  2.880   18.722  1.00 81.32  ? 66  PHE F CD1   1 
ATOM   5517  C CD2   . PHE C  1 66  ? -8.711  2.972   18.567  1.00 83.65  ? 66  PHE F CD2   1 
ATOM   5518  C CE1   . PHE C  1 66  ? -6.275  2.310   17.457  1.00 79.31  ? 66  PHE F CE1   1 
ATOM   5519  C CE2   . PHE C  1 66  ? -8.647  2.423   17.290  1.00 83.57  ? 66  PHE F CE2   1 
ATOM   5520  C CZ    . PHE C  1 66  ? -7.430  2.097   16.743  1.00 79.06  ? 66  PHE F CZ    1 
ATOM   5521  N N     . SER C  1 67  ? -6.585  3.357   23.857  1.00 89.58  ? 67  SER F N     1 
ATOM   5522  C CA    . SER C  1 67  ? -6.342  4.065   25.102  1.00 91.90  ? 67  SER F CA    1 
ATOM   5523  C C     . SER C  1 67  ? -4.843  4.320   25.223  1.00 94.42  ? 67  SER F C     1 
ATOM   5524  O O     . SER C  1 67  ? -4.046  3.559   24.678  1.00 91.40  ? 67  SER F O     1 
ATOM   5525  C CB    . SER C  1 67  ? -6.841  3.254   26.302  1.00 99.58  ? 67  SER F CB    1 
ATOM   5526  O OG    . SER C  1 67  ? -6.368  1.916   26.254  1.00 106.66 ? 67  SER F OG    1 
ATOM   5527  N N     . GLY C  1 68  ? -4.487  5.363   25.968  1.00 92.53  ? 68  GLY F N     1 
ATOM   5528  C CA    . GLY C  1 68  ? -3.104  5.735   26.232  1.00 90.99  ? 68  GLY F CA    1 
ATOM   5529  C C     . GLY C  1 68  ? -2.847  5.853   27.721  1.00 97.18  ? 68  GLY F C     1 
ATOM   5530  O O     . GLY C  1 68  ? -3.752  6.191   28.480  1.00 98.09  ? 68  GLY F O     1 
ATOM   5531  N N     . SER C  1 69  ? -1.608  5.581   28.147  1.00 94.91  ? 69  SER F N     1 
ATOM   5532  C CA    . SER C  1 69  ? -1.194  5.712   29.544  1.00 98.93  ? 69  SER F CA    1 
ATOM   5533  C C     . SER C  1 69  ? 0.254   6.215   29.613  1.00 99.65  ? 69  SER F C     1 
ATOM   5534  O O     . SER C  1 69  ? 0.998   6.082   28.642  1.00 96.28  ? 69  SER F O     1 
ATOM   5535  C CB    . SER C  1 69  ? -1.337  4.374   30.268  1.00 107.77 ? 69  SER F CB    1 
ATOM   5536  O OG    . SER C  1 69  ? -2.639  3.832   30.097  1.00 118.98 ? 69  SER F OG    1 
ATOM   5537  N N     . GLY C  1 70  ? 0.622   6.823   30.733  1.00 97.62  ? 70  GLY F N     1 
ATOM   5538  C CA    . GLY C  1 70  ? 1.981   7.298   30.953  1.00 97.13  ? 70  GLY F CA    1 
ATOM   5539  C C     . GLY C  1 70  ? 2.172   8.719   31.445  1.00 101.15 ? 70  GLY F C     1 
ATOM   5540  O O     . GLY C  1 70  ? 1.315   9.593   31.297  1.00 98.39  ? 70  GLY F O     1 
ATOM   5541  N N     . SER C  1 71  ? 3.349   8.937   32.030  1.00 101.56 ? 71  SER F N     1 
ATOM   5542  C CA    . SER C  1 71  ? 3.815   10.225  32.528  1.00 103.06 ? 71  SER F CA    1 
ATOM   5543  C C     . SER C  1 71  ? 5.339   10.233  32.446  1.00 110.72 ? 71  SER F C     1 
ATOM   5544  O O     . SER C  1 71  ? 5.947   9.171   32.325  1.00 110.37 ? 71  SER F O     1 
ATOM   5545  C CB    . SER C  1 71  ? 3.377   10.442  33.976  1.00 106.56 ? 71  SER F CB    1 
ATOM   5546  O OG    . SER C  1 71  ? 3.818   9.386   34.813  1.00 107.76 ? 71  SER F OG    1 
ATOM   5547  N N     . GLY C  1 72  ? 5.923   11.424  32.518  1.00 110.17 ? 72  GLY F N     1 
ATOM   5548  C CA    . GLY C  1 72  ? 7.368   11.625  32.493  1.00 111.26 ? 72  GLY F CA    1 
ATOM   5549  C C     . GLY C  1 72  ? 8.010   11.389  31.145  1.00 109.84 ? 72  GLY F C     1 
ATOM   5550  O O     . GLY C  1 72  ? 7.944   12.244  30.263  1.00 104.53 ? 72  GLY F O     1 
ATOM   5551  N N     . THR C  1 73  ? 8.703   10.245  31.020  1.00 107.78 ? 73  THR F N     1 
ATOM   5552  C CA    . THR C  1 73  ? 9.418   9.843   29.815  1.00 104.46 ? 73  THR F CA    1 
ATOM   5553  C C     . THR C  1 73  ? 8.891   8.558   29.166  1.00 105.30 ? 73  THR F C     1 
ATOM   5554  O O     . THR C  1 73  ? 9.274   8.321   28.034  1.00 102.00 ? 73  THR F O     1 
ATOM   5555  C CB    . THR C  1 73  ? 10.906  9.661   30.162  1.00 110.98 ? 73  THR F CB    1 
ATOM   5556  O OG1   . THR C  1 73  ? 11.027  8.795   31.291  1.00 112.04 ? 73  THR F OG1   1 
ATOM   5557  C CG2   . THR C  1 73  ? 11.603  10.976  30.448  1.00 108.73 ? 73  THR F CG2   1 
ATOM   5558  N N     . ASP C  1 74  ? 8.076   7.715   29.856  1.00 103.12 ? 74  ASP F N     1 
ATOM   5559  C CA    . ASP C  1 74  ? 7.582   6.445   29.298  1.00 100.65 ? 74  ASP F CA    1 
ATOM   5560  C C     . ASP C  1 74  ? 6.085   6.528   29.021  1.00 99.43  ? 74  ASP F C     1 
ATOM   5561  O O     . ASP C  1 74  ? 5.307   6.783   29.932  1.00 98.10  ? 74  ASP F O     1 
ATOM   5562  C CB    . ASP C  1 74  ? 7.869   5.268   30.246  1.00 106.65 ? 74  ASP F CB    1 
ATOM   5563  C CG    . ASP C  1 74  ? 9.335   4.899   30.372  1.00 128.49 ? 74  ASP F CG    1 
ATOM   5564  O OD1   . ASP C  1 74  ? 10.189  5.796   30.215  1.00 131.37 ? 74  ASP F OD1   1 
ATOM   5565  O OD2   . ASP C  1 74  ? 9.626   3.723   30.696  1.00 138.61 ? 74  ASP F OD2   1 
ATOM   5566  N N     . PHE C  1 75  ? 5.688   6.294   27.757  1.00 93.43  ? 75  PHE F N     1 
ATOM   5567  C CA    . PHE C  1 75  ? 4.289   6.373   27.328  1.00 91.82  ? 75  PHE F CA    1 
ATOM   5568  C C     . PHE C  1 75  ? 3.866   5.147   26.557  1.00 92.60  ? 75  PHE F C     1 
ATOM   5569  O O     . PHE C  1 75  ? 4.655   4.596   25.798  1.00 90.97  ? 75  PHE F O     1 
ATOM   5570  C CB    . PHE C  1 75  ? 4.071   7.628   26.499  1.00 90.75  ? 75  PHE F CB    1 
ATOM   5571  C CG    . PHE C  1 75  ? 4.279   8.865   27.329  1.00 95.32  ? 75  PHE F CG    1 
ATOM   5572  C CD1   . PHE C  1 75  ? 5.544   9.413   27.478  1.00 100.22 ? 75  PHE F CD1   1 
ATOM   5573  C CD2   . PHE C  1 75  ? 3.238   9.406   28.066  1.00 99.45  ? 75  PHE F CD2   1 
ATOM   5574  C CE1   . PHE C  1 75  ? 5.745   10.524  28.288  1.00 104.05 ? 75  PHE F CE1   1 
ATOM   5575  C CE2   . PHE C  1 75  ? 3.423   10.555  28.819  1.00 105.14 ? 75  PHE F CE2   1 
ATOM   5576  C CZ    . PHE C  1 75  ? 4.679   11.105  28.937  1.00 104.74 ? 75  PHE F CZ    1 
ATOM   5577  N N     . THR C  1 76  ? 2.622   4.713   26.771  1.00 88.84  ? 76  THR F N     1 
ATOM   5578  C CA    . THR C  1 76  ? 2.074   3.526   26.142  1.00 87.31  ? 76  THR F CA    1 
ATOM   5579  C C     . THR C  1 76  ? 0.726   3.814   25.493  1.00 88.62  ? 76  THR F C     1 
ATOM   5580  O O     . THR C  1 76  ? -0.124  4.459   26.113  1.00 89.53  ? 76  THR F O     1 
ATOM   5581  C CB    . THR C  1 76  ? 1.953   2.411   27.187  1.00 100.71 ? 76  THR F CB    1 
ATOM   5582  O OG1   . THR C  1 76  ? 3.268   2.008   27.569  1.00 100.80 ? 76  THR F OG1   1 
ATOM   5583  C CG2   . THR C  1 76  ? 1.175   1.199   26.671  1.00 100.76 ? 76  THR F CG2   1 
ATOM   5584  N N     . LEU C  1 77  ? 0.548   3.325   24.241  1.00 80.55  ? 77  LEU F N     1 
ATOM   5585  C CA    . LEU C  1 77  ? -0.702  3.365   23.503  1.00 78.35  ? 77  LEU F CA    1 
ATOM   5586  C C     . LEU C  1 77  ? -1.128  1.926   23.433  1.00 87.41  ? 77  LEU F C     1 
ATOM   5587  O O     . LEU C  1 77  ? -0.386  1.093   22.910  1.00 87.14  ? 77  LEU F O     1 
ATOM   5588  C CB    . LEU C  1 77  ? -0.544  3.923   22.072  1.00 73.15  ? 77  LEU F CB    1 
ATOM   5589  C CG    . LEU C  1 77  ? -1.794  3.849   21.155  1.00 74.48  ? 77  LEU F CG    1 
ATOM   5590  C CD1   . LEU C  1 77  ? -2.815  4.922   21.526  1.00 74.52  ? 77  LEU F CD1   1 
ATOM   5591  C CD2   . LEU C  1 77  ? -1.415  3.996   19.703  1.00 69.27  ? 77  LEU F CD2   1 
ATOM   5592  N N     . THR C  1 78  ? -2.314  1.630   23.957  1.00 87.82  ? 78  THR F N     1 
ATOM   5593  C CA    . THR C  1 78  ? -2.871  0.288   23.959  1.00 90.30  ? 78  THR F CA    1 
ATOM   5594  C C     . THR C  1 78  ? -4.007  0.201   22.927  1.00 93.33  ? 78  THR F C     1 
ATOM   5595  O O     . THR C  1 78  ? -4.682  1.197   22.681  1.00 92.02  ? 78  THR F O     1 
ATOM   5596  C CB    . THR C  1 78  ? -3.368  -0.034  25.383  1.00 97.65  ? 78  THR F CB    1 
ATOM   5597  O OG1   . THR C  1 78  ? -2.264  0.005   26.292  1.00 96.04  ? 78  THR F OG1   1 
ATOM   5598  C CG2   . THR C  1 78  ? -4.044  -1.377  25.479  1.00 94.87  ? 78  THR F CG2   1 
ATOM   5599  N N     . ILE C  1 79  ? -4.206  -0.990  22.333  1.00 90.95  ? 79  ILE F N     1 
ATOM   5600  C CA    . ILE C  1 79  ? -5.330  -1.300  21.443  1.00 90.47  ? 79  ILE F CA    1 
ATOM   5601  C C     . ILE C  1 79  ? -5.897  -2.620  21.981  1.00 100.97 ? 79  ILE F C     1 
ATOM   5602  O O     . ILE C  1 79  ? -5.577  -3.692  21.458  1.00 100.25 ? 79  ILE F O     1 
ATOM   5603  C CB    . ILE C  1 79  ? -4.991  -1.396  19.932  1.00 89.35  ? 79  ILE F CB    1 
ATOM   5604  C CG1   . ILE C  1 79  ? -4.091  -0.228  19.465  1.00 85.52  ? 79  ILE F CG1   1 
ATOM   5605  C CG2   . ILE C  1 79  ? -6.306  -1.455  19.126  1.00 90.04  ? 79  ILE F CG2   1 
ATOM   5606  C CD1   . ILE C  1 79  ? -3.711  -0.282  17.934  1.00 81.73  ? 79  ILE F CD1   1 
ATOM   5607  N N     . SER C  1 80  ? -6.695  -2.530  23.072  1.00 102.94 ? 80  SER F N     1 
ATOM   5608  C CA    . SER C  1 80  ? -7.328  -3.662  23.770  1.00 108.27 ? 80  SER F CA    1 
ATOM   5609  C C     . SER C  1 80  ? -7.621  -4.892  22.890  1.00 112.91 ? 80  SER F C     1 
ATOM   5610  O O     . SER C  1 80  ? -7.257  -6.010  23.269  1.00 116.03 ? 80  SER F O     1 
ATOM   5611  C CB    . SER C  1 80  ? -8.612  -3.210  24.467  1.00 115.44 ? 80  SER F CB    1 
ATOM   5612  O OG    . SER C  1 80  ? -9.569  -2.724  23.540  1.00 121.72 ? 80  SER F OG    1 
ATOM   5613  N N     . SER C  1 81  ? -8.238  -4.650  21.749  1.00 105.97 ? 81  SER F N     1 
ATOM   5614  C CA    . SER C  1 81  ? -8.546  -5.693  20.821  1.00 106.10 ? 81  SER F CA    1 
ATOM   5615  C C     . SER C  1 81  ? -8.459  -5.093  19.441  1.00 105.35 ? 81  SER F C     1 
ATOM   5616  O O     . SER C  1 81  ? -9.190  -4.178  19.126  1.00 103.76 ? 81  SER F O     1 
ATOM   5617  C CB    . SER C  1 81  ? -9.942  -6.218  21.069  1.00 113.95 ? 81  SER F CB    1 
ATOM   5618  O OG    . SER C  1 81  ? -10.268 -7.221  20.128  1.00 122.61 ? 81  SER F OG    1 
ATOM   5619  N N     . LEU C  1 82  ? -7.556  -5.612  18.624  1.00 100.07 ? 82  LEU F N     1 
ATOM   5620  C CA    . LEU C  1 82  ? -7.339  -5.123  17.264  1.00 95.27  ? 82  LEU F CA    1 
ATOM   5621  C C     . LEU C  1 82  ? -8.451  -5.503  16.335  1.00 100.55 ? 82  LEU F C     1 
ATOM   5622  O O     . LEU C  1 82  ? -9.170  -6.447  16.588  1.00 104.18 ? 82  LEU F O     1 
ATOM   5623  C CB    . LEU C  1 82  ? -6.074  -5.735  16.685  1.00 92.55  ? 82  LEU F CB    1 
ATOM   5624  C CG    . LEU C  1 82  ? -4.743  -5.147  17.073  1.00 94.43  ? 82  LEU F CG    1 
ATOM   5625  C CD1   . LEU C  1 82  ? -3.633  -6.136  16.808  1.00 93.65  ? 82  LEU F CD1   1 
ATOM   5626  C CD2   . LEU C  1 82  ? -4.539  -3.878  16.295  1.00 93.26  ? 82  LEU F CD2   1 
ATOM   5627  N N     . GLU C  1 83  ? -8.565  -4.764  15.243  1.00 93.68  ? 83  GLU F N     1 
ATOM   5628  C CA    . GLU C  1 83  ? -9.553  -5.034  14.219  1.00 93.63  ? 83  GLU F CA    1 
ATOM   5629  C C     . GLU C  1 83  ? -8.824  -4.935  12.890  1.00 92.95  ? 83  GLU F C     1 
ATOM   5630  O O     . GLU C  1 83  ? -7.690  -4.493  12.869  1.00 89.17  ? 83  GLU F O     1 
ATOM   5631  C CB    . GLU C  1 83  ? -10.708 -4.055  14.306  1.00 20.00  ? 83  GLU F CB    1 
ATOM   5632  C CG    . GLU C  1 83  ? -11.921 -4.514  13.529  1.00 20.00  ? 83  GLU F CG    1 
ATOM   5633  C CD    . GLU C  1 83  ? -12.970 -5.162  14.395  1.00 20.00  ? 83  GLU F CD    1 
ATOM   5634  O OE1   . GLU C  1 83  ? -12.948 -4.925  15.607  1.00 20.00  ? 83  GLU F OE1   1 
ATOM   5635  O OE2   . GLU C  1 83  ? -13.821 -5.901  13.866  1.00 20.00  ? 83  GLU F OE2   1 
ATOM   5636  N N     . PRO C  1 84  ? -9.488  -5.389  11.762  1.00 90.46  ? 84  PRO F N     1 
ATOM   5637  C CA    . PRO C  1 84  ? -8.714  -5.277  10.513  1.00 87.28  ? 84  PRO F CA    1 
ATOM   5638  C C     . PRO C  1 84  ? -8.327  -3.849  10.156  1.00 87.93  ? 84  PRO F C     1 
ATOM   5639  O O     . PRO C  1 84  ? -7.293  -3.632  9.564   1.00 84.27  ? 84  PRO F O     1 
ATOM   5640  C CB    . PRO C  1 84  ? -9.646  -5.846  9.457   1.00 90.55  ? 84  PRO F CB    1 
ATOM   5641  C CG    . PRO C  1 84  ? -10.480 -6.808  10.175  1.00 99.38  ? 84  PRO F CG    1 
ATOM   5642  C CD    . PRO C  1 84  ? -10.812 -6.059  11.405  1.00 95.83  ? 84  PRO F CD    1 
ATOM   5643  N N     . GLU C  1 85  ? -9.170  -2.903  10.516  1.00 84.85  ? 85  GLU F N     1 
ATOM   5644  C CA    . GLU C  1 85  ? -8.948  -1.475  10.281  1.00 81.41  ? 85  GLU F CA    1 
ATOM   5645  C C     . GLU C  1 85  ? -7.818  -0.882  11.164  1.00 82.55  ? 85  GLU F C     1 
ATOM   5646  O O     . GLU C  1 85  ? -7.404  0.242   10.914  1.00 79.10  ? 85  GLU F O     1 
ATOM   5647  C CB    . GLU C  1 85  ? -10.273 -0.693  10.486  1.00 84.33  ? 85  GLU F CB    1 
ATOM   5648  C CG    . GLU C  1 85  ? -10.670 -0.453  11.936  1.00 97.52  ? 85  GLU F CG    1 
ATOM   5649  C CD    . GLU C  1 85  ? -12.127 -0.090  12.156  1.00 114.06 ? 85  GLU F CD    1 
ATOM   5650  O OE1   . GLU C  1 85  ? -12.820 -0.837  12.883  1.00 92.96  ? 85  GLU F OE1   1 
ATOM   5651  O OE2   . GLU C  1 85  ? -12.564 0.966   11.644  1.00 111.99 ? 85  GLU F OE2   1 
ATOM   5652  N N     . ASP C  1 86  ? -7.346  -1.597  12.204  1.00 80.36  ? 86  ASP F N     1 
ATOM   5653  C CA    . ASP C  1 86  ? -6.289  -1.081  13.089  1.00 78.39  ? 86  ASP F CA    1 
ATOM   5654  C C     . ASP C  1 86  ? -4.863  -1.345  12.583  1.00 76.79  ? 86  ASP F C     1 
ATOM   5655  O O     . ASP C  1 86  ? -3.921  -0.727  13.082  1.00 74.53  ? 86  ASP F O     1 
ATOM   5656  C CB    . ASP C  1 86  ? -6.447  -1.670  14.493  1.00 84.05  ? 86  ASP F CB    1 
ATOM   5657  C CG    . ASP C  1 86  ? -7.750  -1.325  15.172  1.00 101.57 ? 86  ASP F CG    1 
ATOM   5658  O OD1   . ASP C  1 86  ? -8.504  -0.484  14.626  1.00 102.92 ? 86  ASP F OD1   1 
ATOM   5659  O OD2   . ASP C  1 86  ? -8.027  -1.900  16.248  1.00 109.13 ? 86  ASP F OD2   1 
ATOM   5660  N N     . PHE C  1 87  ? -4.688  -2.246  11.614  1.00 71.54  ? 87  PHE F N     1 
ATOM   5661  C CA    . PHE C  1 87  ? -3.357  -2.562  11.105  1.00 68.98  ? 87  PHE F CA    1 
ATOM   5662  C C     . PHE C  1 87  ? -2.922  -1.359  10.290  1.00 68.28  ? 87  PHE F C     1 
ATOM   5663  O O     . PHE C  1 87  ? -3.552  -1.028  9.287   1.00 66.83  ? 87  PHE F O     1 
ATOM   5664  C CB    . PHE C  1 87  ? -3.370  -3.881  10.315  1.00 71.72  ? 87  PHE F CB    1 
ATOM   5665  C CG    . PHE C  1 87  ? -3.757  -5.052  11.197  1.00 77.51  ? 87  PHE F CG    1 
ATOM   5666  C CD1   . PHE C  1 87  ? -2.826  -5.653  12.031  1.00 81.09  ? 87  PHE F CD1   1 
ATOM   5667  C CD2   . PHE C  1 87  ? -5.072  -5.488  11.264  1.00 82.28  ? 87  PHE F CD2   1 
ATOM   5668  C CE1   . PHE C  1 87  ? -3.186  -6.713  12.853  1.00 85.40  ? 87  PHE F CE1   1 
ATOM   5669  C CE2   . PHE C  1 87  ? -5.429  -6.548  12.086  1.00 88.28  ? 87  PHE F CE2   1 
ATOM   5670  C CZ    . PHE C  1 87  ? -4.484  -7.153  12.876  1.00 87.52  ? 87  PHE F CZ    1 
ATOM   5671  N N     . ALA C  1 88  ? -1.958  -0.604  10.839  1.00 62.39  ? 88  ALA F N     1 
ATOM   5672  C CA    . ALA C  1 88  ? -1.491  0.671   10.285  1.00 58.41  ? 88  ALA F CA    1 
ATOM   5673  C C     . ALA C  1 88  ? -0.194  1.081   10.990  1.00 62.01  ? 88  ALA F C     1 
ATOM   5674  O O     . ALA C  1 88  ? 0.303   0.331   11.842  1.00 64.16  ? 88  ALA F O     1 
ATOM   5675  C CB    . ALA C  1 88  ? -2.561  1.738   10.531  1.00 59.00  ? 88  ALA F CB    1 
ATOM   5676  N N     . VAL C  1 89  ? 0.338   2.275   10.679  1.00 56.27  ? 89  VAL F N     1 
ATOM   5677  C CA    . VAL C  1 89  ? 1.511   2.787   11.396  1.00 55.70  ? 89  VAL F CA    1 
ATOM   5678  C C     . VAL C  1 89  ? 0.980   3.684   12.524  1.00 61.80  ? 89  VAL F C     1 
ATOM   5679  O O     . VAL C  1 89  ? -0.078  4.298   12.366  1.00 60.71  ? 89  VAL F O     1 
ATOM   5680  C CB    . VAL C  1 89  ? 2.464   3.582   10.485  1.00 20.00  ? 89  VAL F CB    1 
ATOM   5681  C CG1   . VAL C  1 89  ? 3.566   4.234   11.305  1.00 20.00  ? 89  VAL F CG1   1 
ATOM   5682  C CG2   . VAL C  1 89  ? 3.053   2.677   9.412   1.00 20.00  ? 89  VAL F CG2   1 
ATOM   5683  N N     . TYR C  1 90  ? 1.688   3.722   13.672  1.00 59.93  ? 90  TYR F N     1 
ATOM   5684  C CA    . TYR C  1 90  ? 1.302   4.554   14.801  1.00 61.27  ? 90  TYR F CA    1 
ATOM   5685  C C     . TYR C  1 90  ? 2.475   5.423   15.211  1.00 64.76  ? 90  TYR F C     1 
ATOM   5686  O O     . TYR C  1 90  ? 3.584   4.907   15.356  1.00 64.07  ? 90  TYR F O     1 
ATOM   5687  C CB    . TYR C  1 90  ? 0.867   3.679   15.955  1.00 66.15  ? 90  TYR F CB    1 
ATOM   5688  C CG    . TYR C  1 90  ? -0.457  3.023   15.676  1.00 68.65  ? 90  TYR F CG    1 
ATOM   5689  C CD1   . TYR C  1 90  ? -0.525  1.803   15.016  1.00 70.94  ? 90  TYR F CD1   1 
ATOM   5690  C CD2   . TYR C  1 90  ? -1.646  3.668   15.972  1.00 70.35  ? 90  TYR F CD2   1 
ATOM   5691  C CE1   . TYR C  1 90  ? -1.748  1.237   14.667  1.00 73.31  ? 90  TYR F CE1   1 
ATOM   5692  C CE2   . TYR C  1 90  ? -2.873  3.126   15.607  1.00 72.38  ? 90  TYR F CE2   1 
ATOM   5693  C CZ    . TYR C  1 90  ? -2.921  1.909   14.954  1.00 79.15  ? 90  TYR F CZ    1 
ATOM   5694  O OH    . TYR C  1 90  ? -4.146  1.359   14.684  1.00 79.31  ? 90  TYR F OH    1 
ATOM   5695  N N     . TYR C  1 91  ? 2.241   6.743   15.369  1.00 60.57  ? 91  TYR F N     1 
ATOM   5696  C CA    . TYR C  1 91  ? 3.288   7.699   15.739  1.00 60.83  ? 91  TYR F CA    1 
ATOM   5697  C C     . TYR C  1 91  ? 2.995   8.401   17.028  1.00 66.19  ? 91  TYR F C     1 
ATOM   5698  O O     . TYR C  1 91  ? 1.864   8.781   17.242  1.00 64.06  ? 91  TYR F O     1 
ATOM   5699  C CB    . TYR C  1 91  ? 3.400   8.789   14.667  1.00 59.40  ? 91  TYR F CB    1 
ATOM   5700  C CG    . TYR C  1 91  ? 3.998   8.318   13.372  1.00 58.60  ? 91  TYR F CG    1 
ATOM   5701  C CD1   . TYR C  1 91  ? 5.372   8.184   13.228  1.00 61.37  ? 91  TYR F CD1   1 
ATOM   5702  C CD2   . TYR C  1 91  ? 3.204   8.123   12.247  1.00 56.52  ? 91  TYR F CD2   1 
ATOM   5703  C CE1   . TYR C  1 91  ? 5.937   7.798   12.015  1.00 60.40  ? 91  TYR F CE1   1 
ATOM   5704  C CE2   . TYR C  1 91  ? 3.757   7.762   11.027  1.00 54.67  ? 91  TYR F CE2   1 
ATOM   5705  C CZ    . TYR C  1 91  ? 5.121   7.586   10.913  1.00 59.22  ? 91  TYR F CZ    1 
ATOM   5706  O OH    . TYR C  1 91  ? 5.664   7.209   9.702   1.00 54.12  ? 91  TYR F OH    1 
ATOM   5707  N N     . CYS C  1 92  ? 4.036   8.680   17.826  1.00 66.96  ? 92  CYS F N     1 
ATOM   5708  C CA    . CYS C  1 92  ? 3.932   9.483   19.050  1.00 69.89  ? 92  CYS F CA    1 
ATOM   5709  C C     . CYS C  1 92  ? 4.554   10.869  18.724  1.00 70.94  ? 92  CYS F C     1 
ATOM   5710  O O     . CYS C  1 92  ? 5.432   10.965  17.859  1.00 67.94  ? 92  CYS F O     1 
ATOM   5711  C CB    . CYS C  1 92  ? 4.656   8.817   20.216  1.00 73.85  ? 92  CYS F CB    1 
ATOM   5712  S SG    . CYS C  1 92  ? 6.446   8.727   19.988  1.00 78.63  ? 92  CYS F SG    1 
ATOM   5713  N N     . GLN C  1 93  ? 4.086   11.924  19.406  1.00 67.85  ? 93  GLN F N     1 
ATOM   5714  C CA    . GLN C  1 93  ? 4.544   13.303  19.206  1.00 66.55  ? 93  GLN F CA    1 
ATOM   5715  C C     . GLN C  1 93  ? 4.578   14.041  20.549  1.00 71.08  ? 93  GLN F C     1 
ATOM   5716  O O     . GLN C  1 93  ? 3.635   13.893  21.328  1.00 69.90  ? 93  GLN F O     1 
ATOM   5717  C CB    . GLN C  1 93  ? 3.557   14.019  18.276  1.00 65.63  ? 93  GLN F CB    1 
ATOM   5718  C CG    . GLN C  1 93  ? 3.969   15.428  17.840  1.00 75.36  ? 93  GLN F CG    1 
ATOM   5719  C CD    . GLN C  1 93  ? 2.911   16.457  18.172  1.00 86.50  ? 93  GLN F CD    1 
ATOM   5720  O OE1   . GLN C  1 93  ? 1.728   16.244  17.937  1.00 75.32  ? 93  GLN F OE1   1 
ATOM   5721  N NE2   . GLN C  1 93  ? 3.297   17.586  18.758  1.00 86.81  ? 93  GLN F NE2   1 
ATOM   5722  N N     . HIS C  1 94  ? 5.621   14.868  20.799  1.00 69.98  ? 94  HIS F N     1 
ATOM   5723  C CA    . HIS C  1 94  ? 5.695   15.653  22.032  1.00 73.93  ? 94  HIS F CA    1 
ATOM   5724  C C     . HIS C  1 94  ? 5.432   17.108  21.688  1.00 77.96  ? 94  HIS F C     1 
ATOM   5725  O O     . HIS C  1 94  ? 5.648   17.522  20.535  1.00 73.40  ? 94  HIS F O     1 
ATOM   5726  C CB    . HIS C  1 94  ? 7.064   15.528  22.768  1.00 77.50  ? 94  HIS F CB    1 
ATOM   5727  C CG    . HIS C  1 94  ? 8.124   16.487  22.297  1.00 81.55  ? 94  HIS F CG    1 
ATOM   5728  N ND1   . HIS C  1 94  ? 9.074   16.120  21.361  1.00 82.13  ? 94  HIS F ND1   1 
ATOM   5729  C CD2   . HIS C  1 94  ? 8.308   17.789  22.607  1.00 85.27  ? 94  HIS F CD2   1 
ATOM   5730  C CE1   . HIS C  1 94  ? 9.806   17.204  21.149  1.00 83.28  ? 94  HIS F CE1   1 
ATOM   5731  N NE2   . HIS C  1 94  ? 9.379   18.228  21.883  1.00 85.68  ? 94  HIS F NE2   1 
ATOM   5732  N N     . SER C  1 95  ? 5.060   17.894  22.721  1.00 78.37  ? 95  SER F N     1 
ATOM   5733  C CA    . SER C  1 95  ? 4.906   19.344  22.595  1.00 80.53  ? 95  SER F CA    1 
ATOM   5734  C C     . SER C  1 95  ? 5.131   20.107  23.938  1.00 90.37  ? 95  SER F C     1 
ATOM   5735  O O     . SER C  1 95  ? 4.584   21.192  24.147  1.00 89.83  ? 95  SER F O     1 
ATOM   5736  C CB    . SER C  1 95  ? 3.577   19.712  21.935  1.00 80.07  ? 95  SER F CB    1 
ATOM   5737  O OG    . SER C  1 95  ? 2.457   19.424  22.754  1.00 87.12  ? 95  SER F OG    1 
ATOM   5738  N N     . ARG C  1 96  ? 5.999   19.574  24.807  1.00 92.33  ? 96  ARG F N     1 
ATOM   5739  C CA    . ARG C  1 96  ? 6.386   20.269  26.034  1.00 98.37  ? 96  ARG F CA    1 
ATOM   5740  C C     . ARG C  1 96  ? 7.389   21.380  25.690  1.00 105.46 ? 96  ARG F C     1 
ATOM   5741  O O     . ARG C  1 96  ? 7.559   22.312  26.471  1.00 109.53 ? 96  ARG F O     1 
ATOM   5742  C CB    . ARG C  1 96  ? 7.027   19.297  27.038  1.00 103.99 ? 96  ARG F CB    1 
ATOM   5743  N N     . ASP C  1 97  ? 8.049   21.277  24.529  1.00 100.81 ? 97  ASP F N     1 
ATOM   5744  C CA    . ASP C  1 97  ? 9.073   22.217  24.089  1.00 103.38 ? 97  ASP F CA    1 
ATOM   5745  C C     . ASP C  1 97  ? 9.121   22.254  22.560  1.00 101.90 ? 97  ASP F C     1 
ATOM   5746  O O     . ASP C  1 97  ? 8.740   21.266  21.932  1.00 99.02  ? 97  ASP F O     1 
ATOM   5747  C CB    . ASP C  1 97  ? 10.431  21.716  24.643  1.00 108.78 ? 97  ASP F CB    1 
ATOM   5748  C CG    . ASP C  1 97  ? 11.651  22.450  24.132  1.00 123.04 ? 97  ASP F CG    1 
ATOM   5749  O OD1   . ASP C  1 97  ? 11.593  23.700  24.032  1.00 126.00 ? 97  ASP F OD1   1 
ATOM   5750  O OD2   . ASP C  1 97  ? 12.659  21.777  23.821  1.00 127.82 ? 97  ASP F OD2   1 
ATOM   5751  N N     . LEU C  1 98  ? 9.589   23.373  21.961  1.00 97.66  ? 98  LEU F N     1 
ATOM   5752  C CA    . LEU C  1 98  ? 9.766   23.454  20.511  1.00 94.31  ? 98  LEU F CA    1 
ATOM   5753  C C     . LEU C  1 98  ? 11.277  23.268  20.230  1.00 96.40  ? 98  LEU F C     1 
ATOM   5754  O O     . LEU C  1 98  ? 12.090  23.691  21.046  1.00 98.15  ? 98  LEU F O     1 
ATOM   5755  C CB    . LEU C  1 98  ? 9.258   24.786  19.954  1.00 20.00  ? 98  LEU F CB    1 
ATOM   5756  C CG    . LEU C  1 98  ? 7.748   25.022  20.034  1.00 20.00  ? 98  LEU F CG    1 
ATOM   5757  C CD1   . LEU C  1 98  ? 7.401   26.434  19.585  1.00 20.00  ? 98  LEU F CD1   1 
ATOM   5758  C CD2   . LEU C  1 98  ? 6.997   23.992  19.205  1.00 20.00  ? 98  LEU F CD2   1 
ATOM   5759  N N     . PRO C  1 99  ? 11.682  22.495  19.196  1.00 89.62  ? 99  PRO F N     1 
ATOM   5760  C CA    . PRO C  1 99  ? 10.853  21.897  18.144  1.00 84.17  ? 99  PRO F CA    1 
ATOM   5761  C C     . PRO C  1 99  ? 10.002  20.715  18.567  1.00 83.65  ? 99  PRO F C     1 
ATOM   5762  O O     . PRO C  1 99  ? 10.374  19.945  19.449  1.00 82.66  ? 99  PRO F O     1 
ATOM   5763  C CB    . PRO C  1 99  ? 11.889  21.474  17.090  1.00 85.16  ? 99  PRO F CB    1 
ATOM   5764  C CG    . PRO C  1 99  ? 13.116  21.200  17.870  1.00 92.76  ? 99  PRO F CG    1 
ATOM   5765  C CD    . PRO C  1 99  ? 13.114  22.243  18.945  1.00 92.53  ? 99  PRO F CD    1 
ATOM   5766  N N     . LEU C  1 100 ? 8.842   20.577  17.896  1.00 77.25  ? 100 LEU F N     1 
ATOM   5767  C CA    . LEU C  1 100 ? 7.932   19.453  18.074  1.00 74.01  ? 100 LEU F CA    1 
ATOM   5768  C C     . LEU C  1 100 ? 8.599   18.300  17.305  1.00 75.11  ? 100 LEU F C     1 
ATOM   5769  O O     . LEU C  1 100 ? 9.154   18.533  16.221  1.00 73.62  ? 100 LEU F O     1 
ATOM   5770  C CB    . LEU C  1 100 ? 6.543   19.777  17.470  1.00 71.87  ? 100 LEU F CB    1 
ATOM   5771  C CG    . LEU C  1 100 ? 5.910   21.081  17.985  1.00 78.90  ? 100 LEU F CG    1 
ATOM   5772  C CD1   . LEU C  1 100 ? 4.585   21.304  17.375  1.00 76.03  ? 100 LEU F CD1   1 
ATOM   5773  C CD2   . LEU C  1 100 ? 5.796   21.078  19.516  1.00 81.60  ? 100 LEU F CD2   1 
ATOM   5774  N N     . THR C  1 101 ? 8.640   17.095  17.889  1.00 70.43  ? 101 THR F N     1 
ATOM   5775  C CA    . THR C  1 101 ? 9.227   15.951  17.197  1.00 67.92  ? 101 THR F CA    1 
ATOM   5776  C C     . THR C  1 101 ? 8.299   14.779  17.303  1.00 68.53  ? 101 THR F C     1 
ATOM   5777  O O     . THR C  1 101 ? 7.516   14.695  18.244  1.00 66.52  ? 101 THR F O     1 
ATOM   5778  C CB    . THR C  1 101 ? 10.645  15.587  17.680  1.00 70.54  ? 101 THR F CB    1 
ATOM   5779  O OG1   . THR C  1 101 ? 10.599  15.113  19.029  1.00 69.84  ? 101 THR F OG1   1 
ATOM   5780  C CG2   . THR C  1 101 ? 11.636  16.725  17.507  1.00 71.61  ? 101 THR F CG2   1 
ATOM   5781  N N     . PHE C  1 102 ? 8.398   13.876  16.313  1.00 63.37  ? 102 PHE F N     1 
ATOM   5782  C CA    . PHE C  1 102 ? 7.623   12.647  16.271  1.00 61.08  ? 102 PHE F CA    1 
ATOM   5783  C C     . PHE C  1 102 ? 8.555   11.472  16.550  1.00 66.44  ? 102 PHE F C     1 
ATOM   5784  O O     . PHE C  1 102 ? 9.749   11.546  16.257  1.00 67.68  ? 102 PHE F O     1 
ATOM   5785  C CB    . PHE C  1 102 ? 6.985   12.454  14.875  1.00 58.45  ? 102 PHE F CB    1 
ATOM   5786  C CG    . PHE C  1 102 ? 5.842   13.394  14.600  1.00 58.28  ? 102 PHE F CG    1 
ATOM   5787  C CD1   . PHE C  1 102 ? 6.073   14.656  14.077  1.00 62.15  ? 102 PHE F CD1   1 
ATOM   5788  C CD2   . PHE C  1 102 ? 4.536   13.015  14.857  1.00 58.14  ? 102 PHE F CD2   1 
ATOM   5789  C CE1   . PHE C  1 102 ? 5.015   15.523  13.823  1.00 62.83  ? 102 PHE F CE1   1 
ATOM   5790  C CE2   . PHE C  1 102 ? 3.477   13.860  14.552  1.00 61.16  ? 102 PHE F CE2   1 
ATOM   5791  C CZ    . PHE C  1 102 ? 3.720   15.105  14.027  1.00 60.29  ? 102 PHE F CZ    1 
ATOM   5792  N N     . GLY C  1 103 ? 7.983   10.367  17.006  1.00 61.99  ? 103 GLY F N     1 
ATOM   5793  C CA    . GLY C  1 103 ? 8.714   9.117   17.111  1.00 61.83  ? 103 GLY F CA    1 
ATOM   5794  C C     . GLY C  1 103 ? 8.858   8.522   15.714  1.00 60.87  ? 103 GLY F C     1 
ATOM   5795  O O     . GLY C  1 103 ? 8.219   8.985   14.761  1.00 57.49  ? 103 GLY F O     1 
ATOM   5796  N N     . GLY C  1 104 ? 9.671   7.488   15.588  1.00 56.90  ? 104 GLY F N     1 
ATOM   5797  C CA    . GLY C  1 104 ? 9.939   6.859   14.299  1.00 54.96  ? 104 GLY F CA    1 
ATOM   5798  C C     . GLY C  1 104 ? 8.848   5.978   13.727  1.00 59.32  ? 104 GLY F C     1 
ATOM   5799  O O     . GLY C  1 104 ? 8.940   5.559   12.567  1.00 57.75  ? 104 GLY F O     1 
ATOM   5800  N N     . GLY C  1 105 ? 7.836   5.683   14.541  1.00 58.25  ? 105 GLY F N     1 
ATOM   5801  C CA    . GLY C  1 105 ? 6.684   4.893   14.151  1.00 56.06  ? 105 GLY F CA    1 
ATOM   5802  C C     . GLY C  1 105 ? 6.799   3.440   14.562  1.00 62.97  ? 105 GLY F C     1 
ATOM   5803  O O     . GLY C  1 105 ? 7.900   2.920   14.779  1.00 63.56  ? 105 GLY F O     1 
ATOM   5804  N N     . THR C  1 106 ? 5.638   2.797   14.700  1.00 61.48  ? 106 THR F N     1 
ATOM   5805  C CA    . THR C  1 106 ? 5.471   1.368   14.972  1.00 62.22  ? 106 THR F CA    1 
ATOM   5806  C C     . THR C  1 106 ? 4.400   0.864   13.974  1.00 63.70  ? 106 THR F C     1 
ATOM   5807  O O     . THR C  1 106 ? 3.282   1.393   13.960  1.00 60.62  ? 106 THR F O     1 
ATOM   5808  C CB    . THR C  1 106 ? 5.102   1.134   16.452  1.00 68.54  ? 106 THR F CB    1 
ATOM   5809  O OG1   . THR C  1 106 ? 6.259   1.343   17.251  1.00 71.69  ? 106 THR F OG1   1 
ATOM   5810  C CG2   . THR C  1 106 ? 4.562   -0.261  16.730  1.00 64.71  ? 106 THR F CG2   1 
ATOM   5811  N N     . LYS C  1 107 ? 4.762   -0.111  13.117  1.00 61.95  ? 107 LYS F N     1 
ATOM   5812  C CA    . LYS C  1 107 ? 3.833   -0.714  12.156  1.00 60.96  ? 107 LYS F CA    1 
ATOM   5813  C C     . LYS C  1 107 ? 3.190   -1.955  12.779  1.00 68.07  ? 107 LYS F C     1 
ATOM   5814  O O     . LYS C  1 107 ? 3.898   -2.920  13.098  1.00 67.14  ? 107 LYS F O     1 
ATOM   5815  C CB    . LYS C  1 107 ? 4.532   -1.117  10.851  1.00 62.13  ? 107 LYS F CB    1 
ATOM   5816  C CG    . LYS C  1 107 ? 3.564   -1.680  9.803   1.00 73.83  ? 107 LYS F CG    1 
ATOM   5817  C CD    . LYS C  1 107 ? 4.275   -2.061  8.506   1.00 89.90  ? 107 LYS F CD    1 
ATOM   5818  C CE    . LYS C  1 107 ? 3.392   -2.898  7.599   1.00 109.29 ? 107 LYS F CE    1 
ATOM   5819  N NZ    . LYS C  1 107 ? 4.076   -3.286  6.330   1.00 118.36 ? 107 LYS F NZ    1 
ATOM   5820  N N     . VAL C  1 108 ? 1.837   -1.944  12.879  1.00 66.76  ? 108 VAL F N     1 
ATOM   5821  C CA    . VAL C  1 108 ? 1.064   -3.065  13.389  1.00 69.66  ? 108 VAL F CA    1 
ATOM   5822  C C     . VAL C  1 108 ? 0.611   -3.856  12.156  1.00 72.96  ? 108 VAL F C     1 
ATOM   5823  O O     . VAL C  1 108 ? -0.221  -3.392  11.384  1.00 69.27  ? 108 VAL F O     1 
ATOM   5824  C CB    . VAL C  1 108 ? -0.085  -2.618  14.321  1.00 75.36  ? 108 VAL F CB    1 
ATOM   5825  C CG1   . VAL C  1 108 ? -0.860  -3.826  14.847  1.00 78.99  ? 108 VAL F CG1   1 
ATOM   5826  C CG2   . VAL C  1 108 ? 0.471   -1.808  15.496  1.00 75.93  ? 108 VAL F CG2   1 
ATOM   5827  N N     . GLU C  1 109 ? 1.231   -5.031  11.959  1.00 73.47  ? 109 GLU F N     1 
ATOM   5828  C CA    . GLU C  1 109 ? 1.044   -5.952  10.827  1.00 72.63  ? 109 GLU F CA    1 
ATOM   5829  C C     . GLU C  1 109 ? 0.199   -7.168  11.294  1.00 78.32  ? 109 GLU F C     1 
ATOM   5830  O O     . GLU C  1 109 ? 0.132   -7.472  12.503  1.00 79.21  ? 109 GLU F O     1 
ATOM   5831  C CB    . GLU C  1 109 ? 2.452   -6.361  10.292  1.00 73.43  ? 109 GLU F CB    1 
ATOM   5832  C CG    . GLU C  1 109 ? 2.593   -7.685  9.553   1.00 89.75  ? 109 GLU F CG    1 
ATOM   5833  C CD    . GLU C  1 109 ? 3.992   -8.268  9.553   1.00 115.20 ? 109 GLU F CD    1 
ATOM   5834  O OE1   . GLU C  1 109 ? 4.335   -8.974  10.528  1.00 113.56 ? 109 GLU F OE1   1 
ATOM   5835  O OE2   . GLU C  1 109 ? 4.723   -8.074  8.555   1.00 110.03 ? 109 GLU F OE2   1 
ATOM   5836  N N     . ILE C  1 110 ? -0.458  -7.843  10.323  1.00 74.26  ? 110 ILE F N     1 
ATOM   5837  C CA    . ILE C  1 110 ? -1.322  -9.006  10.574  1.00 76.95  ? 110 ILE F CA    1 
ATOM   5838  C C     . ILE C  1 110 ? -0.466  -10.273 10.647  1.00 82.57  ? 110 ILE F C     1 
ATOM   5839  O O     . ILE C  1 110 ? 0.311   -10.532 9.725   1.00 79.52  ? 110 ILE F O     1 
ATOM   5840  C CB    . ILE C  1 110 ? -2.415  -9.166  9.474   1.00 79.33  ? 110 ILE F CB    1 
ATOM   5841  C CG1   . ILE C  1 110 ? -3.234  -7.876  9.255   1.00 76.92  ? 110 ILE F CG1   1 
ATOM   5842  C CG2   . ILE C  1 110 ? -3.339  -10.350 9.788   1.00 83.39  ? 110 ILE F CG2   1 
ATOM   5843  C CD1   . ILE C  1 110 ? -3.640  -7.700  7.861   1.00 84.75  ? 110 ILE F CD1   1 
ATOM   5844  N N     . LYS C  1 111 ? -0.657  -11.081 11.709  1.00 83.75  ? 111 LYS F N     1 
ATOM   5845  C CA    . LYS C  1 111 ? 0.047   -12.353 11.914  1.00 86.67  ? 111 LYS F CA    1 
ATOM   5846  C C     . LYS C  1 111 ? -0.623  -13.387 11.032  1.00 93.13  ? 111 LYS F C     1 
ATOM   5847  O O     . LYS C  1 111 ? -1.829  -13.314 10.782  1.00 93.90  ? 111 LYS F O     1 
ATOM   5848  C CB    . LYS C  1 111 ? 0.051   -12.814 13.390  1.00 92.80  ? 111 LYS F CB    1 
ATOM   5849  N N     . ARG C  1 112 ? 0.154   -14.349 10.562  1.00 90.21  ? 112 ARG F N     1 
ATOM   5850  C CA    . ARG C  1 112 ? -0.340  -15.322 9.603   1.00 91.26  ? 112 ARG F CA    1 
ATOM   5851  C C     . ARG C  1 112 ? 0.589   -16.542 9.573   1.00 96.47  ? 112 ARG F C     1 
ATOM   5852  O O     . ARG C  1 112 ? 1.715   -16.470 10.076  1.00 95.70  ? 112 ARG F O     1 
ATOM   5853  C CB    . ARG C  1 112 ? -0.436  -14.611 8.202   1.00 87.86  ? 112 ARG F CB    1 
ATOM   5854  C CG    . ARG C  1 112 ? -0.599  -15.565 7.042   1.00 98.58  ? 112 ARG F CG    1 
ATOM   5855  C CD    . ARG C  1 112 ? -0.945  -14.979 5.718   1.00 99.64  ? 112 ARG F CD    1 
ATOM   5856  N NE    . ARG C  1 112 ? -1.767  -15.913 4.938   1.00 113.17 ? 112 ARG F NE    1 
ATOM   5857  C CZ    . ARG C  1 112 ? -1.356  -17.084 4.441   1.00 135.70 ? 112 ARG F CZ    1 
ATOM   5858  N NH1   . ARG C  1 112 ? -0.102  -17.494 4.622   1.00 120.19 ? 112 ARG F NH1   1 
ATOM   5859  N NH2   . ARG C  1 112 ? -2.196  -17.854 3.758   1.00 134.56 ? 112 ARG F NH2   1 
ATOM   5860  N N     . THR C  1 113 ? 0.090   -17.673 9.039   1.00 95.59  ? 113 THR F N     1 
ATOM   5861  C CA    . THR C  1 113 ? 0.882   -18.895 8.872   1.00 98.02  ? 113 THR F CA    1 
ATOM   5862  C C     . THR C  1 113 ? 1.951   -18.649 7.802   1.00 98.79  ? 113 THR F C     1 
ATOM   5863  O O     . THR C  1 113 ? 1.723   -17.893 6.853   1.00 94.61  ? 113 THR F O     1 
ATOM   5864  C CB    . THR C  1 113 ? -0.018  -20.102 8.546   1.00 103.92 ? 113 THR F CB    1 
ATOM   5865  O OG1   . THR C  1 113 ? -0.955  -19.747 7.518   1.00 102.34 ? 113 THR F OG1   1 
ATOM   5866  C CG2   . THR C  1 113 ? -0.761  -20.599 9.766   1.00 100.39 ? 113 THR F CG2   1 
ATOM   5867  N N     . VAL C  1 114 ? 3.128   -19.262 7.971   1.00 96.43  ? 114 VAL F N     1 
ATOM   5868  C CA    . VAL C  1 114 ? 4.241   -19.043 7.050   1.00 92.98  ? 114 VAL F CA    1 
ATOM   5869  C C     . VAL C  1 114 ? 3.906   -19.600 5.682   1.00 95.67  ? 114 VAL F C     1 
ATOM   5870  O O     . VAL C  1 114 ? 3.475   -20.738 5.566   1.00 97.77  ? 114 VAL F O     1 
ATOM   5871  C CB    . VAL C  1 114 ? 5.572   -19.611 7.603   1.00 99.08  ? 114 VAL F CB    1 
ATOM   5872  C CG1   . VAL C  1 114 ? 6.691   -19.513 6.560   1.00 96.54  ? 114 VAL F CG1   1 
ATOM   5873  C CG2   . VAL C  1 114 ? 5.972   -18.898 8.898   1.00 98.52  ? 114 VAL F CG2   1 
ATOM   5874  N N     . ALA C  1 115 ? 4.039   -18.763 4.656   1.00 90.13  ? 115 ALA F N     1 
ATOM   5875  C CA    . ALA C  1 115 ? 3.810   -19.140 3.263   1.00 89.49  ? 115 ALA F CA    1 
ATOM   5876  C C     . ALA C  1 115 ? 5.109   -18.886 2.523   1.00 93.46  ? 115 ALA F C     1 
ATOM   5877  O O     . ALA C  1 115 ? 5.718   -17.822 2.692   1.00 89.48  ? 115 ALA F O     1 
ATOM   5878  C CB    . ALA C  1 115 ? 2.682   -18.318 2.661   1.00 87.42  ? 115 ALA F CB    1 
ATOM   5879  N N     . ALA C  1 116 ? 5.562   -19.880 1.742   1.00 94.21  ? 116 ALA F N     1 
ATOM   5880  C CA    . ALA C  1 116 ? 6.784   -19.761 0.953   1.00 92.65  ? 116 ALA F CA    1 
ATOM   5881  C C     . ALA C  1 116 ? 6.506   -18.875 -0.270  1.00 93.64  ? 116 ALA F C     1 
ATOM   5882  O O     . ALA C  1 116 ? 5.344   -18.742 -0.663  1.00 92.48  ? 116 ALA F O     1 
ATOM   5883  C CB    . ALA C  1 116 ? 7.261   -21.135 0.506   1.00 96.92  ? 116 ALA F CB    1 
ATOM   5884  N N     . PRO C  1 117 ? 7.531   -18.261 -0.893  1.00 88.92  ? 117 PRO F N     1 
ATOM   5885  C CA    . PRO C  1 117 ? 7.266   -17.445 -2.075  1.00 86.00  ? 117 PRO F CA    1 
ATOM   5886  C C     . PRO C  1 117 ? 7.231   -18.266 -3.348  1.00 90.82  ? 117 PRO F C     1 
ATOM   5887  O O     . PRO C  1 117 ? 8.090   -19.121 -3.555  1.00 92.25  ? 117 PRO F O     1 
ATOM   5888  C CB    . PRO C  1 117 ? 8.445   -16.447 -2.095  1.00 85.42  ? 117 PRO F CB    1 
ATOM   5889  C CG    . PRO C  1 117 ? 9.394   -16.892 -0.963  1.00 91.81  ? 117 PRO F CG    1 
ATOM   5890  C CD    . PRO C  1 117 ? 8.975   -18.283 -0.607  1.00 91.37  ? 117 PRO F CD    1 
ATOM   5891  N N     . SER C  1 118 ? 6.252   -17.988 -4.210  1.00 86.55  ? 118 SER F N     1 
ATOM   5892  C CA    . SER C  1 118 ? 6.178   -18.589 -5.534  1.00 87.05  ? 118 SER F CA    1 
ATOM   5893  C C     . SER C  1 118 ? 7.096   -17.669 -6.370  1.00 86.65  ? 118 SER F C     1 
ATOM   5894  O O     . SER C  1 118 ? 6.751   -16.505 -6.600  1.00 83.55  ? 118 SER F O     1 
ATOM   5895  C CB    . SER C  1 118 ? 4.738   -18.594 -6.050  1.00 90.99  ? 118 SER F CB    1 
ATOM   5896  O OG    . SER C  1 118 ? 3.850   -19.086 -5.059  1.00 100.48 ? 118 SER F OG    1 
ATOM   5897  N N     . VAL C  1 119 ? 8.331   -18.132 -6.663  1.00 82.54  ? 119 VAL F N     1 
ATOM   5898  C CA    . VAL C  1 119 ? 9.327   -17.326 -7.381  1.00 78.46  ? 119 VAL F CA    1 
ATOM   5899  C C     . VAL C  1 119 ? 9.255   -17.532 -8.884  1.00 79.81  ? 119 VAL F C     1 
ATOM   5900  O O     . VAL C  1 119 ? 9.063   -18.651 -9.365  1.00 81.09  ? 119 VAL F O     1 
ATOM   5901  C CB    . VAL C  1 119 ? 10.770  -17.538 -6.849  1.00 82.38  ? 119 VAL F CB    1 
ATOM   5902  C CG1   . VAL C  1 119 ? 11.766  -16.609 -7.554  1.00 79.65  ? 119 VAL F CG1   1 
ATOM   5903  C CG2   . VAL C  1 119 ? 10.825  -17.326 -5.337  1.00 81.79  ? 119 VAL F CG2   1 
ATOM   5904  N N     . PHE C  1 120 ? 9.392   -16.414 -9.617  1.00 73.55  ? 120 PHE F N     1 
ATOM   5905  C CA    . PHE C  1 120 ? 9.413   -16.357 -11.076 1.00 72.06  ? 120 PHE F CA    1 
ATOM   5906  C C     . PHE C  1 120 ? 10.522  -15.405 -11.491 1.00 73.12  ? 120 PHE F C     1 
ATOM   5907  O O     . PHE C  1 120 ? 10.800  -14.428 -10.791 1.00 69.49  ? 120 PHE F O     1 
ATOM   5908  C CB    . PHE C  1 120 ? 8.069   -15.864 -11.646 1.00 71.83  ? 120 PHE F CB    1 
ATOM   5909  C CG    . PHE C  1 120 ? 6.841   -16.580 -11.127 1.00 73.77  ? 120 PHE F CG    1 
ATOM   5910  C CD1   . PHE C  1 120 ? 6.256   -16.208 -9.921  1.00 74.70  ? 120 PHE F CD1   1 
ATOM   5911  C CD2   . PHE C  1 120 ? 6.247   -17.592 -11.860 1.00 77.11  ? 120 PHE F CD2   1 
ATOM   5912  C CE1   . PHE C  1 120 ? 5.107   -16.847 -9.457  1.00 76.76  ? 120 PHE F CE1   1 
ATOM   5913  C CE2   . PHE C  1 120 ? 5.084   -18.215 -11.407 1.00 81.60  ? 120 PHE F CE2   1 
ATOM   5914  C CZ    . PHE C  1 120 ? 4.526   -17.846 -10.204 1.00 78.74  ? 120 PHE F CZ    1 
ATOM   5915  N N     . ILE C  1 121 ? 11.142  -15.692 -12.641 1.00 71.24  ? 121 ILE F N     1 
ATOM   5916  C CA    . ILE C  1 121 ? 12.212  -14.888 -13.230 1.00 68.97  ? 121 ILE F CA    1 
ATOM   5917  C C     . ILE C  1 121 ? 11.777  -14.491 -14.649 1.00 70.38  ? 121 ILE F C     1 
ATOM   5918  O O     . ILE C  1 121 ? 11.119  -15.287 -15.336 1.00 71.39  ? 121 ILE F O     1 
ATOM   5919  C CB    . ILE C  1 121 ? 13.603  -15.610 -13.180 1.00 73.78  ? 121 ILE F CB    1 
ATOM   5920  C CG1   . ILE C  1 121 ? 14.729  -14.648 -13.654 1.00 73.69  ? 121 ILE F CG1   1 
ATOM   5921  C CG2   . ILE C  1 121 ? 13.625  -16.911 -13.989 1.00 76.87  ? 121 ILE F CG2   1 
ATOM   5922  C CD1   . ILE C  1 121 ? 16.170  -15.143 -13.442 1.00 82.09  ? 121 ILE F CD1   1 
ATOM   5923  N N     . PHE C  1 122 ? 12.115  -13.253 -15.068 1.00 63.99  ? 122 PHE F N     1 
ATOM   5924  C CA    . PHE C  1 122 ? 11.786  -12.746 -16.395 1.00 65.01  ? 122 PHE F CA    1 
ATOM   5925  C C     . PHE C  1 122 ? 13.039  -12.188 -17.048 1.00 71.25  ? 122 PHE F C     1 
ATOM   5926  O O     . PHE C  1 122 ? 13.724  -11.364 -16.439 1.00 70.48  ? 122 PHE F O     1 
ATOM   5927  C CB    . PHE C  1 122 ? 10.727  -11.614 -16.355 1.00 64.35  ? 122 PHE F CB    1 
ATOM   5928  C CG    . PHE C  1 122 ? 9.433   -11.962 -15.663 1.00 65.32  ? 122 PHE F CG    1 
ATOM   5929  C CD1   . PHE C  1 122 ? 8.502   -12.781 -16.276 1.00 68.86  ? 122 PHE F CD1   1 
ATOM   5930  C CD2   . PHE C  1 122 ? 9.107   -11.398 -14.435 1.00 64.59  ? 122 PHE F CD2   1 
ATOM   5931  C CE1   . PHE C  1 122 ? 7.308   -13.109 -15.643 1.00 69.15  ? 122 PHE F CE1   1 
ATOM   5932  C CE2   . PHE C  1 122 ? 7.892   -11.694 -13.816 1.00 66.59  ? 122 PHE F CE2   1 
ATOM   5933  C CZ    . PHE C  1 122 ? 7.004   -12.561 -14.419 1.00 66.17  ? 122 PHE F CZ    1 
ATOM   5934  N N     . PRO C  1 123 ? 13.326  -12.559 -18.303 1.00 70.04  ? 123 PRO F N     1 
ATOM   5935  C CA    . PRO C  1 123 ? 14.473  -11.959 -18.990 1.00 70.85  ? 123 PRO F CA    1 
ATOM   5936  C C     . PRO C  1 123 ? 14.139  -10.560 -19.530 1.00 72.98  ? 123 PRO F C     1 
ATOM   5937  O O     . PRO C  1 123 ? 12.967  -10.166 -19.563 1.00 69.77  ? 123 PRO F O     1 
ATOM   5938  C CB    . PRO C  1 123 ? 14.694  -12.927 -20.151 1.00 75.60  ? 123 PRO F CB    1 
ATOM   5939  C CG    . PRO C  1 123 ? 13.323  -13.379 -20.497 1.00 79.79  ? 123 PRO F CG    1 
ATOM   5940  C CD    . PRO C  1 123 ? 12.603  -13.495 -19.192 1.00 73.56  ? 123 PRO F CD    1 
ATOM   5941  N N     . PRO C  1 124 ? 15.136  -9.817  -20.050 1.00 70.72  ? 124 PRO F N     1 
ATOM   5942  C CA    . PRO C  1 124 ? 14.817  -8.539  -20.692 1.00 68.79  ? 124 PRO F CA    1 
ATOM   5943  C C     . PRO C  1 124 ? 14.094  -8.810  -21.997 1.00 71.64  ? 124 PRO F C     1 
ATOM   5944  O O     . PRO C  1 124 ? 14.393  -9.799  -22.661 1.00 73.76  ? 124 PRO F O     1 
ATOM   5945  C CB    . PRO C  1 124 ? 16.190  -7.900  -20.950 1.00 72.32  ? 124 PRO F CB    1 
ATOM   5946  C CG    . PRO C  1 124 ? 17.191  -8.791  -20.327 1.00 79.19  ? 124 PRO F CG    1 
ATOM   5947  C CD    . PRO C  1 124 ? 16.567  -10.137 -20.195 1.00 74.94  ? 124 PRO F CD    1 
ATOM   5948  N N     . SER C  1 125 ? 13.139  -7.968  -22.348 1.00 65.36  ? 125 SER F N     1 
ATOM   5949  C CA    . SER C  1 125 ? 12.397  -8.118  -23.603 1.00 66.22  ? 125 SER F CA    1 
ATOM   5950  C C     . SER C  1 125 ? 13.267  -7.714  -24.770 1.00 72.23  ? 125 SER F C     1 
ATOM   5951  O O     . SER C  1 125 ? 14.159  -6.885  -24.601 1.00 70.44  ? 125 SER F O     1 
ATOM   5952  C CB    . SER C  1 125 ? 11.150  -7.237  -23.589 1.00 66.22  ? 125 SER F CB    1 
ATOM   5953  O OG    . SER C  1 125 ? 11.466  -5.852  -23.607 1.00 63.23  ? 125 SER F OG    1 
ATOM   5954  N N     . ASP C  1 126 ? 12.991  -8.274  -25.957 1.00 73.47  ? 126 ASP F N     1 
ATOM   5955  C CA    . ASP C  1 126 ? 13.690  -7.913  -27.198 1.00 75.69  ? 126 ASP F CA    1 
ATOM   5956  C C     . ASP C  1 126 ? 13.533  -6.396  -27.414 1.00 77.39  ? 126 ASP F C     1 
ATOM   5957  O O     . ASP C  1 126 ? 14.513  -5.718  -27.713 1.00 78.19  ? 126 ASP F O     1 
ATOM   5958  C CB    . ASP C  1 126 ? 13.084  -8.641  -28.421 1.00 80.27  ? 126 ASP F CB    1 
ATOM   5959  C CG    . ASP C  1 126 ? 13.444  -10.108 -28.602 1.00 94.25  ? 126 ASP F CG    1 
ATOM   5960  O OD1   . ASP C  1 126 ? 14.493  -10.536 -28.062 1.00 95.79  ? 126 ASP F OD1   1 
ATOM   5961  O OD2   . ASP C  1 126 ? 12.710  -10.817 -29.347 1.00 97.38  ? 126 ASP F OD2   1 
ATOM   5962  N N     . GLU C  1 127 ? 12.297  -5.874  -27.239 1.00 70.81  ? 127 GLU F N     1 
ATOM   5963  C CA    . GLU C  1 127 ? 11.996  -4.442  -27.400 1.00 69.89  ? 127 GLU F CA    1 
ATOM   5964  C C     . GLU C  1 127 ? 12.935  -3.563  -26.577 1.00 74.85  ? 127 GLU F C     1 
ATOM   5965  O O     . GLU C  1 127 ? 13.407  -2.552  -27.084 1.00 77.90  ? 127 GLU F O     1 
ATOM   5966  C CB    . GLU C  1 127 ? 10.547  -4.135  -27.010 1.00 68.41  ? 127 GLU F CB    1 
ATOM   5967  C CG    . GLU C  1 127 ? 10.036  -2.813  -27.543 1.00 80.29  ? 127 GLU F CG    1 
ATOM   5968  C CD    . GLU C  1 127 ? 8.689   -2.416  -26.977 1.00 104.81 ? 127 GLU F CD    1 
ATOM   5969  O OE1   . GLU C  1 127 ? 7.858   -3.322  -26.740 1.00 107.79 ? 127 GLU F OE1   1 
ATOM   5970  O OE2   . GLU C  1 127 ? 8.465   -1.204  -26.756 1.00 100.01 ? 127 GLU F OE2   1 
ATOM   5971  N N     . GLN C  1 128 ? 13.234  -3.964  -25.338 1.00 69.61  ? 128 GLN F N     1 
ATOM   5972  C CA    . GLN C  1 128 ? 14.120  -3.203  -24.453 1.00 68.37  ? 128 GLN F CA    1 
ATOM   5973  C C     . GLN C  1 128 ? 15.548  -3.303  -24.905 1.00 74.72  ? 128 GLN F C     1 
ATOM   5974  O O     . GLN C  1 128 ? 16.238  -2.293  -24.937 1.00 74.75  ? 128 GLN F O     1 
ATOM   5975  C CB    . GLN C  1 128 ? 14.010  -3.678  -22.993 1.00 66.49  ? 128 GLN F CB    1 
ATOM   5976  C CG    . GLN C  1 128 ? 14.819  -2.795  -22.042 1.00 73.96  ? 128 GLN F CG    1 
ATOM   5977  C CD    . GLN C  1 128 ? 14.802  -3.212  -20.592 1.00 76.31  ? 128 GLN F CD    1 
ATOM   5978  O OE1   . GLN C  1 128 ? 14.583  -4.386  -20.236 1.00 62.05  ? 128 GLN F OE1   1 
ATOM   5979  N NE2   . GLN C  1 128 ? 15.169  -2.265  -19.737 1.00 65.65  ? 128 GLN F NE2   1 
ATOM   5980  N N     . LEU C  1 129 ? 16.003  -4.512  -25.240 1.00 74.49  ? 129 LEU F N     1 
ATOM   5981  C CA    . LEU C  1 129 ? 17.376  -4.754  -25.689 1.00 77.07  ? 129 LEU F CA    1 
ATOM   5982  C C     . LEU C  1 129 ? 17.794  -3.873  -26.877 1.00 84.41  ? 129 LEU F C     1 
ATOM   5983  O O     . LEU C  1 129 ? 18.961  -3.508  -26.948 1.00 85.34  ? 129 LEU F O     1 
ATOM   5984  C CB    . LEU C  1 129 ? 17.604  -6.246  -25.977 1.00 78.62  ? 129 LEU F CB    1 
ATOM   5985  C CG    . LEU C  1 129 ? 17.580  -7.177  -24.739 1.00 81.52  ? 129 LEU F CG    1 
ATOM   5986  C CD1   . LEU C  1 129 ? 17.455  -8.638  -25.143 1.00 82.40  ? 129 LEU F CD1   1 
ATOM   5987  C CD2   . LEU C  1 129 ? 18.832  -7.007  -23.864 1.00 85.45  ? 129 LEU F CD2   1 
ATOM   5988  N N     . LYS C  1 130 ? 16.849  -3.434  -27.733 1.00 83.75  ? 130 LYS F N     1 
ATOM   5989  C CA    . LYS C  1 130 ? 17.168  -2.500  -28.831 1.00 87.83  ? 130 LYS F CA    1 
ATOM   5990  C C     . LYS C  1 130 ? 17.523  -1.070  -28.310 1.00 92.57  ? 130 LYS F C     1 
ATOM   5991  O O     . LYS C  1 130 ? 18.138  -0.302  -29.051 1.00 95.85  ? 130 LYS F O     1 
ATOM   5992  C CB    . LYS C  1 130 ? 16.017  -2.423  -29.859 1.00 91.37  ? 130 LYS F CB    1 
ATOM   5993  N N     . SER C  1 131 ? 17.138  -0.727  -27.052 1.00 86.58  ? 131 SER F N     1 
ATOM   5994  C CA    . SER C  1 131 ? 17.387  0.575   -26.404 1.00 85.92  ? 131 SER F CA    1 
ATOM   5995  C C     . SER C  1 131 ? 18.748  0.722   -25.674 1.00 91.10  ? 131 SER F C     1 
ATOM   5996  O O     . SER C  1 131 ? 19.015  1.801   -25.142 1.00 91.31  ? 131 SER F O     1 
ATOM   5997  C CB    . SER C  1 131 ? 16.268  0.890   -25.404 1.00 86.22  ? 131 SER F CB    1 
ATOM   5998  O OG    . SER C  1 131 ? 16.476  0.337   -24.107 1.00 90.41  ? 131 SER F OG    1 
ATOM   5999  N N     . GLY C  1 132 ? 19.550  -0.341  -25.590 1.00 87.94  ? 132 GLY F N     1 
ATOM   6000  C CA    . GLY C  1 132 ? 20.850  -0.290  -24.922 1.00 88.65  ? 132 GLY F CA    1 
ATOM   6001  C C     . GLY C  1 132 ? 20.887  -0.690  -23.455 1.00 88.16  ? 132 GLY F C     1 
ATOM   6002  O O     . GLY C  1 132 ? 21.979  -0.808  -22.898 1.00 89.04  ? 132 GLY F O     1 
ATOM   6003  N N     . THR C  1 133 ? 19.724  -0.917  -22.813 1.00 80.17  ? 133 THR F N     1 
ATOM   6004  C CA    . THR C  1 133 ? 19.660  -1.337  -21.406 1.00 77.14  ? 133 THR F CA    1 
ATOM   6005  C C     . THR C  1 133 ? 18.962  -2.689  -21.306 1.00 77.71  ? 133 THR F C     1 
ATOM   6006  O O     . THR C  1 133 ? 18.301  -3.106  -22.252 1.00 76.59  ? 133 THR F O     1 
ATOM   6007  C CB    . THR C  1 133 ? 19.013  -0.248  -20.528 1.00 86.20  ? 133 THR F CB    1 
ATOM   6008  O OG1   . THR C  1 133 ? 17.756  0.159   -21.084 1.00 93.12  ? 133 THR F OG1   1 
ATOM   6009  C CG2   . THR C  1 133 ? 19.902  0.974   -20.378 1.00 85.13  ? 133 THR F CG2   1 
ATOM   6010  N N     . ALA C  1 134 ? 19.140  -3.383  -20.170 1.00 72.67  ? 134 ALA F N     1 
ATOM   6011  C CA    . ALA C  1 134 ? 18.563  -4.707  -19.927 1.00 70.72  ? 134 ALA F CA    1 
ATOM   6012  C C     . ALA C  1 134 ? 18.120  -4.848  -18.481 1.00 69.86  ? 134 ALA F C     1 
ATOM   6013  O O     . ALA C  1 134 ? 18.943  -4.731  -17.579 1.00 67.32  ? 134 ALA F O     1 
ATOM   6014  C CB    . ALA C  1 134 ? 19.587  -5.781  -20.245 1.00 74.30  ? 134 ALA F CB    1 
ATOM   6015  N N     . SER C  1 135 ? 16.824  -5.099  -18.260 1.00 64.88  ? 135 SER F N     1 
ATOM   6016  C CA    . SER C  1 135 ? 16.268  -5.280  -16.929 1.00 61.31  ? 135 SER F CA    1 
ATOM   6017  C C     . SER C  1 135 ? 15.860  -6.737  -16.779 1.00 64.13  ? 135 SER F C     1 
ATOM   6018  O O     . SER C  1 135 ? 15.027  -7.232  -17.539 1.00 61.18  ? 135 SER F O     1 
ATOM   6019  C CB    . SER C  1 135 ? 15.065  -4.367  -16.712 1.00 61.51  ? 135 SER F CB    1 
ATOM   6020  O OG    . SER C  1 135 ? 15.427  -3.010  -16.912 1.00 69.44  ? 135 SER F OG    1 
ATOM   6021  N N     . VAL C  1 136 ? 16.433  -7.414  -15.773 1.00 62.64  ? 136 VAL F N     1 
ATOM   6022  C CA    . VAL C  1 136 ? 16.099  -8.793  -15.459 1.00 63.49  ? 136 VAL F CA    1 
ATOM   6023  C C     . VAL C  1 136 ? 15.269  -8.679  -14.178 1.00 66.91  ? 136 VAL F C     1 
ATOM   6024  O O     . VAL C  1 136 ? 15.705  -8.008  -13.243 1.00 65.54  ? 136 VAL F O     1 
ATOM   6025  C CB    . VAL C  1 136 ? 17.352  -9.673  -15.290 1.00 69.64  ? 136 VAL F CB    1 
ATOM   6026  C CG1   . VAL C  1 136 ? 16.984  -11.137 -15.417 1.00 70.76  ? 136 VAL F CG1   1 
ATOM   6027  C CG2   . VAL C  1 136 ? 18.431  -9.298  -16.303 1.00 71.32  ? 136 VAL F CG2   1 
ATOM   6028  N N     . VAL C  1 137 ? 14.060  -9.274  -14.159 1.00 64.05  ? 137 VAL F N     1 
ATOM   6029  C CA    . VAL C  1 137 ? 13.116  -9.146  -13.049 1.00 62.58  ? 137 VAL F CA    1 
ATOM   6030  C C     . VAL C  1 137 ? 12.816  -10.489 -12.378 1.00 69.90  ? 137 VAL F C     1 
ATOM   6031  O O     . VAL C  1 137 ? 12.396  -11.436 -13.033 1.00 71.64  ? 137 VAL F O     1 
ATOM   6032  C CB    . VAL C  1 137 ? 11.822  -8.430  -13.528 1.00 63.95  ? 137 VAL F CB    1 
ATOM   6033  C CG1   . VAL C  1 137 ? 10.724  -8.455  -12.460 1.00 62.47  ? 137 VAL F CG1   1 
ATOM   6034  C CG2   . VAL C  1 137 ? 12.132  -6.993  -13.940 1.00 62.39  ? 137 VAL F CG2   1 
ATOM   6035  N N     . CYS C  1 138 ? 12.970  -10.524 -11.063 1.00 67.39  ? 138 CYS F N     1 
ATOM   6036  C CA    . CYS C  1 138 ? 12.700  -11.674 -10.213 1.00 70.74  ? 138 CYS F CA    1 
ATOM   6037  C C     . CYS C  1 138 ? 11.492  -11.266 -9.352  1.00 68.33  ? 138 CYS F C     1 
ATOM   6038  O O     . CYS C  1 138 ? 11.498  -10.170 -8.801  1.00 64.44  ? 138 CYS F O     1 
ATOM   6039  C CB    . CYS C  1 138 ? 13.935  -11.971 -9.358  1.00 74.63  ? 138 CYS F CB    1 
ATOM   6040  S SG    . CYS C  1 138 ? 13.832  -13.460 -8.331  1.00 82.24  ? 138 CYS F SG    1 
ATOM   6041  N N     . LEU C  1 139 ? 10.442  -12.108 -9.311  1.00 63.62  ? 139 LEU F N     1 
ATOM   6042  C CA    . LEU C  1 139 ? 9.213   -11.868 -8.557  1.00 60.88  ? 139 LEU F CA    1 
ATOM   6043  C C     . LEU C  1 139 ? 9.115   -12.903 -7.453  1.00 65.92  ? 139 LEU F C     1 
ATOM   6044  O O     . LEU C  1 139 ? 9.204   -14.085 -7.737  1.00 66.97  ? 139 LEU F O     1 
ATOM   6045  C CB    . LEU C  1 139 ? 7.987   -12.016 -9.481  1.00 60.51  ? 139 LEU F CB    1 
ATOM   6046  C CG    . LEU C  1 139 ? 6.607   -12.132 -8.799  1.00 63.81  ? 139 LEU F CG    1 
ATOM   6047  C CD1   . LEU C  1 139 ? 6.211   -10.802 -8.158  1.00 61.02  ? 139 LEU F CD1   1 
ATOM   6048  C CD2   . LEU C  1 139 ? 5.543   -12.581 -9.780  1.00 65.97  ? 139 LEU F CD2   1 
ATOM   6049  N N     . LEU C  1 140 ? 8.880   -12.467 -6.216  1.00 63.00  ? 140 LEU F N     1 
ATOM   6050  C CA    . LEU C  1 140 ? 8.672   -13.355 -5.061  1.00 65.50  ? 140 LEU F CA    1 
ATOM   6051  C C     . LEU C  1 140 ? 7.219   -13.098 -4.736  1.00 67.54  ? 140 LEU F C     1 
ATOM   6052  O O     . LEU C  1 140 ? 6.887   -11.967 -4.384  1.00 64.61  ? 140 LEU F O     1 
ATOM   6053  C CB    . LEU C  1 140 ? 9.580   -12.977 -3.871  1.00 65.66  ? 140 LEU F CB    1 
ATOM   6054  C CG    . LEU C  1 140 ? 11.066  -13.406 -3.957  1.00 72.06  ? 140 LEU F CG    1 
ATOM   6055  C CD1   . LEU C  1 140 ? 11.747  -12.906 -5.229  1.00 71.41  ? 140 LEU F CD1   1 
ATOM   6056  C CD2   . LEU C  1 140 ? 11.839  -12.908 -2.771  1.00 74.63  ? 140 LEU F CD2   1 
ATOM   6057  N N     . ASN C  1 141 ? 6.338   -14.080 -4.977  1.00 65.46  ? 141 ASN F N     1 
ATOM   6058  C CA    . ASN C  1 141 ? 4.901   -13.874 -4.813  1.00 65.08  ? 141 ASN F CA    1 
ATOM   6059  C C     . ASN C  1 141 ? 4.281   -14.576 -3.602  1.00 70.86  ? 141 ASN F C     1 
ATOM   6060  O O     . ASN C  1 141 ? 4.710   -15.658 -3.221  1.00 72.11  ? 141 ASN F O     1 
ATOM   6061  C CB    . ASN C  1 141 ? 4.165   -14.307 -6.103  1.00 65.41  ? 141 ASN F CB    1 
ATOM   6062  C CG    . ASN C  1 141 ? 2.908   -13.520 -6.373  1.00 80.14  ? 141 ASN F CG    1 
ATOM   6063  O OD1   . ASN C  1 141 ? 2.858   -12.312 -6.152  1.00 80.05  ? 141 ASN F OD1   1 
ATOM   6064  N ND2   . ASN C  1 141 ? 1.856   -14.171 -6.837  1.00 69.27  ? 141 ASN F ND2   1 
ATOM   6065  N N     . ASN C  1 142 ? 3.234   -13.938 -3.036  1.00 67.08  ? 142 ASN F N     1 
ATOM   6066  C CA    . ASN C  1 142 ? 2.397   -14.392 -1.929  1.00 68.55  ? 142 ASN F CA    1 
ATOM   6067  C C     . ASN C  1 142 ? 3.152   -15.188 -0.849  1.00 75.00  ? 142 ASN F C     1 
ATOM   6068  O O     . ASN C  1 142 ? 2.947   -16.401 -0.687  1.00 77.17  ? 142 ASN F O     1 
ATOM   6069  C CB    . ASN C  1 142 ? 1.182   -15.182 -2.477  1.00 69.10  ? 142 ASN F CB    1 
ATOM   6070  C CG    . ASN C  1 142 ? 0.286   -14.373 -3.402  1.00 80.57  ? 142 ASN F CG    1 
ATOM   6071  O OD1   . ASN C  1 142 ? 0.346   -13.136 -3.468  1.00 69.35  ? 142 ASN F OD1   1 
ATOM   6072  N ND2   . ASN C  1 142 ? -0.602  -15.051 -4.105  1.00 70.59  ? 142 ASN F ND2   1 
ATOM   6073  N N     . PHE C  1 143 ? 3.981   -14.453 -0.082  1.00 70.55  ? 143 PHE F N     1 
ATOM   6074  C CA    . PHE C  1 143 ? 4.791   -14.981 1.013   1.00 73.00  ? 143 PHE F CA    1 
ATOM   6075  C C     . PHE C  1 143 ? 4.593   -14.188 2.312   1.00 78.31  ? 143 PHE F C     1 
ATOM   6076  O O     . PHE C  1 143 ? 4.107   -13.057 2.285   1.00 74.97  ? 143 PHE F O     1 
ATOM   6077  C CB    . PHE C  1 143 ? 6.278   -15.003 0.614   1.00 73.89  ? 143 PHE F CB    1 
ATOM   6078  C CG    . PHE C  1 143 ? 6.935   -13.658 0.437   1.00 71.19  ? 143 PHE F CG    1 
ATOM   6079  C CD1   . PHE C  1 143 ? 6.910   -13.010 -0.793  1.00 70.53  ? 143 PHE F CD1   1 
ATOM   6080  C CD2   . PHE C  1 143 ? 7.611   -13.056 1.488   1.00 71.77  ? 143 PHE F CD2   1 
ATOM   6081  C CE1   . PHE C  1 143 ? 7.509   -11.760 -0.948  1.00 68.22  ? 143 PHE F CE1   1 
ATOM   6082  C CE2   . PHE C  1 143 ? 8.187   -11.795 1.341   1.00 71.04  ? 143 PHE F CE2   1 
ATOM   6083  C CZ    . PHE C  1 143 ? 8.161   -11.170 0.118   1.00 67.25  ? 143 PHE F CZ    1 
ATOM   6084  N N     . TYR C  1 144 ? 4.970   -14.798 3.448   1.00 79.74  ? 144 TYR F N     1 
ATOM   6085  C CA    . TYR C  1 144 ? 4.861   -14.176 4.774   1.00 80.20  ? 144 TYR F CA    1 
ATOM   6086  C C     . TYR C  1 144 ? 5.860   -14.844 5.733   1.00 87.60  ? 144 TYR F C     1 
ATOM   6087  O O     . TYR C  1 144 ? 5.923   -16.072 5.718   1.00 89.67  ? 144 TYR F O     1 
ATOM   6088  C CB    . TYR C  1 144 ? 3.414   -14.317 5.319   1.00 83.03  ? 144 TYR F CB    1 
ATOM   6089  C CG    . TYR C  1 144 ? 3.258   -13.703 6.691   1.00 84.43  ? 144 TYR F CG    1 
ATOM   6090  C CD1   . TYR C  1 144 ? 3.021   -12.344 6.841   1.00 82.78  ? 144 TYR F CD1   1 
ATOM   6091  C CD2   . TYR C  1 144 ? 3.501   -14.450 7.839   1.00 89.02  ? 144 TYR F CD2   1 
ATOM   6092  C CE1   . TYR C  1 144 ? 2.998   -11.748 8.096   1.00 83.31  ? 144 TYR F CE1   1 
ATOM   6093  C CE2   . TYR C  1 144 ? 3.501   -13.860 9.099   1.00 90.38  ? 144 TYR F CE2   1 
ATOM   6094  C CZ    . TYR C  1 144 ? 3.244   -12.509 9.224   1.00 93.40  ? 144 TYR F CZ    1 
ATOM   6095  O OH    . TYR C  1 144 ? 3.244   -11.949 10.473  1.00 95.27  ? 144 TYR F OH    1 
ATOM   6096  N N     . PRO C  1 145 ? 6.634   -14.120 6.591   1.00 84.40  ? 145 PRO F N     1 
ATOM   6097  C CA    . PRO C  1 145 ? 6.720   -12.649 6.797   1.00 81.16  ? 145 PRO F CA    1 
ATOM   6098  C C     . PRO C  1 145 ? 7.441   -11.868 5.694   1.00 83.45  ? 145 PRO F C     1 
ATOM   6099  O O     . PRO C  1 145 ? 7.941   -12.467 4.762   1.00 82.38  ? 145 PRO F O     1 
ATOM   6100  C CB    . PRO C  1 145 ? 7.444   -12.542 8.144   1.00 84.25  ? 145 PRO F CB    1 
ATOM   6101  C CG    . PRO C  1 145 ? 8.342   -13.733 8.161   1.00 91.07  ? 145 PRO F CG    1 
ATOM   6102  C CD    . PRO C  1 145 ? 7.564   -14.834 7.489   1.00 87.99  ? 145 PRO F CD    1 
ATOM   6103  N N     . ARG C  1 146 ? 7.503   -10.520 5.820   1.00 80.29  ? 146 ARG F N     1 
ATOM   6104  C CA    . ARG C  1 146 ? 8.107   -9.620  4.816   1.00 78.50  ? 146 ARG F CA    1 
ATOM   6105  C C     . ARG C  1 146 ? 9.616   -9.819  4.575   1.00 85.62  ? 146 ARG F C     1 
ATOM   6106  O O     . ARG C  1 146 ? 10.116  -9.460  3.499   1.00 84.57  ? 146 ARG F O     1 
ATOM   6107  C CB    . ARG C  1 146 ? 7.851   -8.147  5.181   1.00 76.77  ? 146 ARG F CB    1 
ATOM   6108  C CG    . ARG C  1 146 ? 7.950   -7.185  3.984   1.00 82.27  ? 146 ARG F CG    1 
ATOM   6109  C CD    . ARG C  1 146 ? 7.552   -5.757  4.336   1.00 86.62  ? 146 ARG F CD    1 
ATOM   6110  N NE    . ARG C  1 146 ? 8.591   -4.798  3.935   1.00 94.96  ? 146 ARG F NE    1 
ATOM   6111  C CZ    . ARG C  1 146 ? 8.413   -3.673  3.237   1.00 111.70 ? 146 ARG F CZ    1 
ATOM   6112  N NH1   . ARG C  1 146 ? 7.196   -3.313  2.825   1.00 102.64 ? 146 ARG F NH1   1 
ATOM   6113  N NH2   . ARG C  1 146 ? 9.450   -2.897  2.945   1.00 94.27  ? 146 ARG F NH2   1 
ATOM   6114  N N     . GLU C  1 147 ? 10.334  -10.381 5.560   1.00 85.02  ? 147 GLU F N     1 
ATOM   6115  C CA    . GLU C  1 147 ? 11.776  -10.596 5.461   1.00 85.91  ? 147 GLU F CA    1 
ATOM   6116  C C     . GLU C  1 147 ? 12.077  -11.731 4.486   1.00 90.02  ? 147 GLU F C     1 
ATOM   6117  O O     . GLU C  1 147 ? 11.574  -12.843 4.646   1.00 91.25  ? 147 GLU F O     1 
ATOM   6118  C CB    . GLU C  1 147 ? 12.390  -10.896 6.843   1.00 90.25  ? 147 GLU F CB    1 
ATOM   6119  C CG    . GLU C  1 147 ? 12.128  -9.820  7.890   1.00 100.65 ? 147 GLU F CG    1 
ATOM   6120  C CD    . GLU C  1 147 ? 11.074  -10.160 8.930   1.00 122.99 ? 147 GLU F CD    1 
ATOM   6121  O OE1   . GLU C  1 147 ? 11.377  -10.963 9.843   1.00 127.70 ? 147 GLU F OE1   1 
ATOM   6122  O OE2   . GLU C  1 147 ? 9.950   -9.613  8.841   1.00 107.37 ? 147 GLU F OE2   1 
ATOM   6123  N N     . ALA C  1 148 ? 12.874  -11.427 3.460   1.00 85.44  ? 148 ALA F N     1 
ATOM   6124  C CA    . ALA C  1 148 ? 13.279  -12.367 2.410   1.00 86.04  ? 148 ALA F CA    1 
ATOM   6125  C C     . ALA C  1 148 ? 14.512  -11.791 1.724   1.00 88.15  ? 148 ALA F C     1 
ATOM   6126  O O     . ALA C  1 148 ? 14.510  -10.595 1.411   1.00 85.69  ? 148 ALA F O     1 
ATOM   6127  C CB    . ALA C  1 148 ? 12.158  -12.525 1.387   1.00 85.36  ? 148 ALA F CB    1 
ATOM   6128  N N     . LYS C  1 149 ? 15.557  -12.605 1.493   1.00 85.68  ? 149 LYS F N     1 
ATOM   6129  C CA    . LYS C  1 149 ? 16.774  -12.103 0.845   1.00 84.77  ? 149 LYS F CA    1 
ATOM   6130  C C     . LYS C  1 149 ? 16.847  -12.582 -0.597  1.00 87.30  ? 149 LYS F C     1 
ATOM   6131  O O     . LYS C  1 149 ? 16.646  -13.765 -0.864  1.00 88.09  ? 149 LYS F O     1 
ATOM   6132  C CB    . LYS C  1 149 ? 18.036  -12.490 1.639   1.00 89.36  ? 149 LYS F CB    1 
ATOM   6133  N N     . VAL C  1 150 ? 17.097  -11.643 -1.529  1.00 82.49  ? 150 VAL F N     1 
ATOM   6134  C CA    . VAL C  1 150 ? 17.226  -11.916 -2.964  1.00 82.05  ? 150 VAL F CA    1 
ATOM   6135  C C     . VAL C  1 150 ? 18.680  -11.668 -3.348  1.00 86.83  ? 150 VAL F C     1 
ATOM   6136  O O     . VAL C  1 150 ? 19.163  -10.553 -3.154  1.00 85.78  ? 150 VAL F O     1 
ATOM   6137  C CB    . VAL C  1 150 ? 16.279  -11.018 -3.816  1.00 83.25  ? 150 VAL F CB    1 
ATOM   6138  C CG1   . VAL C  1 150 ? 16.170  -11.541 -5.249  1.00 83.69  ? 150 VAL F CG1   1 
ATOM   6139  C CG2   . VAL C  1 150 ? 14.896  -10.920 -3.184  1.00 81.58  ? 150 VAL F CG2   1 
ATOM   6140  N N     . GLN C  1 151 ? 19.377  -12.695 -3.872  1.00 86.09  ? 151 GLN F N     1 
ATOM   6141  C CA    . GLN C  1 151 ? 20.770  -12.591 -4.327  1.00 88.23  ? 151 GLN F CA    1 
ATOM   6142  C C     . GLN C  1 151 ? 20.777  -12.793 -5.833  1.00 91.15  ? 151 GLN F C     1 
ATOM   6143  O O     . GLN C  1 151 ? 20.299  -13.829 -6.289  1.00 91.53  ? 151 GLN F O     1 
ATOM   6144  C CB    . GLN C  1 151 ? 21.668  -13.687 -3.709  1.00 93.58  ? 151 GLN F CB    1 
ATOM   6145  C CG    . GLN C  1 151 ? 21.974  -13.532 -2.218  1.00 117.46 ? 151 GLN F CG    1 
ATOM   6146  C CD    . GLN C  1 151 ? 20.966  -14.190 -1.297  1.00 142.03 ? 151 GLN F CD    1 
ATOM   6147  O OE1   . GLN C  1 151 ? 20.346  -15.215 -1.617  1.00 137.18 ? 151 GLN F OE1   1 
ATOM   6148  N NE2   . GLN C  1 151 ? 20.823  -13.652 -0.092  1.00 137.21 ? 151 GLN F NE2   1 
ATOM   6149  N N     . TRP C  1 152 ? 21.351  -11.851 -6.596  1.00 86.23  ? 152 TRP F N     1 
ATOM   6150  C CA    . TRP C  1 152 ? 21.443  -11.987 -8.052  1.00 86.14  ? 152 TRP F CA    1 
ATOM   6151  C C     . TRP C  1 152 ? 22.810  -12.569 -8.393  1.00 94.24  ? 152 TRP F C     1 
ATOM   6152  O O     . TRP C  1 152 ? 23.820  -12.121 -7.851  1.00 95.02  ? 152 TRP F O     1 
ATOM   6153  C CB    . TRP C  1 152 ? 21.241  -10.638 -8.779  1.00 82.10  ? 152 TRP F CB    1 
ATOM   6154  C CG    . TRP C  1 152 ? 19.811  -10.270 -9.000  1.00 79.48  ? 152 TRP F CG    1 
ATOM   6155  C CD1   . TRP C  1 152 ? 19.091  -9.328  -8.325  1.00 79.95  ? 152 TRP F CD1   1 
ATOM   6156  C CD2   . TRP C  1 152 ? 18.956  -10.768 -10.032 1.00 78.51  ? 152 TRP F CD2   1 
ATOM   6157  N NE1   . TRP C  1 152 ? 17.828  -9.226  -8.858  1.00 77.13  ? 152 TRP F NE1   1 
ATOM   6158  C CE2   . TRP C  1 152 ? 17.716  -10.101 -9.909  1.00 79.68  ? 152 TRP F CE2   1 
ATOM   6159  C CE3   . TRP C  1 152 ? 19.115  -11.711 -11.053 1.00 81.36  ? 152 TRP F CE3   1 
ATOM   6160  C CZ2   . TRP C  1 152 ? 16.661  -10.317 -10.799 1.00 77.88  ? 152 TRP F CZ2   1 
ATOM   6161  C CZ3   . TRP C  1 152 ? 18.050  -11.961 -11.901 1.00 81.91  ? 152 TRP F CZ3   1 
ATOM   6162  C CH2   . TRP C  1 152 ? 16.840  -11.266 -11.770 1.00 79.77  ? 152 TRP F CH2   1 
ATOM   6163  N N     . LYS C  1 153 ? 22.830  -13.565 -9.288  1.00 93.50  ? 153 LYS F N     1 
ATOM   6164  C CA    . LYS C  1 153 ? 24.043  -14.225 -9.755  1.00 97.23  ? 153 LYS F CA    1 
ATOM   6165  C C     . LYS C  1 153 ? 24.083  -14.213 -11.280 1.00 102.95 ? 153 LYS F C     1 
ATOM   6166  O O     . LYS C  1 153 ? 23.089  -14.562 -11.916 1.00 101.55 ? 153 LYS F O     1 
ATOM   6167  C CB    . LYS C  1 153 ? 24.083  -15.680 -9.267  1.00 102.20 ? 153 LYS F CB    1 
ATOM   6168  C CG    . LYS C  1 153 ? 24.818  -15.895 -7.947  1.00 123.23 ? 153 LYS F CG    1 
ATOM   6169  C CD    . LYS C  1 153 ? 23.898  -15.895 -6.738  1.00 132.59 ? 153 LYS F CD    1 
ATOM   6170  C CE    . LYS C  1 153 ? 24.577  -16.518 -5.542  1.00 143.18 ? 153 LYS F CE    1 
ATOM   6171  N NZ    . LYS C  1 153 ? 23.719  -16.493 -4.328  1.00 152.93 ? 153 LYS F NZ    1 
ATOM   6172  N N     . VAL C  1 154 ? 25.235  -13.852 -11.864 1.00 102.65 ? 154 VAL F N     1 
ATOM   6173  C CA    . VAL C  1 154 ? 25.433  -13.855 -13.320 1.00 103.93 ? 154 VAL F CA    1 
ATOM   6174  C C     . VAL C  1 154 ? 26.617  -14.798 -13.573 1.00 111.62 ? 154 VAL F C     1 
ATOM   6175  O O     . VAL C  1 154 ? 27.713  -14.520 -13.084 1.00 112.26 ? 154 VAL F O     1 
ATOM   6176  C CB    . VAL C  1 154 ? 25.669  -12.427 -13.880 1.00 107.01 ? 154 VAL F CB    1 
ATOM   6177  C CG1   . VAL C  1 154 ? 25.810  -12.459 -15.393 1.00 108.24 ? 154 VAL F CG1   1 
ATOM   6178  C CG2   . VAL C  1 154 ? 24.536  -11.484 -13.486 1.00 102.96 ? 154 VAL F CG2   1 
ATOM   6179  N N     . ASP C  1 155 ? 26.387  -15.942 -14.262 1.00 110.64 ? 155 ASP F N     1 
ATOM   6180  C CA    . ASP C  1 155 ? 27.408  -16.993 -14.490 1.00 114.93 ? 155 ASP F CA    1 
ATOM   6181  C C     . ASP C  1 155 ? 28.021  -17.457 -13.136 1.00 121.80 ? 155 ASP F C     1 
ATOM   6182  O O     . ASP C  1 155 ? 29.232  -17.653 -13.040 1.00 124.99 ? 155 ASP F O     1 
ATOM   6183  C CB    . ASP C  1 155 ? 28.508  -16.529 -15.486 1.00 118.84 ? 155 ASP F CB    1 
ATOM   6184  C CG    . ASP C  1 155 ? 28.064  -16.360 -16.927 1.00 124.21 ? 155 ASP F CG    1 
ATOM   6185  O OD1   . ASP C  1 155 ? 27.269  -17.197 -17.408 1.00 123.69 ? 155 ASP F OD1   1 
ATOM   6186  O OD2   . ASP C  1 155 ? 28.592  -15.454 -17.605 1.00 129.40 ? 155 ASP F OD2   1 
ATOM   6187  N N     . ASN C  1 156 ? 27.163  -17.586 -12.087 1.00 117.00 ? 156 ASN F N     1 
ATOM   6188  C CA    . ASN C  1 156 ? 27.513  -17.957 -10.701 1.00 118.38 ? 156 ASN F CA    1 
ATOM   6189  C C     . ASN C  1 156 ? 28.298  -16.856 -9.933  1.00 122.26 ? 156 ASN F C     1 
ATOM   6190  O O     . ASN C  1 156 ? 28.703  -17.101 -8.791  1.00 122.82 ? 156 ASN F O     1 
ATOM   6191  C CB    . ASN C  1 156 ? 28.244  -19.316 -10.619 1.00 126.15 ? 156 ASN F CB    1 
ATOM   6192  C CG    . ASN C  1 156 ? 27.371  -20.501 -10.961 1.00 159.43 ? 156 ASN F CG    1 
ATOM   6193  O OD1   . ASN C  1 156 ? 27.199  -20.861 -12.134 1.00 154.52 ? 156 ASN F OD1   1 
ATOM   6194  N ND2   . ASN C  1 156 ? 26.802  -21.144 -9.944  1.00 154.32 ? 156 ASN F ND2   1 
ATOM   6195  N N     . ALA C  1 157 ? 28.444  -15.634 -10.513 1.00 117.49 ? 157 ALA F N     1 
ATOM   6196  C CA    . ALA C  1 157 ? 29.142  -14.508 -9.879  1.00 117.08 ? 157 ALA F CA    1 
ATOM   6197  C C     . ALA C  1 157 ? 28.120  -13.620 -9.198  1.00 115.48 ? 157 ALA F C     1 
ATOM   6198  O O     . ALA C  1 157 ? 27.149  -13.219 -9.832  1.00 111.80 ? 157 ALA F O     1 
ATOM   6199  C CB    . ALA C  1 157 ? 29.907  -13.703 -10.920 1.00 119.21 ? 157 ALA F CB    1 
ATOM   6200  N N     . LEU C  1 158 ? 28.348  -13.291 -7.922  1.00 111.73 ? 158 LEU F N     1 
ATOM   6201  C CA    . LEU C  1 158 ? 27.426  -12.470 -7.148  1.00 107.94 ? 158 LEU F CA    1 
ATOM   6202  C C     . LEU C  1 158 ? 27.432  -11.011 -7.637  1.00 108.98 ? 158 LEU F C     1 
ATOM   6203  O O     . LEU C  1 158 ? 28.487  -10.478 -7.991  1.00 111.07 ? 158 LEU F O     1 
ATOM   6204  C CB    . LEU C  1 158 ? 27.767  -12.535 -5.652  1.00 109.35 ? 158 LEU F CB    1 
ATOM   6205  C CG    . LEU C  1 158 ? 26.659  -12.083 -4.700  1.00 111.87 ? 158 LEU F CG    1 
ATOM   6206  C CD1   . LEU C  1 158 ? 25.602  -13.174 -4.522  1.00 111.44 ? 158 LEU F CD1   1 
ATOM   6207  C CD2   . LEU C  1 158 ? 27.233  -11.694 -3.353  1.00 115.99 ? 158 LEU F CD2   1 
ATOM   6208  N N     . GLN C  1 159 ? 26.238  -10.379 -7.645  1.00 99.65  ? 159 GLN F N     1 
ATOM   6209  C CA    . GLN C  1 159 ? 26.028  -9.007  -8.095  1.00 96.28  ? 159 GLN F CA    1 
ATOM   6210  C C     . GLN C  1 159 ? 25.797  -8.097  -6.904  1.00 97.21  ? 159 GLN F C     1 
ATOM   6211  O O     . GLN C  1 159 ? 25.206  -8.528  -5.911  1.00 96.00  ? 159 GLN F O     1 
ATOM   6212  C CB    . GLN C  1 159 ? 24.817  -8.955  -9.028  1.00 94.33  ? 159 GLN F CB    1 
ATOM   6213  C CG    . GLN C  1 159 ? 24.927  -9.869  -10.232 1.00 97.05  ? 159 GLN F CG    1 
ATOM   6214  C CD    . GLN C  1 159 ? 26.090  -9.486  -11.108 1.00 105.97 ? 159 GLN F CD    1 
ATOM   6215  O OE1   . GLN C  1 159 ? 26.163  -8.355  -11.608 1.00 88.80  ? 159 GLN F OE1   1 
ATOM   6216  N NE2   . GLN C  1 159 ? 27.052  -10.397 -11.275 1.00 108.48 ? 159 GLN F NE2   1 
ATOM   6217  N N     . SER C  1 160 ? 26.258  -6.838  -7.001  1.00 92.73  ? 160 SER F N     1 
ATOM   6218  C CA    . SER C  1 160 ? 26.128  -5.877  -5.911  1.00 91.45  ? 160 SER F CA    1 
ATOM   6219  C C     . SER C  1 160 ? 26.033  -4.420  -6.408  1.00 93.52  ? 160 SER F C     1 
ATOM   6220  O O     . SER C  1 160 ? 26.849  -3.984  -7.219  1.00 95.57  ? 160 SER F O     1 
ATOM   6221  C CB    . SER C  1 160 ? 27.311  -6.031  -4.956  1.00 97.93  ? 160 SER F CB    1 
ATOM   6222  O OG    . SER C  1 160 ? 27.190  -5.191  -3.820  1.00 106.05 ? 160 SER F OG    1 
ATOM   6223  N N     . GLY C  1 161 ? 25.047  -3.689  -5.899  1.00 86.90  ? 161 GLY F N     1 
ATOM   6224  C CA    . GLY C  1 161 ? 24.845  -2.278  -6.220  1.00 86.16  ? 161 GLY F CA    1 
ATOM   6225  C C     . GLY C  1 161 ? 24.301  -1.954  -7.603  1.00 87.79  ? 161 GLY F C     1 
ATOM   6226  O O     . GLY C  1 161 ? 24.343  -0.790  -8.017  1.00 87.53  ? 161 GLY F O     1 
ATOM   6227  N N     . ASN C  1 162 ? 23.764  -2.964  -8.313  1.00 81.74  ? 162 ASN F N     1 
ATOM   6228  C CA    . ASN C  1 162 ? 23.173  -2.810  -9.647  1.00 79.97  ? 162 ASN F CA    1 
ATOM   6229  C C     . ASN C  1 162 ? 21.733  -3.366  -9.643  1.00 80.50  ? 162 ASN F C     1 
ATOM   6230  O O     . ASN C  1 162 ? 21.185  -3.697  -10.694 1.00 79.50  ? 162 ASN F O     1 
ATOM   6231  C CB    . ASN C  1 162 ? 24.057  -3.510  -10.705 1.00 82.05  ? 162 ASN F CB    1 
ATOM   6232  C CG    . ASN C  1 162 ? 24.331  -4.988  -10.467 1.00 94.85  ? 162 ASN F CG    1 
ATOM   6233  O OD1   . ASN C  1 162 ? 23.924  -5.581  -9.456  1.00 80.39  ? 162 ASN F OD1   1 
ATOM   6234  N ND2   . ASN C  1 162 ? 25.032  -5.617  -11.403 1.00 90.02  ? 162 ASN F ND2   1 
ATOM   6235  N N     . SER C  1 163 ? 21.122  -3.431  -8.450  1.00 75.04  ? 163 SER F N     1 
ATOM   6236  C CA    . SER C  1 163 ? 19.789  -3.950  -8.236  1.00 71.58  ? 163 SER F CA    1 
ATOM   6237  C C     . SER C  1 163 ? 18.957  -2.965  -7.407  1.00 72.29  ? 163 SER F C     1 
ATOM   6238  O O     . SER C  1 163 ? 19.508  -2.077  -6.756  1.00 70.42  ? 163 SER F O     1 
ATOM   6239  C CB    . SER C  1 163 ? 19.871  -5.287  -7.507  1.00 75.98  ? 163 SER F CB    1 
ATOM   6240  O OG    . SER C  1 163 ? 18.588  -5.728  -7.098  1.00 89.79  ? 163 SER F OG    1 
ATOM   6241  N N     . GLN C  1 164 ? 17.619  -3.137  -7.461  1.00 67.89  ? 164 GLN F N     1 
ATOM   6242  C CA    . GLN C  1 164 ? 16.632  -2.371  -6.703  1.00 65.51  ? 164 GLN F CA    1 
ATOM   6243  C C     . GLN C  1 164 ? 15.418  -3.263  -6.425  1.00 69.58  ? 164 GLN F C     1 
ATOM   6244  O O     . GLN C  1 164 ? 14.941  -3.957  -7.318  1.00 68.09  ? 164 GLN F O     1 
ATOM   6245  C CB    . GLN C  1 164 ? 16.191  -1.108  -7.455  1.00 65.49  ? 164 GLN F CB    1 
ATOM   6246  C CG    . GLN C  1 164 ? 17.247  -0.022  -7.534  1.00 73.11  ? 164 GLN F CG    1 
ATOM   6247  C CD    . GLN C  1 164 ? 16.680  1.302   -8.009  1.00 86.81  ? 164 GLN F CD    1 
ATOM   6248  O OE1   . GLN C  1 164 ? 16.477  1.516   -9.210  1.00 82.83  ? 164 GLN F OE1   1 
ATOM   6249  N NE2   . GLN C  1 164 ? 16.400  2.225   -7.086  1.00 70.61  ? 164 GLN F NE2   1 
ATOM   6250  N N     . GLU C  1 165 ? 14.939  -3.249  -5.180  1.00 69.00  ? 165 GLU F N     1 
ATOM   6251  C CA    . GLU C  1 165 ? 13.784  -4.023  -4.729  1.00 67.49  ? 165 GLU F CA    1 
ATOM   6252  C C     . GLU C  1 165 ? 12.623  -3.102  -4.408  1.00 66.13  ? 165 GLU F C     1 
ATOM   6253  O O     . GLU C  1 165 ? 12.819  -1.952  -4.003  1.00 65.30  ? 165 GLU F O     1 
ATOM   6254  C CB    . GLU C  1 165 ? 14.107  -4.824  -3.465  1.00 70.11  ? 165 GLU F CB    1 
ATOM   6255  C CG    . GLU C  1 165 ? 14.969  -6.048  -3.701  1.00 86.33  ? 165 GLU F CG    1 
ATOM   6256  C CD    . GLU C  1 165 ? 15.224  -6.871  -2.451  1.00 101.99 ? 165 GLU F CD    1 
ATOM   6257  O OE1   . GLU C  1 165 ? 15.983  -7.861  -2.542  1.00 104.80 ? 165 GLU F OE1   1 
ATOM   6258  O OE2   . GLU C  1 165 ? 14.674  -6.525  -1.380  1.00 84.00  ? 165 GLU F OE2   1 
ATOM   6259  N N     . SER C  1 166 ? 11.418  -3.647  -4.540  1.00 59.23  ? 166 SER F N     1 
ATOM   6260  C CA    . SER C  1 166 ? 10.151  -2.977  -4.227  1.00 55.55  ? 166 SER F CA    1 
ATOM   6261  C C     . SER C  1 166 ? 9.209   -4.044  -3.633  1.00 58.09  ? 166 SER F C     1 
ATOM   6262  O O     . SER C  1 166 ? 9.259   -5.192  -4.062  1.00 56.37  ? 166 SER F O     1 
ATOM   6263  C CB    . SER C  1 166 ? 9.558   -2.343  -5.482  1.00 52.17  ? 166 SER F CB    1 
ATOM   6264  O OG    . SER C  1 166 ? 8.354   -1.679  -5.168  0.60 48.66  ? 166 SER F OG    1 
ATOM   6265  N N     . VAL C  1 167 ? 8.424   -3.683  -2.595  1.00 55.45  ? 167 VAL F N     1 
ATOM   6266  C CA    . VAL C  1 167 ? 7.535   -4.615  -1.890  1.00 55.18  ? 167 VAL F CA    1 
ATOM   6267  C C     . VAL C  1 167 ? 6.135   -4.042  -1.810  1.00 56.84  ? 167 VAL F C     1 
ATOM   6268  O O     . VAL C  1 167 ? 5.972   -2.856  -1.574  1.00 53.55  ? 167 VAL F O     1 
ATOM   6269  C CB    . VAL C  1 167 ? 8.060   -4.937  -0.465  1.00 60.31  ? 167 VAL F CB    1 
ATOM   6270  C CG1   . VAL C  1 167 ? 7.430   -6.226  0.076   1.00 61.86  ? 167 VAL F CG1   1 
ATOM   6271  C CG2   . VAL C  1 167 ? 9.580   -5.053  -0.447  1.00 61.14  ? 167 VAL F CG2   1 
ATOM   6272  N N     . THR C  1 168 ? 5.118   -4.893  -1.979  1.00 56.39  ? 168 THR F N     1 
ATOM   6273  C CA    . THR C  1 168 ? 3.729   -4.478  -1.836  1.00 56.11  ? 168 THR F CA    1 
ATOM   6274  C C     . THR C  1 168 ? 3.370   -4.333  -0.335  1.00 61.59  ? 168 THR F C     1 
ATOM   6275  O O     . THR C  1 168 ? 4.085   -4.804  0.553   1.00 61.86  ? 168 THR F O     1 
ATOM   6276  C CB    . THR C  1 168 ? 2.778   -5.539  -2.421  1.00 62.55  ? 168 THR F CB    1 
ATOM   6277  O OG1   . THR C  1 168 ? 3.046   -6.812  -1.813  1.00 64.11  ? 168 THR F OG1   1 
ATOM   6278  C CG2   . THR C  1 168 ? 2.881   -5.652  -3.893  1.00 60.03  ? 168 THR F CG2   1 
ATOM   6279  N N     . GLU C  1 169 ? 2.218   -3.723  -0.078  1.00 59.00  ? 169 GLU F N     1 
ATOM   6280  C CA    . GLU C  1 169 ? 1.657   -3.649  1.252   1.00 59.90  ? 169 GLU F CA    1 
ATOM   6281  C C     . GLU C  1 169 ? 1.003   -5.006  1.464   1.00 69.15  ? 169 GLU F C     1 
ATOM   6282  O O     . GLU C  1 169 ? 0.731   -5.733  0.494   1.00 69.31  ? 169 GLU F O     1 
ATOM   6283  C CB    . GLU C  1 169 ? 0.608   -2.516  1.378   1.00 60.32  ? 169 GLU F CB    1 
ATOM   6284  C CG    . GLU C  1 169 ? 1.209   -1.134  1.625   1.00 66.35  ? 169 GLU F CG    1 
ATOM   6285  C CD    . GLU C  1 169 ? 1.956   -0.932  2.933   1.00 88.92  ? 169 GLU F CD    1 
ATOM   6286  O OE1   . GLU C  1 169 ? 2.963   -0.191  2.918   1.00 74.16  ? 169 GLU F OE1   1 
ATOM   6287  O OE2   . GLU C  1 169 ? 1.555   -1.520  3.966   1.00 99.84  ? 169 GLU F OE2   1 
ATOM   6288  N N     . GLN C  1 170 ? 0.761   -5.359  2.730   1.00 69.02  ? 170 GLN F N     1 
ATOM   6289  C CA    . GLN C  1 170 ? 0.143   -6.644  3.084   1.00 70.77  ? 170 GLN F CA    1 
ATOM   6290  C C     . GLN C  1 170 ? -1.236  -6.728  2.389   1.00 74.70  ? 170 GLN F C     1 
ATOM   6291  O O     . GLN C  1 170 ? -2.009  -5.775  2.449   1.00 72.74  ? 170 GLN F O     1 
ATOM   6292  C CB    . GLN C  1 170 ? 0.029   -6.739  4.616   1.00 73.52  ? 170 GLN F CB    1 
ATOM   6293  C CG    . GLN C  1 170 ? -0.210  -8.121  5.167   1.00 79.51  ? 170 GLN F CG    1 
ATOM   6294  C CD    . GLN C  1 170 ? 0.142   -8.199  6.637   1.00 89.39  ? 170 GLN F CD    1 
ATOM   6295  O OE1   . GLN C  1 170 ? -0.100  -7.270  7.417   1.00 77.55  ? 170 GLN F OE1   1 
ATOM   6296  N NE2   . GLN C  1 170 ? 0.712   -9.308  7.061   1.00 87.16  ? 170 GLN F NE2   1 
ATOM   6297  N N     . ASP C  1 171 ? -1.488  -7.814  1.649   1.00 73.76  ? 171 ASP F N     1 
ATOM   6298  C CA    . ASP C  1 171 ? -2.733  -8.006  0.892   1.00 75.51  ? 171 ASP F CA    1 
ATOM   6299  C C     . ASP C  1 171 ? -3.978  -8.132  1.796   1.00 83.15  ? 171 ASP F C     1 
ATOM   6300  O O     . ASP C  1 171 ? -4.006  -8.969  2.689   1.00 84.69  ? 171 ASP F O     1 
ATOM   6301  C CB    . ASP C  1 171 ? -2.619  -9.263  0.010   1.00 79.28  ? 171 ASP F CB    1 
ATOM   6302  C CG    . ASP C  1 171 ? -3.720  -9.429  -1.012  1.00 90.48  ? 171 ASP F CG    1 
ATOM   6303  O OD1   . ASP C  1 171 ? -4.805  -9.918  -0.637  1.00 93.84  ? 171 ASP F OD1   1 
ATOM   6304  O OD2   . ASP C  1 171 ? -3.479  -9.113  -2.196  1.00 95.99  ? 171 ASP F OD2   1 
ATOM   6305  N N     . SER C  1 172 ? -5.017  -7.340  1.501   1.00 80.93  ? 172 SER F N     1 
ATOM   6306  C CA    . SER C  1 172 ? -6.293  -7.283  2.228   1.00 83.74  ? 172 SER F CA    1 
ATOM   6307  C C     . SER C  1 172 ? -6.941  -8.650  2.475   1.00 91.84  ? 172 SER F C     1 
ATOM   6308  O O     . SER C  1 172 ? -7.314  -8.955  3.610   1.00 94.07  ? 172 SER F O     1 
ATOM   6309  C CB    . SER C  1 172 ? -7.292  -6.414  1.464   1.00 87.39  ? 172 SER F CB    1 
ATOM   6310  O OG    . SER C  1 172 ? -6.770  -5.119  1.209   1.00 95.76  ? 172 SER F OG    1 
ATOM   6311  N N     . LYS C  1 173 ? -7.077  -9.460  1.415   1.00 88.69  ? 173 LYS F N     1 
ATOM   6312  C CA    . LYS C  1 173 ? -7.704  -10.776 1.520   1.00 92.35  ? 173 LYS F CA    1 
ATOM   6313  C C     . LYS C  1 173 ? -6.856  -11.802 2.303   1.00 97.39  ? 173 LYS F C     1 
ATOM   6314  O O     . LYS C  1 173 ? -7.232  -12.137 3.426   1.00 100.07 ? 173 LYS F O     1 
ATOM   6315  C CB    . LYS C  1 173 ? -8.105  -11.321 0.133   1.00 95.61  ? 173 LYS F CB    1 
ATOM   6316  N N     . ASP C  1 174 ? -5.718  -12.272 1.743   1.00 91.66  ? 174 ASP F N     1 
ATOM   6317  C CA    . ASP C  1 174 ? -4.894  -13.324 2.364   1.00 92.93  ? 174 ASP F CA    1 
ATOM   6318  C C     . ASP C  1 174 ? -3.721  -12.842 3.284   1.00 93.70  ? 174 ASP F C     1 
ATOM   6319  O O     . ASP C  1 174 ? -2.978  -13.705 3.765   1.00 95.17  ? 174 ASP F O     1 
ATOM   6320  C CB    . ASP C  1 174 ? -4.354  -14.287 1.278   1.00 95.36  ? 174 ASP F CB    1 
ATOM   6321  C CG    . ASP C  1 174 ? -3.443  -13.661 0.231   1.00 97.81  ? 174 ASP F CG    1 
ATOM   6322  O OD1   . ASP C  1 174 ? -3.408  -12.426 0.145   1.00 94.00  ? 174 ASP F OD1   1 
ATOM   6323  O OD2   . ASP C  1 174 ? -2.833  -14.416 -0.551  1.00 101.99 ? 174 ASP F OD2   1 
ATOM   6324  N N     . SER C  1 175 ? -3.567  -11.510 3.550   1.00 85.21  ? 175 SER F N     1 
ATOM   6325  C CA    . SER C  1 175 ? -2.519  -10.952 4.441   1.00 82.03  ? 175 SER F CA    1 
ATOM   6326  C C     . SER C  1 175 ? -1.076  -11.330 4.038   1.00 81.62  ? 175 SER F C     1 
ATOM   6327  O O     . SER C  1 175 ? -0.185  -11.434 4.887   1.00 80.15  ? 175 SER F O     1 
ATOM   6328  C CB    . SER C  1 175 ? -2.785  -11.342 5.900   1.00 88.36  ? 175 SER F CB    1 
ATOM   6329  O OG    . SER C  1 175 ? -4.102  -11.022 6.309   1.00 99.96  ? 175 SER F OG    1 
ATOM   6330  N N     . THR C  1 176 ? -0.848  -11.500 2.735   1.00 76.46  ? 176 THR F N     1 
ATOM   6331  C CA    . THR C  1 176 ? 0.447   -11.906 2.188   1.00 74.25  ? 176 THR F CA    1 
ATOM   6332  C C     . THR C  1 176 ? 1.228   -10.738 1.580   1.00 69.31  ? 176 THR F C     1 
ATOM   6333  O O     . THR C  1 176 ? 0.649   -9.688  1.280   1.00 64.21  ? 176 THR F O     1 
ATOM   6334  C CB    . THR C  1 176 ? 0.207   -13.053 1.198   1.00 88.61  ? 176 THR F CB    1 
ATOM   6335  O OG1   . THR C  1 176 ? 1.396   -13.821 1.120   1.00 99.86  ? 176 THR F OG1   1 
ATOM   6336  C CG2   . THR C  1 176 ? -0.222  -12.586 -0.182  1.00 79.36  ? 176 THR F CG2   1 
ATOM   6337  N N     . TYR C  1 177 ? 2.546   -10.939 1.393   1.00 64.89  ? 177 TYR F N     1 
ATOM   6338  C CA    . TYR C  1 177 ? 3.447   -9.954  0.782   1.00 62.54  ? 177 TYR F CA    1 
ATOM   6339  C C     . TYR C  1 177 ? 3.981   -10.482 -0.558  1.00 65.76  ? 177 TYR F C     1 
ATOM   6340  O O     . TYR C  1 177 ? 4.180   -11.676 -0.716  1.00 67.53  ? 177 TYR F O     1 
ATOM   6341  C CB    . TYR C  1 177 ? 4.670   -9.670  1.686   1.00 64.56  ? 177 TYR F CB    1 
ATOM   6342  C CG    . TYR C  1 177 ? 4.373   -8.894  2.948   1.00 65.78  ? 177 TYR F CG    1 
ATOM   6343  C CD1   . TYR C  1 177 ? 4.203   -7.519  2.914   1.00 65.08  ? 177 TYR F CD1   1 
ATOM   6344  C CD2   . TYR C  1 177 ? 4.341   -9.527  4.191   1.00 69.64  ? 177 TYR F CD2   1 
ATOM   6345  C CE1   . TYR C  1 177 ? 3.945   -6.793  4.068   1.00 66.53  ? 177 TYR F CE1   1 
ATOM   6346  C CE2   . TYR C  1 177 ? 4.093   -8.809  5.361   1.00 70.97  ? 177 TYR F CE2   1 
ATOM   6347  C CZ    . TYR C  1 177 ? 3.904   -7.436  5.294   1.00 78.26  ? 177 TYR F CZ    1 
ATOM   6348  O OH    . TYR C  1 177 ? 3.660   -6.689  6.422   1.00 80.93  ? 177 TYR F OH    1 
ATOM   6349  N N     . SER C  1 178 ? 4.237   -9.583  -1.498  1.00 61.46  ? 178 SER F N     1 
ATOM   6350  C CA    . SER C  1 178 ? 4.864   -9.887  -2.786  1.00 60.17  ? 178 SER F CA    1 
ATOM   6351  C C     . SER C  1 178 ? 5.972   -8.871  -2.994  1.00 61.46  ? 178 SER F C     1 
ATOM   6352  O O     . SER C  1 178 ? 5.851   -7.718  -2.568  1.00 57.60  ? 178 SER F O     1 
ATOM   6353  C CB    . SER C  1 178 ? 3.860   -9.871  -3.917  1.00 60.69  ? 178 SER F CB    1 
ATOM   6354  O OG    . SER C  1 178 ? 2.938   -10.936 -3.741  1.00 68.06  ? 178 SER F OG    1 
ATOM   6355  N N     . LEU C  1 179 ? 7.073   -9.316  -3.600  1.00 60.16  ? 179 LEU F N     1 
ATOM   6356  C CA    . LEU C  1 179 ? 8.283   -8.515  -3.792  1.00 58.71  ? 179 LEU F CA    1 
ATOM   6357  C C     . LEU C  1 179 ? 8.800   -8.653  -5.225  1.00 62.46  ? 179 LEU F C     1 
ATOM   6358  O O     . LEU C  1 179 ? 8.723   -9.721  -5.829  1.00 61.37  ? 179 LEU F O     1 
ATOM   6359  C CB    . LEU C  1 179 ? 9.360   -9.007  -2.790  1.00 59.94  ? 179 LEU F CB    1 
ATOM   6360  C CG    . LEU C  1 179 ? 10.695  -8.223  -2.721  1.00 64.39  ? 179 LEU F CG    1 
ATOM   6361  C CD1   . LEU C  1 179 ? 11.244  -8.244  -1.324  1.00 65.40  ? 179 LEU F CD1   1 
ATOM   6362  C CD2   . LEU C  1 179 ? 11.787  -8.784  -3.657  1.00 67.37  ? 179 LEU F CD2   1 
ATOM   6363  N N     . SER C  1 180 ? 9.430   -7.595  -5.706  1.00 60.64  ? 180 SER F N     1 
ATOM   6364  C CA    . SER C  1 180 ? 10.030  -7.540  -7.034  1.00 61.67  ? 180 SER F CA    1 
ATOM   6365  C C     . SER C  1 180 ? 11.477  -7.079  -6.895  1.00 67.46  ? 180 SER F C     1 
ATOM   6366  O O     . SER C  1 180 ? 11.725  -6.144  -6.136  1.00 67.60  ? 180 SER F O     1 
ATOM   6367  C CB    . SER C  1 180 ? 9.268   -6.548  -7.899  1.00 64.51  ? 180 SER F CB    1 
ATOM   6368  O OG    . SER C  1 180 ? 9.379   -6.910  -9.265  1.00 81.39  ? 180 SER F OG    1 
ATOM   6369  N N     . SER C  1 181 ? 12.418  -7.708  -7.621  1.00 64.18  ? 181 SER F N     1 
ATOM   6370  C CA    . SER C  1 181 ? 13.828  -7.309  -7.621  1.00 64.13  ? 181 SER F CA    1 
ATOM   6371  C C     . SER C  1 181 ? 14.243  -7.129  -9.070  1.00 66.60  ? 181 SER F C     1 
ATOM   6372  O O     . SER C  1 181 ? 14.052  -8.046  -9.861  1.00 66.17  ? 181 SER F O     1 
ATOM   6373  C CB    . SER C  1 181 ? 14.705  -8.364  -6.952  1.00 70.77  ? 181 SER F CB    1 
ATOM   6374  O OG    . SER C  1 181 ? 16.061  -7.943  -6.897  1.00 77.64  ? 181 SER F OG    1 
ATOM   6375  N N     . THR C  1 182 ? 14.760  -5.944  -9.430  1.00 62.54  ? 182 THR F N     1 
ATOM   6376  C CA    . THR C  1 182 ? 15.199  -5.686  -10.788 1.00 63.50  ? 182 THR F CA    1 
ATOM   6377  C C     . THR C  1 182 ? 16.713  -5.522  -10.839 1.00 69.31  ? 182 THR F C     1 
ATOM   6378  O O     . THR C  1 182 ? 17.257  -4.646  -10.175 1.00 68.09  ? 182 THR F O     1 
ATOM   6379  C CB    . THR C  1 182 ? 14.486  -4.462  -11.383 1.00 65.46  ? 182 THR F CB    1 
ATOM   6380  O OG1   . THR C  1 182 ? 13.082  -4.620  -11.200 1.00 64.66  ? 182 THR F OG1   1 
ATOM   6381  C CG2   . THR C  1 182 ? 14.785  -4.292  -12.865 1.00 64.46  ? 182 THR F CG2   1 
ATOM   6382  N N     . LEU C  1 183 ? 17.377  -6.342  -11.657 1.00 69.17  ? 183 LEU F N     1 
ATOM   6383  C CA    . LEU C  1 183 ? 18.817  -6.251  -11.900 1.00 71.61  ? 183 LEU F CA    1 
ATOM   6384  C C     . LEU C  1 183 ? 18.929  -5.500  -13.214 1.00 73.72  ? 183 LEU F C     1 
ATOM   6385  O O     . LEU C  1 183 ? 18.417  -5.990  -14.219 1.00 72.17  ? 183 LEU F O     1 
ATOM   6386  C CB    . LEU C  1 183 ? 19.446  -7.651  -12.030 1.00 74.01  ? 183 LEU F CB    1 
ATOM   6387  C CG    . LEU C  1 183 ? 20.927  -7.734  -12.417 1.00 81.66  ? 183 LEU F CG    1 
ATOM   6388  C CD1   . LEU C  1 183 ? 21.812  -7.476  -11.225 1.00 83.02  ? 183 LEU F CD1   1 
ATOM   6389  C CD2   . LEU C  1 183 ? 21.256  -9.101  -12.977 1.00 85.51  ? 183 LEU F CD2   1 
ATOM   6390  N N     . THR C  1 184 ? 19.533  -4.292  -13.198 1.00 70.18  ? 184 THR F N     1 
ATOM   6391  C CA    . THR C  1 184 ? 19.720  -3.496  -14.402 1.00 70.54  ? 184 THR F CA    1 
ATOM   6392  C C     . THR C  1 184 ? 21.161  -3.614  -14.857 1.00 78.93  ? 184 THR F C     1 
ATOM   6393  O O     . THR C  1 184 ? 22.075  -3.525  -14.041 1.00 80.34  ? 184 THR F O     1 
ATOM   6394  C CB    . THR C  1 184 ? 19.304  -2.049  -14.192 1.00 71.94  ? 184 THR F CB    1 
ATOM   6395  O OG1   . THR C  1 184 ? 17.986  -2.025  -13.664 1.00 65.40  ? 184 THR F OG1   1 
ATOM   6396  C CG2   . THR C  1 184 ? 19.315  -1.244  -15.502 1.00 70.89  ? 184 THR F CG2   1 
ATOM   6397  N N     . LEU C  1 185 ? 21.348  -3.870  -16.159 1.00 77.76  ? 185 LEU F N     1 
ATOM   6398  C CA    . LEU C  1 185 ? 22.638  -4.012  -16.825 1.00 80.99  ? 185 LEU F CA    1 
ATOM   6399  C C     . LEU C  1 185 ? 22.564  -3.285  -18.153 1.00 84.92  ? 185 LEU F C     1 
ATOM   6400  O O     . LEU C  1 185 ? 21.476  -3.135  -18.709 1.00 82.34  ? 185 LEU F O     1 
ATOM   6401  C CB    . LEU C  1 185 ? 22.921  -5.501  -17.121 1.00 82.79  ? 185 LEU F CB    1 
ATOM   6402  C CG    . LEU C  1 185 ? 22.998  -6.444  -15.907 1.00 87.55  ? 185 LEU F CG    1 
ATOM   6403  C CD1   . LEU C  1 185 ? 22.478  -7.829  -16.255 1.00 87.52  ? 185 LEU F CD1   1 
ATOM   6404  C CD2   . LEU C  1 185 ? 24.405  -6.507  -15.361 1.00 94.10  ? 185 LEU F CD2   1 
ATOM   6405  N N     . SER C  1 186 ? 23.716  -2.919  -18.716 1.00 84.87  ? 186 SER F N     1 
ATOM   6406  C CA    . SER C  1 186 ? 23.754  -2.328  -20.055 1.00 85.85  ? 186 SER F CA    1 
ATOM   6407  C C     . SER C  1 186 ? 23.609  -3.467  -21.066 1.00 88.03  ? 186 SER F C     1 
ATOM   6408  O O     . SER C  1 186 ? 23.733  -4.636  -20.697 1.00 86.11  ? 186 SER F O     1 
ATOM   6409  C CB    . SER C  1 186 ? 25.078  -1.605  -20.292 1.00 93.68  ? 186 SER F CB    1 
ATOM   6410  O OG    . SER C  1 186 ? 26.183  -2.495  -20.274 1.00 105.76 ? 186 SER F OG    1 
ATOM   6411  N N     . LYS C  1 187 ? 23.377  -3.129  -22.336 1.00 86.20  ? 187 LYS F N     1 
ATOM   6412  C CA    . LYS C  1 187 ? 23.271  -4.124  -23.408 1.00 87.29  ? 187 LYS F CA    1 
ATOM   6413  C C     . LYS C  1 187 ? 24.622  -4.819  -23.597 1.00 94.79  ? 187 LYS F C     1 
ATOM   6414  O O     . LYS C  1 187 ? 24.641  -6.037  -23.781 1.00 93.90  ? 187 LYS F O     1 
ATOM   6415  C CB    . LYS C  1 187 ? 22.795  -3.461  -24.713 1.00 90.22  ? 187 LYS F CB    1 
ATOM   6416  C CG    . LYS C  1 187 ? 22.702  -4.368  -25.938 1.00 93.07  ? 187 LYS F CG    1 
ATOM   6417  C CD    . LYS C  1 187 ? 22.263  -3.542  -27.142 1.00 103.06 ? 187 LYS F CD    1 
ATOM   6418  C CE    . LYS C  1 187 ? 21.923  -4.365  -28.356 1.00 118.27 ? 187 LYS F CE    1 
ATOM   6419  N NZ    . LYS C  1 187 ? 23.125  -4.611  -29.208 1.00 132.33 ? 187 LYS F NZ    1 
ATOM   6420  N N     . ALA C  1 188 ? 25.742  -4.049  -23.510 1.00 95.61  ? 188 ALA F N     1 
ATOM   6421  C CA    . ALA C  1 188 ? 27.118  -4.559  -23.654 1.00 100.24 ? 188 ALA F CA    1 
ATOM   6422  C C     . ALA C  1 188 ? 27.492  -5.525  -22.528 1.00 105.80 ? 188 ALA F C     1 
ATOM   6423  O O     . ALA C  1 188 ? 28.068  -6.581  -22.796 1.00 107.70 ? 188 ALA F O     1 
ATOM   6424  C CB    . ALA C  1 188 ? 28.108  -3.402  -23.675 1.00 103.83 ? 188 ALA F CB    1 
ATOM   6425  N N     . ASP C  1 189 ? 27.172  -5.157  -21.276 1.00 100.88 ? 189 ASP F N     1 
ATOM   6426  C CA    . ASP C  1 189 ? 27.445  -5.981  -20.090 1.00 100.56 ? 189 ASP F CA    1 
ATOM   6427  C C     . ASP C  1 189 ? 26.540  -7.224  -20.101 1.00 101.83 ? 189 ASP F C     1 
ATOM   6428  O O     . ASP C  1 189 ? 26.998  -8.309  -19.741 1.00 102.96 ? 189 ASP F O     1 
ATOM   6429  C CB    . ASP C  1 189 ? 27.227  -5.155  -18.796 1.00 100.58 ? 189 ASP F CB    1 
ATOM   6430  C CG    . ASP C  1 189 ? 27.840  -5.718  -17.521 1.00 116.60 ? 189 ASP F CG    1 
ATOM   6431  O OD1   . ASP C  1 189 ? 28.366  -6.856  -17.560 1.00 120.40 ? 189 ASP F OD1   1 
ATOM   6432  O OD2   . ASP C  1 189 ? 27.818  -5.008  -16.487 1.00 121.08 ? 189 ASP F OD2   1 
ATOM   6433  N N     . TYR C  1 190 ? 25.267  -7.071  -20.536 1.00 94.44  ? 190 TYR F N     1 
ATOM   6434  C CA    . TYR C  1 190 ? 24.315  -8.185  -20.630 1.00 91.70  ? 190 TYR F CA    1 
ATOM   6435  C C     . TYR C  1 190 ? 24.738  -9.185  -21.722 1.00 98.40  ? 190 TYR F C     1 
ATOM   6436  O O     . TYR C  1 190 ? 24.608  -10.389 -21.526 1.00 97.33  ? 190 TYR F O     1 
ATOM   6437  C CB    . TYR C  1 190 ? 22.882  -7.665  -20.890 1.00 88.80  ? 190 TYR F CB    1 
ATOM   6438  C CG    . TYR C  1 190 ? 21.853  -8.767  -21.022 1.00 87.99  ? 190 TYR F CG    1 
ATOM   6439  C CD1   . TYR C  1 190 ? 21.487  -9.540  -19.927 1.00 88.25  ? 190 TYR F CD1   1 
ATOM   6440  C CD2   . TYR C  1 190 ? 21.264  -9.055  -22.248 1.00 89.11  ? 190 TYR F CD2   1 
ATOM   6441  C CE1   . TYR C  1 190 ? 20.576  -10.586 -20.051 1.00 87.62  ? 190 TYR F CE1   1 
ATOM   6442  C CE2   . TYR C  1 190 ? 20.334  -10.085 -22.380 1.00 88.87  ? 190 TYR F CE2   1 
ATOM   6443  C CZ    . TYR C  1 190 ? 20.007  -10.860 -21.283 1.00 92.63  ? 190 TYR F CZ    1 
ATOM   6444  O OH    . TYR C  1 190 ? 19.079  -11.860 -21.413 1.00 90.93  ? 190 TYR F OH    1 
ATOM   6445  N N     . GLU C  1 191 ? 25.246  -8.689  -22.859 1.00 98.95  ? 191 GLU F N     1 
ATOM   6446  C CA    . GLU C  1 191 ? 25.692  -9.555  -23.961 1.00 102.70 ? 191 GLU F CA    1 
ATOM   6447  C C     . GLU C  1 191 ? 27.000  -10.312 -23.628 1.00 111.42 ? 191 GLU F C     1 
ATOM   6448  O O     . GLU C  1 191 ? 27.262  -11.354 -24.233 1.00 112.31 ? 191 GLU F O     1 
ATOM   6449  C CB    . GLU C  1 191 ? 25.850  -8.760  -25.268 1.00 106.17 ? 191 GLU F CB    1 
ATOM   6450  N N     . LYS C  1 192 ? 27.800  -9.804  -22.655 1.00 110.32 ? 192 LYS F N     1 
ATOM   6451  C CA    . LYS C  1 192 ? 29.065  -10.430 -22.241 1.00 114.14 ? 192 LYS F CA    1 
ATOM   6452  C C     . LYS C  1 192 ? 28.845  -11.759 -21.482 1.00 119.29 ? 192 LYS F C     1 
ATOM   6453  O O     . LYS C  1 192 ? 29.626  -12.694 -21.682 1.00 123.22 ? 192 LYS F O     1 
ATOM   6454  C CB    . LYS C  1 192 ? 29.930  -9.448  -21.401 1.00 117.12 ? 192 LYS F CB    1 
ATOM   6455  C CG    . LYS C  1 192 ? 31.434  -9.729  -21.482 1.00 140.95 ? 192 LYS F CG    1 
ATOM   6456  C CD    . LYS C  1 192 ? 32.301  -8.561  -20.999 1.00 151.15 ? 192 LYS F CD    1 
ATOM   6457  C CE    . LYS C  1 192 ? 33.765  -8.779  -21.335 1.00 162.47 ? 192 LYS F CE    1 
ATOM   6458  N NZ    . LYS C  1 192 ? 34.624  -7.658  -20.870 1.00 170.72 ? 192 LYS F NZ    1 
ATOM   6459  N N     . HIS C  1 193 ? 27.782  -11.851 -20.646 1.00 111.82 ? 193 HIS F N     1 
ATOM   6460  C CA    . HIS C  1 193 ? 27.456  -13.052 -19.858 1.00 110.69 ? 193 HIS F CA    1 
ATOM   6461  C C     . HIS C  1 193 ? 26.309  -13.876 -20.481 1.00 111.95 ? 193 HIS F C     1 
ATOM   6462  O O     . HIS C  1 193 ? 25.674  -13.416 -21.431 1.00 110.82 ? 193 HIS F O     1 
ATOM   6463  C CB    . HIS C  1 193 ? 27.117  -12.643 -18.428 1.00 108.68 ? 193 HIS F CB    1 
ATOM   6464  C CG    . HIS C  1 193 ? 28.222  -11.892 -17.758 1.00 113.81 ? 193 HIS F CG    1 
ATOM   6465  N ND1   . HIS C  1 193 ? 29.417  -12.505 -17.434 1.00 119.29 ? 193 HIS F ND1   1 
ATOM   6466  C CD2   . HIS C  1 193 ? 28.280  -10.594 -17.382 1.00 114.29 ? 193 HIS F CD2   1 
ATOM   6467  C CE1   . HIS C  1 193 ? 30.162  -11.570 -16.863 1.00 119.41 ? 193 HIS F CE1   1 
ATOM   6468  N NE2   . HIS C  1 193 ? 29.515  -10.403 -16.805 1.00 116.83 ? 193 HIS F NE2   1 
ATOM   6469  N N     . LYS C  1 194 ? 26.065  -15.101 -19.950 1.00 107.74 ? 194 LYS F N     1 
ATOM   6470  C CA    . LYS C  1 194 ? 25.065  -16.048 -20.479 1.00 106.73 ? 194 LYS F CA    1 
ATOM   6471  C C     . LYS C  1 194 ? 23.977  -16.501 -19.490 1.00 107.72 ? 194 LYS F C     1 
ATOM   6472  O O     . LYS C  1 194 ? 22.807  -16.516 -19.872 1.00 104.59 ? 194 LYS F O     1 
ATOM   6473  C CB    . LYS C  1 194 ? 25.781  -17.288 -21.045 1.00 113.11 ? 194 LYS F CB    1 
ATOM   6474  N N     . VAL C  1 195 ? 24.349  -16.915 -18.255 1.00 105.05 ? 195 VAL F N     1 
ATOM   6475  C CA    . VAL C  1 195 ? 23.401  -17.428 -17.257 1.00 102.98 ? 195 VAL F CA    1 
ATOM   6476  C C     . VAL C  1 195 ? 23.026  -16.343 -16.271 1.00 104.88 ? 195 VAL F C     1 
ATOM   6477  O O     . VAL C  1 195 ? 23.919  -15.733 -15.686 1.00 106.36 ? 195 VAL F O     1 
ATOM   6478  C CB    . VAL C  1 195 ? 23.995  -18.649 -16.501 1.00 109.41 ? 195 VAL F CB    1 
ATOM   6479  C CG1   . VAL C  1 195 ? 23.032  -19.154 -15.424 1.00 107.44 ? 195 VAL F CG1   1 
ATOM   6480  C CG2   . VAL C  1 195 ? 24.364  -19.781 -17.467 1.00 112.85 ? 195 VAL F CG2   1 
ATOM   6481  N N     . TYR C  1 196 ? 21.711  -16.157 -16.030 1.00 97.29  ? 196 TYR F N     1 
ATOM   6482  C CA    . TYR C  1 196 ? 21.180  -15.187 -15.065 1.00 92.87  ? 196 TYR F CA    1 
ATOM   6483  C C     . TYR C  1 196 ? 20.258  -15.911 -14.095 1.00 95.35  ? 196 TYR F C     1 
ATOM   6484  O O     . TYR C  1 196 ? 19.420  -16.692 -14.539 1.00 95.47  ? 196 TYR F O     1 
ATOM   6485  C CB    . TYR C  1 196 ? 20.411  -14.078 -15.798 1.00 90.81  ? 196 TYR F CB    1 
ATOM   6486  C CG    . TYR C  1 196 ? 21.317  -13.270 -16.694 1.00 92.45  ? 196 TYR F CG    1 
ATOM   6487  C CD1   . TYR C  1 196 ? 21.656  -13.723 -17.964 1.00 96.41  ? 196 TYR F CD1   1 
ATOM   6488  C CD2   . TYR C  1 196 ? 21.933  -12.115 -16.231 1.00 92.13  ? 196 TYR F CD2   1 
ATOM   6489  C CE1   . TYR C  1 196 ? 22.561  -13.031 -18.761 1.00 97.49  ? 196 TYR F CE1   1 
ATOM   6490  C CE2   . TYR C  1 196 ? 22.851  -11.422 -17.013 1.00 94.62  ? 196 TYR F CE2   1 
ATOM   6491  C CZ    . TYR C  1 196 ? 23.169  -11.889 -18.275 1.00 102.21 ? 196 TYR F CZ    1 
ATOM   6492  O OH    . TYR C  1 196 ? 24.040  -11.174 -19.056 1.00 103.58 ? 196 TYR F OH    1 
ATOM   6493  N N     . ALA C  1 197 ? 20.413  -15.672 -12.781 1.00 91.06  ? 197 ALA F N     1 
ATOM   6494  C CA    . ALA C  1 197 ? 19.586  -16.325 -11.759 1.00 90.31  ? 197 ALA F CA    1 
ATOM   6495  C C     . ALA C  1 197 ? 19.391  -15.469 -10.516 1.00 90.95  ? 197 ALA F C     1 
ATOM   6496  O O     . ALA C  1 197 ? 20.269  -14.684 -10.169 1.00 89.39  ? 197 ALA F O     1 
ATOM   6497  C CB    . ALA C  1 197 ? 20.227  -17.644 -11.350 1.00 94.61  ? 197 ALA F CB    1 
ATOM   6498  N N     . CYS C  1 198 ? 18.254  -15.659 -9.822  1.00 87.07  ? 198 CYS F N     1 
ATOM   6499  C CA    . CYS C  1 198 ? 17.977  -14.997 -8.546  1.00 85.26  ? 198 CYS F CA    1 
ATOM   6500  C C     . CYS C  1 198 ? 17.692  -16.083 -7.492  1.00 89.83  ? 198 CYS F C     1 
ATOM   6501  O O     . CYS C  1 198 ? 16.741  -16.851 -7.622  1.00 89.27  ? 198 CYS F O     1 
ATOM   6502  C CB    . CYS C  1 198 ? 16.841  -13.974 -8.644  1.00 82.51  ? 198 CYS F CB    1 
ATOM   6503  S SG    . CYS C  1 198 ? 15.247  -14.660 -9.176  1.00 86.13  ? 198 CYS F SG    1 
ATOM   6504  N N     . GLU C  1 199 ? 18.555  -16.171 -6.481  1.00 87.71  ? 199 GLU F N     1 
ATOM   6505  C CA    . GLU C  1 199 ? 18.415  -17.120 -5.383  1.00 88.79  ? 199 GLU F CA    1 
ATOM   6506  C C     . GLU C  1 199 ? 17.548  -16.454 -4.337  1.00 89.44  ? 199 GLU F C     1 
ATOM   6507  O O     . GLU C  1 199 ? 17.772  -15.280 -4.048  1.00 87.06  ? 199 GLU F O     1 
ATOM   6508  C CB    . GLU C  1 199 ? 19.800  -17.450 -4.817  1.00 92.91  ? 199 GLU F CB    1 
ATOM   6509  C CG    . GLU C  1 199 ? 19.830  -18.323 -3.570  1.00 102.63 ? 199 GLU F CG    1 
ATOM   6510  C CD    . GLU C  1 199 ? 21.252  -18.570 -3.119  1.00 117.56 ? 199 GLU F CD    1 
ATOM   6511  O OE1   . GLU C  1 199 ? 22.052  -19.087 -3.932  1.00 97.52  ? 199 GLU F OE1   1 
ATOM   6512  O OE2   . GLU C  1 199 ? 21.588  -18.164 -1.984  1.00 116.19 ? 199 GLU F OE2   1 
ATOM   6513  N N     . VAL C  1 200 ? 16.570  -17.184 -3.766  1.00 86.65  ? 200 VAL F N     1 
ATOM   6514  C CA    . VAL C  1 200 ? 15.644  -16.639 -2.756  1.00 85.28  ? 200 VAL F CA    1 
ATOM   6515  C C     . VAL C  1 200 ? 15.689  -17.428 -1.437  1.00 92.72  ? 200 VAL F C     1 
ATOM   6516  O O     . VAL C  1 200 ? 15.476  -18.642 -1.433  1.00 93.32  ? 200 VAL F O     1 
ATOM   6517  C CB    . VAL C  1 200 ? 14.202  -16.550 -3.333  1.00 87.11  ? 200 VAL F CB    1 
ATOM   6518  C CG1   . VAL C  1 200 ? 13.164  -16.289 -2.229  1.00 86.10  ? 200 VAL F CG1   1 
ATOM   6519  C CG2   . VAL C  1 200 ? 14.128  -15.471 -4.418  1.00 83.51  ? 200 VAL F CG2   1 
ATOM   6520  N N     . THR C  1 201 ? 15.892  -16.704 -0.312  1.00 90.88  ? 201 THR F N     1 
ATOM   6521  C CA    . THR C  1 201 ? 15.924  -17.284 1.035   1.00 93.77  ? 201 THR F CA    1 
ATOM   6522  C C     . THR C  1 201 ? 14.726  -16.718 1.797   1.00 95.14  ? 201 THR F C     1 
ATOM   6523  O O     . THR C  1 201 ? 14.458  -15.516 1.708   1.00 90.92  ? 201 THR F O     1 
ATOM   6524  C CB    . THR C  1 201 ? 17.272  -16.999 1.725   1.00 105.40 ? 201 THR F CB    1 
ATOM   6525  O OG1   . THR C  1 201 ? 17.459  -15.594 1.878   1.00 106.17 ? 201 THR F OG1   1 
ATOM   6526  C CG2   . THR C  1 201 ? 18.428  -17.558 0.959   1.00 105.15 ? 201 THR F CG2   1 
ATOM   6527  N N     . HIS C  1 202 ? 13.989  -17.594 2.507   1.00 93.65  ? 202 HIS F N     1 
ATOM   6528  C CA    . HIS C  1 202 ? 12.789  -17.214 3.262   1.00 92.19  ? 202 HIS F CA    1 
ATOM   6529  C C     . HIS C  1 202 ? 12.446  -18.326 4.296   1.00 100.08 ? 202 HIS F C     1 
ATOM   6530  O O     . HIS C  1 202 ? 12.746  -19.494 4.050   1.00 101.47 ? 202 HIS F O     1 
ATOM   6531  C CB    . HIS C  1 202 ? 11.619  -16.952 2.273   1.00 89.93  ? 202 HIS F CB    1 
ATOM   6532  C CG    . HIS C  1 202 ? 10.326  -16.582 2.925   1.00 92.18  ? 202 HIS F CG    1 
ATOM   6533  N ND1   . HIS C  1 202 ? 10.135  -15.345 3.512   1.00 91.17  ? 202 HIS F ND1   1 
ATOM   6534  C CD2   . HIS C  1 202 ? 9.182   -17.293 3.034   1.00 95.20  ? 202 HIS F CD2   1 
ATOM   6535  C CE1   . HIS C  1 202 ? 8.918   -15.376 4.024   1.00 90.60  ? 202 HIS F CE1   1 
ATOM   6536  N NE2   . HIS C  1 202 ? 8.293   -16.513 3.726   1.00 93.37  ? 202 HIS F NE2   1 
ATOM   6537  N N     . GLN C  1 203 ? 11.825  -17.959 5.442   1.00 97.81  ? 203 GLN F N     1 
ATOM   6538  C CA    . GLN C  1 203 ? 11.455  -18.905 6.520   1.00 101.54 ? 203 GLN F CA    1 
ATOM   6539  C C     . GLN C  1 203 ? 10.669  -20.136 6.039   1.00 107.85 ? 203 GLN F C     1 
ATOM   6540  O O     . GLN C  1 203 ? 10.811  -21.215 6.615   1.00 112.82 ? 203 GLN F O     1 
ATOM   6541  C CB    . GLN C  1 203 ? 10.658  -18.189 7.629   1.00 102.44 ? 203 GLN F CB    1 
ATOM   6542  C CG    . GLN C  1 203 ? 11.522  -17.333 8.554   1.00 116.33 ? 203 GLN F CG    1 
ATOM   6543  C CD    . GLN C  1 203 ? 10.713  -16.367 9.395   1.00 130.10 ? 203 GLN F CD    1 
ATOM   6544  O OE1   . GLN C  1 203 ? 10.962  -15.156 9.403   1.00 117.85 ? 203 GLN F OE1   1 
ATOM   6545  N NE2   . GLN C  1 203 ? 9.764   -16.875 10.174  1.00 126.13 ? 203 GLN F NE2   1 
ATOM   6546  N N     . GLY C  1 204 ? 9.830   -19.945 5.027   1.00 101.22 ? 204 GLY F N     1 
ATOM   6547  C CA    . GLY C  1 204 ? 9.029   -20.995 4.409   1.00 103.13 ? 204 GLY F CA    1 
ATOM   6548  C C     . GLY C  1 204 ? 9.790   -21.956 3.512   1.00 108.91 ? 204 GLY F C     1 
ATOM   6549  O O     . GLY C  1 204 ? 9.247   -23.003 3.152   1.00 111.26 ? 204 GLY F O     1 
ATOM   6550  N N     . LEU C  1 205 ? 11.035  -21.613 3.119   1.00 104.56 ? 205 LEU F N     1 
ATOM   6551  C CA    . LEU C  1 205 ? 11.868  -22.452 2.248   1.00 106.44 ? 205 LEU F CA    1 
ATOM   6552  C C     . LEU C  1 205 ? 12.906  -23.224 3.052   1.00 115.47 ? 205 LEU F C     1 
ATOM   6553  O O     . LEU C  1 205 ? 13.709  -22.604 3.749   1.00 114.85 ? 205 LEU F O     1 
ATOM   6554  C CB    . LEU C  1 205 ? 12.598  -21.580 1.215   1.00 102.71 ? 205 LEU F CB    1 
ATOM   6555  C CG    . LEU C  1 205 ? 11.714  -20.782 0.254   1.00 102.98 ? 205 LEU F CG    1 
ATOM   6556  C CD1   . LEU C  1 205 ? 12.528  -19.775 -0.501  1.00 99.43  ? 205 LEU F CD1   1 
ATOM   6557  C CD2   . LEU C  1 205 ? 10.996  -21.697 -0.715  1.00 106.46 ? 205 LEU F CD2   1 
ATOM   6558  N N     . SER C  1 206 ? 12.923  -24.567 2.920   1.00 116.72 ? 206 SER F N     1 
ATOM   6559  C CA    . SER C  1 206 ? 13.892  -25.438 3.604   1.00 121.13 ? 206 SER F CA    1 
ATOM   6560  C C     . SER C  1 206 ? 15.295  -25.341 2.975   1.00 125.43 ? 206 SER F C     1 
ATOM   6561  O O     . SER C  1 206 ? 16.275  -25.757 3.599   1.00 126.95 ? 206 SER F O     1 
ATOM   6562  C CB    . SER C  1 206 ? 13.433  -26.892 3.554   1.00 129.07 ? 206 SER F CB    1 
ATOM   6563  O OG    . SER C  1 206 ? 14.308  -27.716 4.307   1.00 145.60 ? 206 SER F OG    1 
ATOM   6564  N N     . SER C  1 207 ? 15.371  -24.875 1.712   1.00 119.97 ? 207 SER F N     1 
ATOM   6565  C CA    . SER C  1 207 ? 16.623  -24.695 0.973   1.00 119.37 ? 207 SER F CA    1 
ATOM   6566  C C     . SER C  1 207 ? 16.414  -23.568 -0.061  1.00 118.05 ? 207 SER F C     1 
ATOM   6567  O O     . SER C  1 207 ? 15.320  -23.478 -0.633  1.00 115.53 ? 207 SER F O     1 
ATOM   6568  C CB    . SER C  1 207 ? 17.029  -25.988 0.272   1.00 126.64 ? 207 SER F CB    1 
ATOM   6569  O OG    . SER C  1 207 ? 18.347  -25.897 -0.244  1.00 135.78 ? 207 SER F OG    1 
ATOM   6570  N N     . PRO C  1 208 ? 17.425  -22.703 -0.317  1.00 111.91 ? 208 PRO F N     1 
ATOM   6571  C CA    . PRO C  1 208 ? 17.207  -21.587 -1.255  1.00 106.78 ? 208 PRO F CA    1 
ATOM   6572  C C     . PRO C  1 208 ? 16.709  -21.976 -2.652  1.00 107.76 ? 208 PRO F C     1 
ATOM   6573  O O     . PRO C  1 208 ? 17.314  -22.820 -3.318  1.00 110.19 ? 208 PRO F O     1 
ATOM   6574  C CB    . PRO C  1 208 ? 18.566  -20.882 -1.308  1.00 108.25 ? 208 PRO F CB    1 
ATOM   6575  C CG    . PRO C  1 208 ? 19.278  -21.301 -0.068  1.00 115.97 ? 208 PRO F CG    1 
ATOM   6576  C CD    . PRO C  1 208 ? 18.774  -22.654 0.287   1.00 115.10 ? 208 PRO F CD    1 
ATOM   6577  N N     . VAL C  1 209 ? 15.581  -21.361 -3.073  1.00 98.96  ? 209 VAL F N     1 
ATOM   6578  C CA    . VAL C  1 209 ? 14.966  -21.573 -4.384  1.00 97.22  ? 209 VAL F CA    1 
ATOM   6579  C C     . VAL C  1 209 ? 15.658  -20.607 -5.339  1.00 96.92  ? 209 VAL F C     1 
ATOM   6580  O O     . VAL C  1 209 ? 15.785  -19.427 -5.023  1.00 92.90  ? 209 VAL F O     1 
ATOM   6581  C CB    . VAL C  1 209 ? 13.414  -21.412 -4.342  1.00 99.59  ? 209 VAL F CB    1 
ATOM   6582  C CG1   . VAL C  1 209 ? 12.822  -21.110 -5.726  1.00 97.70  ? 209 VAL F CG1   1 
ATOM   6583  C CG2   . VAL C  1 209 ? 12.768  -22.663 -3.751  1.00 102.98 ? 209 VAL F CG2   1 
ATOM   6584  N N     . THR C  1 210 ? 16.129  -21.122 -6.489  1.00 95.14  ? 210 THR F N     1 
ATOM   6585  C CA    . THR C  1 210 ? 16.879  -20.370 -7.486  1.00 92.89  ? 210 THR F CA    1 
ATOM   6586  C C     . THR C  1 210 ? 16.283  -20.582 -8.868  1.00 95.87  ? 210 THR F C     1 
ATOM   6587  O O     . THR C  1 210 ? 16.477  -21.641 -9.472  1.00 97.75  ? 210 THR F O     1 
ATOM   6588  C CB    . THR C  1 210 ? 18.370  -20.783 -7.431  1.00 102.82 ? 210 THR F CB    1 
ATOM   6589  O OG1   . THR C  1 210 ? 18.883  -20.531 -6.116  1.00 101.31 ? 210 THR F OG1   1 
ATOM   6590  C CG2   . THR C  1 210 ? 19.228  -20.047 -8.455  1.00 100.46 ? 210 THR F CG2   1 
ATOM   6591  N N     . LYS C  1 211 ? 15.564  -19.561 -9.372  1.00 89.31  ? 211 LYS F N     1 
ATOM   6592  C CA    . LYS C  1 211 ? 14.979  -19.582 -10.713 1.00 88.61  ? 211 LYS F CA    1 
ATOM   6593  C C     . LYS C  1 211 ? 15.983  -18.898 -11.640 1.00 91.40  ? 211 LYS F C     1 
ATOM   6594  O O     . LYS C  1 211 ? 16.578  -17.884 -11.259 1.00 89.24  ? 211 LYS F O     1 
ATOM   6595  C CB    . LYS C  1 211 ? 13.598  -18.898 -10.729 1.00 87.62  ? 211 LYS F CB    1 
ATOM   6596  C CG    . LYS C  1 211 ? 12.540  -19.640 -9.897  1.00 96.36  ? 211 LYS F CG    1 
ATOM   6597  C CD    . LYS C  1 211 ? 12.068  -20.962 -10.535 1.00 103.04 ? 211 LYS F CD    1 
ATOM   6598  C CE    . LYS C  1 211 ? 11.253  -21.825 -9.602  1.00 110.03 ? 211 LYS F CE    1 
ATOM   6599  N NZ    . LYS C  1 211 ? 9.903   -21.270 -9.348  1.00 122.10 ? 211 LYS F NZ    1 
ATOM   6600  N N     . SER C  1 212 ? 16.212  -19.494 -12.825 1.00 88.89  ? 212 SER F N     1 
ATOM   6601  C CA    . SER C  1 212 ? 17.223  -19.048 -13.779 1.00 88.61  ? 212 SER F CA    1 
ATOM   6602  C C     . SER C  1 212 ? 16.777  -19.165 -15.246 1.00 91.12  ? 212 SER F C     1 
ATOM   6603  O O     . SER C  1 212 ? 15.759  -19.788 -15.549 1.00 91.36  ? 212 SER F O     1 
ATOM   6604  C CB    . SER C  1 212 ? 18.471  -19.908 -13.580 1.00 97.17  ? 212 SER F CB    1 
ATOM   6605  O OG    . SER C  1 212 ? 19.494  -19.697 -14.542 1.00 109.73 ? 212 SER F OG    1 
ATOM   6606  N N     . PHE C  1 213 ? 17.580  -18.566 -16.150 1.00 86.09  ? 213 PHE F N     1 
ATOM   6607  C CA    . PHE C  1 213 ? 17.420  -18.658 -17.601 1.00 86.32  ? 213 PHE F CA    1 
ATOM   6608  C C     . PHE C  1 213 ? 18.772  -18.392 -18.295 1.00 93.28  ? 213 PHE F C     1 
ATOM   6609  O O     . PHE C  1 213 ? 19.686  -17.826 -17.680 1.00 90.45  ? 213 PHE F O     1 
ATOM   6610  C CB    . PHE C  1 213 ? 16.334  -17.710 -18.131 1.00 84.97  ? 213 PHE F CB    1 
ATOM   6611  C CG    . PHE C  1 213 ? 16.704  -16.249 -18.057 1.00 83.65  ? 213 PHE F CG    1 
ATOM   6612  C CD1   . PHE C  1 213 ? 17.483  -15.662 -19.045 1.00 86.96  ? 213 PHE F CD1   1 
ATOM   6613  C CD2   . PHE C  1 213 ? 16.314  -15.473 -16.980 1.00 82.26  ? 213 PHE F CD2   1 
ATOM   6614  C CE1   . PHE C  1 213 ? 17.871  -14.333 -18.949 1.00 85.50  ? 213 PHE F CE1   1 
ATOM   6615  C CE2   . PHE C  1 213 ? 16.675  -14.135 -16.901 1.00 82.63  ? 213 PHE F CE2   1 
ATOM   6616  C CZ    . PHE C  1 213 ? 17.455  -13.571 -17.885 1.00 81.56  ? 213 PHE F CZ    1 
ATOM   6617  N N     . ASN C  1 214 ? 18.866  -18.768 -19.592 1.00 95.32  ? 214 ASN F N     1 
ATOM   6618  C CA    . ASN C  1 214 ? 20.068  -18.590 -20.404 1.00 98.81  ? 214 ASN F CA    1 
ATOM   6619  C C     . ASN C  1 214 ? 19.754  -17.620 -21.545 1.00 105.00 ? 214 ASN F C     1 
ATOM   6620  O O     . ASN C  1 214 ? 18.834  -17.878 -22.325 1.00 105.42 ? 214 ASN F O     1 
ATOM   6621  C CB    . ASN C  1 214 ? 20.547  -19.943 -20.943 1.00 105.46 ? 214 ASN F CB    1 
ATOM   6622  C CG    . ASN C  1 214 ? 22.014  -19.967 -21.313 1.00 132.35 ? 214 ASN F CG    1 
ATOM   6623  O OD1   . ASN C  1 214 ? 22.884  -19.841 -20.446 1.00 124.57 ? 214 ASN F OD1   1 
ATOM   6624  N ND2   . ASN C  1 214 ? 22.334  -20.164 -22.596 1.00 126.94 ? 214 ASN F ND2   1 
ATOM   6625  N N     . ARG C  1 215 ? 20.516  -16.498 -21.624 1.00 102.46 ? 215 ARG F N     1 
ATOM   6626  C CA    . ARG C  1 215 ? 20.353  -15.398 -22.601 1.00 102.25 ? 215 ARG F CA    1 
ATOM   6627  C C     . ARG C  1 215 ? 19.934  -15.833 -24.000 1.00 110.79 ? 215 ARG F C     1 
ATOM   6628  O O     . ARG C  1 215 ? 18.895  -15.390 -24.492 1.00 109.16 ? 215 ARG F O     1 
ATOM   6629  C CB    . ARG C  1 215 ? 21.646  -14.563 -22.687 1.00 102.45 ? 215 ARG F CB    1 
ATOM   6630  C CG    . ARG C  1 215 ? 21.549  -13.331 -23.586 1.00 111.01 ? 215 ARG F CG    1 
ATOM   6631  C CD    . ARG C  1 215 ? 22.703  -12.382 -23.337 1.00 126.01 ? 215 ARG F CD    1 
ATOM   6632  N NE    . ARG C  1 215 ? 23.965  -12.906 -23.865 1.00 143.52 ? 215 ARG F NE    1 
ATOM   6633  C CZ    . ARG C  1 215 ? 24.357  -12.833 -25.136 1.00 162.20 ? 215 ARG F CZ    1 
ATOM   6634  N NH1   . ARG C  1 215 ? 23.586  -12.247 -26.049 1.00 149.04 ? 215 ARG F NH1   1 
ATOM   6635  N NH2   . ARG C  1 215 ? 25.528  -13.338 -25.504 1.00 154.29 ? 215 ARG F NH2   1 
ATOM   6636  N N     . GLY C  1 216 ? 20.752  -16.667 -24.629 1.00 112.78 ? 216 GLY F N     1 
ATOM   6637  C CA    . GLY C  1 216 ? 20.490  -17.154 -25.977 1.00 116.38 ? 216 GLY F CA    1 
ATOM   6638  C C     . GLY C  1 216 ? 19.307  -18.097 -26.052 1.00 122.62 ? 216 GLY F C     1 
ATOM   6639  O O     . GLY C  1 216 ? 18.532  -18.033 -27.010 1.00 122.97 ? 216 GLY F O     1 
ATOM   6640  N N     . GLU C  1 217 ? 19.148  -18.968 -25.033 1.00 120.32 ? 217 GLU F N     1 
ATOM   6641  C CA    . GLU C  1 217 ? 18.053  -19.945 -24.998 1.00 121.29 ? 217 GLU F CA    1 
ATOM   6642  C C     . GLU C  1 217 ? 16.763  -19.308 -24.479 1.00 121.70 ? 217 GLU F C     1 
ATOM   6643  O O     . GLU C  1 217 ? 16.465  -19.385 -23.289 1.00 120.07 ? 217 GLU F O     1 
ATOM   6644  C CB    . GLU C  1 217 ? 18.440  -21.201 -24.181 1.00 124.73 ? 217 GLU F CB    1 
ATOM   6645  N N     . CYS C  1 218 ? 16.005  -18.677 -25.391 1.00 116.97 ? 218 CYS F N     1 
ATOM   6646  C CA    . CYS C  1 218 ? 14.708  -18.034 -25.123 1.00 121.89 ? 218 CYS F CA    1 
ATOM   6647  C C     . CYS C  1 218 ? 13.871  -18.006 -26.433 1.00 144.26 ? 218 CYS F C     1 
ATOM   6648  O O     . CYS C  1 218 ? 13.867  -18.967 -27.222 1.00 100.41 ? 218 CYS F O     1 
ATOM   6649  C CB    . CYS C  1 218 ? 14.897  -16.626 -24.548 1.00 118.18 ? 218 CYS F CB    1 
ATOM   6650  S SG    . CYS C  1 218 ? 14.931  -16.514 -22.723 1.00 118.69 ? 218 CYS F SG    1 
ATOM   6651  N N     . GLN D  2 1   ? -18.725 20.720  9.318   1.00 68.20  ? 1   GLN G N     1 
ATOM   6652  C CA    . GLN D  2 1   ? -17.607 19.842  9.669   1.00 66.10  ? 1   GLN G CA    1 
ATOM   6653  C C     . GLN D  2 1   ? -16.243 20.489  9.418   1.00 65.20  ? 1   GLN G C     1 
ATOM   6654  O O     . GLN D  2 1   ? -16.073 21.211  8.433   1.00 63.23  ? 1   GLN G O     1 
ATOM   6655  C CB    . GLN D  2 1   ? -17.726 18.493  8.935   1.00 67.45  ? 1   GLN G CB    1 
ATOM   6656  C CG    . GLN D  2 1   ? -17.570 18.522  7.399   1.00 92.48  ? 1   GLN G CG    1 
ATOM   6657  C CD    . GLN D  2 1   ? -18.757 19.095  6.654   1.00 119.47 ? 1   GLN G CD    1 
ATOM   6658  O OE1   . GLN D  2 1   ? -19.816 19.371  7.224   1.00 118.95 ? 1   GLN G OE1   1 
ATOM   6659  N NE2   . GLN D  2 1   ? -18.629 19.235  5.342   1.00 112.76 ? 1   GLN G NE2   1 
ATOM   6660  N N     . VAL D  2 2   ? -15.256 20.185  10.285  1.00 59.58  ? 2   VAL G N     1 
ATOM   6661  C CA    . VAL D  2 2   ? -13.909 20.739  10.145  1.00 56.47  ? 2   VAL G CA    1 
ATOM   6662  C C     . VAL D  2 2   ? -13.269 20.111  8.903   1.00 59.86  ? 2   VAL G C     1 
ATOM   6663  O O     . VAL D  2 2   ? -13.341 18.896  8.726   1.00 60.20  ? 2   VAL G O     1 
ATOM   6664  C CB    . VAL D  2 2   ? -13.018 20.560  11.402  1.00 58.88  ? 2   VAL G CB    1 
ATOM   6665  C CG1   . VAL D  2 2   ? -11.634 21.160  11.173  1.00 57.10  ? 2   VAL G CG1   1 
ATOM   6666  C CG2   . VAL D  2 2   ? -13.671 21.172  12.628  1.00 59.81  ? 2   VAL G CG2   1 
ATOM   6667  N N     . GLN D  2 3   ? -12.680 20.950  8.036   1.00 55.90  ? 3   GLN G N     1 
ATOM   6668  C CA    . GLN D  2 3   ? -12.059 20.524  6.774   1.00 54.69  ? 3   GLN G CA    1 
ATOM   6669  C C     . GLN D  2 3   ? -10.881 21.388  6.450   1.00 58.48  ? 3   GLN G C     1 
ATOM   6670  O O     . GLN D  2 3   ? -10.963 22.617  6.605   1.00 59.12  ? 3   GLN G O     1 
ATOM   6671  C CB    . GLN D  2 3   ? -13.045 20.642  5.610   1.00 56.46  ? 3   GLN G CB    1 
ATOM   6672  C CG    . GLN D  2 3   ? -13.769 19.356  5.302   1.00 75.12  ? 3   GLN G CG    1 
ATOM   6673  C CD    . GLN D  2 3   ? -14.989 19.522  4.426   1.00 89.81  ? 3   GLN G CD    1 
ATOM   6674  O OE1   . GLN D  2 3   ? -15.970 18.785  4.587   1.00 82.72  ? 3   GLN G OE1   1 
ATOM   6675  N NE2   . GLN D  2 3   ? -14.956 20.428  3.440   1.00 81.97  ? 3   GLN G NE2   1 
ATOM   6676  N N     . LEU D  2 4   ? -9.803  20.746  5.965   1.00 52.65  ? 4   LEU G N     1 
ATOM   6677  C CA    . LEU D  2 4   ? -8.558  21.378  5.561   1.00 51.18  ? 4   LEU G CA    1 
ATOM   6678  C C     . LEU D  2 4   ? -8.270  20.846  4.163   1.00 51.35  ? 4   LEU G C     1 
ATOM   6679  O O     . LEU D  2 4   ? -7.986  19.650  3.994   1.00 49.17  ? 4   LEU G O     1 
ATOM   6680  C CB    . LEU D  2 4   ? -7.401  21.014  6.525   1.00 50.88  ? 4   LEU G CB    1 
ATOM   6681  C CG    . LEU D  2 4   ? -7.516  21.479  7.967   1.00 54.32  ? 4   LEU G CG    1 
ATOM   6682  C CD1   . LEU D  2 4   ? -6.190  21.290  8.702   1.00 52.67  ? 4   LEU G CD1   1 
ATOM   6683  C CD2   . LEU D  2 4   ? -7.886  22.926  8.064   1.00 59.54  ? 4   LEU G CD2   1 
ATOM   6684  N N     . VAL D  2 5   ? -8.420  21.711  3.147   1.00 46.44  ? 5   VAL G N     1 
ATOM   6685  C CA    . VAL D  2 5   ? -8.238  21.278  1.769   1.00 45.10  ? 5   VAL G CA    1 
ATOM   6686  C C     . VAL D  2 5   ? -6.977  21.919  1.224   1.00 49.82  ? 5   VAL G C     1 
ATOM   6687  O O     . VAL D  2 5   ? -6.837  23.140  1.252   1.00 51.28  ? 5   VAL G O     1 
ATOM   6688  C CB    . VAL D  2 5   ? -9.495  21.540  0.898   1.00 47.50  ? 5   VAL G CB    1 
ATOM   6689  C CG1   . VAL D  2 5   ? -9.266  21.074  -0.539  1.00 46.14  ? 5   VAL G CG1   1 
ATOM   6690  C CG2   . VAL D  2 5   ? -10.705 20.805  1.478   1.00 47.75  ? 5   VAL G CG2   1 
ATOM   6691  N N     . GLN D  2 6   ? -6.035  21.087  0.794   1.00 44.04  ? 6   GLN G N     1 
ATOM   6692  C CA    . GLN D  2 6   ? -4.776  21.557  0.267   1.00 43.05  ? 6   GLN G CA    1 
ATOM   6693  C C     . GLN D  2 6   ? -4.760  21.638  -1.246  1.00 47.51  ? 6   GLN G C     1 
ATOM   6694  O O     . GLN D  2 6   ? -5.488  20.939  -1.908  1.00 47.26  ? 6   GLN G O     1 
ATOM   6695  C CB    . GLN D  2 6   ? -3.633  20.660  0.730   1.00 42.65  ? 6   GLN G CB    1 
ATOM   6696  C CG    . GLN D  2 6   ? -3.445  20.708  2.223   1.00 52.28  ? 6   GLN G CG    1 
ATOM   6697  C CD    . GLN D  2 6   ? -2.252  19.939  2.708   1.00 55.50  ? 6   GLN G CD    1 
ATOM   6698  O OE1   . GLN D  2 6   ? -2.380  19.122  3.603   1.00 51.54  ? 6   GLN G OE1   1 
ATOM   6699  N NE2   . GLN D  2 6   ? -1.056  20.264  2.232   1.00 53.71  ? 6   GLN G NE2   1 
ATOM   6700  N N     . SER D  2 7   ? -3.862  22.461  -1.774  1.00 44.55  ? 7   SER G N     1 
ATOM   6701  C CA    . SER D  2 7   ? -3.623  22.596  -3.198  1.00 43.68  ? 7   SER G CA    1 
ATOM   6702  C C     . SER D  2 7   ? -2.937  21.327  -3.725  1.00 45.71  ? 7   SER G C     1 
ATOM   6703  O O     . SER D  2 7   ? -2.423  20.502  -2.962  1.00 44.43  ? 7   SER G O     1 
ATOM   6704  C CB    . SER D  2 7   ? -2.767  23.838  -3.474  1.00 47.01  ? 7   SER G CB    1 
ATOM   6705  O OG    . SER D  2 7   ? -1.686  23.951  -2.564  1.00 51.68  ? 7   SER G OG    1 
ATOM   6706  N N     . GLY D  2 8   ? -2.936  21.212  -5.036  1.00 43.15  ? 8   GLY G N     1 
ATOM   6707  C CA    . GLY D  2 8   ? -2.465  20.052  -5.774  1.00 43.31  ? 8   GLY G CA    1 
ATOM   6708  C C     . GLY D  2 8   ? -0.977  19.793  -5.897  1.00 50.50  ? 8   GLY G C     1 
ATOM   6709  O O     . GLY D  2 8   ? -0.147  20.552  -5.394  1.00 49.49  ? 8   GLY G O     1 
ATOM   6710  N N     . VAL D  2 9   ? -0.669  18.730  -6.668  1.00 48.81  ? 9   VAL G N     1 
ATOM   6711  C CA    . VAL D  2 9   ? 0.656   18.191  -6.930  1.00 50.88  ? 9   VAL G CA    1 
ATOM   6712  C C     . VAL D  2 9   ? 1.596   19.283  -7.457  1.00 55.61  ? 9   VAL G C     1 
ATOM   6713  O O     . VAL D  2 9   ? 1.185   20.155  -8.219  1.00 56.03  ? 9   VAL G O     1 
ATOM   6714  C CB    . VAL D  2 9   ? 0.657   16.950  -7.889  1.00 57.89  ? 9   VAL G CB    1 
ATOM   6715  C CG1   . VAL D  2 9   ? 2.037   16.310  -7.928  1.00 57.94  ? 9   VAL G CG1   1 
ATOM   6716  C CG2   . VAL D  2 9   ? -0.355  15.885  -7.454  1.00 59.33  ? 9   VAL G CG2   1 
ATOM   6717  N N     . GLU D  2 10  ? 2.859   19.214  -7.035  1.00 53.07  ? 10  GLU G N     1 
ATOM   6718  C CA    . GLU D  2 10  ? 3.907   20.159  -7.397  1.00 53.12  ? 10  GLU G CA    1 
ATOM   6719  C C     . GLU D  2 10  ? 5.140   19.399  -7.832  1.00 54.42  ? 10  GLU G C     1 
ATOM   6720  O O     . GLU D  2 10  ? 5.486   18.386  -7.226  1.00 52.14  ? 10  GLU G O     1 
ATOM   6721  C CB    . GLU D  2 10  ? 4.280   21.031  -6.206  1.00 54.44  ? 10  GLU G CB    1 
ATOM   6722  C CG    . GLU D  2 10  ? 3.198   21.974  -5.719  1.00 59.77  ? 10  GLU G CG    1 
ATOM   6723  C CD    . GLU D  2 10  ? 2.863   23.149  -6.615  1.00 81.41  ? 10  GLU G CD    1 
ATOM   6724  O OE1   . GLU D  2 10  ? 3.499   23.297  -7.684  1.00 63.93  ? 10  GLU G OE1   1 
ATOM   6725  O OE2   . GLU D  2 10  ? 1.958   23.930  -6.237  1.00 81.32  ? 10  GLU G OE2   1 
ATOM   6726  N N     . VAL D  2 11  ? 5.757   19.860  -8.919  1.00 50.06  ? 11  VAL G N     1 
ATOM   6727  C CA    . VAL D  2 11  ? 6.959   19.266  -9.473  1.00 50.48  ? 11  VAL G CA    1 
ATOM   6728  C C     . VAL D  2 11  ? 7.887   20.446  -9.760  1.00 55.23  ? 11  VAL G C     1 
ATOM   6729  O O     . VAL D  2 11  ? 7.552   21.317  -10.560 1.00 55.28  ? 11  VAL G O     1 
ATOM   6730  C CB    . VAL D  2 11  ? 6.643   18.406  -10.730 1.00 53.39  ? 11  VAL G CB    1 
ATOM   6731  C CG1   . VAL D  2 11  ? 7.892   17.698  -11.255 1.00 53.60  ? 11  VAL G CG1   1 
ATOM   6732  C CG2   . VAL D  2 11  ? 5.570   17.376  -10.401 1.00 52.26  ? 11  VAL G CG2   1 
ATOM   6733  N N     . LYS D  2 12  ? 9.012   20.500  -9.067  1.00 51.69  ? 12  LYS G N     1 
ATOM   6734  C CA    . LYS D  2 12  ? 9.961   21.601  -9.188  1.00 51.87  ? 12  LYS G CA    1 
ATOM   6735  C C     . LYS D  2 12  ? 11.386  21.168  -9.469  1.00 56.79  ? 12  LYS G C     1 
ATOM   6736  O O     . LYS D  2 12  ? 11.776  20.035  -9.198  1.00 56.16  ? 12  LYS G O     1 
ATOM   6737  C CB    . LYS D  2 12  ? 9.943   22.424  -7.896  1.00 52.69  ? 12  LYS G CB    1 
ATOM   6738  C CG    . LYS D  2 12  ? 8.583   22.981  -7.529  1.00 48.15  ? 12  LYS G CG    1 
ATOM   6739  C CD    . LYS D  2 12  ? 8.153   24.079  -8.484  1.00 57.13  ? 12  LYS G CD    1 
ATOM   6740  C CE    . LYS D  2 12  ? 6.852   24.680  -8.054  1.00 63.43  ? 12  LYS G CE    1 
ATOM   6741  N NZ    . LYS D  2 12  ? 6.556   25.925  -8.789  1.00 73.59  ? 12  LYS G NZ    1 
ATOM   6742  N N     . LYS D  2 13  ? 12.166  22.104  -10.010 1.00 55.56  ? 13  LYS G N     1 
ATOM   6743  C CA    . LYS D  2 13  ? 13.595  21.920  -10.249 1.00 56.16  ? 13  LYS G CA    1 
ATOM   6744  C C     . LYS D  2 13  ? 14.296  22.332  -8.950  1.00 58.52  ? 13  LYS G C     1 
ATOM   6745  O O     . LYS D  2 13  ? 13.744  23.151  -8.218  1.00 57.68  ? 13  LYS G O     1 
ATOM   6746  C CB    . LYS D  2 13  ? 14.091  22.794  -11.432 1.00 61.02  ? 13  LYS G CB    1 
ATOM   6747  C CG    . LYS D  2 13  ? 14.451  22.001  -12.691 1.00 73.24  ? 13  LYS G CG    1 
ATOM   6748  C CD    . LYS D  2 13  ? 13.297  21.885  -13.686 1.00 86.72  ? 13  LYS G CD    1 
ATOM   6749  C CE    . LYS D  2 13  ? 13.511  20.747  -14.672 1.00 100.91 ? 13  LYS G CE    1 
ATOM   6750  N NZ    . LYS D  2 13  ? 12.517  20.751  -15.783 1.00 104.67 ? 13  LYS G NZ    1 
ATOM   6751  N N     . PRO D  2 14  ? 15.494  21.789  -8.615  1.00 54.51  ? 14  PRO G N     1 
ATOM   6752  C CA    . PRO D  2 14  ? 16.199  22.267  -7.406  1.00 53.80  ? 14  PRO G CA    1 
ATOM   6753  C C     . PRO D  2 14  ? 16.602  23.734  -7.588  1.00 58.03  ? 14  PRO G C     1 
ATOM   6754  O O     . PRO D  2 14  ? 16.870  24.166  -8.715  1.00 59.22  ? 14  PRO G O     1 
ATOM   6755  C CB    . PRO D  2 14  ? 17.404  21.332  -7.303  1.00 55.57  ? 14  PRO G CB    1 
ATOM   6756  C CG    . PRO D  2 14  ? 17.614  20.865  -8.655  1.00 59.95  ? 14  PRO G CG    1 
ATOM   6757  C CD    . PRO D  2 14  ? 16.314  20.821  -9.362  1.00 54.69  ? 14  PRO G CD    1 
ATOM   6758  N N     . GLY D  2 15  ? 16.572  24.489  -6.499  1.00 52.88  ? 15  GLY G N     1 
ATOM   6759  C CA    . GLY D  2 15  ? 16.807  25.929  -6.498  1.00 53.08  ? 15  GLY G CA    1 
ATOM   6760  C C     . GLY D  2 15  ? 15.536  26.740  -6.715  1.00 55.96  ? 15  GLY G C     1 
ATOM   6761  O O     . GLY D  2 15  ? 15.537  27.947  -6.497  1.00 54.83  ? 15  GLY G O     1 
ATOM   6762  N N     . ALA D  2 16  ? 14.427  26.088  -7.129  1.00 52.85  ? 16  ALA G N     1 
ATOM   6763  C CA    . ALA D  2 16  ? 13.146  26.756  -7.346  1.00 51.61  ? 16  ALA G CA    1 
ATOM   6764  C C     . ALA D  2 16  ? 12.422  26.912  -6.022  1.00 51.15  ? 16  ALA G C     1 
ATOM   6765  O O     . ALA D  2 16  ? 12.901  26.484  -4.973  1.00 48.87  ? 16  ALA G O     1 
ATOM   6766  C CB    . ALA D  2 16  ? 12.278  25.931  -8.301  1.00 52.23  ? 16  ALA G CB    1 
ATOM   6767  N N     . SER D  2 17  ? 11.261  27.531  -6.085  1.00 48.70  ? 17  SER G N     1 
ATOM   6768  C CA    . SER D  2 17  ? 10.387  27.764  -4.943  1.00 47.82  ? 17  SER G CA    1 
ATOM   6769  C C     . SER D  2 17  ? 9.046   27.032  -5.123  1.00 51.58  ? 17  SER G C     1 
ATOM   6770  O O     . SER D  2 17  ? 8.645   26.706  -6.246  1.00 50.05  ? 17  SER G O     1 
ATOM   6771  C CB    . SER D  2 17  ? 10.112  29.258  -4.810  1.00 48.61  ? 17  SER G CB    1 
ATOM   6772  O OG    . SER D  2 17  ? 9.936   29.547  -3.435  1.00 69.08  ? 17  SER G OG    1 
ATOM   6773  N N     . VAL D  2 18  ? 8.330   26.836  -4.006  1.00 49.14  ? 18  VAL G N     1 
ATOM   6774  C CA    . VAL D  2 18  ? 6.982   26.232  -4.018  1.00 48.00  ? 18  VAL G CA    1 
ATOM   6775  C C     . VAL D  2 18  ? 6.140   26.881  -2.914  1.00 52.88  ? 18  VAL G C     1 
ATOM   6776  O O     . VAL D  2 18  ? 6.669   27.153  -1.836  1.00 52.04  ? 18  VAL G O     1 
ATOM   6777  C CB    . VAL D  2 18  ? 7.003   24.682  -3.912  1.00 49.01  ? 18  VAL G CB    1 
ATOM   6778  C CG1   . VAL D  2 18  ? 7.450   24.221  -2.532  1.00 47.55  ? 18  VAL G CG1   1 
ATOM   6779  C CG2   . VAL D  2 18  ? 5.659   24.090  -4.259  1.00 48.41  ? 18  VAL G CG2   1 
ATOM   6780  N N     . LYS D  2 19  ? 4.858   27.156  -3.208  1.00 50.99  ? 19  LYS G N     1 
ATOM   6781  C CA    . LYS D  2 19  ? 3.908   27.714  -2.256  1.00 52.17  ? 19  LYS G CA    1 
ATOM   6782  C C     . LYS D  2 19  ? 2.687   26.794  -2.225  1.00 55.48  ? 19  LYS G C     1 
ATOM   6783  O O     . LYS D  2 19  ? 2.043   26.611  -3.246  1.00 53.88  ? 19  LYS G O     1 
ATOM   6784  C CB    . LYS D  2 19  ? 3.518   29.145  -2.633  1.00 55.92  ? 19  LYS G CB    1 
ATOM   6785  C CG    . LYS D  2 19  ? 2.895   29.925  -1.488  1.00 64.34  ? 19  LYS G CG    1 
ATOM   6786  C CD    . LYS D  2 19  ? 2.856   31.381  -1.812  1.00 76.50  ? 19  LYS G CD    1 
ATOM   6787  C CE    . LYS D  2 19  ? 2.018   32.146  -0.819  1.00 92.50  ? 19  LYS G CE    1 
ATOM   6788  N NZ    . LYS D  2 19  ? 2.088   33.614  -1.059  1.00 108.38 ? 19  LYS G NZ    1 
ATOM   6789  N N     . VAL D  2 20  ? 2.433   26.162  -1.070  1.00 52.67  ? 20  VAL G N     1 
ATOM   6790  C CA    . VAL D  2 20  ? 1.327   25.226  -0.866  1.00 52.21  ? 20  VAL G CA    1 
ATOM   6791  C C     . VAL D  2 20  ? 0.256   25.975  -0.091  1.00 55.27  ? 20  VAL G C     1 
ATOM   6792  O O     . VAL D  2 20  ? 0.590   26.680  0.840   1.00 54.78  ? 20  VAL G O     1 
ATOM   6793  C CB    . VAL D  2 20  ? 1.801   23.973  -0.066  1.00 55.36  ? 20  VAL G CB    1 
ATOM   6794  C CG1   . VAL D  2 20  ? 0.642   22.991  0.166   1.00 55.56  ? 20  VAL G CG1   1 
ATOM   6795  C CG2   . VAL D  2 20  ? 2.974   23.279  -0.769  1.00 54.51  ? 20  VAL G CG2   1 
ATOM   6796  N N     . SER D  2 21  ? -1.016  25.809  -0.452  1.00 51.89  ? 21  SER G N     1 
ATOM   6797  C CA    . SER D  2 21  ? -2.135  26.415  0.282   1.00 50.92  ? 21  SER G CA    1 
ATOM   6798  C C     . SER D  2 21  ? -2.932  25.343  1.050   1.00 52.55  ? 21  SER G C     1 
ATOM   6799  O O     . SER D  2 21  ? -2.887  24.166  0.718   1.00 49.59  ? 21  SER G O     1 
ATOM   6800  C CB    . SER D  2 21  ? -3.062  27.173  -0.661  1.00 51.01  ? 21  SER G CB    1 
ATOM   6801  O OG    . SER D  2 21  ? -3.549  26.284  -1.638  1.00 59.08  ? 21  SER G OG    1 
ATOM   6802  N N     . CYS D  2 22  ? -3.616  25.773  2.095   1.00 51.50  ? 22  CYS G N     1 
ATOM   6803  C CA    . CYS D  2 22  ? -4.429  24.929  2.956   1.00 52.25  ? 22  CYS G CA    1 
ATOM   6804  C C     . CYS D  2 22  ? -5.694  25.718  3.307   1.00 54.63  ? 22  CYS G C     1 
ATOM   6805  O O     . CYS D  2 22  ? -5.652  26.577  4.179   1.00 53.02  ? 22  CYS G O     1 
ATOM   6806  C CB    . CYS D  2 22  ? -3.635  24.552  4.202   1.00 53.17  ? 22  CYS G CB    1 
ATOM   6807  S SG    . CYS D  2 22  ? -4.568  23.593  5.421   1.00 57.69  ? 22  CYS G SG    1 
ATOM   6808  N N     . LYS D  2 23  ? -6.787  25.460  2.573   1.00 52.54  ? 23  LYS G N     1 
ATOM   6809  C CA    . LYS D  2 23  ? -8.094  26.105  2.762   1.00 53.05  ? 23  LYS G CA    1 
ATOM   6810  C C     . LYS D  2 23  ? -8.819  25.479  3.959   1.00 56.35  ? 23  LYS G C     1 
ATOM   6811  O O     . LYS D  2 23  ? -9.160  24.311  3.919   1.00 55.70  ? 23  LYS G O     1 
ATOM   6812  C CB    . LYS D  2 23  ? -8.952  25.957  1.487   1.00 54.69  ? 23  LYS G CB    1 
ATOM   6813  C CG    . LYS D  2 23  ? -10.294 26.666  1.564   1.00 70.92  ? 23  LYS G CG    1 
ATOM   6814  C CD    . LYS D  2 23  ? -10.337 27.913  0.730   1.00 79.23  ? 23  LYS G CD    1 
ATOM   6815  C CE    . LYS D  2 23  ? -11.541 28.782  1.025   1.00 83.63  ? 23  LYS G CE    1 
ATOM   6816  N NZ    . LYS D  2 23  ? -11.220 30.221  0.912   1.00 92.41  ? 23  LYS G NZ    1 
ATOM   6817  N N     . ALA D  2 24  ? -9.036  26.250  5.008   1.00 54.56  ? 24  ALA G N     1 
ATOM   6818  C CA    . ALA D  2 24  ? -9.723  25.776  6.203   1.00 56.17  ? 24  ALA G CA    1 
ATOM   6819  C C     . ALA D  2 24  ? -11.194 26.109  6.097   1.00 62.81  ? 24  ALA G C     1 
ATOM   6820  O O     . ALA D  2 24  ? -11.546 27.139  5.527   1.00 63.60  ? 24  ALA G O     1 
ATOM   6821  C CB    . ALA D  2 24  ? -9.150  26.444  7.445   1.00 56.94  ? 24  ALA G CB    1 
ATOM   6822  N N     . SER D  2 25  ? -12.056 25.258  6.653   1.00 59.81  ? 25  SER G N     1 
ATOM   6823  C CA    . SER D  2 25  ? -13.498 25.530  6.683   1.00 60.20  ? 25  SER G CA    1 
ATOM   6824  C C     . SER D  2 25  ? -14.183 24.768  7.823   1.00 65.00  ? 25  SER G C     1 
ATOM   6825  O O     . SER D  2 25  ? -13.645 23.775  8.312   1.00 64.86  ? 25  SER G O     1 
ATOM   6826  C CB    . SER D  2 25  ? -14.135 25.193  5.336   1.00 60.48  ? 25  SER G CB    1 
ATOM   6827  O OG    . SER D  2 25  ? -14.233 23.796  5.141   1.00 65.37  ? 25  SER G OG    1 
ATOM   6828  N N     . GLY D  2 26  ? -15.348 25.257  8.241   1.00 61.47  ? 26  GLY G N     1 
ATOM   6829  C CA    . GLY D  2 26  ? -16.161 24.623  9.272   1.00 61.10  ? 26  GLY G CA    1 
ATOM   6830  C C     . GLY D  2 26  ? -15.750 24.902  10.696  1.00 63.79  ? 26  GLY G C     1 
ATOM   6831  O O     . GLY D  2 26  ? -16.209 24.215  11.610  1.00 64.76  ? 26  GLY G O     1 
ATOM   6832  N N     . TYR D  2 27  ? -14.910 25.901  10.914  1.00 58.94  ? 27  TYR G N     1 
ATOM   6833  C CA    . TYR D  2 27  ? -14.519 26.263  12.266  1.00 58.98  ? 27  TYR G CA    1 
ATOM   6834  C C     . TYR D  2 27  ? -14.050 27.696  12.317  1.00 66.04  ? 27  TYR G C     1 
ATOM   6835  O O     . TYR D  2 27  ? -13.873 28.315  11.269  1.00 66.62  ? 27  TYR G O     1 
ATOM   6836  C CB    . TYR D  2 27  ? -13.451 25.292  12.823  1.00 58.58  ? 27  TYR G CB    1 
ATOM   6837  C CG    . TYR D  2 27  ? -12.074 25.400  12.210  1.00 57.61  ? 27  TYR G CG    1 
ATOM   6838  C CD1   . TYR D  2 27  ? -11.725 24.644  11.098  1.00 59.19  ? 27  TYR G CD1   1 
ATOM   6839  C CD2   . TYR D  2 27  ? -11.082 26.162  12.811  1.00 57.31  ? 27  TYR G CD2   1 
ATOM   6840  C CE1   . TYR D  2 27  ? -10.429 24.653  10.594  1.00 57.81  ? 27  TYR G CE1   1 
ATOM   6841  C CE2   . TYR D  2 27  ? -9.784  26.189  12.309  1.00 56.69  ? 27  TYR G CE2   1 
ATOM   6842  C CZ    . TYR D  2 27  ? -9.461  25.446  11.191  1.00 60.91  ? 27  TYR G CZ    1 
ATOM   6843  O OH    . TYR D  2 27  ? -8.189  25.506  10.663  1.00 59.41  ? 27  TYR G OH    1 
ATOM   6844  N N     . THR D  2 28  ? -13.833 28.212  13.536  1.00 64.33  ? 28  THR G N     1 
ATOM   6845  C CA    . THR D  2 28  ? -13.335 29.565  13.760  1.00 65.37  ? 28  THR G CA    1 
ATOM   6846  C C     . THR D  2 28  ? -11.810 29.558  13.521  1.00 67.65  ? 28  THR G C     1 
ATOM   6847  O O     . THR D  2 28  ? -11.024 29.262  14.423  1.00 67.57  ? 28  THR G O     1 
ATOM   6848  C CB    . THR D  2 28  ? -13.773 30.043  15.158  1.00 80.36  ? 28  THR G CB    1 
ATOM   6849  O OG1   . THR D  2 28  ? -13.329 29.085  16.113  1.00 92.73  ? 28  THR G OG1   1 
ATOM   6850  C CG2   . THR D  2 28  ? -15.279 30.147  15.273  1.00 77.76  ? 28  THR G CG2   1 
ATOM   6851  N N     . PHE D  2 29  ? -11.412 29.870  12.291  1.00 63.05  ? 29  PHE G N     1 
ATOM   6852  C CA    . PHE D  2 29  ? -10.016 29.827  11.824  1.00 61.90  ? 29  PHE G CA    1 
ATOM   6853  C C     . PHE D  2 29  ? -8.966  30.426  12.783  1.00 66.69  ? 29  PHE G C     1 
ATOM   6854  O O     . PHE D  2 29  ? -7.895  29.853  12.983  1.00 64.61  ? 29  PHE G O     1 
ATOM   6855  C CB    . PHE D  2 29  ? -9.931  30.506  10.460  1.00 62.72  ? 29  PHE G CB    1 
ATOM   6856  C CG    . PHE D  2 29  ? -8.587  30.447  9.783   1.00 62.04  ? 29  PHE G CG    1 
ATOM   6857  C CD1   . PHE D  2 29  ? -8.102  29.255  9.282   1.00 63.96  ? 29  PHE G CD1   1 
ATOM   6858  C CD2   . PHE D  2 29  ? -7.871  31.608  9.525   1.00 62.93  ? 29  PHE G CD2   1 
ATOM   6859  C CE1   . PHE D  2 29  ? -6.909  29.216  8.571   1.00 63.77  ? 29  PHE G CE1   1 
ATOM   6860  C CE2   . PHE D  2 29  ? -6.672  31.563  8.830   1.00 64.57  ? 29  PHE G CE2   1 
ATOM   6861  C CZ    . PHE D  2 29  ? -6.187  30.366  8.377   1.00 62.14  ? 29  PHE G CZ    1 
ATOM   6862  N N     . THR D  2 30  ? -9.297  31.555  13.385  1.00 66.00  ? 30  THR G N     1 
ATOM   6863  C CA    . THR D  2 30  ? -8.405  32.286  14.270  1.00 65.56  ? 30  THR G CA    1 
ATOM   6864  C C     . THR D  2 30  ? -8.254  31.681  15.691  1.00 70.62  ? 30  THR G C     1 
ATOM   6865  O O     . THR D  2 30  ? -7.339  32.106  16.408  1.00 69.73  ? 30  THR G O     1 
ATOM   6866  C CB    . THR D  2 30  ? -8.835  33.751  14.307  1.00 72.83  ? 30  THR G CB    1 
ATOM   6867  O OG1   . THR D  2 30  ? -10.266 33.817  14.313  1.00 78.58  ? 30  THR G OG1   1 
ATOM   6868  C CG2   . THR D  2 30  ? -8.298  34.524  13.105  1.00 69.09  ? 30  THR G CG2   1 
ATOM   6869  N N     . ASN D  2 31  ? -9.082  30.689  16.096  1.00 69.26  ? 31  ASN G N     1 
ATOM   6870  C CA    . ASN D  2 31  ? -8.918  30.046  17.423  1.00 70.57  ? 31  ASN G CA    1 
ATOM   6871  C C     . ASN D  2 31  ? -7.951  28.837  17.405  1.00 75.63  ? 31  ASN G C     1 
ATOM   6872  O O     . ASN D  2 31  ? -7.781  28.185  18.442  1.00 77.03  ? 31  ASN G O     1 
ATOM   6873  C CB    . ASN D  2 31  ? -10.265 29.601  18.001  1.00 69.57  ? 31  ASN G CB    1 
ATOM   6874  C CG    . ASN D  2 31  ? -11.312 30.672  18.177  1.00 81.26  ? 31  ASN G CG    1 
ATOM   6875  O OD1   . ASN D  2 31  ? -12.498 30.344  18.256  1.00 75.79  ? 31  ASN G OD1   1 
ATOM   6876  N ND2   . ASN D  2 31  ? -10.942 31.957  18.323  1.00 69.31  ? 31  ASN G ND2   1 
ATOM   6877  N N     . TYR D  2 32  ? -7.317  28.547  16.248  1.00 69.80  ? 32  TYR G N     1 
ATOM   6878  C CA    . TYR D  2 32  ? -6.412  27.422  16.089  1.00 68.18  ? 32  TYR G CA    1 
ATOM   6879  C C     . TYR D  2 32  ? -5.122  27.842  15.397  1.00 71.39  ? 32  TYR G C     1 
ATOM   6880  O O     . TYR D  2 32  ? -5.114  28.723  14.541  1.00 70.96  ? 32  TYR G O     1 
ATOM   6881  C CB    . TYR D  2 32  ? -7.099  26.328  15.256  1.00 68.23  ? 32  TYR G CB    1 
ATOM   6882  C CG    . TYR D  2 32  ? -8.239  25.658  15.993  1.00 69.95  ? 32  TYR G CG    1 
ATOM   6883  C CD1   . TYR D  2 32  ? -9.479  26.277  16.113  1.00 71.84  ? 32  TYR G CD1   1 
ATOM   6884  C CD2   . TYR D  2 32  ? -8.063  24.431  16.620  1.00 71.00  ? 32  TYR G CD2   1 
ATOM   6885  C CE1   . TYR D  2 32  ? -10.512 25.693  16.845  1.00 73.31  ? 32  TYR G CE1   1 
ATOM   6886  C CE2   . TYR D  2 32  ? -9.085  23.837  17.355  1.00 73.13  ? 32  TYR G CE2   1 
ATOM   6887  C CZ    . TYR D  2 32  ? -10.313 24.470  17.465  1.00 80.27  ? 32  TYR G CZ    1 
ATOM   6888  O OH    . TYR D  2 32  ? -11.346 23.880  18.165  1.00 78.54  ? 32  TYR G OH    1 
ATOM   6889  N N     . TYR D  2 33  ? -4.023  27.204  15.776  1.00 67.33  ? 33  TYR G N     1 
ATOM   6890  C CA    . TYR D  2 33  ? -2.747  27.387  15.102  1.00 65.77  ? 33  TYR G CA    1 
ATOM   6891  C C     . TYR D  2 33  ? -2.881  26.566  13.807  1.00 63.37  ? 33  TYR G C     1 
ATOM   6892  O O     . TYR D  2 33  ? -3.708  25.655  13.735  1.00 59.83  ? 33  TYR G O     1 
ATOM   6893  C CB    . TYR D  2 33  ? -1.589  26.753  15.905  1.00 67.97  ? 33  TYR G CB    1 
ATOM   6894  C CG    . TYR D  2 33  ? -1.048  27.542  17.070  1.00 72.53  ? 33  TYR G CG    1 
ATOM   6895  C CD1   . TYR D  2 33  ? -0.102  28.541  16.875  1.00 74.88  ? 33  TYR G CD1   1 
ATOM   6896  C CD2   . TYR D  2 33  ? -1.301  27.146  18.378  1.00 75.05  ? 33  TYR G CD2   1 
ATOM   6897  C CE1   . TYR D  2 33  ? 0.480   29.214  17.951  1.00 77.69  ? 33  TYR G CE1   1 
ATOM   6898  C CE2   . TYR D  2 33  ? -0.743  27.823  19.463  1.00 77.13  ? 33  TYR G CE2   1 
ATOM   6899  C CZ    . TYR D  2 33  ? 0.157   28.853  19.246  1.00 85.12  ? 33  TYR G CZ    1 
ATOM   6900  O OH    . TYR D  2 33  ? 0.721   29.539  20.301  1.00 87.28  ? 33  TYR G OH    1 
ATOM   6901  N N     . MET D  2 34  ? -2.039  26.854  12.823  1.00 58.64  ? 34  MET G N     1 
ATOM   6902  C CA    . MET D  2 34  ? -1.893  26.004  11.655  1.00 56.64  ? 34  MET G CA    1 
ATOM   6903  C C     . MET D  2 34  ? -0.440  25.606  11.595  1.00 58.40  ? 34  MET G C     1 
ATOM   6904  O O     . MET D  2 34  ? 0.446   26.468  11.517  1.00 56.80  ? 34  MET G O     1 
ATOM   6905  C CB    . MET D  2 34  ? -2.300  26.644  10.334  1.00 57.94  ? 34  MET G CB    1 
ATOM   6906  C CG    . MET D  2 34  ? -2.401  25.578  9.234   1.00 60.30  ? 34  MET G CG    1 
ATOM   6907  S SD    . MET D  2 34  ? -3.820  24.463  9.469   1.00 62.26  ? 34  MET G SD    1 
ATOM   6908  C CE    . MET D  2 34  ? -5.109  25.563  8.940   1.00 58.90  ? 34  MET G CE    1 
ATOM   6909  N N     . TYR D  2 35  ? -0.210  24.293  11.650  1.00 55.06  ? 35  TYR G N     1 
ATOM   6910  C CA    . TYR D  2 35  ? 1.096   23.690  11.588  1.00 54.57  ? 35  TYR G CA    1 
ATOM   6911  C C     . TYR D  2 35  ? 1.348   23.051  10.231  1.00 55.77  ? 35  TYR G C     1 
ATOM   6912  O O     . TYR D  2 35  ? 0.409   22.762  9.500   1.00 52.16  ? 35  TYR G O     1 
ATOM   6913  C CB    . TYR D  2 35  ? 1.255   22.656  12.716  1.00 58.86  ? 35  TYR G CB    1 
ATOM   6914  C CG    . TYR D  2 35  ? 1.444   23.268  14.093  1.00 65.02  ? 35  TYR G CG    1 
ATOM   6915  C CD1   . TYR D  2 35  ? 2.470   24.166  14.342  1.00 67.83  ? 35  TYR G CD1   1 
ATOM   6916  C CD2   . TYR D  2 35  ? 0.621   22.920  15.152  1.00 67.87  ? 35  TYR G CD2   1 
ATOM   6917  C CE1   . TYR D  2 35  ? 2.685   24.698  15.612  1.00 69.50  ? 35  TYR G CE1   1 
ATOM   6918  C CE2   . TYR D  2 35  ? 0.814   23.457  16.426  1.00 70.23  ? 35  TYR G CE2   1 
ATOM   6919  C CZ    . TYR D  2 35  ? 1.843   24.356  16.653  1.00 79.70  ? 35  TYR G CZ    1 
ATOM   6920  O OH    . TYR D  2 35  ? 2.055   24.868  17.921  1.00 86.21  ? 35  TYR G OH    1 
ATOM   6921  N N     . TRP D  2 36  ? 2.648   22.877  9.892   1.00 53.47  ? 36  TRP G N     1 
ATOM   6922  C CA    . TRP D  2 36  ? 3.130   22.277  8.657   1.00 52.31  ? 36  TRP G CA    1 
ATOM   6923  C C     . TRP D  2 36  ? 4.042   21.128  9.007   1.00 53.93  ? 36  TRP G C     1 
ATOM   6924  O O     . TRP D  2 36  ? 4.956   21.285  9.813   1.00 53.85  ? 36  TRP G O     1 
ATOM   6925  C CB    . TRP D  2 36  ? 3.816   23.319  7.772   1.00 50.82  ? 36  TRP G CB    1 
ATOM   6926  C CG    . TRP D  2 36  ? 2.821   24.325  7.260   1.00 51.71  ? 36  TRP G CG    1 
ATOM   6927  C CD1   . TRP D  2 36  ? 2.397   25.449  7.910   1.00 54.81  ? 36  TRP G CD1   1 
ATOM   6928  C CD2   . TRP D  2 36  ? 1.909   24.132  6.168   1.00 51.23  ? 36  TRP G CD2   1 
ATOM   6929  N NE1   . TRP D  2 36  ? 1.363   26.040  7.212   1.00 53.69  ? 36  TRP G NE1   1 
ATOM   6930  C CE2   . TRP D  2 36  ? 1.060   25.263  6.127   1.00 54.63  ? 36  TRP G CE2   1 
ATOM   6931  C CE3   . TRP D  2 36  ? 1.809   23.179  5.140   1.00 51.91  ? 36  TRP G CE3   1 
ATOM   6932  C CZ2   . TRP D  2 36  ? 0.162   25.483  5.079   1.00 54.30  ? 36  TRP G CZ2   1 
ATOM   6933  C CZ3   . TRP D  2 36  ? 0.921   23.401  4.105   1.00 52.49  ? 36  TRP G CZ3   1 
ATOM   6934  C CH2   . TRP D  2 36  ? 0.079   24.522  4.102   1.00 53.36  ? 36  TRP G CH2   1 
ATOM   6935  N N     . VAL D  2 37  ? 3.700   19.941  8.501   1.00 50.17  ? 37  VAL G N     1 
ATOM   6936  C CA    . VAL D  2 37  ? 4.411   18.687  8.745   1.00 50.02  ? 37  VAL G CA    1 
ATOM   6937  C C     . VAL D  2 37  ? 4.669   18.043  7.394   1.00 53.91  ? 37  VAL G C     1 
ATOM   6938  O O     . VAL D  2 37  ? 3.775   18.048  6.548   1.00 51.66  ? 37  VAL G O     1 
ATOM   6939  C CB    . VAL D  2 37  ? 3.574   17.736  9.654   1.00 53.55  ? 37  VAL G CB    1 
ATOM   6940  C CG1   . VAL D  2 37  ? 4.277   16.390  9.852   1.00 53.58  ? 37  VAL G CG1   1 
ATOM   6941  C CG2   . VAL D  2 37  ? 3.244   18.388  11.005  1.00 53.31  ? 37  VAL G CG2   1 
ATOM   6942  N N     . ARG D  2 38  ? 5.857   17.464  7.189   1.00 51.31  ? 38  ARG G N     1 
ATOM   6943  C CA    . ARG D  2 38  ? 6.128   16.772  5.927   1.00 51.87  ? 38  ARG G CA    1 
ATOM   6944  C C     . ARG D  2 38  ? 6.565   15.340  6.168   1.00 54.81  ? 38  ARG G C     1 
ATOM   6945  O O     . ARG D  2 38  ? 7.063   14.990  7.239   1.00 55.87  ? 38  ARG G O     1 
ATOM   6946  C CB    . ARG D  2 38  ? 7.138   17.532  5.036   1.00 51.60  ? 38  ARG G CB    1 
ATOM   6947  C CG    . ARG D  2 38  ? 8.572   17.456  5.513   1.00 50.79  ? 38  ARG G CG    1 
ATOM   6948  C CD    . ARG D  2 38  ? 9.491   18.231  4.589   1.00 48.07  ? 38  ARG G CD    1 
ATOM   6949  N NE    . ARG D  2 38  ? 10.890  17.990  4.940   1.00 49.14  ? 38  ARG G NE    1 
ATOM   6950  C CZ    . ARG D  2 38  ? 11.942  18.506  4.314   1.00 56.66  ? 38  ARG G CZ    1 
ATOM   6951  N NH1   . ARG D  2 38  ? 11.776  19.354  3.307   1.00 50.14  ? 38  ARG G NH1   1 
ATOM   6952  N NH2   . ARG D  2 38  ? 13.167  18.206  4.713   1.00 49.71  ? 38  ARG G NH2   1 
ATOM   6953  N N     . GLN D  2 39  ? 6.405   14.542  5.146   1.00 48.77  ? 39  GLN G N     1 
ATOM   6954  C CA    . GLN D  2 39  ? 6.738   13.123  5.147   1.00 48.76  ? 39  GLN G CA    1 
ATOM   6955  C C     . GLN D  2 39  ? 7.397   12.722  3.825   1.00 50.86  ? 39  GLN G C     1 
ATOM   6956  O O     . GLN D  2 39  ? 6.720   12.630  2.790   1.00 49.54  ? 39  GLN G O     1 
ATOM   6957  C CB    . GLN D  2 39  ? 5.460   12.276  5.352   1.00 49.17  ? 39  GLN G CB    1 
ATOM   6958  C CG    . GLN D  2 39  ? 5.785   10.797  5.473   1.00 53.49  ? 39  GLN G CG    1 
ATOM   6959  C CD    . GLN D  2 39  ? 4.657   10.049  6.111   1.00 60.09  ? 39  GLN G CD    1 
ATOM   6960  O OE1   . GLN D  2 39  ? 3.500   10.311  5.837   1.00 61.20  ? 39  GLN G OE1   1 
ATOM   6961  N NE2   . GLN D  2 39  ? 4.952   9.163   7.040   1.00 54.05  ? 39  GLN G NE2   1 
ATOM   6962  N N     . ALA D  2 40  ? 8.698   12.458  3.864   1.00 47.55  ? 40  ALA G N     1 
ATOM   6963  C CA    . ALA D  2 40  ? 9.418   12.015  2.677   1.00 47.55  ? 40  ALA G CA    1 
ATOM   6964  C C     . ALA D  2 40  ? 9.034   10.548  2.402   1.00 52.65  ? 40  ALA G C     1 
ATOM   6965  O O     . ALA D  2 40  ? 8.572   9.858   3.314   1.00 50.58  ? 40  ALA G O     1 
ATOM   6966  C CB    . ALA D  2 40  ? 10.919  12.174  2.860   1.00 48.21  ? 40  ALA G CB    1 
ATOM   6967  N N     . PRO D  2 41  ? 9.105   10.083  1.143   1.00 51.36  ? 41  PRO G N     1 
ATOM   6968  C CA    . PRO D  2 41  ? 8.606   8.730   0.830   1.00 51.64  ? 41  PRO G CA    1 
ATOM   6969  C C     . PRO D  2 41  ? 9.248   7.594   1.621   1.00 57.08  ? 41  PRO G C     1 
ATOM   6970  O O     . PRO D  2 41  ? 10.477  7.523   1.688   1.00 57.26  ? 41  PRO G O     1 
ATOM   6971  C CB    . PRO D  2 41  ? 8.866   8.607   -0.666  1.00 53.06  ? 41  PRO G CB    1 
ATOM   6972  C CG    . PRO D  2 41  ? 8.924   9.997   -1.160  1.00 56.25  ? 41  PRO G CG    1 
ATOM   6973  C CD    . PRO D  2 41  ? 9.545   10.784  -0.077  1.00 52.59  ? 41  PRO G CD    1 
ATOM   6974  N N     . GLY D  2 42  ? 8.407   6.761   2.256   1.00 53.93  ? 42  GLY G N     1 
ATOM   6975  C CA    . GLY D  2 42  ? 8.843   5.661   3.116   1.00 54.31  ? 42  GLY G CA    1 
ATOM   6976  C C     . GLY D  2 42  ? 9.524   6.080   4.409   1.00 61.28  ? 42  GLY G C     1 
ATOM   6977  O O     . GLY D  2 42  ? 10.215  5.260   5.022   1.00 63.71  ? 42  GLY G O     1 
ATOM   6978  N N     . GLN D  2 43  ? 9.359   7.361   4.833   1.00 55.67  ? 43  GLN G N     1 
ATOM   6979  C CA    . GLN D  2 43  ? 9.991   7.926   6.023   1.00 54.47  ? 43  GLN G CA    1 
ATOM   6980  C C     . GLN D  2 43  ? 8.933   8.378   7.044   1.00 55.87  ? 43  GLN G C     1 
ATOM   6981  O O     . GLN D  2 43  ? 7.732   8.255   6.811   1.00 51.91  ? 43  GLN G O     1 
ATOM   6982  C CB    . GLN D  2 43  ? 10.887  9.112   5.611   1.00 55.68  ? 43  GLN G CB    1 
ATOM   6983  C CG    . GLN D  2 43  ? 12.012  8.751   4.658   1.00 75.00  ? 43  GLN G CG    1 
ATOM   6984  C CD    . GLN D  2 43  ? 13.027  7.892   5.341   1.00 97.82  ? 43  GLN G CD    1 
ATOM   6985  O OE1   . GLN D  2 43  ? 13.804  8.377   6.174   1.00 95.92  ? 43  GLN G OE1   1 
ATOM   6986  N NE2   . GLN D  2 43  ? 13.017  6.592   5.047   1.00 87.51  ? 43  GLN G NE2   1 
ATOM   6987  N N     . GLY D  2 44  ? 9.403   8.907   8.167   1.00 55.14  ? 44  GLY G N     1 
ATOM   6988  C CA    . GLY D  2 44  ? 8.543   9.404   9.231   1.00 55.65  ? 44  GLY G CA    1 
ATOM   6989  C C     . GLY D  2 44  ? 8.108   10.842  9.020   1.00 58.36  ? 44  GLY G C     1 
ATOM   6990  O O     . GLY D  2 44  ? 8.386   11.433  7.969   1.00 56.68  ? 44  GLY G O     1 
ATOM   6991  N N     . LEU D  2 45  ? 7.486   11.424  10.071  1.00 53.72  ? 45  LEU G N     1 
ATOM   6992  C CA    . LEU D  2 45  ? 6.944   12.785  10.076  1.00 51.74  ? 45  LEU G CA    1 
ATOM   6993  C C     . LEU D  2 45  ? 7.914   13.810  10.612  1.00 59.21  ? 45  LEU G C     1 
ATOM   6994  O O     . LEU D  2 45  ? 8.499   13.607  11.671  1.00 62.01  ? 45  LEU G O     1 
ATOM   6995  C CB    . LEU D  2 45  ? 5.660   12.810  10.906  1.00 50.74  ? 45  LEU G CB    1 
ATOM   6996  C CG    . LEU D  2 45  ? 4.548   11.843  10.447  1.00 52.78  ? 45  LEU G CG    1 
ATOM   6997  C CD1   . LEU D  2 45  ? 3.403   11.777  11.445  1.00 52.01  ? 45  LEU G CD1   1 
ATOM   6998  C CD2   . LEU D  2 45  ? 4.040   12.207  9.071   1.00 52.22  ? 45  LEU G CD2   1 
ATOM   6999  N N     . GLU D  2 46  ? 8.062   14.937  9.905   1.00 54.94  ? 46  GLU G N     1 
ATOM   7000  C CA    . GLU D  2 46  ? 8.937   16.025  10.320  1.00 54.51  ? 46  GLU G CA    1 
ATOM   7001  C C     . GLU D  2 46  ? 8.120   17.347  10.445  1.00 60.66  ? 46  GLU G C     1 
ATOM   7002  O O     . GLU D  2 46  ? 7.642   17.882  9.451   1.00 59.01  ? 46  GLU G O     1 
ATOM   7003  C CB    . GLU D  2 46  ? 10.101  16.185  9.333   1.00 55.01  ? 46  GLU G CB    1 
ATOM   7004  C CG    . GLU D  2 46  ? 11.127  17.232  9.733   1.00 64.21  ? 46  GLU G CG    1 
ATOM   7005  C CD    . GLU D  2 46  ? 12.350  17.311  8.831   1.00 89.33  ? 46  GLU G CD    1 
ATOM   7006  O OE1   . GLU D  2 46  ? 13.342  17.959  9.241   1.00 84.39  ? 46  GLU G OE1   1 
ATOM   7007  O OE2   . GLU D  2 46  ? 12.310  16.764  7.703   1.00 74.60  ? 46  GLU G OE2   1 
ATOM   7008  N N     . TRP D  2 47  ? 7.990   17.876  11.669  1.00 60.63  ? 47  TRP G N     1 
ATOM   7009  C CA    . TRP D  2 47  ? 7.337   19.160  11.909  1.00 60.89  ? 47  TRP G CA    1 
ATOM   7010  C C     . TRP D  2 47  ? 8.243   20.251  11.373  1.00 62.21  ? 47  TRP G C     1 
ATOM   7011  O O     . TRP D  2 47  ? 9.425   20.278  11.716  1.00 62.40  ? 47  TRP G O     1 
ATOM   7012  C CB    . TRP D  2 47  ? 7.109   19.390  13.404  1.00 61.51  ? 47  TRP G CB    1 
ATOM   7013  C CG    . TRP D  2 47  ? 6.608   20.768  13.731  1.00 63.29  ? 47  TRP G CG    1 
ATOM   7014  C CD1   . TRP D  2 47  ? 5.330   21.210  13.614  1.00 66.29  ? 47  TRP G CD1   1 
ATOM   7015  C CD2   . TRP D  2 47  ? 7.370   21.870  14.260  1.00 63.74  ? 47  TRP G CD2   1 
ATOM   7016  N NE1   . TRP D  2 47  ? 5.232   22.499  14.075  1.00 66.65  ? 47  TRP G NE1   1 
ATOM   7017  C CE2   . TRP D  2 47  ? 6.466   22.930  14.485  1.00 68.04  ? 47  TRP G CE2   1 
ATOM   7018  C CE3   . TRP D  2 47  ? 8.713   22.036  14.647  1.00 65.38  ? 47  TRP G CE3   1 
ATOM   7019  C CZ2   . TRP D  2 47  ? 6.855   24.139  15.090  1.00 67.30  ? 47  TRP G CZ2   1 
ATOM   7020  C CZ3   . TRP D  2 47  ? 9.108   23.250  15.196  1.00 67.23  ? 47  TRP G CZ3   1 
ATOM   7021  C CH2   . TRP D  2 47  ? 8.183   24.287  15.411  1.00 67.76  ? 47  TRP G CH2   1 
ATOM   7022  N N     . MET D  2 48  ? 7.686   21.141  10.542  1.00 57.16  ? 48  MET G N     1 
ATOM   7023  C CA    . MET D  2 48  ? 8.411   22.240  9.901   1.00 56.42  ? 48  MET G CA    1 
ATOM   7024  C C     . MET D  2 48  ? 8.260   23.550  10.654  1.00 61.81  ? 48  MET G C     1 
ATOM   7025  O O     . MET D  2 48  ? 9.240   24.257  10.894  1.00 61.39  ? 48  MET G O     1 
ATOM   7026  C CB    . MET D  2 48  ? 7.894   22.456  8.469   1.00 57.93  ? 48  MET G CB    1 
ATOM   7027  C CG    . MET D  2 48  ? 8.017   21.225  7.582   1.00 61.48  ? 48  MET G CG    1 
ATOM   7028  S SD    . MET D  2 48  ? 7.377   21.513  5.936   1.00 65.61  ? 48  MET G SD    1 
ATOM   7029  C CE    . MET D  2 48  ? 8.456   22.874  5.342   1.00 62.15  ? 48  MET G CE    1 
ATOM   7030  N N     . GLY D  2 49  ? 7.019   23.909  10.925  1.00 59.30  ? 49  GLY G N     1 
ATOM   7031  C CA    . GLY D  2 49  ? 6.704   25.159  11.583  1.00 58.74  ? 49  GLY G CA    1 
ATOM   7032  C C     . GLY D  2 49  ? 5.233   25.320  11.879  1.00 62.12  ? 49  GLY G C     1 
ATOM   7033  O O     . GLY D  2 49  ? 4.440   24.399  11.648  1.00 60.31  ? 49  GLY G O     1 
ATOM   7034  N N     . GLY D  2 50  ? 4.904   26.491  12.411  1.00 59.51  ? 50  GLY G N     1 
ATOM   7035  C CA    . GLY D  2 50  ? 3.561   26.872  12.807  1.00 58.85  ? 50  GLY G CA    1 
ATOM   7036  C C     . GLY D  2 50  ? 3.307   28.345  12.700  1.00 62.58  ? 50  GLY G C     1 
ATOM   7037  O O     . GLY D  2 50  ? 4.246   29.130  12.817  1.00 62.30  ? 50  GLY G O     1 
ATOM   7038  N N     . ILE D  2 51  ? 2.037   28.718  12.468  1.00 59.71  ? 51  ILE G N     1 
ATOM   7039  C CA    . ILE D  2 51  ? 1.589   30.115  12.411  1.00 59.69  ? 51  ILE G CA    1 
ATOM   7040  C C     . ILE D  2 51  ? 0.313   30.290  13.251  1.00 66.00  ? 51  ILE G C     1 
ATOM   7041  O O     . ILE D  2 51  ? -0.529  29.390  13.308  1.00 64.55  ? 51  ILE G O     1 
ATOM   7042  C CB    . ILE D  2 51  ? 1.380   30.642  10.966  1.00 61.42  ? 51  ILE G CB    1 
ATOM   7043  C CG1   . ILE D  2 51  ? 1.117   32.178  10.976  1.00 60.77  ? 51  ILE G CG1   1 
ATOM   7044  C CG2   . ILE D  2 51  ? 0.233   29.903  10.269  1.00 60.71  ? 51  ILE G CG2   1 
ATOM   7045  C CD1   . ILE D  2 51  ? 1.622   32.897  9.787   1.00 60.11  ? 51  ILE G CD1   1 
ATOM   7046  N N     . ASN D  2 52  ? 0.199   31.440  13.916  1.00 65.66  ? 52  ASN G N     1 
ATOM   7047  C CA    . ASN D  2 52  ? -0.969  31.807  14.716  1.00 66.70  ? 52  ASN G CA    1 
ATOM   7048  C C     . ASN D  2 52  ? -1.718  32.764  13.817  1.00 73.06  ? 52  ASN G C     1 
ATOM   7049  O O     . ASN D  2 52  ? -1.209  33.858  13.571  1.00 72.34  ? 52  ASN G O     1 
ATOM   7050  C CB    . ASN D  2 52  ? -0.544  32.485  16.009  1.00 66.88  ? 52  ASN G CB    1 
ATOM   7051  C CG    . ASN D  2 52  ? -1.680  33.048  16.851  1.00 88.14  ? 52  ASN G CG    1 
ATOM   7052  O OD1   . ASN D  2 52  ? -2.850  33.108  16.445  1.00 84.69  ? 52  ASN G OD1   1 
ATOM   7053  N ND2   . ASN D  2 52  ? -1.353  33.485  18.054  1.00 75.27  ? 52  ASN G ND2   1 
ATOM   7054  N N     . PRO D  2 53  ? -2.880  32.378  13.255  1.00 72.67  ? 53  PRO G N     1 
ATOM   7055  C CA    . PRO D  2 53  ? -3.558  33.284  12.319  1.00 73.58  ? 53  PRO G CA    1 
ATOM   7056  C C     . PRO D  2 53  ? -3.990  34.630  12.890  1.00 79.03  ? 53  PRO G C     1 
ATOM   7057  O O     . PRO D  2 53  ? -3.856  35.639  12.195  1.00 78.33  ? 53  PRO G O     1 
ATOM   7058  C CB    . PRO D  2 53  ? -4.759  32.464  11.826  1.00 75.44  ? 53  PRO G CB    1 
ATOM   7059  C CG    . PRO D  2 53  ? -4.463  31.056  12.186  1.00 79.24  ? 53  PRO G CG    1 
ATOM   7060  C CD    . PRO D  2 53  ? -3.630  31.115  13.408  1.00 74.88  ? 53  PRO G CD    1 
ATOM   7061  N N     . SER D  2 54  ? -4.467  34.658  14.151  1.00 77.15  ? 54  SER G N     1 
ATOM   7062  C CA    . SER D  2 54  ? -4.950  35.904  14.769  1.00 77.39  ? 54  SER G CA    1 
ATOM   7063  C C     . SER D  2 54  ? -3.905  37.038  14.807  1.00 81.69  ? 54  SER G C     1 
ATOM   7064  O O     . SER D  2 54  ? -4.304  38.187  14.712  1.00 82.49  ? 54  SER G O     1 
ATOM   7065  C CB    . SER D  2 54  ? -5.535  35.652  16.159  1.00 78.99  ? 54  SER G CB    1 
ATOM   7066  O OG    . SER D  2 54  ? -4.549  35.406  17.143  1.00 88.12  ? 54  SER G OG    1 
ATOM   7067  N N     . ASN D  2 55  ? -2.597  36.732  14.890  1.00 78.35  ? 55  ASN G N     1 
ATOM   7068  C CA    . ASN D  2 55  ? -1.535  37.758  14.929  1.00 77.80  ? 55  ASN G CA    1 
ATOM   7069  C C     . ASN D  2 55  ? -0.330  37.560  13.952  1.00 81.64  ? 55  ASN G C     1 
ATOM   7070  O O     . ASN D  2 55  ? 0.566   38.420  13.926  1.00 82.50  ? 55  ASN G O     1 
ATOM   7071  C CB    . ASN D  2 55  ? -1.014  37.866  16.366  1.00 74.83  ? 55  ASN G CB    1 
ATOM   7072  C CG    . ASN D  2 55  ? -0.236  36.664  16.866  1.00 93.25  ? 55  ASN G CG    1 
ATOM   7073  O OD1   . ASN D  2 55  ? 0.033   35.720  16.135  1.00 91.95  ? 55  ASN G OD1   1 
ATOM   7074  N ND2   . ASN D  2 55  ? 0.177   36.678  18.121  1.00 85.37  ? 55  ASN G ND2   1 
ATOM   7075  N N     . GLY D  2 56  ? -0.278  36.436  13.229  1.00 75.07  ? 56  GLY G N     1 
ATOM   7076  C CA    . GLY D  2 56  ? 0.831   36.123  12.336  1.00 73.81  ? 56  GLY G CA    1 
ATOM   7077  C C     . GLY D  2 56  ? 2.120   35.647  12.987  1.00 77.10  ? 56  GLY G C     1 
ATOM   7078  O O     . GLY D  2 56  ? 3.149   35.580  12.310  1.00 76.72  ? 56  GLY G O     1 
ATOM   7079  N N     . GLY D  2 57  ? 2.064   35.250  14.260  1.00 73.31  ? 57  GLY G N     1 
ATOM   7080  C CA    . GLY D  2 57  ? 3.234   34.794  15.003  1.00 73.35  ? 57  GLY G CA    1 
ATOM   7081  C C     . GLY D  2 57  ? 3.718   33.422  14.579  1.00 78.33  ? 57  GLY G C     1 
ATOM   7082  O O     . GLY D  2 57  ? 2.984   32.437  14.711  1.00 77.91  ? 57  GLY G O     1 
ATOM   7083  N N     . THR D  2 58  ? 4.975   33.333  14.105  1.00 75.76  ? 58  THR G N     1 
ATOM   7084  C CA    . THR D  2 58  ? 5.529   32.072  13.600  1.00 75.28  ? 58  THR G CA    1 
ATOM   7085  C C     . THR D  2 58  ? 6.581   31.390  14.484  1.00 78.76  ? 58  THR G C     1 
ATOM   7086  O O     . THR D  2 58  ? 7.435   32.052  15.068  1.00 78.40  ? 58  THR G O     1 
ATOM   7087  C CB    . THR D  2 58  ? 6.100   32.301  12.204  1.00 79.27  ? 58  THR G CB    1 
ATOM   7088  O OG1   . THR D  2 58  ? 7.037   33.384  12.242  1.00 76.47  ? 58  THR G OG1   1 
ATOM   7089  C CG2   . THR D  2 58  ? 5.007   32.572  11.172  1.00 70.56  ? 58  THR G CG2   1 
ATOM   7090  N N     . ASN D  2 59  ? 6.518   30.044  14.542  1.00 75.17  ? 59  ASN G N     1 
ATOM   7091  C CA    . ASN D  2 59  ? 7.472   29.168  15.250  1.00 74.92  ? 59  ASN G CA    1 
ATOM   7092  C C     . ASN D  2 59  ? 8.031   28.179  14.213  1.00 78.71  ? 59  ASN G C     1 
ATOM   7093  O O     . ASN D  2 59  ? 7.284   27.732  13.336  1.00 76.55  ? 59  ASN G O     1 
ATOM   7094  C CB    . ASN D  2 59  ? 6.775   28.413  16.383  1.00 74.40  ? 59  ASN G CB    1 
ATOM   7095  C CG    . ASN D  2 59  ? 6.437   29.274  17.578  1.00 103.66 ? 59  ASN G CG    1 
ATOM   7096  O OD1   . ASN D  2 59  ? 6.730   30.475  17.621  1.00 106.60 ? 59  ASN G OD1   1 
ATOM   7097  N ND2   . ASN D  2 59  ? 5.804   28.684  18.580  1.00 91.52  ? 59  ASN G ND2   1 
ATOM   7098  N N     . PHE D  2 60  ? 9.336   27.860  14.289  1.00 75.72  ? 60  PHE G N     1 
ATOM   7099  C CA    . PHE D  2 60  ? 9.975   26.973  13.307  1.00 75.22  ? 60  PHE G CA    1 
ATOM   7100  C C     . PHE D  2 60  ? 10.933  25.960  13.870  1.00 81.15  ? 60  PHE G C     1 
ATOM   7101  O O     . PHE D  2 60  ? 11.433  26.076  14.995  1.00 82.21  ? 60  PHE G O     1 
ATOM   7102  C CB    . PHE D  2 60  ? 10.753  27.804  12.278  1.00 76.38  ? 60  PHE G CB    1 
ATOM   7103  C CG    . PHE D  2 60  ? 9.876   28.580  11.340  1.00 77.05  ? 60  PHE G CG    1 
ATOM   7104  C CD1   . PHE D  2 60  ? 9.266   27.958  10.266  1.00 79.01  ? 60  PHE G CD1   1 
ATOM   7105  C CD2   . PHE D  2 60  ? 9.663   29.937  11.525  1.00 79.39  ? 60  PHE G CD2   1 
ATOM   7106  C CE1   . PHE D  2 60  ? 8.461   28.677  9.392   1.00 79.95  ? 60  PHE G CE1   1 
ATOM   7107  C CE2   . PHE D  2 60  ? 8.873   30.662  10.637  1.00 81.92  ? 60  PHE G CE2   1 
ATOM   7108  C CZ    . PHE D  2 60  ? 8.258   30.025  9.586   1.00 79.26  ? 60  PHE G CZ    1 
ATOM   7109  N N     . ASN D  2 61  ? 11.237  24.985  13.017  1.00 77.53  ? 61  ASN G N     1 
ATOM   7110  C CA    . ASN D  2 61  ? 12.245  23.974  13.261  1.00 77.88  ? 61  ASN G CA    1 
ATOM   7111  C C     . ASN D  2 61  ? 13.503  24.592  12.636  1.00 82.08  ? 61  ASN G C     1 
ATOM   7112  O O     . ASN D  2 61  ? 13.426  25.096  11.510  1.00 79.76  ? 61  ASN G O     1 
ATOM   7113  C CB    . ASN D  2 61  ? 11.839  22.666  12.587  1.00 75.63  ? 61  ASN G CB    1 
ATOM   7114  C CG    . ASN D  2 61  ? 12.834  21.541  12.659  1.00 86.31  ? 61  ASN G CG    1 
ATOM   7115  O OD1   . ASN D  2 61  ? 14.001  21.715  13.032  1.00 82.69  ? 61  ASN G OD1   1 
ATOM   7116  N ND2   . ASN D  2 61  ? 12.391  20.353  12.266  1.00 74.28  ? 61  ASN G ND2   1 
ATOM   7117  N N     . GLU D  2 62  ? 14.637  24.612  13.393  1.00 80.23  ? 62  GLU G N     1 
ATOM   7118  C CA    . GLU D  2 62  ? 15.927  25.202  12.976  1.00 80.51  ? 62  GLU G CA    1 
ATOM   7119  C C     . GLU D  2 62  ? 16.328  24.897  11.518  1.00 80.87  ? 62  GLU G C     1 
ATOM   7120  O O     . GLU D  2 62  ? 16.820  25.784  10.808  1.00 78.56  ? 62  GLU G O     1 
ATOM   7121  C CB    . GLU D  2 62  ? 17.067  24.785  13.952  1.00 83.61  ? 62  GLU G CB    1 
ATOM   7122  C CG    . GLU D  2 62  ? 17.431  23.295  13.948  1.00 98.56  ? 62  GLU G CG    1 
ATOM   7123  C CD    . GLU D  2 62  ? 18.559  22.870  14.878  1.00 128.60 ? 62  GLU G CD    1 
ATOM   7124  O OE1   . GLU D  2 62  ? 19.006  23.694  15.711  1.00 112.80 ? 62  GLU G OE1   1 
ATOM   7125  O OE2   . GLU D  2 62  ? 19.010  21.707  14.755  1.00 128.48 ? 62  GLU G OE2   1 
ATOM   7126  N N     . LYS D  2 63  ? 16.081  23.645  11.079  1.00 77.05  ? 63  LYS G N     1 
ATOM   7127  C CA    . LYS D  2 63  ? 16.363  23.166  9.725   1.00 76.10  ? 63  LYS G CA    1 
ATOM   7128  C C     . LYS D  2 63  ? 15.573  23.938  8.655   1.00 77.80  ? 63  LYS G C     1 
ATOM   7129  O O     . LYS D  2 63  ? 16.024  24.023  7.516   1.00 77.76  ? 63  LYS G O     1 
ATOM   7130  C CB    . LYS D  2 63  ? 16.017  21.666  9.608   1.00 78.63  ? 63  LYS G CB    1 
ATOM   7131  C CG    . LYS D  2 63  ? 16.858  20.744  10.487  1.00 91.77  ? 63  LYS G CG    1 
ATOM   7132  C CD    . LYS D  2 63  ? 16.452  19.271  10.356  1.00 99.89  ? 63  LYS G CD    1 
ATOM   7133  C CE    . LYS D  2 63  ? 17.323  18.370  11.217  1.00 111.20 ? 63  LYS G CE    1 
ATOM   7134  N NZ    . LYS D  2 63  ? 17.222  16.933  10.827  1.00 119.39 ? 63  LYS G NZ    1 
ATOM   7135  N N     . PHE D  2 64  ? 14.391  24.463  9.008   1.00 73.69  ? 64  PHE G N     1 
ATOM   7136  C CA    . PHE D  2 64  ? 13.493  25.187  8.091   1.00 72.91  ? 64  PHE G CA    1 
ATOM   7137  C C     . PHE D  2 64  ? 13.414  26.707  8.306   1.00 78.97  ? 64  PHE G C     1 
ATOM   7138  O O     . PHE D  2 64  ? 12.787  27.387  7.485   1.00 78.66  ? 64  PHE G O     1 
ATOM   7139  C CB    . PHE D  2 64  ? 12.100  24.575  8.172   1.00 72.56  ? 64  PHE G CB    1 
ATOM   7140  C CG    . PHE D  2 64  ? 12.120  23.128  7.794   1.00 72.06  ? 64  PHE G CG    1 
ATOM   7141  C CD1   . PHE D  2 64  ? 12.383  22.739  6.490   1.00 73.45  ? 64  PHE G CD1   1 
ATOM   7142  C CD2   . PHE D  2 64  ? 11.971  22.149  8.753   1.00 73.37  ? 64  PHE G CD2   1 
ATOM   7143  C CE1   . PHE D  2 64  ? 12.457  21.395  6.155   1.00 73.96  ? 64  PHE G CE1   1 
ATOM   7144  C CE2   . PHE D  2 64  ? 12.014  20.809  8.415   1.00 76.05  ? 64  PHE G CE2   1 
ATOM   7145  C CZ    . PHE D  2 64  ? 12.270  20.436  7.123   1.00 73.45  ? 64  PHE G CZ    1 
ATOM   7146  N N     . LYS D  2 65  ? 14.045  27.248  9.372   1.00 76.40  ? 65  LYS G N     1 
ATOM   7147  C CA    . LYS D  2 65  ? 14.127  28.707  9.553   1.00 76.88  ? 65  LYS G CA    1 
ATOM   7148  C C     . LYS D  2 65  ? 15.039  29.202  8.418   1.00 82.01  ? 65  LYS G C     1 
ATOM   7149  O O     . LYS D  2 65  ? 16.000  28.503  8.063   1.00 82.54  ? 65  LYS G O     1 
ATOM   7150  C CB    . LYS D  2 65  ? 14.716  29.091  10.926  1.00 80.25  ? 65  LYS G CB    1 
ATOM   7151  N N     . ASN D  2 66  ? 14.677  30.336  7.793   1.00 78.46  ? 66  ASN G N     1 
ATOM   7152  C CA    . ASN D  2 66  ? 15.363  30.955  6.638   1.00 78.32  ? 66  ASN G CA    1 
ATOM   7153  C C     . ASN D  2 66  ? 14.801  30.500  5.286   1.00 78.25  ? 66  ASN G C     1 
ATOM   7154  O O     . ASN D  2 66  ? 14.728  31.340  4.390   1.00 80.10  ? 66  ASN G O     1 
ATOM   7155  C CB    . ASN D  2 66  ? 16.904  30.822  6.646   1.00 83.67  ? 66  ASN G CB    1 
ATOM   7156  C CG    . ASN D  2 66  ? 17.597  31.591  7.778   1.00 112.27 ? 66  ASN G CG    1 
ATOM   7157  O OD1   . ASN D  2 66  ? 17.546  31.217  8.964   1.00 98.31  ? 66  ASN G OD1   1 
ATOM   7158  N ND2   . ASN D  2 66  ? 18.272  32.690  7.442   1.00 106.46 ? 66  ASN G ND2   1 
ATOM   7159  N N     . ARG D  2 67  ? 14.416  29.214  5.109   1.00 68.61  ? 67  ARG G N     1 
ATOM   7160  C CA    . ARG D  2 67  ? 13.882  28.747  3.815   1.00 66.51  ? 67  ARG G CA    1 
ATOM   7161  C C     . ARG D  2 67  ? 12.342  28.739  3.732   1.00 64.37  ? 67  ARG G C     1 
ATOM   7162  O O     . ARG D  2 67  ? 11.817  28.741  2.620   1.00 60.64  ? 67  ARG G O     1 
ATOM   7163  C CB    . ARG D  2 67  ? 14.374  27.339  3.471   1.00 66.83  ? 67  ARG G CB    1 
ATOM   7164  C CG    . ARG D  2 67  ? 15.869  27.111  3.593   1.00 75.72  ? 67  ARG G CG    1 
ATOM   7165  C CD    . ARG D  2 67  ? 16.179  25.651  3.385   1.00 73.06  ? 67  ARG G CD    1 
ATOM   7166  N NE    . ARG D  2 67  ? 15.650  25.269  2.091   1.00 67.40  ? 67  ARG G NE    1 
ATOM   7167  C CZ    . ARG D  2 67  ? 15.106  24.100  1.770   1.00 70.23  ? 67  ARG G CZ    1 
ATOM   7168  N NH1   . ARG D  2 67  ? 15.057  23.107  2.656   1.00 46.24  ? 67  ARG G NH1   1 
ATOM   7169  N NH2   . ARG D  2 67  ? 14.626  23.906  0.554   1.00 54.71  ? 67  ARG G NH2   1 
ATOM   7170  N N     . VAL D  2 68  ? 11.639  28.678  4.885   1.00 60.94  ? 68  VAL G N     1 
ATOM   7171  C CA    . VAL D  2 68  ? 10.173  28.646  4.939   1.00 60.84  ? 68  VAL G CA    1 
ATOM   7172  C C     . VAL D  2 68  ? 9.555   29.984  5.283   1.00 62.98  ? 68  VAL G C     1 
ATOM   7173  O O     . VAL D  2 68  ? 9.946   30.597  6.253   1.00 62.59  ? 68  VAL G O     1 
ATOM   7174  C CB    . VAL D  2 68  ? 9.653   27.562  5.913   1.00 64.60  ? 68  VAL G CB    1 
ATOM   7175  C CG1   . VAL D  2 68  ? 8.134   27.500  5.892   1.00 64.59  ? 68  VAL G CG1   1 
ATOM   7176  C CG2   . VAL D  2 68  ? 10.196  26.205  5.524   1.00 64.17  ? 68  VAL G CG2   1 
ATOM   7177  N N     . THR D  2 69  ? 8.533   30.395  4.529   1.00 58.93  ? 69  THR G N     1 
ATOM   7178  C CA    . THR D  2 69  ? 7.718   31.566  4.859   1.00 57.80  ? 69  THR G CA    1 
ATOM   7179  C C     . THR D  2 69  ? 6.285   31.023  5.061   1.00 59.57  ? 69  THR G C     1 
ATOM   7180  O O     . THR D  2 69  ? 5.732   30.375  4.158   1.00 57.83  ? 69  THR G O     1 
ATOM   7181  C CB    . THR D  2 69  ? 7.716   32.638  3.753   1.00 63.74  ? 69  THR G CB    1 
ATOM   7182  O OG1   . THR D  2 69  ? 9.038   33.002  3.431   1.00 63.32  ? 69  THR G OG1   1 
ATOM   7183  C CG2   . THR D  2 69  ? 6.928   33.876  4.144   1.00 62.91  ? 69  THR G CG2   1 
ATOM   7184  N N     . LEU D  2 70  ? 5.728   31.259  6.251   1.00 55.75  ? 70  LEU G N     1 
ATOM   7185  C CA    . LEU D  2 70  ? 4.360   30.920  6.618   1.00 55.51  ? 70  LEU G CA    1 
ATOM   7186  C C     . LEU D  2 70  ? 3.478   32.168  6.571   1.00 60.34  ? 70  LEU G C     1 
ATOM   7187  O O     . LEU D  2 70  ? 3.853   33.195  7.106   1.00 61.06  ? 70  LEU G O     1 
ATOM   7188  C CB    . LEU D  2 70  ? 4.324   30.293  8.031   1.00 55.32  ? 70  LEU G CB    1 
ATOM   7189  C CG    . LEU D  2 70  ? 4.999   28.912  8.158   1.00 59.67  ? 70  LEU G CG    1 
ATOM   7190  C CD1   . LEU D  2 70  ? 4.755   28.302  9.531   1.00 59.77  ? 70  LEU G CD1   1 
ATOM   7191  C CD2   . LEU D  2 70  ? 4.546   27.961  7.054   1.00 63.03  ? 70  LEU G CD2   1 
ATOM   7192  N N     . THR D  2 71  ? 2.332   32.098  5.887   1.00 58.13  ? 71  THR G N     1 
ATOM   7193  C CA    . THR D  2 71  ? 1.373   33.204  5.818   1.00 58.33  ? 71  THR G CA    1 
ATOM   7194  C C     . THR D  2 71  ? -0.045  32.691  5.974   1.00 64.46  ? 71  THR G C     1 
ATOM   7195  O O     . THR D  2 71  ? -0.308  31.488  5.896   1.00 62.43  ? 71  THR G O     1 
ATOM   7196  C CB    . THR D  2 71  ? 1.532   34.056  4.554   1.00 61.03  ? 71  THR G CB    1 
ATOM   7197  O OG1   . THR D  2 71  ? 1.438   33.216  3.404   1.00 56.74  ? 71  THR G OG1   1 
ATOM   7198  C CG2   . THR D  2 71  ? 2.848   34.905  4.565   1.00 57.36  ? 71  THR G CG2   1 
ATOM   7199  N N     . THR D  2 72  ? -0.954  33.635  6.214   1.00 63.89  ? 72  THR G N     1 
ATOM   7200  C CA    . THR D  2 72  ? -2.366  33.384  6.471   1.00 63.93  ? 72  THR G CA    1 
ATOM   7201  C C     . THR D  2 72  ? -3.247  34.485  5.865   1.00 67.73  ? 72  THR G C     1 
ATOM   7202  O O     . THR D  2 72  ? -2.836  35.639  5.815   1.00 67.94  ? 72  THR G O     1 
ATOM   7203  C CB    . THR D  2 72  ? -2.503  33.309  8.010   1.00 72.52  ? 72  THR G CB    1 
ATOM   7204  O OG1   . THR D  2 72  ? -2.655  31.953  8.429   1.00 70.17  ? 72  THR G OG1   1 
ATOM   7205  C CG2   . THR D  2 72  ? -3.591  34.212  8.578   1.00 72.88  ? 72  THR G CG2   1 
ATOM   7206  N N     . ASP D  2 73  ? -4.471  34.129  5.457   1.00 64.31  ? 73  ASP G N     1 
ATOM   7207  C CA    . ASP D  2 73  ? -5.497  35.075  5.014   1.00 64.27  ? 73  ASP G CA    1 
ATOM   7208  C C     . ASP D  2 73  ? -6.781  34.703  5.776   1.00 67.07  ? 73  ASP G C     1 
ATOM   7209  O O     . ASP D  2 73  ? -7.357  33.639  5.538   1.00 64.48  ? 73  ASP G O     1 
ATOM   7210  C CB    . ASP D  2 73  ? -5.696  35.078  3.491   1.00 66.65  ? 73  ASP G CB    1 
ATOM   7211  C CG    . ASP D  2 73  ? -6.742  36.082  3.005   1.00 73.86  ? 73  ASP G CG    1 
ATOM   7212  O OD1   . ASP D  2 73  ? -7.342  36.760  3.843   1.00 75.72  ? 73  ASP G OD1   1 
ATOM   7213  O OD2   . ASP D  2 73  ? -7.020  36.114  1.788   1.00 79.37  ? 73  ASP G OD2   1 
ATOM   7214  N N     . SER D  2 74  ? -7.174  35.562  6.743   1.00 65.69  ? 74  SER G N     1 
ATOM   7215  C CA    . SER D  2 74  ? -8.341  35.345  7.604   1.00 66.97  ? 74  SER G CA    1 
ATOM   7216  C C     . SER D  2 74  ? -9.674  35.515  6.863   1.00 70.78  ? 74  SER G C     1 
ATOM   7217  O O     . SER D  2 74  ? -10.641 34.835  7.227   1.00 69.78  ? 74  SER G O     1 
ATOM   7218  C CB    . SER D  2 74  ? -8.273  36.216  8.862   1.00 73.79  ? 74  SER G CB    1 
ATOM   7219  O OG    . SER D  2 74  ? -7.976  37.573  8.588   1.00 89.43  ? 74  SER G OG    1 
ATOM   7220  N N     . SER D  2 75  ? -9.724  36.339  5.786   1.00 67.52  ? 75  SER G N     1 
ATOM   7221  C CA    . SER D  2 75  ? -10.944 36.460  4.973   1.00 67.06  ? 75  SER G CA    1 
ATOM   7222  C C     . SER D  2 75  ? -11.229 35.133  4.302   1.00 71.44  ? 75  SER G C     1 
ATOM   7223  O O     . SER D  2 75  ? -12.344 34.625  4.409   1.00 73.52  ? 75  SER G O     1 
ATOM   7224  C CB    . SER D  2 75  ? -10.801 37.511  3.875   1.00 68.65  ? 75  SER G CB    1 
ATOM   7225  O OG    . SER D  2 75  ? -11.958 37.506  3.039   1.00 73.29  ? 75  SER G OG    1 
ATOM   7226  N N     . THR D  2 76  ? -10.218 34.577  3.607   1.00 64.89  ? 76  THR G N     1 
ATOM   7227  C CA    . THR D  2 76  ? -10.335 33.310  2.886   1.00 63.27  ? 76  THR G CA    1 
ATOM   7228  C C     . THR D  2 76  ? -9.947  32.078  3.731   1.00 63.47  ? 76  THR G C     1 
ATOM   7229  O O     . THR D  2 76  ? -9.873  30.990  3.168   1.00 62.34  ? 76  THR G O     1 
ATOM   7230  C CB    . THR D  2 76  ? -9.533  33.386  1.579   1.00 67.50  ? 76  THR G CB    1 
ATOM   7231  O OG1   . THR D  2 76  ? -8.141  33.536  1.895   1.00 66.64  ? 76  THR G OG1   1 
ATOM   7232  C CG2   . THR D  2 76  ? -10.004 34.518  0.680   1.00 63.52  ? 76  THR G CG2   1 
ATOM   7233  N N     . THR D  2 77  ? -9.755  32.229  5.060   1.00 58.71  ? 77  THR G N     1 
ATOM   7234  C CA    . THR D  2 77  ? -9.365  31.159  5.992   1.00 58.29  ? 77  THR G CA    1 
ATOM   7235  C C     . THR D  2 77  ? -8.411  30.167  5.315   1.00 60.32  ? 77  THR G C     1 
ATOM   7236  O O     . THR D  2 77  ? -8.690  28.972  5.235   1.00 57.86  ? 77  THR G O     1 
ATOM   7237  C CB    . THR D  2 77  ? -10.596 30.491  6.646   1.00 60.22  ? 77  THR G CB    1 
ATOM   7238  O OG1   . THR D  2 77  ? -11.400 29.929  5.641   1.00 51.70  ? 77  THR G OG1   1 
ATOM   7239  C CG2   . THR D  2 77  ? -11.433 31.458  7.483   1.00 54.08  ? 77  THR G CG2   1 
ATOM   7240  N N     . THR D  2 78  ? -7.324  30.709  4.750   1.00 57.63  ? 78  THR G N     1 
ATOM   7241  C CA    . THR D  2 78  ? -6.330  29.932  4.016   1.00 56.96  ? 78  THR G CA    1 
ATOM   7242  C C     . THR D  2 78  ? -4.966  30.154  4.638   1.00 55.68  ? 78  THR G C     1 
ATOM   7243  O O     . THR D  2 78  ? -4.591  31.290  4.919   1.00 51.57  ? 78  THR G O     1 
ATOM   7244  C CB    . THR D  2 78  ? -6.309  30.303  2.537   1.00 62.38  ? 78  THR G CB    1 
ATOM   7245  O OG1   . THR D  2 78  ? -7.598  30.053  1.990   1.00 63.28  ? 78  THR G OG1   1 
ATOM   7246  C CG2   . THR D  2 78  ? -5.289  29.482  1.755   1.00 65.26  ? 78  THR G CG2   1 
ATOM   7247  N N     . ALA D  2 79  ? -4.226  29.062  4.818   1.00 52.20  ? 79  ALA G N     1 
ATOM   7248  C CA    . ALA D  2 79  ? -2.850  29.081  5.322   1.00 51.54  ? 79  ALA G CA    1 
ATOM   7249  C C     . ALA D  2 79  ? -1.957  28.739  4.137   1.00 53.18  ? 79  ALA G C     1 
ATOM   7250  O O     . ALA D  2 79  ? -2.358  27.898  3.318   1.00 51.68  ? 79  ALA G O     1 
ATOM   7251  C CB    . ALA D  2 79  ? -2.676  28.028  6.403   1.00 52.20  ? 79  ALA G CB    1 
ATOM   7252  N N     . TYR D  2 80  ? -0.774  29.403  4.020   1.00 50.12  ? 80  TYR G N     1 
ATOM   7253  C CA    . TYR D  2 80  ? 0.203   29.110  2.955   1.00 49.90  ? 80  TYR G CA    1 
ATOM   7254  C C     . TYR D  2 80  ? 1.558   28.821  3.541   1.00 53.64  ? 80  TYR G C     1 
ATOM   7255  O O     . TYR D  2 80  ? 1.929   29.387  4.571   1.00 51.58  ? 80  TYR G O     1 
ATOM   7256  C CB    . TYR D  2 80  ? 0.368   30.230  1.927   1.00 51.43  ? 80  TYR G CB    1 
ATOM   7257  C CG    . TYR D  2 80  ? -0.920  30.764  1.359   1.00 53.51  ? 80  TYR G CG    1 
ATOM   7258  C CD1   . TYR D  2 80  ? -1.637  31.750  2.020   1.00 55.73  ? 80  TYR G CD1   1 
ATOM   7259  C CD2   . TYR D  2 80  ? -1.361  30.372  0.105   1.00 54.88  ? 80  TYR G CD2   1 
ATOM   7260  C CE1   . TYR D  2 80  ? -2.799  32.280  1.482   1.00 55.84  ? 80  TYR G CE1   1 
ATOM   7261  C CE2   . TYR D  2 80  ? -2.531  30.882  -0.439  1.00 56.45  ? 80  TYR G CE2   1 
ATOM   7262  C CZ    . TYR D  2 80  ? -3.262  31.821  0.264   1.00 60.81  ? 80  TYR G CZ    1 
ATOM   7263  O OH    . TYR D  2 80  ? -4.453  32.291  -0.232  1.00 63.82  ? 80  TYR G OH    1 
ATOM   7264  N N     . MET D  2 81  ? 2.313   27.953  2.843   1.00 50.28  ? 81  MET G N     1 
ATOM   7265  C CA    . MET D  2 81  ? 3.647   27.525  3.229   1.00 49.37  ? 81  MET G CA    1 
ATOM   7266  C C     . MET D  2 81  ? 4.497   27.664  1.983   1.00 54.45  ? 81  MET G C     1 
ATOM   7267  O O     . MET D  2 81  ? 4.236   26.974  0.997   1.00 54.64  ? 81  MET G O     1 
ATOM   7268  C CB    . MET D  2 81  ? 3.569   26.075  3.736   1.00 51.13  ? 81  MET G CB    1 
ATOM   7269  C CG    . MET D  2 81  ? 4.883   25.466  4.300   1.00 54.53  ? 81  MET G CG    1 
ATOM   7270  S SD    . MET D  2 81  ? 6.214   25.092  3.131   1.00 59.30  ? 81  MET G SD    1 
ATOM   7271  C CE    . MET D  2 81  ? 5.432   23.994  2.030   1.00 54.75  ? 81  MET G CE    1 
ATOM   7272  N N     . GLU D  2 82  ? 5.435   28.629  1.981   1.00 51.44  ? 82  GLU G N     1 
ATOM   7273  C CA    . GLU D  2 82  ? 6.329   28.830  0.855   1.00 51.63  ? 82  GLU G CA    1 
ATOM   7274  C C     . GLU D  2 82  ? 7.681   28.263  1.236   1.00 53.40  ? 82  GLU G C     1 
ATOM   7275  O O     . GLU D  2 82  ? 8.248   28.683  2.238   1.00 52.91  ? 82  GLU G O     1 
ATOM   7276  C CB    . GLU D  2 82  ? 6.451   30.298  0.450   1.00 54.10  ? 82  GLU G CB    1 
ATOM   7277  C CG    . GLU D  2 82  ? 7.199   30.471  -0.874  1.00 66.43  ? 82  GLU G CG    1 
ATOM   7278  C CD    . GLU D  2 82  ? 7.407   31.895  -1.348  1.00 92.88  ? 82  GLU G CD    1 
ATOM   7279  O OE1   . GLU D  2 82  ? 7.181   32.833  -0.551  1.00 103.80 ? 82  GLU G OE1   1 
ATOM   7280  O OE2   . GLU D  2 82  ? 7.835   32.070  -2.511  1.00 85.72  ? 82  GLU G OE2   1 
ATOM   7281  N N     . LEU D  2 83  ? 8.163   27.265  0.486   1.00 49.06  ? 83  LEU G N     1 
ATOM   7282  C CA    . LEU D  2 83  ? 9.471   26.676  0.740   1.00 49.15  ? 83  LEU G CA    1 
ATOM   7283  C C     . LEU D  2 83  ? 10.377  27.146  -0.401  1.00 52.70  ? 83  LEU G C     1 
ATOM   7284  O O     . LEU D  2 83  ? 10.055  26.914  -1.563  1.00 51.26  ? 83  LEU G O     1 
ATOM   7285  C CB    . LEU D  2 83  ? 9.401   25.146  0.835   1.00 48.55  ? 83  LEU G CB    1 
ATOM   7286  C CG    . LEU D  2 83  ? 10.694  24.378  1.143   1.00 53.40  ? 83  LEU G CG    1 
ATOM   7287  C CD1   . LEU D  2 83  ? 11.321  24.793  2.454   1.00 54.05  ? 83  LEU G CD1   1 
ATOM   7288  C CD2   . LEU D  2 83  ? 10.403  22.877  1.237   1.00 55.94  ? 83  LEU G CD2   1 
ATOM   7289  N N     . LYS D  2 84  ? 11.443  27.912  -0.064  1.00 50.99  ? 84  LYS G N     1 
ATOM   7290  C CA    . LYS D  2 84  ? 12.383  28.452  -1.057  1.00 52.48  ? 84  LYS G CA    1 
ATOM   7291  C C     . LYS D  2 84  ? 13.647  27.602  -1.130  1.00 55.00  ? 84  LYS G C     1 
ATOM   7292  O O     . LYS D  2 84  ? 13.863  26.723  -0.278  1.00 53.44  ? 84  LYS G O     1 
ATOM   7293  C CB    . LYS D  2 84  ? 12.706  29.926  -0.747  1.00 56.31  ? 84  LYS G CB    1 
ATOM   7294  N N     . SER D  2 85  ? 14.425  27.804  -2.207  1.00 52.66  ? 85  SER G N     1 
ATOM   7295  C CA    . SER D  2 85  ? 15.706  27.117  -2.447  1.00 52.96  ? 85  SER G CA    1 
ATOM   7296  C C     . SER D  2 85  ? 15.551  25.594  -2.330  1.00 55.01  ? 85  SER G C     1 
ATOM   7297  O O     . SER D  2 85  ? 16.222  24.942  -1.522  1.00 52.17  ? 85  SER G O     1 
ATOM   7298  C CB    . SER D  2 85  ? 16.772  27.633  -1.475  1.00 56.83  ? 85  SER G CB    1 
ATOM   7299  O OG    . SER D  2 85  ? 16.941  29.040  -1.548  1.00 64.22  ? 85  SER G OG    1 
ATOM   7300  N N     . LEU D  2 86  ? 14.639  25.031  -3.130  1.00 53.29  ? 86  LEU G N     1 
ATOM   7301  C CA    . LEU D  2 86  ? 14.329  23.603  -3.052  1.00 52.47  ? 86  LEU G CA    1 
ATOM   7302  C C     . LEU D  2 86  ? 15.516  22.689  -3.387  1.00 58.63  ? 86  LEU G C     1 
ATOM   7303  O O     . LEU D  2 86  ? 16.339  23.019  -4.238  1.00 59.98  ? 86  LEU G O     1 
ATOM   7304  C CB    . LEU D  2 86  ? 13.109  23.255  -3.899  1.00 51.27  ? 86  LEU G CB    1 
ATOM   7305  C CG    . LEU D  2 86  ? 11.781  23.831  -3.399  1.00 54.63  ? 86  LEU G CG    1 
ATOM   7306  C CD1   . LEU D  2 86  ? 10.732  23.832  -4.519  1.00 55.37  ? 86  LEU G CD1   1 
ATOM   7307  C CD2   . LEU D  2 86  ? 11.266  23.072  -2.176  1.00 52.19  ? 86  LEU G CD2   1 
ATOM   7308  N N     . GLN D  2 87  ? 15.619  21.579  -2.641  1.00 54.57  ? 87  GLN G N     1 
ATOM   7309  C CA    . GLN D  2 87  ? 16.667  20.560  -2.717  1.00 54.35  ? 87  GLN G CA    1 
ATOM   7310  C C     . GLN D  2 87  ? 15.980  19.214  -2.962  1.00 56.33  ? 87  GLN G C     1 
ATOM   7311  O O     . GLN D  2 87  ? 14.815  19.067  -2.585  1.00 54.33  ? 87  GLN G O     1 
ATOM   7312  C CB    . GLN D  2 87  ? 17.455  20.512  -1.386  1.00 55.53  ? 87  GLN G CB    1 
ATOM   7313  C CG    . GLN D  2 87  ? 18.033  21.844  -0.979  1.00 78.33  ? 87  GLN G CG    1 
ATOM   7314  C CD    . GLN D  2 87  ? 18.380  21.940  0.481   1.00 84.37  ? 87  GLN G CD    1 
ATOM   7315  O OE1   . GLN D  2 87  ? 18.542  20.915  1.180   1.00 71.87  ? 87  GLN G OE1   1 
ATOM   7316  N NE2   . GLN D  2 87  ? 18.481  23.202  0.964   1.00 63.74  ? 87  GLN G NE2   1 
ATOM   7317  N N     . PHE D  2 88  ? 16.674  18.236  -3.583  1.00 53.03  ? 88  PHE G N     1 
ATOM   7318  C CA    . PHE D  2 88  ? 16.074  16.909  -3.876  1.00 52.18  ? 88  PHE G CA    1 
ATOM   7319  C C     . PHE D  2 88  ? 15.429  16.250  -2.662  1.00 54.25  ? 88  PHE G C     1 
ATOM   7320  O O     . PHE D  2 88  ? 14.337  15.692  -2.800  1.00 51.42  ? 88  PHE G O     1 
ATOM   7321  C CB    . PHE D  2 88  ? 17.085  15.929  -4.483  1.00 54.36  ? 88  PHE G CB    1 
ATOM   7322  C CG    . PHE D  2 88  ? 17.733  16.329  -5.781  1.00 57.01  ? 88  PHE G CG    1 
ATOM   7323  C CD1   . PHE D  2 88  ? 16.991  16.933  -6.793  1.00 60.56  ? 88  PHE G CD1   1 
ATOM   7324  C CD2   . PHE D  2 88  ? 19.050  15.978  -6.053  1.00 60.46  ? 88  PHE G CD2   1 
ATOM   7325  C CE1   . PHE D  2 88  ? 17.580  17.252  -8.014  1.00 62.90  ? 88  PHE G CE1   1 
ATOM   7326  C CE2   . PHE D  2 88  ? 19.643  16.321  -7.262  1.00 64.38  ? 88  PHE G CE2   1 
ATOM   7327  C CZ    . PHE D  2 88  ? 18.897  16.930  -8.247  1.00 62.91  ? 88  PHE G CZ    1 
ATOM   7328  N N     . ASP D  2 89  ? 16.034  16.411  -1.462  1.00 52.88  ? 89  ASP G N     1 
ATOM   7329  C CA    . ASP D  2 89  ? 15.509  15.802  -0.247  1.00 53.58  ? 89  ASP G CA    1 
ATOM   7330  C C     . ASP D  2 89  ? 14.318  16.594  0.396   1.00 56.43  ? 89  ASP G C     1 
ATOM   7331  O O     . ASP D  2 89  ? 13.822  16.200  1.460   1.00 56.25  ? 89  ASP G O     1 
ATOM   7332  C CB    . ASP D  2 89  ? 16.636  15.503  0.751   1.00 56.97  ? 89  ASP G CB    1 
ATOM   7333  C CG    . ASP D  2 89  ? 17.132  16.663  1.565   1.00 69.24  ? 89  ASP G CG    1 
ATOM   7334  O OD1   . ASP D  2 89  ? 16.911  17.822  1.145   1.00 71.44  ? 89  ASP G OD1   1 
ATOM   7335  O OD2   . ASP D  2 89  ? 17.747  16.416  2.616   1.00 76.11  ? 89  ASP G OD2   1 
ATOM   7336  N N     . ASP D  2 90  ? 13.806  17.639  -0.294  1.00 51.50  ? 90  ASP G N     1 
ATOM   7337  C CA    . ASP D  2 90  ? 12.550  18.289  0.057   1.00 48.74  ? 90  ASP G CA    1 
ATOM   7338  C C     . ASP D  2 90  ? 11.407  17.527  -0.605  1.00 49.48  ? 90  ASP G C     1 
ATOM   7339  O O     . ASP D  2 90  ? 10.247  17.915  -0.452  1.00 48.82  ? 90  ASP G O     1 
ATOM   7340  C CB    . ASP D  2 90  ? 12.513  19.751  -0.389  1.00 49.90  ? 90  ASP G CB    1 
ATOM   7341  C CG    . ASP D  2 90  ? 13.497  20.612  0.334   1.00 52.92  ? 90  ASP G CG    1 
ATOM   7342  O OD1   . ASP D  2 90  ? 13.510  20.578  1.565   1.00 53.76  ? 90  ASP G OD1   1 
ATOM   7343  O OD2   . ASP D  2 90  ? 14.158  21.426  -0.320  1.00 58.55  ? 90  ASP G OD2   1 
ATOM   7344  N N     . THR D  2 91  ? 11.702  16.447  -1.337  1.00 46.72  ? 91  THR G N     1 
ATOM   7345  C CA    . THR D  2 91  ? 10.658  15.638  -1.960  1.00 46.51  ? 91  THR G CA    1 
ATOM   7346  C C     . THR D  2 91  ? 9.848   14.955  -0.870  1.00 50.38  ? 91  THR G C     1 
ATOM   7347  O O     . THR D  2 91  ? 10.365  14.110  -0.156  1.00 51.12  ? 91  THR G O     1 
ATOM   7348  C CB    . THR D  2 91  ? 11.265  14.620  -2.949  1.00 52.07  ? 91  THR G CB    1 
ATOM   7349  O OG1   . THR D  2 91  ? 11.739  15.342  -4.076  1.00 53.79  ? 91  THR G OG1   1 
ATOM   7350  C CG2   . THR D  2 91  ? 10.261  13.553  -3.385  1.00 44.80  ? 91  THR G CG2   1 
ATOM   7351  N N     . ALA D  2 92  ? 8.592   15.319  -0.736  1.00 48.15  ? 92  ALA G N     1 
ATOM   7352  C CA    . ALA D  2 92  ? 7.752   14.752  0.310   1.00 47.03  ? 92  ALA G CA    1 
ATOM   7353  C C     . ALA D  2 92  ? 6.325   15.112  0.061   1.00 49.83  ? 92  ALA G C     1 
ATOM   7354  O O     . ALA D  2 92  ? 6.018   15.870  -0.879  1.00 48.93  ? 92  ALA G O     1 
ATOM   7355  C CB    . ALA D  2 92  ? 8.183   15.351  1.660   1.00 47.88  ? 92  ALA G CB    1 
ATOM   7356  N N     . VAL D  2 93  ? 5.445   14.578  0.934   1.00 45.18  ? 93  VAL G N     1 
ATOM   7357  C CA    . VAL D  2 93  ? 4.050   14.956  1.011   1.00 43.67  ? 93  VAL G CA    1 
ATOM   7358  C C     . VAL D  2 93  ? 4.051   15.967  2.148   1.00 49.89  ? 93  VAL G C     1 
ATOM   7359  O O     . VAL D  2 93  ? 4.620   15.693  3.187   1.00 49.70  ? 93  VAL G O     1 
ATOM   7360  C CB    . VAL D  2 93  ? 3.098   13.774  1.268   1.00 45.01  ? 93  VAL G CB    1 
ATOM   7361  C CG1   . VAL D  2 93  ? 1.650   14.248  1.376   1.00 44.18  ? 93  VAL G CG1   1 
ATOM   7362  C CG2   . VAL D  2 93  ? 3.231   12.745  0.165   1.00 43.63  ? 93  VAL G CG2   1 
ATOM   7363  N N     . TYR D  2 94  ? 3.503   17.162  1.913   1.00 48.34  ? 94  TYR G N     1 
ATOM   7364  C CA    . TYR D  2 94  ? 3.441   18.259  2.887   1.00 46.68  ? 94  TYR G CA    1 
ATOM   7365  C C     . TYR D  2 94  ? 2.033   18.338  3.389   1.00 50.77  ? 94  TYR G C     1 
ATOM   7366  O O     . TYR D  2 94  ? 1.122   18.440  2.580   1.00 51.13  ? 94  TYR G O     1 
ATOM   7367  C CB    . TYR D  2 94  ? 3.798   19.595  2.208   1.00 46.97  ? 94  TYR G CB    1 
ATOM   7368  C CG    . TYR D  2 94  ? 5.276   19.697  1.922   1.00 47.11  ? 94  TYR G CG    1 
ATOM   7369  C CD1   . TYR D  2 94  ? 5.855   18.987  0.878   1.00 47.92  ? 94  TYR G CD1   1 
ATOM   7370  C CD2   . TYR D  2 94  ? 6.120   20.385  2.779   1.00 47.83  ? 94  TYR G CD2   1 
ATOM   7371  C CE1   . TYR D  2 94  ? 7.236   18.983  0.684   1.00 47.20  ? 94  TYR G CE1   1 
ATOM   7372  C CE2   . TYR D  2 94  ? 7.501   20.362  2.610   1.00 48.93  ? 94  TYR G CE2   1 
ATOM   7373  C CZ    . TYR D  2 94  ? 8.056   19.672  1.558   1.00 51.30  ? 94  TYR G CZ    1 
ATOM   7374  O OH    . TYR D  2 94  ? 9.426   19.717  1.425   1.00 51.38  ? 94  TYR G OH    1 
ATOM   7375  N N     . TYR D  2 95  ? 1.846   18.337  4.706   1.00 48.06  ? 95  TYR G N     1 
ATOM   7376  C CA    . TYR D  2 95  ? 0.548   18.420  5.361   1.00 46.90  ? 95  TYR G CA    1 
ATOM   7377  C C     . TYR D  2 95  ? 0.361   19.689  6.201   1.00 52.51  ? 95  TYR G C     1 
ATOM   7378  O O     . TYR D  2 95  ? 1.273   20.120  6.912   1.00 50.50  ? 95  TYR G O     1 
ATOM   7379  C CB    . TYR D  2 95  ? 0.389   17.284  6.358   1.00 46.72  ? 95  TYR G CB    1 
ATOM   7380  C CG    . TYR D  2 95  ? 0.346   15.922  5.731   1.00 46.93  ? 95  TYR G CG    1 
ATOM   7381  C CD1   . TYR D  2 95  ? -0.820  15.435  5.168   1.00 47.70  ? 95  TYR G CD1   1 
ATOM   7382  C CD2   . TYR D  2 95  ? 1.450   15.085  5.768   1.00 48.23  ? 95  TYR G CD2   1 
ATOM   7383  C CE1   . TYR D  2 95  ? -0.883  14.157  4.643   1.00 48.21  ? 95  TYR G CE1   1 
ATOM   7384  C CE2   . TYR D  2 95  ? 1.422   13.832  5.174   1.00 48.34  ? 95  TYR G CE2   1 
ATOM   7385  C CZ    . TYR D  2 95  ? 0.243   13.356  4.645   1.00 51.37  ? 95  TYR G CZ    1 
ATOM   7386  O OH    . TYR D  2 95  ? 0.171   12.114  4.071   1.00 51.19  ? 95  TYR G OH    1 
ATOM   7387  N N     . CYS D  2 96  ? -0.876  20.197  6.224   1.00 51.43  ? 96  CYS G N     1 
ATOM   7388  C CA    . CYS D  2 96  ? -1.242  21.240  7.154   1.00 51.86  ? 96  CYS G CA    1 
ATOM   7389  C C     . CYS D  2 96  ? -2.080  20.523  8.197   1.00 54.01  ? 96  CYS G C     1 
ATOM   7390  O O     . CYS D  2 96  ? -2.693  19.493  7.915   1.00 52.88  ? 96  CYS G O     1 
ATOM   7391  C CB    . CYS D  2 96  ? -2.001  22.389  6.500   1.00 52.88  ? 96  CYS G CB    1 
ATOM   7392  S SG    . CYS D  2 96  ? -3.468  21.881  5.572   1.00 57.20  ? 96  CYS G SG    1 
ATOM   7393  N N     . ALA D  2 97  ? -2.021  21.001  9.418   1.00 52.41  ? 97  ALA G N     1 
ATOM   7394  C CA    . ALA D  2 97  ? -2.789  20.416  10.505  1.00 52.95  ? 97  ALA G CA    1 
ATOM   7395  C C     . ALA D  2 97  ? -3.010  21.494  11.521  1.00 56.01  ? 97  ALA G C     1 
ATOM   7396  O O     . ALA D  2 97  ? -2.096  22.266  11.786  1.00 55.55  ? 97  ALA G O     1 
ATOM   7397  C CB    . ALA D  2 97  ? -2.052  19.225  11.113  1.00 53.93  ? 97  ALA G CB    1 
ATOM   7398  N N     . ARG D  2 98  ? -4.226  21.600  12.048  1.00 54.28  ? 98  ARG G N     1 
ATOM   7399  C CA    . ARG D  2 98  ? -4.524  22.666  13.011  1.00 55.48  ? 98  ARG G CA    1 
ATOM   7400  C C     . ARG D  2 98  ? -4.236  22.217  14.455  1.00 60.23  ? 98  ARG G C     1 
ATOM   7401  O O     . ARG D  2 98  ? -4.119  21.026  14.710  1.00 59.41  ? 98  ARG G O     1 
ATOM   7402  C CB    . ARG D  2 98  ? -5.988  23.152  12.846  1.00 53.39  ? 98  ARG G CB    1 
ATOM   7403  C CG    . ARG D  2 98  ? -7.016  22.123  13.274  1.00 51.01  ? 98  ARG G CG    1 
ATOM   7404  C CD    . ARG D  2 98  ? -8.364  22.715  13.485  1.00 64.15  ? 98  ARG G CD    1 
ATOM   7405  N NE    . ARG D  2 98  ? -9.194  21.862  14.337  1.00 73.61  ? 98  ARG G NE    1 
ATOM   7406  C CZ    . ARG D  2 98  ? -10.383 22.201  14.828  1.00 81.07  ? 98  ARG G CZ    1 
ATOM   7407  N NH1   . ARG D  2 98  ? -10.908 23.391  14.556  1.00 65.88  ? 98  ARG G NH1   1 
ATOM   7408  N NH2   . ARG D  2 98  ? -11.053 21.358  15.602  1.00 71.20  ? 98  ARG G NH2   1 
ATOM   7409  N N     . ARG D  2 99  ? -4.199  23.165  15.394  1.00 58.05  ? 99  ARG G N     1 
ATOM   7410  C CA    . ARG D  2 99  ? -3.998  22.853  16.807  1.00 59.46  ? 99  ARG G CA    1 
ATOM   7411  C C     . ARG D  2 99  ? -4.649  23.941  17.650  1.00 63.93  ? 99  ARG G C     1 
ATOM   7412  O O     . ARG D  2 99  ? -4.439  25.115  17.380  1.00 62.38  ? 99  ARG G O     1 
ATOM   7413  C CB    . ARG D  2 99  ? -2.495  22.738  17.117  1.00 59.73  ? 99  ARG G CB    1 
ATOM   7414  C CG    . ARG D  2 99  ? -2.161  22.105  18.464  1.00 75.96  ? 99  ARG G CG    1 
ATOM   7415  C CD    . ARG D  2 99  ? -2.041  23.134  19.574  1.00 91.27  ? 99  ARG G CD    1 
ATOM   7416  N NE    . ARG D  2 99  ? -0.699  23.677  19.788  1.00 101.67 ? 99  ARG G NE    1 
ATOM   7417  C CZ    . ARG D  2 99  ? -0.403  24.643  20.659  1.00 109.90 ? 99  ARG G CZ    1 
ATOM   7418  N NH1   . ARG D  2 99  ? -1.355  25.179  21.421  1.00 101.45 ? 99  ARG G NH1   1 
ATOM   7419  N NH2   . ARG D  2 99  ? 0.848   25.074  20.782  1.00 82.97  ? 99  ARG G NH2   1 
ATOM   7420  N N     . ASP D  2 100 ? -5.443  23.568  18.658  1.00 62.85  ? 100 ASP G N     1 
ATOM   7421  C CA    . ASP D  2 100 ? -6.101  24.568  19.517  1.00 64.38  ? 100 ASP G CA    1 
ATOM   7422  C C     . ASP D  2 100 ? -5.101  25.588  20.071  1.00 72.73  ? 100 ASP G C     1 
ATOM   7423  O O     . ASP D  2 100 ? -4.077  25.184  20.618  1.00 71.79  ? 100 ASP G O     1 
ATOM   7424  C CB    . ASP D  2 100 ? -6.833  23.883  20.680  1.00 66.57  ? 100 ASP G CB    1 
ATOM   7425  C CG    . ASP D  2 100 ? -7.918  24.737  21.292  1.00 74.99  ? 100 ASP G CG    1 
ATOM   7426  O OD1   . ASP D  2 100 ? -7.578  25.696  22.031  1.00 74.88  ? 100 ASP G OD1   1 
ATOM   7427  O OD2   . ASP D  2 100 ? -9.111  24.442  21.044  1.00 80.28  ? 100 ASP G OD2   1 
ATOM   7428  N N     . TYR D  2 101 ? -5.392  26.898  19.941  1.00 74.02  ? 101 TYR G N     1 
ATOM   7429  C CA    . TYR D  2 101 ? -4.491  27.926  20.452  1.00 76.28  ? 101 TYR G CA    1 
ATOM   7430  C C     . TYR D  2 101 ? -4.398  27.944  21.985  1.00 83.37  ? 101 TYR G C     1 
ATOM   7431  O O     . TYR D  2 101 ? -3.289  28.089  22.496  1.00 83.09  ? 101 TYR G O     1 
ATOM   7432  C CB    . TYR D  2 101 ? -4.855  29.334  19.944  1.00 78.75  ? 101 TYR G CB    1 
ATOM   7433  C CG    . TYR D  2 101 ? -3.897  30.386  20.473  1.00 82.97  ? 101 TYR G CG    1 
ATOM   7434  C CD1   . TYR D  2 101 ? -2.652  30.579  19.884  1.00 84.25  ? 101 TYR G CD1   1 
ATOM   7435  C CD2   . TYR D  2 101 ? -4.168  31.074  21.652  1.00 86.06  ? 101 TYR G CD2   1 
ATOM   7436  C CE1   . TYR D  2 101 ? -1.727  31.481  20.415  1.00 85.73  ? 101 TYR G CE1   1 
ATOM   7437  C CE2   . TYR D  2 101 ? -3.251  31.976  22.196  1.00 86.74  ? 101 TYR G CE2   1 
ATOM   7438  C CZ    . TYR D  2 101 ? -2.029  32.180  21.573  1.00 95.74  ? 101 TYR G CZ    1 
ATOM   7439  O OH    . TYR D  2 101 ? -1.120  33.072  22.108  1.00 100.25 ? 101 TYR G OH    1 
ATOM   7440  N N     . ARG D  2 102 ? -5.531  27.840  22.710  1.00 82.54  ? 102 ARG G N     1 
ATOM   7441  C CA    . ARG D  2 102 ? -5.504  27.927  24.183  1.00 84.87  ? 102 ARG G CA    1 
ATOM   7442  C C     . ARG D  2 102 ? -4.886  26.676  24.841  1.00 92.30  ? 102 ARG G C     1 
ATOM   7443  O O     . ARG D  2 102 ? -3.819  26.792  25.438  1.00 91.90  ? 102 ARG G O     1 
ATOM   7444  C CB    . ARG D  2 102 ? -6.893  28.260  24.775  1.00 86.11  ? 102 ARG G CB    1 
ATOM   7445  N N     . PHE D  2 103 ? -5.524  25.498  24.723  1.00 91.65  ? 103 PHE G N     1 
ATOM   7446  C CA    . PHE D  2 103 ? -5.007  24.260  25.315  1.00 92.98  ? 103 PHE G CA    1 
ATOM   7447  C C     . PHE D  2 103 ? -4.587  23.265  24.221  1.00 93.83  ? 103 PHE G C     1 
ATOM   7448  O O     . PHE D  2 103 ? -5.437  22.811  23.453  1.00 92.26  ? 103 PHE G O     1 
ATOM   7449  C CB    . PHE D  2 103 ? -6.053  23.612  26.244  1.00 97.21  ? 103 PHE G CB    1 
ATOM   7450  C CG    . PHE D  2 103 ? -6.526  24.469  27.397  1.00 101.31 ? 103 PHE G CG    1 
ATOM   7451  C CD1   . PHE D  2 103 ? -5.618  25.153  28.199  1.00 105.34 ? 103 PHE G CD1   1 
ATOM   7452  C CD2   . PHE D  2 103 ? -7.872  24.521  27.738  1.00 105.33 ? 103 PHE G CD2   1 
ATOM   7453  C CE1   . PHE D  2 103 ? -6.059  25.924  29.282  1.00 107.49 ? 103 PHE G CE1   1 
ATOM   7454  C CE2   . PHE D  2 103 ? -8.308  25.294  28.816  1.00 109.12 ? 103 PHE G CE2   1 
ATOM   7455  C CZ    . PHE D  2 103 ? -7.401  25.987  29.583  1.00 107.33 ? 103 PHE G CZ    1 
ATOM   7456  N N     . ASP D  2 104 ? -3.281  22.901  24.180  1.00 88.62  ? 104 ASP G N     1 
ATOM   7457  C CA    . ASP D  2 104 ? -2.746  21.966  23.187  1.00 86.33  ? 104 ASP G CA    1 
ATOM   7458  C C     . ASP D  2 104 ? -3.288  20.559  23.370  1.00 86.24  ? 104 ASP G C     1 
ATOM   7459  O O     . ASP D  2 104 ? -2.929  19.876  24.326  1.00 86.40  ? 104 ASP G O     1 
ATOM   7460  C CB    . ASP D  2 104 ? -1.202  21.950  23.198  1.00 88.50  ? 104 ASP G CB    1 
ATOM   7461  C CG    . ASP D  2 104 ? -0.564  20.810  22.410  1.00 103.13 ? 104 ASP G CG    1 
ATOM   7462  O OD1   . ASP D  2 104 ? -0.478  20.916  21.162  1.00 101.97 ? 104 ASP G OD1   1 
ATOM   7463  O OD2   . ASP D  2 104 ? -0.174  19.807  23.039  1.00 112.93 ? 104 ASP G OD2   1 
ATOM   7464  N N     . MET D  2 105 ? -4.150  20.130  22.440  1.00 79.26  ? 105 MET G N     1 
ATOM   7465  C CA    . MET D  2 105 ? -4.758  18.799  22.454  1.00 78.13  ? 105 MET G CA    1 
ATOM   7466  C C     . MET D  2 105 ? -4.406  18.053  21.154  1.00 76.10  ? 105 MET G C     1 
ATOM   7467  O O     . MET D  2 105 ? -5.224  17.304  20.627  1.00 74.68  ? 105 MET G O     1 
ATOM   7468  C CB    . MET D  2 105 ? -6.276  18.930  22.648  1.00 81.18  ? 105 MET G CB    1 
ATOM   7469  C CG    . MET D  2 105 ? -6.655  19.625  23.967  1.00 86.42  ? 105 MET G CG    1 
ATOM   7470  S SD    . MET D  2 105 ? -8.209  20.560  23.885  1.00 91.04  ? 105 MET G SD    1 
ATOM   7471  C CE    . MET D  2 105 ? -9.354  19.219  23.835  1.00 88.34  ? 105 MET G CE    1 
ATOM   7472  N N     . GLY D  2 106 ? -3.168  18.241  20.686  1.00 70.74  ? 106 GLY G N     1 
ATOM   7473  C CA    . GLY D  2 106 ? -2.637  17.599  19.483  1.00 68.67  ? 106 GLY G CA    1 
ATOM   7474  C C     . GLY D  2 106 ? -3.174  18.176  18.186  1.00 69.40  ? 106 GLY G C     1 
ATOM   7475  O O     . GLY D  2 106 ? -4.003  19.091  18.204  1.00 69.30  ? 106 GLY G O     1 
ATOM   7476  N N     . PHE D  2 107 ? -2.696  17.646  17.047  1.00 64.45  ? 107 PHE G N     1 
ATOM   7477  C CA    . PHE D  2 107 ? -3.146  18.051  15.699  1.00 62.41  ? 107 PHE G CA    1 
ATOM   7478  C C     . PHE D  2 107 ? -4.384  17.234  15.367  1.00 57.96  ? 107 PHE G C     1 
ATOM   7479  O O     . PHE D  2 107 ? -4.258  16.101  14.931  1.00 55.21  ? 107 PHE G O     1 
ATOM   7480  C CB    . PHE D  2 107 ? -2.035  17.838  14.656  1.00 64.31  ? 107 PHE G CB    1 
ATOM   7481  C CG    . PHE D  2 107 ? -0.677  18.419  14.969  1.00 66.50  ? 107 PHE G CG    1 
ATOM   7482  C CD1   . PHE D  2 107 ? -0.536  19.474  15.861  1.00 70.97  ? 107 PHE G CD1   1 
ATOM   7483  C CD2   . PHE D  2 107 ? 0.467   17.898  14.386  1.00 68.44  ? 107 PHE G CD2   1 
ATOM   7484  C CE1   . PHE D  2 107 ? 0.732   19.922  16.233  1.00 72.37  ? 107 PHE G CE1   1 
ATOM   7485  C CE2   . PHE D  2 107 ? 1.725   18.396  14.712  1.00 71.56  ? 107 PHE G CE2   1 
ATOM   7486  C CZ    . PHE D  2 107 ? 1.849   19.404  15.627  1.00 70.02  ? 107 PHE G CZ    1 
ATOM   7487  N N     . ASP D  2 108 ? -5.585  17.778  15.644  1.00 53.33  ? 108 ASP G N     1 
ATOM   7488  C CA    . ASP D  2 108 ? -6.841  17.014  15.523  1.00 53.02  ? 108 ASP G CA    1 
ATOM   7489  C C     . ASP D  2 108 ? -7.405  16.929  14.117  1.00 55.15  ? 108 ASP G C     1 
ATOM   7490  O O     . ASP D  2 108 ? -8.070  15.940  13.798  1.00 54.43  ? 108 ASP G O     1 
ATOM   7491  C CB    . ASP D  2 108 ? -7.911  17.502  16.508  1.00 55.94  ? 108 ASP G CB    1 
ATOM   7492  C CG    . ASP D  2 108 ? -8.277  18.974  16.471  1.00 62.79  ? 108 ASP G CG    1 
ATOM   7493  O OD1   . ASP D  2 108 ? -7.488  19.769  15.917  1.00 61.68  ? 108 ASP G OD1   1 
ATOM   7494  O OD2   . ASP D  2 108 ? -9.304  19.349  17.096  1.00 73.75  ? 108 ASP G OD2   1 
ATOM   7495  N N     . TYR D  2 109 ? -7.111  17.898  13.254  1.00 51.47  ? 109 TYR G N     1 
ATOM   7496  C CA    . TYR D  2 109 ? -7.565  17.801  11.860  1.00 50.15  ? 109 TYR G CA    1 
ATOM   7497  C C     . TYR D  2 109 ? -6.405  18.094  10.948  1.00 51.36  ? 109 TYR G C     1 
ATOM   7498  O O     . TYR D  2 109 ? -5.653  19.020  11.196  1.00 49.76  ? 109 TYR G O     1 
ATOM   7499  C CB    . TYR D  2 109 ? -8.758  18.722  11.596  1.00 51.17  ? 109 TYR G CB    1 
ATOM   7500  C CG    . TYR D  2 109 ? -10.032 18.193  12.207  1.00 52.36  ? 109 TYR G CG    1 
ATOM   7501  C CD1   . TYR D  2 109 ? -10.853 17.329  11.506  1.00 53.91  ? 109 TYR G CD1   1 
ATOM   7502  C CD2   . TYR D  2 109 ? -10.440 18.595  13.474  1.00 54.18  ? 109 TYR G CD2   1 
ATOM   7503  C CE1   . TYR D  2 109 ? -12.039 16.854  12.055  1.00 55.65  ? 109 TYR G CE1   1 
ATOM   7504  C CE2   . TYR D  2 109 ? -11.623 18.122  14.036  1.00 55.78  ? 109 TYR G CE2   1 
ATOM   7505  C CZ    . TYR D  2 109 ? -12.424 17.255  13.318  1.00 61.73  ? 109 TYR G CZ    1 
ATOM   7506  O OH    . TYR D  2 109 ? -13.606 16.775  13.833  1.00 68.88  ? 109 TYR G OH    1 
ATOM   7507  N N     . TRP D  2 110 ? -6.260  17.286  9.905   1.00 50.24  ? 110 TRP G N     1 
ATOM   7508  C CA    . TRP D  2 110 ? -5.172  17.378  8.938   1.00 49.73  ? 110 TRP G CA    1 
ATOM   7509  C C     . TRP D  2 110 ? -5.754  17.580  7.546   1.00 51.47  ? 110 TRP G C     1 
ATOM   7510  O O     . TRP D  2 110 ? -6.835  17.093  7.250   1.00 49.17  ? 110 TRP G O     1 
ATOM   7511  C CB    . TRP D  2 110 ? -4.349  16.056  8.936   1.00 48.49  ? 110 TRP G CB    1 
ATOM   7512  C CG    . TRP D  2 110 ? -3.617  15.768  10.208  1.00 51.25  ? 110 TRP G CG    1 
ATOM   7513  C CD1   . TRP D  2 110 ? -4.165  15.518  11.435  1.00 55.41  ? 110 TRP G CD1   1 
ATOM   7514  C CD2   . TRP D  2 110 ? -2.193  15.665  10.375  1.00 51.02  ? 110 TRP G CD2   1 
ATOM   7515  N NE1   . TRP D  2 110 ? -3.175  15.323  12.363  1.00 55.37  ? 110 TRP G NE1   1 
ATOM   7516  C CE2   . TRP D  2 110 ? -1.952  15.389  11.738  1.00 55.99  ? 110 TRP G CE2   1 
ATOM   7517  C CE3   . TRP D  2 110 ? -1.093  15.782  9.500   1.00 51.20  ? 110 TRP G CE3   1 
ATOM   7518  C CZ2   . TRP D  2 110 ? -0.657  15.202  12.244  1.00 54.85  ? 110 TRP G CZ2   1 
ATOM   7519  C CZ3   . TRP D  2 110 ? 0.186   15.602  9.996   1.00 52.15  ? 110 TRP G CZ3   1 
ATOM   7520  C CH2   . TRP D  2 110 ? 0.402   15.350  11.359  1.00 53.99  ? 110 TRP G CH2   1 
ATOM   7521  N N     . GLY D  2 111 ? -4.989  18.233  6.682   1.00 49.16  ? 111 GLY G N     1 
ATOM   7522  C CA    . GLY D  2 111 ? -5.314  18.300  5.261   1.00 48.07  ? 111 GLY G CA    1 
ATOM   7523  C C     . GLY D  2 111 ? -4.953  16.990  4.587   1.00 49.78  ? 111 GLY G C     1 
ATOM   7524  O O     . GLY D  2 111 ? -4.336  16.121  5.199   1.00 50.12  ? 111 GLY G O     1 
ATOM   7525  N N     . GLN D  2 112 ? -5.315  16.822  3.329   1.00 45.55  ? 112 GLN G N     1 
ATOM   7526  C CA    . GLN D  2 112 ? -5.072  15.555  2.632   1.00 44.72  ? 112 GLN G CA    1 
ATOM   7527  C C     . GLN D  2 112 ? -3.652  15.350  2.163   1.00 47.40  ? 112 GLN G C     1 
ATOM   7528  O O     . GLN D  2 112 ? -3.367  14.270  1.648   1.00 48.79  ? 112 GLN G O     1 
ATOM   7529  C CB    . GLN D  2 112 ? -6.056  15.346  1.441   1.00 45.16  ? 112 GLN G CB    1 
ATOM   7530  C CG    . GLN D  2 112 ? -5.658  15.995  0.087   1.00 43.82  ? 112 GLN G CG    1 
ATOM   7531  C CD    . GLN D  2 112 ? -5.927  17.480  0.054   1.00 52.99  ? 112 GLN G CD    1 
ATOM   7532  O OE1   . GLN D  2 112 ? -6.206  18.102  1.072   1.00 48.33  ? 112 GLN G OE1   1 
ATOM   7533  N NE2   . GLN D  2 112 ? -5.966  18.069  -1.128  1.00 42.30  ? 112 GLN G NE2   1 
ATOM   7534  N N     . GLY D  2 113 ? -2.806  16.373  2.280   1.00 42.42  ? 113 GLY G N     1 
ATOM   7535  C CA    . GLY D  2 113 ? -1.439  16.302  1.817   1.00 42.95  ? 113 GLY G CA    1 
ATOM   7536  C C     . GLY D  2 113 ? -1.265  16.832  0.405   1.00 45.75  ? 113 GLY G C     1 
ATOM   7537  O O     . GLY D  2 113 ? -2.193  16.788  -0.428  1.00 43.81  ? 113 GLY G O     1 
ATOM   7538  N N     . THR D  2 114 ? -0.071  17.397  0.160   1.00 43.43  ? 114 THR G N     1 
ATOM   7539  C CA    . THR D  2 114 ? 0.338   17.927  -1.156  1.00 43.73  ? 114 THR G CA    1 
ATOM   7540  C C     . THR D  2 114 ? 1.672   17.296  -1.468  1.00 46.76  ? 114 THR G C     1 
ATOM   7541  O O     . THR D  2 114 ? 2.624   17.477  -0.699  1.00 47.88  ? 114 THR G O     1 
ATOM   7542  C CB    . THR D  2 114 ? 0.502   19.465  -1.170  1.00 50.15  ? 114 THR G CB    1 
ATOM   7543  O OG1   . THR D  2 114 ? -0.731  20.109  -0.855  1.00 46.87  ? 114 THR G OG1   1 
ATOM   7544  C CG2   . THR D  2 114 ? 1.012   19.961  -2.511  1.00 46.16  ? 114 THR G CG2   1 
ATOM   7545  N N     . THR D  2 115 ? 1.751   16.571  -2.567  1.00 43.27  ? 115 THR G N     1 
ATOM   7546  C CA    . THR D  2 115 ? 2.999   15.939  -2.996  1.00 44.25  ? 115 THR G CA    1 
ATOM   7547  C C     . THR D  2 115 ? 3.849   16.970  -3.748  1.00 49.74  ? 115 THR G C     1 
ATOM   7548  O O     . THR D  2 115 ? 3.338   17.702  -4.602  1.00 47.70  ? 115 THR G O     1 
ATOM   7549  C CB    . THR D  2 115 ? 2.726   14.682  -3.832  1.00 53.45  ? 115 THR G CB    1 
ATOM   7550  O OG1   . THR D  2 115 ? 1.877   13.817  -3.091  1.00 55.94  ? 115 THR G OG1   1 
ATOM   7551  C CG2   . THR D  2 115 ? 4.006   13.908  -4.180  1.00 54.47  ? 115 THR G CG2   1 
ATOM   7552  N N     . VAL D  2 116 ? 5.128   17.080  -3.344  1.00 49.57  ? 116 VAL G N     1 
ATOM   7553  C CA    . VAL D  2 116 ? 6.128   17.943  -3.969  1.00 49.63  ? 116 VAL G CA    1 
ATOM   7554  C C     . VAL D  2 116 ? 7.295   17.071  -4.398  1.00 51.24  ? 116 VAL G C     1 
ATOM   7555  O O     . VAL D  2 116 ? 7.872   16.362  -3.581  1.00 49.71  ? 116 VAL G O     1 
ATOM   7556  C CB    . VAL D  2 116 ? 6.629   19.081  -3.053  1.00 53.73  ? 116 VAL G CB    1 
ATOM   7557  C CG1   . VAL D  2 116 ? 7.672   19.937  -3.781  1.00 53.91  ? 116 VAL G CG1   1 
ATOM   7558  C CG2   . VAL D  2 116 ? 5.472   19.939  -2.533  1.00 53.19  ? 116 VAL G CG2   1 
ATOM   7559  N N     . THR D  2 117 ? 7.653   17.139  -5.666  1.00 47.63  ? 117 THR G N     1 
ATOM   7560  C CA    . THR D  2 117 ? 8.809   16.431  -6.202  1.00 46.96  ? 117 THR G CA    1 
ATOM   7561  C C     . THR D  2 117 ? 9.826   17.472  -6.607  1.00 49.38  ? 117 THR G C     1 
ATOM   7562  O O     . THR D  2 117 ? 9.490   18.404  -7.321  1.00 49.42  ? 117 THR G O     1 
ATOM   7563  C CB    . THR D  2 117 ? 8.394   15.530  -7.368  1.00 53.61  ? 117 THR G CB    1 
ATOM   7564  O OG1   . THR D  2 117 ? 7.335   14.688  -6.916  1.00 54.69  ? 117 THR G OG1   1 
ATOM   7565  C CG2   . THR D  2 117 ? 9.528   14.667  -7.857  1.00 51.85  ? 117 THR G CG2   1 
ATOM   7566  N N     . VAL D  2 118 ? 11.062  17.317  -6.151  1.00 47.50  ? 118 VAL G N     1 
ATOM   7567  C CA    . VAL D  2 118 ? 12.177  18.226  -6.468  1.00 47.87  ? 118 VAL G CA    1 
ATOM   7568  C C     . VAL D  2 118 ? 13.162  17.408  -7.318  1.00 51.24  ? 118 VAL G C     1 
ATOM   7569  O O     . VAL D  2 118 ? 13.673  16.408  -6.840  1.00 50.19  ? 118 VAL G O     1 
ATOM   7570  C CB    . VAL D  2 118 ? 12.804  18.833  -5.197  1.00 50.93  ? 118 VAL G CB    1 
ATOM   7571  C CG1   . VAL D  2 118 ? 13.936  19.794  -5.557  1.00 51.66  ? 118 VAL G CG1   1 
ATOM   7572  C CG2   . VAL D  2 118 ? 11.733  19.531  -4.361  1.00 50.24  ? 118 VAL G CG2   1 
ATOM   7573  N N     . SER D  2 119 ? 13.328  17.772  -8.598  1.00 49.50  ? 119 SER G N     1 
ATOM   7574  C CA    . SER D  2 119 ? 14.130  16.993  -9.548  1.00 50.59  ? 119 SER G CA    1 
ATOM   7575  C C     . SER D  2 119 ? 14.592  17.799  -10.789 1.00 59.15  ? 119 SER G C     1 
ATOM   7576  O O     . SER D  2 119 ? 13.894  18.710  -11.222 1.00 58.61  ? 119 SER G O     1 
ATOM   7577  C CB    . SER D  2 119 ? 13.286  15.815  -10.028 1.00 49.27  ? 119 SER G CB    1 
ATOM   7578  O OG    . SER D  2 119 ? 13.832  15.129  -11.144 1.00 49.58  ? 119 SER G OG    1 
ATOM   7579  N N     . SER D  2 120 ? 15.697  17.368  -11.430 1.00 59.53  ? 120 SER G N     1 
ATOM   7580  C CA    . SER D  2 120 ? 16.182  18.009  -12.667 1.00 61.23  ? 120 SER G CA    1 
ATOM   7581  C C     . SER D  2 120 ? 15.488  17.486  -13.924 1.00 65.17  ? 120 SER G C     1 
ATOM   7582  O O     . SER D  2 120 ? 15.481  18.182  -14.935 1.00 65.31  ? 120 SER G O     1 
ATOM   7583  C CB    . SER D  2 120 ? 17.690  17.905  -12.779 1.00 65.37  ? 120 SER G CB    1 
ATOM   7584  O OG    . SER D  2 120 ? 18.227  18.687  -11.725 1.00 74.37  ? 120 SER G OG    1 
ATOM   7585  N N     . ALA D  2 121 ? 14.852  16.297  -13.845 1.00 60.79  ? 121 ALA G N     1 
ATOM   7586  C CA    . ALA D  2 121 ? 14.021  15.762  -14.924 1.00 61.48  ? 121 ALA G CA    1 
ATOM   7587  C C     . ALA D  2 121 ? 12.746  16.658  -14.912 1.00 71.73  ? 121 ALA G C     1 
ATOM   7588  O O     . ALA D  2 121 ? 12.449  17.169  -13.826 1.00 72.66  ? 121 ALA G O     1 
ATOM   7589  C CB    . ALA D  2 121 ? 13.656  14.316  -14.595 1.00 61.25  ? 121 ALA G CB    1 
ATOM   7590  N N     . SER D  2 122 ? 12.038  17.017  -16.006 1.00 71.09  ? 122 SER G N     1 
ATOM   7591  C CA    . SER D  2 122 ? 11.965  16.630  -17.416 1.00 71.51  ? 122 SER G CA    1 
ATOM   7592  C C     . SER D  2 122 ? 10.887  15.559  -17.536 1.00 69.20  ? 122 SER G C     1 
ATOM   7593  O O     . SER D  2 122 ? 11.152  14.361  -17.396 1.00 67.22  ? 122 SER G O     1 
ATOM   7594  C CB    . SER D  2 122 ? 13.300  16.273  -18.059 1.00 80.64  ? 122 SER G CB    1 
ATOM   7595  O OG    . SER D  2 122 ? 14.235  17.329  -17.878 1.00 96.91  ? 122 SER G OG    1 
ATOM   7596  N N     . THR D  2 123 ? 9.633   16.029  -17.748 1.00 63.14  ? 123 THR G N     1 
ATOM   7597  C CA    . THR D  2 123 ? 8.464   15.152  -17.825 1.00 61.13  ? 123 THR G CA    1 
ATOM   7598  C C     . THR D  2 123 ? 8.687   14.188  -18.983 1.00 62.97  ? 123 THR G C     1 
ATOM   7599  O O     . THR D  2 123 ? 9.178   14.578  -20.046 1.00 63.57  ? 123 THR G O     1 
ATOM   7600  C CB    . THR D  2 123 ? 7.050   15.859  -17.786 1.00 66.33  ? 123 THR G CB    1 
ATOM   7601  O OG1   . THR D  2 123 ? 6.202   15.357  -18.817 1.00 65.65  ? 123 THR G OG1   1 
ATOM   7602  C CG2   . THR D  2 123 ? 7.078   17.357  -17.809 1.00 64.02  ? 123 THR G CG2   1 
ATOM   7603  N N     . LYS D  2 124 ? 8.446   12.905  -18.717 1.00 56.87  ? 124 LYS G N     1 
ATOM   7604  C CA    . LYS D  2 124 ? 8.715   11.843  -19.676 1.00 54.82  ? 124 LYS G CA    1 
ATOM   7605  C C     . LYS D  2 124 ? 7.769   10.696  -19.444 1.00 56.68  ? 124 LYS G C     1 
ATOM   7606  O O     . LYS D  2 124 ? 7.516   10.327  -18.305 1.00 53.35  ? 124 LYS G O     1 
ATOM   7607  C CB    . LYS D  2 124 ? 10.167  11.375  -19.514 1.00 54.84  ? 124 LYS G CB    1 
ATOM   7608  C CG    . LYS D  2 124 ? 10.661  10.456  -20.602 1.00 59.42  ? 124 LYS G CG    1 
ATOM   7609  C CD    . LYS D  2 124 ? 12.101  10.040  -20.352 1.00 65.13  ? 124 LYS G CD    1 
ATOM   7610  C CE    . LYS D  2 124 ? 12.503  8.860   -21.197 1.00 83.80  ? 124 LYS G CE    1 
ATOM   7611  N NZ    . LYS D  2 124 ? 13.949  8.532   -21.040 1.00 101.35 ? 124 LYS G NZ    1 
ATOM   7612  N N     . GLY D  2 125 ? 7.257   10.148  -20.534 1.00 54.95  ? 125 GLY G N     1 
ATOM   7613  C CA    . GLY D  2 125 ? 6.350   9.008   -20.511 1.00 53.03  ? 125 GLY G CA    1 
ATOM   7614  C C     . GLY D  2 125 ? 7.118   7.715   -20.456 1.00 54.46  ? 125 GLY G C     1 
ATOM   7615  O O     . GLY D  2 125 ? 8.267   7.649   -20.914 1.00 54.00  ? 125 GLY G O     1 
ATOM   7616  N N     . PRO D  2 126 ? 6.490   6.658   -19.906 1.00 50.50  ? 126 PRO G N     1 
ATOM   7617  C CA    . PRO D  2 126 ? 7.196   5.376   -19.784 1.00 49.70  ? 126 PRO G CA    1 
ATOM   7618  C C     . PRO D  2 126 ? 7.333   4.596   -21.069 1.00 55.68  ? 126 PRO G C     1 
ATOM   7619  O O     . PRO D  2 126 ? 6.501   4.709   -21.969 1.00 55.72  ? 126 PRO G O     1 
ATOM   7620  C CB    . PRO D  2 126 ? 6.307   4.566   -18.813 1.00 50.86  ? 126 PRO G CB    1 
ATOM   7621  C CG    . PRO D  2 126 ? 4.952   5.162   -18.942 1.00 54.39  ? 126 PRO G CG    1 
ATOM   7622  C CD    . PRO D  2 126 ? 5.148   6.607   -19.278 1.00 51.12  ? 126 PRO G CD    1 
ATOM   7623  N N     . SER D  2 127 ? 8.359   3.732   -21.093 1.00 53.26  ? 127 SER G N     1 
ATOM   7624  C CA    . SER D  2 127 ? 8.565   2.693   -22.080 1.00 52.93  ? 127 SER G CA    1 
ATOM   7625  C C     . SER D  2 127 ? 7.959   1.503   -21.323 1.00 55.91  ? 127 SER G C     1 
ATOM   7626  O O     . SER D  2 127 ? 8.236   1.337   -20.133 1.00 55.17  ? 127 SER G O     1 
ATOM   7627  C CB    . SER D  2 127 ? 10.048  2.476   -22.361 1.00 57.51  ? 127 SER G CB    1 
ATOM   7628  O OG    . SER D  2 127 ? 10.660  3.654   -22.863 1.00 69.11  ? 127 SER G OG    1 
ATOM   7629  N N     . VAL D  2 128 ? 7.039   0.772   -21.956 1.00 51.61  ? 128 VAL G N     1 
ATOM   7630  C CA    . VAL D  2 128 ? 6.333   -0.349  -21.345 1.00 49.00  ? 128 VAL G CA    1 
ATOM   7631  C C     . VAL D  2 128 ? 6.841   -1.598  -22.026 1.00 55.02  ? 128 VAL G C     1 
ATOM   7632  O O     . VAL D  2 128 ? 6.684   -1.746  -23.246 1.00 55.38  ? 128 VAL G O     1 
ATOM   7633  C CB    . VAL D  2 128 ? 4.799   -0.193  -21.451 1.00 50.72  ? 128 VAL G CB    1 
ATOM   7634  C CG1   . VAL D  2 128 ? 4.081   -1.365  -20.803 1.00 48.72  ? 128 VAL G CG1   1 
ATOM   7635  C CG2   . VAL D  2 128 ? 4.343   1.119   -20.812 1.00 49.90  ? 128 VAL G CG2   1 
ATOM   7636  N N     . PHE D  2 129 ? 7.460   -2.493  -21.233 1.00 50.51  ? 129 PHE G N     1 
ATOM   7637  C CA    . PHE D  2 129 ? 8.080   -3.712  -21.724 1.00 49.03  ? 129 PHE G CA    1 
ATOM   7638  C C     . PHE D  2 129 ? 7.372   -4.889  -21.146 1.00 54.94  ? 129 PHE G C     1 
ATOM   7639  O O     . PHE D  2 129 ? 6.996   -4.855  -19.980 1.00 53.79  ? 129 PHE G O     1 
ATOM   7640  C CB    . PHE D  2 129 ? 9.551   -3.748  -21.336 1.00 49.66  ? 129 PHE G CB    1 
ATOM   7641  C CG    . PHE D  2 129 ? 10.349  -2.601  -21.905 1.00 50.57  ? 129 PHE G CG    1 
ATOM   7642  C CD1   . PHE D  2 129 ? 10.420  -2.395  -23.278 1.00 52.45  ? 129 PHE G CD1   1 
ATOM   7643  C CD2   . PHE D  2 129 ? 11.019  -1.717  -21.071 1.00 51.40  ? 129 PHE G CD2   1 
ATOM   7644  C CE1   . PHE D  2 129 ? 11.165  -1.348  -23.806 1.00 53.27  ? 129 PHE G CE1   1 
ATOM   7645  C CE2   . PHE D  2 129 ? 11.779  -0.681  -21.602 1.00 54.73  ? 129 PHE G CE2   1 
ATOM   7646  C CZ    . PHE D  2 129 ? 11.869  -0.517  -22.969 1.00 52.98  ? 129 PHE G CZ    1 
ATOM   7647  N N     . PRO D  2 130 ? 7.176   -5.964  -21.940 1.00 53.08  ? 130 PRO G N     1 
ATOM   7648  C CA    . PRO D  2 130 ? 6.473   -7.142  -21.413 1.00 51.46  ? 130 PRO G CA    1 
ATOM   7649  C C     . PRO D  2 130 ? 7.346   -7.986  -20.489 1.00 54.11  ? 130 PRO G C     1 
ATOM   7650  O O     . PRO D  2 130 ? 8.563   -8.019  -20.658 1.00 53.04  ? 130 PRO G O     1 
ATOM   7651  C CB    . PRO D  2 130 ? 6.106   -7.902  -22.692 1.00 52.54  ? 130 PRO G CB    1 
ATOM   7652  C CG    . PRO D  2 130 ? 7.223   -7.620  -23.591 1.00 56.97  ? 130 PRO G CG    1 
ATOM   7653  C CD    . PRO D  2 130 ? 7.588   -6.180  -23.341 1.00 53.91  ? 130 PRO G CD    1 
ATOM   7654  N N     . LEU D  2 131 ? 6.710   -8.643  -19.505 1.00 51.82  ? 131 LEU G N     1 
ATOM   7655  C CA    . LEU D  2 131 ? 7.344   -9.558  -18.555 1.00 52.12  ? 131 LEU G CA    1 
ATOM   7656  C C     . LEU D  2 131 ? 6.699   -10.920 -18.804 1.00 58.14  ? 131 LEU G C     1 
ATOM   7657  O O     . LEU D  2 131 ? 5.494   -11.075 -18.604 1.00 55.54  ? 131 LEU G O     1 
ATOM   7658  C CB    . LEU D  2 131 ? 7.156   -9.137  -17.068 1.00 51.64  ? 131 LEU G CB    1 
ATOM   7659  C CG    . LEU D  2 131 ? 7.872   -7.852  -16.590 1.00 55.70  ? 131 LEU G CG    1 
ATOM   7660  C CD1   . LEU D  2 131 ? 7.368   -7.411  -15.202 1.00 54.78  ? 131 LEU G CD1   1 
ATOM   7661  C CD2   . LEU D  2 131 ? 9.332   -8.042  -16.561 1.00 58.82  ? 131 LEU G CD2   1 
ATOM   7662  N N     . ALA D  2 132 ? 7.477   -11.879 -19.322 1.00 59.69  ? 132 ALA G N     1 
ATOM   7663  C CA    . ALA D  2 132 ? 6.951   -13.205 -19.639 1.00 60.75  ? 132 ALA G CA    1 
ATOM   7664  C C     . ALA D  2 132 ? 7.990   -14.286 -19.423 1.00 68.35  ? 132 ALA G C     1 
ATOM   7665  O O     . ALA D  2 132 ? 9.191   -14.036 -19.596 1.00 66.45  ? 132 ALA G O     1 
ATOM   7666  C CB    . ALA D  2 132 ? 6.479   -13.232 -21.076 1.00 61.81  ? 132 ALA G CB    1 
ATOM   7667  N N     . PRO D  2 133 ? 7.547   -15.505 -19.052 1.00 70.62  ? 133 PRO G N     1 
ATOM   7668  C CA    . PRO D  2 133 ? 8.507   -16.606 -18.833 1.00 72.99  ? 133 PRO G CA    1 
ATOM   7669  C C     . PRO D  2 133 ? 9.262   -16.978 -20.092 1.00 85.66  ? 133 PRO G C     1 
ATOM   7670  O O     . PRO D  2 133 ? 8.675   -16.990 -21.170 1.00 84.39  ? 133 PRO G O     1 
ATOM   7671  C CB    . PRO D  2 133 ? 7.623   -17.750 -18.363 1.00 73.85  ? 133 PRO G CB    1 
ATOM   7672  C CG    . PRO D  2 133 ? 6.275   -17.412 -18.897 1.00 77.11  ? 133 PRO G CG    1 
ATOM   7673  C CD    . PRO D  2 133 ? 6.163   -15.956 -18.816 1.00 72.18  ? 133 PRO G CD    1 
ATOM   7674  N N     . CYS D  2 134 ? 10.569  -17.241 -19.953 1.00 91.22  ? 134 CYS G N     1 
ATOM   7675  C CA    . CYS D  2 134 ? 11.436  -17.605 -21.071 1.00 95.40  ? 134 CYS G CA    1 
ATOM   7676  C C     . CYS D  2 134 ? 11.002  -18.944 -21.689 1.00 101.67 ? 134 CYS G C     1 
ATOM   7677  O O     . CYS D  2 134 ? 11.038  -19.074 -22.908 1.00 100.88 ? 134 CYS G O     1 
ATOM   7678  C CB    . CYS D  2 134 ? 12.902  -17.628 -20.634 1.00 98.21  ? 134 CYS G CB    1 
ATOM   7679  S SG    . CYS D  2 134 ? 14.063  -18.178 -21.917 1.00 104.09 ? 134 CYS G SG    1 
ATOM   7680  N N     . SER D  2 135 ? 10.557  -19.913 -20.868 1.00 101.33 ? 135 SER G N     1 
ATOM   7681  C CA    . SER D  2 135 ? 10.124  -21.224 -21.370 1.00 102.53 ? 135 SER G CA    1 
ATOM   7682  C C     . SER D  2 135 ? 8.965   -21.809 -20.559 1.00 109.01 ? 135 SER G C     1 
ATOM   7683  O O     . SER D  2 135 ? 9.129   -22.863 -19.944 1.00 108.79 ? 135 SER G O     1 
ATOM   7684  C CB    . SER D  2 135 ? 11.303  -22.200 -21.376 1.00 106.53 ? 135 SER G CB    1 
ATOM   7685  O OG    . SER D  2 135 ? 11.801  -22.446 -20.069 1.00 113.53 ? 135 SER G OG    1 
ATOM   7686  N N     . ARG D  2 136 ? 7.786   -21.159 -20.579 1.00 107.71 ? 136 ARG G N     1 
ATOM   7687  C CA    . ARG D  2 136 ? 6.615   -21.681 -19.851 1.00 108.40 ? 136 ARG G CA    1 
ATOM   7688  C C     . ARG D  2 136 ? 5.976   -22.893 -20.542 1.00 114.57 ? 136 ARG G C     1 
ATOM   7689  O O     . ARG D  2 136 ? 4.871   -22.819 -21.095 1.00 113.79 ? 136 ARG G O     1 
ATOM   7690  C CB    . ARG D  2 136 ? 5.557   -20.608 -19.549 1.00 108.20 ? 136 ARG G CB    1 
ATOM   7691  N N     . SER D  2 137 ? 6.694   -24.015 -20.486 1.00 113.19 ? 137 SER G N     1 
ATOM   7692  C CA    . SER D  2 137 ? 6.230   -25.307 -20.961 1.00 113.57 ? 137 SER G CA    1 
ATOM   7693  C C     . SER D  2 137 ? 5.864   -25.968 -19.623 1.00 118.22 ? 137 SER G C     1 
ATOM   7694  O O     . SER D  2 137 ? 4.681   -26.013 -19.282 1.00 117.51 ? 137 SER G O     1 
ATOM   7695  C CB    . SER D  2 137 ? 7.328   -26.033 -21.745 1.00 117.48 ? 137 SER G CB    1 
ATOM   7696  O OG    . SER D  2 137 ? 7.499   -25.444 -23.025 1.00 124.97 ? 137 SER G OG    1 
ATOM   7697  N N     . THR D  2 138 ? 6.885   -26.303 -18.799 1.00 115.37 ? 138 THR G N     1 
ATOM   7698  C CA    . THR D  2 138 ? 6.768   -26.794 -17.419 1.00 115.26 ? 138 THR G CA    1 
ATOM   7699  C C     . THR D  2 138 ? 5.674   -27.866 -17.141 1.00 117.91 ? 138 THR G C     1 
ATOM   7700  O O     . THR D  2 138 ? 5.038   -28.415 -18.050 1.00 116.87 ? 138 THR G O     1 
ATOM   7701  C CB    . THR D  2 138 ? 6.553   -25.565 -16.474 1.00 121.13 ? 138 THR G CB    1 
ATOM   7702  O OG1   . THR D  2 138 ? 5.188   -25.132 -16.535 1.00 117.56 ? 138 THR G OG1   1 
ATOM   7703  C CG2   . THR D  2 138 ? 7.497   -24.398 -16.787 1.00 118.16 ? 138 THR G CG2   1 
ATOM   7704  N N     . SER D  2 139 ? 5.558   -28.212 -15.854 1.00 113.47 ? 139 SER G N     1 
ATOM   7705  C CA    . SER D  2 139 ? 4.551   -29.098 -15.295 1.00 112.44 ? 139 SER G CA    1 
ATOM   7706  C C     . SER D  2 139 ? 3.730   -28.336 -14.222 1.00 113.17 ? 139 SER G C     1 
ATOM   7707  O O     . SER D  2 139 ? 2.811   -28.920 -13.642 1.00 112.59 ? 139 SER G O     1 
ATOM   7708  C CB    . SER D  2 139 ? 5.241   -30.305 -14.667 1.00 117.26 ? 139 SER G CB    1 
ATOM   7709  O OG    . SER D  2 139 ? 6.210   -30.850 -15.552 1.00 126.32 ? 139 SER G OG    1 
ATOM   7710  N N     . GLU D  2 140 ? 4.044   -27.025 -13.982 1.00 107.07 ? 140 GLU G N     1 
ATOM   7711  C CA    . GLU D  2 140 ? 3.373   -26.187 -12.981 1.00 105.28 ? 140 GLU G CA    1 
ATOM   7712  C C     . GLU D  2 140 ? 2.102   -25.590 -13.591 1.00 103.66 ? 140 GLU G C     1 
ATOM   7713  O O     . GLU D  2 140 ? 2.078   -25.245 -14.775 1.00 102.15 ? 140 GLU G O     1 
ATOM   7714  C CB    . GLU D  2 140 ? 4.328   -25.078 -12.471 1.00 106.85 ? 140 GLU G CB    1 
ATOM   7715  C CG    . GLU D  2 140 ? 3.953   -24.471 -11.118 1.00 116.76 ? 140 GLU G CG    1 
ATOM   7716  C CD    . GLU D  2 140 ? 4.976   -24.608 -10.000 1.00 131.72 ? 140 GLU G CD    1 
ATOM   7717  O OE1   . GLU D  2 140 ? 4.560   -24.814 -8.836  1.00 118.23 ? 140 GLU G OE1   1 
ATOM   7718  O OE2   . GLU D  2 140 ? 6.189   -24.470 -10.278 1.00 121.10 ? 140 GLU G OE2   1 
ATOM   7719  N N     . SER D  2 141 ? 1.048   -25.492 -12.777 1.00 97.51  ? 141 SER G N     1 
ATOM   7720  C CA    . SER D  2 141 ? -0.268  -25.019 -13.197 1.00 96.35  ? 141 SER G CA    1 
ATOM   7721  C C     . SER D  2 141 ? -0.451  -23.495 -13.190 1.00 96.02  ? 141 SER G C     1 
ATOM   7722  O O     . SER D  2 141 ? -1.431  -23.024 -13.775 1.00 95.61  ? 141 SER G O     1 
ATOM   7723  C CB    . SER D  2 141 ? -1.346  -25.663 -12.327 1.00 101.52 ? 141 SER G CB    1 
ATOM   7724  O OG    . SER D  2 141 ? -1.066  -25.480 -10.947 1.00 113.19 ? 141 SER G OG    1 
ATOM   7725  N N     . THR D  2 142 ? 0.441   -22.728 -12.521 1.00 89.05  ? 142 THR G N     1 
ATOM   7726  C CA    . THR D  2 142 ? 0.315   -21.265 -12.448 1.00 87.08  ? 142 THR G CA    1 
ATOM   7727  C C     . THR D  2 142 ? 1.541   -20.533 -13.041 1.00 84.51  ? 142 THR G C     1 
ATOM   7728  O O     . THR D  2 142 ? 2.680   -20.787 -12.637 1.00 82.88  ? 142 THR G O     1 
ATOM   7729  C CB    . THR D  2 142 ? 0.001   -20.847 -11.008 1.00 97.21  ? 142 THR G CB    1 
ATOM   7730  O OG1   . THR D  2 142 ? -1.247  -21.441 -10.640 1.00 96.17  ? 142 THR G OG1   1 
ATOM   7731  C CG2   . THR D  2 142 ? -0.104  -19.327 -10.839 1.00 97.01  ? 142 THR G CG2   1 
ATOM   7732  N N     . ALA D  2 143 ? 1.276   -19.610 -13.997 1.00 77.67  ? 143 ALA G N     1 
ATOM   7733  C CA    . ALA D  2 143 ? 2.295   -18.787 -14.652 1.00 75.83  ? 143 ALA G CA    1 
ATOM   7734  C C     . ALA D  2 143 ? 2.126   -17.309 -14.277 1.00 74.64  ? 143 ALA G C     1 
ATOM   7735  O O     . ALA D  2 143 ? 1.005   -16.820 -14.143 1.00 73.07  ? 143 ALA G O     1 
ATOM   7736  C CB    . ALA D  2 143 ? 2.187   -18.925 -16.157 1.00 76.12  ? 143 ALA G CB    1 
ATOM   7737  N N     . ALA D  2 144 ? 3.247   -16.600 -14.176 1.00 68.44  ? 144 ALA G N     1 
ATOM   7738  C CA    . ALA D  2 144 ? 3.266   -15.174 -13.884 1.00 67.16  ? 144 ALA G CA    1 
ATOM   7739  C C     . ALA D  2 144 ? 3.604   -14.407 -15.178 1.00 68.65  ? 144 ALA G C     1 
ATOM   7740  O O     . ALA D  2 144 ? 4.463   -14.831 -15.954 1.00 66.20  ? 144 ALA G O     1 
ATOM   7741  C CB    . ALA D  2 144 ? 4.312   -14.868 -12.818 1.00 67.68  ? 144 ALA G CB    1 
ATOM   7742  N N     . LEU D  2 145 ? 2.906   -13.303 -15.418 1.00 65.58  ? 145 LEU G N     1 
ATOM   7743  C CA    . LEU D  2 145 ? 3.227   -12.401 -16.527 1.00 65.91  ? 145 LEU G CA    1 
ATOM   7744  C C     . LEU D  2 145 ? 3.074   -10.951 -16.063 1.00 64.21  ? 145 LEU G C     1 
ATOM   7745  O O     . LEU D  2 145 ? 2.381   -10.684 -15.091 1.00 64.05  ? 145 LEU G O     1 
ATOM   7746  C CB    . LEU D  2 145 ? 2.442   -12.733 -17.821 1.00 66.79  ? 145 LEU G CB    1 
ATOM   7747  C CG    . LEU D  2 145 ? 0.935   -12.914 -17.718 1.00 72.13  ? 145 LEU G CG    1 
ATOM   7748  C CD1   . LEU D  2 145 ? 0.207   -11.589 -17.850 1.00 74.47  ? 145 LEU G CD1   1 
ATOM   7749  C CD2   . LEU D  2 145 ? 0.444   -13.801 -18.810 1.00 69.47  ? 145 LEU G CD2   1 
ATOM   7750  N N     . GLY D  2 146 ? 3.737   -10.032 -16.727 1.00 57.89  ? 146 GLY G N     1 
ATOM   7751  C CA    . GLY D  2 146 ? 3.656   -8.637  -16.328 1.00 57.09  ? 146 GLY G CA    1 
ATOM   7752  C C     . GLY D  2 146 ? 4.079   -7.578  -17.336 1.00 59.58  ? 146 GLY G C     1 
ATOM   7753  O O     . GLY D  2 146 ? 4.277   -7.841  -18.531 1.00 57.40  ? 146 GLY G O     1 
ATOM   7754  N N     . CYS D  2 147 ? 4.232   -6.362  -16.815 1.00 55.79  ? 147 CYS G N     1 
ATOM   7755  C CA    . CYS D  2 147 ? 4.638   -5.169  -17.547 1.00 56.15  ? 147 CYS G CA    1 
ATOM   7756  C C     . CYS D  2 147 ? 5.622   -4.418  -16.702 1.00 51.28  ? 147 CYS G C     1 
ATOM   7757  O O     . CYS D  2 147 ? 5.315   -4.110  -15.551 1.00 46.95  ? 147 CYS G O     1 
ATOM   7758  C CB    . CYS D  2 147 ? 3.436   -4.285  -17.890 1.00 58.94  ? 147 CYS G CB    1 
ATOM   7759  S SG    . CYS D  2 147 ? 2.529   -4.817  -19.371 1.00 64.83  ? 147 CYS G SG    1 
ATOM   7760  N N     . LEU D  2 148 ? 6.759   -4.071  -17.293 1.00 47.07  ? 148 LEU G N     1 
ATOM   7761  C CA    . LEU D  2 148 ? 7.806   -3.277  -16.681 1.00 46.78  ? 148 LEU G CA    1 
ATOM   7762  C C     . LEU D  2 148 ? 7.589   -1.874  -17.233 1.00 51.66  ? 148 LEU G C     1 
ATOM   7763  O O     . LEU D  2 148 ? 7.715   -1.692  -18.436 1.00 52.00  ? 148 LEU G O     1 
ATOM   7764  C CB    . LEU D  2 148 ? 9.190   -3.815  -17.081 1.00 46.46  ? 148 LEU G CB    1 
ATOM   7765  C CG    . LEU D  2 148 ? 10.394  -2.954  -16.670 1.00 50.63  ? 148 LEU G CG    1 
ATOM   7766  C CD1   . LEU D  2 148 ? 10.359  -2.586  -15.163 1.00 50.94  ? 148 LEU G CD1   1 
ATOM   7767  C CD2   . LEU D  2 148 ? 11.677  -3.626  -16.993 1.00 50.05  ? 148 LEU G CD2   1 
ATOM   7768  N N     . VAL D  2 149 ? 7.213   -0.909  -16.374 1.00 47.37  ? 149 VAL G N     1 
ATOM   7769  C CA    . VAL D  2 149 ? 6.888   0.468   -16.757 1.00 47.09  ? 149 VAL G CA    1 
ATOM   7770  C C     . VAL D  2 149 ? 8.104   1.277   -16.371 1.00 52.04  ? 149 VAL G C     1 
ATOM   7771  O O     . VAL D  2 149 ? 8.209   1.694   -15.227 1.00 50.90  ? 149 VAL G O     1 
ATOM   7772  C CB    . VAL D  2 149 ? 5.585   0.907   -16.033 1.00 50.20  ? 149 VAL G CB    1 
ATOM   7773  C CG1   . VAL D  2 149 ? 5.177   2.331   -16.417 1.00 50.65  ? 149 VAL G CG1   1 
ATOM   7774  C CG2   . VAL D  2 149 ? 4.455   -0.083  -16.317 1.00 49.59  ? 149 VAL G CG2   1 
ATOM   7775  N N     . LYS D  2 150 ? 9.066   1.432   -17.303 1.00 48.74  ? 150 LYS G N     1 
ATOM   7776  C CA    . LYS D  2 150 ? 10.358  2.037   -17.011 1.00 47.97  ? 150 LYS G CA    1 
ATOM   7777  C C     . LYS D  2 150 ? 10.553  3.410   -17.589 1.00 53.54  ? 150 LYS G C     1 
ATOM   7778  O O     . LYS D  2 150 ? 10.017  3.725   -18.652 1.00 54.18  ? 150 LYS G O     1 
ATOM   7779  C CB    . LYS D  2 150 ? 11.479  1.092   -17.532 1.00 50.22  ? 150 LYS G CB    1 
ATOM   7780  C CG    . LYS D  2 150 ? 12.875  1.360   -16.966 1.00 56.95  ? 150 LYS G CG    1 
ATOM   7781  C CD    . LYS D  2 150 ? 13.881  0.346   -17.415 1.00 57.32  ? 150 LYS G CD    1 
ATOM   7782  C CE    . LYS D  2 150 ? 15.293  0.900   -17.550 1.00 72.20  ? 150 LYS G CE    1 
ATOM   7783  N NZ    . LYS D  2 150 ? 16.054  0.860   -16.284 1.00 93.98  ? 150 LYS G NZ    1 
ATOM   7784  N N     . ASP D  2 151 ? 11.358  4.226   -16.875 1.00 50.34  ? 151 ASP G N     1 
ATOM   7785  C CA    . ASP D  2 151 ? 11.842  5.549   -17.271 1.00 50.84  ? 151 ASP G CA    1 
ATOM   7786  C C     . ASP D  2 151 ? 10.767  6.613   -17.511 1.00 54.88  ? 151 ASP G C     1 
ATOM   7787  O O     . ASP D  2 151 ? 10.757  7.276   -18.545 1.00 55.36  ? 151 ASP G O     1 
ATOM   7788  C CB    . ASP D  2 151 ? 12.760  5.420   -18.513 1.00 52.54  ? 151 ASP G CB    1 
ATOM   7789  C CG    . ASP D  2 151 ? 14.004  4.600   -18.249 1.00 61.50  ? 151 ASP G CG    1 
ATOM   7790  O OD1   . ASP D  2 151 ? 14.430  4.528   -17.075 1.00 60.44  ? 151 ASP G OD1   1 
ATOM   7791  O OD2   . ASP D  2 151 ? 14.585  4.077   -19.220 1.00 69.80  ? 151 ASP G OD2   1 
ATOM   7792  N N     . TYR D  2 152 ? 9.956   6.872   -16.498 1.00 50.52  ? 152 TYR G N     1 
ATOM   7793  C CA    . TYR D  2 152 ? 8.947   7.927   -16.580 1.00 48.65  ? 152 TYR G CA    1 
ATOM   7794  C C     . TYR D  2 152 ? 9.160   8.948   -15.491 1.00 51.62  ? 152 TYR G C     1 
ATOM   7795  O O     . TYR D  2 152 ? 9.801   8.684   -14.457 1.00 50.22  ? 152 TYR G O     1 
ATOM   7796  C CB    . TYR D  2 152 ? 7.520   7.357   -16.529 1.00 48.43  ? 152 TYR G CB    1 
ATOM   7797  C CG    . TYR D  2 152 ? 7.153   6.663   -15.236 1.00 47.92  ? 152 TYR G CG    1 
ATOM   7798  C CD1   . TYR D  2 152 ? 7.416   5.312   -15.050 1.00 48.74  ? 152 TYR G CD1   1 
ATOM   7799  C CD2   . TYR D  2 152 ? 6.500   7.347   -14.214 1.00 47.78  ? 152 TYR G CD2   1 
ATOM   7800  C CE1   . TYR D  2 152 ? 7.094   4.670   -13.858 1.00 47.83  ? 152 TYR G CE1   1 
ATOM   7801  C CE2   . TYR D  2 152 ? 6.175   6.718   -13.018 1.00 48.31  ? 152 TYR G CE2   1 
ATOM   7802  C CZ    . TYR D  2 152 ? 6.508   5.381   -12.830 1.00 55.78  ? 152 TYR G CZ    1 
ATOM   7803  O OH    . TYR D  2 152 ? 6.232   4.726   -11.652 1.00 54.06  ? 152 TYR G OH    1 
ATOM   7804  N N     . PHE D  2 153 ? 8.620   10.128  -15.721 1.00 48.11  ? 153 PHE G N     1 
ATOM   7805  C CA    . PHE D  2 153 ? 8.724   11.200  -14.748 1.00 47.41  ? 153 PHE G CA    1 
ATOM   7806  C C     . PHE D  2 153 ? 7.635   12.177  -15.019 1.00 52.11  ? 153 PHE G C     1 
ATOM   7807  O O     . PHE D  2 153 ? 7.425   12.530  -16.177 1.00 53.10  ? 153 PHE G O     1 
ATOM   7808  C CB    . PHE D  2 153 ? 10.103  11.884  -14.792 1.00 49.58  ? 153 PHE G CB    1 
ATOM   7809  C CG    . PHE D  2 153 ? 10.262  13.007  -13.795 1.00 50.54  ? 153 PHE G CG    1 
ATOM   7810  C CD1   . PHE D  2 153 ? 10.591  12.744  -12.474 1.00 52.48  ? 153 PHE G CD1   1 
ATOM   7811  C CD2   . PHE D  2 153 ? 9.989   14.319  -14.154 1.00 51.98  ? 153 PHE G CD2   1 
ATOM   7812  C CE1   . PHE D  2 153 ? 10.560  13.766  -11.517 1.00 52.08  ? 153 PHE G CE1   1 
ATOM   7813  C CE2   . PHE D  2 153 ? 10.008  15.340  -13.214 1.00 53.99  ? 153 PHE G CE2   1 
ATOM   7814  C CZ    . PHE D  2 153 ? 10.300  15.060  -11.903 1.00 51.59  ? 153 PHE G CZ    1 
ATOM   7815  N N     . PRO D  2 154 ? 6.973   12.701  -13.980 1.00 48.23  ? 154 PRO G N     1 
ATOM   7816  C CA    . PRO D  2 154 ? 7.066   12.357  -12.556 1.00 47.26  ? 154 PRO G CA    1 
ATOM   7817  C C     . PRO D  2 154 ? 6.068   11.230  -12.252 1.00 51.23  ? 154 PRO G C     1 
ATOM   7818  O O     . PRO D  2 154 ? 5.481   10.635  -13.159 1.00 49.84  ? 154 PRO G O     1 
ATOM   7819  C CB    . PRO D  2 154 ? 6.665   13.682  -11.898 1.00 48.32  ? 154 PRO G CB    1 
ATOM   7820  C CG    . PRO D  2 154 ? 5.554   14.175  -12.809 1.00 53.11  ? 154 PRO G CG    1 
ATOM   7821  C CD    . PRO D  2 154 ? 5.910   13.695  -14.201 1.00 49.16  ? 154 PRO G CD    1 
ATOM   7822  N N     . GLU D  2 155 ? 5.867   10.944  -10.978 1.00 47.72  ? 155 GLU G N     1 
ATOM   7823  C CA    . GLU D  2 155 ? 4.842   9.999   -10.559 1.00 46.85  ? 155 GLU G CA    1 
ATOM   7824  C C     . GLU D  2 155 ? 3.478   10.738  -10.694 1.00 53.09  ? 155 GLU G C     1 
ATOM   7825  O O     . GLU D  2 155 ? 3.451   11.971  -10.671 1.00 52.11  ? 155 GLU G O     1 
ATOM   7826  C CB    . GLU D  2 155 ? 5.077   9.600   -9.085  1.00 47.33  ? 155 GLU G CB    1 
ATOM   7827  C CG    . GLU D  2 155 ? 5.988   8.410   -8.897  1.00 53.88  ? 155 GLU G CG    1 
ATOM   7828  C CD    . GLU D  2 155 ? 5.247   7.095   -8.727  1.00 73.26  ? 155 GLU G CD    1 
ATOM   7829  O OE1   . GLU D  2 155 ? 5.170   6.638   -7.564  1.00 72.41  ? 155 GLU G OE1   1 
ATOM   7830  O OE2   . GLU D  2 155 ? 4.704   6.548   -9.722  1.00 62.18  ? 155 GLU G OE2   1 
ATOM   7831  N N     . PRO D  2 156 ? 2.333   10.041  -10.829 1.00 51.29  ? 156 PRO G N     1 
ATOM   7832  C CA    . PRO D  2 156 ? 2.134   8.591   -10.812 1.00 50.23  ? 156 PRO G CA    1 
ATOM   7833  C C     . PRO D  2 156 ? 1.768   7.985   -12.165 1.00 54.89  ? 156 PRO G C     1 
ATOM   7834  O O     . PRO D  2 156 ? 1.337   8.686   -13.070 1.00 55.23  ? 156 PRO G O     1 
ATOM   7835  C CB    . PRO D  2 156 ? 0.915   8.470   -9.895  1.00 50.78  ? 156 PRO G CB    1 
ATOM   7836  C CG    . PRO D  2 156 ? 0.059   9.659   -10.322 1.00 54.86  ? 156 PRO G CG    1 
ATOM   7837  C CD    . PRO D  2 156 ? 1.021   10.723  -10.835 1.00 51.30  ? 156 PRO G CD    1 
ATOM   7838  N N     . VAL D  2 157 ? 1.880   6.658   -12.254 1.00 52.97  ? 157 VAL G N     1 
ATOM   7839  C CA    . VAL D  2 157 ? 1.391   5.852   -13.373 1.00 53.89  ? 157 VAL G CA    1 
ATOM   7840  C C     . VAL D  2 157 ? 0.291   4.958   -12.793 1.00 59.23  ? 157 VAL G C     1 
ATOM   7841  O O     . VAL D  2 157 ? 0.334   4.626   -11.612 1.00 57.68  ? 157 VAL G O     1 
ATOM   7842  C CB    . VAL D  2 157 ? 2.446   4.998   -14.134 1.00 56.67  ? 157 VAL G CB    1 
ATOM   7843  C CG1   . VAL D  2 157 ? 3.408   5.875   -14.911 1.00 56.59  ? 157 VAL G CG1   1 
ATOM   7844  C CG2   . VAL D  2 157 ? 3.179   4.031   -13.211 1.00 55.99  ? 157 VAL G CG2   1 
ATOM   7845  N N     . THR D  2 158 ? -0.687  4.582   -13.611 1.00 58.21  ? 158 THR G N     1 
ATOM   7846  C CA    . THR D  2 158 ? -1.743  3.645   -13.198 1.00 58.61  ? 158 THR G CA    1 
ATOM   7847  C C     . THR D  2 158 ? -1.676  2.437   -14.138 1.00 60.62  ? 158 THR G C     1 
ATOM   7848  O O     . THR D  2 158 ? -1.503  2.611   -15.339 1.00 59.42  ? 158 THR G O     1 
ATOM   7849  C CB    . THR D  2 158 ? -3.129  4.278   -13.226 1.00 69.36  ? 158 THR G CB    1 
ATOM   7850  O OG1   . THR D  2 158 ? -3.510  4.540   -14.571 1.00 72.59  ? 158 THR G OG1   1 
ATOM   7851  C CG2   . THR D  2 158 ? -3.206  5.525   -12.418 1.00 69.05  ? 158 THR G CG2   1 
ATOM   7852  N N     . VAL D  2 159 ? -1.814  1.233   -13.587 1.00 56.20  ? 159 VAL G N     1 
ATOM   7853  C CA    . VAL D  2 159 ? -1.772  0.015   -14.359 1.00 55.89  ? 159 VAL G CA    1 
ATOM   7854  C C     . VAL D  2 159 ? -3.014  -0.790  -14.079 1.00 60.09  ? 159 VAL G C     1 
ATOM   7855  O O     . VAL D  2 159 ? -3.380  -1.023  -12.926 1.00 58.70  ? 159 VAL G O     1 
ATOM   7856  C CB    . VAL D  2 159 ? -0.504  -0.844  -14.130 1.00 58.72  ? 159 VAL G CB    1 
ATOM   7857  C CG1   . VAL D  2 159 ? -0.420  -1.975  -15.169 1.00 56.97  ? 159 VAL G CG1   1 
ATOM   7858  C CG2   . VAL D  2 159 ? 0.756   0.016   -14.158 1.00 58.91  ? 159 VAL G CG2   1 
ATOM   7859  N N     . SER D  2 160 ? -3.647  -1.213  -15.165 1.00 59.30  ? 160 SER G N     1 
ATOM   7860  C CA    . SER D  2 160 ? -4.813  -2.085  -15.195 1.00 59.24  ? 160 SER G CA    1 
ATOM   7861  C C     . SER D  2 160 ? -4.464  -3.276  -16.113 1.00 60.16  ? 160 SER G C     1 
ATOM   7862  O O     . SER D  2 160 ? -3.482  -3.222  -16.857 1.00 56.19  ? 160 SER G O     1 
ATOM   7863  C CB    . SER D  2 160 ? -6.012  -1.332  -15.757 1.00 64.23  ? 160 SER G CB    1 
ATOM   7864  O OG    . SER D  2 160 ? -7.161  -2.157  -15.692 1.00 83.53  ? 160 SER G OG    1 
ATOM   7865  N N     . TRP D  2 161 ? -5.279  -4.336  -16.059 1.00 58.28  ? 161 TRP G N     1 
ATOM   7866  C CA    . TRP D  2 161 ? -5.104  -5.531  -16.898 1.00 56.90  ? 161 TRP G CA    1 
ATOM   7867  C C     . TRP D  2 161 ? -6.407  -5.860  -17.606 1.00 60.11  ? 161 TRP G C     1 
ATOM   7868  O O     . TRP D  2 161 ? -7.442  -5.953  -16.963 1.00 59.74  ? 161 TRP G O     1 
ATOM   7869  C CB    . TRP D  2 161 ? -4.624  -6.716  -16.061 1.00 54.47  ? 161 TRP G CB    1 
ATOM   7870  C CG    . TRP D  2 161 ? -3.179  -6.613  -15.715 1.00 54.56  ? 161 TRP G CG    1 
ATOM   7871  C CD1   . TRP D  2 161 ? -2.634  -5.971  -14.640 1.00 57.47  ? 161 TRP G CD1   1 
ATOM   7872  C CD2   . TRP D  2 161 ? -2.083  -7.044  -16.523 1.00 53.82  ? 161 TRP G CD2   1 
ATOM   7873  N NE1   . TRP D  2 161 ? -1.262  -6.023  -14.707 1.00 56.14  ? 161 TRP G NE1   1 
ATOM   7874  C CE2   . TRP D  2 161 ? -0.897  -6.709  -15.832 1.00 57.55  ? 161 TRP G CE2   1 
ATOM   7875  C CE3   . TRP D  2 161 ? -1.986  -7.722  -17.743 1.00 54.66  ? 161 TRP G CE3   1 
ATOM   7876  C CZ2   . TRP D  2 161 ? 0.367   -7.031  -16.324 1.00 57.17  ? 161 TRP G CZ2   1 
ATOM   7877  C CZ3   . TRP D  2 161 ? -0.736  -8.027  -18.239 1.00 56.47  ? 161 TRP G CZ3   1 
ATOM   7878  C CH2   . TRP D  2 161 ? 0.426   -7.701  -17.527 1.00 57.23  ? 161 TRP G CH2   1 
ATOM   7879  N N     . ASN D  2 162 ? -6.367  -5.999  -18.928 1.00 57.96  ? 162 ASN G N     1 
ATOM   7880  C CA    . ASN D  2 162 ? -7.550  -6.279  -19.733 1.00 58.89  ? 162 ASN G CA    1 
ATOM   7881  C C     . ASN D  2 162 ? -8.678  -5.264  -19.489 1.00 66.07  ? 162 ASN G C     1 
ATOM   7882  O O     . ASN D  2 162 ? -9.836  -5.634  -19.347 1.00 67.17  ? 162 ASN G O     1 
ATOM   7883  C CB    . ASN D  2 162 ? -8.015  -7.733  -19.543 1.00 59.05  ? 162 ASN G CB    1 
ATOM   7884  C CG    . ASN D  2 162 ? -6.985  -8.732  -19.983 1.00 70.34  ? 162 ASN G CG    1 
ATOM   7885  O OD1   . ASN D  2 162 ? -5.995  -8.391  -20.629 1.00 61.58  ? 162 ASN G OD1   1 
ATOM   7886  N ND2   . ASN D  2 162 ? -7.165  -9.981  -19.600 1.00 68.30  ? 162 ASN G ND2   1 
ATOM   7887  N N     . SER D  2 163 ? -8.304  -3.974  -19.432 1.00 64.04  ? 163 SER G N     1 
ATOM   7888  C CA    . SER D  2 163 ? -9.196  -2.823  -19.299 1.00 64.43  ? 163 SER G CA    1 
ATOM   7889  C C     . SER D  2 163 ? -10.100 -2.865  -18.054 1.00 70.12  ? 163 SER G C     1 
ATOM   7890  O O     . SER D  2 163 ? -11.225 -2.351  -18.092 1.00 70.35  ? 163 SER G O     1 
ATOM   7891  C CB    . SER D  2 163 ? -10.002 -2.661  -20.581 1.00 67.15  ? 163 SER G CB    1 
ATOM   7892  O OG    . SER D  2 163 ? -9.139  -2.797  -21.704 1.00 72.82  ? 163 SER G OG    1 
ATOM   7893  N N     . GLY D  2 164 ? -9.560  -3.411  -16.956 1.00 67.64  ? 164 GLY G N     1 
ATOM   7894  C CA    . GLY D  2 164 ? -10.256 -3.543  -15.675 1.00 68.06  ? 164 GLY G CA    1 
ATOM   7895  C C     . GLY D  2 164 ? -10.829 -4.921  -15.398 1.00 74.27  ? 164 GLY G C     1 
ATOM   7896  O O     . GLY D  2 164 ? -11.091 -5.245  -14.240 1.00 74.25  ? 164 GLY G O     1 
ATOM   7897  N N     . ALA D  2 165 ? -11.025 -5.754  -16.450 1.00 72.10  ? 165 ALA G N     1 
ATOM   7898  C CA    . ALA D  2 165 ? -11.601 -7.105  -16.341 1.00 70.95  ? 165 ALA G CA    1 
ATOM   7899  C C     . ALA D  2 165 ? -10.782 -8.073  -15.476 1.00 74.32  ? 165 ALA G C     1 
ATOM   7900  O O     . ALA D  2 165 ? -11.368 -8.886  -14.756 1.00 74.19  ? 165 ALA G O     1 
ATOM   7901  C CB    . ALA D  2 165 ? -11.779 -7.695  -17.724 1.00 71.07  ? 165 ALA G CB    1 
ATOM   7902  N N     . LEU D  2 166 ? -9.444  -8.008  -15.568 1.00 69.64  ? 166 LEU G N     1 
ATOM   7903  C CA    . LEU D  2 166 ? -8.549  -8.879  -14.798 1.00 68.81  ? 166 LEU G CA    1 
ATOM   7904  C C     . LEU D  2 166 ? -8.064  -8.133  -13.531 1.00 73.87  ? 166 LEU G C     1 
ATOM   7905  O O     . LEU D  2 166 ? -7.293  -7.170  -13.610 1.00 72.35  ? 166 LEU G O     1 
ATOM   7906  C CB    . LEU D  2 166 ? -7.372  -9.365  -15.689 1.00 68.00  ? 166 LEU G CB    1 
ATOM   7907  C CG    . LEU D  2 166 ? -6.244  -10.186 -15.014 1.00 71.87  ? 166 LEU G CG    1 
ATOM   7908  C CD1   . LEU D  2 166 ? -6.788  -11.362 -14.216 1.00 71.88  ? 166 LEU G CD1   1 
ATOM   7909  C CD2   . LEU D  2 166 ? -5.233  -10.672 -16.040 1.00 73.68  ? 166 LEU G CD2   1 
ATOM   7910  N N     . THR D  2 167 ? -8.576  -8.558  -12.371 1.00 72.75  ? 167 THR G N     1 
ATOM   7911  C CA    . THR D  2 167 ? -8.249  -7.976  -11.067 1.00 73.43  ? 167 THR G CA    1 
ATOM   7912  C C     . THR D  2 167 ? -7.591  -8.991  -10.119 1.00 78.13  ? 167 THR G C     1 
ATOM   7913  O O     . THR D  2 167 ? -6.648  -8.621  -9.416  1.00 77.54  ? 167 THR G O     1 
ATOM   7914  C CB    . THR D  2 167 ? -9.499  -7.362  -10.457 1.00 83.89  ? 167 THR G CB    1 
ATOM   7915  O OG1   . THR D  2 167 ? -10.580 -8.289  -10.613 1.00 85.16  ? 167 THR G OG1   1 
ATOM   7916  C CG2   . THR D  2 167 ? -9.851  -6.012  -11.099 1.00 82.53  ? 167 THR G CG2   1 
ATOM   7917  N N     . SER D  2 168 ? -8.081  -10.252 -10.081 1.00 74.93  ? 168 SER G N     1 
ATOM   7918  C CA    . SER D  2 168 ? -7.509  -11.269 -9.187  1.00 74.09  ? 168 SER G CA    1 
ATOM   7919  C C     . SER D  2 168 ? -6.107  -11.663 -9.636  1.00 74.22  ? 168 SER G C     1 
ATOM   7920  O O     . SER D  2 168 ? -5.861  -11.772 -10.840 1.00 73.60  ? 168 SER G O     1 
ATOM   7921  C CB    . SER D  2 168 ? -8.398  -12.512 -9.107  1.00 79.28  ? 168 SER G CB    1 
ATOM   7922  O OG    . SER D  2 168 ? -9.521  -12.303 -8.263  1.00 88.42  ? 168 SER G OG    1 
ATOM   7923  N N     . GLY D  2 169 ? -5.205  -11.823 -8.664  1.00 68.27  ? 169 GLY G N     1 
ATOM   7924  C CA    . GLY D  2 169 ? -3.814  -12.186 -8.907  1.00 67.45  ? 169 GLY G CA    1 
ATOM   7925  C C     . GLY D  2 169 ? -2.872  -11.035 -9.247  1.00 68.60  ? 169 GLY G C     1 
ATOM   7926  O O     . GLY D  2 169 ? -1.660  -11.253 -9.341  1.00 66.75  ? 169 GLY G O     1 
ATOM   7927  N N     . VAL D  2 170 ? -3.398  -9.791  -9.359  1.00 63.96  ? 170 VAL G N     1 
ATOM   7928  C CA    . VAL D  2 170 ? -2.599  -8.639  -9.745  1.00 63.04  ? 170 VAL G CA    1 
ATOM   7929  C C     . VAL D  2 170 ? -1.873  -8.033  -8.564  1.00 66.40  ? 170 VAL G C     1 
ATOM   7930  O O     . VAL D  2 170 ? -2.462  -7.818  -7.501  1.00 65.37  ? 170 VAL G O     1 
ATOM   7931  C CB    . VAL D  2 170 ? -3.439  -7.554  -10.454 1.00 67.19  ? 170 VAL G CB    1 
ATOM   7932  C CG1   . VAL D  2 170 ? -2.561  -6.359  -10.846 1.00 66.92  ? 170 VAL G CG1   1 
ATOM   7933  C CG2   . VAL D  2 170 ? -4.175  -8.121  -11.677 1.00 66.85  ? 170 VAL G CG2   1 
ATOM   7934  N N     . HIS D  2 171 ? -0.601  -7.692  -8.792  1.00 62.73  ? 171 HIS G N     1 
ATOM   7935  C CA    . HIS D  2 171 ? 0.231   -6.988  -7.840  1.00 62.24  ? 171 HIS G CA    1 
ATOM   7936  C C     . HIS D  2 171 ? 0.970   -5.901  -8.590  1.00 62.50  ? 171 HIS G C     1 
ATOM   7937  O O     . HIS D  2 171 ? 1.838   -6.209  -9.402  1.00 60.46  ? 171 HIS G O     1 
ATOM   7938  C CB    . HIS D  2 171 ? 1.233   -7.924  -7.155  1.00 64.00  ? 171 HIS G CB    1 
ATOM   7939  C CG    . HIS D  2 171 ? 0.586   -8.920  -6.257  1.00 68.47  ? 171 HIS G CG    1 
ATOM   7940  N ND1   . HIS D  2 171 ? -0.149  -8.524  -5.150  1.00 71.17  ? 171 HIS G ND1   1 
ATOM   7941  C CD2   . HIS D  2 171 ? 0.538   -10.263 -6.357  1.00 70.41  ? 171 HIS G CD2   1 
ATOM   7942  C CE1   . HIS D  2 171 ? -0.593  -9.640  -4.596  1.00 70.91  ? 171 HIS G CE1   1 
ATOM   7943  N NE2   . HIS D  2 171 ? -0.199  -10.711 -5.286  1.00 71.07  ? 171 HIS G NE2   1 
ATOM   7944  N N     . THR D  2 172 ? 0.580   -4.632  -8.365  1.00 58.18  ? 172 THR G N     1 
ATOM   7945  C CA    . THR D  2 172 ? 1.276   -3.484  -8.924  1.00 55.83  ? 172 THR G CA    1 
ATOM   7946  C C     . THR D  2 172 ? 2.187   -2.947  -7.818  1.00 55.93  ? 172 THR G C     1 
ATOM   7947  O O     . THR D  2 172 ? 1.732   -2.475  -6.788  1.00 54.11  ? 172 THR G O     1 
ATOM   7948  C CB    . THR D  2 172 ? 0.320   -2.460  -9.483  1.00 58.48  ? 172 THR G CB    1 
ATOM   7949  O OG1   . THR D  2 172 ? -0.411  -3.067  -10.548 1.00 53.42  ? 172 THR G OG1   1 
ATOM   7950  C CG2   . THR D  2 172 ? 1.056   -1.234  -10.010 1.00 57.66  ? 172 THR G CG2   1 
ATOM   7951  N N     . PHE D  2 173 ? 3.473   -3.028  -8.048  1.00 53.23  ? 173 PHE G N     1 
ATOM   7952  C CA    . PHE D  2 173 ? 4.464   -2.631  -7.077  1.00 53.01  ? 173 PHE G CA    1 
ATOM   7953  C C     . PHE D  2 173 ? 4.640   -1.124  -6.958  1.00 55.14  ? 173 PHE G C     1 
ATOM   7954  O O     . PHE D  2 173 ? 4.518   -0.413  -7.946  1.00 54.26  ? 173 PHE G O     1 
ATOM   7955  C CB    . PHE D  2 173 ? 5.797   -3.268  -7.449  1.00 55.10  ? 173 PHE G CB    1 
ATOM   7956  C CG    . PHE D  2 173 ? 5.756   -4.754  -7.246  1.00 57.76  ? 173 PHE G CG    1 
ATOM   7957  C CD1   . PHE D  2 173 ? 5.977   -5.300  -5.995  1.00 62.59  ? 173 PHE G CD1   1 
ATOM   7958  C CD2   . PHE D  2 173 ? 5.491   -5.613  -8.305  1.00 60.66  ? 173 PHE G CD2   1 
ATOM   7959  C CE1   . PHE D  2 173 ? 5.918   -6.673  -5.802  1.00 63.80  ? 173 PHE G CE1   1 
ATOM   7960  C CE2   . PHE D  2 173 ? 5.446   -6.991  -8.111  1.00 63.74  ? 173 PHE G CE2   1 
ATOM   7961  C CZ    . PHE D  2 173 ? 5.646   -7.513  -6.856  1.00 62.50  ? 173 PHE G CZ    1 
ATOM   7962  N N     . PRO D  2 174 ? 5.068   -0.615  -5.786  1.00 50.75  ? 174 PRO G N     1 
ATOM   7963  C CA    . PRO D  2 174 ? 5.366   0.830   -5.710  1.00 49.72  ? 174 PRO G CA    1 
ATOM   7964  C C     . PRO D  2 174 ? 6.549   1.177   -6.605  1.00 50.76  ? 174 PRO G C     1 
ATOM   7965  O O     . PRO D  2 174 ? 7.469   0.370   -6.810  1.00 47.96  ? 174 PRO G O     1 
ATOM   7966  C CB    . PRO D  2 174 ? 5.679   1.086   -4.226  1.00 51.13  ? 174 PRO G CB    1 
ATOM   7967  C CG    . PRO D  2 174 ? 5.813   -0.253  -3.589  1.00 55.43  ? 174 PRO G CG    1 
ATOM   7968  C CD    . PRO D  2 174 ? 5.279   -1.310  -4.493  1.00 51.06  ? 174 PRO G CD    1 
ATOM   7969  N N     . ALA D  2 175 ? 6.510   2.381   -7.150  1.00 47.69  ? 175 ALA G N     1 
ATOM   7970  C CA    . ALA D  2 175 ? 7.591   2.874   -7.988  1.00 46.73  ? 175 ALA G CA    1 
ATOM   7971  C C     . ALA D  2 175 ? 8.909   2.990   -7.210  1.00 49.67  ? 175 ALA G C     1 
ATOM   7972  O O     . ALA D  2 175 ? 8.947   3.216   -5.997  1.00 46.88  ? 175 ALA G O     1 
ATOM   7973  C CB    . ALA D  2 175 ? 7.222   4.225   -8.599  1.00 47.28  ? 175 ALA G CB    1 
ATOM   7974  N N     . VAL D  2 176 ? 9.984   2.880   -7.964  1.00 48.30  ? 176 VAL G N     1 
ATOM   7975  C CA    . VAL D  2 176 ? 11.356  2.967   -7.516  1.00 48.55  ? 176 VAL G CA    1 
ATOM   7976  C C     . VAL D  2 176 ? 11.927  4.158   -8.266  1.00 51.92  ? 176 VAL G C     1 
ATOM   7977  O O     . VAL D  2 176 ? 11.666  4.283   -9.462  1.00 51.41  ? 176 VAL G O     1 
ATOM   7978  C CB    . VAL D  2 176 ? 12.055  1.605   -7.858  1.00 53.83  ? 176 VAL G CB    1 
ATOM   7979  C CG1   . VAL D  2 176 ? 13.350  1.765   -8.618  1.00 54.57  ? 176 VAL G CG1   1 
ATOM   7980  C CG2   . VAL D  2 176 ? 12.254  0.746   -6.622  1.00 53.88  ? 176 VAL G CG2   1 
ATOM   7981  N N     . LEU D  2 177 ? 12.693  5.035   -7.573  1.00 50.19  ? 177 LEU G N     1 
ATOM   7982  C CA    . LEU D  2 177 ? 13.378  6.176   -8.179  1.00 50.05  ? 177 LEU G CA    1 
ATOM   7983  C C     . LEU D  2 177 ? 14.785  5.721   -8.530  1.00 57.87  ? 177 LEU G C     1 
ATOM   7984  O O     . LEU D  2 177 ? 15.561  5.368   -7.636  1.00 60.26  ? 177 LEU G O     1 
ATOM   7985  C CB    . LEU D  2 177 ? 13.439  7.365   -7.214  1.00 49.50  ? 177 LEU G CB    1 
ATOM   7986  C CG    . LEU D  2 177 ? 14.050  8.645   -7.778  1.00 52.47  ? 177 LEU G CG    1 
ATOM   7987  C CD1   . LEU D  2 177 ? 13.442  9.004   -9.170  1.00 51.14  ? 177 LEU G CD1   1 
ATOM   7988  C CD2   . LEU D  2 177 ? 13.883  9.781   -6.781  1.00 50.66  ? 177 LEU G CD2   1 
ATOM   7989  N N     . GLN D  2 178 ? 15.108  5.688   -9.821  1.00 54.00  ? 178 GLN G N     1 
ATOM   7990  C CA    . GLN D  2 178 ? 16.408  5.197   -10.274 1.00 53.96  ? 178 GLN G CA    1 
ATOM   7991  C C     . GLN D  2 178 ? 17.480  6.290   -10.188 1.00 59.52  ? 178 GLN G C     1 
ATOM   7992  O O     . GLN D  2 178 ? 17.143  7.463   -10.125 1.00 57.82  ? 178 GLN G O     1 
ATOM   7993  C CB    . GLN D  2 178 ? 16.297  4.661   -11.719 1.00 54.43  ? 178 GLN G CB    1 
ATOM   7994  C CG    . GLN D  2 178 ? 15.172  3.617   -11.946 1.00 59.25  ? 178 GLN G CG    1 
ATOM   7995  C CD    . GLN D  2 178 ? 14.957  3.367   -13.423 1.00 70.55  ? 178 GLN G CD    1 
ATOM   7996  O OE1   . GLN D  2 178 ? 15.528  2.439   -14.004 1.00 64.24  ? 178 GLN G OE1   1 
ATOM   7997  N NE2   . GLN D  2 178 ? 14.215  4.253   -14.087 1.00 51.85  ? 178 GLN G NE2   1 
ATOM   7998  N N     . SER D  2 179 ? 18.769  5.909   -10.293 1.00 59.53  ? 179 SER G N     1 
ATOM   7999  C CA    . SER D  2 179 ? 19.905  6.856   -10.268 1.00 61.68  ? 179 SER G CA    1 
ATOM   8000  C C     . SER D  2 179 ? 19.760  7.985   -11.285 1.00 66.70  ? 179 SER G C     1 
ATOM   8001  O O     . SER D  2 179 ? 20.194  9.102   -11.021 1.00 67.38  ? 179 SER G O     1 
ATOM   8002  C CB    . SER D  2 179 ? 21.226  6.127   -10.491 1.00 67.72  ? 179 SER G CB    1 
ATOM   8003  O OG    . SER D  2 179 ? 21.124  5.199   -11.562 1.00 82.48  ? 179 SER G OG    1 
ATOM   8004  N N     . SER D  2 180 ? 19.120  7.695   -12.433 1.00 62.60  ? 180 SER G N     1 
ATOM   8005  C CA    . SER D  2 180 ? 18.816  8.672   -13.491 1.00 61.74  ? 180 SER G CA    1 
ATOM   8006  C C     . SER D  2 180 ? 17.834  9.760   -13.046 1.00 63.12  ? 180 SER G C     1 
ATOM   8007  O O     . SER D  2 180 ? 17.709  10.777  -13.724 1.00 63.47  ? 180 SER G O     1 
ATOM   8008  C CB    . SER D  2 180 ? 18.186  7.952   -14.682 1.00 63.44  ? 180 SER G CB    1 
ATOM   8009  O OG    . SER D  2 180 ? 17.054  7.201   -14.270 1.00 62.95  ? 180 SER G OG    1 
ATOM   8010  N N     . GLY D  2 181 ? 17.079  9.503   -11.981 1.00 56.84  ? 181 GLY G N     1 
ATOM   8011  C CA    . GLY D  2 181 ? 16.050  10.414  -11.515 1.00 54.00  ? 181 GLY G CA    1 
ATOM   8012  C C     . GLY D  2 181 ? 14.727  10.154  -12.198 1.00 52.94  ? 181 GLY G C     1 
ATOM   8013  O O     . GLY D  2 181 ? 13.783  10.926  -12.032 1.00 51.33  ? 181 GLY G O     1 
ATOM   8014  N N     . LEU D  2 182 ? 14.634  9.040   -12.952 1.00 48.76  ? 182 LEU G N     1 
ATOM   8015  C CA    . LEU D  2 182 ? 13.399  8.623   -13.609 1.00 47.44  ? 182 LEU G CA    1 
ATOM   8016  C C     . LEU D  2 182 ? 12.830  7.462   -12.821 1.00 49.49  ? 182 LEU G C     1 
ATOM   8017  O O     . LEU D  2 182 ? 13.573  6.635   -12.300 1.00 49.73  ? 182 LEU G O     1 
ATOM   8018  C CB    . LEU D  2 182 ? 13.663  8.172   -15.050 1.00 46.97  ? 182 LEU G CB    1 
ATOM   8019  C CG    . LEU D  2 182 ? 14.162  9.205   -16.013 1.00 51.70  ? 182 LEU G CG    1 
ATOM   8020  C CD1   . LEU D  2 182 ? 14.258  8.611   -17.372 1.00 51.83  ? 182 LEU G CD1   1 
ATOM   8021  C CD2   . LEU D  2 182 ? 13.238  10.423  -16.055 1.00 55.11  ? 182 LEU G CD2   1 
ATOM   8022  N N     . TYR D  2 183 ? 11.528  7.393   -12.732 1.00 46.03  ? 183 TYR G N     1 
ATOM   8023  C CA    . TYR D  2 183 ? 10.883  6.316   -11.991 1.00 45.38  ? 183 TYR G CA    1 
ATOM   8024  C C     . TYR D  2 183 ? 10.743  5.021   -12.816 1.00 52.16  ? 183 TYR G C     1 
ATOM   8025  O O     . TYR D  2 183 ? 11.056  4.968   -14.010 1.00 54.07  ? 183 TYR G O     1 
ATOM   8026  C CB    . TYR D  2 183 ? 9.529   6.782   -11.465 1.00 45.44  ? 183 TYR G CB    1 
ATOM   8027  C CG    . TYR D  2 183 ? 9.638   7.886   -10.454 1.00 45.78  ? 183 TYR G CG    1 
ATOM   8028  C CD1   . TYR D  2 183 ? 9.742   7.606   -9.094  1.00 45.47  ? 183 TYR G CD1   1 
ATOM   8029  C CD2   . TYR D  2 183 ? 9.559   9.219   -10.841 1.00 47.67  ? 183 TYR G CD2   1 
ATOM   8030  C CE1   . TYR D  2 183 ? 9.799   8.625   -8.147  1.00 40.82  ? 183 TYR G CE1   1 
ATOM   8031  C CE2   . TYR D  2 183 ? 9.571   10.245  -9.904  1.00 48.38  ? 183 TYR G CE2   1 
ATOM   8032  C CZ    . TYR D  2 183 ? 9.728   9.948   -8.556  1.00 54.58  ? 183 TYR G CZ    1 
ATOM   8033  O OH    . TYR D  2 183 ? 9.759   10.962  -7.620  1.00 58.88  ? 183 TYR G OH    1 
ATOM   8034  N N     . SER D  2 184 ? 10.295  3.976   -12.150 1.00 47.03  ? 184 SER G N     1 
ATOM   8035  C CA    . SER D  2 184 ? 10.110  2.662   -12.750 1.00 44.98  ? 184 SER G CA    1 
ATOM   8036  C C     . SER D  2 184 ? 9.267   1.797   -11.803 1.00 50.19  ? 184 SER G C     1 
ATOM   8037  O O     . SER D  2 184 ? 9.457   1.854   -10.584 1.00 48.59  ? 184 SER G O     1 
ATOM   8038  C CB    . SER D  2 184 ? 11.473  2.004   -12.958 1.00 47.97  ? 184 SER G CB    1 
ATOM   8039  O OG    . SER D  2 184 ? 11.393  0.701   -13.500 1.00 54.12  ? 184 SER G OG    1 
ATOM   8040  N N     . LEU D  2 185 ? 8.301   1.055   -12.344 1.00 50.24  ? 185 LEU G N     1 
ATOM   8041  C CA    . LEU D  2 185 ? 7.539   0.082   -11.574 1.00 49.54  ? 185 LEU G CA    1 
ATOM   8042  C C     . LEU D  2 185 ? 7.167   -1.108  -12.409 1.00 52.80  ? 185 LEU G C     1 
ATOM   8043  O O     . LEU D  2 185 ? 7.173   -1.019  -13.630 1.00 52.78  ? 185 LEU G O     1 
ATOM   8044  C CB    . LEU D  2 185 ? 6.327   0.679   -10.866 1.00 49.84  ? 185 LEU G CB    1 
ATOM   8045  C CG    . LEU D  2 185 ? 5.050   1.071   -11.601 1.00 53.49  ? 185 LEU G CG    1 
ATOM   8046  C CD1   . LEU D  2 185 ? 4.225   -0.147  -12.034 1.00 54.59  ? 185 LEU G CD1   1 
ATOM   8047  C CD2   . LEU D  2 185 ? 4.221   1.928   -10.696 1.00 50.51  ? 185 LEU G CD2   1 
ATOM   8048  N N     . SER D  2 186 ? 6.862   -2.235  -11.744 1.00 48.97  ? 186 SER G N     1 
ATOM   8049  C CA    . SER D  2 186 ? 6.374   -3.432  -12.386 1.00 48.77  ? 186 SER G CA    1 
ATOM   8050  C C     . SER D  2 186 ? 5.015   -3.742  -11.876 1.00 52.46  ? 186 SER G C     1 
ATOM   8051  O O     . SER D  2 186 ? 4.670   -3.421  -10.730 1.00 52.06  ? 186 SER G O     1 
ATOM   8052  C CB    . SER D  2 186 ? 7.297   -4.624  -12.163 1.00 53.56  ? 186 SER G CB    1 
ATOM   8053  O OG    . SER D  2 186 ? 8.378   -4.572  -13.079 1.00 64.35  ? 186 SER G OG    1 
ATOM   8054  N N     . SER D  2 187 ? 4.201   -4.276  -12.775 1.00 49.64  ? 187 SER G N     1 
ATOM   8055  C CA    . SER D  2 187 ? 2.886   -4.832  -12.480 1.00 48.88  ? 187 SER G CA    1 
ATOM   8056  C C     . SER D  2 187 ? 2.921   -6.284  -12.959 1.00 54.28  ? 187 SER G C     1 
ATOM   8057  O O     . SER D  2 187 ? 3.445   -6.564  -14.036 1.00 52.40  ? 187 SER G O     1 
ATOM   8058  C CB    . SER D  2 187 ? 1.773   -4.087  -13.200 1.00 49.70  ? 187 SER G CB    1 
ATOM   8059  O OG    . SER D  2 187 ? 0.518   -4.601  -12.776 1.00 55.15  ? 187 SER G OG    1 
ATOM   8060  N N     . VAL D  2 188 ? 2.422   -7.203  -12.133 1.00 53.22  ? 188 VAL G N     1 
ATOM   8061  C CA    . VAL D  2 188 ? 2.425   -8.627  -12.441 1.00 52.46  ? 188 VAL G CA    1 
ATOM   8062  C C     . VAL D  2 188 ? 1.069   -9.183  -12.199 1.00 57.92  ? 188 VAL G C     1 
ATOM   8063  O O     . VAL D  2 188 ? 0.264   -8.570  -11.518 1.00 57.56  ? 188 VAL G O     1 
ATOM   8064  C CB    . VAL D  2 188 ? 3.477   -9.414  -11.622 1.00 55.64  ? 188 VAL G CB    1 
ATOM   8065  C CG1   . VAL D  2 188 ? 4.893   -8.967  -11.957 1.00 54.54  ? 188 VAL G CG1   1 
ATOM   8066  C CG2   . VAL D  2 188 ? 3.199   -9.322  -10.113 1.00 56.01  ? 188 VAL G CG2   1 
ATOM   8067  N N     . VAL D  2 189 ? 0.823   -10.360 -12.737 1.00 58.54  ? 189 VAL G N     1 
ATOM   8068  C CA    . VAL D  2 189 ? -0.434  -11.067 -12.548 1.00 60.41  ? 189 VAL G CA    1 
ATOM   8069  C C     . VAL D  2 189 ? -0.180  -12.573 -12.686 1.00 69.50  ? 189 VAL G C     1 
ATOM   8070  O O     . VAL D  2 189 ? 0.547   -12.989 -13.600 1.00 69.92  ? 189 VAL G O     1 
ATOM   8071  C CB    . VAL D  2 189 ? -1.537  -10.541 -13.497 1.00 64.45  ? 189 VAL G CB    1 
ATOM   8072  C CG1   . VAL D  2 189 ? -1.143  -10.688 -14.964 1.00 63.92  ? 189 VAL G CG1   1 
ATOM   8073  C CG2   . VAL D  2 189 ? -2.887  -11.206 -13.211 1.00 64.43  ? 189 VAL G CG2   1 
ATOM   8074  N N     . THR D  2 190 ? -0.716  -13.380 -11.741 1.00 67.73  ? 190 THR G N     1 
ATOM   8075  C CA    . THR D  2 190 ? -0.596  -14.839 -11.813 1.00 67.36  ? 190 THR G CA    1 
ATOM   8076  C C     . THR D  2 190 ? -1.876  -15.356 -12.425 1.00 71.16  ? 190 THR G C     1 
ATOM   8077  O O     . THR D  2 190 ? -2.973  -14.979 -12.007 1.00 69.57  ? 190 THR G O     1 
ATOM   8078  C CB    . THR D  2 190 ? -0.278  -15.473 -10.469 1.00 70.07  ? 190 THR G CB    1 
ATOM   8079  O OG1   . THR D  2 190 ? -1.240  -15.043 -9.502  1.00 69.97  ? 190 THR G OG1   1 
ATOM   8080  C CG2   . THR D  2 190 ? 1.161   -15.180 -10.024 1.00 64.20  ? 190 THR G CG2   1 
ATOM   8081  N N     . VAL D  2 191 ? -1.725  -16.165 -13.458 1.00 70.03  ? 191 VAL G N     1 
ATOM   8082  C CA    . VAL D  2 191 ? -2.842  -16.726 -14.220 1.00 71.34  ? 191 VAL G CA    1 
ATOM   8083  C C     . VAL D  2 191 ? -2.648  -18.250 -14.387 1.00 78.37  ? 191 VAL G C     1 
ATOM   8084  O O     . VAL D  2 191 ? -1.526  -18.764 -14.203 1.00 77.03  ? 191 VAL G O     1 
ATOM   8085  C CB    . VAL D  2 191 ? -2.965  -16.008 -15.597 1.00 74.72  ? 191 VAL G CB    1 
ATOM   8086  C CG1   . VAL D  2 191 ? -3.191  -14.507 -15.404 1.00 74.91  ? 191 VAL G CG1   1 
ATOM   8087  C CG2   . VAL D  2 191 ? -1.742  -16.263 -16.480 1.00 73.70  ? 191 VAL G CG2   1 
ATOM   8088  N N     . PRO D  2 192 ? -3.714  -18.998 -14.744 1.00 77.40  ? 192 PRO G N     1 
ATOM   8089  C CA    . PRO D  2 192 ? -3.524  -20.440 -14.973 1.00 77.61  ? 192 PRO G CA    1 
ATOM   8090  C C     . PRO D  2 192 ? -2.726  -20.614 -16.253 1.00 81.89  ? 192 PRO G C     1 
ATOM   8091  O O     . PRO D  2 192 ? -3.077  -19.988 -17.251 1.00 82.04  ? 192 PRO G O     1 
ATOM   8092  C CB    . PRO D  2 192 ? -4.953  -20.990 -15.095 1.00 79.82  ? 192 PRO G CB    1 
ATOM   8093  C CG    . PRO D  2 192 ? -5.885  -19.824 -14.865 1.00 84.28  ? 192 PRO G CG    1 
ATOM   8094  C CD    . PRO D  2 192 ? -5.099  -18.577 -15.045 1.00 79.40  ? 192 PRO G CD    1 
ATOM   8095  N N     . SER D  2 193 ? -1.643  -21.410 -16.219 1.00 79.33  ? 193 SER G N     1 
ATOM   8096  C CA    . SER D  2 193 ? -0.770  -21.632 -17.382 1.00 79.84  ? 193 SER G CA    1 
ATOM   8097  C C     . SER D  2 193 ? -1.518  -22.197 -18.609 1.00 85.21  ? 193 SER G C     1 
ATOM   8098  O O     . SER D  2 193 ? -1.084  -21.982 -19.741 1.00 83.02  ? 193 SER G O     1 
ATOM   8099  C CB    . SER D  2 193 ? 0.414   -22.520 -17.004 1.00 84.54  ? 193 SER G CB    1 
ATOM   8100  O OG    . SER D  2 193 ? -0.001  -23.705 -16.344 1.00 96.68  ? 193 SER G OG    1 
ATOM   8101  N N     . SER D  2 194 ? -2.645  -22.899 -18.382 1.00 85.06  ? 194 SER G N     1 
ATOM   8102  C CA    . SER D  2 194 ? -3.500  -23.436 -19.451 1.00 86.01  ? 194 SER G CA    1 
ATOM   8103  C C     . SER D  2 194 ? -4.065  -22.310 -20.329 1.00 92.23  ? 194 SER G C     1 
ATOM   8104  O O     . SER D  2 194 ? -4.195  -22.476 -21.545 1.00 92.05  ? 194 SER G O     1 
ATOM   8105  C CB    . SER D  2 194 ? -4.664  -24.231 -18.854 1.00 88.73  ? 194 SER G CB    1 
ATOM   8106  O OG    . SER D  2 194 ? -5.555  -23.409 -18.114 1.00 94.11  ? 194 SER G OG    1 
ATOM   8107  N N     . SER D  2 195 ? -4.412  -21.174 -19.696 1.00 90.27  ? 195 SER G N     1 
ATOM   8108  C CA    . SER D  2 195 ? -5.003  -20.014 -20.370 1.00 90.86  ? 195 SER G CA    1 
ATOM   8109  C C     . SER D  2 195 ? -4.072  -19.243 -21.315 1.00 92.79  ? 195 SER G C     1 
ATOM   8110  O O     . SER D  2 195 ? -4.582  -18.524 -22.162 1.00 91.71  ? 195 SER G O     1 
ATOM   8111  C CB    . SER D  2 195 ? -5.536  -19.023 -19.339 1.00 96.50  ? 195 SER G CB    1 
ATOM   8112  O OG    . SER D  2 195 ? -6.269  -19.653 -18.301 1.00 111.00 ? 195 SER G OG    1 
ATOM   8113  N N     . LEU D  2 196 ? -2.746  -19.328 -21.138 1.00 89.25  ? 196 LEU G N     1 
ATOM   8114  C CA    . LEU D  2 196 ? -1.751  -18.549 -21.902 1.00 89.78  ? 196 LEU G CA    1 
ATOM   8115  C C     . LEU D  2 196 ? -2.120  -18.256 -23.389 1.00 95.46  ? 196 LEU G C     1 
ATOM   8116  O O     . LEU D  2 196 ? -2.370  -17.081 -23.712 1.00 97.42  ? 196 LEU G O     1 
ATOM   8117  C CB    . LEU D  2 196 ? -0.337  -19.173 -21.808 1.00 89.22  ? 196 LEU G CB    1 
ATOM   8118  C CG    . LEU D  2 196 ? 0.663   -18.481 -20.846 1.00 93.87  ? 196 LEU G CG    1 
ATOM   8119  C CD1   . LEU D  2 196 ? 0.017   -18.030 -19.536 1.00 93.91  ? 196 LEU G CD1   1 
ATOM   8120  C CD2   . LEU D  2 196 ? 1.819   -19.391 -20.520 1.00 96.79  ? 196 LEU G CD2   1 
ATOM   8121  N N     . GLY D  2 197 ? -2.157  -19.275 -24.254 1.00 89.09  ? 197 GLY G N     1 
ATOM   8122  C CA    . GLY D  2 197 ? -2.510  -19.073 -25.662 1.00 87.79  ? 197 GLY G CA    1 
ATOM   8123  C C     . GLY D  2 197 ? -3.998  -19.119 -25.983 1.00 87.74  ? 197 GLY G C     1 
ATOM   8124  O O     . GLY D  2 197 ? -4.388  -18.984 -27.149 1.00 86.07  ? 197 GLY G O     1 
ATOM   8125  N N     . THR D  2 198 ? -4.840  -19.323 -24.950 1.00 83.58  ? 198 THR G N     1 
ATOM   8126  C CA    . THR D  2 198 ? -6.304  -19.388 -25.040 1.00 83.87  ? 198 THR G CA    1 
ATOM   8127  C C     . THR D  2 198 ? -6.926  -18.018 -24.781 1.00 87.89  ? 198 THR G C     1 
ATOM   8128  O O     . THR D  2 198 ? -7.917  -17.682 -25.422 1.00 88.24  ? 198 THR G O     1 
ATOM   8129  C CB    . THR D  2 198 ? -6.829  -20.412 -24.009 1.00 96.58  ? 198 THR G CB    1 
ATOM   8130  O OG1   . THR D  2 198 ? -6.081  -21.631 -24.122 1.00 96.59  ? 198 THR G OG1   1 
ATOM   8131  C CG2   . THR D  2 198 ? -8.319  -20.694 -24.157 1.00 97.78  ? 198 THR G CG2   1 
ATOM   8132  N N     . LYS D  2 199 ? -6.378  -17.254 -23.800 1.00 83.64  ? 199 LYS G N     1 
ATOM   8133  C CA    . LYS D  2 199 ? -6.849  -15.917 -23.425 1.00 82.55  ? 199 LYS G CA    1 
ATOM   8134  C C     . LYS D  2 199 ? -5.755  -14.872 -23.658 1.00 82.86  ? 199 LYS G C     1 
ATOM   8135  O O     . LYS D  2 199 ? -4.550  -15.174 -23.630 1.00 81.48  ? 199 LYS G O     1 
ATOM   8136  C CB    . LYS D  2 199 ? -7.288  -15.897 -21.940 1.00 85.34  ? 199 LYS G CB    1 
ATOM   8137  C CG    . LYS D  2 199 ? -8.057  -14.638 -21.480 1.00 106.10 ? 199 LYS G CG    1 
ATOM   8138  C CD    . LYS D  2 199 ? -9.429  -14.420 -22.200 1.00 120.55 ? 199 LYS G CD    1 
ATOM   8139  C CE    . LYS D  2 199 ? -9.717  -12.997 -22.671 1.00 123.52 ? 199 LYS G CE    1 
ATOM   8140  N NZ    . LYS D  2 199 ? -10.352 -12.974 -24.020 1.00 121.97 ? 199 LYS G NZ    1 
ATOM   8141  N N     . THR D  2 200 ? -6.211  -13.633 -23.906 1.00 76.89  ? 200 THR G N     1 
ATOM   8142  C CA    . THR D  2 200 ? -5.375  -12.454 -24.135 1.00 74.87  ? 200 THR G CA    1 
ATOM   8143  C C     . THR D  2 200 ? -5.020  -11.778 -22.797 1.00 72.86  ? 200 THR G C     1 
ATOM   8144  O O     . THR D  2 200 ? -5.873  -11.667 -21.912 1.00 71.99  ? 200 THR G O     1 
ATOM   8145  C CB    . THR D  2 200 ? -6.114  -11.492 -25.085 1.00 85.06  ? 200 THR G CB    1 
ATOM   8146  O OG1   . THR D  2 200 ? -5.966  -11.982 -26.410 1.00 87.05  ? 200 THR G OG1   1 
ATOM   8147  C CG2   . THR D  2 200 ? -5.604  -10.072 -25.016 1.00 89.38  ? 200 THR G CG2   1 
ATOM   8148  N N     . TYR D  2 201 ? -3.774  -11.274 -22.691 1.00 64.74  ? 201 TYR G N     1 
ATOM   8149  C CA    . TYR D  2 201 ? -3.288  -10.541 -21.526 1.00 61.99  ? 201 TYR G CA    1 
ATOM   8150  C C     . TYR D  2 201 ? -2.657  -9.223  -21.972 1.00 61.00  ? 201 TYR G C     1 
ATOM   8151  O O     . TYR D  2 201 ? -1.647  -9.218  -22.668 1.00 57.98  ? 201 TYR G O     1 
ATOM   8152  C CB    . TYR D  2 201 ? -2.343  -11.413 -20.689 1.00 62.31  ? 201 TYR G CB    1 
ATOM   8153  C CG    . TYR D  2 201 ? -3.103  -12.538 -20.022 1.00 64.49  ? 201 TYR G CG    1 
ATOM   8154  C CD1   . TYR D  2 201 ? -4.119  -12.271 -19.109 1.00 66.71  ? 201 TYR G CD1   1 
ATOM   8155  C CD2   . TYR D  2 201 ? -2.916  -13.861 -20.414 1.00 65.36  ? 201 TYR G CD2   1 
ATOM   8156  C CE1   . TYR D  2 201 ? -4.895  -13.294 -18.567 1.00 67.92  ? 201 TYR G CE1   1 
ATOM   8157  C CE2   . TYR D  2 201 ? -3.654  -14.895 -19.844 1.00 66.36  ? 201 TYR G CE2   1 
ATOM   8158  C CZ    . TYR D  2 201 ? -4.651  -14.607 -18.928 1.00 74.94  ? 201 TYR G CZ    1 
ATOM   8159  O OH    . TYR D  2 201 ? -5.373  -15.615 -18.338 1.00 78.58  ? 201 TYR G OH    1 
ATOM   8160  N N     . THR D  2 202 ? -3.296  -8.102  -21.579 1.00 58.05  ? 202 THR G N     1 
ATOM   8161  C CA    . THR D  2 202 ? -2.883  -6.745  -21.937 1.00 58.69  ? 202 THR G CA    1 
ATOM   8162  C C     . THR D  2 202 ? -2.849  -5.849  -20.720 1.00 60.78  ? 202 THR G C     1 
ATOM   8163  O O     . THR D  2 202 ? -3.865  -5.743  -20.055 1.00 61.14  ? 202 THR G O     1 
ATOM   8164  C CB    . THR D  2 202 ? -3.895  -6.138  -22.935 1.00 61.42  ? 202 THR G CB    1 
ATOM   8165  O OG1   . THR D  2 202 ? -3.824  -6.880  -24.139 1.00 63.08  ? 202 THR G OG1   1 
ATOM   8166  C CG2   . THR D  2 202 ? -3.638  -4.639  -23.233 1.00 58.26  ? 202 THR G CG2   1 
ATOM   8167  N N     . CYS D  2 203 ? -1.756  -5.117  -20.503 1.00 56.67  ? 203 CYS G N     1 
ATOM   8168  C CA    . CYS D  2 203 ? -1.702  -4.131  -19.431 1.00 57.38  ? 203 CYS G CA    1 
ATOM   8169  C C     . CYS D  2 203 ? -1.976  -2.714  -20.002 1.00 56.90  ? 203 CYS G C     1 
ATOM   8170  O O     . CYS D  2 203 ? -1.460  -2.346  -21.051 1.00 52.76  ? 203 CYS G O     1 
ATOM   8171  C CB    . CYS D  2 203 ? -0.385  -4.200  -18.665 1.00 59.16  ? 203 CYS G CB    1 
ATOM   8172  S SG    . CYS D  2 203 ? 1.017   -3.453  -19.518 1.00 64.87  ? 203 CYS G SG    1 
ATOM   8173  N N     . ASN D  2 204 ? -2.803  -1.936  -19.298 1.00 54.52  ? 204 ASN G N     1 
ATOM   8174  C CA    . ASN D  2 204 ? -3.170  -0.578  -19.690 1.00 53.92  ? 204 ASN G CA    1 
ATOM   8175  C C     . ASN D  2 204 ? -2.461  0.344   -18.724 1.00 55.04  ? 204 ASN G C     1 
ATOM   8176  O O     . ASN D  2 204 ? -2.778  0.376   -17.529 1.00 52.15  ? 204 ASN G O     1 
ATOM   8177  C CB    . ASN D  2 204 ? -4.681  -0.385  -19.638 1.00 56.15  ? 204 ASN G CB    1 
ATOM   8178  C CG    . ASN D  2 204 ? -5.447  -1.612  -20.078 1.00 69.12  ? 204 ASN G CG    1 
ATOM   8179  O OD1   . ASN D  2 204 ? -6.055  -2.316  -19.268 1.00 63.07  ? 204 ASN G OD1   1 
ATOM   8180  N ND2   . ASN D  2 204 ? -5.308  -1.973  -21.329 1.00 56.68  ? 204 ASN G ND2   1 
ATOM   8181  N N     . VAL D  2 205 ? -1.447  1.033   -19.237 1.00 51.93  ? 205 VAL G N     1 
ATOM   8182  C CA    . VAL D  2 205 ? -0.613  1.943   -18.472 1.00 51.44  ? 205 VAL G CA    1 
ATOM   8183  C C     . VAL D  2 205 ? -1.021  3.369   -18.830 1.00 59.58  ? 205 VAL G C     1 
ATOM   8184  O O     . VAL D  2 205 ? -1.070  3.719   -20.015 1.00 60.27  ? 205 VAL G O     1 
ATOM   8185  C CB    . VAL D  2 205 ? 0.883   1.667   -18.802 1.00 54.03  ? 205 VAL G CB    1 
ATOM   8186  C CG1   . VAL D  2 205 ? 1.808   2.586   -18.023 1.00 53.64  ? 205 VAL G CG1   1 
ATOM   8187  C CG2   . VAL D  2 205 ? 1.245   0.210   -18.556 1.00 52.50  ? 205 VAL G CG2   1 
ATOM   8188  N N     . ASP D  2 206 ? -1.317  4.191   -17.818 1.00 58.01  ? 206 ASP G N     1 
ATOM   8189  C CA    . ASP D  2 206 ? -1.643  5.599   -18.039 1.00 58.81  ? 206 ASP G CA    1 
ATOM   8190  C C     . ASP D  2 206 ? -0.692  6.464   -17.206 1.00 60.30  ? 206 ASP G C     1 
ATOM   8191  O O     . ASP D  2 206 ? -0.547  6.245   -16.007 1.00 59.63  ? 206 ASP G O     1 
ATOM   8192  C CB    . ASP D  2 206 ? -3.126  5.922   -17.698 1.00 61.02  ? 206 ASP G CB    1 
ATOM   8193  C CG    . ASP D  2 206 ? -3.582  7.337   -18.059 1.00 72.04  ? 206 ASP G CG    1 
ATOM   8194  O OD1   . ASP D  2 206 ? -2.924  7.985   -18.917 1.00 73.82  ? 206 ASP G OD1   1 
ATOM   8195  O OD2   . ASP D  2 206 ? -4.606  7.790   -17.504 1.00 76.19  ? 206 ASP G OD2   1 
ATOM   8196  N N     . HIS D  2 207 ? -0.027  7.411   -17.873 1.00 55.49  ? 207 HIS G N     1 
ATOM   8197  C CA    . HIS D  2 207 ? 0.834   8.421   -17.280 1.00 54.94  ? 207 HIS G CA    1 
ATOM   8198  C C     . HIS D  2 207 ? 0.238   9.792   -17.652 1.00 59.07  ? 207 HIS G C     1 
ATOM   8199  O O     . HIS D  2 207 ? 0.568   10.369  -18.689 1.00 58.02  ? 207 HIS G O     1 
ATOM   8200  C CB    . HIS D  2 207 ? 2.263   8.283   -17.805 1.00 55.52  ? 207 HIS G CB    1 
ATOM   8201  C CG    . HIS D  2 207 ? 3.231   9.151   -17.072 1.00 58.42  ? 207 HIS G CG    1 
ATOM   8202  N ND1   . HIS D  2 207 ? 4.018   10.057  -17.736 1.00 60.67  ? 207 HIS G ND1   1 
ATOM   8203  C CD2   . HIS D  2 207 ? 3.470   9.250   -15.748 1.00 60.24  ? 207 HIS G CD2   1 
ATOM   8204  C CE1   . HIS D  2 207 ? 4.728   10.665  -16.811 1.00 60.55  ? 207 HIS G CE1   1 
ATOM   8205  N NE2   . HIS D  2 207 ? 4.426   10.211  -15.594 1.00 60.45  ? 207 HIS G NE2   1 
ATOM   8206  N N     . LYS D  2 208 ? -0.655  10.294  -16.797 1.00 57.15  ? 208 LYS G N     1 
ATOM   8207  C CA    . LYS D  2 208 ? -1.366  11.557  -17.019 1.00 58.00  ? 208 LYS G CA    1 
ATOM   8208  C C     . LYS D  2 208 ? -0.466  12.784  -17.160 1.00 62.15  ? 208 LYS G C     1 
ATOM   8209  O O     . LYS D  2 208 ? -0.767  13.594  -18.028 1.00 63.00  ? 208 LYS G O     1 
ATOM   8210  C CB    . LYS D  2 208 ? -2.433  11.791  -15.927 1.00 59.79  ? 208 LYS G CB    1 
ATOM   8211  C CG    . LYS D  2 208 ? -3.608  10.833  -16.049 1.00 67.53  ? 208 LYS G CG    1 
ATOM   8212  C CD    . LYS D  2 208 ? -4.690  11.080  -15.026 1.00 75.62  ? 208 LYS G CD    1 
ATOM   8213  C CE    . LYS D  2 208 ? -5.944  10.317  -15.388 1.00 93.65  ? 208 LYS G CE    1 
ATOM   8214  N NZ    . LYS D  2 208 ? -7.021  10.474  -14.372 1.00 107.95 ? 208 LYS G NZ    1 
ATOM   8215  N N     . PRO D  2 209 ? 0.668   12.933  -16.432 1.00 57.55  ? 209 PRO G N     1 
ATOM   8216  C CA    . PRO D  2 209 ? 1.510   14.131  -16.626 1.00 57.81  ? 209 PRO G CA    1 
ATOM   8217  C C     . PRO D  2 209 ? 2.088   14.332  -18.026 1.00 62.28  ? 209 PRO G C     1 
ATOM   8218  O O     . PRO D  2 209 ? 2.422   15.457  -18.378 1.00 63.51  ? 209 PRO G O     1 
ATOM   8219  C CB    . PRO D  2 209 ? 2.621   13.958  -15.580 1.00 59.03  ? 209 PRO G CB    1 
ATOM   8220  C CG    . PRO D  2 209 ? 2.059   13.023  -14.554 1.00 62.06  ? 209 PRO G CG    1 
ATOM   8221  C CD    . PRO D  2 209 ? 1.201   12.085  -15.350 1.00 57.87  ? 209 PRO G CD    1 
ATOM   8222  N N     . SER D  2 210 ? 2.261   13.254  -18.788 1.00 59.78  ? 210 SER G N     1 
ATOM   8223  C CA    . SER D  2 210 ? 2.758   13.284  -20.166 1.00 61.43  ? 210 SER G CA    1 
ATOM   8224  C C     . SER D  2 210 ? 1.623   13.002  -21.174 1.00 68.51  ? 210 SER G C     1 
ATOM   8225  O O     . SER D  2 210 ? 1.903   12.934  -22.363 1.00 68.48  ? 210 SER G O     1 
ATOM   8226  C CB    . SER D  2 210 ? 3.848   12.231  -20.350 1.00 64.06  ? 210 SER G CB    1 
ATOM   8227  O OG    . SER D  2 210 ? 3.317   10.922  -20.253 1.00 67.11  ? 210 SER G OG    1 
ATOM   8228  N N     . ASN D  2 211 ? 0.361   12.823  -20.702 1.00 68.11  ? 211 ASN G N     1 
ATOM   8229  C CA    . ASN D  2 211 ? -0.817  12.472  -21.511 1.00 69.70  ? 211 ASN G CA    1 
ATOM   8230  C C     . ASN D  2 211 ? -0.563  11.202  -22.369 1.00 73.54  ? 211 ASN G C     1 
ATOM   8231  O O     . ASN D  2 211 ? -1.053  11.115  -23.504 1.00 74.06  ? 211 ASN G O     1 
ATOM   8232  C CB    . ASN D  2 211 ? -1.293  13.685  -22.358 1.00 75.15  ? 211 ASN G CB    1 
ATOM   8233  C CG    . ASN D  2 211 ? -2.758  13.623  -22.768 1.00 110.64 ? 211 ASN G CG    1 
ATOM   8234  O OD1   . ASN D  2 211 ? -3.656  13.503  -21.924 1.00 106.50 ? 211 ASN G OD1   1 
ATOM   8235  N ND2   . ASN D  2 211 ? -3.044  13.744  -24.070 1.00 104.08 ? 211 ASN G ND2   1 
ATOM   8236  N N     . THR D  2 212 ? 0.209   10.213  -21.808 1.00 67.72  ? 212 THR G N     1 
ATOM   8237  C CA    . THR D  2 212 ? 0.533   8.966   -22.505 1.00 66.50  ? 212 THR G CA    1 
ATOM   8238  C C     . THR D  2 212 ? -0.340  7.809   -22.003 1.00 66.07  ? 212 THR G C     1 
ATOM   8239  O O     . THR D  2 212 ? -0.534  7.644   -20.807 1.00 63.52  ? 212 THR G O     1 
ATOM   8240  C CB    . THR D  2 212 ? 2.060   8.629   -22.489 1.00 80.84  ? 212 THR G CB    1 
ATOM   8241  O OG1   . THR D  2 212 ? 2.505   8.403   -21.169 1.00 89.33  ? 212 THR G OG1   1 
ATOM   8242  C CG2   . THR D  2 212 ? 2.929   9.705   -23.156 1.00 81.37  ? 212 THR G CG2   1 
ATOM   8243  N N     . LYS D  2 213 ? -0.921  7.050   -22.942 1.00 63.17  ? 213 LYS G N     1 
ATOM   8244  C CA    . LYS D  2 213 ? -1.717  5.856   -22.670 1.00 61.29  ? 213 LYS G CA    1 
ATOM   8245  C C     . LYS D  2 213 ? -1.133  4.751   -23.542 1.00 62.40  ? 213 LYS G C     1 
ATOM   8246  O O     . LYS D  2 213 ? -0.835  4.971   -24.717 1.00 62.23  ? 213 LYS G O     1 
ATOM   8247  C CB    . LYS D  2 213 ? -3.212  6.081   -22.934 1.00 63.98  ? 213 LYS G CB    1 
ATOM   8248  C CG    . LYS D  2 213 ? -3.854  6.990   -21.889 1.00 77.10  ? 213 LYS G CG    1 
ATOM   8249  C CD    . LYS D  2 213 ? -5.380  7.022   -21.960 1.00 86.66  ? 213 LYS G CD    1 
ATOM   8250  C CE    . LYS D  2 213 ? -6.026  5.932   -21.142 1.00 97.49  ? 213 LYS G CE    1 
ATOM   8251  N NZ    . LYS D  2 213 ? -7.469  5.791   -21.458 1.00 111.36 ? 213 LYS G NZ    1 
ATOM   8252  N N     . VAL D  2 214 ? -0.826  3.621   -22.926 1.00 58.65  ? 214 VAL G N     1 
ATOM   8253  C CA    . VAL D  2 214 ? -0.211  2.480   -23.607 1.00 58.03  ? 214 VAL G CA    1 
ATOM   8254  C C     . VAL D  2 214 ? -0.941  1.212   -23.202 1.00 60.17  ? 214 VAL G C     1 
ATOM   8255  O O     . VAL D  2 214 ? -1.002  0.908   -22.012 1.00 59.16  ? 214 VAL G O     1 
ATOM   8256  C CB    . VAL D  2 214 ? 1.292   2.358   -23.262 1.00 61.57  ? 214 VAL G CB    1 
ATOM   8257  C CG1   . VAL D  2 214 ? 1.903   1.123   -23.928 1.00 61.81  ? 214 VAL G CG1   1 
ATOM   8258  C CG2   . VAL D  2 214 ? 2.038   3.618   -23.664 1.00 62.63  ? 214 VAL G CG2   1 
ATOM   8259  N N     . ASP D  2 215 ? -1.465  0.475   -24.184 1.00 56.60  ? 215 ASP G N     1 
ATOM   8260  C CA    . ASP D  2 215 ? -2.119  -0.816  -23.971 1.00 55.49  ? 215 ASP G CA    1 
ATOM   8261  C C     . ASP D  2 215 ? -1.168  -1.779  -24.599 1.00 58.73  ? 215 ASP G C     1 
ATOM   8262  O O     . ASP D  2 215 ? -1.119  -1.857  -25.811 1.00 59.71  ? 215 ASP G O     1 
ATOM   8263  C CB    . ASP D  2 215 ? -3.504  -0.850  -24.610 1.00 57.47  ? 215 ASP G CB    1 
ATOM   8264  C CG    . ASP D  2 215 ? -4.386  0.263   -24.098 1.00 65.34  ? 215 ASP G CG    1 
ATOM   8265  O OD1   . ASP D  2 215 ? -4.576  0.349   -22.865 1.00 63.84  ? 215 ASP G OD1   1 
ATOM   8266  O OD2   . ASP D  2 215 ? -4.831  1.088   -24.918 1.00 76.15  ? 215 ASP G OD2   1 
ATOM   8267  N N     . LYS D  2 216 ? -0.290  -2.378  -23.779 1.00 55.14  ? 216 LYS G N     1 
ATOM   8268  C CA    . LYS D  2 216 ? 0.765   -3.258  -24.234 1.00 54.62  ? 216 LYS G CA    1 
ATOM   8269  C C     . LYS D  2 216 ? 0.293   -4.691  -24.132 1.00 60.91  ? 216 LYS G C     1 
ATOM   8270  O O     . LYS D  2 216 ? -0.056  -5.168  -23.043 1.00 58.84  ? 216 LYS G O     1 
ATOM   8271  C CB    . LYS D  2 216 ? 2.056   -3.034  -23.421 1.00 55.52  ? 216 LYS G CB    1 
ATOM   8272  C CG    . LYS D  2 216 ? 3.241   -3.985  -23.720 1.00 57.81  ? 216 LYS G CG    1 
ATOM   8273  C CD    . LYS D  2 216 ? 3.721   -3.986  -25.166 1.00 60.24  ? 216 LYS G CD    1 
ATOM   8274  C CE    . LYS D  2 216 ? 4.926   -3.133  -25.429 1.00 75.70  ? 216 LYS G CE    1 
ATOM   8275  N NZ    . LYS D  2 216 ? 5.132   -2.913  -26.884 1.00 90.09  ? 216 LYS G NZ    1 
ATOM   8276  N N     . ARG D  2 217 ? 0.289   -5.381  -25.286 1.00 59.21  ? 217 ARG G N     1 
ATOM   8277  C CA    . ARG D  2 217 ? -0.094  -6.781  -25.372 1.00 57.72  ? 217 ARG G CA    1 
ATOM   8278  C C     . ARG D  2 217 ? 1.124   -7.579  -24.936 1.00 60.64  ? 217 ARG G C     1 
ATOM   8279  O O     . ARG D  2 217 ? 2.171   -7.473  -25.572 1.00 59.71  ? 217 ARG G O     1 
ATOM   8280  C CB    . ARG D  2 217 ? -0.481  -7.105  -26.819 1.00 57.09  ? 217 ARG G CB    1 
ATOM   8281  C CG    . ARG D  2 217 ? -1.070  -8.494  -27.035 1.00 58.44  ? 217 ARG G CG    1 
ATOM   8282  C CD    . ARG D  2 217 ? -2.433  -8.629  -26.395 1.00 64.08  ? 217 ARG G CD    1 
ATOM   8283  N NE    . ARG D  2 217 ? -3.287  -9.538  -27.160 1.00 91.62  ? 217 ARG G NE    1 
ATOM   8284  C CZ    . ARG D  2 217 ? -4.043  -9.210  -28.205 1.00 105.37 ? 217 ARG G CZ    1 
ATOM   8285  N NH1   . ARG D  2 217 ? -4.077  -7.957  -28.646 1.00 94.66  ? 217 ARG G NH1   1 
ATOM   8286  N NH2   . ARG D  2 217 ? -4.769  -10.134 -28.820 1.00 101.33 ? 217 ARG G NH2   1 
ATOM   8287  N N     . VAL D  2 218 ? 1.011   -8.327  -23.829 1.00 58.63  ? 218 VAL G N     1 
ATOM   8288  C CA    . VAL D  2 218 ? 2.154   -9.111  -23.315 1.00 59.73  ? 218 VAL G CA    1 
ATOM   8289  C C     . VAL D  2 218 ? 2.006   -10.574 -23.760 1.00 64.67  ? 218 VAL G C     1 
ATOM   8290  O O     . VAL D  2 218 ? 3.025   -11.222 -24.003 1.00 63.94  ? 218 VAL G O     1 
ATOM   8291  C CB    . VAL D  2 218 ? 2.461   -8.918  -21.778 1.00 62.83  ? 218 VAL G CB    1 
ATOM   8292  C CG1   . VAL D  2 218 ? 1.526   -7.902  -21.120 1.00 62.78  ? 218 VAL G CG1   1 
ATOM   8293  C CG2   . VAL D  2 218 ? 2.508   -10.224 -20.990 1.00 61.98  ? 218 VAL G CG2   1 
ATOM   8294  N N     . GLU D  2 219 ? 0.763   -11.077 -23.879 1.00 61.94  ? 219 GLU G N     1 
ATOM   8295  C CA    . GLU D  2 219 ? 0.513   -12.428 -24.350 1.00 62.91  ? 219 GLU G CA    1 
ATOM   8296  C C     . GLU D  2 219 ? -0.779  -12.497 -25.175 1.00 69.93  ? 219 GLU G C     1 
ATOM   8297  O O     . GLU D  2 219 ? -1.859  -12.140 -24.697 1.00 69.20  ? 219 GLU G O     1 
ATOM   8298  C CB    . GLU D  2 219 ? 0.516   -13.422 -23.172 1.00 63.47  ? 219 GLU G CB    1 
ATOM   8299  C CG    . GLU D  2 219 ? 1.346   -14.661 -23.452 1.00 73.37  ? 219 GLU G CG    1 
ATOM   8300  C CD    . GLU D  2 219 ? 2.836   -14.430 -23.614 1.00 74.71  ? 219 GLU G CD    1 
ATOM   8301  O OE1   . GLU D  2 219 ? 3.312   -14.434 -24.768 1.00 78.07  ? 219 GLU G OE1   1 
ATOM   8302  O OE2   . GLU D  2 219 ? 3.533   -14.271 -22.592 1.00 65.58  ? 219 GLU G OE2   1 
ATOM   8303  N N     . SER D  2 220 ? -0.642  -12.940 -26.436 1.00 68.72  ? 220 SER G N     1 
ATOM   8304  C CA    . SER D  2 220 ? -1.747  -13.069 -27.390 1.00 69.29  ? 220 SER G CA    1 
ATOM   8305  C C     . SER D  2 220 ? -2.238  -14.519 -27.453 1.00 73.64  ? 220 SER G C     1 
ATOM   8306  O O     . SER D  2 220 ? -1.688  -15.392 -26.768 1.00 71.39  ? 220 SER G O     1 
ATOM   8307  C CB    . SER D  2 220 ? -1.291  -12.599 -28.776 1.00 72.61  ? 220 SER G CB    1 
ATOM   8308  O OG    . SER D  2 220 ? -1.522  -11.208 -28.938 1.00 78.00  ? 220 SER G OG    1 
ATOM   8309  N N     . LYS D  2 221 ? -3.289  -14.772 -28.267 1.00 71.94  ? 221 LYS G N     1 
ATOM   8310  C CA    . LYS D  2 221 ? -3.785  -16.143 -28.477 1.00 71.40  ? 221 LYS G CA    1 
ATOM   8311  C C     . LYS D  2 221 ? -2.825  -16.867 -29.450 1.00 74.64  ? 221 LYS G C     1 
ATOM   8312  O O     . LYS D  2 221 ? -2.030  -16.208 -30.139 1.00 73.40  ? 221 LYS G O     1 
ATOM   8313  C CB    . LYS D  2 221 ? -5.209  -16.153 -29.084 1.00 73.95  ? 221 LYS G CB    1 
ATOM   8314  C CG    . LYS D  2 221 ? -6.344  -15.817 -28.120 1.00 80.37  ? 221 LYS G CG    1 
ATOM   8315  C CD    . LYS D  2 221 ? -7.665  -15.704 -28.883 1.00 88.95  ? 221 LYS G CD    1 
ATOM   8316  C CE    . LYS D  2 221 ? -8.833  -15.288 -28.020 1.00 104.77 ? 221 LYS G CE    1 
ATOM   8317  N NZ    . LYS D  2 221 ? -9.922  -14.661 -28.828 1.00 114.38 ? 221 LYS G NZ    1 
ATOM   8318  N N     . TYR D  2 222 ? -2.934  -18.214 -29.536 1.00 70.46  ? 222 TYR G N     1 
ATOM   8319  C CA    . TYR D  2 222 ? -2.138  -19.008 -30.488 1.00 69.83  ? 222 TYR G CA    1 
ATOM   8320  C C     . TYR D  2 222 ? -2.532  -18.640 -31.913 1.00 73.03  ? 222 TYR G C     1 
ATOM   8321  O O     . TYR D  2 222 ? -3.646  -18.162 -32.148 1.00 72.86  ? 222 TYR G O     1 
ATOM   8322  C CB    . TYR D  2 222 ? -2.383  -20.526 -30.336 1.00 70.22  ? 222 TYR G CB    1 
ATOM   8323  C CG    . TYR D  2 222 ? -1.865  -21.138 -29.059 1.00 71.16  ? 222 TYR G CG    1 
ATOM   8324  C CD1   . TYR D  2 222 ? -0.506  -21.181 -28.788 1.00 73.34  ? 222 TYR G CD1   1 
ATOM   8325  C CD2   . TYR D  2 222 ? -2.728  -21.755 -28.160 1.00 71.91  ? 222 TYR G CD2   1 
ATOM   8326  C CE1   . TYR D  2 222 ? -0.015  -21.768 -27.620 1.00 74.29  ? 222 TYR G CE1   1 
ATOM   8327  C CE2   . TYR D  2 222 ? -2.249  -22.366 -26.997 1.00 72.67  ? 222 TYR G CE2   1 
ATOM   8328  C CZ    . TYR D  2 222 ? -0.889  -22.378 -26.734 1.00 84.06  ? 222 TYR G CZ    1 
ATOM   8329  O OH    . TYR D  2 222 ? -0.429  -22.944 -25.563 1.00 91.62  ? 222 TYR G OH    1 
ATOM   8330  N N     . GLY D  2 223 ? -1.621  -18.898 -32.844 1.00 69.56  ? 223 GLY G N     1 
ATOM   8331  C CA    . GLY D  2 223 ? -1.846  -18.687 -34.269 1.00 69.80  ? 223 GLY G CA    1 
ATOM   8332  C C     . GLY D  2 223 ? -0.861  -17.773 -34.967 1.00 72.52  ? 223 GLY G C     1 
ATOM   8333  O O     . GLY D  2 223 ? -0.155  -16.997 -34.321 1.00 70.18  ? 223 GLY G O     1 
ATOM   8334  N N     . PRO D  2 224 ? -0.854  -17.797 -36.323 1.00 69.90  ? 224 PRO G N     1 
ATOM   8335  C CA    . PRO D  2 224 ? 0.056   -16.909 -37.077 1.00 69.89  ? 224 PRO G CA    1 
ATOM   8336  C C     . PRO D  2 224 ? -0.195  -15.444 -36.771 1.00 72.13  ? 224 PRO G C     1 
ATOM   8337  O O     . PRO D  2 224 ? -1.326  -15.114 -36.416 1.00 72.09  ? 224 PRO G O     1 
ATOM   8338  C CB    . PRO D  2 224 ? -0.257  -17.236 -38.544 1.00 72.94  ? 224 PRO G CB    1 
ATOM   8339  C CG    . PRO D  2 224 ? -0.856  -18.590 -38.513 1.00 76.63  ? 224 PRO G CG    1 
ATOM   8340  C CD    . PRO D  2 224 ? -1.645  -18.647 -37.236 1.00 71.23  ? 224 PRO G CD    1 
ATOM   8341  N N     . PRO D  2 225 ? 0.824   -14.552 -36.833 1.00 66.63  ? 225 PRO G N     1 
ATOM   8342  C CA    . PRO D  2 225 ? 2.225   -14.770 -37.258 1.00 65.83  ? 225 PRO G CA    1 
ATOM   8343  C C     . PRO D  2 225 ? 3.176   -15.381 -36.214 1.00 67.65  ? 225 PRO G C     1 
ATOM   8344  O O     . PRO D  2 225 ? 4.391   -15.346 -36.415 1.00 66.35  ? 225 PRO G O     1 
ATOM   8345  C CB    . PRO D  2 225 ? 2.669   -13.347 -37.643 1.00 68.56  ? 225 PRO G CB    1 
ATOM   8346  C CG    . PRO D  2 225 ? 1.944   -12.486 -36.645 1.00 71.25  ? 225 PRO G CG    1 
ATOM   8347  C CD    . PRO D  2 225 ? 0.587   -13.134 -36.491 1.00 66.46  ? 225 PRO G CD    1 
ATOM   8348  N N     . CYS D  2 226 ? 2.662   -15.932 -35.105 1.00 63.74  ? 226 CYS G N     1 
ATOM   8349  C CA    . CYS D  2 226 ? 3.551   -16.516 -34.118 1.00 63.86  ? 226 CYS G CA    1 
ATOM   8350  C C     . CYS D  2 226 ? 4.109   -17.848 -34.611 1.00 71.31  ? 226 CYS G C     1 
ATOM   8351  O O     . CYS D  2 226 ? 3.359   -18.656 -35.149 1.00 67.60  ? 226 CYS G O     1 
ATOM   8352  C CB    . CYS D  2 226 ? 2.869   -16.646 -32.756 1.00 62.79  ? 226 CYS G CB    1 
ATOM   8353  S SG    . CYS D  2 226 ? 2.593   -15.049 -31.938 1.00 67.10  ? 226 CYS G SG    1 
ATOM   8354  N N     . PRO D  2 227 ? 5.435   -18.066 -34.454 1.00 74.15  ? 227 PRO G N     1 
ATOM   8355  C CA    . PRO D  2 227 ? 6.041   -19.325 -34.916 1.00 74.98  ? 227 PRO G CA    1 
ATOM   8356  C C     . PRO D  2 227 ? 5.481   -20.536 -34.171 1.00 79.16  ? 227 PRO G C     1 
ATOM   8357  O O     . PRO D  2 227 ? 5.121   -20.430 -33.003 1.00 76.85  ? 227 PRO G O     1 
ATOM   8358  C CB    . PRO D  2 227 ? 7.541   -19.101 -34.706 1.00 77.47  ? 227 PRO G CB    1 
ATOM   8359  C CG    . PRO D  2 227 ? 7.618   -18.072 -33.622 1.00 82.09  ? 227 PRO G CG    1 
ATOM   8360  C CD    . PRO D  2 227 ? 6.436   -17.184 -33.821 1.00 77.42  ? 227 PRO G CD    1 
ATOM   8361  N N     . PRO D  2 228 ? 5.353   -21.682 -34.868 1.00 79.17  ? 228 PRO G N     1 
ATOM   8362  C CA    . PRO D  2 228 ? 4.661   -22.846 -34.280 1.00 79.25  ? 228 PRO G CA    1 
ATOM   8363  C C     . PRO D  2 228 ? 5.358   -23.665 -33.177 1.00 84.93  ? 228 PRO G C     1 
ATOM   8364  O O     . PRO D  2 228 ? 4.652   -24.484 -32.576 1.00 84.56  ? 228 PRO G O     1 
ATOM   8365  C CB    . PRO D  2 228 ? 4.394   -23.728 -35.500 1.00 80.96  ? 228 PRO G CB    1 
ATOM   8366  C CG    . PRO D  2 228 ? 5.450   -23.357 -36.472 1.00 85.84  ? 228 PRO G CG    1 
ATOM   8367  C CD    . PRO D  2 228 ? 5.674   -21.910 -36.290 1.00 81.72  ? 228 PRO G CD    1 
ATOM   8368  N N     . CYS D  2 229 ? 6.688   -23.482 -32.913 1.00 82.31  ? 229 CYS G N     1 
ATOM   8369  C CA    . CYS D  2 229 ? 7.493   -24.239 -31.906 1.00 114.32 ? 229 CYS G CA    1 
ATOM   8370  C C     . CYS D  2 229 ? 8.024   -25.539 -32.487 1.00 105.95 ? 229 CYS G C     1 
ATOM   8371  O O     . CYS D  2 229 ? 7.240   -26.444 -32.735 1.00 70.90  ? 229 CYS G O     1 
ATOM   8372  C CB    . CYS D  2 229 ? 6.756   -24.487 -30.585 1.00 114.15 ? 229 CYS G CB    1 
ATOM   8373  S SG    . CYS D  2 229 ? 6.270   -22.982 -29.693 1.00 118.23 ? 229 CYS G SG    1 
ATOM   8374  N N     . GLY D  2 236 ? -1.762  -36.344 -28.093 1.00 102.38 ? 236 GLY G N     1 
ATOM   8375  C CA    . GLY D  2 236 ? -3.009  -35.613 -27.894 1.00 102.47 ? 236 GLY G CA    1 
ATOM   8376  C C     . GLY D  2 236 ? -3.910  -36.284 -26.880 1.00 106.35 ? 236 GLY G C     1 
ATOM   8377  O O     . GLY D  2 236 ? -4.980  -36.794 -27.234 1.00 106.00 ? 236 GLY G O     1 
ATOM   8378  N N     . GLY D  2 237 ? -3.462  -36.275 -25.621 1.00 102.56 ? 237 GLY G N     1 
ATOM   8379  C CA    . GLY D  2 237 ? -4.152  -36.903 -24.497 1.00 102.10 ? 237 GLY G CA    1 
ATOM   8380  C C     . GLY D  2 237 ? -3.714  -38.345 -24.297 1.00 104.78 ? 237 GLY G C     1 
ATOM   8381  O O     . GLY D  2 237 ? -3.093  -38.922 -25.197 1.00 103.61 ? 237 GLY G O     1 
ATOM   8382  N N     . PRO D  2 238 ? -4.037  -38.985 -23.143 1.00 101.42 ? 238 PRO G N     1 
ATOM   8383  C CA    . PRO D  2 238 ? -3.597  -40.380 -22.931 1.00 100.21 ? 238 PRO G CA    1 
ATOM   8384  C C     . PRO D  2 238 ? -4.205  -41.434 -23.869 1.00 99.22  ? 238 PRO G C     1 
ATOM   8385  O O     . PRO D  2 238 ? -5.378  -41.349 -24.241 1.00 98.32  ? 238 PRO G O     1 
ATOM   8386  C CB    . PRO D  2 238 ? -3.947  -40.673 -21.462 1.00 102.92 ? 238 PRO G CB    1 
ATOM   8387  C CG    . PRO D  2 238 ? -4.373  -39.401 -20.866 1.00 108.44 ? 238 PRO G CG    1 
ATOM   8388  C CD    . PRO D  2 238 ? -4.748  -38.455 -21.963 1.00 104.03 ? 238 PRO G CD    1 
ATOM   8389  N N     . SER D  2 239 ? -3.374  -42.428 -24.250 1.00 92.31  ? 239 SER G N     1 
ATOM   8390  C CA    . SER D  2 239 ? -3.749  -43.558 -25.113 1.00 90.18  ? 239 SER G CA    1 
ATOM   8391  C C     . SER D  2 239 ? -3.436  -44.833 -24.337 1.00 87.98  ? 239 SER G C     1 
ATOM   8392  O O     . SER D  2 239 ? -2.507  -44.838 -23.518 1.00 85.69  ? 239 SER G O     1 
ATOM   8393  C CB    . SER D  2 239 ? -2.961  -43.537 -26.421 1.00 93.85  ? 239 SER G CB    1 
ATOM   8394  O OG    . SER D  2 239 ? -3.198  -42.354 -27.170 1.00 104.12 ? 239 SER G OG    1 
ATOM   8395  N N     . VAL D  2 240 ? -4.213  -45.911 -24.588 1.00 81.75  ? 240 VAL G N     1 
ATOM   8396  C CA    . VAL D  2 240 ? -4.063  -47.189 -23.858 1.00 79.31  ? 240 VAL G CA    1 
ATOM   8397  C C     . VAL D  2 240 ? -3.808  -48.392 -24.775 1.00 75.88  ? 240 VAL G C     1 
ATOM   8398  O O     . VAL D  2 240 ? -4.522  -48.605 -25.766 1.00 74.27  ? 240 VAL G O     1 
ATOM   8399  C CB    . VAL D  2 240 ? -5.282  -47.441 -22.922 1.00 82.83  ? 240 VAL G CB    1 
ATOM   8400  C CG1   . VAL D  2 240 ? -5.169  -48.786 -22.201 1.00 82.41  ? 240 VAL G CG1   1 
ATOM   8401  C CG2   . VAL D  2 240 ? -5.419  -46.309 -21.915 1.00 83.02  ? 240 VAL G CG2   1 
ATOM   8402  N N     . PHE D  2 241 ? -2.821  -49.212 -24.378 1.00 68.15  ? 241 PHE G N     1 
ATOM   8403  C CA    . PHE D  2 241 ? -2.461  -50.445 -25.071 1.00 66.24  ? 241 PHE G CA    1 
ATOM   8404  C C     . PHE D  2 241 ? -2.536  -51.611 -24.100 1.00 68.02  ? 241 PHE G C     1 
ATOM   8405  O O     . PHE D  2 241 ? -2.031  -51.533 -22.975 1.00 67.06  ? 241 PHE G O     1 
ATOM   8406  C CB    . PHE D  2 241 ? -1.078  -50.325 -25.729 1.00 67.26  ? 241 PHE G CB    1 
ATOM   8407  C CG    . PHE D  2 241 ? -1.099  -49.209 -26.743 1.00 68.07  ? 241 PHE G CG    1 
ATOM   8408  C CD1   . PHE D  2 241 ? -1.829  -49.336 -27.918 1.00 70.35  ? 241 PHE G CD1   1 
ATOM   8409  C CD2   . PHE D  2 241 ? -0.586  -47.957 -26.426 1.00 69.38  ? 241 PHE G CD2   1 
ATOM   8410  C CE1   . PHE D  2 241 ? -1.956  -48.267 -28.798 1.00 71.28  ? 241 PHE G CE1   1 
ATOM   8411  C CE2   . PHE D  2 241 ? -0.726  -46.886 -27.304 1.00 71.85  ? 241 PHE G CE2   1 
ATOM   8412  C CZ    . PHE D  2 241 ? -1.389  -47.052 -28.491 1.00 69.86  ? 241 PHE G CZ    1 
ATOM   8413  N N     . LEU D  2 242 ? -3.227  -52.675 -24.530 1.00 63.62  ? 242 LEU G N     1 
ATOM   8414  C CA    . LEU D  2 242 ? -3.449  -53.879 -23.740 1.00 63.05  ? 242 LEU G CA    1 
ATOM   8415  C C     . LEU D  2 242 ? -2.813  -55.056 -24.468 1.00 62.16  ? 242 LEU G C     1 
ATOM   8416  O O     . LEU D  2 242 ? -3.155  -55.331 -25.616 1.00 59.17  ? 242 LEU G O     1 
ATOM   8417  C CB    . LEU D  2 242 ? -4.960  -54.070 -23.546 1.00 63.39  ? 242 LEU G CB    1 
ATOM   8418  C CG    . LEU D  2 242 ? -5.398  -55.170 -22.606 1.00 67.53  ? 242 LEU G CG    1 
ATOM   8419  C CD1   . LEU D  2 242 ? -4.753  -55.027 -21.246 1.00 67.34  ? 242 LEU G CD1   1 
ATOM   8420  C CD2   . LEU D  2 242 ? -6.895  -55.188 -22.508 1.00 69.24  ? 242 LEU G CD2   1 
ATOM   8421  N N     . PHE D  2 243 ? -1.867  -55.718 -23.801 1.00 58.43  ? 243 PHE G N     1 
ATOM   8422  C CA    . PHE D  2 243 ? -1.060  -56.800 -24.354 1.00 57.73  ? 243 PHE G CA    1 
ATOM   8423  C C     . PHE D  2 243 ? -1.448  -58.163 -23.800 1.00 59.34  ? 243 PHE G C     1 
ATOM   8424  O O     . PHE D  2 243 ? -1.614  -58.327 -22.592 1.00 57.79  ? 243 PHE G O     1 
ATOM   8425  C CB    . PHE D  2 243 ? 0.410   -56.504 -24.082 1.00 60.24  ? 243 PHE G CB    1 
ATOM   8426  C CG    . PHE D  2 243 ? 0.824   -55.208 -24.743 1.00 62.55  ? 243 PHE G CG    1 
ATOM   8427  C CD1   . PHE D  2 243 ? 0.961   -55.126 -26.121 1.00 65.60  ? 243 PHE G CD1   1 
ATOM   8428  C CD2   . PHE D  2 243 ? 1.035   -54.062 -23.990 1.00 65.99  ? 243 PHE G CD2   1 
ATOM   8429  C CE1   . PHE D  2 243 ? 1.327   -53.933 -26.734 1.00 66.81  ? 243 PHE G CE1   1 
ATOM   8430  C CE2   . PHE D  2 243 ? 1.406   -52.863 -24.606 1.00 69.11  ? 243 PHE G CE2   1 
ATOM   8431  C CZ    . PHE D  2 243 ? 1.558   -52.808 -25.974 1.00 67.02  ? 243 PHE G CZ    1 
ATOM   8432  N N     . PRO D  2 244 ? -1.639  -59.159 -24.678 1.00 55.12  ? 244 PRO G N     1 
ATOM   8433  C CA    . PRO D  2 244 ? -2.056  -60.476 -24.190 1.00 55.60  ? 244 PRO G CA    1 
ATOM   8434  C C     . PRO D  2 244 ? -0.882  -61.238 -23.612 1.00 60.15  ? 244 PRO G C     1 
ATOM   8435  O O     . PRO D  2 244 ? 0.271   -60.861 -23.855 1.00 60.61  ? 244 PRO G O     1 
ATOM   8436  C CB    . PRO D  2 244 ? -2.558  -61.153 -25.469 1.00 56.18  ? 244 PRO G CB    1 
ATOM   8437  C CG    . PRO D  2 244 ? -1.722  -60.582 -26.515 1.00 58.05  ? 244 PRO G CG    1 
ATOM   8438  C CD    . PRO D  2 244 ? -1.507  -59.158 -26.152 1.00 54.16  ? 244 PRO G CD    1 
ATOM   8439  N N     . PRO D  2 245 ? -1.140  -62.381 -22.962 1.00 55.91  ? 245 PRO G N     1 
ATOM   8440  C CA    . PRO D  2 245 ? -0.026  -63.221 -22.505 1.00 56.55  ? 245 PRO G CA    1 
ATOM   8441  C C     . PRO D  2 245 ? 0.751   -63.836 -23.674 1.00 61.47  ? 245 PRO G C     1 
ATOM   8442  O O     . PRO D  2 245 ? 0.284   -63.879 -24.819 1.00 59.60  ? 245 PRO G O     1 
ATOM   8443  C CB    . PRO D  2 245 ? -0.721  -64.307 -21.663 1.00 58.51  ? 245 PRO G CB    1 
ATOM   8444  C CG    . PRO D  2 245 ? -2.077  -64.379 -22.214 1.00 62.75  ? 245 PRO G CG    1 
ATOM   8445  C CD    . PRO D  2 245 ? -2.437  -62.983 -22.616 1.00 57.43  ? 245 PRO G CD    1 
ATOM   8446  N N     . LYS D  2 246 ? 1.907   -64.392 -23.349 1.00 61.06  ? 246 LYS G N     1 
ATOM   8447  C CA    . LYS D  2 246 ? 2.755   -65.044 -24.330 1.00 60.86  ? 246 LYS G CA    1 
ATOM   8448  C C     . LYS D  2 246 ? 2.186   -66.448 -24.567 1.00 63.43  ? 246 LYS G C     1 
ATOM   8449  O O     . LYS D  2 246 ? 1.906   -67.132 -23.595 1.00 64.70  ? 246 LYS G O     1 
ATOM   8450  C CB    . LYS D  2 246 ? 4.200   -65.135 -23.798 1.00 64.17  ? 246 LYS G CB    1 
ATOM   8451  C CG    . LYS D  2 246 ? 5.255   -65.160 -24.889 1.00 86.00  ? 246 LYS G CG    1 
ATOM   8452  N N     . PRO D  2 247 ? 2.024   -66.902 -25.824 1.00 58.41  ? 247 PRO G N     1 
ATOM   8453  C CA    . PRO D  2 247 ? 1.507   -68.258 -26.071 1.00 58.53  ? 247 PRO G CA    1 
ATOM   8454  C C     . PRO D  2 247 ? 2.077   -69.387 -25.205 1.00 64.29  ? 247 PRO G C     1 
ATOM   8455  O O     . PRO D  2 247 ? 1.301   -70.177 -24.680 1.00 63.56  ? 247 PRO G O     1 
ATOM   8456  C CB    . PRO D  2 247 ? 1.839   -68.477 -27.546 1.00 58.85  ? 247 PRO G CB    1 
ATOM   8457  C CG    . PRO D  2 247 ? 1.738   -67.164 -28.125 1.00 62.54  ? 247 PRO G CG    1 
ATOM   8458  C CD    . PRO D  2 247 ? 2.253   -66.197 -27.096 1.00 58.56  ? 247 PRO G CD    1 
ATOM   8459  N N     . LYS D  2 248 ? 3.412   -69.450 -25.025 1.00 63.41  ? 248 LYS G N     1 
ATOM   8460  C CA    . LYS D  2 248 ? 4.032   -70.523 -24.217 1.00 65.05  ? 248 LYS G CA    1 
ATOM   8461  C C     . LYS D  2 248 ? 3.568   -70.502 -22.763 1.00 68.67  ? 248 LYS G C     1 
ATOM   8462  O O     . LYS D  2 248 ? 3.450   -71.563 -22.140 1.00 67.68  ? 248 LYS G O     1 
ATOM   8463  C CB    . LYS D  2 248 ? 5.576   -70.463 -24.261 1.00 68.67  ? 248 LYS G CB    1 
ATOM   8464  C CG    . LYS D  2 248 ? 6.211   -71.796 -24.638 1.00 87.63  ? 248 LYS G CG    1 
ATOM   8465  C CD    . LYS D  2 248 ? 7.700   -71.891 -24.293 1.00 100.26 ? 248 LYS G CD    1 
ATOM   8466  C CE    . LYS D  2 248 ? 8.578   -70.998 -25.147 1.00 112.01 ? 248 LYS G CE    1 
ATOM   8467  N NZ    . LYS D  2 248 ? 9.963   -70.892 -24.608 1.00 125.37 ? 248 LYS G NZ    1 
ATOM   8468  N N     . ASP D  2 249 ? 3.327   -69.282 -22.229 1.00 65.36  ? 249 ASP G N     1 
ATOM   8469  C CA    . ASP D  2 249 ? 2.888   -69.068 -20.846 1.00 65.92  ? 249 ASP G CA    1 
ATOM   8470  C C     . ASP D  2 249 ? 1.451   -69.544 -20.604 1.00 66.74  ? 249 ASP G C     1 
ATOM   8471  O O     . ASP D  2 249 ? 1.127   -69.885 -19.476 1.00 66.66  ? 249 ASP G O     1 
ATOM   8472  C CB    . ASP D  2 249 ? 3.012   -67.579 -20.441 1.00 68.35  ? 249 ASP G CB    1 
ATOM   8473  C CG    . ASP D  2 249 ? 4.399   -66.956 -20.528 1.00 78.78  ? 249 ASP G CG    1 
ATOM   8474  O OD1   . ASP D  2 249 ? 5.397   -67.716 -20.548 1.00 78.82  ? 249 ASP G OD1   1 
ATOM   8475  O OD2   . ASP D  2 249 ? 4.485   -65.705 -20.549 1.00 84.51  ? 249 ASP G OD2   1 
ATOM   8476  N N     . THR D  2 250 ? 0.586   -69.549 -21.645 1.00 61.81  ? 250 THR G N     1 
ATOM   8477  C CA    . THR D  2 250 ? -0.812  -70.013 -21.522 1.00 60.66  ? 250 THR G CA    1 
ATOM   8478  C C     . THR D  2 250 ? -0.892  -71.561 -21.668 1.00 64.41  ? 250 THR G C     1 
ATOM   8479  O O     . THR D  2 250 ? -1.775  -72.203 -21.083 1.00 64.25  ? 250 THR G O     1 
ATOM   8480  C CB    . THR D  2 250 ? -1.709  -69.315 -22.552 1.00 60.06  ? 250 THR G CB    1 
ATOM   8481  O OG1   . THR D  2 250 ? -1.389  -69.807 -23.849 1.00 56.85  ? 250 THR G OG1   1 
ATOM   8482  C CG2   . THR D  2 250 ? -1.583  -67.779 -22.532 1.00 63.34  ? 250 THR G CG2   1 
ATOM   8483  N N     . LEU D  2 251 ? 0.036   -72.143 -22.444 1.00 61.04  ? 251 LEU G N     1 
ATOM   8484  C CA    . LEU D  2 251 ? 0.071   -73.572 -22.755 1.00 61.98  ? 251 LEU G CA    1 
ATOM   8485  C C     . LEU D  2 251 ? 0.838   -74.423 -21.744 1.00 73.02  ? 251 LEU G C     1 
ATOM   8486  O O     . LEU D  2 251 ? 0.489   -75.594 -21.580 1.00 72.66  ? 251 LEU G O     1 
ATOM   8487  C CB    . LEU D  2 251 ? 0.623   -73.777 -24.186 1.00 59.82  ? 251 LEU G CB    1 
ATOM   8488  C CG    . LEU D  2 251 ? -0.186  -73.072 -25.296 1.00 62.88  ? 251 LEU G CG    1 
ATOM   8489  C CD1   . LEU D  2 251 ? 0.598   -72.983 -26.583 1.00 62.31  ? 251 LEU G CD1   1 
ATOM   8490  C CD2   . LEU D  2 251 ? -1.527  -73.726 -25.515 1.00 62.42  ? 251 LEU G CD2   1 
ATOM   8491  N N     . MET D  2 252 ? 1.866   -73.850 -21.067 1.00 74.91  ? 252 MET G N     1 
ATOM   8492  C CA    . MET D  2 252 ? 2.662   -74.559 -20.044 1.00 77.48  ? 252 MET G CA    1 
ATOM   8493  C C     . MET D  2 252 ? 2.186   -74.168 -18.644 1.00 82.38  ? 252 MET G C     1 
ATOM   8494  O O     . MET D  2 252 ? 2.095   -72.982 -18.330 1.00 80.52  ? 252 MET G O     1 
ATOM   8495  C CB    . MET D  2 252 ? 4.155   -74.251 -20.195 1.00 80.28  ? 252 MET G CB    1 
ATOM   8496  C CG    . MET D  2 252 ? 4.762   -74.893 -21.409 1.00 84.16  ? 252 MET G CG    1 
ATOM   8497  S SD    . MET D  2 252 ? 6.407   -74.245 -21.766 1.00 89.65  ? 252 MET G SD    1 
ATOM   8498  C CE    . MET D  2 252 ? 7.368   -75.143 -20.542 1.00 87.96  ? 252 MET G CE    1 
ATOM   8499  N N     . ILE D  2 253 ? 1.895   -75.173 -17.802 1.00 82.79  ? 253 ILE G N     1 
ATOM   8500  C CA    . ILE D  2 253 ? 1.402   -74.945 -16.442 1.00 84.76  ? 253 ILE G CA    1 
ATOM   8501  C C     . ILE D  2 253 ? 2.504   -74.457 -15.496 1.00 90.51  ? 253 ILE G C     1 
ATOM   8502  O O     . ILE D  2 253 ? 2.186   -73.883 -14.447 1.00 91.79  ? 253 ILE G O     1 
ATOM   8503  C CB    . ILE D  2 253 ? 0.659   -76.199 -15.909 1.00 89.22  ? 253 ILE G CB    1 
ATOM   8504  C CG1   . ILE D  2 253 ? -0.588  -75.784 -15.124 1.00 90.48  ? 253 ILE G CG1   1 
ATOM   8505  C CG2   . ILE D  2 253 ? 1.570   -77.146 -15.107 1.00 90.94  ? 253 ILE G CG2   1 
ATOM   8506  C CD1   . ILE D  2 253 ? -1.803  -75.357 -16.062 1.00 90.25  ? 253 ILE G CD1   1 
ATOM   8507  N N     . SER D  2 254 ? 3.784   -74.683 -15.856 1.00 86.41  ? 254 SER G N     1 
ATOM   8508  C CA    . SER D  2 254 ? 4.928   -74.204 -15.080 1.00 87.29  ? 254 SER G CA    1 
ATOM   8509  C C     . SER D  2 254 ? 5.052   -72.681 -15.200 1.00 89.76  ? 254 SER G C     1 
ATOM   8510  O O     . SER D  2 254 ? 5.285   -71.999 -14.198 1.00 91.27  ? 254 SER G O     1 
ATOM   8511  C CB    . SER D  2 254 ? 6.217   -74.870 -15.561 1.00 91.65  ? 254 SER G CB    1 
ATOM   8512  O OG    . SER D  2 254 ? 6.420   -74.717 -16.957 1.00 99.27  ? 254 SER G OG    1 
ATOM   8513  N N     . ARG D  2 255 ? 4.882   -72.156 -16.428 1.00 83.20  ? 255 ARG G N     1 
ATOM   8514  C CA    . ARG D  2 255 ? 4.959   -70.721 -16.722 1.00 80.91  ? 255 ARG G CA    1 
ATOM   8515  C C     . ARG D  2 255 ? 3.692   -69.971 -16.290 1.00 81.68  ? 255 ARG G C     1 
ATOM   8516  O O     . ARG D  2 255 ? 2.643   -70.585 -16.111 1.00 80.99  ? 255 ARG G O     1 
ATOM   8517  C CB    . ARG D  2 255 ? 5.245   -70.504 -18.209 1.00 79.87  ? 255 ARG G CB    1 
ATOM   8518  C CG    . ARG D  2 255 ? 6.669   -70.885 -18.613 1.00 90.33  ? 255 ARG G CG    1 
ATOM   8519  C CD    . ARG D  2 255 ? 6.831   -71.105 -20.102 1.00 105.12 ? 255 ARG G CD    1 
ATOM   8520  N NE    . ARG D  2 255 ? 7.445   -69.965 -20.800 1.00 114.13 ? 255 ARG G NE    1 
ATOM   8521  C CZ    . ARG D  2 255 ? 8.729   -69.860 -21.155 1.00 123.06 ? 255 ARG G CZ    1 
ATOM   8522  N NH1   . ARG D  2 255 ? 9.595   -70.828 -20.859 1.00 108.69 ? 255 ARG G NH1   1 
ATOM   8523  N NH2   . ARG D  2 255 ? 9.157   -68.784 -21.809 1.00 103.22 ? 255 ARG G NH2   1 
ATOM   8524  N N     . THR D  2 256 ? 3.804   -68.641 -16.109 1.00 77.14  ? 256 THR G N     1 
ATOM   8525  C CA    . THR D  2 256 ? 2.710   -67.782 -15.635 1.00 76.68  ? 256 THR G CA    1 
ATOM   8526  C C     . THR D  2 256 ? 2.257   -66.787 -16.730 1.00 77.45  ? 256 THR G C     1 
ATOM   8527  O O     . THR D  2 256 ? 3.067   -65.955 -17.164 1.00 75.96  ? 256 THR G O     1 
ATOM   8528  C CB    . THR D  2 256 ? 3.134   -67.078 -14.325 1.00 83.80  ? 256 THR G CB    1 
ATOM   8529  O OG1   . THR D  2 256 ? 3.310   -68.079 -13.296 1.00 84.68  ? 256 THR G OG1   1 
ATOM   8530  C CG2   . THR D  2 256 ? 2.119   -66.027 -13.861 1.00 78.97  ? 256 THR G CG2   1 
ATOM   8531  N N     . PRO D  2 257 ? 0.972   -66.837 -17.179 1.00 71.65  ? 257 PRO G N     1 
ATOM   8532  C CA    . PRO D  2 257 ? 0.517   -65.876 -18.197 1.00 69.34  ? 257 PRO G CA    1 
ATOM   8533  C C     . PRO D  2 257 ? -0.009  -64.598 -17.567 1.00 71.56  ? 257 PRO G C     1 
ATOM   8534  O O     . PRO D  2 257 ? -0.650  -64.652 -16.512 1.00 71.57  ? 257 PRO G O     1 
ATOM   8535  C CB    . PRO D  2 257 ? -0.593  -66.640 -18.929 1.00 71.10  ? 257 PRO G CB    1 
ATOM   8536  C CG    . PRO D  2 257 ? -1.055  -67.716 -17.959 1.00 76.36  ? 257 PRO G CG    1 
ATOM   8537  C CD    . PRO D  2 257 ? -0.130  -67.736 -16.779 1.00 73.20  ? 257 PRO G CD    1 
ATOM   8538  N N     . GLU D  2 258 ? 0.249   -63.448 -18.218 1.00 66.94  ? 258 GLU G N     1 
ATOM   8539  C CA    . GLU D  2 258 ? -0.199  -62.140 -17.733 1.00 66.80  ? 258 GLU G CA    1 
ATOM   8540  C C     . GLU D  2 258 ? -0.755  -61.294 -18.850 1.00 69.10  ? 258 GLU G C     1 
ATOM   8541  O O     . GLU D  2 258 ? -0.238  -61.323 -19.955 1.00 68.18  ? 258 GLU G O     1 
ATOM   8542  C CB    . GLU D  2 258 ? 0.981   -61.354 -17.132 1.00 68.66  ? 258 GLU G CB    1 
ATOM   8543  C CG    . GLU D  2 258 ? 1.518   -61.876 -15.810 1.00 82.77  ? 258 GLU G CG    1 
ATOM   8544  C CD    . GLU D  2 258 ? 3.032   -61.945 -15.761 1.00 113.35 ? 258 GLU G CD    1 
ATOM   8545  O OE1   . GLU D  2 258 ? 3.695   -60.966 -16.183 1.00 97.29  ? 258 GLU G OE1   1 
ATOM   8546  O OE2   . GLU D  2 258 ? 3.556   -62.999 -15.333 1.00 115.39 ? 258 GLU G OE2   1 
ATOM   8547  N N     . VAL D  2 259 ? -1.723  -60.453 -18.527 1.00 66.52  ? 259 VAL G N     1 
ATOM   8548  C CA    . VAL D  2 259 ? -2.284  -59.469 -19.448 1.00 65.50  ? 259 VAL G CA    1 
ATOM   8549  C C     . VAL D  2 259 ? -1.676  -58.137 -18.972 1.00 69.31  ? 259 VAL G C     1 
ATOM   8550  O O     . VAL D  2 259 ? -1.774  -57.835 -17.786 1.00 69.53  ? 259 VAL G O     1 
ATOM   8551  C CB    . VAL D  2 259 ? -3.832  -59.457 -19.425 1.00 69.91  ? 259 VAL G CB    1 
ATOM   8552  C CG1   . VAL D  2 259 ? -4.378  -58.415 -20.385 1.00 69.01  ? 259 VAL G CG1   1 
ATOM   8553  C CG2   . VAL D  2 259 ? -4.393  -60.830 -19.778 1.00 70.52  ? 259 VAL G CG2   1 
ATOM   8554  N N     . THR D  2 260 ? -1.011  -57.376 -19.862 1.00 65.59  ? 260 THR G N     1 
ATOM   8555  C CA    . THR D  2 260 ? -0.357  -56.116 -19.489 1.00 65.63  ? 260 THR G CA    1 
ATOM   8556  C C     . THR D  2 260 ? -1.098  -54.918 -20.069 1.00 71.47  ? 260 THR G C     1 
ATOM   8557  O O     . THR D  2 260 ? -1.277  -54.846 -21.277 1.00 71.17  ? 260 THR G O     1 
ATOM   8558  C CB    . THR D  2 260 ? 1.111   -56.158 -19.928 1.00 68.98  ? 260 THR G CB    1 
ATOM   8559  O OG1   . THR D  2 260 ? 1.724   -57.315 -19.362 1.00 65.38  ? 260 THR G OG1   1 
ATOM   8560  C CG2   . THR D  2 260 ? 1.883   -54.898 -19.530 1.00 69.24  ? 260 THR G CG2   1 
ATOM   8561  N N     . CYS D  2 261 ? -1.494  -53.964 -19.222 1.00 70.28  ? 261 CYS G N     1 
ATOM   8562  C CA    . CYS D  2 261 ? -2.180  -52.732 -19.643 1.00 70.24  ? 261 CYS G CA    1 
ATOM   8563  C C     . CYS D  2 261 ? -1.218  -51.551 -19.462 1.00 74.22  ? 261 CYS G C     1 
ATOM   8564  O O     . CYS D  2 261 ? -0.797  -51.297 -18.334 1.00 73.35  ? 261 CYS G O     1 
ATOM   8565  C CB    . CYS D  2 261 ? -3.443  -52.544 -18.808 1.00 71.09  ? 261 CYS G CB    1 
ATOM   8566  S SG    . CYS D  2 261 ? -4.541  -51.213 -19.367 1.00 74.47  ? 261 CYS G SG    1 
ATOM   8567  N N     . VAL D  2 262 ? -0.858  -50.844 -20.551 1.00 72.05  ? 262 VAL G N     1 
ATOM   8568  C CA    . VAL D  2 262 ? 0.043   -49.684 -20.458 1.00 72.53  ? 262 VAL G CA    1 
ATOM   8569  C C     . VAL D  2 262 ? -0.678  -48.444 -20.993 1.00 75.51  ? 262 VAL G C     1 
ATOM   8570  O O     . VAL D  2 262 ? -1.369  -48.507 -22.012 1.00 73.63  ? 262 VAL G O     1 
ATOM   8571  C CB    . VAL D  2 262 ? 1.468   -49.883 -21.082 1.00 76.54  ? 262 VAL G CB    1 
ATOM   8572  C CG1   . VAL D  2 262 ? 1.953   -51.321 -20.942 1.00 76.09  ? 262 VAL G CG1   1 
ATOM   8573  C CG2   . VAL D  2 262 ? 1.559   -49.414 -22.529 1.00 76.03  ? 262 VAL G CG2   1 
ATOM   8574  N N     . VAL D  2 263 ? -0.505  -47.323 -20.294 1.00 72.51  ? 263 VAL G N     1 
ATOM   8575  C CA    . VAL D  2 263 ? -1.104  -46.045 -20.671 1.00 72.35  ? 263 VAL G CA    1 
ATOM   8576  C C     . VAL D  2 263 ? 0.059   -45.085 -20.951 1.00 76.16  ? 263 VAL G C     1 
ATOM   8577  O O     . VAL D  2 263 ? 0.984   -44.959 -20.146 1.00 73.50  ? 263 VAL G O     1 
ATOM   8578  C CB    . VAL D  2 263 ? -2.116  -45.499 -19.614 1.00 76.58  ? 263 VAL G CB    1 
ATOM   8579  C CG1   . VAL D  2 263 ? -1.492  -45.410 -18.235 1.00 77.02  ? 263 VAL G CG1   1 
ATOM   8580  C CG2   . VAL D  2 263 ? -2.688  -44.136 -20.025 1.00 76.27  ? 263 VAL G CG2   1 
ATOM   8581  N N     . VAL D  2 264 ? -0.001  -44.430 -22.106 1.00 75.83  ? 264 VAL G N     1 
ATOM   8582  C CA    . VAL D  2 264 ? 1.029   -43.496 -22.575 1.00 77.02  ? 264 VAL G CA    1 
ATOM   8583  C C     . VAL D  2 264 ? 0.371   -42.158 -22.883 1.00 86.41  ? 264 VAL G C     1 
ATOM   8584  O O     . VAL D  2 264 ? -0.862  -42.084 -22.942 1.00 86.39  ? 264 VAL G O     1 
ATOM   8585  C CB    . VAL D  2 264 ? 1.816   -44.049 -23.815 1.00 79.02  ? 264 VAL G CB    1 
ATOM   8586  C CG1   . VAL D  2 264 ? 2.761   -45.175 -23.408 1.00 78.44  ? 264 VAL G CG1   1 
ATOM   8587  C CG2   . VAL D  2 264 ? 0.883   -44.503 -24.939 1.00 77.97  ? 264 VAL G CG2   1 
ATOM   8588  N N     . ASP D  2 265 ? 1.205   -41.113 -23.090 1.00 86.33  ? 265 ASP G N     1 
ATOM   8589  C CA    . ASP D  2 265 ? 0.791   -39.737 -23.389 1.00 87.18  ? 265 ASP G CA    1 
ATOM   8590  C C     . ASP D  2 265 ? 0.013   -39.120 -22.209 1.00 96.11  ? 265 ASP G C     1 
ATOM   8591  O O     . ASP D  2 265 ? -0.945  -38.368 -22.414 1.00 96.85  ? 265 ASP G O     1 
ATOM   8592  C CB    . ASP D  2 265 ? 0.026   -39.633 -24.737 1.00 88.49  ? 265 ASP G CB    1 
ATOM   8593  C CG    . ASP D  2 265 ? 0.845   -40.001 -25.970 1.00 94.93  ? 265 ASP G CG    1 
ATOM   8594  O OD1   . ASP D  2 265 ? 2.093   -40.012 -25.874 1.00 93.37  ? 265 ASP G OD1   1 
ATOM   8595  O OD2   . ASP D  2 265 ? 0.236   -40.228 -27.043 1.00 99.82  ? 265 ASP G OD2   1 
ATOM   8596  N N     . VAL D  2 266 ? 0.452   -39.432 -20.968 1.00 94.75  ? 266 VAL G N     1 
ATOM   8597  C CA    . VAL D  2 266 ? -0.162  -38.909 -19.751 1.00 96.17  ? 266 VAL G CA    1 
ATOM   8598  C C     . VAL D  2 266 ? 0.490   -37.566 -19.482 1.00 103.32 ? 266 VAL G C     1 
ATOM   8599  O O     . VAL D  2 266 ? 1.715   -37.492 -19.515 1.00 102.90 ? 266 VAL G O     1 
ATOM   8600  C CB    . VAL D  2 266 ? 0.023   -39.878 -18.557 1.00 100.52 ? 266 VAL G CB    1 
ATOM   8601  C CG1   . VAL D  2 266 ? -0.402  -39.226 -17.245 1.00 100.83 ? 266 VAL G CG1   1 
ATOM   8602  C CG2   . VAL D  2 266 ? -0.743  -41.173 -18.796 1.00 100.48 ? 266 VAL G CG2   1 
ATOM   8603  N N     . SER D  2 267 ? -0.308  -36.516 -19.192 1.00 102.12 ? 267 SER G N     1 
ATOM   8604  C CA    . SER D  2 267 ? 0.229   -35.175 -18.939 1.00 102.72 ? 267 SER G CA    1 
ATOM   8605  C C     . SER D  2 267 ? 1.003   -35.106 -17.625 1.00 108.37 ? 267 SER G C     1 
ATOM   8606  O O     . SER D  2 267 ? 0.773   -35.911 -16.720 1.00 108.10 ? 267 SER G O     1 
ATOM   8607  C CB    . SER D  2 267 ? -0.889  -34.135 -18.937 1.00 106.87 ? 267 SER G CB    1 
ATOM   8608  O OG    . SER D  2 267 ? -1.674  -34.202 -20.117 1.00 114.99 ? 267 SER G OG    1 
ATOM   8609  N N     . GLN D  2 268 ? 1.925   -34.141 -17.534 1.00 106.34 ? 268 GLN G N     1 
ATOM   8610  C CA    . GLN D  2 268 ? 2.749   -33.926 -16.340 1.00 107.69 ? 268 GLN G CA    1 
ATOM   8611  C C     . GLN D  2 268 ? 1.905   -33.299 -15.209 1.00 114.34 ? 268 GLN G C     1 
ATOM   8612  O O     . GLN D  2 268 ? 2.091   -33.631 -14.033 1.00 113.78 ? 268 GLN G O     1 
ATOM   8613  C CB    . GLN D  2 268 ? 3.961   -33.039 -16.677 1.00 108.94 ? 268 GLN G CB    1 
ATOM   8614  N N     . GLU D  2 269 ? 0.982   -32.390 -15.578 1.00 113.03 ? 269 GLU G N     1 
ATOM   8615  C CA    . GLU D  2 269 ? 0.058   -31.740 -14.636 1.00 114.31 ? 269 GLU G CA    1 
ATOM   8616  C C     . GLU D  2 269 ? -1.021  -32.722 -14.109 1.00 120.52 ? 269 GLU G C     1 
ATOM   8617  O O     . GLU D  2 269 ? -1.530  -32.519 -13.003 1.00 121.02 ? 269 GLU G O     1 
ATOM   8618  C CB    . GLU D  2 269 ? -0.601  -30.490 -15.278 1.00 115.42 ? 269 GLU G CB    1 
ATOM   8619  C CG    . GLU D  2 269 ? -1.493  -30.764 -16.489 1.00 124.30 ? 269 GLU G CG    1 
ATOM   8620  C CD    . GLU D  2 269 ? -1.156  -29.988 -17.751 1.00 141.66 ? 269 GLU G CD    1 
ATOM   8621  O OE1   . GLU D  2 269 ? -2.069  -29.332 -18.302 1.00 131.04 ? 269 GLU G OE1   1 
ATOM   8622  O OE2   . GLU D  2 269 ? 0.008   -30.062 -18.208 1.00 135.29 ? 269 GLU G OE2   1 
ATOM   8623  N N     . ASP D  2 270 ? -1.343  -33.793 -14.892 1.00 117.49 ? 270 ASP G N     1 
ATOM   8624  C CA    . ASP D  2 270 ? -2.326  -34.831 -14.548 1.00 117.63 ? 270 ASP G CA    1 
ATOM   8625  C C     . ASP D  2 270 ? -1.671  -36.239 -14.511 1.00 120.99 ? 270 ASP G C     1 
ATOM   8626  O O     . ASP D  2 270 ? -1.968  -37.063 -15.380 1.00 120.49 ? 270 ASP G O     1 
ATOM   8627  C CB    . ASP D  2 270 ? -3.464  -34.828 -15.594 1.00 119.35 ? 270 ASP G CB    1 
ATOM   8628  C CG    . ASP D  2 270 ? -4.160  -33.499 -15.768 1.00 131.79 ? 270 ASP G CG    1 
ATOM   8629  O OD1   . ASP D  2 270 ? -4.841  -33.057 -14.814 1.00 132.93 ? 270 ASP G OD1   1 
ATOM   8630  O OD2   . ASP D  2 270 ? -4.057  -32.917 -16.873 1.00 138.06 ? 270 ASP G OD2   1 
ATOM   8631  N N     . PRO D  2 271 ? -0.821  -36.569 -13.509 1.00 117.18 ? 271 PRO G N     1 
ATOM   8632  C CA    . PRO D  2 271 ? -0.201  -37.904 -13.478 1.00 116.90 ? 271 PRO G CA    1 
ATOM   8633  C C     . PRO D  2 271 ? -0.989  -38.905 -12.611 1.00 121.11 ? 271 PRO G C     1 
ATOM   8634  O O     . PRO D  2 271 ? -0.509  -39.355 -11.562 1.00 121.53 ? 271 PRO G O     1 
ATOM   8635  C CB    . PRO D  2 271 ? 1.195   -37.597 -12.928 1.00 118.95 ? 271 PRO G CB    1 
ATOM   8636  C CG    . PRO D  2 271 ? 0.980   -36.419 -12.008 1.00 123.63 ? 271 PRO G CG    1 
ATOM   8637  C CD    . PRO D  2 271 ? -0.327  -35.749 -12.388 1.00 118.93 ? 271 PRO G CD    1 
ATOM   8638  N N     . GLU D  2 272 ? -2.217  -39.253 -13.055 1.00 116.48 ? 272 GLU G N     1 
ATOM   8639  C CA    . GLU D  2 272 ? -3.091  -40.206 -12.346 1.00 116.20 ? 272 GLU G CA    1 
ATOM   8640  C C     . GLU D  2 272 ? -2.749  -41.655 -12.691 1.00 117.03 ? 272 GLU G C     1 
ATOM   8641  O O     . GLU D  2 272 ? -2.316  -41.954 -13.808 1.00 115.78 ? 272 GLU G O     1 
ATOM   8642  C CB    . GLU D  2 272 ? -4.579  -39.940 -12.631 1.00 117.76 ? 272 GLU G CB    1 
ATOM   8643  C CG    . GLU D  2 272 ? -5.147  -38.764 -11.859 1.00 128.46 ? 272 GLU G CG    1 
ATOM   8644  C CD    . GLU D  2 272 ? -4.769  -37.426 -12.453 1.00 142.06 ? 272 GLU G CD    1 
ATOM   8645  O OE1   . GLU D  2 272 ? -5.335  -37.079 -13.514 1.00 128.75 ? 272 GLU G OE1   1 
ATOM   8646  O OE2   . GLU D  2 272 ? -3.882  -36.747 -11.887 1.00 131.85 ? 272 GLU G OE2   1 
ATOM   8647  N N     . VAL D  2 273 ? -2.987  -42.552 -11.722 1.00 111.91 ? 273 VAL G N     1 
ATOM   8648  C CA    . VAL D  2 273 ? -2.688  -43.984 -11.820 1.00 110.75 ? 273 VAL G CA    1 
ATOM   8649  C C     . VAL D  2 273 ? -3.943  -44.830 -11.472 1.00 110.34 ? 273 VAL G C     1 
ATOM   8650  O O     . VAL D  2 273 ? -3.845  -45.817 -10.730 1.00 110.78 ? 273 VAL G O     1 
ATOM   8651  C CB    . VAL D  2 273 ? -1.442  -44.321 -10.931 1.00 115.89 ? 273 VAL G CB    1 
ATOM   8652  C CG1   . VAL D  2 273 ? -0.203  -43.576 -11.439 1.00 114.95 ? 273 VAL G CG1   1 
ATOM   8653  C CG2   . VAL D  2 273 ? -1.675  -43.995 -9.443  1.00 117.02 ? 273 VAL G CG2   1 
ATOM   8654  N N     . GLN D  2 274 ? -5.116  -44.464 -12.052 1.00 102.30 ? 274 GLN G N     1 
ATOM   8655  C CA    . GLN D  2 274 ? -6.388  -45.153 -11.756 1.00 101.12 ? 274 GLN G CA    1 
ATOM   8656  C C     . GLN D  2 274 ? -6.699  -46.285 -12.749 1.00 98.12  ? 274 GLN G C     1 
ATOM   8657  O O     . GLN D  2 274 ? -7.127  -46.028 -13.879 1.00 94.96  ? 274 GLN G O     1 
ATOM   8658  C CB    . GLN D  2 274 ? -7.555  -44.149 -11.671 1.00 103.00 ? 274 GLN G CB    1 
ATOM   8659  N N     . PHE D  2 275 ? -6.492  -47.546 -12.297 1.00 91.96  ? 275 PHE G N     1 
ATOM   8660  C CA    . PHE D  2 275 ? -6.737  -48.753 -13.092 1.00 89.82  ? 275 PHE G CA    1 
ATOM   8661  C C     . PHE D  2 275 ? -7.906  -49.572 -12.527 1.00 90.50  ? 275 PHE G C     1 
ATOM   8662  O O     . PHE D  2 275 ? -7.972  -49.798 -11.318 1.00 89.44  ? 275 PHE G O     1 
ATOM   8663  C CB    . PHE D  2 275 ? -5.482  -49.644 -13.107 1.00 91.22  ? 275 PHE G CB    1 
ATOM   8664  C CG    . PHE D  2 275 ? -4.378  -49.174 -14.018 1.00 91.57  ? 275 PHE G CG    1 
ATOM   8665  C CD1   . PHE D  2 275 ? -4.377  -49.508 -15.361 1.00 93.12  ? 275 PHE G CD1   1 
ATOM   8666  C CD2   . PHE D  2 275 ? -3.287  -48.483 -13.513 1.00 93.61  ? 275 PHE G CD2   1 
ATOM   8667  C CE1   . PHE D  2 275 ? -3.333  -49.114 -16.193 1.00 93.03  ? 275 PHE G CE1   1 
ATOM   8668  C CE2   . PHE D  2 275 ? -2.239  -48.099 -14.344 1.00 95.17  ? 275 PHE G CE2   1 
ATOM   8669  C CZ    . PHE D  2 275 ? -2.273  -48.408 -15.681 1.00 92.12  ? 275 PHE G CZ    1 
ATOM   8670  N N     . ASN D  2 276 ? -8.791  -50.053 -13.421 1.00 85.12  ? 276 ASN G N     1 
ATOM   8671  C CA    . ASN D  2 276 ? -9.916  -50.935 -13.082 1.00 84.84  ? 276 ASN G CA    1 
ATOM   8672  C C     . ASN D  2 276 ? -9.909  -52.104 -14.069 1.00 84.71  ? 276 ASN G C     1 
ATOM   8673  O O     . ASN D  2 276 ? -9.915  -51.874 -15.279 1.00 82.56  ? 276 ASN G O     1 
ATOM   8674  C CB    . ASN D  2 276 ? -11.253 -50.187 -13.133 1.00 86.09  ? 276 ASN G CB    1 
ATOM   8675  C CG    . ASN D  2 276 ? -11.504 -49.373 -11.887 1.00 104.66 ? 276 ASN G CG    1 
ATOM   8676  O OD1   . ASN D  2 276 ? -11.785 -49.916 -10.813 1.00 96.64  ? 276 ASN G OD1   1 
ATOM   8677  N ND2   . ASN D  2 276 ? -11.340 -48.062 -11.973 1.00 96.76  ? 276 ASN G ND2   1 
ATOM   8678  N N     . TRP D  2 277 ? -9.875  -53.343 -13.551 1.00 79.79  ? 277 TRP G N     1 
ATOM   8679  C CA    . TRP D  2 277 ? -9.820  -54.563 -14.353 1.00 78.58  ? 277 TRP G CA    1 
ATOM   8680  C C     . TRP D  2 277 ? -11.089 -55.404 -14.224 1.00 82.04  ? 277 TRP G C     1 
ATOM   8681  O O     . TRP D  2 277 ? -11.622 -55.521 -13.124 1.00 82.38  ? 277 TRP G O     1 
ATOM   8682  C CB    . TRP D  2 277 ? -8.634  -55.417 -13.908 1.00 77.41  ? 277 TRP G CB    1 
ATOM   8683  C CG    . TRP D  2 277 ? -7.290  -54.907 -14.341 1.00 77.40  ? 277 TRP G CG    1 
ATOM   8684  C CD1   . TRP D  2 277 ? -6.424  -54.147 -13.610 1.00 80.47  ? 277 TRP G CD1   1 
ATOM   8685  C CD2   . TRP D  2 277 ? -6.606  -55.240 -15.553 1.00 75.73  ? 277 TRP G CD2   1 
ATOM   8686  N NE1   . TRP D  2 277 ? -5.239  -53.999 -14.287 1.00 78.52  ? 277 TRP G NE1   1 
ATOM   8687  C CE2   . TRP D  2 277 ? -5.311  -54.687 -15.468 1.00 78.88  ? 277 TRP G CE2   1 
ATOM   8688  C CE3   . TRP D  2 277 ? -6.946  -55.992 -16.685 1.00 76.10  ? 277 TRP G CE3   1 
ATOM   8689  C CZ2   . TRP D  2 277 ? -4.361  -54.865 -16.468 1.00 76.81  ? 277 TRP G CZ2   1 
ATOM   8690  C CZ3   . TRP D  2 277 ? -6.013  -56.135 -17.691 1.00 76.21  ? 277 TRP G CZ3   1 
ATOM   8691  C CH2   . TRP D  2 277 ? -4.725  -55.613 -17.558 1.00 76.41  ? 277 TRP G CH2   1 
ATOM   8692  N N     . TYR D  2 278 ? -11.526 -56.041 -15.337 1.00 77.22  ? 278 TYR G N     1 
ATOM   8693  C CA    . TYR D  2 278 ? -12.702 -56.916 -15.366 1.00 77.15  ? 278 TYR G CA    1 
ATOM   8694  C C     . TYR D  2 278 ? -12.434 -58.215 -16.127 1.00 78.13  ? 278 TYR G C     1 
ATOM   8695  O O     . TYR D  2 278 ? -11.893 -58.185 -17.240 1.00 76.14  ? 278 TYR G O     1 
ATOM   8696  C CB    . TYR D  2 278 ? -13.899 -56.230 -16.032 1.00 78.93  ? 278 TYR G CB    1 
ATOM   8697  C CG    . TYR D  2 278 ? -14.184 -54.830 -15.547 1.00 82.43  ? 278 TYR G CG    1 
ATOM   8698  C CD1   . TYR D  2 278 ? -13.461 -53.743 -16.031 1.00 83.21  ? 278 TYR G CD1   1 
ATOM   8699  C CD2   . TYR D  2 278 ? -15.234 -54.575 -14.672 1.00 85.03  ? 278 TYR G CD2   1 
ATOM   8700  C CE1   . TYR D  2 278 ? -13.726 -52.448 -15.593 1.00 84.95  ? 278 TYR G CE1   1 
ATOM   8701  C CE2   . TYR D  2 278 ? -15.517 -53.284 -14.238 1.00 86.25  ? 278 TYR G CE2   1 
ATOM   8702  C CZ    . TYR D  2 278 ? -14.758 -52.221 -14.695 1.00 92.07  ? 278 TYR G CZ    1 
ATOM   8703  O OH    . TYR D  2 278 ? -15.038 -50.939 -14.280 1.00 91.72  ? 278 TYR G OH    1 
ATOM   8704  N N     . VAL D  2 279 ? -12.860 -59.350 -15.541 1.00 73.69  ? 279 VAL G N     1 
ATOM   8705  C CA    . VAL D  2 279 ? -12.758 -60.676 -16.151 1.00 72.16  ? 279 VAL G CA    1 
ATOM   8706  C C     . VAL D  2 279 ? -14.194 -61.094 -16.458 1.00 76.49  ? 279 VAL G C     1 
ATOM   8707  O O     . VAL D  2 279 ? -14.969 -61.333 -15.529 1.00 77.73  ? 279 VAL G O     1 
ATOM   8708  C CB    . VAL D  2 279 ? -12.036 -61.705 -15.257 1.00 75.38  ? 279 VAL G CB    1 
ATOM   8709  C CG1   . VAL D  2 279 ? -11.898 -63.043 -15.981 1.00 74.56  ? 279 VAL G CG1   1 
ATOM   8710  C CG2   . VAL D  2 279 ? -10.671 -61.190 -14.827 1.00 74.24  ? 279 VAL G CG2   1 
ATOM   8711  N N     . ASP D  2 280 ? -14.560 -61.128 -17.756 1.00 71.23  ? 280 ASP G N     1 
ATOM   8712  C CA    . ASP D  2 280 ? -15.910 -61.461 -18.218 1.00 71.38  ? 280 ASP G CA    1 
ATOM   8713  C C     . ASP D  2 280 ? -16.955 -60.540 -17.595 1.00 74.56  ? 280 ASP G C     1 
ATOM   8714  O O     . ASP D  2 280 ? -17.925 -60.993 -17.007 1.00 74.86  ? 280 ASP G O     1 
ATOM   8715  C CB    . ASP D  2 280 ? -16.242 -62.961 -18.000 1.00 73.71  ? 280 ASP G CB    1 
ATOM   8716  C CG    . ASP D  2 280 ? -15.676 -63.873 -19.064 1.00 79.34  ? 280 ASP G CG    1 
ATOM   8717  O OD1   . ASP D  2 280 ? -15.327 -63.369 -20.154 1.00 76.72  ? 280 ASP G OD1   1 
ATOM   8718  O OD2   . ASP D  2 280 ? -15.661 -65.098 -18.843 1.00 84.42  ? 280 ASP G OD2   1 
ATOM   8719  N N     . GLY D  2 281 ? -16.698 -59.244 -17.687 1.00 71.42  ? 281 GLY G N     1 
ATOM   8720  C CA    . GLY D  2 281 ? -17.582 -58.213 -17.164 1.00 72.58  ? 281 GLY G CA    1 
ATOM   8721  C C     . GLY D  2 281 ? -17.576 -58.014 -15.659 1.00 77.04  ? 281 GLY G C     1 
ATOM   8722  O O     . GLY D  2 281 ? -18.019 -56.964 -15.196 1.00 77.53  ? 281 GLY G O     1 
ATOM   8723  N N     . VAL D  2 282 ? -17.071 -58.990 -14.882 1.00 73.38  ? 282 VAL G N     1 
ATOM   8724  C CA    . VAL D  2 282 ? -17.027 -58.894 -13.434 1.00 74.95  ? 282 VAL G CA    1 
ATOM   8725  C C     . VAL D  2 282 ? -15.700 -58.266 -13.005 1.00 78.68  ? 282 VAL G C     1 
ATOM   8726  O O     . VAL D  2 282 ? -14.635 -58.812 -13.306 1.00 76.17  ? 282 VAL G O     1 
ATOM   8727  C CB    . VAL D  2 282 ? -17.238 -60.276 -12.771 1.00 79.72  ? 282 VAL G CB    1 
ATOM   8728  C CG1   . VAL D  2 282 ? -17.338 -60.136 -11.248 1.00 80.48  ? 282 VAL G CG1   1 
ATOM   8729  C CG2   . VAL D  2 282 ? -18.483 -60.976 -13.342 1.00 80.02  ? 282 VAL G CG2   1 
ATOM   8730  N N     . GLU D  2 283 ? -15.773 -57.149 -12.249 1.00 76.61  ? 283 GLU G N     1 
ATOM   8731  C CA    . GLU D  2 283 ? -14.585 -56.466 -11.730 1.00 75.89  ? 283 GLU G CA    1 
ATOM   8732  C C     . GLU D  2 283 ? -13.719 -57.393 -10.836 1.00 78.73  ? 283 GLU G C     1 
ATOM   8733  O O     . GLU D  2 283 ? -14.246 -58.254 -10.135 1.00 79.39  ? 283 GLU G O     1 
ATOM   8734  C CB    . GLU D  2 283 ? -14.969 -55.184 -10.965 1.00 77.86  ? 283 GLU G CB    1 
ATOM   8735  C CG    . GLU D  2 283 ? -13.778 -54.286 -10.654 1.00 87.38  ? 283 GLU G CG    1 
ATOM   8736  C CD    . GLU D  2 283 ? -14.074 -52.885 -10.149 1.00 106.76 ? 283 GLU G CD    1 
ATOM   8737  O OE1   . GLU D  2 283 ? -15.215 -52.399 -10.322 1.00 91.83  ? 283 GLU G OE1   1 
ATOM   8738  O OE2   . GLU D  2 283 ? -13.128 -52.245 -9.637  1.00 103.16 ? 283 GLU G OE2   1 
ATOM   8739  N N     . VAL D  2 284 ? -12.388 -57.226 -10.931 1.00 74.08  ? 284 VAL G N     1 
ATOM   8740  C CA    . VAL D  2 284 ? -11.370 -57.961 -10.174 1.00 73.97  ? 284 VAL G CA    1 
ATOM   8741  C C     . VAL D  2 284 ? -10.404 -56.928 -9.538  1.00 75.24  ? 284 VAL G C     1 
ATOM   8742  O O     . VAL D  2 284 ? -10.439 -55.754 -9.900  1.00 71.68  ? 284 VAL G O     1 
ATOM   8743  C CB    . VAL D  2 284 ? -10.627 -59.020 -11.040 1.00 77.17  ? 284 VAL G CB    1 
ATOM   8744  C CG1   . VAL D  2 284 ? -11.571 -60.128 -11.469 1.00 77.49  ? 284 VAL G CG1   1 
ATOM   8745  C CG2   . VAL D  2 284 ? -9.956  -58.397 -12.264 1.00 75.21  ? 284 VAL G CG2   1 
ATOM   8746  N N     . HIS D  2 285 ? -9.610  -57.351 -8.550  1.00 74.79  ? 285 HIS G N     1 
ATOM   8747  C CA    . HIS D  2 285 ? -8.697  -56.458 -7.814  1.00 76.03  ? 285 HIS G CA    1 
ATOM   8748  C C     . HIS D  2 285 ? -7.303  -57.059 -7.574  1.00 84.44  ? 285 HIS G C     1 
ATOM   8749  O O     . HIS D  2 285 ? -6.538  -56.480 -6.786  1.00 87.01  ? 285 HIS G O     1 
ATOM   8750  C CB    . HIS D  2 285 ? -9.314  -56.107 -6.436  1.00 78.24  ? 285 HIS G CB    1 
ATOM   8751  C CG    . HIS D  2 285 ? -10.739 -55.677 -6.507  1.00 81.59  ? 285 HIS G CG    1 
ATOM   8752  N ND1   . HIS D  2 285 ? -11.096 -54.451 -7.041  1.00 82.26  ? 285 HIS G ND1   1 
ATOM   8753  C CD2   . HIS D  2 285 ? -11.859 -56.354 -6.177  1.00 84.27  ? 285 HIS G CD2   1 
ATOM   8754  C CE1   . HIS D  2 285 ? -12.419 -54.412 -6.991  1.00 82.36  ? 285 HIS G CE1   1 
ATOM   8755  N NE2   . HIS D  2 285 ? -12.917 -55.525 -6.455  1.00 84.03  ? 285 HIS G NE2   1 
ATOM   8756  N N     . ASN D  2 286 ? -6.942  -58.169 -8.264  1.00 79.18  ? 286 ASN G N     1 
ATOM   8757  C CA    . ASN D  2 286 ? -5.652  -58.826 -8.047  1.00 78.60  ? 286 ASN G CA    1 
ATOM   8758  C C     . ASN D  2 286 ? -4.557  -58.331 -9.022  1.00 82.26  ? 286 ASN G C     1 
ATOM   8759  O O     . ASN D  2 286 ? -3.512  -58.973 -9.114  1.00 82.51  ? 286 ASN G O     1 
ATOM   8760  C CB    . ASN D  2 286 ? -5.812  -60.377 -8.056  1.00 76.52  ? 286 ASN G CB    1 
ATOM   8761  C CG    . ASN D  2 286 ? -6.398  -60.986 -9.321  1.00 93.12  ? 286 ASN G CG    1 
ATOM   8762  O OD1   . ASN D  2 286 ? -7.447  -60.550 -9.817  1.00 82.36  ? 286 ASN G OD1   1 
ATOM   8763  N ND2   . ASN D  2 286 ? -5.779  -62.048 -9.845  1.00 81.87  ? 286 ASN G ND2   1 
ATOM   8764  N N     . ALA D  2 287 ? -4.748  -57.173 -9.701  1.00 79.10  ? 287 ALA G N     1 
ATOM   8765  C CA    . ALA D  2 287 ? -3.725  -56.660 -10.624 1.00 78.68  ? 287 ALA G CA    1 
ATOM   8766  C C     . ALA D  2 287 ? -2.617  -55.959 -9.846  1.00 86.43  ? 287 ALA G C     1 
ATOM   8767  O O     . ALA D  2 287 ? -2.914  -55.199 -8.922  1.00 88.23  ? 287 ALA G O     1 
ATOM   8768  C CB    . ALA D  2 287 ? -4.336  -55.692 -11.625 1.00 77.93  ? 287 ALA G CB    1 
ATOM   8769  N N     . LYS D  2 288 ? -1.348  -56.223 -10.209 1.00 83.31  ? 288 LYS G N     1 
ATOM   8770  C CA    . LYS D  2 288 ? -0.182  -55.608 -9.576  1.00 83.75  ? 288 LYS G CA    1 
ATOM   8771  C C     . LYS D  2 288 ? 0.237   -54.414 -10.422 1.00 87.58  ? 288 LYS G C     1 
ATOM   8772  O O     . LYS D  2 288 ? 0.895   -54.596 -11.449 1.00 87.17  ? 288 LYS G O     1 
ATOM   8773  C CB    . LYS D  2 288 ? 0.966   -56.629 -9.438  1.00 86.48  ? 288 LYS G CB    1 
ATOM   8774  C CG    . LYS D  2 288 ? 0.578   -57.845 -8.592  1.00 104.72 ? 288 LYS G CG    1 
ATOM   8775  C CD    . LYS D  2 288 ? 1.776   -58.709 -8.156  1.00 117.46 ? 288 LYS G CD    1 
ATOM   8776  C CE    . LYS D  2 288 ? 2.390   -58.270 -6.839  1.00 132.92 ? 288 LYS G CE    1 
ATOM   8777  N NZ    . LYS D  2 288 ? 3.468   -59.191 -6.379  1.00 141.78 ? 288 LYS G NZ    1 
ATOM   8778  N N     . THR D  2 289 ? -0.200  -53.197 -10.032 1.00 83.74  ? 289 THR G N     1 
ATOM   8779  C CA    . THR D  2 289 ? 0.137   -51.972 -10.766 1.00 82.21  ? 289 THR G CA    1 
ATOM   8780  C C     . THR D  2 289 ? 1.518   -51.481 -10.364 1.00 87.39  ? 289 THR G C     1 
ATOM   8781  O O     . THR D  2 289 ? 1.936   -51.667 -9.219  1.00 88.19  ? 289 THR G O     1 
ATOM   8782  C CB    . THR D  2 289 ? -0.963  -50.920 -10.625 1.00 87.58  ? 289 THR G CB    1 
ATOM   8783  O OG1   . THR D  2 289 ? -2.166  -51.460 -11.171 1.00 90.67  ? 289 THR G OG1   1 
ATOM   8784  C CG2   . THR D  2 289 ? -0.636  -49.628 -11.344 1.00 81.80  ? 289 THR G CG2   1 
ATOM   8785  N N     . LYS D  2 290 ? 2.234   -50.883 -11.333 1.00 83.67  ? 290 LYS G N     1 
ATOM   8786  C CA    . LYS D  2 290 ? 3.598   -50.385 -11.161 1.00 84.33  ? 290 LYS G CA    1 
ATOM   8787  C C     . LYS D  2 290 ? 3.593   -48.853 -11.019 1.00 88.92  ? 290 LYS G C     1 
ATOM   8788  O O     . LYS D  2 290 ? 2.654   -48.213 -11.496 1.00 86.40  ? 290 LYS G O     1 
ATOM   8789  C CB    . LYS D  2 290 ? 4.453   -50.806 -12.375 1.00 86.40  ? 290 LYS G CB    1 
ATOM   8790  C CG    . LYS D  2 290 ? 4.656   -52.324 -12.494 1.00 100.76 ? 290 LYS G CG    1 
ATOM   8791  C CD    . LYS D  2 290 ? 5.143   -52.717 -13.882 1.00 108.83 ? 290 LYS G CD    1 
ATOM   8792  C CE    . LYS D  2 290 ? 5.499   -54.176 -14.016 1.00 121.18 ? 290 LYS G CE    1 
ATOM   8793  N NZ    . LYS D  2 290 ? 5.755   -54.550 -15.438 1.00 129.30 ? 290 LYS G NZ    1 
ATOM   8794  N N     . PRO D  2 291 ? 4.615   -48.239 -10.364 1.00 88.34  ? 291 PRO G N     1 
ATOM   8795  C CA    . PRO D  2 291 ? 4.638   -46.762 -10.253 1.00 88.21  ? 291 PRO G CA    1 
ATOM   8796  C C     . PRO D  2 291 ? 4.866   -46.079 -11.600 1.00 92.19  ? 291 PRO G C     1 
ATOM   8797  O O     . PRO D  2 291 ? 5.432   -46.695 -12.501 1.00 91.11  ? 291 PRO G O     1 
ATOM   8798  C CB    . PRO D  2 291 ? 5.806   -46.499 -9.300  1.00 90.86  ? 291 PRO G CB    1 
ATOM   8799  C CG    . PRO D  2 291 ? 6.692   -47.678 -9.447  1.00 95.56  ? 291 PRO G CG    1 
ATOM   8800  C CD    . PRO D  2 291 ? 5.798   -48.847 -9.718  1.00 90.82  ? 291 PRO G CD    1 
ATOM   8801  N N     . ARG D  2 292 ? 4.441   -44.811 -11.732 1.00 90.30  ? 292 ARG G N     1 
ATOM   8802  C CA    . ARG D  2 292 ? 4.591   -44.049 -12.986 1.00 90.25  ? 292 ARG G CA    1 
ATOM   8803  C C     . ARG D  2 292 ? 6.050   -43.655 -13.260 1.00 96.77  ? 292 ARG G C     1 
ATOM   8804  O O     . ARG D  2 292 ? 6.863   -43.613 -12.335 1.00 97.04  ? 292 ARG G O     1 
ATOM   8805  C CB    . ARG D  2 292 ? 3.706   -42.787 -12.983 1.00 90.19  ? 292 ARG G CB    1 
ATOM   8806  N N     . GLU D  2 293 ? 6.375   -43.388 -14.543 1.00 94.60  ? 293 GLU G N     1 
ATOM   8807  C CA    . GLU D  2 293 ? 7.718   -42.975 -14.975 1.00 95.20  ? 293 GLU G CA    1 
ATOM   8808  C C     . GLU D  2 293 ? 7.666   -41.981 -16.148 1.00 100.29 ? 293 GLU G C     1 
ATOM   8809  O O     . GLU D  2 293 ? 6.800   -42.090 -17.023 1.00 98.44  ? 293 GLU G O     1 
ATOM   8810  C CB    . GLU D  2 293 ? 8.570   -44.193 -15.366 1.00 96.77  ? 293 GLU G CB    1 
ATOM   8811  C CG    . GLU D  2 293 ? 9.238   -44.899 -14.194 1.00 109.24 ? 293 GLU G CG    1 
ATOM   8812  C CD    . GLU D  2 293 ? 8.472   -46.057 -13.585 1.00 134.01 ? 293 GLU G CD    1 
ATOM   8813  O OE1   . GLU D  2 293 ? 8.434   -46.149 -12.336 1.00 130.13 ? 293 GLU G OE1   1 
ATOM   8814  O OE2   . GLU D  2 293 ? 7.935   -46.888 -14.352 1.00 130.33 ? 293 GLU G OE2   1 
ATOM   8815  N N     . GLU D  2 294 ? 8.605   -41.007 -16.147 1.00 99.30  ? 294 GLU G N     1 
ATOM   8816  C CA    . GLU D  2 294 ? 8.732   -39.986 -17.193 1.00 99.01  ? 294 GLU G CA    1 
ATOM   8817  C C     . GLU D  2 294 ? 9.526   -40.658 -18.299 1.00 103.49 ? 294 GLU G C     1 
ATOM   8818  O O     . GLU D  2 294 ? 10.616  -41.174 -18.026 1.00 103.36 ? 294 GLU G O     1 
ATOM   8819  C CB    . GLU D  2 294 ? 9.491   -38.745 -16.668 1.00 101.04 ? 294 GLU G CB    1 
ATOM   8820  C CG    . GLU D  2 294 ? 8.834   -38.056 -15.477 1.00 113.38 ? 294 GLU G CG    1 
ATOM   8821  C CD    . GLU D  2 294 ? 9.603   -36.894 -14.870 1.00 130.74 ? 294 GLU G CD    1 
ATOM   8822  O OE1   . GLU D  2 294 ? 10.849  -36.982 -14.776 1.00 123.17 ? 294 GLU G OE1   1 
ATOM   8823  O OE2   . GLU D  2 294 ? 8.950   -35.917 -14.435 1.00 119.16 ? 294 GLU G OE2   1 
ATOM   8824  N N     . GLN D  2 295 ? 8.967   -40.711 -19.524 1.00 100.47 ? 295 GLN G N     1 
ATOM   8825  C CA    . GLN D  2 295 ? 9.594   -41.411 -20.650 1.00 100.64 ? 295 GLN G CA    1 
ATOM   8826  C C     . GLN D  2 295 ? 10.221  -40.480 -21.688 1.00 104.40 ? 295 GLN G C     1 
ATOM   8827  O O     . GLN D  2 295 ? 9.776   -40.479 -22.836 1.00 104.31 ? 295 GLN G O     1 
ATOM   8828  C CB    . GLN D  2 295 ? 8.561   -42.328 -21.337 1.00 101.43 ? 295 GLN G CB    1 
ATOM   8829  C CG    . GLN D  2 295 ? 8.031   -43.462 -20.480 1.00 108.17 ? 295 GLN G CG    1 
ATOM   8830  C CD    . GLN D  2 295 ? 9.028   -44.582 -20.292 1.00 127.81 ? 295 GLN G CD    1 
ATOM   8831  O OE1   . GLN D  2 295 ? 9.417   -45.260 -21.253 1.00 124.53 ? 295 GLN G OE1   1 
ATOM   8832  N NE2   . GLN D  2 295 ? 9.425   -44.848 -19.051 1.00 118.44 ? 295 GLN G NE2   1 
ATOM   8833  N N     . PHE D  2 296 ? 11.235  -39.672 -21.285 1.00 100.19 ? 296 PHE G N     1 
ATOM   8834  C CA    . PHE D  2 296 ? 11.995  -38.730 -22.139 1.00 99.23  ? 296 PHE G CA    1 
ATOM   8835  C C     . PHE D  2 296 ? 11.145  -37.835 -23.092 1.00 104.64 ? 296 PHE G C     1 
ATOM   8836  O O     . PHE D  2 296 ? 11.700  -37.126 -23.934 1.00 104.82 ? 296 PHE G O     1 
ATOM   8837  C CB    . PHE D  2 296 ? 13.076  -39.489 -22.931 1.00 100.42 ? 296 PHE G CB    1 
ATOM   8838  C CG    . PHE D  2 296 ? 14.271  -39.840 -22.080 1.00 101.78 ? 296 PHE G CG    1 
ATOM   8839  C CD1   . PHE D  2 296 ? 14.303  -41.020 -21.355 1.00 104.35 ? 296 PHE G CD1   1 
ATOM   8840  C CD2   . PHE D  2 296 ? 15.319  -38.948 -21.928 1.00 103.52 ? 296 PHE G CD2   1 
ATOM   8841  C CE1   . PHE D  2 296 ? 15.382  -41.317 -20.524 1.00 105.74 ? 296 PHE G CE1   1 
ATOM   8842  C CE2   . PHE D  2 296 ? 16.392  -39.246 -21.094 1.00 106.83 ? 296 PHE G CE2   1 
ATOM   8843  C CZ    . PHE D  2 296 ? 16.424  -40.434 -20.408 1.00 105.02 ? 296 PHE G CZ    1 
ATOM   8844  N N     . ASN D  2 297 ? 9.825   -37.797 -22.884 1.00 101.61 ? 297 ASN G N     1 
ATOM   8845  C CA    . ASN D  2 297 ? 8.868   -37.000 -23.635 1.00 100.80 ? 297 ASN G CA    1 
ATOM   8846  C C     . ASN D  2 297 ? 8.347   -36.050 -22.554 1.00 104.97 ? 297 ASN G C     1 
ATOM   8847  O O     . ASN D  2 297 ? 8.801   -36.139 -21.402 1.00 103.82 ? 297 ASN G O     1 
ATOM   8848  C CB    . ASN D  2 297 ? 7.733   -37.939 -24.226 1.00 100.38 ? 297 ASN G CB    1 
ATOM   8849  C CG    . ASN D  2 297 ? 7.997   -38.356 -25.677 1.00 115.41 ? 297 ASN G CG    1 
ATOM   8850  O OD1   . ASN D  2 297 ? 8.793   -37.689 -26.348 1.00 119.70 ? 297 ASN G OD1   1 
ATOM   8851  N ND2   . ASN D  2 297 ? 7.434   -39.433 -26.314 1.00 90.78  ? 297 ASN G ND2   1 
ATOM   8852  N N     . SER D  2 298 ? 7.379   -35.187 -22.876 1.00 102.15 ? 298 SER G N     1 
ATOM   8853  C CA    . SER D  2 298 ? 6.758   -34.341 -21.849 1.00 102.06 ? 298 SER G CA    1 
ATOM   8854  C C     . SER D  2 298 ? 5.532   -35.153 -21.367 1.00 104.15 ? 298 SER G C     1 
ATOM   8855  O O     . SER D  2 298 ? 4.435   -34.600 -21.219 1.00 104.33 ? 298 SER G O     1 
ATOM   8856  C CB    . SER D  2 298 ? 6.354   -32.978 -22.424 1.00 106.42 ? 298 SER G CB    1 
ATOM   8857  O OG    . SER D  2 298 ? 5.223   -33.038 -23.284 1.00 116.21 ? 298 SER G OG    1 
ATOM   8858  N N     . THR D  2 299 ? 5.718   -36.494 -21.165 1.00 98.40  ? 299 THR G N     1 
ATOM   8859  C CA    . THR D  2 299 ? 4.638   -37.414 -20.830 1.00 96.82  ? 299 THR G CA    1 
ATOM   8860  C C     . THR D  2 299 ? 5.055   -38.499 -19.849 1.00 96.74  ? 299 THR G C     1 
ATOM   8861  O O     . THR D  2 299 ? 6.230   -38.855 -19.749 1.00 96.25  ? 299 THR G O     1 
ATOM   8862  C CB    . THR D  2 299 ? 4.063   -38.061 -22.102 1.00 105.65 ? 299 THR G CB    1 
ATOM   8863  O OG1   . THR D  2 299 ? 5.052   -38.902 -22.702 1.00 106.48 ? 299 THR G OG1   1 
ATOM   8864  C CG2   . THR D  2 299 ? 3.556   -37.027 -23.120 1.00 103.71 ? 299 THR G CG2   1 
ATOM   8865  N N     . TYR D  2 300 ? 4.054   -39.036 -19.149 1.00 90.49  ? 300 TYR G N     1 
ATOM   8866  C CA    . TYR D  2 300 ? 4.210   -40.102 -18.171 1.00 89.24  ? 300 TYR G CA    1 
ATOM   8867  C C     . TYR D  2 300 ? 3.721   -41.425 -18.802 1.00 87.97  ? 300 TYR G C     1 
ATOM   8868  O O     . TYR D  2 300 ? 2.912   -41.418 -19.741 1.00 86.18  ? 300 TYR G O     1 
ATOM   8869  C CB    . TYR D  2 300 ? 3.398   -39.774 -16.890 1.00 91.02  ? 300 TYR G CB    1 
ATOM   8870  C CG    . TYR D  2 300 ? 4.220   -39.186 -15.761 1.00 93.27  ? 300 TYR G CG    1 
ATOM   8871  C CD1   . TYR D  2 300 ? 5.012   -39.996 -14.957 1.00 95.91  ? 300 TYR G CD1   1 
ATOM   8872  C CD2   . TYR D  2 300 ? 4.126   -37.837 -15.433 1.00 94.08  ? 300 TYR G CD2   1 
ATOM   8873  C CE1   . TYR D  2 300 ? 5.751   -39.469 -13.900 1.00 97.54  ? 300 TYR G CE1   1 
ATOM   8874  C CE2   . TYR D  2 300 ? 4.867   -37.294 -14.383 1.00 95.68  ? 300 TYR G CE2   1 
ATOM   8875  C CZ    . TYR D  2 300 ? 5.681   -38.116 -13.616 1.00 104.82 ? 300 TYR G CZ    1 
ATOM   8876  O OH    . TYR D  2 300 ? 6.405   -37.628 -12.546 1.00 107.82 ? 300 TYR G OH    1 
ATOM   8877  N N     . ARG D  2 301 ? 4.257   -42.550 -18.305 1.00 82.01  ? 301 ARG G N     1 
ATOM   8878  C CA    . ARG D  2 301 ? 3.846   -43.902 -18.722 1.00 80.39  ? 301 ARG G CA    1 
ATOM   8879  C C     . ARG D  2 301 ? 3.699   -44.753 -17.470 1.00 80.77  ? 301 ARG G C     1 
ATOM   8880  O O     . ARG D  2 301 ? 4.588   -44.735 -16.609 1.00 80.35  ? 301 ARG G O     1 
ATOM   8881  C CB    . ARG D  2 301 ? 4.873   -44.542 -19.682 1.00 79.18  ? 301 ARG G CB    1 
ATOM   8882  C CG    . ARG D  2 301 ? 4.556   -45.970 -20.162 1.00 81.13  ? 301 ARG G CG    1 
ATOM   8883  C CD    . ARG D  2 301 ? 5.588   -46.431 -21.188 1.00 88.04  ? 301 ARG G CD    1 
ATOM   8884  N NE    . ARG D  2 301 ? 5.439   -47.833 -21.602 1.00 85.71  ? 301 ARG G NE    1 
ATOM   8885  C CZ    . ARG D  2 301 ? 5.884   -48.895 -20.932 1.00 90.64  ? 301 ARG G CZ    1 
ATOM   8886  N NH1   . ARG D  2 301 ? 6.510   -48.746 -19.768 1.00 61.89  ? 301 ARG G NH1   1 
ATOM   8887  N NH2   . ARG D  2 301 ? 5.695   -50.118 -21.416 1.00 85.94  ? 301 ARG G NH2   1 
ATOM   8888  N N     . VAL D  2 302 ? 2.595   -45.499 -17.368 1.00 75.03  ? 302 VAL G N     1 
ATOM   8889  C CA    . VAL D  2 302 ? 2.367   -46.359 -16.196 1.00 75.49  ? 302 VAL G CA    1 
ATOM   8890  C C     . VAL D  2 302 ? 1.767   -47.693 -16.652 1.00 77.72  ? 302 VAL G C     1 
ATOM   8891  O O     . VAL D  2 302 ? 1.020   -47.750 -17.643 1.00 76.46  ? 302 VAL G O     1 
ATOM   8892  C CB    . VAL D  2 302 ? 1.574   -45.642 -15.056 1.00 79.34  ? 302 VAL G CB    1 
ATOM   8893  C CG1   . VAL D  2 302 ? 0.206   -45.172 -15.505 1.00 77.96  ? 302 VAL G CG1   1 
ATOM   8894  C CG2   . VAL D  2 302 ? 1.483   -46.509 -13.807 1.00 80.34  ? 302 VAL G CG2   1 
ATOM   8895  N N     . VAL D  2 303 ? 2.167   -48.773 -15.960 1.00 73.57  ? 303 VAL G N     1 
ATOM   8896  C CA    . VAL D  2 303 ? 1.794   -50.128 -16.334 1.00 73.07  ? 303 VAL G CA    1 
ATOM   8897  C C     . VAL D  2 303 ? 1.069   -50.893 -15.221 1.00 78.27  ? 303 VAL G C     1 
ATOM   8898  O O     . VAL D  2 303 ? 1.482   -50.856 -14.059 1.00 78.19  ? 303 VAL G O     1 
ATOM   8899  C CB    . VAL D  2 303 ? 3.066   -50.894 -16.801 1.00 75.96  ? 303 VAL G CB    1 
ATOM   8900  C CG1   . VAL D  2 303 ? 2.732   -52.330 -17.210 1.00 75.32  ? 303 VAL G CG1   1 
ATOM   8901  C CG2   . VAL D  2 303 ? 3.771   -50.146 -17.934 1.00 74.63  ? 303 VAL G CG2   1 
ATOM   8902  N N     . SER D  2 304 ? 0.005   -51.628 -15.609 1.00 74.72  ? 304 SER G N     1 
ATOM   8903  C CA    . SER D  2 304 ? -0.729  -52.525 -14.722 1.00 75.25  ? 304 SER G CA    1 
ATOM   8904  C C     . SER D  2 304 ? -0.697  -53.926 -15.341 1.00 77.97  ? 304 SER G C     1 
ATOM   8905  O O     . SER D  2 304 ? -0.921  -54.066 -16.548 1.00 76.56  ? 304 SER G O     1 
ATOM   8906  C CB    . SER D  2 304 ? -2.163  -52.048 -14.512 1.00 78.72  ? 304 SER G CB    1 
ATOM   8907  O OG    . SER D  2 304 ? -2.786  -52.809 -13.487 1.00 83.80  ? 304 SER G OG    1 
ATOM   8908  N N     . VAL D  2 305 ? -0.399  -54.948 -14.514 1.00 74.30  ? 305 VAL G N     1 
ATOM   8909  C CA    . VAL D  2 305 ? -0.266  -56.339 -14.930 1.00 73.78  ? 305 VAL G CA    1 
ATOM   8910  C C     . VAL D  2 305 ? -1.244  -57.252 -14.165 1.00 77.45  ? 305 VAL G C     1 
ATOM   8911  O O     . VAL D  2 305 ? -1.091  -57.455 -12.951 1.00 77.73  ? 305 VAL G O     1 
ATOM   8912  C CB    . VAL D  2 305 ? 1.203   -56.795 -14.719 1.00 78.83  ? 305 VAL G CB    1 
ATOM   8913  C CG1   . VAL D  2 305 ? 1.359   -58.312 -14.890 1.00 79.00  ? 305 VAL G CG1   1 
ATOM   8914  C CG2   . VAL D  2 305 ? 2.137   -56.038 -15.658 1.00 77.75  ? 305 VAL G CG2   1 
ATOM   8915  N N     . LEU D  2 306 ? -2.193  -57.867 -14.898 1.00 71.27  ? 306 LEU G N     1 
ATOM   8916  C CA    . LEU D  2 306 ? -3.141  -58.814 -14.320 1.00 70.07  ? 306 LEU G CA    1 
ATOM   8917  C C     . LEU D  2 306 ? -2.729  -60.253 -14.697 1.00 73.33  ? 306 LEU G C     1 
ATOM   8918  O O     . LEU D  2 306 ? -2.657  -60.597 -15.882 1.00 71.54  ? 306 LEU G O     1 
ATOM   8919  C CB    . LEU D  2 306 ? -4.578  -58.520 -14.795 1.00 68.84  ? 306 LEU G CB    1 
ATOM   8920  C CG    . LEU D  2 306 ? -5.675  -59.482 -14.260 1.00 73.80  ? 306 LEU G CG    1 
ATOM   8921  C CD1   . LEU D  2 306 ? -5.712  -59.505 -12.715 1.00 73.36  ? 306 LEU G CD1   1 
ATOM   8922  C CD2   . LEU D  2 306 ? -7.036  -59.112 -14.797 1.00 76.35  ? 306 LEU G CD2   1 
ATOM   8923  N N     . THR D  2 307 ? -2.467  -61.091 -13.686 1.00 70.48  ? 307 THR G N     1 
ATOM   8924  C CA    . THR D  2 307 ? -2.158  -62.501 -13.904 1.00 70.66  ? 307 THR G CA    1 
ATOM   8925  C C     . THR D  2 307 ? -3.478  -63.172 -14.286 1.00 74.00  ? 307 THR G C     1 
ATOM   8926  O O     . THR D  2 307 ? -4.545  -62.690 -13.897 1.00 72.97  ? 307 THR G O     1 
ATOM   8927  C CB    . THR D  2 307 ? -1.596  -63.161 -12.626 1.00 81.11  ? 307 THR G CB    1 
ATOM   8928  O OG1   . THR D  2 307 ? -0.567  -62.336 -12.076 1.00 82.49  ? 307 THR G OG1   1 
ATOM   8929  C CG2   . THR D  2 307 ? -1.054  -64.581 -12.879 1.00 76.40  ? 307 THR G CG2   1 
ATOM   8930  N N     . VAL D  2 308 ? -3.408  -64.268 -15.056 1.00 70.36  ? 308 VAL G N     1 
ATOM   8931  C CA    . VAL D  2 308 ? -4.599  -65.004 -15.508 1.00 69.29  ? 308 VAL G CA    1 
ATOM   8932  C C     . VAL D  2 308 ? -4.388  -66.503 -15.299 1.00 71.52  ? 308 VAL G C     1 
ATOM   8933  O O     . VAL D  2 308 ? -3.240  -66.942 -15.333 1.00 70.56  ? 308 VAL G O     1 
ATOM   8934  C CB    . VAL D  2 308 ? -4.938  -64.643 -16.997 1.00 70.44  ? 308 VAL G CB    1 
ATOM   8935  C CG1   . VAL D  2 308 ? -5.095  -63.141 -17.170 1.00 69.79  ? 308 VAL G CG1   1 
ATOM   8936  C CG2   . VAL D  2 308 ? -3.901  -65.177 -17.982 1.00 68.43  ? 308 VAL G CG2   1 
ATOM   8937  N N     . LEU D  2 309 ? -5.458  -67.289 -15.039 1.00 69.30  ? 309 LEU G N     1 
ATOM   8938  C CA    . LEU D  2 309 ? -5.275  -68.753 -14.934 1.00 70.59  ? 309 LEU G CA    1 
ATOM   8939  C C     . LEU D  2 309 ? -5.239  -69.270 -16.377 1.00 73.99  ? 309 LEU G C     1 
ATOM   8940  O O     . LEU D  2 309 ? -5.870  -68.690 -17.267 1.00 70.66  ? 309 LEU G O     1 
ATOM   8941  C CB    . LEU D  2 309 ? -6.352  -69.496 -14.103 1.00 72.58  ? 309 LEU G CB    1 
ATOM   8942  C CG    . LEU D  2 309 ? -6.292  -71.099 -14.102 1.00 79.43  ? 309 LEU G CG    1 
ATOM   8943  C CD1   . LEU D  2 309 ? -5.027  -71.670 -13.411 1.00 80.05  ? 309 LEU G CD1   1 
ATOM   8944  C CD2   . LEU D  2 309 ? -7.522  -71.728 -13.415 1.00 84.68  ? 309 LEU G CD2   1 
ATOM   8945  N N     . HIS D  2 310 ? -4.488  -70.350 -16.593 1.00 73.41  ? 310 HIS G N     1 
ATOM   8946  C CA    . HIS D  2 310 ? -4.298  -70.981 -17.897 1.00 72.93  ? 310 HIS G CA    1 
ATOM   8947  C C     . HIS D  2 310 ? -5.645  -71.331 -18.550 1.00 74.79  ? 310 HIS G C     1 
ATOM   8948  O O     . HIS D  2 310 ? -5.891  -70.927 -19.694 1.00 74.22  ? 310 HIS G O     1 
ATOM   8949  C CB    . HIS D  2 310 ? -3.383  -72.213 -17.769 1.00 74.87  ? 310 HIS G CB    1 
ATOM   8950  C CG    . HIS D  2 310 ? -2.012  -71.879 -17.247 1.00 79.87  ? 310 HIS G CG    1 
ATOM   8951  N ND1   . HIS D  2 310 ? -1.800  -71.589 -15.902 1.00 83.96  ? 310 HIS G ND1   1 
ATOM   8952  C CD2   . HIS D  2 310 ? -0.825  -71.803 -17.894 1.00 81.38  ? 310 HIS G CD2   1 
ATOM   8953  C CE1   . HIS D  2 310 ? -0.506  -71.332 -15.786 1.00 83.27  ? 310 HIS G CE1   1 
ATOM   8954  N NE2   . HIS D  2 310 ? 0.121   -71.458 -16.957 1.00 82.21  ? 310 HIS G NE2   1 
ATOM   8955  N N     . GLN D  2 311 ? -6.525  -72.012 -17.805 1.00 68.91  ? 311 GLN G N     1 
ATOM   8956  C CA    . GLN D  2 311 ? -7.866  -72.395 -18.279 1.00 67.63  ? 311 GLN G CA    1 
ATOM   8957  C C     . GLN D  2 311 ? -8.759  -71.197 -18.632 1.00 68.91  ? 311 GLN G C     1 
ATOM   8958  O O     . GLN D  2 311 ? -9.493  -71.280 -19.613 1.00 66.76  ? 311 GLN G O     1 
ATOM   8959  C CB    . GLN D  2 311 ? -8.583  -73.325 -17.265 1.00 70.55  ? 311 GLN G CB    1 
ATOM   8960  N N     . ASP D  2 312 ? -8.681  -70.076 -17.880 1.00 65.21  ? 312 ASP G N     1 
ATOM   8961  C CA    . ASP D  2 312 ? -9.512  -68.899 -18.170 1.00 64.31  ? 312 ASP G CA    1 
ATOM   8962  C C     . ASP D  2 312 ? -9.171  -68.277 -19.542 1.00 65.74  ? 312 ASP G C     1 
ATOM   8963  O O     . ASP D  2 312 ? -10.060 -67.907 -20.314 1.00 64.03  ? 312 ASP G O     1 
ATOM   8964  C CB    . ASP D  2 312 ? -9.357  -67.832 -17.076 1.00 67.30  ? 312 ASP G CB    1 
ATOM   8965  C CG    . ASP D  2 312 ? -9.888  -68.198 -15.708 1.00 79.45  ? 312 ASP G CG    1 
ATOM   8966  O OD1   . ASP D  2 312 ? -10.694 -69.151 -15.616 1.00 80.85  ? 312 ASP G OD1   1 
ATOM   8967  O OD2   . ASP D  2 312 ? -9.528  -67.508 -14.733 1.00 85.06  ? 312 ASP G OD2   1 
ATOM   8968  N N     . TRP D  2 313 ? -7.881  -68.154 -19.836 1.00 60.69  ? 313 TRP G N     1 
ATOM   8969  C CA    . TRP D  2 313 ? -7.452  -67.603 -21.119 1.00 57.82  ? 313 TRP G CA    1 
ATOM   8970  C C     . TRP D  2 313 ? -7.841  -68.574 -22.258 1.00 59.37  ? 313 TRP G C     1 
ATOM   8971  O O     . TRP D  2 313 ? -8.402  -68.138 -23.249 1.00 55.81  ? 313 TRP G O     1 
ATOM   8972  C CB    . TRP D  2 313 ? -5.943  -67.332 -21.103 1.00 54.92  ? 313 TRP G CB    1 
ATOM   8973  C CG    . TRP D  2 313 ? -5.462  -66.697 -22.368 1.00 53.29  ? 313 TRP G CG    1 
ATOM   8974  C CD1   . TRP D  2 313 ? -4.961  -67.330 -23.466 1.00 54.74  ? 313 TRP G CD1   1 
ATOM   8975  C CD2   . TRP D  2 313 ? -5.613  -65.326 -22.729 1.00 52.65  ? 313 TRP G CD2   1 
ATOM   8976  N NE1   . TRP D  2 313 ? -4.769  -66.428 -24.481 1.00 53.01  ? 313 TRP G NE1   1 
ATOM   8977  C CE2   . TRP D  2 313 ? -5.151  -65.188 -24.052 1.00 53.99  ? 313 TRP G CE2   1 
ATOM   8978  C CE3   . TRP D  2 313 ? -6.100  -64.194 -22.059 1.00 54.76  ? 313 TRP G CE3   1 
ATOM   8979  C CZ2   . TRP D  2 313 ? -5.166  -63.976 -24.717 1.00 52.33  ? 313 TRP G CZ2   1 
ATOM   8980  C CZ3   . TRP D  2 313 ? -6.096  -62.978 -22.719 1.00 55.03  ? 313 TRP G CZ3   1 
ATOM   8981  C CH2   . TRP D  2 313 ? -5.652  -62.881 -24.038 1.00 54.08  ? 313 TRP G CH2   1 
ATOM   8982  N N     . LEU D  2 314 ? -7.594  -69.882 -22.067 1.00 58.68  ? 314 LEU G N     1 
ATOM   8983  C CA    . LEU D  2 314 ? -7.927  -70.922 -23.043 1.00 58.95  ? 314 LEU G CA    1 
ATOM   8984  C C     . LEU D  2 314 ? -9.440  -71.136 -23.262 1.00 64.94  ? 314 LEU G C     1 
ATOM   8985  O O     . LEU D  2 314 ? -9.820  -71.492 -24.379 1.00 65.13  ? 314 LEU G O     1 
ATOM   8986  C CB    . LEU D  2 314 ? -7.239  -72.243 -22.692 1.00 59.13  ? 314 LEU G CB    1 
ATOM   8987  C CG    . LEU D  2 314 ? -5.719  -72.229 -22.824 1.00 63.53  ? 314 LEU G CG    1 
ATOM   8988  C CD1   . LEU D  2 314 ? -5.112  -73.517 -22.329 1.00 64.53  ? 314 LEU G CD1   1 
ATOM   8989  C CD2   . LEU D  2 314 ? -5.290  -72.002 -24.260 1.00 65.20  ? 314 LEU G CD2   1 
ATOM   8990  N N     . ASN D  2 315 ? -10.304 -70.863 -22.261 1.00 61.65  ? 315 ASN G N     1 
ATOM   8991  C CA    . ASN D  2 315 ? -11.757 -70.967 -22.459 1.00 61.68  ? 315 ASN G CA    1 
ATOM   8992  C C     . ASN D  2 315 ? -12.347 -69.639 -22.977 1.00 64.41  ? 315 ASN G C     1 
ATOM   8993  O O     . ASN D  2 315 ? -13.563 -69.466 -22.951 1.00 63.16  ? 315 ASN G O     1 
ATOM   8994  C CB    . ASN D  2 315 ? -12.478 -71.339 -21.161 1.00 64.48  ? 315 ASN G CB    1 
ATOM   8995  C CG    . ASN D  2 315 ? -12.054 -72.580 -20.439 1.00 80.88  ? 315 ASN G CG    1 
ATOM   8996  O OD1   . ASN D  2 315 ? -12.137 -72.637 -19.212 1.00 82.74  ? 315 ASN G OD1   1 
ATOM   8997  N ND2   . ASN D  2 315 ? -11.671 -73.632 -21.141 1.00 74.67  ? 315 ASN G ND2   1 
ATOM   8998  N N     . GLY D  2 316 ? -11.505 -68.734 -23.470 1.00 61.93  ? 316 GLY G N     1 
ATOM   8999  C CA    . GLY D  2 316 ? -11.936 -67.436 -23.949 1.00 63.17  ? 316 GLY G CA    1 
ATOM   9000  C C     . GLY D  2 316 ? -11.650 -66.403 -22.893 1.00 74.43  ? 316 GLY G C     1 
ATOM   9001  O O     . GLY D  2 316 ? -10.486 -66.053 -22.675 1.00 79.92  ? 316 GLY G O     1 
ATOM   9002  N N     . LYS D  2 317 ? -12.694 -65.912 -22.249 1.00 69.71  ? 317 LYS G N     1 
ATOM   9003  C CA    . LYS D  2 317 ? -12.663 -64.908 -21.175 1.00 69.39  ? 317 LYS G CA    1 
ATOM   9004  C C     . LYS D  2 317 ? -12.106 -63.549 -21.609 1.00 68.97  ? 317 LYS G C     1 
ATOM   9005  O O     . LYS D  2 317 ? -10.960 -63.445 -22.004 1.00 67.21  ? 317 LYS G O     1 
ATOM   9006  C CB    . LYS D  2 317 ? -11.962 -65.395 -19.897 1.00 72.72  ? 317 LYS G CB    1 
ATOM   9007  C CG    . LYS D  2 317 ? -12.751 -66.483 -19.137 1.00 75.84  ? 317 LYS G CG    1 
ATOM   9008  C CD    . LYS D  2 317 ? -12.919 -66.235 -17.633 1.00 80.92  ? 317 LYS G CD    1 
ATOM   9009  C CE    . LYS D  2 317 ? -13.763 -67.331 -16.997 1.00 89.44  ? 317 LYS G CE    1 
ATOM   9010  N NZ    . LYS D  2 317 ? -13.583 -67.436 -15.525 1.00 94.48  ? 317 LYS G NZ    1 
ATOM   9011  N N     . GLU D  2 318 ? -12.943 -62.513 -21.528 1.00 65.63  ? 318 GLU G N     1 
ATOM   9012  C CA    . GLU D  2 318 ? -12.605 -61.140 -21.885 1.00 64.51  ? 318 GLU G CA    1 
ATOM   9013  C C     . GLU D  2 318 ? -11.923 -60.420 -20.719 1.00 66.99  ? 318 GLU G C     1 
ATOM   9014  O O     . GLU D  2 318 ? -12.521 -60.303 -19.656 1.00 69.34  ? 318 GLU G O     1 
ATOM   9015  C CB    . GLU D  2 318 ? -13.874 -60.363 -22.288 1.00 66.44  ? 318 GLU G CB    1 
ATOM   9016  C CG    . GLU D  2 318 ? -14.595 -60.905 -23.514 1.00 75.53  ? 318 GLU G CG    1 
ATOM   9017  C CD    . GLU D  2 318 ? -15.920 -60.219 -23.798 1.00 103.75 ? 318 GLU G CD    1 
ATOM   9018  O OE1   . GLU D  2 318 ? -16.063 -59.024 -23.447 1.00 90.48  ? 318 GLU G OE1   1 
ATOM   9019  O OE2   . GLU D  2 318 ? -16.826 -60.885 -24.350 1.00 106.21 ? 318 GLU G OE2   1 
ATOM   9020  N N     . TYR D  2 319 ? -10.696 -59.907 -20.933 1.00 60.45  ? 319 TYR G N     1 
ATOM   9021  C CA    . TYR D  2 319 ? -9.929  -59.160 -19.938 1.00 58.73  ? 319 TYR G CA    1 
ATOM   9022  C C     . TYR D  2 319 ? -9.977  -57.718 -20.306 1.00 66.51  ? 319 TYR G C     1 
ATOM   9023  O O     . TYR D  2 319 ? -9.270  -57.297 -21.219 1.00 67.46  ? 319 TYR G O     1 
ATOM   9024  C CB    . TYR D  2 319 ? -8.482  -59.665 -19.863 1.00 56.39  ? 319 TYR G CB    1 
ATOM   9025  C CG    . TYR D  2 319 ? -8.419  -61.070 -19.314 1.00 54.54  ? 319 TYR G CG    1 
ATOM   9026  C CD1   . TYR D  2 319 ? -8.588  -62.169 -20.144 1.00 55.66  ? 319 TYR G CD1   1 
ATOM   9027  C CD2   . TYR D  2 319 ? -8.288  -61.300 -17.949 1.00 55.73  ? 319 TYR G CD2   1 
ATOM   9028  C CE1   . TYR D  2 319 ? -8.664  -63.463 -19.627 1.00 57.30  ? 319 TYR G CE1   1 
ATOM   9029  C CE2   . TYR D  2 319 ? -8.340  -62.588 -17.421 1.00 56.69  ? 319 TYR G CE2   1 
ATOM   9030  C CZ    . TYR D  2 319 ? -8.521  -63.670 -18.265 1.00 62.37  ? 319 TYR G CZ    1 
ATOM   9031  O OH    . TYR D  2 319 ? -8.522  -64.950 -17.777 1.00 62.21  ? 319 TYR G OH    1 
ATOM   9032  N N     . LYS D  2 320 ? -10.807 -56.946 -19.599 1.00 66.18  ? 320 LYS G N     1 
ATOM   9033  C CA    . LYS D  2 320 ? -11.002 -55.513 -19.852 1.00 66.24  ? 320 LYS G CA    1 
ATOM   9034  C C     . LYS D  2 320 ? -10.145 -54.646 -18.894 1.00 71.88  ? 320 LYS G C     1 
ATOM   9035  O O     . LYS D  2 320 ? -10.095 -54.914 -17.689 1.00 70.98  ? 320 LYS G O     1 
ATOM   9036  C CB    . LYS D  2 320 ? -12.498 -55.190 -19.701 1.00 69.38  ? 320 LYS G CB    1 
ATOM   9037  C CG    . LYS D  2 320 ? -12.948 -53.773 -20.046 1.00 85.85  ? 320 LYS G CG    1 
ATOM   9038  C CD    . LYS D  2 320 ? -14.459 -53.649 -19.815 1.00 99.09  ? 320 LYS G CD    1 
ATOM   9039  C CE    . LYS D  2 320 ? -14.988 -52.245 -19.937 1.00 106.49 ? 320 LYS G CE    1 
ATOM   9040  N NZ    . LYS D  2 320 ? -16.334 -52.118 -19.320 1.00 112.20 ? 320 LYS G NZ    1 
ATOM   9041  N N     . CYS D  2 321 ? -9.475  -53.619 -19.442 1.00 69.63  ? 321 CYS G N     1 
ATOM   9042  C CA    . CYS D  2 321 ? -8.674  -52.674 -18.660 1.00 71.34  ? 321 CYS G CA    1 
ATOM   9043  C C     . CYS D  2 321 ? -9.271  -51.273 -18.823 1.00 75.77  ? 321 CYS G C     1 
ATOM   9044  O O     . CYS D  2 321 ? -9.218  -50.726 -19.923 1.00 73.69  ? 321 CYS G O     1 
ATOM   9045  C CB    . CYS D  2 321 ? -7.210  -52.701 -19.089 1.00 71.59  ? 321 CYS G CB    1 
ATOM   9046  S SG    . CYS D  2 321 ? -6.146  -51.570 -18.150 1.00 75.95  ? 321 CYS G SG    1 
ATOM   9047  N N     . LYS D  2 322 ? -9.860  -50.711 -17.736 1.00 74.74  ? 322 LYS G N     1 
ATOM   9048  C CA    . LYS D  2 322 ? -10.437 -49.354 -17.725 1.00 75.22  ? 322 LYS G CA    1 
ATOM   9049  C C     . LYS D  2 322 ? -9.406  -48.425 -17.090 1.00 78.87  ? 322 LYS G C     1 
ATOM   9050  O O     . LYS D  2 322 ? -8.888  -48.730 -16.006 1.00 79.00  ? 322 LYS G O     1 
ATOM   9051  C CB    . LYS D  2 322 ? -11.765 -49.288 -16.943 1.00 79.33  ? 322 LYS G CB    1 
ATOM   9052  N N     . VAL D  2 323 ? -9.074  -47.320 -17.779 1.00 75.03  ? 323 VAL G N     1 
ATOM   9053  C CA    . VAL D  2 323 ? -8.083  -46.367 -17.287 1.00 75.38  ? 323 VAL G CA    1 
ATOM   9054  C C     . VAL D  2 323 ? -8.760  -45.020 -17.086 1.00 82.60  ? 323 VAL G C     1 
ATOM   9055  O O     . VAL D  2 323 ? -9.525  -44.575 -17.951 1.00 80.84  ? 323 VAL G O     1 
ATOM   9056  C CB    . VAL D  2 323 ? -6.841  -46.287 -18.219 1.00 77.32  ? 323 VAL G CB    1 
ATOM   9057  C CG1   . VAL D  2 323 ? -5.825  -45.250 -17.717 1.00 75.96  ? 323 VAL G CG1   1 
ATOM   9058  C CG2   . VAL D  2 323 ? -6.185  -47.666 -18.348 1.00 76.98  ? 323 VAL G CG2   1 
ATOM   9059  N N     . SER D  2 324 ? -8.484  -44.386 -15.928 1.00 83.34  ? 324 SER G N     1 
ATOM   9060  C CA    . SER D  2 324 ? -9.056  -43.097 -15.556 1.00 85.31  ? 324 SER G CA    1 
ATOM   9061  C C     . SER D  2 324 ? -7.954  -42.082 -15.224 1.00 94.28  ? 324 SER G C     1 
ATOM   9062  O O     . SER D  2 324 ? -6.955  -42.423 -14.576 1.00 93.69  ? 324 SER G O     1 
ATOM   9063  C CB    . SER D  2 324 ? -10.028 -43.279 -14.395 1.00 88.38  ? 324 SER G CB    1 
ATOM   9064  O OG    . SER D  2 324 ? -11.236 -43.853 -14.866 1.00 94.47  ? 324 SER G OG    1 
ATOM   9065  N N     . ASN D  2 325 ? -8.149  -40.836 -15.694 1.00 95.28  ? 325 ASN G N     1 
ATOM   9066  C CA    . ASN D  2 325 ? -7.204  -39.716 -15.563 1.00 96.92  ? 325 ASN G CA    1 
ATOM   9067  C C     . ASN D  2 325 ? -7.973  -38.393 -15.805 1.00 105.73 ? 325 ASN G C     1 
ATOM   9068  O O     . ASN D  2 325 ? -8.838  -38.346 -16.694 1.00 104.66 ? 325 ASN G O     1 
ATOM   9069  C CB    . ASN D  2 325 ? -6.064  -39.894 -16.603 1.00 97.97  ? 325 ASN G CB    1 
ATOM   9070  C CG    . ASN D  2 325 ? -5.038  -38.778 -16.676 1.00 113.92 ? 325 ASN G CG    1 
ATOM   9071  O OD1   . ASN D  2 325 ? -5.227  -37.773 -17.373 1.00 104.27 ? 325 ASN G OD1   1 
ATOM   9072  N ND2   . ASN D  2 325 ? -3.862  -38.996 -16.115 1.00 103.78 ? 325 ASN G ND2   1 
ATOM   9073  N N     . LYS D  2 326 ? -7.619  -37.308 -15.061 1.00 106.13 ? 326 LYS G N     1 
ATOM   9074  C CA    . LYS D  2 326 ? -8.306  -36.005 -15.185 1.00 107.48 ? 326 LYS G CA    1 
ATOM   9075  C C     . LYS D  2 326 ? -7.921  -35.183 -16.454 1.00 112.58 ? 326 LYS G C     1 
ATOM   9076  O O     . LYS D  2 326 ? -8.321  -34.021 -16.566 1.00 112.69 ? 326 LYS G O     1 
ATOM   9077  C CB    . LYS D  2 326 ? -8.152  -35.157 -13.898 1.00 111.11 ? 326 LYS G CB    1 
ATOM   9078  C CG    . LYS D  2 326 ? -9.202  -35.499 -12.835 1.00 129.62 ? 326 LYS G CG    1 
ATOM   9079  C CD    . LYS D  2 326 ? -10.542 -34.778 -13.082 1.00 139.52 ? 326 LYS G CD    1 
ATOM   9080  C CE    . LYS D  2 326 ? -11.609 -35.121 -12.064 1.00 146.61 ? 326 LYS G CE    1 
ATOM   9081  N NZ    . LYS D  2 326 ? -12.311 -36.391 -12.389 1.00 153.49 ? 326 LYS G NZ    1 
ATOM   9082  N N     . GLY D  2 327 ? -7.235  -35.810 -17.414 1.00 109.30 ? 327 GLY G N     1 
ATOM   9083  C CA    . GLY D  2 327 ? -6.927  -35.233 -18.713 1.00 108.90 ? 327 GLY G CA    1 
ATOM   9084  C C     . GLY D  2 327 ? -7.781  -35.864 -19.804 1.00 114.38 ? 327 GLY G C     1 
ATOM   9085  O O     . GLY D  2 327 ? -7.491  -35.688 -20.991 1.00 113.68 ? 327 GLY G O     1 
ATOM   9086  N N     . LEU D  2 328 ? -8.847  -36.611 -19.415 1.00 112.38 ? 328 LEU G N     1 
ATOM   9087  C CA    . LEU D  2 328 ? -9.753  -37.291 -20.340 1.00 112.70 ? 328 LEU G CA    1 
ATOM   9088  C C     . LEU D  2 328 ? -11.176 -36.744 -20.162 1.00 116.88 ? 328 LEU G C     1 
ATOM   9089  O O     . LEU D  2 328 ? -11.579 -36.489 -19.023 1.00 117.29 ? 328 LEU G O     1 
ATOM   9090  C CB    . LEU D  2 328 ? -9.766  -38.806 -20.036 1.00 113.08 ? 328 LEU G CB    1 
ATOM   9091  C CG    . LEU D  2 328 ? -8.451  -39.566 -20.262 1.00 117.09 ? 328 LEU G CG    1 
ATOM   9092  C CD1   . LEU D  2 328 ? -8.452  -40.898 -19.514 1.00 117.59 ? 328 LEU G CD1   1 
ATOM   9093  C CD2   . LEU D  2 328 ? -8.210  -39.818 -21.744 1.00 118.13 ? 328 LEU G CD2   1 
ATOM   9094  N N     . PRO D  2 329 ? -11.971 -36.597 -21.247 1.00 112.55 ? 329 PRO G N     1 
ATOM   9095  C CA    . PRO D  2 329 ? -13.367 -36.157 -21.068 1.00 113.07 ? 329 PRO G CA    1 
ATOM   9096  C C     . PRO D  2 329 ? -14.211 -37.230 -20.364 1.00 117.08 ? 329 PRO G C     1 
ATOM   9097  O O     . PRO D  2 329 ? -15.091 -36.901 -19.563 1.00 117.61 ? 329 PRO G O     1 
ATOM   9098  C CB    . PRO D  2 329 ? -13.846 -35.891 -22.500 1.00 114.71 ? 329 PRO G CB    1 
ATOM   9099  C CG    . PRO D  2 329 ? -12.997 -36.755 -23.358 1.00 118.30 ? 329 PRO G CG    1 
ATOM   9100  C CD    . PRO D  2 329 ? -11.672 -36.899 -22.664 1.00 113.29 ? 329 PRO G CD    1 
ATOM   9101  N N     . SER D  2 330 ? -13.919 -38.517 -20.661 1.00 112.23 ? 330 SER G N     1 
ATOM   9102  C CA    . SER D  2 330 ? -14.575 -39.681 -20.083 1.00 112.03 ? 330 SER G CA    1 
ATOM   9103  C C     . SER D  2 330 ? -13.467 -40.645 -19.560 1.00 112.95 ? 330 SER G C     1 
ATOM   9104  O O     . SER D  2 330 ? -12.632 -40.206 -18.766 1.00 112.12 ? 330 SER G O     1 
ATOM   9105  C CB    . SER D  2 330 ? -15.467 -40.322 -21.142 1.00 116.30 ? 330 SER G CB    1 
ATOM   9106  O OG    . SER D  2 330 ? -14.695 -40.766 -22.247 1.00 124.34 ? 330 SER G OG    1 
ATOM   9107  N N     . SER D  2 331 ? -13.447 -41.925 -19.998 1.00 107.48 ? 331 SER G N     1 
ATOM   9108  C CA    . SER D  2 331 ? -12.436 -42.906 -19.592 1.00 105.77 ? 331 SER G CA    1 
ATOM   9109  C C     . SER D  2 331 ? -12.146 -43.850 -20.762 1.00 105.59 ? 331 SER G C     1 
ATOM   9110  O O     . SER D  2 331 ? -13.049 -44.132 -21.550 1.00 105.68 ? 331 SER G O     1 
ATOM   9111  C CB    . SER D  2 331 ? -12.926 -43.709 -18.389 1.00 110.21 ? 331 SER G CB    1 
ATOM   9112  O OG    . SER D  2 331 ? -14.188 -44.305 -18.646 1.00 118.26 ? 331 SER G OG    1 
ATOM   9113  N N     . ILE D  2 332 ? -10.898 -44.328 -20.877 1.00 98.58  ? 332 ILE G N     1 
ATOM   9114  C CA    . ILE D  2 332 ? -10.485 -45.246 -21.949 1.00 96.29  ? 332 ILE G CA    1 
ATOM   9115  C C     . ILE D  2 332 ? -10.605 -46.679 -21.427 1.00 95.86  ? 332 ILE G C     1 
ATOM   9116  O O     . ILE D  2 332 ? -10.148 -46.967 -20.320 1.00 95.03  ? 332 ILE G O     1 
ATOM   9117  C CB    . ILE D  2 332 ? -9.033  -44.946 -22.417 1.00 98.77  ? 332 ILE G CB    1 
ATOM   9118  C CG1   . ILE D  2 332 ? -8.850  -43.474 -22.867 1.00 99.25  ? 332 ILE G CG1   1 
ATOM   9119  C CG2   . ILE D  2 332 ? -8.596  -45.910 -23.524 1.00 99.44  ? 332 ILE G CG2   1 
ATOM   9120  C CD1   . ILE D  2 332 ? -9.679  -43.034 -24.091 1.00 108.26 ? 332 ILE G CD1   1 
ATOM   9121  N N     . GLU D  2 333 ? -11.195 -47.573 -22.239 1.00 89.84  ? 333 GLU G N     1 
ATOM   9122  C CA    . GLU D  2 333 ? -11.381 -48.987 -21.901 1.00 88.71  ? 333 GLU G CA    1 
ATOM   9123  C C     . GLU D  2 333 ? -10.994 -49.884 -23.085 1.00 87.85  ? 333 GLU G C     1 
ATOM   9124  O O     . GLU D  2 333 ? -11.587 -49.778 -24.161 1.00 86.93  ? 333 GLU G O     1 
ATOM   9125  C CB    . GLU D  2 333 ? -12.820 -49.298 -21.415 1.00 91.53  ? 333 GLU G CB    1 
ATOM   9126  C CG    . GLU D  2 333 ? -13.937 -48.378 -21.905 1.00 107.18 ? 333 GLU G CG    1 
ATOM   9127  C CD    . GLU D  2 333 ? -14.305 -48.479 -23.374 1.00 131.32 ? 333 GLU G CD    1 
ATOM   9128  O OE1   . GLU D  2 333 ? -13.818 -47.647 -24.174 1.00 119.51 ? 333 GLU G OE1   1 
ATOM   9129  O OE2   . GLU D  2 333 ? -15.111 -49.373 -23.719 1.00 130.02 ? 333 GLU G OE2   1 
ATOM   9130  N N     . LYS D  2 334 ? -9.997  -50.765 -22.880 1.00 80.40  ? 334 LYS G N     1 
ATOM   9131  C CA    . LYS D  2 334 ? -9.537  -51.702 -23.910 1.00 77.53  ? 334 LYS G CA    1 
ATOM   9132  C C     . LYS D  2 334 ? -9.827  -53.113 -23.415 1.00 76.25  ? 334 LYS G C     1 
ATOM   9133  O O     . LYS D  2 334 ? -9.793  -53.355 -22.209 1.00 75.65  ? 334 LYS G O     1 
ATOM   9134  C CB    . LYS D  2 334 ? -8.042  -51.502 -24.215 1.00 79.13  ? 334 LYS G CB    1 
ATOM   9135  N N     . THR D  2 335 ? -10.183 -54.021 -24.335 1.00 69.25  ? 335 THR G N     1 
ATOM   9136  C CA    . THR D  2 335 ? -10.504 -55.415 -24.003 1.00 68.33  ? 335 THR G CA    1 
ATOM   9137  C C     . THR D  2 335 ? -9.677  -56.371 -24.855 1.00 68.34  ? 335 THR G C     1 
ATOM   9138  O O     . THR D  2 335 ? -9.387  -56.096 -26.025 1.00 65.84  ? 335 THR G O     1 
ATOM   9139  C CB    . THR D  2 335 ? -12.019 -55.691 -24.180 1.00 77.60  ? 335 THR G CB    1 
ATOM   9140  O OG1   . THR D  2 335 ? -12.774 -54.676 -23.515 1.00 76.20  ? 335 THR G OG1   1 
ATOM   9141  C CG2   . THR D  2 335 ? -12.440 -57.078 -23.657 1.00 76.33  ? 335 THR G CG2   1 
ATOM   9142  N N     . ILE D  2 336 ? -9.324  -57.514 -24.268 1.00 63.32  ? 336 ILE G N     1 
ATOM   9143  C CA    . ILE D  2 336 ? -8.556  -58.520 -24.974 1.00 61.58  ? 336 ILE G CA    1 
ATOM   9144  C C     . ILE D  2 336 ? -9.012  -59.892 -24.559 1.00 62.08  ? 336 ILE G C     1 
ATOM   9145  O O     . ILE D  2 336 ? -9.633  -60.063 -23.511 1.00 61.81  ? 336 ILE G O     1 
ATOM   9146  C CB    . ILE D  2 336 ? -7.012  -58.291 -24.817 1.00 65.06  ? 336 ILE G CB    1 
ATOM   9147  C CG1   . ILE D  2 336 ? -6.227  -58.986 -25.946 1.00 66.41  ? 336 ILE G CG1   1 
ATOM   9148  C CG2   . ILE D  2 336 ? -6.467  -58.732 -23.448 1.00 66.14  ? 336 ILE G CG2   1 
ATOM   9149  C CD1   . ILE D  2 336 ? -4.938  -58.388 -26.241 1.00 81.10  ? 336 ILE G CD1   1 
ATOM   9150  N N     . SER D  2 337 ? -8.768  -60.858 -25.434 1.00 56.62  ? 337 SER G N     1 
ATOM   9151  C CA    . SER D  2 337 ? -9.078  -62.260 -25.203 1.00 56.53  ? 337 SER G CA    1 
ATOM   9152  C C     . SER D  2 337 ? -8.368  -63.105 -26.246 1.00 56.91  ? 337 SER G C     1 
ATOM   9153  O O     . SER D  2 337 ? -7.802  -62.593 -27.217 1.00 56.54  ? 337 SER G O     1 
ATOM   9154  C CB    . SER D  2 337 ? -10.590 -62.520 -25.269 1.00 62.46  ? 337 SER G CB    1 
ATOM   9155  O OG    . SER D  2 337 ? -11.128 -62.300 -26.562 1.00 76.62  ? 337 SER G OG    1 
ATOM   9156  N N     . LYS D  2 338 ? -8.432  -64.403 -26.060 1.00 51.45  ? 338 LYS G N     1 
ATOM   9157  C CA    . LYS D  2 338 ? -7.913  -65.334 -27.021 1.00 49.06  ? 338 LYS G CA    1 
ATOM   9158  C C     . LYS D  2 338 ? -8.768  -65.217 -28.305 1.00 53.20  ? 338 LYS G C     1 
ATOM   9159  O O     . LYS D  2 338 ? -9.940  -64.833 -28.232 1.00 53.39  ? 338 LYS G O     1 
ATOM   9160  C CB    . LYS D  2 338 ? -8.004  -66.745 -26.458 1.00 51.22  ? 338 LYS G CB    1 
ATOM   9161  C CG    . LYS D  2 338 ? -7.187  -67.749 -27.248 1.00 65.17  ? 338 LYS G CG    1 
ATOM   9162  C CD    . LYS D  2 338 ? -7.468  -69.131 -26.763 1.00 70.15  ? 338 LYS G CD    1 
ATOM   9163  C CE    . LYS D  2 338 ? -8.907  -69.539 -26.957 1.00 62.47  ? 338 LYS G CE    1 
ATOM   9164  N NZ    . LYS D  2 338 ? -9.019  -70.970 -27.268 1.00 63.60  ? 338 LYS G NZ    1 
ATOM   9165  N N     . ALA D  2 339 ? -8.166  -65.483 -29.479 1.00 47.86  ? 339 ALA G N     1 
ATOM   9166  C CA    . ALA D  2 339 ? -8.884  -65.438 -30.744 1.00 46.15  ? 339 ALA G CA    1 
ATOM   9167  C C     . ALA D  2 339 ? -10.041 -66.464 -30.726 1.00 48.43  ? 339 ALA G C     1 
ATOM   9168  O O     . ALA D  2 339 ? -9.865  -67.622 -30.344 1.00 48.06  ? 339 ALA G O     1 
ATOM   9169  C CB    . ALA D  2 339 ? -7.938  -65.753 -31.882 1.00 45.95  ? 339 ALA G CB    1 
ATOM   9170  N N     . LYS D  2 340 ? -11.224 -66.014 -31.112 1.00 44.96  ? 340 LYS G N     1 
ATOM   9171  C CA    . LYS D  2 340 ? -12.407 -66.841 -31.123 1.00 45.34  ? 340 LYS G CA    1 
ATOM   9172  C C     . LYS D  2 340 ? -12.440 -67.762 -32.321 1.00 46.16  ? 340 LYS G C     1 
ATOM   9173  O O     . LYS D  2 340 ? -11.845 -67.476 -33.329 1.00 44.25  ? 340 LYS G O     1 
ATOM   9174  C CB    . LYS D  2 340 ? -13.654 -65.945 -31.046 1.00 50.78  ? 340 LYS G CB    1 
ATOM   9175  C CG    . LYS D  2 340 ? -13.743 -65.209 -29.705 1.00 68.16  ? 340 LYS G CG    1 
ATOM   9176  C CD    . LYS D  2 340 ? -14.411 -63.843 -29.798 1.00 79.68  ? 340 LYS G CD    1 
ATOM   9177  C CE    . LYS D  2 340 ? -15.087 -63.458 -28.504 1.00 85.79  ? 340 LYS G CE    1 
ATOM   9178  N NZ    . LYS D  2 340 ? -16.461 -64.049 -28.399 1.00 87.38  ? 340 LYS G NZ    1 
ATOM   9179  N N     . GLY D  2 341 ? -13.137 -68.873 -32.184 1.00 44.98  ? 341 GLY G N     1 
ATOM   9180  C CA    . GLY D  2 341 ? -13.301 -69.859 -33.231 1.00 44.02  ? 341 GLY G CA    1 
ATOM   9181  C C     . GLY D  2 341 ? -12.878 -71.249 -32.829 1.00 47.81  ? 341 GLY G C     1 
ATOM   9182  O O     . GLY D  2 341 ? -12.046 -71.414 -31.953 1.00 48.96  ? 341 GLY G O     1 
ATOM   9183  N N     . GLN D  2 342 ? -13.414 -72.242 -33.521 1.00 46.10  ? 342 GLN G N     1 
ATOM   9184  C CA    . GLN D  2 342 ? -13.198 -73.677 -33.305 1.00 47.55  ? 342 GLN G CA    1 
ATOM   9185  C C     . GLN D  2 342 ? -11.756 -74.099 -33.430 1.00 49.89  ? 342 GLN G C     1 
ATOM   9186  O O     . GLN D  2 342 ? -11.201 -73.996 -34.507 1.00 49.36  ? 342 GLN G O     1 
ATOM   9187  C CB    . GLN D  2 342 ? -14.087 -74.457 -34.282 1.00 49.45  ? 342 GLN G CB    1 
ATOM   9188  C CG    . GLN D  2 342 ? -14.027 -75.967 -34.232 1.00 72.00  ? 342 GLN G CG    1 
ATOM   9189  C CD    . GLN D  2 342 ? -14.923 -76.548 -35.321 1.00 85.01  ? 342 GLN G CD    1 
ATOM   9190  O OE1   . GLN D  2 342 ? -16.120 -76.200 -35.437 1.00 70.59  ? 342 GLN G OE1   1 
ATOM   9191  N NE2   . GLN D  2 342 ? -14.349 -77.377 -36.200 1.00 83.58  ? 342 GLN G NE2   1 
ATOM   9192  N N     . PRO D  2 343 ? -11.104 -74.607 -32.359 1.00 46.90  ? 343 PRO G N     1 
ATOM   9193  C CA    . PRO D  2 343 ? -9.701  -75.010 -32.506 1.00 44.46  ? 343 PRO G CA    1 
ATOM   9194  C C     . PRO D  2 343 ? -9.489  -76.156 -33.485 1.00 46.47  ? 343 PRO G C     1 
ATOM   9195  O O     . PRO D  2 343 ? -10.312 -77.057 -33.602 1.00 46.46  ? 343 PRO G O     1 
ATOM   9196  C CB    . PRO D  2 343 ? -9.276  -75.375 -31.079 1.00 46.82  ? 343 PRO G CB    1 
ATOM   9197  C CG    . PRO D  2 343 ? -10.225 -74.669 -30.203 1.00 52.03  ? 343 PRO G CG    1 
ATOM   9198  C CD    . PRO D  2 343 ? -11.537 -74.754 -30.953 1.00 48.04  ? 343 PRO G CD    1 
ATOM   9199  N N     . ARG D  2 344 ? -8.367  -76.114 -34.183 1.00 42.98  ? 344 ARG G N     1 
ATOM   9200  C CA    . ARG D  2 344 ? -8.002  -77.110 -35.192 1.00 42.89  ? 344 ARG G CA    1 
ATOM   9201  C C     . ARG D  2 344 ? -6.569  -77.517 -34.919 1.00 47.18  ? 344 ARG G C     1 
ATOM   9202  O O     . ARG D  2 344 ? -5.715  -76.679 -34.584 1.00 44.29  ? 344 ARG G O     1 
ATOM   9203  C CB    . ARG D  2 344 ? -8.160  -76.532 -36.599 1.00 41.90  ? 344 ARG G CB    1 
ATOM   9204  C CG    . ARG D  2 344 ? -9.616  -76.291 -36.954 1.00 41.02  ? 344 ARG G CG    1 
ATOM   9205  C CD    . ARG D  2 344 ? -9.787  -75.556 -38.263 1.00 47.07  ? 344 ARG G CD    1 
ATOM   9206  N NE    . ARG D  2 344 ? -9.396  -76.382 -39.398 1.00 49.84  ? 344 ARG G NE    1 
ATOM   9207  C CZ    . ARG D  2 344 ? -9.519  -76.045 -40.676 1.00 52.00  ? 344 ARG G CZ    1 
ATOM   9208  N NH1   . ARG D  2 344 ? -10.021 -74.862 -41.018 1.00 36.16  ? 344 ARG G NH1   1 
ATOM   9209  N NH2   . ARG D  2 344 ? -9.118  -76.873 -41.621 1.00 50.88  ? 344 ARG G NH2   1 
ATOM   9210  N N     . GLU D  2 345 ? -6.307  -78.800 -35.070 1.00 46.82  ? 345 GLU G N     1 
ATOM   9211  C CA    . GLU D  2 345 ? -5.032  -79.353 -34.685 1.00 47.45  ? 345 GLU G CA    1 
ATOM   9212  C C     . GLU D  2 345 ? -3.913  -79.226 -35.698 1.00 49.30  ? 345 GLU G C     1 
ATOM   9213  O O     . GLU D  2 345 ? -4.058  -79.667 -36.837 1.00 47.49  ? 345 GLU G O     1 
ATOM   9214  C CB    . GLU D  2 345 ? -5.197  -80.814 -34.289 1.00 49.57  ? 345 GLU G CB    1 
ATOM   9215  C CG    . GLU D  2 345 ? -4.079  -81.327 -33.391 1.00 61.99  ? 345 GLU G CG    1 
ATOM   9216  C CD    . GLU D  2 345 ? -4.343  -82.731 -32.896 1.00 80.31  ? 345 GLU G CD    1 
ATOM   9217  O OE1   . GLU D  2 345 ? -4.506  -83.632 -33.746 1.00 53.86  ? 345 GLU G OE1   1 
ATOM   9218  O OE2   . GLU D  2 345 ? -4.460  -82.920 -31.664 1.00 90.82  ? 345 GLU G OE2   1 
ATOM   9219  N N     . PRO D  2 346 ? -2.730  -78.731 -35.252 1.00 46.00  ? 346 PRO G N     1 
ATOM   9220  C CA    . PRO D  2 346 ? -1.590  -78.689 -36.166 1.00 44.74  ? 346 PRO G CA    1 
ATOM   9221  C C     . PRO D  2 346 ? -1.103  -80.067 -36.589 1.00 47.21  ? 346 PRO G C     1 
ATOM   9222  O O     . PRO D  2 346 ? -1.089  -80.988 -35.790 1.00 45.88  ? 346 PRO G O     1 
ATOM   9223  C CB    . PRO D  2 346 ? -0.476  -78.005 -35.354 1.00 46.81  ? 346 PRO G CB    1 
ATOM   9224  C CG    . PRO D  2 346 ? -0.927  -77.907 -33.995 1.00 51.66  ? 346 PRO G CG    1 
ATOM   9225  C CD    . PRO D  2 346 ? -2.390  -78.178 -33.919 1.00 48.07  ? 346 PRO G CD    1 
ATOM   9226  N N     . GLN D  2 347 ? -0.619  -80.151 -37.816 1.00 44.29  ? 347 GLN G N     1 
ATOM   9227  C CA    . GLN D  2 347 ? 0.071   -81.297 -38.394 1.00 43.33  ? 347 GLN G CA    1 
ATOM   9228  C C     . GLN D  2 347 ? 1.516   -80.819 -38.549 1.00 44.96  ? 347 GLN G C     1 
ATOM   9229  O O     . GLN D  2 347 ? 1.736   -79.718 -39.050 1.00 43.14  ? 347 GLN G O     1 
ATOM   9230  C CB    . GLN D  2 347 ? -0.517  -81.636 -39.765 1.00 43.85  ? 347 GLN G CB    1 
ATOM   9231  C CG    . GLN D  2 347 ? -1.953  -82.134 -39.664 1.00 53.18  ? 347 GLN G CG    1 
ATOM   9232  C CD    . GLN D  2 347 ? -2.588  -82.283 -41.019 1.00 70.26  ? 347 GLN G CD    1 
ATOM   9233  O OE1   . GLN D  2 347 ? -1.953  -82.747 -41.985 1.00 58.46  ? 347 GLN G OE1   1 
ATOM   9234  N NE2   . GLN D  2 347 ? -3.850  -81.869 -41.128 1.00 65.93  ? 347 GLN G NE2   1 
ATOM   9235  N N     . VAL D  2 348 ? 2.475   -81.604 -38.089 1.00 41.01  ? 348 VAL G N     1 
ATOM   9236  C CA    . VAL D  2 348 ? 3.891   -81.239 -38.084 1.00 40.35  ? 348 VAL G CA    1 
ATOM   9237  C C     . VAL D  2 348 ? 4.666   -82.214 -38.954 1.00 44.88  ? 348 VAL G C     1 
ATOM   9238  O O     . VAL D  2 348 ? 4.529   -83.423 -38.787 1.00 44.74  ? 348 VAL G O     1 
ATOM   9239  C CB    . VAL D  2 348 ? 4.442   -81.209 -36.638 1.00 43.50  ? 348 VAL G CB    1 
ATOM   9240  C CG1   . VAL D  2 348 ? 5.901   -80.751 -36.613 1.00 43.46  ? 348 VAL G CG1   1 
ATOM   9241  C CG2   . VAL D  2 348 ? 3.577   -80.323 -35.741 1.00 43.26  ? 348 VAL G CG2   1 
ATOM   9242  N N     . TYR D  2 349 ? 5.487   -81.675 -39.867 1.00 41.39  ? 349 TYR G N     1 
ATOM   9243  C CA    . TYR D  2 349 ? 6.290   -82.420 -40.821 1.00 40.29  ? 349 TYR G CA    1 
ATOM   9244  C C     . TYR D  2 349 ? 7.669   -81.828 -40.881 1.00 46.79  ? 349 TYR G C     1 
ATOM   9245  O O     . TYR D  2 349 ? 7.809   -80.608 -40.956 1.00 46.93  ? 349 TYR G O     1 
ATOM   9246  C CB    . TYR D  2 349 ? 5.688   -82.314 -42.225 1.00 40.40  ? 349 TYR G CB    1 
ATOM   9247  C CG    . TYR D  2 349 ? 4.295   -82.870 -42.324 1.00 41.41  ? 349 TYR G CG    1 
ATOM   9248  C CD1   . TYR D  2 349 ? 4.046   -84.218 -42.093 1.00 43.29  ? 349 TYR G CD1   1 
ATOM   9249  C CD2   . TYR D  2 349 ? 3.214   -82.045 -42.579 1.00 41.39  ? 349 TYR G CD2   1 
ATOM   9250  C CE1   . TYR D  2 349 ? 2.748   -84.718 -42.078 1.00 42.48  ? 349 TYR G CE1   1 
ATOM   9251  C CE2   . TYR D  2 349 ? 1.918   -82.529 -42.560 1.00 42.28  ? 349 TYR G CE2   1 
ATOM   9252  C CZ    . TYR D  2 349 ? 1.682   -83.863 -42.268 1.00 48.58  ? 349 TYR G CZ    1 
ATOM   9253  O OH    . TYR D  2 349 ? 0.411   -84.379 -42.287 1.00 48.05  ? 349 TYR G OH    1 
ATOM   9254  N N     . THR D  2 350 ? 8.683   -82.676 -40.924 1.00 44.92  ? 350 THR G N     1 
ATOM   9255  C CA    . THR D  2 350 ? 10.048  -82.229 -41.086 1.00 45.33  ? 350 THR G CA    1 
ATOM   9256  C C     . THR D  2 350 ? 10.515  -82.523 -42.515 1.00 47.07  ? 350 THR G C     1 
ATOM   9257  O O     . THR D  2 350 ? 10.060  -83.487 -43.138 1.00 43.86  ? 350 THR G O     1 
ATOM   9258  C CB    . THR D  2 350 ? 10.929  -82.815 -40.048 1.00 47.17  ? 350 THR G CB    1 
ATOM   9259  O OG1   . THR D  2 350 ? 10.851  -84.230 -40.151 1.00 47.06  ? 350 THR G OG1   1 
ATOM   9260  C CG2   . THR D  2 350 ? 10.576  -82.333 -38.657 1.00 45.02  ? 350 THR G CG2   1 
ATOM   9261  N N     . LEU D  2 351 ? 11.356  -81.617 -43.054 1.00 45.02  ? 351 LEU G N     1 
ATOM   9262  C CA    . LEU D  2 351 ? 11.887  -81.720 -44.407 1.00 43.91  ? 351 LEU G CA    1 
ATOM   9263  C C     . LEU D  2 351 ? 13.389  -81.543 -44.367 1.00 46.19  ? 351 LEU G C     1 
ATOM   9264  O O     . LEU D  2 351 ? 13.886  -80.566 -43.798 1.00 45.26  ? 351 LEU G O     1 
ATOM   9265  C CB    . LEU D  2 351 ? 11.262  -80.673 -45.353 1.00 43.97  ? 351 LEU G CB    1 
ATOM   9266  C CG    . LEU D  2 351 ? 9.703   -80.557 -45.348 1.00 48.79  ? 351 LEU G CG    1 
ATOM   9267  C CD1   . LEU D  2 351 ? 9.224   -79.323 -46.123 1.00 49.29  ? 351 LEU G CD1   1 
ATOM   9268  C CD2   . LEU D  2 351 ? 9.087   -81.733 -45.969 1.00 55.19  ? 351 LEU G CD2   1 
ATOM   9269  N N     . PRO D  2 352 ? 14.140  -82.470 -44.995 1.00 42.83  ? 352 PRO G N     1 
ATOM   9270  C CA    . PRO D  2 352 ? 15.594  -82.320 -45.024 1.00 43.85  ? 352 PRO G CA    1 
ATOM   9271  C C     . PRO D  2 352 ? 16.051  -81.207 -45.965 1.00 51.19  ? 352 PRO G C     1 
ATOM   9272  O O     . PRO D  2 352 ? 15.265  -80.708 -46.791 1.00 50.03  ? 352 PRO G O     1 
ATOM   9273  C CB    . PRO D  2 352 ? 16.064  -83.675 -45.562 1.00 44.84  ? 352 PRO G CB    1 
ATOM   9274  C CG    . PRO D  2 352 ? 14.955  -84.167 -46.361 1.00 46.90  ? 352 PRO G CG    1 
ATOM   9275  C CD    . PRO D  2 352 ? 13.712  -83.681 -45.728 1.00 41.94  ? 352 PRO G CD    1 
ATOM   9276  N N     . PRO D  2 353 ? 17.353  -80.857 -45.919 1.00 51.28  ? 353 PRO G N     1 
ATOM   9277  C CA    . PRO D  2 353 ? 17.865  -79.870 -46.886 1.00 52.04  ? 353 PRO G CA    1 
ATOM   9278  C C     . PRO D  2 353 ? 17.637  -80.289 -48.345 1.00 56.85  ? 353 PRO G C     1 
ATOM   9279  O O     . PRO D  2 353 ? 17.579  -81.491 -48.648 1.00 56.62  ? 353 PRO G O     1 
ATOM   9280  C CB    . PRO D  2 353 ? 19.370  -79.820 -46.583 1.00 54.09  ? 353 PRO G CB    1 
ATOM   9281  C CG    . PRO D  2 353 ? 19.527  -80.358 -45.222 1.00 58.05  ? 353 PRO G CG    1 
ATOM   9282  C CD    . PRO D  2 353 ? 18.434  -81.374 -45.054 1.00 52.83  ? 353 PRO G CD    1 
ATOM   9283  N N     . SER D  2 354 ? 17.473  -79.289 -49.239 1.00 52.20  ? 354 SER G N     1 
ATOM   9284  C CA    . SER D  2 354 ? 17.414  -79.485 -50.693 1.00 51.64  ? 354 SER G CA    1 
ATOM   9285  C C     . SER D  2 354 ? 18.747  -80.106 -51.127 1.00 58.85  ? 354 SER G C     1 
ATOM   9286  O O     . SER D  2 354 ? 19.791  -79.795 -50.527 1.00 57.67  ? 354 SER G O     1 
ATOM   9287  C CB    . SER D  2 354 ? 17.286  -78.132 -51.402 1.00 55.77  ? 354 SER G CB    1 
ATOM   9288  O OG    . SER D  2 354 ? 17.396  -78.188 -52.821 1.00 59.25  ? 354 SER G OG    1 
ATOM   9289  N N     . GLN D  2 355 ? 18.738  -80.885 -52.221 1.00 59.12  ? 355 GLN G N     1 
ATOM   9290  C CA    . GLN D  2 355 ? 19.996  -81.467 -52.762 1.00 61.93  ? 355 GLN G CA    1 
ATOM   9291  C C     . GLN D  2 355 ? 20.920  -80.327 -53.179 1.00 65.11  ? 355 GLN G C     1 
ATOM   9292  O O     . GLN D  2 355 ? 22.111  -80.373 -52.895 1.00 66.97  ? 355 GLN G O     1 
ATOM   9293  C CB    . GLN D  2 355 ? 19.753  -82.398 -53.992 1.00 64.52  ? 355 GLN G CB    1 
ATOM   9294  C CG    . GLN D  2 355 ? 18.546  -83.368 -53.876 1.00 94.88  ? 355 GLN G CG    1 
ATOM   9295  C CD    . GLN D  2 355 ? 18.432  -84.340 -55.038 1.00 117.20 ? 355 GLN G CD    1 
ATOM   9296  O OE1   . GLN D  2 355 ? 18.922  -84.088 -56.150 1.00 113.51 ? 355 GLN G OE1   1 
ATOM   9297  N NE2   . GLN D  2 355 ? 17.728  -85.453 -54.820 1.00 106.16 ? 355 GLN G NE2   1 
ATOM   9298  N N     . GLU D  2 356 ? 20.353  -79.290 -53.822 1.00 59.91  ? 356 GLU G N     1 
ATOM   9299  C CA    . GLU D  2 356 ? 21.095  -78.113 -54.278 1.00 60.81  ? 356 GLU G CA    1 
ATOM   9300  C C     . GLU D  2 356 ? 21.757  -77.278 -53.170 1.00 63.68  ? 356 GLU G C     1 
ATOM   9301  O O     . GLU D  2 356 ? 22.736  -76.589 -53.444 1.00 64.49  ? 356 GLU G O     1 
ATOM   9302  C CB    . GLU D  2 356 ? 20.201  -77.207 -55.155 1.00 62.42  ? 356 GLU G CB    1 
ATOM   9303  C CG    . GLU D  2 356 ? 20.246  -77.543 -56.641 1.00 79.00  ? 356 GLU G CG    1 
ATOM   9304  C CD    . GLU D  2 356 ? 21.541  -77.154 -57.347 1.00 113.23 ? 356 GLU G CD    1 
ATOM   9305  O OE1   . GLU D  2 356 ? 21.951  -75.974 -57.235 1.00 108.49 ? 356 GLU G OE1   1 
ATOM   9306  O OE2   . GLU D  2 356 ? 22.146  -78.029 -58.012 1.00 108.41 ? 356 GLU G OE2   1 
ATOM   9307  N N     . GLU D  2 357 ? 21.231  -77.313 -51.945 1.00 60.05  ? 357 GLU G N     1 
ATOM   9308  C CA    . GLU D  2 357 ? 21.793  -76.551 -50.824 1.00 60.02  ? 357 GLU G CA    1 
ATOM   9309  C C     . GLU D  2 357 ? 22.986  -77.294 -50.174 1.00 67.83  ? 357 GLU G C     1 
ATOM   9310  O O     . GLU D  2 357 ? 23.707  -76.695 -49.377 1.00 68.99  ? 357 GLU G O     1 
ATOM   9311  C CB    . GLU D  2 357 ? 20.695  -76.273 -49.774 1.00 59.36  ? 357 GLU G CB    1 
ATOM   9312  C CG    . GLU D  2 357 ? 20.975  -75.094 -48.849 1.00 61.72  ? 357 GLU G CG    1 
ATOM   9313  C CD    . GLU D  2 357 ? 19.973  -74.888 -47.728 1.00 68.30  ? 357 GLU G CD    1 
ATOM   9314  O OE1   . GLU D  2 357 ? 19.317  -75.876 -47.328 1.00 58.27  ? 357 GLU G OE1   1 
ATOM   9315  O OE2   . GLU D  2 357 ? 19.871  -73.749 -47.215 1.00 58.75  ? 357 GLU G OE2   1 
ATOM   9316  N N     . MET D  2 358 ? 23.214  -78.574 -50.526 1.00 67.01  ? 358 MET G N     1 
ATOM   9317  C CA    . MET D  2 358 ? 24.307  -79.375 -49.957 1.00 69.61  ? 358 MET G CA    1 
ATOM   9318  C C     . MET D  2 358 ? 25.705  -78.923 -50.406 1.00 79.81  ? 358 MET G C     1 
ATOM   9319  O O     . MET D  2 358 ? 26.679  -79.280 -49.761 1.00 80.97  ? 358 MET G O     1 
ATOM   9320  C CB    . MET D  2 358 ? 24.102  -80.874 -50.254 1.00 70.94  ? 358 MET G CB    1 
ATOM   9321  C CG    . MET D  2 358 ? 22.879  -81.471 -49.578 1.00 71.68  ? 358 MET G CG    1 
ATOM   9322  S SD    . MET D  2 358 ? 22.934  -81.393 -47.759 1.00 75.82  ? 358 MET G SD    1 
ATOM   9323  C CE    . MET D  2 358 ? 24.224  -82.605 -47.398 1.00 74.34  ? 358 MET G CE    1 
ATOM   9324  N N     . THR D  2 359 ? 25.805  -78.094 -51.459 1.00 78.93  ? 359 THR G N     1 
ATOM   9325  C CA    . THR D  2 359 ? 27.090  -77.556 -51.903 1.00 80.81  ? 359 THR G CA    1 
ATOM   9326  C C     . THR D  2 359 ? 27.534  -76.410 -50.977 1.00 86.03  ? 359 THR G C     1 
ATOM   9327  O O     . THR D  2 359 ? 28.676  -75.975 -51.080 1.00 87.70  ? 359 THR G O     1 
ATOM   9328  C CB    . THR D  2 359 ? 26.998  -77.082 -53.358 1.00 90.77  ? 359 THR G CB    1 
ATOM   9329  O OG1   . THR D  2 359 ? 26.123  -75.950 -53.432 1.00 88.86  ? 359 THR G OG1   1 
ATOM   9330  C CG2   . THR D  2 359 ? 26.538  -78.195 -54.313 1.00 91.44  ? 359 THR G CG2   1 
ATOM   9331  N N     . LYS D  2 360 ? 26.640  -75.893 -50.109 1.00 81.66  ? 360 LYS G N     1 
ATOM   9332  C CA    . LYS D  2 360 ? 26.982  -74.813 -49.187 1.00 82.09  ? 360 LYS G CA    1 
ATOM   9333  C C     . LYS D  2 360 ? 27.562  -75.356 -47.861 1.00 86.31  ? 360 LYS G C     1 
ATOM   9334  O O     . LYS D  2 360 ? 27.390  -76.528 -47.525 1.00 85.38  ? 360 LYS G O     1 
ATOM   9335  C CB    . LYS D  2 360 ? 25.755  -73.915 -48.931 1.00 82.69  ? 360 LYS G CB    1 
ATOM   9336  C CG    . LYS D  2 360 ? 25.177  -73.273 -50.199 1.00 85.54  ? 360 LYS G CG    1 
ATOM   9337  C CD    . LYS D  2 360 ? 24.256  -72.071 -49.874 1.00 88.16  ? 360 LYS G CD    1 
ATOM   9338  C CE    . LYS D  2 360 ? 24.923  -70.730 -50.113 1.00 98.09  ? 360 LYS G CE    1 
ATOM   9339  N NZ    . LYS D  2 360 ? 24.920  -70.347 -51.553 1.00 104.40 ? 360 LYS G NZ    1 
ATOM   9340  N N     . ASN D  2 361 ? 28.268  -74.485 -47.128 1.00 84.13  ? 361 ASN G N     1 
ATOM   9341  C CA    . ASN D  2 361 ? 28.884  -74.832 -45.841 1.00 84.76  ? 361 ASN G CA    1 
ATOM   9342  C C     . ASN D  2 361 ? 27.806  -75.094 -44.778 1.00 84.23  ? 361 ASN G C     1 
ATOM   9343  O O     . ASN D  2 361 ? 27.953  -76.029 -43.986 1.00 82.46  ? 361 ASN G O     1 
ATOM   9344  C CB    . ASN D  2 361 ? 29.885  -73.723 -45.377 1.00 91.92  ? 361 ASN G CB    1 
ATOM   9345  C CG    . ASN D  2 361 ? 29.263  -72.382 -45.006 1.00 121.55 ? 361 ASN G CG    1 
ATOM   9346  O OD1   . ASN D  2 361 ? 28.175  -72.012 -45.483 1.00 119.09 ? 361 ASN G OD1   1 
ATOM   9347  N ND2   . ASN D  2 361 ? 29.931  -71.627 -44.138 1.00 111.75 ? 361 ASN G ND2   1 
ATOM   9348  N N     . GLN D  2 362 ? 26.730  -74.256 -44.772 1.00 78.38  ? 362 GLN G N     1 
ATOM   9349  C CA    . GLN D  2 362 ? 25.583  -74.395 -43.872 1.00 75.94  ? 362 GLN G CA    1 
ATOM   9350  C C     . GLN D  2 362 ? 24.344  -74.811 -44.676 1.00 73.99  ? 362 GLN G C     1 
ATOM   9351  O O     . GLN D  2 362 ? 24.175  -74.396 -45.830 1.00 73.42  ? 362 GLN G O     1 
ATOM   9352  C CB    . GLN D  2 362 ? 25.302  -73.096 -43.111 1.00 77.20  ? 362 GLN G CB    1 
ATOM   9353  C CG    . GLN D  2 362 ? 26.398  -72.706 -42.122 1.00 96.63  ? 362 GLN G CG    1 
ATOM   9354  C CD    . GLN D  2 362 ? 25.836  -71.981 -40.911 1.00 115.86 ? 362 GLN G CD    1 
ATOM   9355  O OE1   . GLN D  2 362 ? 25.571  -70.771 -40.948 1.00 111.02 ? 362 GLN G OE1   1 
ATOM   9356  N NE2   . GLN D  2 362 ? 25.611  -72.703 -39.813 1.00 106.18 ? 362 GLN G NE2   1 
ATOM   9357  N N     . VAL D  2 363 ? 23.488  -75.638 -44.055 1.00 65.35  ? 363 VAL G N     1 
ATOM   9358  C CA    . VAL D  2 363 ? 22.266  -76.183 -44.675 1.00 60.96  ? 363 VAL G CA    1 
ATOM   9359  C C     . VAL D  2 363 ? 21.052  -75.845 -43.833 1.00 57.98  ? 363 VAL G C     1 
ATOM   9360  O O     . VAL D  2 363 ? 21.193  -75.551 -42.653 1.00 55.90  ? 363 VAL G O     1 
ATOM   9361  C CB    . VAL D  2 363 ? 22.382  -77.708 -44.943 1.00 63.22  ? 363 VAL G CB    1 
ATOM   9362  C CG1   . VAL D  2 363 ? 23.508  -77.988 -45.916 1.00 63.33  ? 363 VAL G CG1   1 
ATOM   9363  C CG2   . VAL D  2 363 ? 22.559  -78.530 -43.655 1.00 63.08  ? 363 VAL G CG2   1 
ATOM   9364  N N     . SER D  2 364 ? 19.858  -75.917 -44.434 1.00 52.63  ? 364 SER G N     1 
ATOM   9365  C CA    . SER D  2 364 ? 18.601  -75.588 -43.750 1.00 50.61  ? 364 SER G CA    1 
ATOM   9366  C C     . SER D  2 364 ? 17.797  -76.829 -43.405 1.00 50.85  ? 364 SER G C     1 
ATOM   9367  O O     . SER D  2 364 ? 17.537  -77.650 -44.278 1.00 49.90  ? 364 SER G O     1 
ATOM   9368  C CB    . SER D  2 364 ? 17.729  -74.676 -44.623 1.00 51.85  ? 364 SER G CB    1 
ATOM   9369  O OG    . SER D  2 364 ? 18.367  -73.465 -44.994 1.00 53.09  ? 364 SER G OG    1 
ATOM   9370  N N     . LEU D  2 365 ? 17.360  -76.936 -42.154 1.00 47.57  ? 365 LEU G N     1 
ATOM   9371  C CA    . LEU D  2 365 ? 16.413  -77.971 -41.698 1.00 47.70  ? 365 LEU G CA    1 
ATOM   9372  C C     . LEU D  2 365 ? 15.046  -77.289 -41.585 1.00 47.39  ? 365 LEU G C     1 
ATOM   9373  O O     . LEU D  2 365 ? 14.914  -76.248 -40.942 1.00 43.42  ? 365 LEU G O     1 
ATOM   9374  C CB    . LEU D  2 365 ? 16.842  -78.587 -40.342 1.00 49.41  ? 365 LEU G CB    1 
ATOM   9375  C CG    . LEU D  2 365 ? 18.210  -79.318 -40.295 1.00 55.25  ? 365 LEU G CG    1 
ATOM   9376  C CD1   . LEU D  2 365 ? 18.242  -80.313 -39.162 1.00 55.88  ? 365 LEU G CD1   1 
ATOM   9377  C CD2   . LEU D  2 365 ? 18.500  -80.042 -41.590 1.00 55.03  ? 365 LEU G CD2   1 
ATOM   9378  N N     . THR D  2 366 ? 14.030  -77.856 -42.249 1.00 45.51  ? 366 THR G N     1 
ATOM   9379  C CA    . THR D  2 366 ? 12.709  -77.227 -42.343 1.00 42.67  ? 366 THR G CA    1 
ATOM   9380  C C     . THR D  2 366 ? 11.646  -77.990 -41.585 1.00 47.00  ? 366 THR G C     1 
ATOM   9381  O O     . THR D  2 366 ? 11.559  -79.224 -41.674 1.00 44.14  ? 366 THR G O     1 
ATOM   9382  C CB    . THR D  2 366 ? 12.354  -77.045 -43.827 1.00 43.63  ? 366 THR G CB    1 
ATOM   9383  O OG1   . THR D  2 366 ? 13.366  -76.251 -44.435 1.00 45.93  ? 366 THR G OG1   1 
ATOM   9384  C CG2   . THR D  2 366 ? 10.982  -76.389 -44.059 1.00 44.24  ? 366 THR G CG2   1 
ATOM   9385  N N     . CYS D  2 367 ? 10.800  -77.230 -40.871 1.00 45.42  ? 367 CYS G N     1 
ATOM   9386  C CA    . CYS D  2 367 ? 9.647   -77.774 -40.196 1.00 46.54  ? 367 CYS G CA    1 
ATOM   9387  C C     . CYS D  2 367 ? 8.372   -77.057 -40.684 1.00 45.50  ? 367 CYS G C     1 
ATOM   9388  O O     . CYS D  2 367 ? 8.247   -75.865 -40.478 1.00 43.83  ? 367 CYS G O     1 
ATOM   9389  C CB    . CYS D  2 367 ? 9.820   -77.639 -38.699 1.00 49.48  ? 367 CYS G CB    1 
ATOM   9390  S SG    . CYS D  2 367 ? 8.488   -78.383 -37.731 1.00 55.43  ? 367 CYS G SG    1 
ATOM   9391  N N     . LEU D  2 368 ? 7.462   -77.785 -41.361 1.00 40.61  ? 368 LEU G N     1 
ATOM   9392  C CA    . LEU D  2 368 ? 6.151   -77.300 -41.809 1.00 39.05  ? 368 LEU G CA    1 
ATOM   9393  C C     . LEU D  2 368 ? 5.133   -77.637 -40.736 1.00 42.25  ? 368 LEU G C     1 
ATOM   9394  O O     . LEU D  2 368 ? 5.068   -78.763 -40.269 1.00 42.22  ? 368 LEU G O     1 
ATOM   9395  C CB    . LEU D  2 368 ? 5.756   -77.905 -43.179 1.00 38.53  ? 368 LEU G CB    1 
ATOM   9396  C CG    . LEU D  2 368 ? 4.270   -77.799 -43.642 1.00 43.02  ? 368 LEU G CG    1 
ATOM   9397  C CD1   . LEU D  2 368 ? 3.778   -76.313 -43.780 1.00 41.78  ? 368 LEU G CD1   1 
ATOM   9398  C CD2   . LEU D  2 368 ? 4.077   -78.532 -44.973 1.00 45.97  ? 368 LEU G CD2   1 
ATOM   9399  N N     . VAL D  2 369 ? 4.384   -76.639 -40.296 1.00 41.03  ? 369 VAL G N     1 
ATOM   9400  C CA    . VAL D  2 369 ? 3.331   -76.771 -39.283 1.00 39.19  ? 369 VAL G CA    1 
ATOM   9401  C C     . VAL D  2 369 ? 2.065   -76.229 -39.939 1.00 41.74  ? 369 VAL G C     1 
ATOM   9402  O O     . VAL D  2 369 ? 2.027   -75.050 -40.299 1.00 40.86  ? 369 VAL G O     1 
ATOM   9403  C CB    . VAL D  2 369 ? 3.693   -76.054 -37.984 1.00 41.85  ? 369 VAL G CB    1 
ATOM   9404  C CG1   . VAL D  2 369 ? 2.642   -76.321 -36.912 1.00 42.97  ? 369 VAL G CG1   1 
ATOM   9405  C CG2   . VAL D  2 369 ? 5.056   -76.510 -37.533 1.00 42.31  ? 369 VAL G CG2   1 
ATOM   9406  N N     . LYS D  2 370 ? 1.107   -77.112 -40.217 1.00 37.00  ? 370 LYS G N     1 
ATOM   9407  C CA    . LYS D  2 370 ? -0.096  -76.760 -40.948 1.00 37.40  ? 370 LYS G CA    1 
ATOM   9408  C C     . LYS D  2 370 ? -1.383  -77.226 -40.329 1.00 40.62  ? 370 LYS G C     1 
ATOM   9409  O O     . LYS D  2 370 ? -1.405  -78.165 -39.542 1.00 41.33  ? 370 LYS G O     1 
ATOM   9410  C CB    . LYS D  2 370 ? 0.001   -77.275 -42.392 1.00 39.79  ? 370 LYS G CB    1 
ATOM   9411  C CG    . LYS D  2 370 ? -0.110  -78.781 -42.582 1.00 45.61  ? 370 LYS G CG    1 
ATOM   9412  C CD    . LYS D  2 370 ? -0.207  -79.172 -44.057 1.00 47.39  ? 370 LYS G CD    1 
ATOM   9413  C CE    . LYS D  2 370 ? -1.094  -80.380 -44.265 1.00 53.58  ? 370 LYS G CE    1 
ATOM   9414  N NZ    . LYS D  2 370 ? -1.218  -80.791 -45.687 1.00 63.67  ? 370 LYS G NZ    1 
ATOM   9415  N N     . GLY D  2 371 ? -2.455  -76.568 -40.717 1.00 36.81  ? 371 GLY G N     1 
ATOM   9416  C CA    . GLY D  2 371 ? -3.805  -76.942 -40.326 1.00 37.99  ? 371 GLY G CA    1 
ATOM   9417  C C     . GLY D  2 371 ? -4.273  -76.554 -38.940 1.00 44.99  ? 371 GLY G C     1 
ATOM   9418  O O     . GLY D  2 371 ? -5.302  -77.082 -38.502 1.00 45.90  ? 371 GLY G O     1 
ATOM   9419  N N     . PHE D  2 372 ? -3.607  -75.555 -38.288 1.00 40.41  ? 372 PHE G N     1 
ATOM   9420  C CA    . PHE D  2 372 ? -3.927  -75.146 -36.908 1.00 39.25  ? 372 PHE G CA    1 
ATOM   9421  C C     . PHE D  2 372 ? -4.813  -73.900 -36.800 1.00 41.37  ? 372 PHE G C     1 
ATOM   9422  O O     . PHE D  2 372 ? -4.778  -73.014 -37.637 1.00 40.14  ? 372 PHE G O     1 
ATOM   9423  C CB    . PHE D  2 372 ? -2.637  -74.967 -36.027 1.00 40.35  ? 372 PHE G CB    1 
ATOM   9424  C CG    . PHE D  2 372 ? -1.605  -73.942 -36.480 1.00 40.89  ? 372 PHE G CG    1 
ATOM   9425  C CD1   . PHE D  2 372 ? -0.634  -74.272 -37.418 1.00 42.33  ? 372 PHE G CD1   1 
ATOM   9426  C CD2   . PHE D  2 372 ? -1.597  -72.661 -35.958 1.00 42.20  ? 372 PHE G CD2   1 
ATOM   9427  C CE1   . PHE D  2 372 ? 0.320   -73.341 -37.816 1.00 42.05  ? 372 PHE G CE1   1 
ATOM   9428  C CE2   . PHE D  2 372 ? -0.633  -71.732 -36.355 1.00 44.31  ? 372 PHE G CE2   1 
ATOM   9429  C CZ    . PHE D  2 372 ? 0.283   -72.059 -37.317 1.00 41.16  ? 372 PHE G CZ    1 
ATOM   9430  N N     . TYR D  2 373 ? -5.596  -73.845 -35.717 1.00 38.14  ? 373 TYR G N     1 
ATOM   9431  C CA    . TYR D  2 373 ? -6.452  -72.707 -35.383 1.00 36.75  ? 373 TYR G CA    1 
ATOM   9432  C C     . TYR D  2 373 ? -6.640  -72.718 -33.866 1.00 44.57  ? 373 TYR G C     1 
ATOM   9433  O O     . TYR D  2 373 ? -6.909  -73.781 -33.344 1.00 44.03  ? 373 TYR G O     1 
ATOM   9434  C CB    . TYR D  2 373 ? -7.837  -72.791 -36.052 1.00 35.40  ? 373 TYR G CB    1 
ATOM   9435  C CG    . TYR D  2 373 ? -8.574  -71.485 -35.958 1.00 37.63  ? 373 TYR G CG    1 
ATOM   9436  C CD1   . TYR D  2 373 ? -9.312  -71.154 -34.821 1.00 41.67  ? 373 TYR G CD1   1 
ATOM   9437  C CD2   . TYR D  2 373 ? -8.457  -70.527 -36.955 1.00 38.10  ? 373 TYR G CD2   1 
ATOM   9438  C CE1   . TYR D  2 373 ? -9.905  -69.905 -34.683 1.00 40.85  ? 373 TYR G CE1   1 
ATOM   9439  C CE2   . TYR D  2 373 ? -9.040  -69.274 -36.824 1.00 39.03  ? 373 TYR G CE2   1 
ATOM   9440  C CZ    . TYR D  2 373 ? -9.812  -68.985 -35.713 1.00 45.41  ? 373 TYR G CZ    1 
ATOM   9441  O OH    . TYR D  2 373 ? -10.373 -67.732 -35.616 1.00 48.74  ? 373 TYR G OH    1 
ATOM   9442  N N     . PRO D  2 374 ? -6.573  -71.587 -33.134 1.00 44.09  ? 374 PRO G N     1 
ATOM   9443  C CA    . PRO D  2 374 ? -6.173  -70.236 -33.567 1.00 43.60  ? 374 PRO G CA    1 
ATOM   9444  C C     . PRO D  2 374 ? -4.681  -70.177 -33.960 1.00 46.15  ? 374 PRO G C     1 
ATOM   9445  O O     . PRO D  2 374 ? -4.027  -71.204 -34.068 1.00 43.88  ? 374 PRO G O     1 
ATOM   9446  C CB    . PRO D  2 374 ? -6.550  -69.367 -32.358 1.00 46.06  ? 374 PRO G CB    1 
ATOM   9447  C CG    . PRO D  2 374 ? -6.446  -70.258 -31.198 1.00 49.80  ? 374 PRO G CG    1 
ATOM   9448  C CD    . PRO D  2 374 ? -6.836  -71.630 -31.682 1.00 45.86  ? 374 PRO G CD    1 
ATOM   9449  N N     . SER D  2 375 ? -4.156  -68.995 -34.242 1.00 42.84  ? 375 SER G N     1 
ATOM   9450  C CA    . SER D  2 375 ? -2.784  -68.881 -34.722 1.00 42.52  ? 375 SER G CA    1 
ATOM   9451  C C     . SER D  2 375 ? -1.723  -68.834 -33.614 1.00 48.40  ? 375 SER G C     1 
ATOM   9452  O O     . SER D  2 375 ? -0.542  -68.900 -33.945 1.00 48.04  ? 375 SER G O     1 
ATOM   9453  C CB    . SER D  2 375 ? -2.636  -67.692 -35.665 1.00 42.45  ? 375 SER G CB    1 
ATOM   9454  O OG    . SER D  2 375 ? -2.747  -66.453 -34.995 1.00 46.37  ? 375 SER G OG    1 
ATOM   9455  N N     . ASP D  2 376 ? -2.134  -68.768 -32.326 1.00 47.02  ? 376 ASP G N     1 
ATOM   9456  C CA    . ASP D  2 376 ? -1.212  -68.765 -31.169 1.00 48.02  ? 376 ASP G CA    1 
ATOM   9457  C C     . ASP D  2 376 ? -0.483  -70.093 -31.105 1.00 52.12  ? 376 ASP G C     1 
ATOM   9458  O O     . ASP D  2 376 ? -1.098  -71.147 -31.007 1.00 52.29  ? 376 ASP G O     1 
ATOM   9459  C CB    . ASP D  2 376 ? -1.958  -68.526 -29.858 1.00 50.92  ? 376 ASP G CB    1 
ATOM   9460  C CG    . ASP D  2 376 ? -2.681  -67.192 -29.879 1.00 70.33  ? 376 ASP G CG    1 
ATOM   9461  O OD1   . ASP D  2 376 ? -1.988  -66.138 -30.030 1.00 70.04  ? 376 ASP G OD1   1 
ATOM   9462  O OD2   . ASP D  2 376 ? -3.948  -67.201 -29.870 1.00 77.01  ? 376 ASP G OD2   1 
ATOM   9463  N N     . ILE D  2 377 ? 0.825   -70.046 -31.259 1.00 48.14  ? 377 ILE G N     1 
ATOM   9464  C CA    . ILE D  2 377 ? 1.629   -71.259 -31.324 1.00 46.77  ? 377 ILE G CA    1 
ATOM   9465  C C     . ILE D  2 377 ? 3.064   -70.890 -30.936 1.00 48.96  ? 377 ILE G C     1 
ATOM   9466  O O     . ILE D  2 377 ? 3.446   -69.723 -31.000 1.00 45.91  ? 377 ILE G O     1 
ATOM   9467  C CB    . ILE D  2 377 ? 1.540   -71.828 -32.774 1.00 47.47  ? 377 ILE G CB    1 
ATOM   9468  C CG1   . ILE D  2 377 ? 2.015   -73.284 -32.878 1.00 47.51  ? 377 ILE G CG1   1 
ATOM   9469  C CG2   . ILE D  2 377 ? 2.284   -70.927 -33.773 1.00 45.16  ? 377 ILE G CG2   1 
ATOM   9470  C CD1   . ILE D  2 377 ? 1.495   -73.969 -34.112 1.00 47.88  ? 377 ILE G CD1   1 
ATOM   9471  N N     . ALA D  2 378 ? 3.820   -71.883 -30.500 1.00 47.66  ? 378 ALA G N     1 
ATOM   9472  C CA    . ALA D  2 378 ? 5.232   -71.725 -30.176 1.00 48.69  ? 378 ALA G CA    1 
ATOM   9473  C C     . ALA D  2 378 ? 5.938   -72.890 -30.833 1.00 50.43  ? 378 ALA G C     1 
ATOM   9474  O O     . ALA D  2 378 ? 5.486   -74.033 -30.702 1.00 48.58  ? 378 ALA G O     1 
ATOM   9475  C CB    . ALA D  2 378 ? 5.441   -71.744 -28.649 1.00 50.65  ? 378 ALA G CB    1 
ATOM   9476  N N     . VAL D  2 379 ? 7.026   -72.605 -31.556 1.00 46.91  ? 379 VAL G N     1 
ATOM   9477  C CA    . VAL D  2 379 ? 7.810   -73.622 -32.246 1.00 45.77  ? 379 VAL G CA    1 
ATOM   9478  C C     . VAL D  2 379 ? 9.275   -73.503 -31.801 1.00 52.87  ? 379 VAL G C     1 
ATOM   9479  O O     . VAL D  2 379 ? 9.753   -72.400 -31.596 1.00 52.27  ? 379 VAL G O     1 
ATOM   9480  C CB    . VAL D  2 379 ? 7.614   -73.571 -33.788 1.00 47.30  ? 379 VAL G CB    1 
ATOM   9481  C CG1   . VAL D  2 379 ? 8.398   -74.689 -34.475 1.00 47.38  ? 379 VAL G CG1   1 
ATOM   9482  C CG2   . VAL D  2 379 ? 6.129   -73.663 -34.153 1.00 45.81  ? 379 VAL G CG2   1 
ATOM   9483  N N     . GLU D  2 380 ? 9.945   -74.651 -31.544 1.00 52.60  ? 380 GLU G N     1 
ATOM   9484  C CA    . GLU D  2 380 ? 11.345  -74.690 -31.106 1.00 54.16  ? 380 GLU G CA    1 
ATOM   9485  C C     . GLU D  2 380 ? 12.075  -75.838 -31.758 1.00 56.57  ? 380 GLU G C     1 
ATOM   9486  O O     . GLU D  2 380 ? 11.452  -76.778 -32.212 1.00 52.91  ? 380 GLU G O     1 
ATOM   9487  C CB    . GLU D  2 380 ? 11.473  -74.897 -29.581 1.00 57.35  ? 380 GLU G CB    1 
ATOM   9488  C CG    . GLU D  2 380 ? 10.704  -73.929 -28.696 1.00 75.09  ? 380 GLU G CG    1 
ATOM   9489  C CD    . GLU D  2 380 ? 10.856  -74.202 -27.208 1.00 99.20  ? 380 GLU G CD    1 
ATOM   9490  O OE1   . GLU D  2 380 ? 11.608  -75.134 -26.836 1.00 91.05  ? 380 GLU G OE1   1 
ATOM   9491  O OE2   . GLU D  2 380 ? 10.212  -73.484 -26.411 1.00 93.25  ? 380 GLU G OE2   1 
ATOM   9492  N N     . TRP D  2 381 ? 13.410  -75.817 -31.684 1.00 58.65  ? 381 TRP G N     1 
ATOM   9493  C CA    . TRP D  2 381 ? 14.236  -76.907 -32.189 1.00 60.13  ? 381 TRP G CA    1 
ATOM   9494  C C     . TRP D  2 381 ? 15.127  -77.444 -31.096 1.00 68.08  ? 381 TRP G C     1 
ATOM   9495  O O     . TRP D  2 381 ? 15.514  -76.711 -30.189 1.00 67.82  ? 381 TRP G O     1 
ATOM   9496  C CB    . TRP D  2 381 ? 15.077  -76.470 -33.378 1.00 58.01  ? 381 TRP G CB    1 
ATOM   9497  C CG    . TRP D  2 381 ? 14.303  -76.256 -34.640 1.00 56.94  ? 381 TRP G CG    1 
ATOM   9498  C CD1   . TRP D  2 381 ? 13.734  -75.094 -35.050 1.00 58.86  ? 381 TRP G CD1   1 
ATOM   9499  C CD2   . TRP D  2 381 ? 14.168  -77.176 -35.733 1.00 56.09  ? 381 TRP G CD2   1 
ATOM   9500  N NE1   . TRP D  2 381 ? 13.210  -75.242 -36.311 1.00 57.09  ? 381 TRP G NE1   1 
ATOM   9501  C CE2   . TRP D  2 381 ? 13.509  -76.491 -36.776 1.00 58.44  ? 381 TRP G CE2   1 
ATOM   9502  C CE3   . TRP D  2 381 ? 14.604  -78.486 -35.962 1.00 57.78  ? 381 TRP G CE3   1 
ATOM   9503  C CZ2   . TRP D  2 381 ? 13.297  -77.058 -38.029 1.00 56.83  ? 381 TRP G CZ2   1 
ATOM   9504  C CZ3   . TRP D  2 381 ? 14.371  -79.055 -37.203 1.00 58.63  ? 381 TRP G CZ3   1 
ATOM   9505  C CH2   . TRP D  2 381 ? 13.703  -78.348 -38.213 1.00 58.07  ? 381 TRP G CH2   1 
ATOM   9506  N N     . GLU D  2 382 ? 15.429  -78.739 -31.179 1.00 68.90  ? 382 GLU G N     1 
ATOM   9507  C CA    . GLU D  2 382 ? 16.332  -79.451 -30.262 1.00 71.36  ? 382 GLU G CA    1 
ATOM   9508  C C     . GLU D  2 382 ? 17.281  -80.331 -31.100 1.00 79.58  ? 382 GLU G C     1 
ATOM   9509  O O     . GLU D  2 382 ? 16.931  -80.735 -32.206 1.00 76.09  ? 382 GLU G O     1 
ATOM   9510  C CB    . GLU D  2 382 ? 15.540  -80.326 -29.249 1.00 73.08  ? 382 GLU G CB    1 
ATOM   9511  C CG    . GLU D  2 382 ? 14.802  -79.568 -28.145 1.00 81.99  ? 382 GLU G CG    1 
ATOM   9512  C CD    . GLU D  2 382 ? 13.543  -78.810 -28.546 1.00 101.01 ? 382 GLU G CD    1 
ATOM   9513  O OE1   . GLU D  2 382 ? 12.720  -79.377 -29.303 1.00 92.96  ? 382 GLU G OE1   1 
ATOM   9514  O OE2   . GLU D  2 382 ? 13.365  -77.658 -28.081 1.00 86.57  ? 382 GLU G OE2   1 
ATOM   9515  N N     . SER D  2 383 ? 18.486  -80.601 -30.587 1.00 84.10  ? 383 SER G N     1 
ATOM   9516  C CA    . SER D  2 383 ? 19.468  -81.467 -31.253 1.00 87.21  ? 383 SER G CA    1 
ATOM   9517  C C     . SER D  2 383 ? 19.873  -82.574 -30.270 1.00 97.95  ? 383 SER G C     1 
ATOM   9518  O O     . SER D  2 383 ? 20.307  -82.253 -29.163 1.00 98.71  ? 383 SER G O     1 
ATOM   9519  C CB    . SER D  2 383 ? 20.686  -80.659 -31.687 1.00 92.11  ? 383 SER G CB    1 
ATOM   9520  O OG    . SER D  2 383 ? 21.681  -81.495 -32.254 1.00 103.94 ? 383 SER G OG    1 
ATOM   9521  N N     . ASN D  2 384 ? 19.693  -83.862 -30.664 1.00 98.39  ? 384 ASN G N     1 
ATOM   9522  C CA    . ASN D  2 384 ? 20.000  -85.067 -29.865 1.00 101.71 ? 384 ASN G CA    1 
ATOM   9523  C C     . ASN D  2 384 ? 19.234  -85.131 -28.523 1.00 111.02 ? 384 ASN G C     1 
ATOM   9524  O O     . ASN D  2 384 ? 18.305  -85.936 -28.383 1.00 111.35 ? 384 ASN G O     1 
ATOM   9525  C CB    . ASN D  2 384 ? 21.522  -85.248 -29.645 1.00 102.12 ? 384 ASN G CB    1 
ATOM   9526  C CG    . ASN D  2 384 ? 22.295  -85.544 -30.906 1.00 113.19 ? 384 ASN G CG    1 
ATOM   9527  O OD1   . ASN D  2 384 ? 23.161  -84.762 -31.315 1.00 108.88 ? 384 ASN G OD1   1 
ATOM   9528  N ND2   . ASN D  2 384 ? 22.021  -86.685 -31.538 1.00 96.19  ? 384 ASN G ND2   1 
ATOM   9529  N N     . GLY D  2 385 ? 19.655  -84.314 -27.556 1.00 109.99 ? 385 GLY G N     1 
ATOM   9530  C CA    . GLY D  2 385 ? 19.022  -84.207 -26.246 1.00 110.63 ? 385 GLY G CA    1 
ATOM   9531  C C     . GLY D  2 385 ? 19.295  -82.861 -25.598 1.00 113.98 ? 385 GLY G C     1 
ATOM   9532  O O     . GLY D  2 385 ? 19.707  -82.820 -24.431 1.00 115.39 ? 385 GLY G O     1 
ATOM   9533  N N     . GLN D  2 386 ? 19.095  -81.743 -26.364 1.00 106.81 ? 386 GLN G N     1 
ATOM   9534  C CA    . GLN D  2 386 ? 19.360  -80.370 -25.883 1.00 106.05 ? 386 GLN G CA    1 
ATOM   9535  C C     . GLN D  2 386 ? 18.809  -79.289 -26.849 1.00 104.92 ? 386 GLN G C     1 
ATOM   9536  O O     . GLN D  2 386 ? 18.721  -79.546 -28.046 1.00 102.72 ? 386 GLN G O     1 
ATOM   9537  C CB    . GLN D  2 386 ? 20.876  -80.151 -25.682 1.00 108.96 ? 386 GLN G CB    1 
ATOM   9538  N N     . PRO D  2 387 ? 18.489  -78.064 -26.363 1.00 99.57  ? 387 PRO G N     1 
ATOM   9539  C CA    . PRO D  2 387 ? 17.938  -77.031 -27.260 1.00 96.80  ? 387 PRO G CA    1 
ATOM   9540  C C     . PRO D  2 387 ? 18.919  -76.405 -28.250 1.00 97.54  ? 387 PRO G C     1 
ATOM   9541  O O     . PRO D  2 387 ? 20.115  -76.282 -27.966 1.00 97.65  ? 387 PRO G O     1 
ATOM   9542  C CB    . PRO D  2 387 ? 17.376  -75.985 -26.289 1.00 98.67  ? 387 PRO G CB    1 
ATOM   9543  C CG    . PRO D  2 387 ? 18.222  -76.103 -25.096 1.00 105.55 ? 387 PRO G CG    1 
ATOM   9544  C CD    . PRO D  2 387 ? 18.549  -77.574 -24.970 1.00 102.34 ? 387 PRO G CD    1 
ATOM   9545  N N     . GLU D  2 388 ? 18.369  -75.965 -29.407 1.00 90.50  ? 388 GLU G N     1 
ATOM   9546  C CA    . GLU D  2 388 ? 19.105  -75.308 -30.488 1.00 88.79  ? 388 GLU G CA    1 
ATOM   9547  C C     . GLU D  2 388 ? 18.877  -73.789 -30.441 1.00 89.85  ? 388 GLU G C     1 
ATOM   9548  O O     . GLU D  2 388 ? 18.064  -73.310 -29.648 1.00 88.77  ? 388 GLU G O     1 
ATOM   9549  C CB    . GLU D  2 388 ? 18.696  -75.894 -31.850 1.00 88.90  ? 388 GLU G CB    1 
ATOM   9550  C CG    . GLU D  2 388 ? 19.551  -77.077 -32.276 1.00 98.03  ? 388 GLU G CG    1 
ATOM   9551  C CD    . GLU D  2 388 ? 20.937  -76.733 -32.793 1.00 116.79 ? 388 GLU G CD    1 
ATOM   9552  O OE1   . GLU D  2 388 ? 21.669  -77.679 -33.161 1.00 116.64 ? 388 GLU G OE1   1 
ATOM   9553  O OE2   . GLU D  2 388 ? 21.295  -75.532 -32.831 1.00 103.58 ? 388 GLU G OE2   1 
ATOM   9554  N N     . ASN D  2 389 ? 19.633  -73.036 -31.265 1.00 84.55  ? 389 ASN G N     1 
ATOM   9555  C CA    . ASN D  2 389 ? 19.575  -71.570 -31.291 1.00 82.62  ? 389 ASN G CA    1 
ATOM   9556  C C     . ASN D  2 389 ? 19.431  -70.954 -32.678 1.00 80.37  ? 389 ASN G C     1 
ATOM   9557  O O     . ASN D  2 389 ? 18.630  -70.021 -32.837 1.00 79.79  ? 389 ASN G O     1 
ATOM   9558  C CB    . ASN D  2 389 ? 20.839  -70.988 -30.636 1.00 88.27  ? 389 ASN G CB    1 
ATOM   9559  C CG    . ASN D  2 389 ? 20.852  -71.104 -29.132 1.00 110.86 ? 389 ASN G CG    1 
ATOM   9560  O OD1   . ASN D  2 389 ? 20.216  -70.306 -28.430 1.00 104.59 ? 389 ASN G OD1   1 
ATOM   9561  N ND2   . ASN D  2 389 ? 21.574  -72.096 -28.603 1.00 100.93 ? 389 ASN G ND2   1 
ATOM   9562  N N     . ASN D  2 390 ? 20.223  -71.411 -33.668 1.00 71.93  ? 390 ASN G N     1 
ATOM   9563  C CA    . ASN D  2 390 ? 20.216  -70.798 -35.009 1.00 68.83  ? 390 ASN G CA    1 
ATOM   9564  C C     . ASN D  2 390 ? 18.955  -71.185 -35.836 1.00 63.73  ? 390 ASN G C     1 
ATOM   9565  O O     . ASN D  2 390 ? 19.070  -71.853 -36.867 1.00 60.77  ? 390 ASN G O     1 
ATOM   9566  C CB    . ASN D  2 390 ? 21.547  -71.097 -35.766 1.00 71.50  ? 390 ASN G CB    1 
ATOM   9567  C CG    . ASN D  2 390 ? 22.142  -69.943 -36.550 1.00 106.77 ? 390 ASN G CG    1 
ATOM   9568  O OD1   . ASN D  2 390 ? 23.369  -69.816 -36.623 1.00 114.42 ? 390 ASN G OD1   1 
ATOM   9569  N ND2   . ASN D  2 390 ? 21.330  -69.097 -37.203 1.00 91.58  ? 390 ASN G ND2   1 
ATOM   9570  N N     . TYR D  2 391 ? 17.752  -70.716 -35.382 1.00 56.01  ? 391 TYR G N     1 
ATOM   9571  C CA    . TYR D  2 391 ? 16.492  -70.944 -36.072 1.00 52.43  ? 391 TYR G CA    1 
ATOM   9572  C C     . TYR D  2 391 ? 15.630  -69.708 -36.058 1.00 52.18  ? 391 TYR G C     1 
ATOM   9573  O O     . TYR D  2 391 ? 15.652  -68.921 -35.112 1.00 49.57  ? 391 TYR G O     1 
ATOM   9574  C CB    . TYR D  2 391 ? 15.702  -72.183 -35.562 1.00 53.13  ? 391 TYR G CB    1 
ATOM   9575  C CG    . TYR D  2 391 ? 15.081  -72.033 -34.195 1.00 55.13  ? 391 TYR G CG    1 
ATOM   9576  C CD1   . TYR D  2 391 ? 13.836  -71.440 -34.036 1.00 55.01  ? 391 TYR G CD1   1 
ATOM   9577  C CD2   . TYR D  2 391 ? 15.674  -72.601 -33.075 1.00 57.85  ? 391 TYR G CD2   1 
ATOM   9578  C CE1   . TYR D  2 391 ? 13.275  -71.268 -32.779 1.00 56.21  ? 391 TYR G CE1   1 
ATOM   9579  C CE2   . TYR D  2 391 ? 15.093  -72.489 -31.816 1.00 59.34  ? 391 TYR G CE2   1 
ATOM   9580  C CZ    . TYR D  2 391 ? 13.891  -71.813 -31.669 1.00 67.85  ? 391 TYR G CZ    1 
ATOM   9581  O OH    . TYR D  2 391 ? 13.288  -71.685 -30.434 1.00 73.76  ? 391 TYR G OH    1 
ATOM   9582  N N     . LYS D  2 392 ? 14.847  -69.565 -37.126 1.00 48.47  ? 392 LYS G N     1 
ATOM   9583  C CA    . LYS D  2 392 ? 13.899  -68.482 -37.340 1.00 46.94  ? 392 LYS G CA    1 
ATOM   9584  C C     . LYS D  2 392 ? 12.590  -69.118 -37.791 1.00 47.85  ? 392 LYS G C     1 
ATOM   9585  O O     . LYS D  2 392 ? 12.572  -70.069 -38.588 1.00 44.69  ? 392 LYS G O     1 
ATOM   9586  C CB    . LYS D  2 392 ? 14.404  -67.540 -38.437 1.00 49.75  ? 392 LYS G CB    1 
ATOM   9587  C CG    . LYS D  2 392 ? 15.699  -66.812 -38.147 1.00 53.86  ? 392 LYS G CG    1 
ATOM   9588  C CD    . LYS D  2 392 ? 15.524  -65.653 -37.210 1.00 61.03  ? 392 LYS G CD    1 
ATOM   9589  C CE    . LYS D  2 392 ? 16.850  -65.035 -36.835 1.00 67.42  ? 392 LYS G CE    1 
ATOM   9590  N NZ    . LYS D  2 392 ? 16.645  -63.778 -36.077 1.00 79.38  ? 392 LYS G NZ    1 
ATOM   9591  N N     . THR D  2 393 ? 11.494  -68.621 -37.250 1.00 44.66  ? 393 THR G N     1 
ATOM   9592  C CA    . THR D  2 393 ? 10.165  -69.119 -37.590 1.00 42.10  ? 393 THR G CA    1 
ATOM   9593  C C     . THR D  2 393 ? 9.424   -68.012 -38.273 1.00 42.89  ? 393 THR G C     1 
ATOM   9594  O O     . THR D  2 393 ? 9.475   -66.875 -37.805 1.00 41.64  ? 393 THR G O     1 
ATOM   9595  C CB    . THR D  2 393 ? 9.460   -69.630 -36.310 1.00 47.65  ? 393 THR G CB    1 
ATOM   9596  O OG1   . THR D  2 393 ? 10.289  -70.625 -35.673 1.00 51.90  ? 393 THR G OG1   1 
ATOM   9597  C CG2   . THR D  2 393 ? 8.080   -70.203 -36.589 1.00 41.68  ? 393 THR G CG2   1 
ATOM   9598  N N     . THR D  2 394 ? 8.643   -68.352 -39.303 1.00 38.41  ? 394 THR G N     1 
ATOM   9599  C CA    . THR D  2 394 ? 7.853   -67.363 -40.022 1.00 37.16  ? 394 THR G CA    1 
ATOM   9600  C C     . THR D  2 394 ? 6.596   -67.088 -39.222 1.00 43.77  ? 394 THR G C     1 
ATOM   9601  O O     . THR D  2 394 ? 6.168   -67.935 -38.431 1.00 44.98  ? 394 THR G O     1 
ATOM   9602  C CB    . THR D  2 394 ? 7.432   -67.871 -41.443 1.00 37.80  ? 394 THR G CB    1 
ATOM   9603  O OG1   . THR D  2 394 ? 6.399   -68.842 -41.326 1.00 38.59  ? 394 THR G OG1   1 
ATOM   9604  C CG2   . THR D  2 394 ? 8.616   -68.473 -42.274 1.00 38.88  ? 394 THR G CG2   1 
ATOM   9605  N N     . PRO D  2 395 ? 5.949   -65.929 -39.432 1.00 39.50  ? 395 PRO G N     1 
ATOM   9606  C CA    . PRO D  2 395 ? 4.635   -65.736 -38.838 1.00 39.30  ? 395 PRO G CA    1 
ATOM   9607  C C     . PRO D  2 395 ? 3.618   -66.772 -39.387 1.00 44.21  ? 395 PRO G C     1 
ATOM   9608  O O     . PRO D  2 395 ? 3.771   -67.202 -40.539 1.00 41.60  ? 395 PRO G O     1 
ATOM   9609  C CB    . PRO D  2 395 ? 4.209   -64.355 -39.364 1.00 39.70  ? 395 PRO G CB    1 
ATOM   9610  C CG    . PRO D  2 395 ? 5.405   -63.737 -39.850 1.00 44.24  ? 395 PRO G CG    1 
ATOM   9611  C CD    . PRO D  2 395 ? 6.293   -64.812 -40.326 1.00 40.50  ? 395 PRO G CD    1 
ATOM   9612  N N     . PRO D  2 396 ? 2.491   -67.019 -38.657 1.00 40.96  ? 396 PRO G N     1 
ATOM   9613  C CA    . PRO D  2 396 ? 1.408   -67.873 -39.196 1.00 39.25  ? 396 PRO G CA    1 
ATOM   9614  C C     . PRO D  2 396 ? 0.731   -67.248 -40.417 1.00 40.19  ? 396 PRO G C     1 
ATOM   9615  O O     . PRO D  2 396 ? 0.516   -66.059 -40.430 1.00 39.42  ? 396 PRO G O     1 
ATOM   9616  C CB    . PRO D  2 396 ? 0.420   -67.973 -38.032 1.00 41.43  ? 396 PRO G CB    1 
ATOM   9617  C CG    . PRO D  2 396 ? 1.126   -67.524 -36.868 1.00 46.90  ? 396 PRO G CG    1 
ATOM   9618  C CD    . PRO D  2 396 ? 2.171   -66.555 -37.302 1.00 42.38  ? 396 PRO G CD    1 
ATOM   9619  N N     . VAL D  2 397 ? 0.379   -68.039 -41.417 1.00 37.03  ? 397 VAL G N     1 
ATOM   9620  C CA    . VAL D  2 397 ? -0.272  -67.549 -42.633 1.00 36.38  ? 397 VAL G CA    1 
ATOM   9621  C C     . VAL D  2 397 ? -1.617  -68.217 -42.741 1.00 38.85  ? 397 VAL G C     1 
ATOM   9622  O O     . VAL D  2 397 ? -1.699  -69.417 -42.560 1.00 37.01  ? 397 VAL G O     1 
ATOM   9623  C CB    . VAL D  2 397 ? 0.559   -67.850 -43.913 1.00 40.00  ? 397 VAL G CB    1 
ATOM   9624  C CG1   . VAL D  2 397 ? -0.133  -67.361 -45.171 1.00 39.13  ? 397 VAL G CG1   1 
ATOM   9625  C CG2   . VAL D  2 397 ? 1.945   -67.264 -43.814 1.00 40.58  ? 397 VAL G CG2   1 
ATOM   9626  N N     . LEU D  2 398 ? -2.660  -67.453 -43.073 1.00 36.87  ? 398 LEU G N     1 
ATOM   9627  C CA    . LEU D  2 398 ? -3.984  -68.017 -43.244 1.00 37.11  ? 398 LEU G CA    1 
ATOM   9628  C C     . LEU D  2 398 ? -4.099  -68.707 -44.608 1.00 42.38  ? 398 LEU G C     1 
ATOM   9629  O O     . LEU D  2 398 ? -3.900  -68.096 -45.643 1.00 41.79  ? 398 LEU G O     1 
ATOM   9630  C CB    . LEU D  2 398 ? -5.030  -66.916 -43.118 1.00 37.39  ? 398 LEU G CB    1 
ATOM   9631  C CG    . LEU D  2 398 ? -6.505  -67.336 -43.137 1.00 41.25  ? 398 LEU G CG    1 
ATOM   9632  C CD1   . LEU D  2 398 ? -6.832  -68.264 -42.025 1.00 38.32  ? 398 LEU G CD1   1 
ATOM   9633  C CD2   . LEU D  2 398 ? -7.384  -66.117 -43.102 1.00 45.97  ? 398 LEU G CD2   1 
ATOM   9634  N N     . ASP D  2 399 ? -4.461  -69.974 -44.588 1.00 40.22  ? 399 ASP G N     1 
ATOM   9635  C CA    . ASP D  2 399 ? -4.695  -70.771 -45.761 1.00 38.92  ? 399 ASP G CA    1 
ATOM   9636  C C     . ASP D  2 399 ? -6.120  -70.615 -46.282 1.00 39.17  ? 399 ASP G C     1 
ATOM   9637  O O     . ASP D  2 399 ? -7.004  -70.133 -45.577 1.00 37.21  ? 399 ASP G O     1 
ATOM   9638  C CB    . ASP D  2 399 ? -4.457  -72.256 -45.419 1.00 42.79  ? 399 ASP G CB    1 
ATOM   9639  C CG    . ASP D  2 399 ? -3.553  -72.937 -46.399 1.00 57.37  ? 399 ASP G CG    1 
ATOM   9640  O OD1   . ASP D  2 399 ? -3.526  -72.516 -47.584 1.00 61.61  ? 399 ASP G OD1   1 
ATOM   9641  O OD2   . ASP D  2 399 ? -2.880  -73.882 -46.000 1.00 57.67  ? 399 ASP G OD2   1 
ATOM   9642  N N     . SER D  2 400 ? -6.370  -71.155 -47.472 1.00 37.55  ? 400 SER G N     1 
ATOM   9643  C CA    . SER D  2 400 ? -7.700  -71.084 -48.115 1.00 37.43  ? 400 SER G CA    1 
ATOM   9644  C C     . SER D  2 400 ? -8.785  -71.915 -47.400 1.00 39.85  ? 400 SER G C     1 
ATOM   9645  O O     . SER D  2 400 ? -9.949  -71.670 -47.632 1.00 40.49  ? 400 SER G O     1 
ATOM   9646  C CB    . SER D  2 400 ? -7.605  -71.506 -49.569 1.00 39.19  ? 400 SER G CB    1 
ATOM   9647  O OG    . SER D  2 400 ? -7.212  -72.870 -49.641 1.00 49.11  ? 400 SER G OG    1 
ATOM   9648  N N     . ASP D  2 401 ? -8.407  -72.830 -46.482 1.00 36.85  ? 401 ASP G N     1 
ATOM   9649  C CA    . ASP D  2 401 ? -9.353  -73.644 -45.730 1.00 36.50  ? 401 ASP G CA    1 
ATOM   9650  C C     . ASP D  2 401 ? -9.691  -73.061 -44.334 1.00 41.18  ? 401 ASP G C     1 
ATOM   9651  O O     . ASP D  2 401 ? -10.338 -73.739 -43.545 1.00 40.39  ? 401 ASP G O     1 
ATOM   9652  C CB    . ASP D  2 401 ? -8.861  -75.102 -45.651 1.00 36.83  ? 401 ASP G CB    1 
ATOM   9653  C CG    . ASP D  2 401 ? -7.739  -75.376 -44.671 1.00 47.21  ? 401 ASP G CG    1 
ATOM   9654  O OD1   . ASP D  2 401 ? -6.995  -74.433 -44.336 1.00 48.25  ? 401 ASP G OD1   1 
ATOM   9655  O OD2   . ASP D  2 401 ? -7.597  -76.529 -44.249 1.00 53.32  ? 401 ASP G OD2   1 
ATOM   9656  N N     . GLY D  2 402 ? -9.246  -71.839 -44.026 1.00 36.79  ? 402 GLY G N     1 
ATOM   9657  C CA    . GLY D  2 402 ? -9.581  -71.201 -42.758 1.00 34.77  ? 402 GLY G CA    1 
ATOM   9658  C C     . GLY D  2 402 ? -8.637  -71.539 -41.629 1.00 38.03  ? 402 GLY G C     1 
ATOM   9659  O O     . GLY D  2 402 ? -8.806  -71.020 -40.535 1.00 39.98  ? 402 GLY G O     1 
ATOM   9660  N N     . SER D  2 403 ? -7.607  -72.331 -41.888 1.00 35.25  ? 403 SER G N     1 
ATOM   9661  C CA    . SER D  2 403 ? -6.588  -72.716 -40.906 1.00 34.39  ? 403 SER G CA    1 
ATOM   9662  C C     . SER D  2 403 ? -5.252  -71.986 -41.208 1.00 39.93  ? 403 SER G C     1 
ATOM   9663  O O     . SER D  2 403 ? -5.117  -71.374 -42.263 1.00 39.54  ? 403 SER G O     1 
ATOM   9664  C CB    . SER D  2 403 ? -6.401  -74.225 -40.942 1.00 34.98  ? 403 SER G CB    1 
ATOM   9665  O OG    . SER D  2 403 ? -5.560  -74.686 -41.978 1.00 42.13  ? 403 SER G OG    1 
ATOM   9666  N N     . PHE D  2 404 ? -4.289  -72.041 -40.282 1.00 38.04  ? 404 PHE G N     1 
ATOM   9667  C CA    . PHE D  2 404 ? -2.950  -71.437 -40.463 1.00 37.33  ? 404 PHE G CA    1 
ATOM   9668  C C     . PHE D  2 404 ? -1.859  -72.456 -40.692 1.00 39.98  ? 404 PHE G C     1 
ATOM   9669  O O     . PHE D  2 404 ? -1.951  -73.585 -40.222 1.00 40.29  ? 404 PHE G O     1 
ATOM   9670  C CB    . PHE D  2 404 ? -2.536  -70.607 -39.222 1.00 38.86  ? 404 PHE G CB    1 
ATOM   9671  C CG    . PHE D  2 404 ? -3.426  -69.422 -38.968 1.00 39.85  ? 404 PHE G CG    1 
ATOM   9672  C CD1   . PHE D  2 404 ? -4.561  -69.548 -38.182 1.00 42.00  ? 404 PHE G CD1   1 
ATOM   9673  C CD2   . PHE D  2 404 ? -3.155  -68.193 -39.553 1.00 40.07  ? 404 PHE G CD2   1 
ATOM   9674  C CE1   . PHE D  2 404 ? -5.434  -68.476 -38.021 1.00 44.88  ? 404 PHE G CE1   1 
ATOM   9675  C CE2   . PHE D  2 404 ? -4.017  -67.105 -39.372 1.00 43.37  ? 404 PHE G CE2   1 
ATOM   9676  C CZ    . PHE D  2 404 ? -5.145  -67.253 -38.599 1.00 43.22  ? 404 PHE G CZ    1 
ATOM   9677  N N     . PHE D  2 405 ? -0.807  -72.031 -41.398 1.00 36.33  ? 405 PHE G N     1 
ATOM   9678  C CA    . PHE D  2 405 ? 0.432   -72.767 -41.508 1.00 35.37  ? 405 PHE G CA    1 
ATOM   9679  C C     . PHE D  2 405 ? 1.596   -71.820 -41.239 1.00 40.50  ? 405 PHE G C     1 
ATOM   9680  O O     . PHE D  2 405 ? 1.465   -70.588 -41.311 1.00 41.26  ? 405 PHE G O     1 
ATOM   9681  C CB    . PHE D  2 405 ? 0.624   -73.446 -42.881 1.00 36.34  ? 405 PHE G CB    1 
ATOM   9682  C CG    . PHE D  2 405 ? 0.968   -72.518 -44.010 1.00 37.24  ? 405 PHE G CG    1 
ATOM   9683  C CD1   . PHE D  2 405 ? -0.024  -71.868 -44.712 1.00 40.30  ? 405 PHE G CD1   1 
ATOM   9684  C CD2   . PHE D  2 405 ? 2.290   -72.290 -44.370 1.00 38.85  ? 405 PHE G CD2   1 
ATOM   9685  C CE1   . PHE D  2 405 ? 0.291   -71.006 -45.761 1.00 41.19  ? 405 PHE G CE1   1 
ATOM   9686  C CE2   . PHE D  2 405 ? 2.604   -71.425 -45.425 1.00 41.62  ? 405 PHE G CE2   1 
ATOM   9687  C CZ    . PHE D  2 405 ? 1.605   -70.773 -46.097 1.00 39.63  ? 405 PHE G CZ    1 
ATOM   9688  N N     . LEU D  2 406 ? 2.733   -72.414 -40.935 1.00 36.19  ? 406 LEU G N     1 
ATOM   9689  C CA    . LEU D  2 406 ? 3.967   -71.708 -40.805 1.00 36.62  ? 406 LEU G CA    1 
ATOM   9690  C C     . LEU D  2 406 ? 5.099   -72.637 -41.107 1.00 40.20  ? 406 LEU G C     1 
ATOM   9691  O O     . LEU D  2 406 ? 4.909   -73.850 -41.236 1.00 40.29  ? 406 LEU G O     1 
ATOM   9692  C CB    . LEU D  2 406 ? 4.129   -71.032 -39.421 1.00 37.21  ? 406 LEU G CB    1 
ATOM   9693  C CG    . LEU D  2 406 ? 4.214   -71.887 -38.166 1.00 42.27  ? 406 LEU G CG    1 
ATOM   9694  C CD1   . LEU D  2 406 ? 5.595   -72.657 -38.061 1.00 42.81  ? 406 LEU G CD1   1 
ATOM   9695  C CD2   . LEU D  2 406 ? 4.021   -71.015 -36.921 1.00 42.48  ? 406 LEU G CD2   1 
ATOM   9696  N N     . TYR D  2 407 ? 6.277   -72.055 -41.240 1.00 37.10  ? 407 TYR G N     1 
ATOM   9697  C CA    . TYR D  2 407 ? 7.536   -72.783 -41.403 1.00 37.58  ? 407 TYR G CA    1 
ATOM   9698  C C     . TYR D  2 407 ? 8.533   -72.285 -40.373 1.00 42.90  ? 407 TYR G C     1 
ATOM   9699  O O     . TYR D  2 407 ? 8.573   -71.101 -40.071 1.00 43.29  ? 407 TYR G O     1 
ATOM   9700  C CB    . TYR D  2 407 ? 8.127   -72.611 -42.789 1.00 37.59  ? 407 TYR G CB    1 
ATOM   9701  C CG    . TYR D  2 407 ? 7.394   -73.371 -43.874 1.00 37.07  ? 407 TYR G CG    1 
ATOM   9702  C CD1   . TYR D  2 407 ? 6.369   -72.775 -44.595 1.00 37.08  ? 407 TYR G CD1   1 
ATOM   9703  C CD2   . TYR D  2 407 ? 7.798   -74.650 -44.251 1.00 37.49  ? 407 TYR G CD2   1 
ATOM   9704  C CE1   . TYR D  2 407 ? 5.807   -73.394 -45.699 1.00 35.84  ? 407 TYR G CE1   1 
ATOM   9705  C CE2   . TYR D  2 407 ? 7.221   -75.297 -45.343 1.00 37.79  ? 407 TYR G CE2   1 
ATOM   9706  C CZ    . TYR D  2 407 ? 6.229   -74.661 -46.073 1.00 42.37  ? 407 TYR G CZ    1 
ATOM   9707  O OH    . TYR D  2 407 ? 5.595   -75.298 -47.111 1.00 38.56  ? 407 TYR G OH    1 
ATOM   9708  N N     . SER D  2 408 ? 9.299   -73.198 -39.826 1.00 41.37  ? 408 SER G N     1 
ATOM   9709  C CA    . SER D  2 408 ? 10.410  -72.921 -38.933 1.00 42.97  ? 408 SER G CA    1 
ATOM   9710  C C     . SER D  2 408 ? 11.634  -73.499 -39.624 1.00 46.47  ? 408 SER G C     1 
ATOM   9711  O O     . SER D  2 408 ? 11.566  -74.601 -40.169 1.00 43.85  ? 408 SER G O     1 
ATOM   9712  C CB    . SER D  2 408 ? 10.233  -73.536 -37.544 1.00 45.23  ? 408 SER G CB    1 
ATOM   9713  O OG    . SER D  2 408 ? 11.236  -73.023 -36.683 1.00 49.47  ? 408 SER G OG    1 
ATOM   9714  N N     . ARG D  2 409 ? 12.742  -72.742 -39.598 1.00 44.20  ? 409 ARG G N     1 
ATOM   9715  C CA    . ARG D  2 409 ? 13.977  -73.091 -40.292 1.00 44.73  ? 409 ARG G CA    1 
ATOM   9716  C C     . ARG D  2 409 ? 15.157  -73.143 -39.348 1.00 48.29  ? 409 ARG G C     1 
ATOM   9717  O O     . ARG D  2 409 ? 15.450  -72.146 -38.742 1.00 47.12  ? 409 ARG G O     1 
ATOM   9718  C CB    . ARG D  2 409 ? 14.215  -72.060 -41.405 1.00 43.11  ? 409 ARG G CB    1 
ATOM   9719  C CG    . ARG D  2 409 ? 15.560  -72.159 -42.102 1.00 53.21  ? 409 ARG G CG    1 
ATOM   9720  C CD    . ARG D  2 409 ? 15.583  -71.351 -43.386 1.00 52.55  ? 409 ARG G CD    1 
ATOM   9721  N NE    . ARG D  2 409 ? 16.945  -71.154 -43.852 1.00 57.69  ? 409 ARG G NE    1 
ATOM   9722  C CZ    . ARG D  2 409 ? 17.701  -70.074 -43.663 1.00 71.87  ? 409 ARG G CZ    1 
ATOM   9723  N NH1   . ARG D  2 409 ? 17.225  -69.020 -43.005 1.00 55.64  ? 409 ARG G NH1   1 
ATOM   9724  N NH2   . ARG D  2 409 ? 18.937  -70.033 -44.141 1.00 59.54  ? 409 ARG G NH2   1 
ATOM   9725  N N     . LEU D  2 410 ? 15.806  -74.297 -39.192 1.00 47.46  ? 410 LEU G N     1 
ATOM   9726  C CA    . LEU D  2 410 ? 17.020  -74.405 -38.371 1.00 49.74  ? 410 LEU G CA    1 
ATOM   9727  C C     . LEU D  2 410 ? 18.231  -74.414 -39.309 1.00 53.92  ? 410 LEU G C     1 
ATOM   9728  O O     . LEU D  2 410 ? 18.316  -75.267 -40.181 1.00 52.33  ? 410 LEU G O     1 
ATOM   9729  C CB    . LEU D  2 410 ? 17.005  -75.692 -37.502 1.00 50.16  ? 410 LEU G CB    1 
ATOM   9730  C CG    . LEU D  2 410 ? 18.257  -76.011 -36.663 1.00 54.94  ? 410 LEU G CG    1 
ATOM   9731  C CD1   . LEU D  2 410 ? 18.368  -75.108 -35.481 1.00 55.58  ? 410 LEU G CD1   1 
ATOM   9732  C CD2   . LEU D  2 410 ? 18.214  -77.411 -36.157 1.00 55.94  ? 410 LEU G CD2   1 
ATOM   9733  N N     . THR D  2 411 ? 19.166  -73.486 -39.116 1.00 54.68  ? 411 THR G N     1 
ATOM   9734  C CA    . THR D  2 411 ? 20.406  -73.441 -39.904 1.00 56.68  ? 411 THR G CA    1 
ATOM   9735  C C     . THR D  2 411 ? 21.483  -74.266 -39.158 1.00 63.45  ? 411 THR G C     1 
ATOM   9736  O O     . THR D  2 411 ? 21.677  -74.077 -37.962 1.00 62.43  ? 411 THR G O     1 
ATOM   9737  C CB    . THR D  2 411 ? 20.821  -71.991 -40.140 1.00 64.55  ? 411 THR G CB    1 
ATOM   9738  O OG1   . THR D  2 411 ? 19.800  -71.370 -40.903 1.00 65.87  ? 411 THR G OG1   1 
ATOM   9739  C CG2   . THR D  2 411 ? 22.132  -71.876 -40.898 1.00 65.35  ? 411 THR G CG2   1 
ATOM   9740  N N     . VAL D  2 412 ? 22.133  -75.205 -39.850 1.00 63.57  ? 412 VAL G N     1 
ATOM   9741  C CA    . VAL D  2 412 ? 23.188  -76.050 -39.263 1.00 65.92  ? 412 VAL G CA    1 
ATOM   9742  C C     . VAL D  2 412 ? 24.380  -76.179 -40.209 1.00 73.50  ? 412 VAL G C     1 
ATOM   9743  O O     . VAL D  2 412 ? 24.214  -76.122 -41.434 1.00 72.00  ? 412 VAL G O     1 
ATOM   9744  C CB    . VAL D  2 412 ? 22.679  -77.475 -38.881 1.00 69.40  ? 412 VAL G CB    1 
ATOM   9745  C CG1   . VAL D  2 412 ? 21.474  -77.403 -37.966 1.00 68.33  ? 412 VAL G CG1   1 
ATOM   9746  C CG2   . VAL D  2 412 ? 22.348  -78.310 -40.118 1.00 68.56  ? 412 VAL G CG2   1 
ATOM   9747  N N     . ASP D  2 413 ? 25.567  -76.491 -39.632 1.00 73.79  ? 413 ASP G N     1 
ATOM   9748  C CA    . ASP D  2 413 ? 26.777  -76.784 -40.411 1.00 73.76  ? 413 ASP G CA    1 
ATOM   9749  C C     . ASP D  2 413 ? 26.517  -78.108 -41.086 1.00 74.43  ? 413 ASP G C     1 
ATOM   9750  O O     . ASP D  2 413 ? 26.055  -79.045 -40.427 1.00 73.97  ? 413 ASP G O     1 
ATOM   9751  C CB    . ASP D  2 413 ? 28.025  -76.894 -39.515 1.00 77.44  ? 413 ASP G CB    1 
ATOM   9752  C CG    . ASP D  2 413 ? 28.561  -75.571 -39.018 1.00 92.96  ? 413 ASP G CG    1 
ATOM   9753  O OD1   . ASP D  2 413 ? 28.186  -74.523 -39.590 1.00 94.35  ? 413 ASP G OD1   1 
ATOM   9754  O OD2   . ASP D  2 413 ? 29.379  -75.580 -38.071 1.00 101.55 ? 413 ASP G OD2   1 
ATOM   9755  N N     . LYS D  2 414 ? 26.756  -78.183 -42.400 1.00 69.21  ? 414 LYS G N     1 
ATOM   9756  C CA    . LYS D  2 414 ? 26.509  -79.409 -43.164 1.00 68.35  ? 414 LYS G CA    1 
ATOM   9757  C C     . LYS D  2 414 ? 27.086  -80.654 -42.498 1.00 74.50  ? 414 LYS G C     1 
ATOM   9758  O O     . LYS D  2 414 ? 26.448  -81.707 -42.548 1.00 72.52  ? 414 LYS G O     1 
ATOM   9759  C CB    . LYS D  2 414 ? 27.045  -79.258 -44.593 1.00 70.17  ? 414 LYS G CB    1 
ATOM   9760  C CG    . LYS D  2 414 ? 26.713  -80.423 -45.500 1.00 74.98  ? 414 LYS G CG    1 
ATOM   9761  C CD    . LYS D  2 414 ? 27.075  -80.134 -46.930 1.00 83.72  ? 414 LYS G CD    1 
ATOM   9762  C CE    . LYS D  2 414 ? 28.509  -80.451 -47.252 1.00 91.46  ? 414 LYS G CE    1 
ATOM   9763  N NZ    . LYS D  2 414 ? 29.025  -79.614 -48.362 1.00 94.34  ? 414 LYS G NZ    1 
ATOM   9764  N N     . SER D  2 415 ? 28.294  -80.540 -41.883 1.00 75.31  ? 415 SER G N     1 
ATOM   9765  C CA    . SER D  2 415 ? 28.975  -81.662 -41.199 1.00 76.51  ? 415 SER G CA    1 
ATOM   9766  C C     . SER D  2 415 ? 28.092  -82.282 -40.098 1.00 79.60  ? 415 SER G C     1 
ATOM   9767  O O     . SER D  2 415 ? 27.990  -83.508 -40.035 1.00 79.32  ? 415 SER G O     1 
ATOM   9768  C CB    . SER D  2 415 ? 30.310  -81.205 -40.618 1.00 80.93  ? 415 SER G CB    1 
ATOM   9769  O OG    . SER D  2 415 ? 30.161  -80.009 -39.869 1.00 92.82  ? 415 SER G OG    1 
ATOM   9770  N N     . ARG D  2 416 ? 27.415  -81.434 -39.278 1.00 74.83  ? 416 ARG G N     1 
ATOM   9771  C CA    . ARG D  2 416 ? 26.493  -81.895 -38.216 1.00 73.54  ? 416 ARG G CA    1 
ATOM   9772  C C     . ARG D  2 416 ? 25.341  -82.749 -38.807 1.00 74.51  ? 416 ARG G C     1 
ATOM   9773  O O     . ARG D  2 416 ? 25.030  -83.815 -38.276 1.00 74.19  ? 416 ARG G O     1 
ATOM   9774  C CB    . ARG D  2 416 ? 25.935  -80.705 -37.414 1.00 72.35  ? 416 ARG G CB    1 
ATOM   9775  N N     . TRP D  2 417 ? 24.744  -82.296 -39.928 1.00 67.66  ? 417 TRP G N     1 
ATOM   9776  C CA    . TRP D  2 417 ? 23.689  -83.045 -40.623 1.00 65.35  ? 417 TRP G CA    1 
ATOM   9777  C C     . TRP D  2 417 ? 24.267  -84.314 -41.234 1.00 73.81  ? 417 TRP G C     1 
ATOM   9778  O O     . TRP D  2 417 ? 23.651  -85.381 -41.151 1.00 73.26  ? 417 TRP G O     1 
ATOM   9779  C CB    . TRP D  2 417 ? 23.059  -82.191 -41.763 1.00 60.98  ? 417 TRP G CB    1 
ATOM   9780  C CG    . TRP D  2 417 ? 22.113  -82.929 -42.667 1.00 58.41  ? 417 TRP G CG    1 
ATOM   9781  C CD1   . TRP D  2 417 ? 22.294  -83.230 -43.987 1.00 60.64  ? 417 TRP G CD1   1 
ATOM   9782  C CD2   . TRP D  2 417 ? 20.812  -83.393 -42.325 1.00 56.04  ? 417 TRP G CD2   1 
ATOM   9783  N NE1   . TRP D  2 417 ? 21.182  -83.873 -44.482 1.00 57.65  ? 417 TRP G NE1   1 
ATOM   9784  C CE2   . TRP D  2 417 ? 20.267  -84.009 -43.474 1.00 57.82  ? 417 TRP G CE2   1 
ATOM   9785  C CE3   . TRP D  2 417 ? 20.060  -83.380 -41.143 1.00 56.25  ? 417 TRP G CE3   1 
ATOM   9786  C CZ2   . TRP D  2 417 ? 18.978  -84.523 -43.495 1.00 55.11  ? 417 TRP G CZ2   1 
ATOM   9787  C CZ3   . TRP D  2 417 ? 18.806  -83.924 -41.154 1.00 55.40  ? 417 TRP G CZ3   1 
ATOM   9788  C CH2   . TRP D  2 417 ? 18.254  -84.446 -42.332 1.00 55.09  ? 417 TRP G CH2   1 
ATOM   9789  N N     . GLN D  2 418 ? 25.421  -84.170 -41.912 1.00 73.59  ? 418 GLN G N     1 
ATOM   9790  C CA    . GLN D  2 418 ? 26.076  -85.292 -42.586 1.00 74.41  ? 418 GLN G CA    1 
ATOM   9791  C C     . GLN D  2 418 ? 26.588  -86.362 -41.614 1.00 76.53  ? 418 GLN G C     1 
ATOM   9792  O O     . GLN D  2 418 ? 26.531  -87.537 -41.970 1.00 74.24  ? 418 GLN G O     1 
ATOM   9793  C CB    . GLN D  2 418 ? 27.185  -84.812 -43.544 1.00 77.22  ? 418 GLN G CB    1 
ATOM   9794  C CG    . GLN D  2 418 ? 26.619  -84.263 -44.862 1.00 91.89  ? 418 GLN G CG    1 
ATOM   9795  C CD    . GLN D  2 418 ? 27.685  -84.075 -45.923 1.00 110.90 ? 418 GLN G CD    1 
ATOM   9796  O OE1   . GLN D  2 418 ? 28.785  -83.568 -45.657 1.00 103.47 ? 418 GLN G OE1   1 
ATOM   9797  N NE2   . GLN D  2 418 ? 27.377  -84.461 -47.161 1.00 104.73 ? 418 GLN G NE2   1 
ATOM   9798  N N     . GLN D  2 419 ? 26.984  -85.991 -40.368 1.00 74.36  ? 419 GLN G N     1 
ATOM   9799  C CA    . GLN D  2 419 ? 27.455  -86.986 -39.384 1.00 76.34  ? 419 GLN G CA    1 
ATOM   9800  C C     . GLN D  2 419 ? 26.284  -87.676 -38.591 1.00 79.68  ? 419 GLN G C     1 
ATOM   9801  O O     . GLN D  2 419 ? 26.544  -88.327 -37.572 1.00 79.27  ? 419 GLN G O     1 
ATOM   9802  C CB    . GLN D  2 419 ? 28.546  -86.398 -38.457 1.00 79.45  ? 419 GLN G CB    1 
ATOM   9803  C CG    . GLN D  2 419 ? 28.077  -85.545 -37.293 1.00 96.43  ? 419 GLN G CG    1 
ATOM   9804  C CD    . GLN D  2 419 ? 29.215  -84.781 -36.657 1.00 122.52 ? 419 GLN G CD    1 
ATOM   9805  O OE1   . GLN D  2 419 ? 30.397  -85.087 -36.859 1.00 123.30 ? 419 GLN G OE1   1 
ATOM   9806  N NE2   . GLN D  2 419 ? 28.887  -83.802 -35.825 1.00 113.56 ? 419 GLN G NE2   1 
ATOM   9807  N N     . GLY D  2 420 ? 25.038  -87.566 -39.102 1.00 74.29  ? 420 GLY G N     1 
ATOM   9808  C CA    . GLY D  2 420 ? 23.867  -88.265 -38.581 1.00 73.08  ? 420 GLY G CA    1 
ATOM   9809  C C     . GLY D  2 420 ? 23.175  -87.737 -37.341 1.00 76.53  ? 420 GLY G C     1 
ATOM   9810  O O     . GLY D  2 420 ? 22.319  -88.444 -36.787 1.00 74.49  ? 420 GLY G O     1 
ATOM   9811  N N     . ASN D  2 421 ? 23.490  -86.496 -36.900 1.00 74.55  ? 421 ASN G N     1 
ATOM   9812  C CA    . ASN D  2 421 ? 22.819  -85.926 -35.713 1.00 74.93  ? 421 ASN G CA    1 
ATOM   9813  C C     . ASN D  2 421 ? 21.285  -85.851 -35.919 1.00 75.73  ? 421 ASN G C     1 
ATOM   9814  O O     . ASN D  2 421 ? 20.824  -85.567 -37.030 1.00 73.73  ? 421 ASN G O     1 
ATOM   9815  C CB    . ASN D  2 421 ? 23.369  -84.537 -35.354 1.00 80.47  ? 421 ASN G CB    1 
ATOM   9816  C CG    . ASN D  2 421 ? 24.822  -84.518 -34.947 1.00 101.11 ? 421 ASN G CG    1 
ATOM   9817  O OD1   . ASN D  2 421 ? 25.601  -85.397 -35.308 1.00 98.38  ? 421 ASN G OD1   1 
ATOM   9818  N ND2   . ASN D  2 421 ? 25.234  -83.486 -34.229 1.00 92.33  ? 421 ASN G ND2   1 
ATOM   9819  N N     . VAL D  2 422 ? 20.517  -86.211 -34.872 1.00 71.16  ? 422 VAL G N     1 
ATOM   9820  C CA    . VAL D  2 422 ? 19.056  -86.194 -34.903 1.00 68.47  ? 422 VAL G CA    1 
ATOM   9821  C C     . VAL D  2 422 ? 18.617  -84.808 -34.479 1.00 69.43  ? 422 VAL G C     1 
ATOM   9822  O O     . VAL D  2 422 ? 19.138  -84.256 -33.501 1.00 68.02  ? 422 VAL G O     1 
ATOM   9823  C CB    . VAL D  2 422 ? 18.405  -87.270 -34.001 1.00 72.11  ? 422 VAL G CB    1 
ATOM   9824  C CG1   . VAL D  2 422 ? 16.891  -87.070 -33.924 1.00 69.87  ? 422 VAL G CG1   1 
ATOM   9825  C CG2   . VAL D  2 422 ? 18.719  -88.670 -34.509 1.00 72.28  ? 422 VAL G CG2   1 
ATOM   9826  N N     . PHE D  2 423 ? 17.638  -84.256 -35.207 1.00 63.23  ? 423 PHE G N     1 
ATOM   9827  C CA    . PHE D  2 423 ? 17.115  -82.930 -34.907 1.00 62.03  ? 423 PHE G CA    1 
ATOM   9828  C C     . PHE D  2 423 ? 15.626  -83.052 -34.670 1.00 63.38  ? 423 PHE G C     1 
ATOM   9829  O O     . PHE D  2 423 ? 14.992  -83.930 -35.255 1.00 62.26  ? 423 PHE G O     1 
ATOM   9830  C CB    . PHE D  2 423 ? 17.435  -81.974 -36.054 1.00 61.92  ? 423 PHE G CB    1 
ATOM   9831  C CG    . PHE D  2 423 ? 18.923  -81.782 -36.218 1.00 62.82  ? 423 PHE G CG    1 
ATOM   9832  C CD1   . PHE D  2 423 ? 19.660  -82.618 -37.042 1.00 64.17  ? 423 PHE G CD1   1 
ATOM   9833  C CD2   . PHE D  2 423 ? 19.583  -80.754 -35.565 1.00 64.63  ? 423 PHE G CD2   1 
ATOM   9834  C CE1   . PHE D  2 423 ? 21.026  -82.408 -37.234 1.00 66.90  ? 423 PHE G CE1   1 
ATOM   9835  C CE2   . PHE D  2 423 ? 20.943  -80.541 -35.768 1.00 65.84  ? 423 PHE G CE2   1 
ATOM   9836  C CZ    . PHE D  2 423 ? 21.657  -81.373 -36.598 1.00 64.58  ? 423 PHE G CZ    1 
ATOM   9837  N N     . SER D  2 424 ? 15.094  -82.225 -33.761 1.00 58.00  ? 424 SER G N     1 
ATOM   9838  C CA    . SER D  2 424 ? 13.692  -82.244 -33.388 1.00 57.44  ? 424 SER G CA    1 
ATOM   9839  C C     . SER D  2 424 ? 13.028  -80.876 -33.488 1.00 59.66  ? 424 SER G C     1 
ATOM   9840  O O     . SER D  2 424 ? 13.550  -79.895 -32.971 1.00 60.24  ? 424 SER G O     1 
ATOM   9841  C CB    . SER D  2 424 ? 13.539  -82.794 -31.977 1.00 63.12  ? 424 SER G CB    1 
ATOM   9842  O OG    . SER D  2 424 ? 13.583  -84.211 -32.034 1.00 81.21  ? 424 SER G OG    1 
ATOM   9843  N N     . CYS D  2 425 ? 11.847  -80.842 -34.108 1.00 54.22  ? 425 CYS G N     1 
ATOM   9844  C CA    . CYS D  2 425 ? 10.991  -79.660 -34.243 1.00 53.61  ? 425 CYS G CA    1 
ATOM   9845  C C     . CYS D  2 425 ? 9.847   -79.876 -33.243 1.00 55.57  ? 425 CYS G C     1 
ATOM   9846  O O     . CYS D  2 425 ? 9.086   -80.830 -33.405 1.00 53.70  ? 425 CYS G O     1 
ATOM   9847  C CB    . CYS D  2 425 ? 10.457  -79.527 -35.665 1.00 53.15  ? 425 CYS G CB    1 
ATOM   9848  S SG    . CYS D  2 425 ? 9.252   -78.206 -35.843 1.00 57.56  ? 425 CYS G SG    1 
ATOM   9849  N N     . SER D  2 426 ? 9.752   -79.034 -32.208 1.00 52.14  ? 426 SER G N     1 
ATOM   9850  C CA    . SER D  2 426 ? 8.721   -79.165 -31.175 1.00 52.04  ? 426 SER G CA    1 
ATOM   9851  C C     . SER D  2 426 ? 7.714   -78.021 -31.278 1.00 54.06  ? 426 SER G C     1 
ATOM   9852  O O     . SER D  2 426 ? 8.108   -76.867 -31.439 1.00 52.63  ? 426 SER G O     1 
ATOM   9853  C CB    . SER D  2 426 ? 9.335   -79.248 -29.782 1.00 54.07  ? 426 SER G CB    1 
ATOM   9854  O OG    . SER D  2 426 ? 9.795   -77.991 -29.322 1.00 62.43  ? 426 SER G OG    1 
ATOM   9855  N N     . VAL D  2 427 ? 6.417   -78.367 -31.204 1.00 49.42  ? 427 VAL G N     1 
ATOM   9856  C CA    . VAL D  2 427 ? 5.298   -77.441 -31.360 1.00 47.19  ? 427 VAL G CA    1 
ATOM   9857  C C     . VAL D  2 427 ? 4.399   -77.504 -30.118 1.00 51.02  ? 427 VAL G C     1 
ATOM   9858  O O     . VAL D  2 427 ? 4.012   -78.588 -29.683 1.00 48.59  ? 427 VAL G O     1 
ATOM   9859  C CB    . VAL D  2 427 ? 4.503   -77.780 -32.653 1.00 48.74  ? 427 VAL G CB    1 
ATOM   9860  C CG1   . VAL D  2 427 ? 3.294   -76.869 -32.839 1.00 47.71  ? 427 VAL G CG1   1 
ATOM   9861  C CG2   . VAL D  2 427 ? 5.413   -77.704 -33.878 1.00 48.43  ? 427 VAL G CG2   1 
ATOM   9862  N N     . MET D  2 428 ? 4.046   -76.327 -29.584 1.00 48.90  ? 428 MET G N     1 
ATOM   9863  C CA    . MET D  2 428 ? 3.096   -76.177 -28.505 1.00 49.53  ? 428 MET G CA    1 
ATOM   9864  C C     . MET D  2 428 ? 1.876   -75.407 -29.059 1.00 49.43  ? 428 MET G C     1 
ATOM   9865  O O     . MET D  2 428 ? 1.995   -74.285 -29.560 1.00 47.32  ? 428 MET G O     1 
ATOM   9866  C CB    . MET D  2 428 ? 3.709   -75.445 -27.316 1.00 53.62  ? 428 MET G CB    1 
ATOM   9867  C CG    . MET D  2 428 ? 4.486   -76.337 -26.409 1.00 60.91  ? 428 MET G CG    1 
ATOM   9868  S SD    . MET D  2 428 ? 5.479   -75.413 -25.235 1.00 68.96  ? 428 MET G SD    1 
ATOM   9869  C CE    . MET D  2 428 ? 6.860   -74.889 -26.385 1.00 65.73  ? 428 MET G CE    1 
ATOM   9870  N N     . HIS D  2 429 ? 0.713   -76.020 -28.955 1.00 46.02  ? 429 HIS G N     1 
ATOM   9871  C CA    . HIS D  2 429 ? -0.526  -75.433 -29.440 1.00 46.24  ? 429 HIS G CA    1 
ATOM   9872  C C     . HIS D  2 429 ? -1.651  -76.000 -28.578 1.00 50.97  ? 429 HIS G C     1 
ATOM   9873  O O     . HIS D  2 429 ? -1.535  -77.107 -28.090 1.00 50.08  ? 429 HIS G O     1 
ATOM   9874  C CB    . HIS D  2 429 ? -0.749  -75.744 -30.944 1.00 45.04  ? 429 HIS G CB    1 
ATOM   9875  C CG    . HIS D  2 429 ? -1.935  -75.034 -31.514 1.00 48.23  ? 429 HIS G CG    1 
ATOM   9876  N ND1   . HIS D  2 429 ? -3.206  -75.536 -31.368 1.00 50.03  ? 429 HIS G ND1   1 
ATOM   9877  C CD2   . HIS D  2 429 ? -2.004  -73.859 -32.185 1.00 49.88  ? 429 HIS G CD2   1 
ATOM   9878  C CE1   . HIS D  2 429 ? -4.003  -74.671 -31.959 1.00 49.14  ? 429 HIS G CE1   1 
ATOM   9879  N NE2   . HIS D  2 429 ? -3.319  -73.616 -32.416 1.00 49.40  ? 429 HIS G NE2   1 
ATOM   9880  N N     . GLU D  2 430 ? -2.706  -75.223 -28.366 1.00 49.79  ? 430 GLU G N     1 
ATOM   9881  C CA    . GLU D  2 430 ? -3.831  -75.635 -27.527 1.00 50.42  ? 430 GLU G CA    1 
ATOM   9882  C C     . GLU D  2 430 ? -4.568  -76.886 -27.997 1.00 53.15  ? 430 GLU G C     1 
ATOM   9883  O O     . GLU D  2 430 ? -5.071  -77.612 -27.174 1.00 54.77  ? 430 GLU G O     1 
ATOM   9884  C CB    . GLU D  2 430 ? -4.820  -74.480 -27.345 1.00 51.00  ? 430 GLU G CB    1 
ATOM   9885  C CG    . GLU D  2 430 ? -5.618  -74.109 -28.582 1.00 51.80  ? 430 GLU G CG    1 
ATOM   9886  C CD    . GLU D  2 430 ? -6.803  -73.242 -28.244 1.00 55.44  ? 430 GLU G CD    1 
ATOM   9887  O OE1   . GLU D  2 430 ? -6.595  -72.019 -28.117 1.00 70.22  ? 430 GLU G OE1   1 
ATOM   9888  O OE2   . GLU D  2 430 ? -7.930  -73.770 -28.098 1.00 62.31  ? 430 GLU G OE2   1 
ATOM   9889  N N     . ALA D  2 431 ? -4.634  -77.134 -29.297 1.00 49.52  ? 431 ALA G N     1 
ATOM   9890  C CA    . ALA D  2 431 ? -5.376  -78.275 -29.849 1.00 49.01  ? 431 ALA G CA    1 
ATOM   9891  C C     . ALA D  2 431 ? -4.575  -79.560 -29.869 1.00 53.51  ? 431 ALA G C     1 
ATOM   9892  O O     . ALA D  2 431 ? -5.122  -80.597 -30.207 1.00 54.11  ? 431 ALA G O     1 
ATOM   9893  C CB    . ALA D  2 431 ? -5.888  -77.945 -31.245 1.00 48.57  ? 431 ALA G CB    1 
ATOM   9894  N N     . LEU D  2 432 ? -3.306  -79.524 -29.454 1.00 51.33  ? 432 LEU G N     1 
ATOM   9895  C CA    . LEU D  2 432 ? -2.487  -80.726 -29.386 1.00 51.30  ? 432 LEU G CA    1 
ATOM   9896  C C     . LEU D  2 432 ? -2.696  -81.425 -28.045 1.00 57.18  ? 432 LEU G C     1 
ATOM   9897  O O     . LEU D  2 432 ? -2.990  -80.763 -27.040 1.00 55.71  ? 432 LEU G O     1 
ATOM   9898  C CB    . LEU D  2 432 ? -1.007  -80.360 -29.525 1.00 50.37  ? 432 LEU G CB    1 
ATOM   9899  C CG    . LEU D  2 432 ? -0.535  -79.973 -30.891 1.00 50.30  ? 432 LEU G CG    1 
ATOM   9900  C CD1   . LEU D  2 432 ? 0.855   -79.428 -30.825 1.00 49.10  ? 432 LEU G CD1   1 
ATOM   9901  C CD2   . LEU D  2 432 ? -0.590  -81.130 -31.820 1.00 49.63  ? 432 LEU G CD2   1 
ATOM   9902  N N     . HIS D  2 433 ? -2.491  -82.754 -28.012 1.00 58.17  ? 433 HIS G N     1 
ATOM   9903  C CA    . HIS D  2 433 ? -2.587  -83.492 -26.743 1.00 61.54  ? 433 HIS G CA    1 
ATOM   9904  C C     . HIS D  2 433 ? -1.432  -83.037 -25.842 1.00 64.09  ? 433 HIS G C     1 
ATOM   9905  O O     . HIS D  2 433 ? -0.288  -82.951 -26.296 1.00 62.37  ? 433 HIS G O     1 
ATOM   9906  C CB    . HIS D  2 433 ? -2.574  -85.027 -26.895 1.00 63.94  ? 433 HIS G CB    1 
ATOM   9907  C CG    . HIS D  2 433 ? -2.948  -85.723 -25.622 1.00 70.77  ? 433 HIS G CG    1 
ATOM   9908  N ND1   . HIS D  2 433 ? -2.296  -86.877 -25.205 1.00 73.92  ? 433 HIS G ND1   1 
ATOM   9909  C CD2   . HIS D  2 433 ? -3.858  -85.370 -24.676 1.00 74.47  ? 433 HIS G CD2   1 
ATOM   9910  C CE1   . HIS D  2 433 ? -2.858  -87.208 -24.052 1.00 74.95  ? 433 HIS G CE1   1 
ATOM   9911  N NE2   . HIS D  2 433 ? -3.780  -86.315 -23.680 1.00 75.56  ? 433 HIS G NE2   1 
ATOM   9912  N N     . ASN D  2 434 ? -1.775  -82.625 -24.618 1.00 61.13  ? 434 ASN G N     1 
ATOM   9913  C CA    . ASN D  2 434 ? -0.864  -82.062 -23.625 1.00 62.32  ? 434 ASN G CA    1 
ATOM   9914  C C     . ASN D  2 434 ? -0.203  -80.783 -24.126 1.00 65.99  ? 434 ASN G C     1 
ATOM   9915  O O     . ASN D  2 434 ? 0.845   -80.379 -23.606 1.00 66.89  ? 434 ASN G O     1 
ATOM   9916  C CB    . ASN D  2 434 ? 0.157   -83.100 -23.156 1.00 67.03  ? 434 ASN G CB    1 
ATOM   9917  C CG    . ASN D  2 434 ? -0.494  -84.231 -22.409 1.00 91.96  ? 434 ASN G CG    1 
ATOM   9918  O OD1   . ASN D  2 434 ? -0.531  -85.369 -22.882 1.00 92.32  ? 434 ASN G OD1   1 
ATOM   9919  N ND2   . ASN D  2 434 ? -1.076  -83.929 -21.250 1.00 75.89  ? 434 ASN G ND2   1 
ATOM   9920  N N     . HIS D  2 435 ? -0.885  -80.098 -25.083 1.00 59.54  ? 435 HIS G N     1 
ATOM   9921  C CA    . HIS D  2 435 ? -0.433  -78.877 -25.745 1.00 57.03  ? 435 HIS G CA    1 
ATOM   9922  C C     . HIS D  2 435 ? 0.971   -78.983 -26.342 1.00 57.35  ? 435 HIS G C     1 
ATOM   9923  O O     . HIS D  2 435 ? 1.682   -77.998 -26.372 1.00 57.16  ? 435 HIS G O     1 
ATOM   9924  C CB    . HIS D  2 435 ? -0.488  -77.704 -24.765 1.00 58.10  ? 435 HIS G CB    1 
ATOM   9925  C CG    . HIS D  2 435 ? -1.842  -77.440 -24.204 1.00 62.48  ? 435 HIS G CG    1 
ATOM   9926  N ND1   . HIS D  2 435 ? -2.015  -76.582 -23.139 1.00 65.38  ? 435 HIS G ND1   1 
ATOM   9927  C CD2   . HIS D  2 435 ? -3.052  -77.898 -24.600 1.00 64.09  ? 435 HIS G CD2   1 
ATOM   9928  C CE1   . HIS D  2 435 ? -3.316  -76.557 -22.909 1.00 65.37  ? 435 HIS G CE1   1 
ATOM   9929  N NE2   . HIS D  2 435 ? -3.979  -77.318 -23.778 1.00 65.04  ? 435 HIS G NE2   1 
ATOM   9930  N N     . TYR D  2 436 ? 1.377   -80.157 -26.788 1.00 52.30  ? 436 TYR G N     1 
ATOM   9931  C CA    . TYR D  2 436 ? 2.744   -80.379 -27.208 1.00 51.88  ? 436 TYR G CA    1 
ATOM   9932  C C     . TYR D  2 436 ? 2.865   -81.574 -28.150 1.00 55.81  ? 436 TYR G C     1 
ATOM   9933  O O     . TYR D  2 436 ? 2.190   -82.582 -27.966 1.00 54.57  ? 436 TYR G O     1 
ATOM   9934  C CB    . TYR D  2 436 ? 3.612   -80.650 -25.943 1.00 54.72  ? 436 TYR G CB    1 
ATOM   9935  C CG    . TYR D  2 436 ? 5.070   -80.912 -26.243 1.00 55.94  ? 436 TYR G CG    1 
ATOM   9936  C CD1   . TYR D  2 436 ? 5.516   -82.189 -26.570 1.00 56.96  ? 436 TYR G CD1   1 
ATOM   9937  C CD2   . TYR D  2 436 ? 5.988   -79.873 -26.290 1.00 57.31  ? 436 TYR G CD2   1 
ATOM   9938  C CE1   . TYR D  2 436 ? 6.833   -82.418 -26.961 1.00 56.72  ? 436 TYR G CE1   1 
ATOM   9939  C CE2   . TYR D  2 436 ? 7.331   -80.106 -26.584 1.00 58.93  ? 436 TYR G CE2   1 
ATOM   9940  C CZ    . TYR D  2 436 ? 7.749   -81.379 -26.934 1.00 64.75  ? 436 TYR G CZ    1 
ATOM   9941  O OH    . TYR D  2 436 ? 9.066   -81.583 -27.260 1.00 65.96  ? 436 TYR G OH    1 
ATOM   9942  N N     . THR D  2 437 ? 3.747   -81.444 -29.143 1.00 53.26  ? 437 THR G N     1 
ATOM   9943  C CA    . THR D  2 437 ? 4.162   -82.516 -30.040 1.00 53.20  ? 437 THR G CA    1 
ATOM   9944  C C     . THR D  2 437 ? 5.581   -82.207 -30.541 1.00 57.85  ? 437 THR G C     1 
ATOM   9945  O O     . THR D  2 437 ? 6.029   -81.054 -30.502 1.00 55.77  ? 437 THR G O     1 
ATOM   9946  C CB    . THR D  2 437 ? 3.213   -82.784 -31.193 1.00 58.64  ? 437 THR G CB    1 
ATOM   9947  O OG1   . THR D  2 437 ? 3.634   -84.013 -31.794 1.00 58.43  ? 437 THR G OG1   1 
ATOM   9948  C CG2   . THR D  2 437 ? 3.254   -81.709 -32.231 1.00 58.35  ? 437 THR G CG2   1 
ATOM   9949  N N     . GLN D  2 438 ? 6.255   -83.253 -31.020 1.00 54.81  ? 438 GLN G N     1 
ATOM   9950  C CA    . GLN D  2 438 ? 7.637   -83.201 -31.467 1.00 54.71  ? 438 GLN G CA    1 
ATOM   9951  C C     . GLN D  2 438 ? 7.828   -84.156 -32.647 1.00 58.76  ? 438 GLN G C     1 
ATOM   9952  O O     . GLN D  2 438 ? 7.255   -85.249 -32.648 1.00 59.33  ? 438 GLN G O     1 
ATOM   9953  C CB    . GLN D  2 438 ? 8.559   -83.599 -30.302 1.00 57.63  ? 438 GLN G CB    1 
ATOM   9954  C CG    . GLN D  2 438 ? 10.002  -83.181 -30.512 1.00 69.50  ? 438 GLN G CG    1 
ATOM   9955  C CD    . GLN D  2 438 ? 10.875  -83.607 -29.364 1.00 80.79  ? 438 GLN G CD    1 
ATOM   9956  O OE1   . GLN D  2 438 ? 11.326  -82.789 -28.543 1.00 69.01  ? 438 GLN G OE1   1 
ATOM   9957  N NE2   . GLN D  2 438 ? 11.153  -84.898 -29.300 1.00 72.20  ? 438 GLN G NE2   1 
ATOM   9958  N N     . LYS D  2 439 ? 8.603   -83.743 -33.655 1.00 54.50  ? 439 LYS G N     1 
ATOM   9959  C CA    . LYS D  2 439 ? 8.861   -84.561 -34.855 1.00 53.30  ? 439 LYS G CA    1 
ATOM   9960  C C     . LYS D  2 439 ? 10.338  -84.522 -35.155 1.00 58.10  ? 439 LYS G C     1 
ATOM   9961  O O     . LYS D  2 439 ? 10.934  -83.452 -35.131 1.00 58.60  ? 439 LYS G O     1 
ATOM   9962  C CB    . LYS D  2 439 ? 8.040   -84.057 -36.054 1.00 52.92  ? 439 LYS G CB    1 
ATOM   9963  C CG    . LYS D  2 439 ? 6.563   -84.465 -35.995 1.00 69.47  ? 439 LYS G CG    1 
ATOM   9964  C CD    . LYS D  2 439 ? 6.271   -85.851 -36.581 1.00 83.03  ? 439 LYS G CD    1 
ATOM   9965  C CE    . LYS D  2 439 ? 6.377   -85.887 -38.104 1.00 106.15 ? 439 LYS G CE    1 
ATOM   9966  N NZ    . LYS D  2 439 ? 5.065   -86.080 -38.793 1.00 114.92 ? 439 LYS G NZ    1 
ATOM   9967  N N     . SER D  2 440 ? 10.934  -85.676 -35.426 1.00 56.05  ? 440 SER G N     1 
ATOM   9968  C CA    . SER D  2 440 ? 12.376  -85.768 -35.644 1.00 57.24  ? 440 SER G CA    1 
ATOM   9969  C C     . SER D  2 440 ? 12.800  -85.720 -37.119 1.00 59.52  ? 440 SER G C     1 
ATOM   9970  O O     . SER D  2 440 ? 12.002  -85.996 -38.010 1.00 57.71  ? 440 SER G O     1 
ATOM   9971  C CB    . SER D  2 440 ? 12.938  -87.005 -34.950 1.00 62.08  ? 440 SER G CB    1 
ATOM   9972  O OG    . SER D  2 440 ? 12.940  -86.791 -33.544 1.00 75.70  ? 440 SER G OG    1 
ATOM   9973  N N     . LEU D  2 441 ? 14.073  -85.339 -37.350 1.00 56.34  ? 441 LEU G N     1 
ATOM   9974  C CA    . LEU D  2 441 ? 14.680  -85.204 -38.685 1.00 54.73  ? 441 LEU G CA    1 
ATOM   9975  C C     . LEU D  2 441 ? 16.155  -85.684 -38.593 1.00 59.71  ? 441 LEU G C     1 
ATOM   9976  O O     . LEU D  2 441 ? 16.881  -85.274 -37.686 1.00 59.74  ? 441 LEU G O     1 
ATOM   9977  C CB    . LEU D  2 441 ? 14.569  -83.718 -39.150 1.00 53.03  ? 441 LEU G CB    1 
ATOM   9978  C CG    . LEU D  2 441 ? 15.005  -83.367 -40.587 1.00 54.96  ? 441 LEU G CG    1 
ATOM   9979  C CD1   . LEU D  2 441 ? 14.272  -84.172 -41.626 1.00 52.52  ? 441 LEU G CD1   1 
ATOM   9980  C CD2   . LEU D  2 441 ? 14.830  -81.898 -40.870 1.00 56.92  ? 441 LEU G CD2   1 
ATOM   9981  N N     . SER D  2 442 ? 16.544  -86.611 -39.485 1.00 58.62  ? 442 SER G N     1 
ATOM   9982  C CA    . SER D  2 442 ? 17.866  -87.261 -39.532 1.00 60.90  ? 442 SER G CA    1 
ATOM   9983  C C     . SER D  2 442 ? 18.270  -87.564 -40.992 1.00 65.99  ? 442 SER G C     1 
ATOM   9984  O O     . SER D  2 442 ? 17.394  -87.833 -41.833 1.00 65.23  ? 442 SER G O     1 
ATOM   9985  C CB    . SER D  2 442 ? 17.809  -88.597 -38.770 1.00 65.90  ? 442 SER G CB    1 
ATOM   9986  O OG    . SER D  2 442 ? 18.803  -88.667 -37.761 1.00 77.48  ? 442 SER G OG    1 
ATOM   9987  N N     . LEU D  2 443 ? 19.587  -87.585 -41.271 1.00 63.99  ? 443 LEU G N     1 
ATOM   9988  C CA    . LEU D  2 443 ? 20.094  -87.903 -42.610 1.00 64.76  ? 443 LEU G CA    1 
ATOM   9989  C C     . LEU D  2 443 ? 19.726  -89.344 -42.959 1.00 71.87  ? 443 LEU G C     1 
ATOM   9990  O O     . LEU D  2 443 ? 20.105  -90.264 -42.219 1.00 71.64  ? 443 LEU G O     1 
ATOM   9991  C CB    . LEU D  2 443 ? 21.620  -87.702 -42.684 1.00 66.56  ? 443 LEU G CB    1 
ATOM   9992  C CG    . LEU D  2 443 ? 22.300  -88.176 -43.993 1.00 72.57  ? 443 LEU G CG    1 
ATOM   9993  C CD1   . LEU D  2 443 ? 21.657  -87.548 -45.221 1.00 71.41  ? 443 LEU G CD1   1 
ATOM   9994  C CD2   . LEU D  2 443 ? 23.760  -87.862 -43.989 1.00 79.22  ? 443 LEU G CD2   1 
ATOM   9995  N N     . SER D  2 444 ? 18.952  -89.537 -44.064 1.00 69.88  ? 444 SER G N     1 
ATOM   9996  C CA    . SER D  2 444 ? 18.498  -90.874 -44.487 1.00 92.87  ? 444 SER G CA    1 
ATOM   9997  C C     . SER D  2 444 ? 19.537  -91.572 -45.361 1.00 121.92 ? 444 SER G C     1 
ATOM   9998  O O     . SER D  2 444 ? 20.000  -92.655 -45.009 1.00 88.70  ? 444 SER G O     1 
ATOM   9999  C CB    . SER D  2 444 ? 17.156  -90.790 -45.215 1.00 93.88  ? 444 SER G CB    1 
ATOM   10000 O OG    . SER D  2 444 ? 16.096  -90.529 -44.310 1.00 98.99  ? 444 SER G OG    1 
HETATM 10001 S S     . SO4 E  3 .   ? 27.429  -12.626 -68.337 1.00 70.06  ? 301 SO4 A S     1 
HETATM 10002 O O1    . SO4 E  3 .   ? 28.291  -11.399 -68.403 1.00 70.25  ? 301 SO4 A O1    1 
HETATM 10003 O O2    . SO4 E  3 .   ? 26.911  -13.058 -69.665 1.00 59.57  ? 301 SO4 A O2    1 
HETATM 10004 O O3    . SO4 E  3 .   ? 28.244  -13.727 -67.796 1.00 75.73  ? 301 SO4 A O3    1 
HETATM 10005 O O4    . SO4 E  3 .   ? 26.318  -12.332 -67.403 1.00 72.79  ? 301 SO4 A O4    1 
HETATM 10006 S S     . SO4 F  3 .   ? 30.628  10.196  -75.323 1.00 99.03  ? 501 SO4 B S     1 
HETATM 10007 O O1    . SO4 F  3 .   ? 30.886  11.126  -76.419 1.00 99.29  ? 501 SO4 B O1    1 
HETATM 10008 O O2    . SO4 F  3 .   ? 30.694  8.824   -75.857 1.00 100.82 ? 501 SO4 B O2    1 
HETATM 10009 O O3    . SO4 F  3 .   ? 29.319  10.462  -74.798 1.00 99.40  ? 501 SO4 B O3    1 
HETATM 10010 O O4    . SO4 F  3 .   ? 31.580  10.377  -74.221 1.00 99.21  ? 501 SO4 B O4    1 
HETATM 10011 S S     . SO4 G  3 .   ? -6.185  -84.536 -46.571 1.00 84.86  ? 502 SO4 B S     1 
HETATM 10012 O O1    . SO4 G  3 .   ? -4.995  -83.849 -47.050 1.00 84.13  ? 502 SO4 B O1    1 
HETATM 10013 O O2    . SO4 G  3 .   ? -7.343  -84.061 -47.328 1.00 89.55  ? 502 SO4 B O2    1 
HETATM 10014 O O3    . SO4 G  3 .   ? -6.036  -85.987 -46.761 1.00 82.51  ? 502 SO4 B O3    1 
HETATM 10015 O O4    . SO4 G  3 .   ? -6.406  -84.213 -45.143 1.00 84.13  ? 502 SO4 B O4    1 
HETATM 10016 S S     . SO4 H  3 .   ? 14.046  -17.414 -59.791 1.00 77.15  ? 503 SO4 B S     1 
HETATM 10017 O O1    . SO4 H  3 .   ? 14.903  -16.247 -60.072 1.00 77.32  ? 503 SO4 B O1    1 
HETATM 10018 O O2    . SO4 H  3 .   ? 13.730  -18.094 -61.062 1.00 79.93  ? 503 SO4 B O2    1 
HETATM 10019 O O3    . SO4 H  3 .   ? 14.794  -18.320 -58.913 1.00 78.36  ? 503 SO4 B O3    1 
HETATM 10020 O O4    . SO4 H  3 .   ? 12.779  -17.036 -59.109 1.00 69.42  ? 503 SO4 B O4    1 
HETATM 10021 S S     . SO4 I  3 .   ? 27.609  -42.950 -50.479 1.00 114.34 ? 504 SO4 B S     1 
HETATM 10022 O O1    . SO4 I  3 .   ? 28.441  -41.738 -50.546 1.00 115.16 ? 504 SO4 B O1    1 
HETATM 10023 O O2    . SO4 I  3 .   ? 27.654  -43.658 -51.769 1.00 113.61 ? 504 SO4 B O2    1 
HETATM 10024 O O3    . SO4 I  3 .   ? 28.131  -43.824 -49.410 1.00 113.06 ? 504 SO4 B O3    1 
HETATM 10025 O O4    . SO4 I  3 .   ? 26.215  -42.572 -50.202 1.00 113.48 ? 504 SO4 B O4    1 
HETATM 10026 C C1    . NAG J  4 .   ? 27.423  -24.844 -29.280 1.00 107.25 ? 505 NAG B C1    1 
HETATM 10027 C C2    . NAG J  4 .   ? 26.767  -24.374 -30.573 1.00 105.81 ? 505 NAG B C2    1 
HETATM 10028 C C3    . NAG J  4 .   ? 26.677  -25.596 -31.482 1.00 103.78 ? 505 NAG B C3    1 
HETATM 10029 C C4    . NAG J  4 .   ? 28.081  -26.121 -31.788 1.00 103.80 ? 505 NAG B C4    1 
HETATM 10030 C C5    . NAG J  4 .   ? 28.876  -26.328 -30.499 1.00 106.93 ? 505 NAG B C5    1 
HETATM 10031 C C6    . NAG J  4 .   ? 30.350  -26.552 -30.757 1.00 109.20 ? 505 NAG B C6    1 
HETATM 10032 C C7    . NAG J  4 .   ? 25.238  -22.467 -30.282 1.00 104.18 ? 505 NAG B C7    1 
HETATM 10033 C C8    . NAG J  4 .   ? 23.804  -22.038 -30.180 1.00 103.68 ? 505 NAG B C8    1 
HETATM 10034 N N2    . NAG J  4 .   ? 25.452  -23.791 -30.356 1.00 105.62 ? 505 NAG B N2    1 
HETATM 10035 O O3    . NAG J  4 .   ? 26.006  -25.201 -32.674 1.00 101.59 ? 505 NAG B O3    1 
HETATM 10036 O O4    . NAG J  4 .   ? 28.021  -27.372 -32.475 1.00 99.58  ? 505 NAG B O4    1 
HETATM 10037 O O5    . NAG J  4 .   ? 28.767  -25.174 -29.643 1.00 107.93 ? 505 NAG B O5    1 
HETATM 10038 O O6    . NAG J  4 .   ? 31.073  -26.806 -29.559 1.00 111.28 ? 505 NAG B O6    1 
HETATM 10039 O O7    . NAG J  4 .   ? 26.159  -21.655 -30.296 1.00 102.92 ? 505 NAG B O7    1 
HETATM 10040 C C1    . NAG K  4 .   ? 27.983  -27.379 -33.898 1.00 95.03  ? 506 NAG B C1    1 
HETATM 10041 C C2    . NAG K  4 .   ? 28.403  -28.755 -34.416 1.00 94.20  ? 506 NAG B C2    1 
HETATM 10042 C C3    . NAG K  4 .   ? 28.359  -28.749 -35.944 1.00 92.73  ? 506 NAG B C3    1 
HETATM 10043 C C4    . NAG K  4 .   ? 26.974  -28.331 -36.443 1.00 91.83  ? 506 NAG B C4    1 
HETATM 10044 C C5    . NAG K  4 .   ? 26.554  -27.019 -35.787 1.00 91.22  ? 506 NAG B C5    1 
HETATM 10045 C C6    . NAG K  4 .   ? 25.132  -26.607 -36.097 1.00 90.18  ? 506 NAG B C6    1 
HETATM 10046 C C7    . NAG K  4 .   ? 29.998  -30.197 -33.192 1.00 95.04  ? 506 NAG B C7    1 
HETATM 10047 C C8    . NAG K  4 .   ? 31.421  -30.353 -32.746 1.00 95.78  ? 506 NAG B C8    1 
HETATM 10048 N N2    . NAG K  4 .   ? 29.733  -29.111 -33.943 1.00 94.39  ? 506 NAG B N2    1 
HETATM 10049 O O3    . NAG K  4 .   ? 28.676  -30.057 -36.406 1.00 92.35  ? 506 NAG B O3    1 
HETATM 10050 O O4    . NAG K  4 .   ? 26.986  -28.103 -37.849 1.00 89.30  ? 506 NAG B O4    1 
HETATM 10051 O O5    . NAG K  4 .   ? 26.653  -27.143 -34.360 1.00 91.97  ? 506 NAG B O5    1 
HETATM 10052 O O6    . NAG K  4 .   ? 24.870  -25.284 -35.642 1.00 91.37  ? 506 NAG B O6    1 
HETATM 10053 O O7    . NAG K  4 .   ? 29.129  -31.010 -32.882 1.00 94.91  ? 506 NAG B O7    1 
HETATM 10054 C C1    . BMA L  5 .   ? 26.799  -29.178 -38.729 1.00 88.45  ? 507 BMA B C1    1 
HETATM 10055 C C2    . BMA L  5 .   ? 26.096  -28.636 -39.973 1.00 89.87  ? 507 BMA B C2    1 
HETATM 10056 C C3    . BMA L  5 .   ? 26.021  -29.724 -41.044 1.00 91.91  ? 507 BMA B C3    1 
HETATM 10057 C C4    . BMA L  5 .   ? 27.417  -30.253 -41.355 1.00 91.13  ? 507 BMA B C4    1 
HETATM 10058 C C5    . BMA L  5 .   ? 28.077  -30.757 -40.073 1.00 91.08  ? 507 BMA B C5    1 
HETATM 10059 C C6    . BMA L  5 .   ? 29.521  -31.166 -40.259 1.00 92.95  ? 507 BMA B C6    1 
HETATM 10060 O O2    . BMA L  5 .   ? 26.793  -27.490 -40.463 1.00 88.04  ? 507 BMA B O2    1 
HETATM 10061 O O3    . BMA L  5 .   ? 25.388  -29.251 -42.233 1.00 94.04  ? 507 BMA B O3    1 
HETATM 10062 O O4    . BMA L  5 .   ? 27.340  -31.304 -42.308 1.00 91.19  ? 507 BMA B O4    1 
HETATM 10063 O O5    . BMA L  5 .   ? 28.077  -29.719 -39.077 1.00 89.40  ? 507 BMA B O5    1 
HETATM 10064 O O6    . BMA L  5 .   ? 30.075  -31.660 -39.034 1.00 95.52  ? 507 BMA B O6    1 
HETATM 10065 C C1    . MAN M  6 .   ? 31.301  -32.344 -39.138 1.00 97.23  ? 508 MAN B C1    1 
HETATM 10066 C C2    . MAN M  6 .   ? 31.640  -32.940 -37.762 1.00 98.30  ? 508 MAN B C2    1 
HETATM 10067 C C3    . MAN M  6 .   ? 31.974  -31.843 -36.755 1.00 97.31  ? 508 MAN B C3    1 
HETATM 10068 C C4    . MAN M  6 .   ? 33.028  -30.886 -37.303 1.00 97.47  ? 508 MAN B C4    1 
HETATM 10069 C C5    . MAN M  6 .   ? 32.611  -30.369 -38.677 1.00 97.57  ? 508 MAN B C5    1 
HETATM 10070 C C6    . MAN M  6 .   ? 33.676  -29.528 -39.342 1.00 95.28  ? 508 MAN B C6    1 
HETATM 10071 O O2    . MAN M  6 .   ? 32.740  -33.841 -37.864 1.00 101.83 ? 508 MAN B O2    1 
HETATM 10072 O O3    . MAN M  6 .   ? 32.438  -32.419 -35.539 1.00 96.15  ? 508 MAN B O3    1 
HETATM 10073 O O4    . MAN M  6 .   ? 33.173  -29.783 -36.415 1.00 97.39  ? 508 MAN B O4    1 
HETATM 10074 O O5    . MAN M  6 .   ? 32.351  -31.474 -39.561 1.00 98.62  ? 508 MAN B O5    1 
HETATM 10075 O O6    . MAN M  6 .   ? 33.263  -29.115 -40.640 1.00 94.19  ? 508 MAN B O6    1 
HETATM 10076 C C1    . MAN N  6 .   ? 23.963  -29.298 -42.339 1.00 98.97  ? 509 MAN B C1    1 
HETATM 10077 C C2    . MAN N  6 .   ? 23.563  -29.240 -43.823 1.00 104.23 ? 509 MAN B C2    1 
HETATM 10078 C C3    . MAN N  6 .   ? 23.887  -27.872 -44.412 1.00 104.04 ? 509 MAN B C3    1 
HETATM 10079 C C4    . MAN N  6 .   ? 23.282  -26.757 -43.564 1.00 103.78 ? 509 MAN B C4    1 
HETATM 10080 C C5    . MAN N  6 .   ? 23.713  -26.911 -42.108 1.00 102.00 ? 509 MAN B C5    1 
HETATM 10081 C C6    . MAN N  6 .   ? 23.060  -25.914 -41.176 1.00 103.07 ? 509 MAN B C6    1 
HETATM 10082 O O2    . MAN N  6 .   ? 22.162  -29.474 -43.978 1.00 107.65 ? 509 MAN B O2    1 
HETATM 10083 O O3    . MAN N  6 .   ? 23.390  -27.801 -45.745 1.00 104.06 ? 509 MAN B O3    1 
HETATM 10084 O O4    . MAN N  6 .   ? 23.708  -25.490 -44.054 1.00 105.22 ? 509 MAN B O4    1 
HETATM 10085 O O5    . MAN N  6 .   ? 23.354  -28.219 -41.630 1.00 99.43  ? 509 MAN B O5    1 
HETATM 10086 O O6    . MAN N  6 .   ? 23.358  -26.186 -39.808 1.00 102.10 ? 509 MAN B O6    1 
HETATM 10087 C C1    . NAG O  4 .   ? 21.752  -30.828 -44.147 1.00 110.20 ? 510 NAG B C1    1 
HETATM 10088 C C2    . NAG O  4 .   ? 20.303  -30.959 -43.678 1.00 110.30 ? 510 NAG B C2    1 
HETATM 10089 C C3    . NAG O  4 .   ? 19.938  -32.441 -43.782 1.00 110.90 ? 510 NAG B C3    1 
HETATM 10090 C C4    . NAG O  4 .   ? 20.109  -32.937 -45.216 1.00 113.50 ? 510 NAG B C4    1 
HETATM 10091 C C5    . NAG O  4 .   ? 21.502  -32.609 -45.747 1.00 113.67 ? 510 NAG B C5    1 
HETATM 10092 C C6    . NAG O  4 .   ? 21.629  -32.849 -47.237 1.00 113.99 ? 510 NAG B C6    1 
HETATM 10093 C C7    . NAG O  4 .   ? 19.896  -29.191 -41.990 1.00 106.67 ? 510 NAG B C7    1 
HETATM 10094 C C8    . NAG O  4 .   ? 19.556  -28.928 -40.554 1.00 106.29 ? 510 NAG B C8    1 
HETATM 10095 N N2    . NAG O  4 .   ? 20.116  -30.479 -42.315 1.00 108.56 ? 510 NAG B N2    1 
HETATM 10096 O O3    . NAG O  4 .   ? 18.589  -32.635 -43.366 1.00 109.14 ? 510 NAG B O3    1 
HETATM 10097 O O4    . NAG O  4 .   ? 19.931  -34.348 -45.259 1.00 115.44 ? 510 NAG B O4    1 
HETATM 10098 O O5    . NAG O  4 .   ? 21.801  -31.221 -45.519 1.00 113.01 ? 510 NAG B O5    1 
HETATM 10099 O O6    . NAG O  4 .   ? 22.883  -32.410 -47.752 1.00 112.77 ? 510 NAG B O6    1 
HETATM 10100 O O7    . NAG O  4 .   ? 19.969  -28.283 -42.815 1.00 105.67 ? 510 NAG B O7    1 
HETATM 10101 C C1    . NAG P  4 .   ? 32.411  -35.209 -38.075 1.00 106.54 ? 511 NAG B C1    1 
HETATM 10102 C C2    . NAG P  4 .   ? 33.404  -35.809 -39.069 1.00 107.88 ? 511 NAG B C2    1 
HETATM 10103 C C3    . NAG P  4 .   ? 32.892  -37.220 -39.358 1.00 108.98 ? 511 NAG B C3    1 
HETATM 10104 C C4    . NAG P  4 .   ? 32.862  -38.043 -38.075 1.00 110.02 ? 511 NAG B C4    1 
HETATM 10105 C C5    . NAG P  4 .   ? 32.033  -37.333 -37.007 1.00 110.35 ? 511 NAG B C5    1 
HETATM 10106 C C6    . NAG P  4 .   ? 32.144  -37.971 -35.639 1.00 112.18 ? 511 NAG B C6    1 
HETATM 10107 C C7    . NAG P  4 .   ? 34.412  -34.054 -40.491 1.00 106.84 ? 511 NAG B C7    1 
HETATM 10108 C C8    . NAG P  4 .   ? 34.404  -33.417 -41.848 1.00 107.51 ? 511 NAG B C8    1 
HETATM 10109 N N2    . NAG P  4 .   ? 33.501  -35.030 -40.295 1.00 106.86 ? 511 NAG B N2    1 
HETATM 10110 O O3    . NAG P  4 .   ? 33.746  -37.854 -40.302 1.00 109.80 ? 511 NAG B O3    1 
HETATM 10111 O O4    . NAG P  4 .   ? 32.297  -39.322 -38.336 1.00 110.44 ? 511 NAG B O4    1 
HETATM 10112 O O5    . NAG P  4 .   ? 32.474  -35.971 -36.867 1.00 108.57 ? 511 NAG B O5    1 
HETATM 10113 O O6    . NAG P  4 .   ? 33.477  -37.948 -35.135 1.00 113.55 ? 511 NAG B O6    1 
HETATM 10114 O O7    . NAG P  4 .   ? 35.194  -33.699 -39.611 1.00 105.28 ? 511 NAG B O7    1 
HETATM 10115 C C1    . SUC Q  7 .   ? 2.469   -62.813 -49.636 1.00 56.67  ? 512 SUC B C1    1 
HETATM 10116 C C2    . SUC Q  7 .   ? 3.049   -62.282 -48.328 1.00 56.22  ? 512 SUC B C2    1 
HETATM 10117 C C3    . SUC Q  7 .   ? 4.058   -61.181 -48.621 1.00 57.42  ? 512 SUC B C3    1 
HETATM 10118 C C4    . SUC Q  7 .   ? 5.142   -61.710 -49.557 1.00 55.40  ? 512 SUC B C4    1 
HETATM 10119 C C5    . SUC Q  7 .   ? 4.494   -62.257 -50.830 1.00 54.20  ? 512 SUC B C5    1 
HETATM 10120 C C6    . SUC Q  7 .   ? 5.461   -62.912 -51.790 1.00 48.49  ? 512 SUC B C6    1 
HETATM 10121 O O1    . SUC Q  7 .   ? 1.708   -61.802 -50.263 1.00 60.94  ? 512 SUC B O1    1 
HETATM 10122 O O2    . SUC Q  7 .   ? 2.029   -61.818 -47.449 1.00 52.43  ? 512 SUC B O2    1 
HETATM 10123 O O3    . SUC Q  7 .   ? 4.614   -60.680 -47.408 1.00 58.96  ? 512 SUC B O3    1 
HETATM 10124 O O4    . SUC Q  7 .   ? 6.025   -60.652 -49.912 1.00 53.18  ? 512 SUC B O4    1 
HETATM 10125 O O5    . SUC Q  7 .   ? 3.510   -63.252 -50.498 1.00 55.14  ? 512 SUC B O5    1 
HETATM 10126 O O6    . SUC Q  7 .   ? 4.785   -63.463 -52.934 1.00 43.37  ? 512 SUC B O6    1 
HETATM 10127 C "C1'" . SUC Q  7 .   ? -0.248  -60.860 -51.279 1.00 64.55  ? 512 SUC B "C1'" 1 
HETATM 10128 C "C2'" . SUC Q  7 .   ? 0.588   -62.119 -51.102 1.00 63.70  ? 512 SUC B "C2'" 1 
HETATM 10129 C "C3'" . SUC Q  7 .   ? 1.017   -62.769 -52.439 1.00 64.44  ? 512 SUC B "C3'" 1 
HETATM 10130 C "C4'" . SUC Q  7 .   ? 0.864   -64.253 -52.160 1.00 66.45  ? 512 SUC B "C4'" 1 
HETATM 10131 C "C5'" . SUC Q  7 .   ? -0.387  -64.224 -51.298 1.00 64.73  ? 512 SUC B "C5'" 1 
HETATM 10132 C "C6'" . SUC Q  7 .   ? -0.627  -65.475 -50.483 1.00 55.73  ? 512 SUC B "C6'" 1 
HETATM 10133 O "O1'" . SUC Q  7 .   ? -0.073  -60.308 -52.576 1.00 62.30  ? 512 SUC B "O1'" 1 
HETATM 10134 O "O2'" . SUC Q  7 .   ? -0.224  -63.081 -50.450 1.00 61.05  ? 512 SUC B "O2'" 1 
HETATM 10135 O "O3'" . SUC Q  7 .   ? 2.289   -62.438 -52.967 1.00 67.60  ? 512 SUC B "O3'" 1 
HETATM 10136 O "O4'" . SUC Q  7 .   ? 0.642   -65.016 -53.342 1.00 69.87  ? 512 SUC B "O4'" 1 
HETATM 10137 O "O6'" . SUC Q  7 .   ? 0.451   -65.750 -49.635 1.00 45.94  ? 512 SUC B "O6'" 1 
HETATM 10138 C C1    . SUC R  7 .   ? -5.358  -79.303 -47.065 1.00 74.96  ? 513 SUC B C1    1 
HETATM 10139 C C2    . SUC R  7 .   ? -4.164  -78.364 -47.186 1.00 73.09  ? 513 SUC B C2    1 
HETATM 10140 C C3    . SUC R  7 .   ? -4.639  -76.921 -47.102 1.00 71.43  ? 513 SUC B C3    1 
HETATM 10141 C C4    . SUC R  7 .   ? -5.698  -76.644 -48.158 1.00 72.61  ? 513 SUC B C4    1 
HETATM 10142 C C5    . SUC R  7 .   ? -6.842  -77.647 -48.031 1.00 75.12  ? 513 SUC B C5    1 
HETATM 10143 C C6    . SUC R  7 .   ? -7.839  -77.550 -49.163 1.00 76.38  ? 513 SUC B C6    1 
HETATM 10144 O O1    . SUC R  7 .   ? -5.878  -79.157 -45.757 1.00 74.54  ? 513 SUC B O1    1 
HETATM 10145 O O2    . SUC R  7 .   ? -3.216  -78.640 -46.161 1.00 74.08  ? 513 SUC B O2    1 
HETATM 10146 O O3    . SUC R  7 .   ? -3.539  -76.052 -47.307 1.00 69.96  ? 513 SUC B O3    1 
HETATM 10147 O O4    . SUC R  7 .   ? -6.207  -75.323 -48.009 1.00 68.56  ? 513 SUC B O4    1 
HETATM 10148 O O5    . SUC R  7 .   ? -6.334  -78.992 -48.053 1.00 76.13  ? 513 SUC B O5    1 
HETATM 10149 O O6    . SUC R  7 .   ? -7.198  -77.565 -50.435 1.00 77.76  ? 513 SUC B O6    1 
HETATM 10150 C "C1'" . SUC R  7 .   ? -4.858  -81.069 -44.674 1.00 70.90  ? 513 SUC B "C1'" 1 
HETATM 10151 C "C2'" . SUC R  7 .   ? -6.142  -80.296 -44.939 1.00 71.96  ? 513 SUC B "C2'" 1 
HETATM 10152 C "C3'" . SUC R  7 .   ? -6.870  -79.758 -43.693 1.00 70.04  ? 513 SUC B "C3'" 1 
HETATM 10153 C "C4'" . SUC R  7 .   ? -8.291  -79.647 -44.234 1.00 69.95  ? 513 SUC B "C4'" 1 
HETATM 10154 C "C5'" . SUC R  7 .   ? -8.388  -80.971 -44.990 1.00 70.18  ? 513 SUC B "C5'" 1 
HETATM 10155 C "C6'" . SUC R  7 .   ? -9.439  -81.050 -46.076 1.00 68.31  ? 513 SUC B "C6'" 1 
HETATM 10156 O "O1'" . SUC R  7 .   ? -5.065  -82.118 -43.742 1.00 71.22  ? 513 SUC B "O1'" 1 
HETATM 10157 O "O2'" . SUC R  7 .   ? -7.083  -81.159 -45.567 1.00 71.29  ? 513 SUC B "O2'" 1 
HETATM 10158 O "O3'" . SUC R  7 .   ? -6.363  -78.581 -43.064 1.00 63.41  ? 513 SUC B "O3'" 1 
HETATM 10159 O "O4'" . SUC R  7 .   ? -9.246  -79.545 -43.186 1.00 69.91  ? 513 SUC B "O4'" 1 
HETATM 10160 O "O6'" . SUC R  7 .   ? -9.334  -79.966 -46.996 1.00 70.41  ? 513 SUC B "O6'" 1 
HETATM 10161 C C1    . NAG S  4 .   ? 6.455   -40.329 -25.761 1.00 94.49  ? 501 NAG G C1    1 
HETATM 10162 C C2    . NAG S  4 .   ? 5.423   -40.635 -26.852 1.00 93.42  ? 501 NAG G C2    1 
HETATM 10163 C C3    . NAG S  4 .   ? 4.628   -41.923 -26.654 1.00 90.12  ? 501 NAG G C3    1 
HETATM 10164 C C4    . NAG S  4 .   ? 5.583   -43.074 -26.361 1.00 85.78  ? 501 NAG G C4    1 
HETATM 10165 C C5    . NAG S  4 .   ? 6.357   -42.713 -25.098 1.00 85.25  ? 501 NAG G C5    1 
HETATM 10166 C C6    . NAG S  4 .   ? 7.282   -43.816 -24.626 1.00 82.09  ? 501 NAG G C6    1 
HETATM 10167 C C7    . NAG S  4 .   ? 4.565   -38.712 -28.152 1.00 95.53  ? 501 NAG G C7    1 
HETATM 10168 C C8    . NAG S  4 .   ? 3.475   -37.688 -28.250 1.00 95.73  ? 501 NAG G C8    1 
HETATM 10169 N N2    . NAG S  4 .   ? 4.525   -39.511 -27.068 1.00 94.79  ? 501 NAG G N2    1 
HETATM 10170 O O3    . NAG S  4 .   ? 3.879   -42.146 -27.844 1.00 91.34  ? 501 NAG G O3    1 
HETATM 10171 O O4    . NAG S  4 .   ? 4.912   -44.324 -26.180 1.00 82.41  ? 501 NAG G O4    1 
HETATM 10172 O O5    . NAG S  4 .   ? 7.148   -41.530 -25.332 1.00 90.55  ? 501 NAG G O5    1 
HETATM 10173 O O6    . NAG S  4 .   ? 8.111   -44.343 -25.674 1.00 82.49  ? 501 NAG G O6    1 
HETATM 10174 O O7    . NAG S  4 .   ? 5.441   -38.807 -29.006 1.00 96.17  ? 501 NAG G O7    1 
HETATM 10175 C C1    . NAG T  4 .   ? 4.578   -45.122 -27.321 1.00 80.61  ? 502 NAG G C1    1 
HETATM 10176 C C2    . NAG T  4 .   ? 4.452   -46.586 -26.900 1.00 79.94  ? 502 NAG G C2    1 
HETATM 10177 C C3    . NAG T  4 .   ? 4.048   -47.442 -28.099 1.00 81.14  ? 502 NAG G C3    1 
HETATM 10178 C C4    . NAG T  4 .   ? 2.748   -46.923 -28.708 1.00 84.44  ? 502 NAG G C4    1 
HETATM 10179 C C5    . NAG T  4 .   ? 2.873   -45.429 -28.996 1.00 84.88  ? 502 NAG G C5    1 
HETATM 10180 C C6    . NAG T  4 .   ? 1.570   -44.795 -29.430 1.00 86.57  ? 502 NAG G C6    1 
HETATM 10181 C C7    . NAG T  4 .   ? 5.758   -47.637 -25.108 1.00 74.48  ? 502 NAG G C7    1 
HETATM 10182 C C8    . NAG T  4 .   ? 7.138   -47.859 -24.570 1.00 73.25  ? 502 NAG G C8    1 
HETATM 10183 N N2    . NAG T  4 .   ? 5.688   -47.082 -26.318 1.00 75.62  ? 502 NAG G N2    1 
HETATM 10184 O O3    . NAG T  4 .   ? 3.885   -48.790 -27.668 1.00 79.11  ? 502 NAG G O3    1 
HETATM 10185 O O4    . NAG T  4 .   ? 2.492   -47.568 -29.954 1.00 87.46  ? 502 NAG G O4    1 
HETATM 10186 O O5    . NAG T  4 .   ? 3.299   -44.733 -27.814 1.00 81.79  ? 502 NAG G O5    1 
HETATM 10187 O O6    . NAG T  4 .   ? 1.782   -43.818 -30.436 1.00 87.05  ? 502 NAG G O6    1 
HETATM 10188 O O7    . NAG T  4 .   ? 4.754   -47.935 -24.464 1.00 77.64  ? 502 NAG G O7    1 
HETATM 10189 C C1    . BMA U  5 .   ? 1.747   -48.775 -29.985 1.00 89.31  ? 503 BMA G C1    1 
HETATM 10190 C C2    . BMA U  5 .   ? 0.996   -48.836 -31.314 1.00 92.03  ? 503 BMA G C2    1 
HETATM 10191 C C3    . BMA U  5 .   ? 0.279   -50.174 -31.440 1.00 92.69  ? 503 BMA G C3    1 
HETATM 10192 C C4    . BMA U  5 .   ? 1.263   -51.324 -31.274 1.00 89.36  ? 503 BMA G C4    1 
HETATM 10193 C C5    . BMA U  5 .   ? 2.026   -51.185 -29.960 1.00 85.48  ? 503 BMA G C5    1 
HETATM 10194 C C6    . BMA U  5 .   ? 3.143   -52.194 -29.823 1.00 81.53  ? 503 BMA G C6    1 
HETATM 10195 O O2    . BMA U  5 .   ? 1.908   -48.658 -32.396 1.00 94.17  ? 503 BMA G O2    1 
HETATM 10196 O O3    . BMA U  5 .   ? -0.345  -50.276 -32.717 1.00 98.84  ? 503 BMA G O3    1 
HETATM 10197 O O4    . BMA U  5 .   ? 0.561   -52.563 -31.292 1.00 91.13  ? 503 BMA G O4    1 
HETATM 10198 O O5    . BMA U  5 .   ? 2.638   -49.889 -29.881 1.00 86.87  ? 503 BMA G O5    1 
HETATM 10199 O O6    . BMA U  5 .   ? 3.934   -51.932 -28.667 1.00 80.85  ? 503 BMA G O6    1 
HETATM 10200 C C1    . MAN V  6 .   ? -1.747  -50.509 -32.806 1.00 104.70 ? 504 MAN G C1    1 
HETATM 10201 C C2    . MAN V  6 .   ? -2.038  -51.054 -34.207 1.00 106.32 ? 504 MAN G C2    1 
HETATM 10202 C C3    . MAN V  6 .   ? -1.744  -49.986 -35.255 1.00 109.72 ? 504 MAN G C3    1 
HETATM 10203 C C4    . MAN V  6 .   ? -2.518  -48.709 -34.947 1.00 110.42 ? 504 MAN G C4    1 
HETATM 10204 C C5    . MAN V  6 .   ? -2.200  -48.243 -33.529 1.00 109.07 ? 504 MAN G C5    1 
HETATM 10205 C C6    . MAN V  6 .   ? -3.018  -47.046 -33.102 1.00 108.69 ? 504 MAN G C6    1 
HETATM 10206 O O2    . MAN V  6 .   ? -3.399  -51.469 -34.289 1.00 105.96 ? 504 MAN G O2    1 
HETATM 10207 O O3    . MAN V  6 .   ? -2.048  -50.464 -36.563 1.00 111.67 ? 504 MAN G O3    1 
HETATM 10208 O O4    . MAN V  6 .   ? -2.164  -47.684 -35.869 1.00 112.10 ? 504 MAN G O4    1 
HETATM 10209 O O5    . MAN V  6 .   ? -2.485  -49.298 -32.592 1.00 108.03 ? 504 MAN G O5    1 
HETATM 10210 O O6    . MAN V  6 .   ? -2.738  -46.650 -31.763 1.00 107.92 ? 504 MAN G O6    1 
HETATM 10211 C C1    . MAN W  6 .   ? 4.816   -52.959 -28.308 1.00 82.60  ? 505 MAN G C1    1 
HETATM 10212 C C2    . MAN W  6 .   ? 5.275   -52.724 -26.868 1.00 81.50  ? 505 MAN G C2    1 
HETATM 10213 C C3    . MAN W  6 .   ? 6.186   -51.504 -26.793 1.00 81.56  ? 505 MAN G C3    1 
HETATM 10214 C C4    . MAN W  6 .   ? 7.349   -51.633 -27.767 1.00 86.08  ? 505 MAN G C4    1 
HETATM 10215 C C5    . MAN W  6 .   ? 6.836   -51.913 -29.178 1.00 87.41  ? 505 MAN G C5    1 
HETATM 10216 C C6    . MAN W  6 .   ? 7.952   -52.238 -30.142 1.00 87.22  ? 505 MAN G C6    1 
HETATM 10217 O O2    . MAN W  6 .   ? 5.991   -53.871 -26.422 1.00 81.86  ? 505 MAN G O2    1 
HETATM 10218 O O3    . MAN W  6 .   ? 6.691   -51.348 -25.473 1.00 79.62  ? 505 MAN G O3    1 
HETATM 10219 O O4    . MAN W  6 .   ? 8.105   -50.428 -27.770 1.00 87.86  ? 505 MAN G O4    1 
HETATM 10220 O O5    . MAN W  6 .   ? 5.955   -53.052 -29.172 1.00 86.66  ? 505 MAN G O5    1 
HETATM 10221 O O6    . MAN W  6 .   ? 7.448   -52.650 -31.403 1.00 88.53  ? 505 MAN G O6    1 
HETATM 10222 C C1    . NAG X  4 .   ? 5.230   -54.893 -25.814 1.00 83.13  ? 506 NAG G C1    1 
HETATM 10223 C C2    . NAG X  4 .   ? 6.017   -56.195 -25.954 1.00 82.78  ? 506 NAG G C2    1 
HETATM 10224 C C3    . NAG X  4 .   ? 5.309   -57.319 -25.198 1.00 82.09  ? 506 NAG G C3    1 
HETATM 10225 C C4    . NAG X  4 .   ? 5.023   -56.908 -23.757 1.00 83.73  ? 506 NAG G C4    1 
HETATM 10226 C C5    . NAG X  4 .   ? 4.268   -55.584 -23.725 1.00 86.74  ? 506 NAG G C5    1 
HETATM 10227 C C6    . NAG X  4 .   ? 4.034   -55.045 -22.330 1.00 90.25  ? 506 NAG G C6    1 
HETATM 10228 C C7    . NAG X  4 .   ? 7.197   -56.198 -28.136 1.00 80.57  ? 506 NAG G C7    1 
HETATM 10229 C C8    . NAG X  4 .   ? 7.101   -56.583 -29.581 1.00 79.47  ? 506 NAG G C8    1 
HETATM 10230 N N2    . NAG X  4 .   ? 6.135   -56.523 -27.368 1.00 80.95  ? 506 NAG G N2    1 
HETATM 10231 O O3    . NAG X  4 .   ? 6.151   -58.464 -25.200 1.00 80.73  ? 506 NAG G O3    1 
HETATM 10232 O O4    . NAG X  4 .   ? 4.214   -57.900 -23.134 1.00 82.97  ? 506 NAG G O4    1 
HETATM 10233 O O5    . NAG X  4 .   ? 5.005   -54.582 -24.442 1.00 84.93  ? 506 NAG G O5    1 
HETATM 10234 O O6    . NAG X  4 .   ? 5.245   -54.694 -21.667 1.00 92.03  ? 506 NAG G O6    1 
HETATM 10235 O O7    . NAG X  4 .   ? 8.174   -55.604 -27.690 1.00 81.14  ? 506 NAG G O7    1 
HETATM 10236 C C1    . FUC Y  8 .   ? 9.470   -44.492 -25.350 1.00 80.94  ? 507 FUC G C1    1 
HETATM 10237 C C2    . FUC Y  8 .   ? 10.187  -45.258 -26.489 1.00 81.29  ? 507 FUC G C2    1 
HETATM 10238 C C3    . FUC Y  8 .   ? 10.408  -44.386 -27.725 1.00 81.49  ? 507 FUC G C3    1 
HETATM 10239 C C4    . FUC Y  8 .   ? 11.024  -43.038 -27.359 1.00 81.73  ? 507 FUC G C4    1 
HETATM 10240 C C5    . FUC Y  8 .   ? 10.128  -42.369 -26.328 1.00 80.96  ? 507 FUC G C5    1 
HETATM 10241 C C6    . FUC Y  8 .   ? 10.615  -41.004 -25.905 1.00 79.32  ? 507 FUC G C6    1 
HETATM 10242 O O2    . FUC Y  8 .   ? 9.491   -46.451 -26.847 1.00 79.49  ? 507 FUC G O2    1